data_4TR8
# 
_entry.id   4TR8 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4TR8         
WWPDB D_1000202137 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4TR8 
_pdbx_database_status.recvd_initial_deposition_date   2014-06-15 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Olieric, V.' 1 
'Burnouf, D.' 2 
'Ennifar, E.' 3 
'Wolff, P.'   4 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            J.Med.Chem. 
_citation.journal_id_ASTM           JMCMAR 
_citation.journal_id_CSD            0151 
_citation.journal_id_ISSN           0022-2623 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            57 
_citation.language                  ? 
_citation.page_first                7565 
_citation.page_last                 7576 
_citation.title                     
'Differential Modes of Peptide Binding onto Replicative Sliding Clamps from Various Bacterial Origins.' 
_citation.year                      2014 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1021/jm500467a 
_citation.pdbx_database_id_PubMed   25170813 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Wolff, P.'     1  
primary 'Amal, I.'      2  
primary 'Olieric, V.'   3  
primary 'Chaloin, O.'   4  
primary 'Gygli, G.'     5  
primary 'Ennifar, E.'   6  
primary 'Lorber, B.'    7  
primary 'Guichard, G.'  8  
primary 'Wagner, J.'    9  
primary 'Dejaegere, A.' 10 
primary 'Burnouf, D.Y.' 11 
# 
_cell.entry_id           4TR8 
_cell.length_a           80.530 
_cell.length_b           92.410 
_cell.length_c           127.400 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4TR8 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA polymerase III subunit beta' 42548.312 2   2.7.7.7 ? ? ? 
2 non-polymer syn 'SODIUM ION'                      22.990    1   ?       ? ? ? 
3 water       nat water                             18.015    432 ?       ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;HHHHHHSSGLVPRGSHMHFTIQREALLKPLQLVAGVVERRQTLPVLSNVLLVVEGQQLSLTGTDLEVELVGRVVLEDAAE
PGEITVPARKLMDICKSLPNDVLIDIRVEEQKLLVKAGRSRFTLSTLPANDFPTVEEGPGSLNFSIAQSKLRRLIDRTSF
AMAQQDVRYYLNGMLLEVNGGTLRSVATDGHRLAMCSLDAQIPSQDRHQVIVPRKGILELARLLTEQDGEVGIVLGQHHI
RATTGEFTFTSKLVDGKFPDYERVLPRGGDKLVVGDRQQLREAFSRTAILSNEKYRGIRLQLSNGLLKIQANNPEQEEAE
EEVQVEYNGGNLEIGFNVSYLLDVLGVIGTEQVRFILSDSNSSALVHEADNDDSAYVVMPMRL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;HHHHHHSSGLVPRGSHMHFTIQREALLKPLQLVAGVVERRQTLPVLSNVLLVVEGQQLSLTGTDLEVELVGRVVLEDAAE
PGEITVPARKLMDICKSLPNDVLIDIRVEEQKLLVKAGRSRFTLSTLPANDFPTVEEGPGSLNFSIAQSKLRRLIDRTSF
AMAQQDVRYYLNGMLLEVNGGTLRSVATDGHRLAMCSLDAQIPSQDRHQVIVPRKGILELARLLTEQDGEVGIVLGQHHI
RATTGEFTFTSKLVDGKFPDYERVLPRGGDKLVVGDRQQLREAFSRTAILSNEKYRGIRLQLSNGLLKIQANNPEQEEAE
EEVQVEYNGGNLEIGFNVSYLLDVLGVIGTEQVRFILSDSNSSALVHEADNDDSAYVVMPMRL
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   HIS n 
1 2   HIS n 
1 3   HIS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   SER n 
1 8   SER n 
1 9   GLY n 
1 10  LEU n 
1 11  VAL n 
1 12  PRO n 
1 13  ARG n 
1 14  GLY n 
1 15  SER n 
1 16  HIS n 
1 17  MET n 
1 18  HIS n 
1 19  PHE n 
1 20  THR n 
1 21  ILE n 
1 22  GLN n 
1 23  ARG n 
1 24  GLU n 
1 25  ALA n 
1 26  LEU n 
1 27  LEU n 
1 28  LYS n 
1 29  PRO n 
1 30  LEU n 
1 31  GLN n 
1 32  LEU n 
1 33  VAL n 
1 34  ALA n 
1 35  GLY n 
1 36  VAL n 
1 37  VAL n 
1 38  GLU n 
1 39  ARG n 
1 40  ARG n 
1 41  GLN n 
1 42  THR n 
1 43  LEU n 
1 44  PRO n 
1 45  VAL n 
1 46  LEU n 
1 47  SER n 
1 48  ASN n 
1 49  VAL n 
1 50  LEU n 
1 51  LEU n 
1 52  VAL n 
1 53  VAL n 
1 54  GLU n 
1 55  GLY n 
1 56  GLN n 
1 57  GLN n 
1 58  LEU n 
1 59  SER n 
1 60  LEU n 
1 61  THR n 
1 62  GLY n 
1 63  THR n 
1 64  ASP n 
1 65  LEU n 
1 66  GLU n 
1 67  VAL n 
1 68  GLU n 
1 69  LEU n 
1 70  VAL n 
1 71  GLY n 
1 72  ARG n 
1 73  VAL n 
1 74  VAL n 
1 75  LEU n 
1 76  GLU n 
1 77  ASP n 
1 78  ALA n 
1 79  ALA n 
1 80  GLU n 
1 81  PRO n 
1 82  GLY n 
1 83  GLU n 
1 84  ILE n 
1 85  THR n 
1 86  VAL n 
1 87  PRO n 
1 88  ALA n 
1 89  ARG n 
1 90  LYS n 
1 91  LEU n 
1 92  MET n 
1 93  ASP n 
1 94  ILE n 
1 95  CYS n 
1 96  LYS n 
1 97  SER n 
1 98  LEU n 
1 99  PRO n 
1 100 ASN n 
1 101 ASP n 
1 102 VAL n 
1 103 LEU n 
1 104 ILE n 
1 105 ASP n 
1 106 ILE n 
1 107 ARG n 
1 108 VAL n 
1 109 GLU n 
1 110 GLU n 
1 111 GLN n 
1 112 LYS n 
1 113 LEU n 
1 114 LEU n 
1 115 VAL n 
1 116 LYS n 
1 117 ALA n 
1 118 GLY n 
1 119 ARG n 
1 120 SER n 
1 121 ARG n 
1 122 PHE n 
1 123 THR n 
1 124 LEU n 
1 125 SER n 
1 126 THR n 
1 127 LEU n 
1 128 PRO n 
1 129 ALA n 
1 130 ASN n 
1 131 ASP n 
1 132 PHE n 
1 133 PRO n 
1 134 THR n 
1 135 VAL n 
1 136 GLU n 
1 137 GLU n 
1 138 GLY n 
1 139 PRO n 
1 140 GLY n 
1 141 SER n 
1 142 LEU n 
1 143 ASN n 
1 144 PHE n 
1 145 SER n 
1 146 ILE n 
1 147 ALA n 
1 148 GLN n 
1 149 SER n 
1 150 LYS n 
1 151 LEU n 
1 152 ARG n 
1 153 ARG n 
1 154 LEU n 
1 155 ILE n 
1 156 ASP n 
1 157 ARG n 
1 158 THR n 
1 159 SER n 
1 160 PHE n 
1 161 ALA n 
1 162 MET n 
1 163 ALA n 
1 164 GLN n 
1 165 GLN n 
1 166 ASP n 
1 167 VAL n 
1 168 ARG n 
1 169 TYR n 
1 170 TYR n 
1 171 LEU n 
1 172 ASN n 
1 173 GLY n 
1 174 MET n 
1 175 LEU n 
1 176 LEU n 
1 177 GLU n 
1 178 VAL n 
1 179 ASN n 
1 180 GLY n 
1 181 GLY n 
1 182 THR n 
1 183 LEU n 
1 184 ARG n 
1 185 SER n 
1 186 VAL n 
1 187 ALA n 
1 188 THR n 
1 189 ASP n 
1 190 GLY n 
1 191 HIS n 
1 192 ARG n 
1 193 LEU n 
1 194 ALA n 
1 195 MET n 
1 196 CYS n 
1 197 SER n 
1 198 LEU n 
1 199 ASP n 
1 200 ALA n 
1 201 GLN n 
1 202 ILE n 
1 203 PRO n 
1 204 SER n 
1 205 GLN n 
1 206 ASP n 
1 207 ARG n 
1 208 HIS n 
1 209 GLN n 
1 210 VAL n 
1 211 ILE n 
1 212 VAL n 
1 213 PRO n 
1 214 ARG n 
1 215 LYS n 
1 216 GLY n 
1 217 ILE n 
1 218 LEU n 
1 219 GLU n 
1 220 LEU n 
1 221 ALA n 
1 222 ARG n 
1 223 LEU n 
1 224 LEU n 
1 225 THR n 
1 226 GLU n 
1 227 GLN n 
1 228 ASP n 
1 229 GLY n 
1 230 GLU n 
1 231 VAL n 
1 232 GLY n 
1 233 ILE n 
1 234 VAL n 
1 235 LEU n 
1 236 GLY n 
1 237 GLN n 
1 238 HIS n 
1 239 HIS n 
1 240 ILE n 
1 241 ARG n 
1 242 ALA n 
1 243 THR n 
1 244 THR n 
1 245 GLY n 
1 246 GLU n 
1 247 PHE n 
1 248 THR n 
1 249 PHE n 
1 250 THR n 
1 251 SER n 
1 252 LYS n 
1 253 LEU n 
1 254 VAL n 
1 255 ASP n 
1 256 GLY n 
1 257 LYS n 
1 258 PHE n 
1 259 PRO n 
1 260 ASP n 
1 261 TYR n 
1 262 GLU n 
1 263 ARG n 
1 264 VAL n 
1 265 LEU n 
1 266 PRO n 
1 267 ARG n 
1 268 GLY n 
1 269 GLY n 
1 270 ASP n 
1 271 LYS n 
1 272 LEU n 
1 273 VAL n 
1 274 VAL n 
1 275 GLY n 
1 276 ASP n 
1 277 ARG n 
1 278 GLN n 
1 279 GLN n 
1 280 LEU n 
1 281 ARG n 
1 282 GLU n 
1 283 ALA n 
1 284 PHE n 
1 285 SER n 
1 286 ARG n 
1 287 THR n 
1 288 ALA n 
1 289 ILE n 
1 290 LEU n 
1 291 SER n 
1 292 ASN n 
1 293 GLU n 
1 294 LYS n 
1 295 TYR n 
1 296 ARG n 
1 297 GLY n 
1 298 ILE n 
1 299 ARG n 
1 300 LEU n 
1 301 GLN n 
1 302 LEU n 
1 303 SER n 
1 304 ASN n 
1 305 GLY n 
1 306 LEU n 
1 307 LEU n 
1 308 LYS n 
1 309 ILE n 
1 310 GLN n 
1 311 ALA n 
1 312 ASN n 
1 313 ASN n 
1 314 PRO n 
1 315 GLU n 
1 316 GLN n 
1 317 GLU n 
1 318 GLU n 
1 319 ALA n 
1 320 GLU n 
1 321 GLU n 
1 322 GLU n 
1 323 VAL n 
1 324 GLN n 
1 325 VAL n 
1 326 GLU n 
1 327 TYR n 
1 328 ASN n 
1 329 GLY n 
1 330 GLY n 
1 331 ASN n 
1 332 LEU n 
1 333 GLU n 
1 334 ILE n 
1 335 GLY n 
1 336 PHE n 
1 337 ASN n 
1 338 VAL n 
1 339 SER n 
1 340 TYR n 
1 341 LEU n 
1 342 LEU n 
1 343 ASP n 
1 344 VAL n 
1 345 LEU n 
1 346 GLY n 
1 347 VAL n 
1 348 ILE n 
1 349 GLY n 
1 350 THR n 
1 351 GLU n 
1 352 GLN n 
1 353 VAL n 
1 354 ARG n 
1 355 PHE n 
1 356 ILE n 
1 357 LEU n 
1 358 SER n 
1 359 ASP n 
1 360 SER n 
1 361 ASN n 
1 362 SER n 
1 363 SER n 
1 364 ALA n 
1 365 LEU n 
1 366 VAL n 
1 367 HIS n 
1 368 GLU n 
1 369 ALA n 
1 370 ASP n 
1 371 ASN n 
1 372 ASP n 
1 373 ASP n 
1 374 SER n 
1 375 ALA n 
1 376 TYR n 
1 377 VAL n 
1 378 VAL n 
1 379 MET n 
1 380 PRO n 
1 381 MET n 
1 382 ARG n 
1 383 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   383 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 PA15_0320650 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Pseudomonas aeruginosa HB15' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     983919 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    V4MZL6_PSEAI 
_struct_ref.pdbx_db_accession          V4MZL6 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MHFTIQREALLKPLQLVAGVVERRQTLPVLSNVLLVVEGQQLSLTGTDLEVELVGRVVLEDAAEPGEITVPARKLMDICK
SLPNDVLIDIRVEEQKLLVKAGRSRFTLSTLPANDFPTVEEGPGSLNFSIAQSKLRRLIDRTSFAMAQQDVRYYLNGMLL
EVNGGTLRSVATDGHRLAMCSLDAQIPSQDRHQVIVPRKGILELARLLTEQDGEVGIVLGQHHIRATTGEFTFTSKLVDG
KFPDYERVLPRGGDKLVVGDRQQLREAFSRTAILSNEKYRGIRLQLSNGLLKIQANNPEQEEAEEEVQVEYNGGNLEIGF
NVSYLLDVLGVIGTEQVRFILSDSNSSALVHEADNDDSAYVVMPMRL
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4TR8 A 17 ? 383 ? V4MZL6 1 ? 367 ? 1 367 
2 1 4TR8 B 17 ? 383 ? V4MZL6 1 ? 367 ? 1 367 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4TR8 HIS A 1  ? UNP V4MZL6 ? ? 'expression tag' 9985 1  
1 4TR8 HIS A 2  ? UNP V4MZL6 ? ? 'expression tag' 9986 2  
1 4TR8 HIS A 3  ? UNP V4MZL6 ? ? 'expression tag' 9987 3  
1 4TR8 HIS A 4  ? UNP V4MZL6 ? ? 'expression tag' 9988 4  
1 4TR8 HIS A 5  ? UNP V4MZL6 ? ? 'expression tag' 9989 5  
1 4TR8 HIS A 6  ? UNP V4MZL6 ? ? 'expression tag' 9990 6  
1 4TR8 SER A 7  ? UNP V4MZL6 ? ? 'expression tag' 9991 7  
1 4TR8 SER A 8  ? UNP V4MZL6 ? ? 'expression tag' 9992 8  
1 4TR8 GLY A 9  ? UNP V4MZL6 ? ? 'expression tag' 9993 9  
1 4TR8 LEU A 10 ? UNP V4MZL6 ? ? 'expression tag' 9994 10 
1 4TR8 VAL A 11 ? UNP V4MZL6 ? ? 'expression tag' 9995 11 
1 4TR8 PRO A 12 ? UNP V4MZL6 ? ? 'expression tag' 9996 12 
1 4TR8 ARG A 13 ? UNP V4MZL6 ? ? 'expression tag' 9997 13 
1 4TR8 GLY A 14 ? UNP V4MZL6 ? ? 'expression tag' 9998 14 
1 4TR8 SER A 15 ? UNP V4MZL6 ? ? 'expression tag' 9999 15 
1 4TR8 HIS A 16 ? UNP V4MZL6 ? ? 'expression tag' 0    16 
2 4TR8 HIS B 1  ? UNP V4MZL6 ? ? 'expression tag' -15  17 
2 4TR8 HIS B 2  ? UNP V4MZL6 ? ? 'expression tag' -14  18 
2 4TR8 HIS B 3  ? UNP V4MZL6 ? ? 'expression tag' -13  19 
2 4TR8 HIS B 4  ? UNP V4MZL6 ? ? 'expression tag' -12  20 
2 4TR8 HIS B 5  ? UNP V4MZL6 ? ? 'expression tag' -11  21 
2 4TR8 HIS B 6  ? UNP V4MZL6 ? ? 'expression tag' -10  22 
2 4TR8 SER B 7  ? UNP V4MZL6 ? ? 'expression tag' -9   23 
2 4TR8 SER B 8  ? UNP V4MZL6 ? ? 'expression tag' -8   24 
2 4TR8 GLY B 9  ? UNP V4MZL6 ? ? 'expression tag' -7   25 
2 4TR8 LEU B 10 ? UNP V4MZL6 ? ? 'expression tag' -6   26 
2 4TR8 VAL B 11 ? UNP V4MZL6 ? ? 'expression tag' -5   27 
2 4TR8 PRO B 12 ? UNP V4MZL6 ? ? 'expression tag' -4   28 
2 4TR8 ARG B 13 ? UNP V4MZL6 ? ? 'expression tag' -3   29 
2 4TR8 GLY B 14 ? UNP V4MZL6 ? ? 'expression tag' -2   30 
2 4TR8 SER B 15 ? UNP V4MZL6 ? ? 'expression tag' -1   31 
2 4TR8 HIS B 16 ? UNP V4MZL6 ? ? 'expression tag' 0    32 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
NA  non-polymer         . 'SODIUM ION'    ? 'Na 1'           22.990  
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4TR8 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.79 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         50.2 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.1M sodium acetate pH 4.5 and PEG 3350' 
_exptl_crystal_grow.pdbx_pH_range   4.5 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'MARMOSAIC 225 mm CCD' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2007-11-16 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SLS BEAMLINE X10SA' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   X10SA 
_diffrn_source.pdbx_synchrotron_site       SLS 
# 
_reflns.B_iso_Wilson_estimate            27.18 
_reflns.entry_id                         4TR8 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.8 
_reflns.d_resolution_low                 43.9 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       88854 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.6 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  14.7 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            17.69 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_refine.aniso_B[1][1]                            -3.2454 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][2]                            5.5899 
_refine.aniso_B[2][3]                            0.0000 
_refine.aniso_B[3][3]                            -2.3444 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               34.57 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               0.9389 
_refine.correlation_coeff_Fo_to_Fc_free          0.9296 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 4TR8 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.80 
_refine.ls_d_res_low                             43.9 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     88625 
_refine.ls_number_reflns_R_free                  4437 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.98 
_refine.ls_percent_reflns_R_free                 5.01 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2086 
_refine.ls_R_factor_R_free                       0.2322 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2074 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   0.108 
_refine.pdbx_overall_SU_R_free_Blow_DPI          0.109 
_refine.pdbx_overall_SU_R_Blow_DPI               0.116 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_R_Cruickshank_DPI             0.113 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
# 
_refine_analyze.entry_id                        4TR8 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_coordinate_error_obs    0.284 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_sigma_a_free_details    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_sigma_a_obs_details     ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.RG_d_res_high                   ? 
_refine_analyze.RG_d_res_low                    ? 
_refine_analyze.RG_free                         ? 
_refine_analyze.RG_work                         ? 
_refine_analyze.RG_free_work_ratio              ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         1 
_refine_hist.pdbx_number_atoms_protein        5556 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         1 
_refine_hist.number_atoms_solvent             432 
_refine_hist.number_atoms_total               5989 
_refine_hist.d_res_high                       1.80 
_refine_hist.d_res_low                        43.9 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.010 ? 5634 ? t_bond_d                  2.00  HARMONIC     
'X-RAY DIFFRACTION' ? 1.11  ? 7655 ? t_angle_deg               2.00  HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? 1968 ? t_dihedral_angle_d        2.00  SINUSOIDAL   
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_incorr_chiral_ct        ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_pseud_angle             ?     ?            
'X-RAY DIFFRACTION' ? ?     ? 146  ? t_trig_c_planes           2.00  HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? 837  ? t_gen_planes              5.00  HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? 5634 ? t_it                      20.00 HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? 0    ? t_nbd                     5.00  SEMIHARMONIC 
'X-RAY DIFFRACTION' ? 3.31  ? ?    ? t_omega_torsion           ?     ?            
'X-RAY DIFFRACTION' ? 16.24 ? ?    ? t_other_torsion           ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_improper_torsion        ?     ?            
'X-RAY DIFFRACTION' ? ?     ? 751  ? t_chiral_improper_torsion 5.00  SEMIHARMONIC 
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_sum_occupancies         ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_utility_distance        ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_utility_angle           ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_utility_torsion         ?     ?            
'X-RAY DIFFRACTION' ? ?     ? 6592 ? t_ideal_dist_contact      4.00  SEMIHARMONIC 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       1.80 
_refine_ls_shell.d_res_low                        1.85 
_refine_ls_shell.number_reflns_all                6482 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             315 
_refine_ls_shell.number_reflns_R_work             6167 
_refine_ls_shell.percent_reflns_obs               99.98 
_refine_ls_shell.percent_reflns_R_free            4.86 
_refine_ls_shell.R_factor_all                     0.2914 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.3107 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.2904 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
# 
_struct.entry_id                     4TR8 
_struct.title                        'Crystal structure of DNA polymerase sliding clamp from Pseudomonas aeruginosa' 
_struct.pdbx_descriptor              'DNA polymerase sliding clamp from Pseudomonas aeruginosa' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4TR8 
_struct_keywords.text            'DNA polymerase, sliding clamp, processivity, DNA binding protein' 
_struct_keywords.pdbx_keywords   'DNA BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ARG A 23  ? VAL A 36  ? ARG A 7   VAL A 20  1 ? 14 
HELX_P HELX_P2  AA2 LEU A 43  ? LEU A 46  ? LEU A 27  LEU A 30  5 ? 4  
HELX_P HELX_P3  AA3 ALA A 88  ? LEU A 98  ? ALA A 72  LEU A 82  1 ? 11 
HELX_P HELX_P4  AA4 PRO A 128 ? PHE A 132 ? PRO A 112 PHE A 116 5 ? 5  
HELX_P HELX_P5  AA5 GLN A 148 ? ARG A 157 ? GLN A 132 ARG A 141 1 ? 10 
HELX_P HELX_P6  AA6 THR A 158 ? MET A 162 ? THR A 142 MET A 146 5 ? 5  
HELX_P HELX_P7  AA7 ARG A 168 ? LEU A 171 ? ARG A 152 LEU A 155 5 ? 4  
HELX_P HELX_P8  AA8 ARG A 214 ? LEU A 224 ? ARG A 198 LEU A 208 1 ? 11 
HELX_P HELX_P9  AA9 ASP A 260 ? LEU A 265 ? ASP A 244 LEU A 249 5 ? 6  
HELX_P HELX_P10 AB1 ARG A 277 ? ILE A 289 ? ARG A 261 ILE A 273 1 ? 13 
HELX_P HELX_P11 AB2 VAL A 338 ? ILE A 348 ? VAL A 322 ILE A 332 1 ? 11 
HELX_P HELX_P12 AB3 ARG B 23  ? GLY B 35  ? ARG B 7   GLY B 19  1 ? 13 
HELX_P HELX_P13 AB4 LEU B 43  ? LEU B 46  ? LEU B 27  LEU B 30  5 ? 4  
HELX_P HELX_P14 AB5 ALA B 88  ? LEU B 98  ? ALA B 72  LEU B 82  1 ? 11 
HELX_P HELX_P15 AB6 PRO B 128 ? PHE B 132 ? PRO B 112 PHE B 116 5 ? 5  
HELX_P HELX_P16 AB7 GLN B 148 ? ARG B 157 ? GLN B 132 ARG B 141 1 ? 10 
HELX_P HELX_P17 AB8 THR B 158 ? MET B 162 ? THR B 142 MET B 146 5 ? 5  
HELX_P HELX_P18 AB9 ARG B 168 ? LEU B 171 ? ARG B 152 LEU B 155 5 ? 4  
HELX_P HELX_P19 AC1 ARG B 214 ? LEU B 224 ? ARG B 198 LEU B 208 1 ? 11 
HELX_P HELX_P20 AC2 ASP B 260 ? VAL B 264 ? ASP B 244 VAL B 248 5 ? 5  
HELX_P HELX_P21 AC3 ARG B 277 ? ILE B 289 ? ARG B 261 ILE B 273 1 ? 13 
HELX_P HELX_P22 AC4 VAL B 338 ? ILE B 348 ? VAL B 322 ILE B 332 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? A ASP 276 OD1 ? ? ? 1_555 C NA  . NA ? ? A ASP 260  A NA  1001 1_555 ? ? ? ? ? ? ? 2.492 ? 
metalc2 metalc ? ? A ASP 276 OD2 ? ? ? 1_555 C NA  . NA ? ? A ASP 260  A NA  1001 1_555 ? ? ? ? ? ? ? 2.668 ? 
metalc3 metalc ? ? C NA  .   NA  ? ? ? 1_555 D HOH . O  ? ? A NA  1001 A HOH 1144 1_555 ? ? ? ? ? ? ? 2.533 ? 
metalc4 metalc ? ? C NA  .   NA  ? ? ? 1_555 D HOH . O  ? ? A NA  1001 A HOH 1109 1_555 ? ? ? ? ? ? ? 2.468 ? 
metalc5 metalc ? ? C NA  .   NA  ? ? ? 1_555 E HOH . O  ? ? A NA  1001 B HOH 421  3_454 ? ? ? ? ? ? ? 2.560 ? 
metalc6 metalc ? ? C NA  .   NA  ? ? ? 1_555 E HOH . O  ? ? A NA  1001 B HOH 401  3_454 ? ? ? ? ? ? ? 2.286 ? 
metalc7 metalc ? ? C NA  .   NA  ? ? ? 1_555 E HOH . O  ? ? A NA  1001 B HOH 412  3_454 ? ? ? ? ? ? ? 2.722 ? 
metalc8 metalc ? ? C NA  .   NA  ? ? ? 1_555 E HOH . O  ? ? A NA  1001 B HOH 404  3_454 ? ? ? ? ? ? ? 2.565 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 8 ? 
AA2 ? 8 ? 
AA3 ? 8 ? 
AA4 ? 8 ? 
AA5 ? 8 ? 
AA6 ? 8 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA1 5 6 ? anti-parallel 
AA1 6 7 ? anti-parallel 
AA1 7 8 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA2 5 6 ? anti-parallel 
AA2 6 7 ? anti-parallel 
AA2 7 8 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA3 4 5 ? anti-parallel 
AA3 5 6 ? anti-parallel 
AA3 6 7 ? anti-parallel 
AA3 7 8 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA4 4 5 ? anti-parallel 
AA4 5 6 ? anti-parallel 
AA4 6 7 ? anti-parallel 
AA4 7 8 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA5 4 5 ? anti-parallel 
AA5 5 6 ? anti-parallel 
AA5 6 7 ? anti-parallel 
AA5 7 8 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA6 4 5 ? anti-parallel 
AA6 5 6 ? anti-parallel 
AA6 6 7 ? anti-parallel 
AA6 7 8 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 HIS A 18  ? GLN A 22  ? HIS A 2   GLN A 6   
AA1 2 LEU A 103 ? GLU A 109 ? LEU A 87  GLU A 93  
AA1 3 LYS A 112 ? ALA A 117 ? LYS A 96  ALA A 101 
AA1 4 SER A 120 ? SER A 125 ? SER A 104 SER A 109 
AA1 5 GLU B 318 ? GLN B 324 ? GLU B 302 GLN B 308 
AA1 6 LEU B 306 ? ASN B 312 ? LEU B 290 ASN B 296 
AA1 7 GLY B 297 ? SER B 303 ? GLY B 281 SER B 287 
AA1 8 LEU B 332 ? ASN B 337 ? LEU B 316 ASN B 321 
AA2 1 GLY A 82  ? PRO A 87  ? GLY A 66  PRO A 71  
AA2 2 ASN A 48  ? GLU A 54  ? ASN A 32  GLU A 38  
AA2 3 GLN A 57  ? THR A 63  ? GLN A 41  THR A 47  
AA2 4 VAL A 67  ? VAL A 74  ? VAL A 51  VAL A 58  
AA2 5 PHE A 247 ? LYS A 252 ? PHE A 231 LYS A 236 
AA2 6 HIS A 239 ? THR A 243 ? HIS A 223 THR A 227 
AA2 7 GLU A 230 ? GLY A 236 ? GLU A 214 GLY A 220 
AA2 8 GLY A 140 ? ALA A 147 ? GLY A 124 ALA A 131 
AA3 1 HIS A 208 ? PRO A 213 ? HIS A 192 PRO A 197 
AA3 2 GLY A 173 ? ASN A 179 ? GLY A 157 ASN A 163 
AA3 3 THR A 182 ? THR A 188 ? THR A 166 THR A 172 
AA3 4 ARG A 192 ? ASP A 199 ? ARG A 176 ASP A 183 
AA3 5 SER A 374 ? VAL A 378 ? SER A 358 VAL A 362 
AA3 6 ALA A 364 ? GLU A 368 ? ALA A 348 GLU A 352 
AA3 7 GLN A 352 ? LEU A 357 ? GLN A 336 LEU A 341 
AA3 8 LYS A 271 ? ASP A 276 ? LYS A 255 ASP A 260 
AA4 1 LEU A 332 ? ASN A 337 ? LEU A 316 ASN A 321 
AA4 2 GLY A 297 ? SER A 303 ? GLY A 281 SER A 287 
AA4 3 LEU A 306 ? ASN A 312 ? LEU A 290 ASN A 296 
AA4 4 GLU A 318 ? GLN A 324 ? GLU A 302 GLN A 308 
AA4 5 SER B 120 ? SER B 125 ? SER B 104 SER B 109 
AA4 6 LYS B 112 ? ALA B 117 ? LYS B 96  ALA B 101 
AA4 7 LEU B 103 ? GLU B 109 ? LEU B 87  GLU B 93  
AA4 8 HIS B 18  ? GLN B 22  ? HIS B 2   GLN B 6   
AA5 1 GLY B 82  ? PRO B 87  ? GLY B 66  PRO B 71  
AA5 2 ASN B 48  ? GLU B 54  ? ASN B 32  GLU B 38  
AA5 3 GLN B 57  ? THR B 63  ? GLN B 41  THR B 47  
AA5 4 VAL B 67  ? VAL B 74  ? VAL B 51  VAL B 58  
AA5 5 PHE B 247 ? LYS B 252 ? PHE B 231 LYS B 236 
AA5 6 HIS B 239 ? THR B 243 ? HIS B 223 THR B 227 
AA5 7 GLU B 230 ? LEU B 235 ? GLU B 214 LEU B 219 
AA5 8 LEU B 142 ? ALA B 147 ? LEU B 126 ALA B 131 
AA6 1 HIS B 208 ? PRO B 213 ? HIS B 192 PRO B 197 
AA6 2 GLY B 173 ? ASN B 179 ? GLY B 157 ASN B 163 
AA6 3 THR B 182 ? THR B 188 ? THR B 166 THR B 172 
AA6 4 ARG B 192 ? ASP B 199 ? ARG B 176 ASP B 183 
AA6 5 SER B 374 ? VAL B 378 ? SER B 358 VAL B 362 
AA6 6 ALA B 364 ? GLU B 368 ? ALA B 348 GLU B 352 
AA6 7 GLN B 352 ? LEU B 357 ? GLN B 336 LEU B 341 
AA6 8 LYS B 271 ? ASP B 276 ? LYS B 255 ASP B 260 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ILE A 21  ? N ILE A 5   O ILE A 104 ? O ILE A 88  
AA1 2 3 N ASP A 105 ? N ASP A 89  O LYS A 116 ? O LYS A 100 
AA1 3 4 N LEU A 113 ? N LEU A 97  O LEU A 124 ? O LEU A 108 
AA1 4 5 N THR A 123 ? N THR A 107 O GLU B 318 ? O GLU B 302 
AA1 5 6 O GLU B 321 ? O GLU B 305 N ILE B 309 ? N ILE B 293 
AA1 6 7 O GLN B 310 ? O GLN B 294 N ARG B 299 ? N ARG B 283 
AA1 7 8 N LEU B 302 ? N LEU B 286 O LEU B 332 ? O LEU B 316 
AA2 1 2 O ILE A 84  ? O ILE A 68  N LEU A 51  ? N LEU A 35  
AA2 2 3 N LEU A 50  ? N LEU A 34  O THR A 61  ? O THR A 45  
AA2 3 4 N LEU A 60  ? N LEU A 44  O GLY A 71  ? O GLY A 55  
AA2 4 5 N GLU A 68  ? N GLU A 52  O THR A 250 ? O THR A 234 
AA2 5 6 O PHE A 249 ? O PHE A 233 N ALA A 242 ? N ALA A 226 
AA2 6 7 O HIS A 239 ? O HIS A 223 N GLY A 236 ? N GLY A 220 
AA2 7 8 O ILE A 233 ? O ILE A 217 N PHE A 144 ? N PHE A 128 
AA3 1 2 O HIS A 208 ? O HIS A 192 N VAL A 178 ? N VAL A 162 
AA3 2 3 N GLU A 177 ? N GLU A 161 O ARG A 184 ? O ARG A 168 
AA3 3 4 N SER A 185 ? N SER A 169 O CYS A 196 ? O CYS A 180 
AA3 4 5 N LEU A 193 ? N LEU A 177 O VAL A 377 ? O VAL A 361 
AA3 5 6 O VAL A 378 ? O VAL A 362 N ALA A 364 ? N ALA A 348 
AA3 6 7 O LEU A 365 ? O LEU A 349 N ILE A 356 ? N ILE A 340 
AA3 7 8 O PHE A 355 ? O PHE A 339 N VAL A 273 ? N VAL A 257 
AA4 1 2 O LEU A 332 ? O LEU A 316 N LEU A 302 ? N LEU A 286 
AA4 2 3 N ARG A 299 ? N ARG A 283 O GLN A 310 ? O GLN A 294 
AA4 3 4 N ILE A 309 ? N ILE A 293 O GLU A 321 ? O GLU A 305 
AA4 4 5 N GLU A 320 ? N GLU A 304 O ARG B 121 ? O ARG B 105 
AA4 5 6 O LEU B 124 ? O LEU B 108 N LEU B 113 ? N LEU B 97  
AA4 6 7 O LYS B 116 ? O LYS B 100 N ASP B 105 ? N ASP B 89  
AA4 7 8 O ILE B 106 ? O ILE B 90  N PHE B 19  ? N PHE B 3   
AA5 1 2 O ILE B 84  ? O ILE B 68  N LEU B 51  ? N LEU B 35  
AA5 2 3 N VAL B 52  ? N VAL B 36  O SER B 59  ? O SER B 43  
AA5 3 4 N LEU B 58  ? N LEU B 42  O VAL B 73  ? O VAL B 57  
AA5 4 5 N GLU B 68  ? N GLU B 52  O THR B 250 ? O THR B 234 
AA5 5 6 O PHE B 249 ? O PHE B 233 N ALA B 242 ? N ALA B 226 
AA5 6 7 O THR B 243 ? O THR B 227 N GLY B 232 ? N GLY B 216 
AA5 7 8 O ILE B 233 ? O ILE B 217 N PHE B 144 ? N PHE B 128 
AA6 1 2 O VAL B 212 ? O VAL B 196 N MET B 174 ? N MET B 158 
AA6 2 3 N GLU B 177 ? N GLU B 161 O ARG B 184 ? O ARG B 168 
AA6 3 4 N LEU B 183 ? N LEU B 167 O LEU B 198 ? O LEU B 182 
AA6 4 5 N MET B 195 ? N MET B 179 O ALA B 375 ? O ALA B 359 
AA6 5 6 O TYR B 376 ? O TYR B 360 N VAL B 366 ? N VAL B 350 
AA6 6 7 O LEU B 365 ? O LEU B 349 N ILE B 356 ? N ILE B 340 
AA6 7 8 O PHE B 355 ? O PHE B 339 N VAL B 273 ? N VAL B 257 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    A 
_struct_site.pdbx_auth_comp_id    NA 
_struct_site.pdbx_auth_seq_id     1001 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    7 
_struct_site.details              'binding site for residue NA A 1001' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 7 ASP A 276 ? ASP A 260  . ? 1_555 ? 
2 AC1 7 HOH D .   ? HOH A 1109 . ? 1_555 ? 
3 AC1 7 HOH D .   ? HOH A 1144 . ? 1_555 ? 
4 AC1 7 HOH E .   ? HOH B 401  . ? 3_454 ? 
5 AC1 7 HOH E .   ? HOH B 404  . ? 3_454 ? 
6 AC1 7 HOH E .   ? HOH B 412  . ? 3_454 ? 
7 AC1 7 HOH E .   ? HOH B 421  . ? 3_454 ? 
# 
_atom_sites.entry_id                    4TR8 
_atom_sites.fract_transf_matrix[1][1]   0.012418 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010821 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007849 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
NA 
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . HIS A 1 1   ? 25.256  -19.078 -4.341  1.00 81.92  ? 9985 HIS A N   1 
ATOM   2    C  CA  . HIS A 1 1   ? 23.879  -19.471 -4.071  1.00 80.33  ? 9985 HIS A CA  1 
ATOM   3    C  C   . HIS A 1 1   ? 22.949  -19.112 -5.243  1.00 82.35  ? 9985 HIS A C   1 
ATOM   4    O  O   . HIS A 1 1   ? 21.948  -18.412 -5.042  1.00 81.37  ? 9985 HIS A O   1 
ATOM   5    C  CB  . HIS A 1 1   ? 23.394  -18.846 -2.747  1.00 81.36  ? 9985 HIS A CB  1 
ATOM   6    N  N   . HIS A 1 2   ? 23.273  -19.573 -6.471  1.00 77.84  ? 9986 HIS A N   1 
ATOM   7    C  CA  . HIS A 1 2   ? 22.373  -19.244 -7.569  1.00 76.08  ? 9986 HIS A CA  1 
ATOM   8    C  C   . HIS A 1 2   ? 21.377  -20.297 -7.988  1.00 77.69  ? 9986 HIS A C   1 
ATOM   9    O  O   . HIS A 1 2   ? 21.666  -21.497 -7.995  1.00 77.04  ? 9986 HIS A O   1 
ATOM   10   C  CB  . HIS A 1 2   ? 22.961  -18.437 -8.739  1.00 77.05  ? 9986 HIS A CB  1 
ATOM   11   C  CG  . HIS A 1 2   ? 24.259  -18.873 -9.333  1.00 81.40  ? 9986 HIS A CG  1 
ATOM   12   N  ND1 . HIS A 1 2   ? 24.618  -20.200 -9.417  1.00 83.48  ? 9986 HIS A ND1 1 
ATOM   13   C  CD2 . HIS A 1 2   ? 25.187  -18.127 -9.975  1.00 83.78  ? 9986 HIS A CD2 1 
ATOM   14   C  CE1 . HIS A 1 2   ? 25.789  -20.210 -10.033 1.00 83.79  ? 9986 HIS A CE1 1 
ATOM   15   N  NE2 . HIS A 1 2   ? 26.161  -18.988 -10.402 1.00 84.36  ? 9986 HIS A NE2 1 
ATOM   16   N  N   . HIS A 1 3   ? 20.163  -19.809 -8.274  1.00 72.77  ? 9987 HIS A N   1 
ATOM   17   C  CA  . HIS A 1 3   ? 18.995  -20.582 -8.656  1.00 71.49  ? 9987 HIS A CA  1 
ATOM   18   C  C   . HIS A 1 3   ? 18.574  -20.283 -10.094 1.00 74.48  ? 9987 HIS A C   1 
ATOM   19   O  O   . HIS A 1 3   ? 18.849  -19.205 -10.628 1.00 73.17  ? 9987 HIS A O   1 
ATOM   20   C  CB  . HIS A 1 3   ? 17.845  -20.279 -7.683  1.00 71.68  ? 9987 HIS A CB  1 
ATOM   21   N  N   . HIS A 1 4   ? 17.865  -21.249 -10.689 1.00 71.58  ? 9988 HIS A N   1 
ATOM   22   C  CA  . HIS A 1 4   ? 17.303  -21.299 -12.044 1.00 70.87  ? 9988 HIS A CA  1 
ATOM   23   C  C   . HIS A 1 4   ? 16.347  -20.122 -12.335 1.00 72.95  ? 9988 HIS A C   1 
ATOM   24   O  O   . HIS A 1 4   ? 15.889  -19.471 -11.394 1.00 72.41  ? 9988 HIS A O   1 
ATOM   25   C  CB  . HIS A 1 4   ? 16.547  -22.638 -12.241 1.00 71.50  ? 9988 HIS A CB  1 
ATOM   26   C  CG  . HIS A 1 4   ? 17.004  -23.794 -11.386 1.00 75.97  ? 9988 HIS A CG  1 
ATOM   27   N  ND1 . HIS A 1 4   ? 16.777  -25.103 -11.776 1.00 77.97  ? 9988 HIS A ND1 1 
ATOM   28   C  CD2 . HIS A 1 4   ? 17.612  -23.806 -10.173 1.00 78.85  ? 9988 HIS A CD2 1 
ATOM   29   C  CE1 . HIS A 1 4   ? 17.277  -25.861 -10.811 1.00 78.32  ? 9988 HIS A CE1 1 
ATOM   30   N  NE2 . HIS A 1 4   ? 17.789  -25.123 -9.826  1.00 79.26  ? 9988 HIS A NE2 1 
ATOM   31   N  N   . HIS A 1 5   ? 16.054  -19.863 -13.644 1.00 68.70  ? 9989 HIS A N   1 
ATOM   32   C  CA  . HIS A 1 5   ? 15.129  -18.844 -14.200 1.00 67.73  ? 9989 HIS A CA  1 
ATOM   33   C  C   . HIS A 1 5   ? 15.686  -17.433 -14.488 1.00 72.32  ? 9989 HIS A C   1 
ATOM   34   O  O   . HIS A 1 5   ? 16.621  -16.992 -13.820 1.00 73.32  ? 9989 HIS A O   1 
ATOM   35   C  CB  . HIS A 1 5   ? 13.770  -18.797 -13.461 1.00 67.60  ? 9989 HIS A CB  1 
ATOM   36   N  N   . HIS A 1 6   ? 15.099  -16.735 -15.497 1.00 68.24  ? 9990 HIS A N   1 
ATOM   37   C  CA  . HIS A 1 6   ? 15.445  -15.363 -15.931 1.00 68.39  ? 9990 HIS A CA  1 
ATOM   38   C  C   . HIS A 1 6   ? 14.298  -14.677 -16.713 1.00 71.34  ? 9990 HIS A C   1 
ATOM   39   O  O   . HIS A 1 6   ? 14.535  -13.726 -17.465 1.00 71.48  ? 9990 HIS A O   1 
ATOM   40   C  CB  . HIS A 1 6   ? 16.734  -15.354 -16.761 1.00 69.99  ? 9990 HIS A CB  1 
ATOM   41   N  N   . SER A 1 7   ? 13.058  -15.173 -16.499 1.00 66.27  ? 9991 SER A N   1 
ATOM   42   C  CA  . SER A 1 7   ? 11.732  -14.811 -17.038 1.00 64.34  ? 9991 SER A CA  1 
ATOM   43   C  C   . SER A 1 7   ? 10.940  -16.120 -17.010 1.00 64.68  ? 9991 SER A C   1 
ATOM   44   O  O   . SER A 1 7   ? 10.075  -16.360 -17.860 1.00 64.85  ? 9991 SER A O   1 
ATOM   45   C  CB  . SER A 1 7   ? 11.818  -14.272 -18.469 1.00 68.29  ? 9991 SER A CB  1 
ATOM   46   N  N   . SER A 1 8   ? 11.279  -16.978 -16.015 1.00 57.85  ? 9992 SER A N   1 
ATOM   47   C  CA  . SER A 1 8   ? 10.811  -18.344 -15.766 1.00 55.47  ? 9992 SER A CA  1 
ATOM   48   C  C   . SER A 1 8   ? 11.335  -19.333 -16.816 1.00 54.73  ? 9992 SER A C   1 
ATOM   49   O  O   . SER A 1 8   ? 11.943  -20.342 -16.446 1.00 55.74  ? 9992 SER A O   1 
ATOM   50   C  CB  . SER A 1 8   ? 9.299   -18.430 -15.578 1.00 58.44  ? 9992 SER A CB  1 
ATOM   51   O  OG  . SER A 1 8   ? 8.971   -18.304 -14.204 1.00 67.83  ? 9992 SER A OG  1 
ATOM   52   N  N   . GLY A 1 9   ? 11.137  -19.015 -18.100 1.00 45.66  ? 9993 GLY A N   1 
ATOM   53   C  CA  . GLY A 1 9   ? 11.599  -19.852 -19.201 1.00 43.14  ? 9993 GLY A CA  1 
ATOM   54   C  C   . GLY A 1 9   ? 11.389  -19.293 -20.598 1.00 40.04  ? 9993 GLY A C   1 
ATOM   55   O  O   . GLY A 1 9   ? 10.908  -18.167 -20.785 1.00 36.21  ? 9993 GLY A O   1 
ATOM   56   N  N   . LEU A 1 10  ? 11.779  -20.094 -21.596 1.00 32.48  ? 9994 LEU A N   1 
ATOM   57   C  CA  . LEU A 1 10  ? 11.593  -19.760 -23.013 1.00 30.35  ? 9994 LEU A CA  1 
ATOM   58   C  C   . LEU A 1 10  ? 10.169  -20.145 -23.455 1.00 32.79  ? 9994 LEU A C   1 
ATOM   59   O  O   . LEU A 1 10  ? 9.664   -19.638 -24.452 1.00 33.42  ? 9994 LEU A O   1 
ATOM   60   C  CB  . LEU A 1 10  ? 12.660  -20.489 -23.874 1.00 29.84  ? 9994 LEU A CB  1 
ATOM   61   C  CG  . LEU A 1 10  ? 14.114  -20.073 -23.615 1.00 33.71  ? 9994 LEU A CG  1 
ATOM   62   C  CD1 . LEU A 1 10  ? 15.096  -21.020 -24.285 1.00 33.31  ? 9994 LEU A CD1 1 
ATOM   63   C  CD2 . LEU A 1 10  ? 14.385  -18.625 -24.054 1.00 34.08  ? 9994 LEU A CD2 1 
ATOM   64   N  N   . VAL A 1 11  ? 9.534   -21.055 -22.721 1.00 29.12  ? 9995 VAL A N   1 
ATOM   65   C  CA  . VAL A 1 11  ? 8.180   -21.537 -22.998 1.00 28.23  ? 9995 VAL A CA  1 
ATOM   66   C  C   . VAL A 1 11  ? 7.372   -21.401 -21.710 1.00 33.51  ? 9995 VAL A C   1 
ATOM   67   O  O   . VAL A 1 11  ? 7.810   -21.883 -20.657 1.00 33.88  ? 9995 VAL A O   1 
ATOM   68   C  CB  . VAL A 1 11  ? 8.167   -23.008 -23.538 1.00 29.97  ? 9995 VAL A CB  1 
ATOM   69   C  CG1 . VAL A 1 11  ? 6.744   -23.524 -23.792 1.00 28.62  ? 9995 VAL A CG1 1 
ATOM   70   C  CG2 . VAL A 1 11  ? 9.021   -23.152 -24.795 1.00 30.65  ? 9995 VAL A CG2 1 
ATOM   71   N  N   . PRO A 1 12  ? 6.161   -20.810 -21.784 1.00 30.40  ? 9996 PRO A N   1 
ATOM   72   C  CA  . PRO A 1 12  ? 5.341   -20.675 -20.568 1.00 30.12  ? 9996 PRO A CA  1 
ATOM   73   C  C   . PRO A 1 12  ? 4.818   -21.999 -20.047 1.00 32.43  ? 9996 PRO A C   1 
ATOM   74   O  O   . PRO A 1 12  ? 4.764   -22.989 -20.780 1.00 30.88  ? 9996 PRO A O   1 
ATOM   75   C  CB  . PRO A 1 12  ? 4.175   -19.782 -21.028 1.00 31.53  ? 9996 PRO A CB  1 
ATOM   76   C  CG  . PRO A 1 12  ? 4.074   -20.026 -22.493 1.00 34.76  ? 9996 PRO A CG  1 
ATOM   77   C  CD  . PRO A 1 12  ? 5.496   -20.209 -22.958 1.00 30.56  ? 9996 PRO A CD  1 
ATOM   78   N  N   . ARG A 1 13  ? 4.400   -22.011 -18.776 1.00 31.13  ? 9997 ARG A N   1 
ATOM   79   C  CA  . ARG A 1 13  ? 3.762   -23.183 -18.193 1.00 32.42  ? 9997 ARG A CA  1 
ATOM   80   C  C   . ARG A 1 13  ? 2.401   -23.383 -18.883 1.00 33.52  ? 9997 ARG A C   1 
ATOM   81   O  O   . ARG A 1 13  ? 1.777   -22.409 -19.350 1.00 31.52  ? 9997 ARG A O   1 
ATOM   82   C  CB  . ARG A 1 13  ? 3.554   -22.976 -16.676 1.00 36.88  ? 9997 ARG A CB  1 
ATOM   83   N  N   . GLY A 1 14  ? 1.962   -24.633 -18.954 1.00 29.48  ? 9998 GLY A N   1 
ATOM   84   C  CA  . GLY A 1 14  ? 0.653   -24.966 -19.500 1.00 28.01  ? 9998 GLY A CA  1 
ATOM   85   C  C   . GLY A 1 14  ? -0.423  -24.332 -18.640 1.00 30.52  ? 9998 GLY A C   1 
ATOM   86   O  O   . GLY A 1 14  ? -0.196  -24.067 -17.451 1.00 30.16  ? 9998 GLY A O   1 
ATOM   87   N  N   . SER A 1 15  ? -1.572  -24.026 -19.246 1.00 25.34  ? 9999 SER A N   1 
ATOM   88   C  CA  . SER A 1 15  ? -2.693  -23.437 -18.529 1.00 24.44  ? 9999 SER A CA  1 
ATOM   89   C  C   . SER A 1 15  ? -3.684  -24.509 -18.064 1.00 28.29  ? 9999 SER A C   1 
ATOM   90   O  O   . SER A 1 15  ? -3.995  -25.441 -18.811 1.00 27.55  ? 9999 SER A O   1 
ATOM   91   C  CB  . SER A 1 15  ? -3.403  -22.417 -19.415 1.00 26.66  ? 9999 SER A CB  1 
ATOM   92   O  OG  . SER A 1 15  ? -4.515  -21.847 -18.745 1.00 27.01  ? 9999 SER A OG  1 
ATOM   93   N  N   . HIS A 1 16  ? -4.205  -24.353 -16.844 1.00 26.75  ? 0    HIS A N   1 
ATOM   94   C  CA  . HIS A 1 16  ? -5.231  -25.255 -16.296 1.00 28.59  ? 0    HIS A CA  1 
ATOM   95   C  C   . HIS A 1 16  ? -6.512  -24.447 -16.022 1.00 28.57  ? 0    HIS A C   1 
ATOM   96   O  O   . HIS A 1 16  ? -7.370  -24.886 -15.242 1.00 27.99  ? 0    HIS A O   1 
ATOM   97   C  CB  . HIS A 1 16  ? -4.715  -25.958 -15.025 1.00 32.04  ? 0    HIS A CB  1 
ATOM   98   C  CG  . HIS A 1 16  ? -3.568  -26.888 -15.292 1.00 37.45  ? 0    HIS A CG  1 
ATOM   99   N  ND1 . HIS A 1 16  ? -2.263  -26.531 -14.988 1.00 40.53  ? 0    HIS A ND1 1 
ATOM   100  C  CD2 . HIS A 1 16  ? -3.561  -28.107 -15.879 1.00 39.98  ? 0    HIS A CD2 1 
ATOM   101  C  CE1 . HIS A 1 16  ? -1.514  -27.558 -15.362 1.00 40.25  ? 0    HIS A CE1 1 
ATOM   102  N  NE2 . HIS A 1 16  ? -2.249  -28.528 -15.907 1.00 40.38  ? 0    HIS A NE2 1 
ATOM   103  N  N   . MET A 1 17  ? -6.628  -23.242 -16.658 1.00 22.34  ? 1    MET A N   1 
ATOM   104  C  CA  . MET A 1 17  ? -7.796  -22.362 -16.501 1.00 20.89  ? 1    MET A CA  1 
ATOM   105  C  C   . MET A 1 17  ? -9.086  -23.152 -16.723 1.00 24.64  ? 1    MET A C   1 
ATOM   106  O  O   . MET A 1 17  ? -9.203  -23.885 -17.714 1.00 23.76  ? 1    MET A O   1 
ATOM   107  C  CB  . MET A 1 17  ? -7.739  -21.200 -17.510 1.00 22.13  ? 1    MET A CB  1 
ATOM   108  C  CG  . MET A 1 17  ? -8.800  -20.121 -17.245 1.00 24.32  ? 1    MET A CG  1 
ATOM   109  S  SD  . MET A 1 17  ? -9.029  -19.031 -18.653 1.00 26.02  ? 1    MET A SD  1 
ATOM   110  C  CE  . MET A 1 17  ? -9.856  -20.156 -19.809 1.00 21.96  ? 1    MET A CE  1 
ATOM   111  N  N   . HIS A 1 18  ? -10.047 -22.998 -15.799 1.00 22.73  ? 2    HIS A N   1 
ATOM   112  C  CA  . HIS A 1 18  ? -11.342 -23.658 -15.872 1.00 23.91  ? 2    HIS A CA  1 
ATOM   113  C  C   . HIS A 1 18  ? -12.396 -22.872 -15.127 1.00 26.16  ? 2    HIS A C   1 
ATOM   114  O  O   . HIS A 1 18  ? -12.224 -22.554 -13.957 1.00 26.33  ? 2    HIS A O   1 
ATOM   115  C  CB  . HIS A 1 18  ? -11.277 -25.130 -15.374 1.00 26.19  ? 2    HIS A CB  1 
ATOM   116  C  CG  . HIS A 1 18  ? -12.594 -25.853 -15.373 1.00 30.59  ? 2    HIS A CG  1 
ATOM   117  N  ND1 . HIS A 1 18  ? -12.864 -26.848 -14.453 1.00 34.31  ? 2    HIS A ND1 1 
ATOM   118  C  CD2 . HIS A 1 18  ? -13.662 -25.726 -16.201 1.00 31.94  ? 2    HIS A CD2 1 
ATOM   119  C  CE1 . HIS A 1 18  ? -14.093 -27.260 -14.725 1.00 33.71  ? 2    HIS A CE1 1 
ATOM   120  N  NE2 . HIS A 1 18  ? -14.611 -26.603 -15.763 1.00 32.71  ? 2    HIS A NE2 1 
ATOM   121  N  N   . PHE A 1 19  ? -13.501 -22.571 -15.808 1.00 21.27  ? 3    PHE A N   1 
ATOM   122  C  CA  . PHE A 1 19  ? -14.629 -21.887 -15.199 1.00 20.47  ? 3    PHE A CA  1 
ATOM   123  C  C   . PHE A 1 19  ? -15.922 -22.307 -15.859 1.00 24.00  ? 3    PHE A C   1 
ATOM   124  O  O   . PHE A 1 19  ? -15.914 -22.825 -16.986 1.00 22.83  ? 3    PHE A O   1 
ATOM   125  C  CB  . PHE A 1 19  ? -14.459 -20.351 -15.262 1.00 21.26  ? 3    PHE A CB  1 
ATOM   126  C  CG  . PHE A 1 19  ? -14.413 -19.749 -16.650 1.00 21.19  ? 3    PHE A CG  1 
ATOM   127  C  CD1 . PHE A 1 19  ? -13.203 -19.627 -17.334 1.00 22.41  ? 3    PHE A CD1 1 
ATOM   128  C  CD2 . PHE A 1 19  ? -15.565 -19.239 -17.244 1.00 22.41  ? 3    PHE A CD2 1 
ATOM   129  C  CE1 . PHE A 1 19  ? -13.149 -19.033 -18.598 1.00 21.80  ? 3    PHE A CE1 1 
ATOM   130  C  CE2 . PHE A 1 19  ? -15.512 -18.662 -18.522 1.00 24.26  ? 3    PHE A CE2 1 
ATOM   131  C  CZ  . PHE A 1 19  ? -14.298 -18.544 -19.180 1.00 21.12  ? 3    PHE A CZ  1 
ATOM   132  N  N   . THR A 1 20  ? -17.030 -22.062 -15.153 1.00 20.80  ? 4    THR A N   1 
ATOM   133  C  CA  . THR A 1 20  ? -18.387 -22.232 -15.663 1.00 21.83  ? 4    THR A CA  1 
ATOM   134  C  C   . THR A 1 20  ? -19.036 -20.878 -15.564 1.00 25.19  ? 4    THR A C   1 
ATOM   135  O  O   . THR A 1 20  ? -18.759 -20.115 -14.628 1.00 24.49  ? 4    THR A O   1 
ATOM   136  C  CB  . THR A 1 20  ? -19.209 -23.330 -14.952 1.00 27.88  ? 4    THR A CB  1 
ATOM   137  O  OG1 . THR A 1 20  ? -19.349 -23.008 -13.574 1.00 32.37  ? 4    THR A OG1 1 
ATOM   138  C  CG2 . THR A 1 20  ? -18.608 -24.701 -15.098 1.00 28.23  ? 4    THR A CG2 1 
ATOM   139  N  N   . ILE A 1 21  ? -19.887 -20.559 -16.542 1.00 20.70  ? 5    ILE A N   1 
ATOM   140  C  CA  . ILE A 1 21  ? -20.538 -19.263 -16.609 1.00 20.26  ? 5    ILE A CA  1 
ATOM   141  C  C   . ILE A 1 21  ? -21.821 -19.385 -17.417 1.00 24.20  ? 5    ILE A C   1 
ATOM   142  O  O   . ILE A 1 21  ? -21.867 -20.160 -18.384 1.00 23.02  ? 5    ILE A O   1 
ATOM   143  C  CB  . ILE A 1 21  ? -19.546 -18.210 -17.213 1.00 21.46  ? 5    ILE A CB  1 
ATOM   144  C  CG1 . ILE A 1 21  ? -20.050 -16.758 -17.075 1.00 22.07  ? 5    ILE A CG1 1 
ATOM   145  C  CG2 . ILE A 1 21  ? -19.080 -18.569 -18.639 1.00 20.11  ? 5    ILE A CG2 1 
ATOM   146  C  CD1 . ILE A 1 21  ? -18.971 -15.624 -17.396 1.00 25.49  ? 5    ILE A CD1 1 
ATOM   147  N  N   . GLN A 1 22  ? -22.846 -18.615 -17.024 1.00 21.67  ? 6    GLN A N   1 
ATOM   148  C  CA  . GLN A 1 22  ? -24.108 -18.541 -17.749 1.00 22.10  ? 6    GLN A CA  1 
ATOM   149  C  C   . GLN A 1 22  ? -23.830 -17.863 -19.098 1.00 24.48  ? 6    GLN A C   1 
ATOM   150  O  O   . GLN A 1 22  ? -23.029 -16.923 -19.172 1.00 23.16  ? 6    GLN A O   1 
ATOM   151  C  CB  . GLN A 1 22  ? -25.147 -17.711 -16.968 1.00 23.75  ? 6    GLN A CB  1 
ATOM   152  C  CG  . GLN A 1 22  ? -25.768 -18.436 -15.778 1.00 38.21  ? 6    GLN A CG  1 
ATOM   153  C  CD  . GLN A 1 22  ? -26.674 -19.576 -16.187 1.00 55.28  ? 6    GLN A CD  1 
ATOM   154  O  OE1 . GLN A 1 22  ? -26.287 -20.753 -16.152 1.00 45.63  ? 6    GLN A OE1 1 
ATOM   155  N  NE2 . GLN A 1 22  ? -27.898 -19.251 -16.578 1.00 51.36  ? 6    GLN A NE2 1 
ATOM   156  N  N   . ARG A 1 23  ? -24.495 -18.332 -20.152 1.00 21.79  ? 7    ARG A N   1 
ATOM   157  C  CA  . ARG A 1 23  ? -24.355 -17.777 -21.502 1.00 21.84  ? 7    ARG A CA  1 
ATOM   158  C  C   . ARG A 1 23  ? -24.361 -16.228 -21.535 1.00 25.26  ? 7    ARG A C   1 
ATOM   159  O  O   . ARG A 1 23  ? -23.435 -15.616 -22.091 1.00 24.04  ? 7    ARG A O   1 
ATOM   160  C  CB  . ARG A 1 23  ? -25.447 -18.354 -22.427 1.00 22.35  ? 7    ARG A CB  1 
ATOM   161  C  CG  . ARG A 1 23  ? -25.494 -17.694 -23.819 1.00 23.90  ? 7    ARG A CG  1 
ATOM   162  C  CD  . ARG A 1 23  ? -26.768 -18.067 -24.557 1.00 27.76  ? 7    ARG A CD  1 
ATOM   163  N  NE  . ARG A 1 23  ? -26.869 -17.387 -25.853 1.00 25.28  ? 7    ARG A NE  1 
ATOM   164  C  CZ  . ARG A 1 23  ? -27.428 -16.199 -26.052 1.00 30.90  ? 7    ARG A CZ  1 
ATOM   165  N  NH1 . ARG A 1 23  ? -27.926 -15.511 -25.030 1.00 25.69  ? 7    ARG A NH1 1 
ATOM   166  N  NH2 . ARG A 1 23  ? -27.464 -15.673 -27.268 1.00 23.32  ? 7    ARG A NH2 1 
ATOM   167  N  N   . GLU A 1 24  ? -25.408 -15.610 -20.934 1.00 21.66  ? 8    GLU A N   1 
ATOM   168  C  CA  . GLU A 1 24  ? -25.635 -14.166 -20.940 1.00 21.48  ? 8    GLU A CA  1 
ATOM   169  C  C   . GLU A 1 24  ? -24.564 -13.398 -20.161 1.00 24.10  ? 8    GLU A C   1 
ATOM   170  O  O   . GLU A 1 24  ? -24.164 -12.311 -20.584 1.00 23.29  ? 8    GLU A O   1 
ATOM   171  C  CB  . GLU A 1 24  ? -27.057 -13.838 -20.417 1.00 23.90  ? 8    GLU A CB  1 
ATOM   172  C  CG  . GLU A 1 24  ? -28.197 -14.371 -21.295 1.00 30.69  ? 8    GLU A CG  1 
ATOM   173  C  CD  . GLU A 1 24  ? -28.379 -15.880 -21.353 1.00 35.60  ? 8    GLU A CD  1 
ATOM   174  O  OE1 . GLU A 1 24  ? -28.025 -16.566 -20.368 1.00 28.41  ? 8    GLU A OE1 1 
ATOM   175  O  OE2 . GLU A 1 24  ? -28.857 -16.381 -22.395 1.00 33.86  ? 8    GLU A OE2 1 
ATOM   176  N  N   . ALA A 1 25  ? -24.080 -13.983 -19.040 1.00 21.97  ? 9    ALA A N   1 
ATOM   177  C  CA  . ALA A 1 25  ? -23.031 -13.382 -18.195 1.00 22.54  ? 9    ALA A CA  1 
ATOM   178  C  C   . ALA A 1 25  ? -21.719 -13.299 -19.000 1.00 24.75  ? 9    ALA A C   1 
ATOM   179  O  O   . ALA A 1 25  ? -20.991 -12.317 -18.888 1.00 23.83  ? 9    ALA A O   1 
ATOM   180  C  CB  . ALA A 1 25  ? -22.830 -14.214 -16.926 1.00 23.66  ? 9    ALA A CB  1 
ATOM   181  N  N   . LEU A 1 26  ? -21.433 -14.327 -19.815 1.00 21.26  ? 10   LEU A N   1 
ATOM   182  C  CA  . LEU A 1 26  ? -20.229 -14.323 -20.659 1.00 20.03  ? 10   LEU A CA  1 
ATOM   183  C  C   . LEU A 1 26  ? -20.378 -13.402 -21.865 1.00 23.57  ? 10   LEU A C   1 
ATOM   184  O  O   . LEU A 1 26  ? -19.444 -12.686 -22.208 1.00 21.30  ? 10   LEU A O   1 
ATOM   185  C  CB  . LEU A 1 26  ? -19.890 -15.758 -21.119 1.00 18.91  ? 10   LEU A CB  1 
ATOM   186  C  CG  . LEU A 1 26  ? -18.685 -15.906 -22.081 1.00 22.97  ? 10   LEU A CG  1 
ATOM   187  C  CD1 . LEU A 1 26  ? -17.385 -15.372 -21.442 1.00 21.81  ? 10   LEU A CD1 1 
ATOM   188  C  CD2 . LEU A 1 26  ? -18.510 -17.335 -22.486 1.00 22.61  ? 10   LEU A CD2 1 
ATOM   189  N  N   . LEU A 1 27  ? -21.543 -13.461 -22.531 1.00 23.08  ? 11   LEU A N   1 
ATOM   190  C  CA  . LEU A 1 27  ? -21.821 -12.747 -23.770 1.00 23.15  ? 11   LEU A CA  1 
ATOM   191  C  C   . LEU A 1 27  ? -21.690 -11.242 -23.676 1.00 25.85  ? 11   LEU A C   1 
ATOM   192  O  O   . LEU A 1 27  ? -21.224 -10.630 -24.636 1.00 23.91  ? 11   LEU A O   1 
ATOM   193  C  CB  . LEU A 1 27  ? -23.188 -13.162 -24.344 1.00 24.51  ? 11   LEU A CB  1 
ATOM   194  C  CG  . LEU A 1 27  ? -23.520 -12.756 -25.796 1.00 31.65  ? 11   LEU A CG  1 
ATOM   195  C  CD1 . LEU A 1 27  ? -22.564 -13.416 -26.812 1.00 32.75  ? 11   LEU A CD1 1 
ATOM   196  C  CD2 . LEU A 1 27  ? -24.969 -13.134 -26.135 1.00 35.33  ? 11   LEU A CD2 1 
ATOM   197  N  N   . LYS A 1 28  ? -22.091 -10.657 -22.528 1.00 24.27  ? 12   LYS A N   1 
ATOM   198  C  CA  . LYS A 1 28  ? -22.055 -9.211  -22.290 1.00 24.86  ? 12   LYS A CA  1 
ATOM   199  C  C   . LYS A 1 28  ? -20.630 -8.630  -22.471 1.00 27.84  ? 12   LYS A C   1 
ATOM   200  O  O   . LYS A 1 28  ? -20.436 -7.906  -23.458 1.00 26.70  ? 12   LYS A O   1 
ATOM   201  C  CB  . LYS A 1 28  ? -22.726 -8.831  -20.948 1.00 27.29  ? 12   LYS A CB  1 
ATOM   202  C  CG  . LYS A 1 28  ? -22.910 -7.327  -20.754 1.00 44.27  ? 12   LYS A CG  1 
ATOM   203  C  CD  . LYS A 1 28  ? -23.359 -6.992  -19.337 1.00 55.65  ? 12   LYS A CD  1 
ATOM   204  C  CE  . LYS A 1 28  ? -23.428 -5.498  -19.112 1.00 66.46  ? 12   LYS A CE  1 
ATOM   205  N  NZ  . LYS A 1 28  ? -23.748 -5.167  -17.697 1.00 74.57  ? 12   LYS A NZ  1 
ATOM   206  N  N   . PRO A 1 29  ? -19.608 -8.990  -21.647 1.00 24.20  ? 13   PRO A N   1 
ATOM   207  C  CA  . PRO A 1 29  ? -18.246 -8.474  -21.917 1.00 23.41  ? 13   PRO A CA  1 
ATOM   208  C  C   . PRO A 1 29  ? -17.651 -8.997  -23.231 1.00 25.09  ? 13   PRO A C   1 
ATOM   209  O  O   . PRO A 1 29  ? -16.979 -8.242  -23.932 1.00 24.09  ? 13   PRO A O   1 
ATOM   210  C  CB  . PRO A 1 29  ? -17.440 -8.951  -20.705 1.00 25.53  ? 13   PRO A CB  1 
ATOM   211  C  CG  . PRO A 1 29  ? -18.167 -10.186 -20.227 1.00 29.63  ? 13   PRO A CG  1 
ATOM   212  C  CD  . PRO A 1 29  ? -19.617 -9.854  -20.446 1.00 25.40  ? 13   PRO A CD  1 
ATOM   213  N  N   . LEU A 1 30  ? -17.899 -10.283 -23.576 1.00 20.04  ? 14   LEU A N   1 
ATOM   214  C  CA  . LEU A 1 30  ? -17.353 -10.896 -24.780 1.00 18.61  ? 14   LEU A CA  1 
ATOM   215  C  C   . LEU A 1 30  ? -17.719 -10.177 -26.075 1.00 22.31  ? 14   LEU A C   1 
ATOM   216  O  O   . LEU A 1 30  ? -16.837 -9.950  -26.890 1.00 22.10  ? 14   LEU A O   1 
ATOM   217  C  CB  . LEU A 1 30  ? -17.700 -12.387 -24.857 1.00 18.61  ? 14   LEU A CB  1 
ATOM   218  C  CG  . LEU A 1 30  ? -17.144 -13.183 -26.064 1.00 21.51  ? 14   LEU A CG  1 
ATOM   219  C  CD1 . LEU A 1 30  ? -15.588 -13.055 -26.172 1.00 21.72  ? 14   LEU A CD1 1 
ATOM   220  C  CD2 . LEU A 1 30  ? -17.518 -14.649 -25.941 1.00 22.96  ? 14   LEU A CD2 1 
ATOM   221  N  N   . GLN A 1 31  ? -18.987 -9.776  -26.253 1.00 21.11  ? 15   GLN A N   1 
ATOM   222  C  CA  . GLN A 1 31  ? -19.398 -9.053  -27.473 1.00 21.33  ? 15   GLN A CA  1 
ATOM   223  C  C   . GLN A 1 31  ? -18.666 -7.716  -27.621 1.00 24.71  ? 15   GLN A C   1 
ATOM   224  O  O   . GLN A 1 31  ? -18.191 -7.388  -28.709 1.00 23.40  ? 15   GLN A O   1 
ATOM   225  C  CB  . GLN A 1 31  ? -20.922 -8.817  -27.498 1.00 22.58  ? 15   GLN A CB  1 
ATOM   226  C  CG  . GLN A 1 31  ? -21.694 -10.016 -28.036 1.00 34.78  ? 15   GLN A CG  1 
ATOM   227  C  CD  . GLN A 1 31  ? -23.196 -9.796  -28.046 1.00 50.46  ? 15   GLN A CD  1 
ATOM   228  O  OE1 . GLN A 1 31  ? -23.813 -9.413  -27.045 1.00 42.45  ? 15   GLN A OE1 1 
ATOM   229  N  NE2 . GLN A 1 31  ? -23.824 -10.080 -29.174 1.00 45.47  ? 15   GLN A NE2 1 
ATOM   230  N  N   . LEU A 1 32  ? -18.540 -6.980  -26.529 1.00 24.14  ? 16   LEU A N   1 
ATOM   231  C  CA  . LEU A 1 32  ? -17.845 -5.692  -26.552 1.00 25.89  ? 16   LEU A CA  1 
ATOM   232  C  C   . LEU A 1 32  ? -16.352 -5.865  -26.795 1.00 26.50  ? 16   LEU A C   1 
ATOM   233  O  O   . LEU A 1 32  ? -15.798 -5.220  -27.686 1.00 25.98  ? 16   LEU A O   1 
ATOM   234  C  CB  . LEU A 1 32  ? -18.148 -4.895  -25.280 1.00 27.38  ? 16   LEU A CB  1 
ATOM   235  C  CG  . LEU A 1 32  ? -19.603 -4.373  -25.215 1.00 34.15  ? 16   LEU A CG  1 
ATOM   236  C  CD1 . LEU A 1 32  ? -19.969 -3.927  -23.811 1.00 35.70  ? 16   LEU A CD1 1 
ATOM   237  C  CD2 . LEU A 1 32  ? -19.867 -3.282  -26.270 1.00 37.88  ? 16   LEU A CD2 1 
ATOM   238  N  N   . VAL A 1 33  ? -15.724 -6.813  -26.079 1.00 21.06  ? 17   VAL A N   1 
ATOM   239  C  CA  . VAL A 1 33  ? -14.298 -7.110  -26.242 1.00 21.34  ? 17   VAL A CA  1 
ATOM   240  C  C   . VAL A 1 33  ? -13.989 -7.610  -27.673 1.00 25.13  ? 17   VAL A C   1 
ATOM   241  O  O   . VAL A 1 33  ? -13.073 -7.079  -28.313 1.00 24.59  ? 17   VAL A O   1 
ATOM   242  C  CB  . VAL A 1 33  ? -13.770 -8.050  -25.115 1.00 25.07  ? 17   VAL A CB  1 
ATOM   243  C  CG1 . VAL A 1 33  ? -12.370 -8.542  -25.408 1.00 25.70  ? 17   VAL A CG1 1 
ATOM   244  C  CG2 . VAL A 1 33  ? -13.810 -7.358  -23.748 1.00 24.68  ? 17   VAL A CG2 1 
ATOM   245  N  N   . ALA A 1 34  ? -14.770 -8.582  -28.189 1.00 22.92  ? 18   ALA A N   1 
ATOM   246  C  CA  . ALA A 1 34  ? -14.570 -9.117  -29.547 1.00 24.18  ? 18   ALA A CA  1 
ATOM   247  C  C   . ALA A 1 34  ? -14.778 -8.046  -30.648 1.00 28.62  ? 18   ALA A C   1 
ATOM   248  O  O   . ALA A 1 34  ? -14.162 -8.143  -31.706 1.00 28.96  ? 18   ALA A O   1 
ATOM   249  C  CB  . ALA A 1 34  ? -15.469 -10.322 -29.797 1.00 25.40  ? 18   ALA A CB  1 
ATOM   250  N  N   . GLY A 1 35  ? -15.582 -7.028  -30.345 1.00 26.13  ? 19   GLY A N   1 
ATOM   251  C  CA  . GLY A 1 35  ? -15.879 -5.895  -31.219 1.00 27.01  ? 19   GLY A CA  1 
ATOM   252  C  C   . GLY A 1 35  ? -14.682 -5.056  -31.636 1.00 32.34  ? 19   GLY A C   1 
ATOM   253  O  O   . GLY A 1 35  ? -14.691 -4.485  -32.729 1.00 32.91  ? 19   GLY A O   1 
ATOM   254  N  N   . VAL A 1 36  ? -13.635 -4.974  -30.779 1.00 27.42  ? 20   VAL A N   1 
ATOM   255  C  CA  . VAL A 1 36  ? -12.420 -4.197  -31.074 1.00 27.22  ? 20   VAL A CA  1 
ATOM   256  C  C   . VAL A 1 36  ? -11.372 -5.065  -31.799 1.00 33.01  ? 20   VAL A C   1 
ATOM   257  O  O   . VAL A 1 36  ? -10.361 -4.551  -32.281 1.00 32.71  ? 20   VAL A O   1 
ATOM   258  C  CB  . VAL A 1 36  ? -11.832 -3.472  -29.819 1.00 30.62  ? 20   VAL A CB  1 
ATOM   259  C  CG1 . VAL A 1 36  ? -12.899 -2.664  -29.073 1.00 29.83  ? 20   VAL A CG1 1 
ATOM   260  C  CG2 . VAL A 1 36  ? -11.110 -4.439  -28.879 1.00 30.18  ? 20   VAL A CG2 1 
ATOM   261  N  N   . VAL A 1 37  ? -11.597 -6.392  -31.825 1.00 30.47  ? 21   VAL A N   1 
ATOM   262  C  CA  . VAL A 1 37  ? -10.702 -7.357  -32.453 1.00 32.29  ? 21   VAL A CA  1 
ATOM   263  C  C   . VAL A 1 37  ? -10.908 -7.342  -33.984 1.00 39.78  ? 21   VAL A C   1 
ATOM   264  O  O   . VAL A 1 37  ? -12.018 -7.598  -34.456 1.00 40.35  ? 21   VAL A O   1 
ATOM   265  C  CB  . VAL A 1 37  ? -10.898 -8.777  -31.845 1.00 35.37  ? 21   VAL A CB  1 
ATOM   266  C  CG1 . VAL A 1 37  ? -10.114 -9.821  -32.617 1.00 35.96  ? 21   VAL A CG1 1 
ATOM   267  C  CG2 . VAL A 1 37  ? -10.527 -8.807  -30.368 1.00 34.75  ? 21   VAL A CG2 1 
ATOM   268  N  N   . GLU A 1 38  ? -9.833  -7.050  -34.743 1.00 37.63  ? 22   GLU A N   1 
ATOM   269  C  CA  . GLU A 1 38  ? -9.870  -7.030  -36.215 1.00 65.46  ? 22   GLU A CA  1 
ATOM   270  C  C   . GLU A 1 38  ? -9.553  -8.403  -36.821 1.00 89.03  ? 22   GLU A C   1 
ATOM   271  O  O   . GLU A 1 38  ? -8.837  -9.209  -36.222 1.00 50.93  ? 22   GLU A O   1 
ATOM   272  C  CB  . GLU A 1 38  ? -8.931  -5.955  -36.784 1.00 67.00  ? 22   GLU A CB  1 
ATOM   273  N  N   . THR A 1 42  ? -2.489  -10.363 -39.717 1.00 57.27  ? 26   THR A N   1 
ATOM   274  C  CA  . THR A 1 42  ? -1.176  -10.928 -40.058 1.00 58.08  ? 26   THR A CA  1 
ATOM   275  C  C   . THR A 1 42  ? -0.534  -11.554 -38.810 1.00 59.99  ? 26   THR A C   1 
ATOM   276  O  O   . THR A 1 42  ? 0.128   -12.594 -38.911 1.00 60.37  ? 26   THR A O   1 
ATOM   277  C  CB  . THR A 1 42  ? -0.282  -9.882  -40.778 1.00 69.40  ? 26   THR A CB  1 
ATOM   278  O  OG1 . THR A 1 42  ? -0.998  -9.313  -41.878 1.00 70.75  ? 26   THR A OG1 1 
ATOM   279  C  CG2 . THR A 1 42  ? 1.024   -10.475 -41.297 1.00 68.84  ? 26   THR A CG2 1 
ATOM   280  N  N   . LEU A 1 43  ? -0.733  -10.909 -37.641 1.00 52.84  ? 27   LEU A N   1 
ATOM   281  C  CA  . LEU A 1 43  ? -0.258  -11.385 -36.345 1.00 51.01  ? 27   LEU A CA  1 
ATOM   282  C  C   . LEU A 1 43  ? -1.443  -12.195 -35.756 1.00 48.14  ? 27   LEU A C   1 
ATOM   283  O  O   . LEU A 1 43  ? -2.455  -11.587 -35.386 1.00 46.92  ? 27   LEU A O   1 
ATOM   284  C  CB  . LEU A 1 43  ? 0.137   -10.175 -35.460 1.00 51.46  ? 27   LEU A CB  1 
ATOM   285  C  CG  . LEU A 1 43  ? 0.880   -10.440 -34.141 1.00 57.25  ? 27   LEU A CG  1 
ATOM   286  C  CD1 . LEU A 1 43  ? 2.212   -11.168 -34.366 1.00 58.81  ? 27   LEU A CD1 1 
ATOM   287  C  CD2 . LEU A 1 43  ? 1.134   -9.139  -33.402 1.00 60.16  ? 27   LEU A CD2 1 
ATOM   288  N  N   . PRO A 1 44  ? -1.390  -13.560 -35.784 1.00 40.46  ? 28   PRO A N   1 
ATOM   289  C  CA  . PRO A 1 44  ? -2.545  -14.362 -35.333 1.00 37.85  ? 28   PRO A CA  1 
ATOM   290  C  C   . PRO A 1 44  ? -3.096  -14.058 -33.949 1.00 35.15  ? 28   PRO A C   1 
ATOM   291  O  O   . PRO A 1 44  ? -4.315  -14.087 -33.787 1.00 32.55  ? 28   PRO A O   1 
ATOM   292  C  CB  . PRO A 1 44  ? -2.053  -15.812 -35.451 1.00 40.26  ? 28   PRO A CB  1 
ATOM   293  C  CG  . PRO A 1 44  ? -0.962  -15.757 -36.468 1.00 46.23  ? 28   PRO A CG  1 
ATOM   294  C  CD  . PRO A 1 44  ? -0.288  -14.436 -36.242 1.00 42.56  ? 28   PRO A CD  1 
ATOM   295  N  N   . VAL A 1 45  ? -2.215  -13.754 -32.971 1.00 30.62  ? 29   VAL A N   1 
ATOM   296  C  CA  . VAL A 1 45  ? -2.603  -13.415 -31.596 1.00 29.69  ? 29   VAL A CA  1 
ATOM   297  C  C   . VAL A 1 45  ? -3.610  -12.238 -31.532 1.00 32.45  ? 29   VAL A C   1 
ATOM   298  O  O   . VAL A 1 45  ? -4.451  -12.217 -30.638 1.00 29.25  ? 29   VAL A O   1 
ATOM   299  C  CB  . VAL A 1 45  ? -1.387  -13.243 -30.644 1.00 32.65  ? 29   VAL A CB  1 
ATOM   300  C  CG1 . VAL A 1 45  ? -0.691  -11.894 -30.847 1.00 32.68  ? 29   VAL A CG1 1 
ATOM   301  C  CG2 . VAL A 1 45  ? -1.787  -13.439 -29.182 1.00 31.88  ? 29   VAL A CG2 1 
ATOM   302  N  N   . LEU A 1 46  ? -3.533  -11.288 -32.493 1.00 31.20  ? 30   LEU A N   1 
ATOM   303  C  CA  . LEU A 1 46  ? -4.387  -10.100 -32.541 1.00 31.43  ? 30   LEU A CA  1 
ATOM   304  C  C   . LEU A 1 46  ? -5.850  -10.407 -32.794 1.00 30.64  ? 30   LEU A C   1 
ATOM   305  O  O   . LEU A 1 46  ? -6.705  -9.594  -32.446 1.00 28.03  ? 30   LEU A O   1 
ATOM   306  C  CB  . LEU A 1 46  ? -3.853  -9.029  -33.526 1.00 32.78  ? 30   LEU A CB  1 
ATOM   307  C  CG  . LEU A 1 46  ? -2.584  -8.277  -33.095 1.00 39.69  ? 30   LEU A CG  1 
ATOM   308  C  CD1 . LEU A 1 46  ? -2.165  -7.256  -34.168 1.00 40.61  ? 30   LEU A CD1 1 
ATOM   309  C  CD2 . LEU A 1 46  ? -2.790  -7.555  -31.753 1.00 42.90  ? 30   LEU A CD2 1 
ATOM   310  N  N   . SER A 1 47  ? -6.137  -11.587 -33.384 1.00 26.32  ? 31   SER A N   1 
ATOM   311  C  CA  . SER A 1 47  ? -7.494  -12.068 -33.664 1.00 25.45  ? 31   SER A CA  1 
ATOM   312  C  C   . SER A 1 47  ? -8.083  -12.781 -32.434 1.00 25.72  ? 31   SER A C   1 
ATOM   313  O  O   . SER A 1 47  ? -9.257  -13.151 -32.432 1.00 23.17  ? 31   SER A O   1 
ATOM   314  C  CB  . SER A 1 47  ? -7.483  -13.019 -34.861 1.00 29.53  ? 31   SER A CB  1 
ATOM   315  O  OG  . SER A 1 47  ? -7.268  -12.274 -36.044 1.00 40.58  ? 31   SER A OG  1 
ATOM   316  N  N   . ASN A 1 48  ? -7.266  -12.948 -31.390 1.00 22.21  ? 32   ASN A N   1 
ATOM   317  C  CA  . ASN A 1 48  ? -7.661  -13.646 -30.179 1.00 20.90  ? 32   ASN A CA  1 
ATOM   318  C  C   . ASN A 1 48  ? -8.070  -12.732 -29.028 1.00 21.24  ? 32   ASN A C   1 
ATOM   319  O  O   . ASN A 1 48  ? -7.612  -11.592 -28.925 1.00 20.32  ? 32   ASN A O   1 
ATOM   320  C  CB  . ASN A 1 48  ? -6.553  -14.614 -29.716 1.00 19.81  ? 32   ASN A CB  1 
ATOM   321  C  CG  . ASN A 1 48  ? -6.384  -15.853 -30.587 1.00 24.92  ? 32   ASN A CG  1 
ATOM   322  O  OD1 . ASN A 1 48  ? -6.895  -15.926 -31.702 1.00 18.97  ? 32   ASN A OD1 1 
ATOM   323  N  ND2 . ASN A 1 48  ? -5.633  -16.833 -30.102 1.00 20.67  ? 32   ASN A ND2 1 
ATOM   324  N  N   . VAL A 1 49  ? -8.934  -13.272 -28.155 1.00 16.31  ? 33   VAL A N   1 
ATOM   325  C  CA  . VAL A 1 49  ? -9.315  -12.634 -26.902 1.00 15.26  ? 33   VAL A CA  1 
ATOM   326  C  C   . VAL A 1 49  ? -8.473  -13.297 -25.817 1.00 18.27  ? 33   VAL A C   1 
ATOM   327  O  O   . VAL A 1 49  ? -8.323  -14.519 -25.823 1.00 18.86  ? 33   VAL A O   1 
ATOM   328  C  CB  . VAL A 1 49  ? -10.845 -12.702 -26.586 1.00 17.66  ? 33   VAL A CB  1 
ATOM   329  C  CG1 . VAL A 1 49  ? -11.375 -14.148 -26.588 1.00 16.54  ? 33   VAL A CG1 1 
ATOM   330  C  CG2 . VAL A 1 49  ? -11.155 -12.019 -25.250 1.00 18.07  ? 33   VAL A CG2 1 
ATOM   331  N  N   . LEU A 1 50  ? -7.931  -12.506 -24.903 1.00 16.60  ? 34   LEU A N   1 
ATOM   332  C  CA  . LEU A 1 50  ? -7.152  -13.022 -23.783 1.00 16.68  ? 34   LEU A CA  1 
ATOM   333  C  C   . LEU A 1 50  ? -8.133  -13.271 -22.636 1.00 20.05  ? 34   LEU A C   1 
ATOM   334  O  O   . LEU A 1 50  ? -8.868  -12.354 -22.231 1.00 19.12  ? 34   LEU A O   1 
ATOM   335  C  CB  . LEU A 1 50  ? -6.063  -12.011 -23.361 1.00 16.29  ? 34   LEU A CB  1 
ATOM   336  C  CG  . LEU A 1 50  ? -5.418  -12.205 -21.965 1.00 18.85  ? 34   LEU A CG  1 
ATOM   337  C  CD1 . LEU A 1 50  ? -4.546  -13.490 -21.907 1.00 18.47  ? 34   LEU A CD1 1 
ATOM   338  C  CD2 . LEU A 1 50  ? -4.672  -10.948 -21.502 1.00 18.88  ? 34   LEU A CD2 1 
ATOM   339  N  N   . LEU A 1 51  ? -8.145  -14.496 -22.118 1.00 15.10  ? 35   LEU A N   1 
ATOM   340  C  CA  . LEU A 1 51  ? -9.004  -14.869 -20.979 1.00 15.34  ? 35   LEU A CA  1 
ATOM   341  C  C   . LEU A 1 51  ? -8.109  -15.059 -19.761 1.00 19.66  ? 35   LEU A C   1 
ATOM   342  O  O   . LEU A 1 51  ? -7.121  -15.796 -19.822 1.00 18.03  ? 35   LEU A O   1 
ATOM   343  C  CB  . LEU A 1 51  ? -9.820  -16.162 -21.249 1.00 16.04  ? 35   LEU A CB  1 
ATOM   344  C  CG  . LEU A 1 51  ? -10.697 -16.152 -22.511 1.00 21.18  ? 35   LEU A CG  1 
ATOM   345  C  CD1 . LEU A 1 51  ? -11.217 -17.534 -22.848 1.00 22.54  ? 35   LEU A CD1 1 
ATOM   346  C  CD2 . LEU A 1 51  ? -11.852 -15.141 -22.384 1.00 21.94  ? 35   LEU A CD2 1 
ATOM   347  N  N   . VAL A 1 52  ? -8.442  -14.391 -18.652 1.00 15.59  ? 36   VAL A N   1 
ATOM   348  C  CA  . VAL A 1 52  ? -7.662  -14.526 -17.422 1.00 16.07  ? 36   VAL A CA  1 
ATOM   349  C  C   . VAL A 1 52  ? -8.617  -14.798 -16.257 1.00 20.52  ? 36   VAL A C   1 
ATOM   350  O  O   . VAL A 1 52  ? -9.547  -14.015 -16.022 1.00 20.65  ? 36   VAL A O   1 
ATOM   351  C  CB  . VAL A 1 52  ? -6.804  -13.242 -17.142 1.00 20.00  ? 36   VAL A CB  1 
ATOM   352  C  CG1 . VAL A 1 52  ? -6.095  -13.338 -15.782 1.00 20.73  ? 36   VAL A CG1 1 
ATOM   353  C  CG2 . VAL A 1 52  ? -5.799  -12.960 -18.261 1.00 19.46  ? 36   VAL A CG2 1 
ATOM   354  N  N   . VAL A 1 53  ? -8.359  -15.858 -15.500 1.00 16.96  ? 37   VAL A N   1 
ATOM   355  C  CA  . VAL A 1 53  ? -9.141  -16.141 -14.304 1.00 17.84  ? 37   VAL A CA  1 
ATOM   356  C  C   . VAL A 1 53  ? -8.199  -15.939 -13.104 1.00 22.92  ? 37   VAL A C   1 
ATOM   357  O  O   . VAL A 1 53  ? -7.188  -16.642 -12.996 1.00 21.69  ? 37   VAL A O   1 
ATOM   358  C  CB  . VAL A 1 53  ? -9.820  -17.542 -14.298 1.00 21.94  ? 37   VAL A CB  1 
ATOM   359  C  CG1 . VAL A 1 53  ? -10.429 -17.858 -12.928 1.00 22.80  ? 37   VAL A CG1 1 
ATOM   360  C  CG2 . VAL A 1 53  ? -10.880 -17.668 -15.403 1.00 21.23  ? 37   VAL A CG2 1 
ATOM   361  N  N   . GLU A 1 54  ? -8.518  -14.968 -12.234 1.00 21.61  ? 38   GLU A N   1 
ATOM   362  C  CA  . GLU A 1 54  ? -7.776  -14.703 -10.985 1.00 22.98  ? 38   GLU A CA  1 
ATOM   363  C  C   . GLU A 1 54  ? -8.851  -14.622 -9.913  1.00 27.72  ? 38   GLU A C   1 
ATOM   364  O  O   . GLU A 1 54  ? -9.772  -13.801 -10.029 1.00 26.21  ? 38   GLU A O   1 
ATOM   365  C  CB  . GLU A 1 54  ? -6.981  -13.370 -11.059 1.00 24.14  ? 38   GLU A CB  1 
ATOM   366  C  CG  . GLU A 1 54  ? -5.748  -13.434 -11.952 1.00 30.40  ? 38   GLU A CG  1 
ATOM   367  C  CD  . GLU A 1 54  ? -4.953  -12.148 -12.113 1.00 44.16  ? 38   GLU A CD  1 
ATOM   368  O  OE1 . GLU A 1 54  ? -5.447  -11.071 -11.711 1.00 37.46  ? 38   GLU A OE1 1 
ATOM   369  O  OE2 . GLU A 1 54  ? -3.825  -12.220 -12.647 1.00 35.65  ? 38   GLU A OE2 1 
ATOM   370  N  N   . GLY A 1 55  ? -8.768  -15.511 -8.924  1.00 27.63  ? 39   GLY A N   1 
ATOM   371  C  CA  . GLY A 1 55  ? -9.784  -15.622 -7.881  1.00 28.28  ? 39   GLY A CA  1 
ATOM   372  C  C   . GLY A 1 55  ? -11.118 -15.972 -8.519  1.00 30.55  ? 39   GLY A C   1 
ATOM   373  O  O   . GLY A 1 55  ? -11.203 -16.918 -9.310  1.00 28.65  ? 39   GLY A O   1 
ATOM   374  N  N   . GLN A 1 56  ? -12.139 -15.149 -8.257  1.00 27.26  ? 40   GLN A N   1 
ATOM   375  C  CA  . GLN A 1 56  ? -13.483 -15.339 -8.804  1.00 26.00  ? 40   GLN A CA  1 
ATOM   376  C  C   . GLN A 1 56  ? -13.746 -14.317 -9.910  1.00 30.33  ? 40   GLN A C   1 
ATOM   377  O  O   . GLN A 1 56  ? -14.898 -14.034 -10.239 1.00 29.47  ? 40   GLN A O   1 
ATOM   378  C  CB  . GLN A 1 56  ? -14.534 -15.251 -7.677  1.00 27.64  ? 40   GLN A CB  1 
ATOM   379  C  CG  . GLN A 1 56  ? -14.457 -16.412 -6.679  1.00 29.17  ? 40   GLN A CG  1 
ATOM   380  C  CD  . GLN A 1 56  ? -14.545 -17.748 -7.374  1.00 40.51  ? 40   GLN A CD  1 
ATOM   381  O  OE1 . GLN A 1 56  ? -15.515 -18.048 -8.084  1.00 37.09  ? 40   GLN A OE1 1 
ATOM   382  N  NE2 . GLN A 1 56  ? -13.499 -18.539 -7.260  1.00 31.01  ? 40   GLN A NE2 1 
ATOM   383  N  N   . GLN A 1 57  ? -12.666 -13.737 -10.455 1.00 27.27  ? 41   GLN A N   1 
ATOM   384  C  CA  . GLN A 1 57  ? -12.786 -12.721 -11.495 1.00 25.95  ? 41   GLN A CA  1 
ATOM   385  C  C   . GLN A 1 57  ? -12.293 -13.233 -12.839 1.00 26.58  ? 41   GLN A C   1 
ATOM   386  O  O   . GLN A 1 57  ? -11.150 -13.693 -12.958 1.00 25.95  ? 41   GLN A O   1 
ATOM   387  C  CB  . GLN A 1 57  ? -12.021 -11.441 -11.117 1.00 27.52  ? 41   GLN A CB  1 
ATOM   388  C  CG  . GLN A 1 57  ? -12.324 -10.277 -12.072 1.00 44.09  ? 41   GLN A CG  1 
ATOM   389  C  CD  . GLN A 1 57  ? -11.377 -9.117  -11.895 1.00 59.80  ? 41   GLN A CD  1 
ATOM   390  O  OE1 . GLN A 1 57  ? -11.729 -8.095  -11.313 1.00 52.38  ? 41   GLN A OE1 1 
ATOM   391  N  NE2 . GLN A 1 57  ? -10.155 -9.246  -12.404 1.00 52.43  ? 41   GLN A NE2 1 
ATOM   392  N  N   . LEU A 1 58  ? -13.159 -13.120 -13.851 1.00 21.38  ? 42   LEU A N   1 
ATOM   393  C  CA  . LEU A 1 58  ? -12.803 -13.436 -15.227 1.00 18.84  ? 42   LEU A CA  1 
ATOM   394  C  C   . LEU A 1 58  ? -12.627 -12.109 -15.954 1.00 20.89  ? 42   LEU A C   1 
ATOM   395  O  O   . LEU A 1 58  ? -13.529 -11.258 -15.916 1.00 20.72  ? 42   LEU A O   1 
ATOM   396  C  CB  . LEU A 1 58  ? -13.872 -14.295 -15.938 1.00 18.78  ? 42   LEU A CB  1 
ATOM   397  C  CG  . LEU A 1 58  ? -13.714 -14.405 -17.474 1.00 21.48  ? 42   LEU A CG  1 
ATOM   398  C  CD1 . LEU A 1 58  ? -12.445 -15.207 -17.858 1.00 22.08  ? 42   LEU A CD1 1 
ATOM   399  C  CD2 . LEU A 1 58  ? -14.936 -15.048 -18.123 1.00 23.68  ? 42   LEU A CD2 1 
ATOM   400  N  N   . SER A 1 59  ? -11.472 -11.926 -16.587 1.00 16.16  ? 43   SER A N   1 
ATOM   401  C  CA  . SER A 1 59  ? -11.215 -10.745 -17.422 1.00 16.63  ? 43   SER A CA  1 
ATOM   402  C  C   . SER A 1 59  ? -11.039 -11.229 -18.863 1.00 19.27  ? 43   SER A C   1 
ATOM   403  O  O   . SER A 1 59  ? -10.489 -12.323 -19.085 1.00 19.48  ? 43   SER A O   1 
ATOM   404  C  CB  . SER A 1 59  ? -9.981  -9.979  -16.950 1.00 18.73  ? 43   SER A CB  1 
ATOM   405  O  OG  . SER A 1 59  ? -10.185 -9.438  -15.656 1.00 26.70  ? 43   SER A OG  1 
ATOM   406  N  N   . LEU A 1 60  ? -11.545 -10.454 -19.825 1.00 15.56  ? 44   LEU A N   1 
ATOM   407  C  CA  . LEU A 1 60  ? -11.452 -10.732 -21.265 1.00 15.00  ? 44   LEU A CA  1 
ATOM   408  C  C   . LEU A 1 60  ? -10.852 -9.483  -21.899 1.00 18.89  ? 44   LEU A C   1 
ATOM   409  O  O   . LEU A 1 60  ? -11.377 -8.384  -21.670 1.00 17.81  ? 44   LEU A O   1 
ATOM   410  C  CB  . LEU A 1 60  ? -12.841 -11.002 -21.893 1.00 15.76  ? 44   LEU A CB  1 
ATOM   411  C  CG  . LEU A 1 60  ? -13.723 -12.117 -21.273 1.00 21.29  ? 44   LEU A CG  1 
ATOM   412  C  CD1 . LEU A 1 60  ? -14.583 -11.572 -20.085 1.00 22.51  ? 44   LEU A CD1 1 
ATOM   413  C  CD2 . LEU A 1 60  ? -14.640 -12.722 -22.334 1.00 23.14  ? 44   LEU A CD2 1 
ATOM   414  N  N   . THR A 1 61  ? -9.759  -9.630  -22.677 1.00 16.82  ? 45   THR A N   1 
ATOM   415  C  CA  . THR A 1 61  ? -9.077  -8.489  -23.291 1.00 17.12  ? 45   THR A CA  1 
ATOM   416  C  C   . THR A 1 61  ? -8.961  -8.665  -24.798 1.00 20.85  ? 45   THR A C   1 
ATOM   417  O  O   . THR A 1 61  ? -8.564  -9.735  -25.284 1.00 18.74  ? 45   THR A O   1 
ATOM   418  C  CB  . THR A 1 61  ? -7.668  -8.273  -22.636 1.00 20.14  ? 45   THR A CB  1 
ATOM   419  O  OG1 . THR A 1 61  ? -7.796  -8.182  -21.212 1.00 18.26  ? 45   THR A OG1 1 
ATOM   420  C  CG2 . THR A 1 61  ? -6.906  -7.050  -23.203 1.00 18.56  ? 45   THR A CG2 1 
ATOM   421  N  N   . GLY A 1 62  ? -9.271  -7.587  -25.511 1.00 17.80  ? 46   GLY A N   1 
ATOM   422  C  CA  . GLY A 1 62  ? -9.174  -7.524  -26.963 1.00 18.40  ? 46   GLY A CA  1 
ATOM   423  C  C   . GLY A 1 62  ? -8.413  -6.279  -27.357 1.00 21.64  ? 46   GLY A C   1 
ATOM   424  O  O   . GLY A 1 62  ? -8.436  -5.290  -26.624 1.00 19.53  ? 46   GLY A O   1 
ATOM   425  N  N   . THR A 1 63  ? -7.665  -6.348  -28.456 1.00 20.11  ? 47   THR A N   1 
ATOM   426  C  CA  . THR A 1 63  ? -6.864  -5.206  -28.932 1.00 20.07  ? 47   THR A CA  1 
ATOM   427  C  C   . THR A 1 63  ? -6.675  -5.210  -30.448 1.00 24.08  ? 47   THR A C   1 
ATOM   428  O  O   . THR A 1 63  ? -6.681  -6.268  -31.072 1.00 22.96  ? 47   THR A O   1 
ATOM   429  C  CB  . THR A 1 63  ? -5.476  -5.156  -28.217 1.00 25.84  ? 47   THR A CB  1 
ATOM   430  O  OG1 . THR A 1 63  ? -4.843  -3.918  -28.529 1.00 27.32  ? 47   THR A OG1 1 
ATOM   431  C  CG2 . THR A 1 63  ? -4.549  -6.321  -28.615 1.00 24.58  ? 47   THR A CG2 1 
ATOM   432  N  N   . ASP A 1 64  ? -6.460  -4.027  -31.019 1.00 23.06  ? 48   ASP A N   1 
ATOM   433  C  CA  . ASP A 1 64  ? -6.121  -3.866  -32.439 1.00 23.67  ? 48   ASP A CA  1 
ATOM   434  C  C   . ASP A 1 64  ? -4.786  -3.093  -32.506 1.00 27.99  ? 48   ASP A C   1 
ATOM   435  O  O   . ASP A 1 64  ? -4.388  -2.622  -33.570 1.00 28.25  ? 48   ASP A O   1 
ATOM   436  C  CB  . ASP A 1 64  ? -7.255  -3.135  -33.199 1.00 24.49  ? 48   ASP A CB  1 
ATOM   437  C  CG  . ASP A 1 64  ? -7.509  -1.695  -32.776 1.00 26.06  ? 48   ASP A CG  1 
ATOM   438  O  OD1 . ASP A 1 64  ? -6.894  -1.245  -31.780 1.00 25.01  ? 48   ASP A OD1 1 
ATOM   439  O  OD2 . ASP A 1 64  ? -8.328  -1.026  -33.430 1.00 26.88  ? 48   ASP A OD2 1 
ATOM   440  N  N   . LEU A 1 65  ? -4.105  -2.973  -31.341 1.00 24.86  ? 49   LEU A N   1 
ATOM   441  C  CA  . LEU A 1 65  ? -2.855  -2.232  -31.090 1.00 26.00  ? 49   LEU A CA  1 
ATOM   442  C  C   . LEU A 1 65  ? -3.062  -0.713  -30.892 1.00 29.73  ? 49   LEU A C   1 
ATOM   443  O  O   . LEU A 1 65  ? -2.173  -0.080  -30.324 1.00 29.72  ? 49   LEU A O   1 
ATOM   444  C  CB  . LEU A 1 65  ? -1.685  -2.552  -32.062 1.00 26.72  ? 49   LEU A CB  1 
ATOM   445  C  CG  . LEU A 1 65  ? -1.256  -4.028  -32.178 1.00 31.78  ? 49   LEU A CG  1 
ATOM   446  C  CD1 . LEU A 1 65  ? -0.114  -4.174  -33.200 1.00 33.72  ? 49   LEU A CD1 1 
ATOM   447  C  CD2 . LEU A 1 65  ? -0.818  -4.593  -30.823 1.00 31.48  ? 49   LEU A CD2 1 
ATOM   448  N  N   . GLU A 1 66  ? -4.241  -0.152  -31.310 1.00 24.98  ? 50   GLU A N   1 
ATOM   449  C  CA  . GLU A 1 66  ? -4.639  1.270   -31.147 1.00 24.98  ? 50   GLU A CA  1 
ATOM   450  C  C   . GLU A 1 66  ? -5.396  1.376   -29.814 1.00 25.45  ? 50   GLU A C   1 
ATOM   451  O  O   . GLU A 1 66  ? -5.085  2.227   -28.975 1.00 23.93  ? 50   GLU A O   1 
ATOM   452  C  CB  . GLU A 1 66  ? -5.556  1.774   -32.325 1.00 26.55  ? 50   GLU A CB  1 
ATOM   453  C  CG  . GLU A 1 66  ? -6.071  3.225   -32.200 1.00 42.85  ? 50   GLU A CG  1 
ATOM   454  C  CD  . GLU A 1 66  ? -7.231  3.721   -33.072 1.00 60.13  ? 50   GLU A CD  1 
ATOM   455  O  OE1 . GLU A 1 66  ? -8.346  3.924   -32.531 1.00 30.98  ? 50   GLU A OE1 1 
ATOM   456  O  OE2 . GLU A 1 66  ? -7.005  3.986   -34.278 1.00 46.95  ? 50   GLU A OE2 1 
ATOM   457  N  N   . VAL A 1 67  ? -6.409  0.514   -29.653 1.00 21.53  ? 51   VAL A N   1 
ATOM   458  C  CA  . VAL A 1 67  ? -7.256  0.431   -28.468 1.00 20.73  ? 51   VAL A CA  1 
ATOM   459  C  C   . VAL A 1 67  ? -7.115  -0.942  -27.796 1.00 22.89  ? 51   VAL A C   1 
ATOM   460  O  O   . VAL A 1 67  ? -6.854  -1.951  -28.460 1.00 21.87  ? 51   VAL A O   1 
ATOM   461  C  CB  . VAL A 1 67  ? -8.758  0.808   -28.714 1.00 24.90  ? 51   VAL A CB  1 
ATOM   462  C  CG1 . VAL A 1 67  ? -8.903  2.202   -29.353 1.00 24.39  ? 51   VAL A CG1 1 
ATOM   463  C  CG2 . VAL A 1 67  ? -9.480  -0.249  -29.542 1.00 25.20  ? 51   VAL A CG2 1 
ATOM   464  N  N   . GLU A 1 68  ? -7.303  -0.965  -26.491 1.00 19.54  ? 52   GLU A N   1 
ATOM   465  C  CA  . GLU A 1 68  ? -7.336  -2.202  -25.720 1.00 18.12  ? 52   GLU A CA  1 
ATOM   466  C  C   . GLU A 1 68  ? -8.604  -2.114  -24.878 1.00 21.87  ? 52   GLU A C   1 
ATOM   467  O  O   . GLU A 1 68  ? -8.855  -1.082  -24.235 1.00 22.59  ? 52   GLU A O   1 
ATOM   468  C  CB  . GLU A 1 68  ? -6.103  -2.334  -24.824 1.00 19.85  ? 52   GLU A CB  1 
ATOM   469  C  CG  . GLU A 1 68  ? -6.090  -3.639  -24.044 1.00 24.87  ? 52   GLU A CG  1 
ATOM   470  C  CD  . GLU A 1 68  ? -5.148  -3.611  -22.861 1.00 34.25  ? 52   GLU A CD  1 
ATOM   471  O  OE1 . GLU A 1 68  ? -4.144  -4.354  -22.896 1.00 31.80  ? 52   GLU A OE1 1 
ATOM   472  O  OE2 . GLU A 1 68  ? -5.378  -2.814  -21.925 1.00 28.20  ? 52   GLU A OE2 1 
ATOM   473  N  N   . LEU A 1 69  ? -9.426  -3.157  -24.934 1.00 17.34  ? 53   LEU A N   1 
ATOM   474  C  CA  . LEU A 1 69  ? -10.643 -3.205  -24.142 1.00 17.14  ? 53   LEU A CA  1 
ATOM   475  C  C   . LEU A 1 69  ? -10.600 -4.428  -23.230 1.00 19.57  ? 53   LEU A C   1 
ATOM   476  O  O   . LEU A 1 69  ? -10.429 -5.550  -23.712 1.00 19.31  ? 53   LEU A O   1 
ATOM   477  C  CB  . LEU A 1 69  ? -11.900 -3.233  -25.034 1.00 17.35  ? 53   LEU A CB  1 
ATOM   478  C  CG  . LEU A 1 69  ? -13.263 -3.225  -24.284 1.00 22.49  ? 53   LEU A CG  1 
ATOM   479  C  CD1 . LEU A 1 69  ? -13.373 -2.068  -23.256 1.00 23.28  ? 53   LEU A CD1 1 
ATOM   480  C  CD2 . LEU A 1 69  ? -14.416 -3.221  -25.254 1.00 24.88  ? 53   LEU A CD2 1 
ATOM   481  N  N   . VAL A 1 70  ? -10.758 -4.194  -21.924 1.00 16.47  ? 54   VAL A N   1 
ATOM   482  C  CA  . VAL A 1 70  ? -10.802 -5.248  -20.904 1.00 16.02  ? 54   VAL A CA  1 
ATOM   483  C  C   . VAL A 1 70  ? -12.243 -5.277  -20.359 1.00 20.74  ? 54   VAL A C   1 
ATOM   484  O  O   . VAL A 1 70  ? -12.742 -4.248  -19.920 1.00 20.88  ? 54   VAL A O   1 
ATOM   485  C  CB  . VAL A 1 70  ? -9.761  -5.053  -19.751 1.00 19.24  ? 54   VAL A CB  1 
ATOM   486  C  CG1 . VAL A 1 70  ? -9.825  -6.214  -18.752 1.00 18.50  ? 54   VAL A CG1 1 
ATOM   487  C  CG2 . VAL A 1 70  ? -8.326  -4.872  -20.283 1.00 19.25  ? 54   VAL A CG2 1 
ATOM   488  N  N   . GLY A 1 71  ? -12.887 -6.438  -20.398 1.00 16.23  ? 55   GLY A N   1 
ATOM   489  C  CA  . GLY A 1 71  ? -14.214 -6.639  -19.825 1.00 16.05  ? 55   GLY A CA  1 
ATOM   490  C  C   . GLY A 1 71  ? -14.092 -7.570  -18.629 1.00 21.73  ? 55   GLY A C   1 
ATOM   491  O  O   . GLY A 1 71  ? -13.286 -8.514  -18.647 1.00 22.40  ? 55   GLY A O   1 
ATOM   492  N  N   . ARG A 1 72  ? -14.835 -7.290  -17.572 1.00 18.16  ? 56   ARG A N   1 
ATOM   493  C  CA  . ARG A 1 72  ? -14.765 -8.081  -16.342 1.00 19.90  ? 56   ARG A CA  1 
ATOM   494  C  C   . ARG A 1 72  ? -16.096 -8.701  -15.985 1.00 24.05  ? 56   ARG A C   1 
ATOM   495  O  O   . ARG A 1 72  ? -17.138 -8.075  -16.163 1.00 22.78  ? 56   ARG A O   1 
ATOM   496  C  CB  . ARG A 1 72  ? -14.296 -7.198  -15.167 1.00 21.20  ? 56   ARG A CB  1 
ATOM   497  C  CG  . ARG A 1 72  ? -12.812 -6.949  -15.166 1.00 24.26  ? 56   ARG A CG  1 
ATOM   498  C  CD  . ARG A 1 72  ? -12.443 -5.975  -14.047 1.00 28.95  ? 56   ARG A CD  1 
ATOM   499  N  NE  . ARG A 1 72  ? -12.888 -4.610  -14.341 1.00 29.30  ? 56   ARG A NE  1 
ATOM   500  C  CZ  . ARG A 1 72  ? -12.228 -3.755  -15.118 1.00 41.53  ? 56   ARG A CZ  1 
ATOM   501  N  NH1 . ARG A 1 72  ? -11.087 -4.117  -15.697 1.00 26.32  ? 56   ARG A NH1 1 
ATOM   502  N  NH2 . ARG A 1 72  ? -12.704 -2.532  -15.324 1.00 25.17  ? 56   ARG A NH2 1 
ATOM   503  N  N   . VAL A 1 73  ? -16.054 -9.921  -15.433 1.00 21.29  ? 57   VAL A N   1 
ATOM   504  C  CA  . VAL A 1 73  ? -17.245 -10.613 -14.948 1.00 22.29  ? 57   VAL A CA  1 
ATOM   505  C  C   . VAL A 1 73  ? -16.897 -11.428 -13.704 1.00 25.34  ? 57   VAL A C   1 
ATOM   506  O  O   . VAL A 1 73  ? -15.875 -12.132 -13.672 1.00 23.74  ? 57   VAL A O   1 
ATOM   507  C  CB  . VAL A 1 73  ? -18.016 -11.413 -16.042 1.00 26.42  ? 57   VAL A CB  1 
ATOM   508  C  CG1 . VAL A 1 73  ? -17.121 -12.419 -16.752 1.00 25.88  ? 57   VAL A CG1 1 
ATOM   509  C  CG2 . VAL A 1 73  ? -19.271 -12.087 -15.483 1.00 26.68  ? 57   VAL A CG2 1 
ATOM   510  N  N   . VAL A 1 74  ? -17.719 -11.272 -12.658 1.00 23.89  ? 58   VAL A N   1 
ATOM   511  C  CA  . VAL A 1 74  ? -17.547 -12.001 -11.403 1.00 25.92  ? 58   VAL A CA  1 
ATOM   512  C  C   . VAL A 1 74  ? -18.116 -13.405 -11.621 1.00 28.46  ? 58   VAL A C   1 
ATOM   513  O  O   . VAL A 1 74  ? -19.246 -13.550 -12.099 1.00 30.25  ? 58   VAL A O   1 
ATOM   514  C  CB  . VAL A 1 74  ? -18.199 -11.267 -10.189 1.00 31.83  ? 58   VAL A CB  1 
ATOM   515  C  CG1 . VAL A 1 74  ? -18.076 -12.095 -8.900  1.00 32.48  ? 58   VAL A CG1 1 
ATOM   516  C  CG2 . VAL A 1 74  ? -17.599 -9.876  -9.995  1.00 31.98  ? 58   VAL A CG2 1 
ATOM   517  N  N   . LEU A 1 75  ? -17.304 -14.419 -11.337 1.00 22.69  ? 59   LEU A N   1 
ATOM   518  C  CA  . LEU A 1 75  ? -17.652 -15.835 -11.440 1.00 22.50  ? 59   LEU A CA  1 
ATOM   519  C  C   . LEU A 1 75  ? -18.326 -16.282 -10.138 1.00 30.33  ? 59   LEU A C   1 
ATOM   520  O  O   . LEU A 1 75  ? -17.739 -16.167 -9.057  1.00 29.73  ? 59   LEU A O   1 
ATOM   521  C  CB  . LEU A 1 75  ? -16.402 -16.687 -11.734 1.00 21.86  ? 59   LEU A CB  1 
ATOM   522  C  CG  . LEU A 1 75  ? -15.681 -16.386 -13.076 1.00 23.88  ? 59   LEU A CG  1 
ATOM   523  C  CD1 . LEU A 1 75  ? -14.329 -17.083 -13.138 1.00 24.58  ? 59   LEU A CD1 1 
ATOM   524  C  CD2 . LEU A 1 75  ? -16.558 -16.807 -14.307 1.00 23.86  ? 59   LEU A CD2 1 
ATOM   525  N  N   . GLU A 1 76  ? -19.563 -16.774 -10.251 1.00 29.50  ? 60   GLU A N   1 
ATOM   526  C  CA  . GLU A 1 76  ? -20.376 -17.246 -9.125  1.00 31.91  ? 60   GLU A CA  1 
ATOM   527  C  C   . GLU A 1 76  ? -19.918 -18.641 -8.651  1.00 36.73  ? 60   GLU A C   1 
ATOM   528  O  O   . GLU A 1 76  ? -19.949 -18.920 -7.450  1.00 36.89  ? 60   GLU A O   1 
ATOM   529  C  CB  . GLU A 1 76  ? -21.873 -17.201 -9.523  1.00 33.85  ? 60   GLU A CB  1 
ATOM   530  C  CG  . GLU A 1 76  ? -22.817 -18.154 -8.804  1.00 52.36  ? 60   GLU A CG  1 
ATOM   531  C  CD  . GLU A 1 76  ? -24.046 -18.547 -9.605  1.00 81.04  ? 60   GLU A CD  1 
ATOM   532  O  OE1 . GLU A 1 76  ? -24.747 -17.641 -10.116 1.00 78.27  ? 60   GLU A OE1 1 
ATOM   533  O  OE2 . GLU A 1 76  ? -24.312 -19.766 -9.717  1.00 75.41  ? 60   GLU A OE2 1 
ATOM   534  N  N   . ASP A 1 77  ? -19.483 -19.496 -9.590  1.00 33.45  ? 61   ASP A N   1 
ATOM   535  C  CA  . ASP A 1 77  ? -19.055 -20.866 -9.305  1.00 34.23  ? 61   ASP A CA  1 
ATOM   536  C  C   . ASP A 1 77  ? -17.534 -20.984 -9.147  1.00 37.70  ? 61   ASP A C   1 
ATOM   537  O  O   . ASP A 1 77  ? -16.786 -20.139 -9.660  1.00 35.56  ? 61   ASP A O   1 
ATOM   538  C  CB  . ASP A 1 77  ? -19.545 -21.836 -10.406 1.00 36.27  ? 61   ASP A CB  1 
ATOM   539  C  CG  . ASP A 1 77  ? -20.982 -21.641 -10.886 1.00 49.09  ? 61   ASP A CG  1 
ATOM   540  O  OD1 . ASP A 1 77  ? -21.888 -21.555 -10.032 1.00 50.10  ? 61   ASP A OD1 1 
ATOM   541  O  OD2 . ASP A 1 77  ? -21.197 -21.598 -12.122 1.00 53.54  ? 61   ASP A OD2 1 
ATOM   542  N  N   . ALA A 1 78  ? -17.084 -22.055 -8.465  1.00 35.03  ? 62   ALA A N   1 
ATOM   543  C  CA  . ALA A 1 78  ? -15.667 -22.360 -8.261  1.00 35.45  ? 62   ALA A CA  1 
ATOM   544  C  C   . ALA A 1 78  ? -14.941 -22.397 -9.620  1.00 37.81  ? 62   ALA A C   1 
ATOM   545  O  O   . ALA A 1 78  ? -15.493 -22.873 -10.618 1.00 38.02  ? 62   ALA A O   1 
ATOM   546  C  CB  . ALA A 1 78  ? -15.513 -23.692 -7.537  1.00 37.15  ? 62   ALA A CB  1 
ATOM   547  N  N   . ALA A 1 79  ? -13.757 -21.790 -9.670  1.00 32.67  ? 63   ALA A N   1 
ATOM   548  C  CA  . ALA A 1 79  ? -12.948 -21.689 -10.880 1.00 30.61  ? 63   ALA A CA  1 
ATOM   549  C  C   . ALA A 1 79  ? -11.483 -21.990 -10.600 1.00 34.02  ? 63   ALA A C   1 
ATOM   550  O  O   . ALA A 1 79  ? -10.970 -21.643 -9.533  1.00 35.07  ? 63   ALA A O   1 
ATOM   551  C  CB  . ALA A 1 79  ? -13.079 -20.295 -11.471 1.00 30.30  ? 63   ALA A CB  1 
ATOM   552  N  N   . GLU A 1 80  ? -10.813 -22.621 -11.567 1.00 28.35  ? 64   GLU A N   1 
ATOM   553  C  CA  . GLU A 1 80  ? -9.383  -22.910 -11.511 1.00 27.67  ? 64   GLU A CA  1 
ATOM   554  C  C   . GLU A 1 80  ? -8.685  -21.728 -12.195 1.00 28.94  ? 64   GLU A C   1 
ATOM   555  O  O   . GLU A 1 80  ? -9.031  -21.413 -13.343 1.00 25.58  ? 64   GLU A O   1 
ATOM   556  C  CB  . GLU A 1 80  ? -9.056  -24.217 -12.243 1.00 29.35  ? 64   GLU A CB  1 
ATOM   557  C  CG  . GLU A 1 80  ? -8.798  -25.389 -11.311 1.00 46.17  ? 64   GLU A CG  1 
ATOM   558  C  CD  . GLU A 1 80  ? -7.396  -25.445 -10.734 1.00 68.94  ? 64   GLU A CD  1 
ATOM   559  O  OE1 . GLU A 1 80  ? -6.461  -25.841 -11.467 1.00 66.64  ? 64   GLU A OE1 1 
ATOM   560  O  OE2 . GLU A 1 80  ? -7.234  -25.106 -9.540  1.00 59.79  ? 64   GLU A OE2 1 
ATOM   561  N  N   . PRO A 1 81  ? -7.718  -21.044 -11.531 1.00 26.64  ? 65   PRO A N   1 
ATOM   562  C  CA  . PRO A 1 81  ? -7.085  -19.883 -12.182 1.00 25.33  ? 65   PRO A CA  1 
ATOM   563  C  C   . PRO A 1 81  ? -6.210  -20.268 -13.367 1.00 26.19  ? 65   PRO A C   1 
ATOM   564  O  O   . PRO A 1 81  ? -5.724  -21.398 -13.476 1.00 23.95  ? 65   PRO A O   1 
ATOM   565  C  CB  . PRO A 1 81  ? -6.281  -19.223 -11.052 1.00 28.07  ? 65   PRO A CB  1 
ATOM   566  C  CG  . PRO A 1 81  ? -5.995  -20.340 -10.102 1.00 32.81  ? 65   PRO A CG  1 
ATOM   567  C  CD  . PRO A 1 81  ? -7.181  -21.263 -10.169 1.00 28.63  ? 65   PRO A CD  1 
ATOM   568  N  N   . GLY A 1 82  ? -6.039  -19.316 -14.260 1.00 22.59  ? 66   GLY A N   1 
ATOM   569  C  CA  . GLY A 1 82  ? -5.223  -19.515 -15.443 1.00 22.14  ? 66   GLY A CA  1 
ATOM   570  C  C   . GLY A 1 82  ? -5.467  -18.459 -16.490 1.00 24.28  ? 66   GLY A C   1 
ATOM   571  O  O   . GLY A 1 82  ? -6.348  -17.610 -16.346 1.00 23.19  ? 66   GLY A O   1 
ATOM   572  N  N   . GLU A 1 83  ? -4.672  -18.505 -17.537 1.00 20.90  ? 67   GLU A N   1 
ATOM   573  C  CA  . GLU A 1 83  ? -4.764  -17.548 -18.628 1.00 22.14  ? 67   GLU A CA  1 
ATOM   574  C  C   . GLU A 1 83  ? -4.534  -18.236 -19.943 1.00 24.44  ? 67   GLU A C   1 
ATOM   575  O  O   . GLU A 1 83  ? -3.862  -19.267 -19.981 1.00 24.58  ? 67   GLU A O   1 
ATOM   576  C  CB  . GLU A 1 83  ? -3.844  -16.331 -18.426 1.00 24.64  ? 67   GLU A CB  1 
ATOM   577  C  CG  . GLU A 1 83  ? -2.446  -16.663 -17.925 1.00 39.90  ? 67   GLU A CG  1 
ATOM   578  C  CD  . GLU A 1 83  ? -1.519  -15.470 -17.786 1.00 60.15  ? 67   GLU A CD  1 
ATOM   579  O  OE1 . GLU A 1 83  ? -2.020  -14.334 -17.596 1.00 36.33  ? 67   GLU A OE1 1 
ATOM   580  O  OE2 . GLU A 1 83  ? -0.287  -15.673 -17.904 1.00 50.49  ? 67   GLU A OE2 1 
ATOM   581  N  N   . ILE A 1 84  ? -5.152  -17.718 -21.009 1.00 19.61  ? 68   ILE A N   1 
ATOM   582  C  CA  . ILE A 1 84  ? -5.086  -18.297 -22.364 1.00 19.00  ? 68   ILE A CA  1 
ATOM   583  C  C   . ILE A 1 84  ? -5.623  -17.303 -23.377 1.00 21.28  ? 68   ILE A C   1 
ATOM   584  O  O   . ILE A 1 84  ? -6.373  -16.410 -23.003 1.00 19.88  ? 68   ILE A O   1 
ATOM   585  C  CB  . ILE A 1 84  ? -5.913  -19.627 -22.431 1.00 22.65  ? 68   ILE A CB  1 
ATOM   586  C  CG1 . ILE A 1 84  ? -5.473  -20.551 -23.596 1.00 24.37  ? 68   ILE A CG1 1 
ATOM   587  C  CG2 . ILE A 1 84  ? -7.437  -19.398 -22.464 1.00 21.82  ? 68   ILE A CG2 1 
ATOM   588  C  CD1 . ILE A 1 84  ? -4.095  -21.136 -23.466 1.00 27.38  ? 68   ILE A CD1 1 
ATOM   589  N  N   . THR A 1 85  ? -5.297  -17.491 -24.659 1.00 17.81  ? 69   THR A N   1 
ATOM   590  C  CA  . THR A 1 85  ? -5.905  -16.691 -25.725 1.00 16.97  ? 69   THR A CA  1 
ATOM   591  C  C   . THR A 1 85  ? -6.586  -17.656 -26.698 1.00 20.59  ? 69   THR A C   1 
ATOM   592  O  O   . THR A 1 85  ? -6.074  -18.756 -26.953 1.00 18.79  ? 69   THR A O   1 
ATOM   593  C  CB  . THR A 1 85  ? -4.947  -15.674 -26.421 1.00 20.44  ? 69   THR A CB  1 
ATOM   594  O  OG1 . THR A 1 85  ? -4.228  -16.314 -27.476 1.00 22.75  ? 69   THR A OG1 1 
ATOM   595  C  CG2 . THR A 1 85  ? -4.013  -14.905 -25.445 1.00 18.67  ? 69   THR A CG2 1 
ATOM   596  N  N   . VAL A 1 86  ? -7.728  -17.237 -27.241 1.00 18.48  ? 70   VAL A N   1 
ATOM   597  C  CA  . VAL A 1 86  ? -8.558  -18.035 -28.141 1.00 19.25  ? 70   VAL A CA  1 
ATOM   598  C  C   . VAL A 1 86  ? -9.179  -17.120 -29.246 1.00 21.05  ? 70   VAL A C   1 
ATOM   599  O  O   . VAL A 1 86  ? -9.466  -15.954 -28.943 1.00 18.87  ? 70   VAL A O   1 
ATOM   600  C  CB  . VAL A 1 86  ? -9.620  -18.808 -27.279 1.00 23.71  ? 70   VAL A CB  1 
ATOM   601  C  CG1 . VAL A 1 86  ? -10.674 -17.889 -26.658 1.00 22.68  ? 70   VAL A CG1 1 
ATOM   602  C  CG2 . VAL A 1 86  ? -10.287 -19.927 -28.055 1.00 24.21  ? 70   VAL A CG2 1 
ATOM   603  N  N   . PRO A 1 87  ? -9.434  -17.608 -30.491 1.00 20.16  ? 71   PRO A N   1 
ATOM   604  C  CA  . PRO A 1 87  ? -10.090 -16.751 -31.508 1.00 19.58  ? 71   PRO A CA  1 
ATOM   605  C  C   . PRO A 1 87  ? -11.345 -16.056 -30.976 1.00 21.52  ? 71   PRO A C   1 
ATOM   606  O  O   . PRO A 1 87  ? -12.268 -16.714 -30.493 1.00 19.64  ? 71   PRO A O   1 
ATOM   607  C  CB  . PRO A 1 87  ? -10.407 -17.723 -32.649 1.00 21.73  ? 71   PRO A CB  1 
ATOM   608  C  CG  . PRO A 1 87  ? -9.350  -18.794 -32.524 1.00 27.47  ? 71   PRO A CG  1 
ATOM   609  C  CD  . PRO A 1 87  ? -9.151  -18.959 -31.038 1.00 22.49  ? 71   PRO A CD  1 
ATOM   610  N  N   . ALA A 1 88  ? -11.322 -14.719 -30.966 1.00 19.76  ? 72   ALA A N   1 
ATOM   611  C  CA  . ALA A 1 88  ? -12.396 -13.913 -30.393 1.00 19.16  ? 72   ALA A CA  1 
ATOM   612  C  C   . ALA A 1 88  ? -13.756 -14.107 -31.077 1.00 21.40  ? 72   ALA A C   1 
ATOM   613  O  O   . ALA A 1 88  ? -14.732 -14.405 -30.390 1.00 19.46  ? 72   ALA A O   1 
ATOM   614  C  CB  . ALA A 1 88  ? -12.002 -12.433 -30.364 1.00 20.03  ? 72   ALA A CB  1 
ATOM   615  N  N   . ARG A 1 89  ? -13.823 -13.937 -32.417 1.00 19.88  ? 73   ARG A N   1 
ATOM   616  C  CA  . ARG A 1 89  ? -15.082 -14.037 -33.168 1.00 19.93  ? 73   ARG A CA  1 
ATOM   617  C  C   . ARG A 1 89  ? -15.719 -15.430 -33.043 1.00 22.77  ? 73   ARG A C   1 
ATOM   618  O  O   . ARG A 1 89  ? -16.917 -15.509 -32.786 1.00 22.59  ? 73   ARG A O   1 
ATOM   619  C  CB  . ARG A 1 89  ? -14.894 -13.595 -34.641 1.00 22.55  ? 73   ARG A CB  1 
ATOM   620  C  CG  . ARG A 1 89  ? -16.157 -13.658 -35.507 1.00 38.53  ? 73   ARG A CG  1 
ATOM   621  C  CD  . ARG A 1 89  ? -17.137 -12.521 -35.241 1.00 58.76  ? 73   ARG A CD  1 
ATOM   622  N  NE  . ARG A 1 89  ? -18.375 -12.679 -36.010 1.00 73.98  ? 73   ARG A NE  1 
ATOM   623  C  CZ  . ARG A 1 89  ? -19.292 -11.727 -36.171 1.00 89.58  ? 73   ARG A CZ  1 
ATOM   624  N  NH1 . ARG A 1 89  ? -19.120 -10.529 -35.623 1.00 77.86  ? 73   ARG A NH1 1 
ATOM   625  N  NH2 . ARG A 1 89  ? -20.384 -11.964 -36.886 1.00 74.71  ? 73   ARG A NH2 1 
ATOM   626  N  N   . LYS A 1 90  ? -14.911 -16.500 -33.178 1.00 19.42  ? 74   LYS A N   1 
ATOM   627  C  CA  . LYS A 1 90  ? -15.352 -17.908 -33.028 1.00 19.56  ? 74   LYS A CA  1 
ATOM   628  C  C   . LYS A 1 90  ? -15.934 -18.118 -31.622 1.00 22.34  ? 74   LYS A C   1 
ATOM   629  O  O   . LYS A 1 90  ? -17.067 -18.595 -31.507 1.00 19.45  ? 74   LYS A O   1 
ATOM   630  C  CB  . LYS A 1 90  ? -14.201 -18.891 -33.300 1.00 22.44  ? 74   LYS A CB  1 
ATOM   631  C  CG  . LYS A 1 90  ? -13.973 -19.140 -34.788 1.00 25.23  ? 74   LYS A CG  1 
ATOM   632  C  CD  . LYS A 1 90  ? -12.640 -19.791 -34.983 1.00 29.77  ? 74   LYS A CD  1 
ATOM   633  C  CE  . LYS A 1 90  ? -12.281 -19.931 -36.429 1.00 34.14  ? 74   LYS A CE  1 
ATOM   634  N  NZ  . LYS A 1 90  ? -10.891 -20.414 -36.560 1.00 29.25  ? 74   LYS A NZ  1 
ATOM   635  N  N   . LEU A 1 91  ? -15.222 -17.665 -30.563 1.00 19.98  ? 75   LEU A N   1 
ATOM   636  C  CA  . LEU A 1 91  ? -15.773 -17.820 -29.207 1.00 19.25  ? 75   LEU A CA  1 
ATOM   637  C  C   . LEU A 1 91  ? -17.117 -17.058 -29.055 1.00 21.82  ? 75   LEU A C   1 
ATOM   638  O  O   . LEU A 1 91  ? -18.079 -17.609 -28.504 1.00 20.71  ? 75   LEU A O   1 
ATOM   639  C  CB  . LEU A 1 91  ? -14.783 -17.402 -28.108 1.00 19.11  ? 75   LEU A CB  1 
ATOM   640  C  CG  . LEU A 1 91  ? -15.255 -17.703 -26.661 1.00 22.60  ? 75   LEU A CG  1 
ATOM   641  C  CD1 . LEU A 1 91  ? -15.479 -19.215 -26.434 1.00 22.23  ? 75   LEU A CD1 1 
ATOM   642  C  CD2 . LEU A 1 91  ? -14.301 -17.112 -25.620 1.00 23.92  ? 75   LEU A CD2 1 
ATOM   643  N  N   . MET A 1 92  ? -17.162 -15.804 -29.543 1.00 20.12  ? 76   MET A N   1 
ATOM   644  C  CA  . MET A 1 92  ? -18.376 -14.989 -29.468 1.00 20.06  ? 76   MET A CA  1 
ATOM   645  C  C   . MET A 1 92  ? -19.542 -15.651 -30.209 1.00 21.30  ? 76   MET A C   1 
ATOM   646  O  O   . MET A 1 92  ? -20.621 -15.801 -29.618 1.00 20.47  ? 76   MET A O   1 
ATOM   647  C  CB  . MET A 1 92  ? -18.145 -13.563 -29.986 1.00 22.11  ? 76   MET A CB  1 
ATOM   648  C  CG  . MET A 1 92  ? -19.379 -12.678 -29.786 1.00 26.29  ? 76   MET A CG  1 
ATOM   649  S  SD  . MET A 1 92  ? -19.166 -11.146 -30.669 1.00 31.56  ? 76   MET A SD  1 
ATOM   650  N  N   . ASP A 1 93  ? -19.306 -16.071 -31.479 1.00 19.10  ? 77   ASP A N   1 
ATOM   651  C  CA  . ASP A 1 93  ? -20.313 -16.721 -32.330 1.00 19.97  ? 77   ASP A CA  1 
ATOM   652  C  C   . ASP A 1 93  ? -20.849 -17.991 -31.697 1.00 22.04  ? 77   ASP A C   1 
ATOM   653  O  O   . ASP A 1 93  ? -22.060 -18.188 -31.708 1.00 21.35  ? 77   ASP A O   1 
ATOM   654  C  CB  . ASP A 1 93  ? -19.799 -16.970 -33.761 1.00 22.03  ? 77   ASP A CB  1 
ATOM   655  C  CG  . ASP A 1 93  ? -19.650 -15.702 -34.596 1.00 28.50  ? 77   ASP A CG  1 
ATOM   656  O  OD1 . ASP A 1 93  ? -20.130 -14.630 -34.149 1.00 27.14  ? 77   ASP A OD1 1 
ATOM   657  O  OD2 . ASP A 1 93  ? -19.039 -15.779 -35.686 1.00 28.76  ? 77   ASP A OD2 1 
ATOM   658  N  N   . ILE A 1 94  ? -19.959 -18.805 -31.083 1.00 19.09  ? 78   ILE A N   1 
ATOM   659  C  CA  . ILE A 1 94  ? -20.359 -20.019 -30.359 1.00 19.63  ? 78   ILE A CA  1 
ATOM   660  C  C   . ILE A 1 94  ? -21.295 -19.644 -29.182 1.00 21.68  ? 78   ILE A C   1 
ATOM   661  O  O   . ILE A 1 94  ? -22.405 -20.167 -29.103 1.00 22.33  ? 78   ILE A O   1 
ATOM   662  C  CB  . ILE A 1 94  ? -19.110 -20.830 -29.894 1.00 22.20  ? 78   ILE A CB  1 
ATOM   663  C  CG1 . ILE A 1 94  ? -18.410 -21.505 -31.115 1.00 22.68  ? 78   ILE A CG1 1 
ATOM   664  C  CG2 . ILE A 1 94  ? -19.501 -21.880 -28.823 1.00 24.44  ? 78   ILE A CG2 1 
ATOM   665  C  CD1 . ILE A 1 94  ? -16.911 -21.928 -30.844 1.00 25.13  ? 78   ILE A CD1 1 
ATOM   666  N  N   . CYS A 1 95  ? -20.829 -18.747 -28.281 1.00 19.61  ? 79   CYS A N   1 
ATOM   667  C  CA  A CYS A 1 95  ? -21.574 -18.262 -27.104 0.50 18.94  ? 79   CYS A CA  1 
ATOM   668  C  CA  B CYS A 1 95  ? -21.623 -18.368 -27.129 0.50 20.92  ? 79   CYS A CA  1 
ATOM   669  C  C   . CYS A 1 95  ? -22.978 -17.751 -27.488 1.00 23.38  ? 79   CYS A C   1 
ATOM   670  O  O   . CYS A 1 95  ? -23.981 -18.160 -26.897 1.00 22.74  ? 79   CYS A O   1 
ATOM   671  C  CB  A CYS A 1 95  ? -20.779 -17.185 -26.362 0.50 17.96  ? 79   CYS A CB  1 
ATOM   672  C  CB  B CYS A 1 95  ? -20.811 -17.509 -26.172 0.50 21.94  ? 79   CYS A CB  1 
ATOM   673  S  SG  A CYS A 1 95  ? -21.538 -16.638 -24.804 0.50 21.37  ? 79   CYS A SG  1 
ATOM   674  S  SG  B CYS A 1 95  ? -19.337 -18.352 -25.544 0.50 26.47  ? 79   CYS A SG  1 
ATOM   675  N  N   . LYS A 1 96  ? -23.026 -16.859 -28.493 1.00 21.22  ? 80   LYS A N   1 
ATOM   676  C  CA  . LYS A 1 96  ? -24.258 -16.222 -28.994 1.00 22.74  ? 80   LYS A CA  1 
ATOM   677  C  C   . LYS A 1 96  ? -25.252 -17.297 -29.508 1.00 26.52  ? 80   LYS A C   1 
ATOM   678  O  O   . LYS A 1 96  ? -26.455 -17.250 -29.203 1.00 25.13  ? 80   LYS A O   1 
ATOM   679  C  CB  . LYS A 1 96  ? -23.896 -15.233 -30.130 1.00 24.39  ? 80   LYS A CB  1 
ATOM   680  C  CG  . LYS A 1 96  ? -25.028 -14.298 -30.537 1.00 51.17  ? 80   LYS A CG  1 
ATOM   681  C  CD  . LYS A 1 96  ? -24.525 -13.177 -31.438 1.00 65.45  ? 80   LYS A CD  1 
ATOM   682  C  CE  . LYS A 1 96  ? -25.642 -12.268 -31.908 1.00 81.61  ? 80   LYS A CE  1 
ATOM   683  N  NZ  . LYS A 1 96  ? -26.414 -12.859 -33.037 1.00 92.26  ? 80   LYS A NZ  1 
ATOM   684  N  N   . SER A 1 97  ? -24.723 -18.290 -30.237 1.00 23.60  ? 81   SER A N   1 
ATOM   685  C  CA  . SER A 1 97  ? -25.499 -19.380 -30.827 1.00 23.46  ? 81   SER A CA  1 
ATOM   686  C  C   . SER A 1 97  ? -26.067 -20.380 -29.810 1.00 27.84  ? 81   SER A C   1 
ATOM   687  O  O   . SER A 1 97  ? -27.005 -21.107 -30.144 1.00 27.70  ? 81   SER A O   1 
ATOM   688  C  CB  . SER A 1 97  ? -24.642 -20.124 -31.848 1.00 25.44  ? 81   SER A CB  1 
ATOM   689  O  OG  . SER A 1 97  ? -23.700 -20.958 -31.185 1.00 28.31  ? 81   SER A OG  1 
ATOM   690  N  N   . LEU A 1 98  ? -25.472 -20.463 -28.598 1.00 23.45  ? 82   LEU A N   1 
ATOM   691  C  CA  . LEU A 1 98  ? -25.922 -21.436 -27.596 1.00 23.82  ? 82   LEU A CA  1 
ATOM   692  C  C   . LEU A 1 98  ? -27.329 -21.114 -27.063 1.00 27.37  ? 82   LEU A C   1 
ATOM   693  O  O   . LEU A 1 98  ? -27.722 -19.942 -27.131 1.00 25.81  ? 82   LEU A O   1 
ATOM   694  C  CB  . LEU A 1 98  ? -24.890 -21.670 -26.471 1.00 23.07  ? 82   LEU A CB  1 
ATOM   695  C  CG  . LEU A 1 98  ? -23.603 -22.400 -26.860 1.00 27.03  ? 82   LEU A CG  1 
ATOM   696  C  CD1 . LEU A 1 98  ? -22.534 -22.186 -25.819 1.00 26.32  ? 82   LEU A CD1 1 
ATOM   697  C  CD2 . LEU A 1 98  ? -23.828 -23.902 -27.104 1.00 30.36  ? 82   LEU A CD2 1 
ATOM   698  N  N   . PRO A 1 99  ? -28.127 -22.121 -26.606 1.00 26.15  ? 83   PRO A N   1 
ATOM   699  C  CA  . PRO A 1 99  ? -29.494 -21.804 -26.144 1.00 27.26  ? 83   PRO A CA  1 
ATOM   700  C  C   . PRO A 1 99  ? -29.484 -20.863 -24.954 1.00 31.91  ? 83   PRO A C   1 
ATOM   701  O  O   . PRO A 1 99  ? -28.562 -20.913 -24.133 1.00 30.36  ? 83   PRO A O   1 
ATOM   702  C  CB  . PRO A 1 99  ? -30.092 -23.166 -25.763 1.00 29.85  ? 83   PRO A CB  1 
ATOM   703  C  CG  . PRO A 1 99  ? -29.177 -24.191 -26.318 1.00 33.70  ? 83   PRO A CG  1 
ATOM   704  C  CD  . PRO A 1 99  ? -27.833 -23.565 -26.483 1.00 28.09  ? 83   PRO A CD  1 
ATOM   705  N  N   . ASN A 1 100 ? -30.501 -19.999 -24.871 1.00 29.40  ? 84   ASN A N   1 
ATOM   706  C  CA  . ASN A 1 100 ? -30.649 -19.022 -23.792 1.00 28.67  ? 84   ASN A CA  1 
ATOM   707  C  C   . ASN A 1 100 ? -30.539 -19.664 -22.415 1.00 29.34  ? 84   ASN A C   1 
ATOM   708  O  O   . ASN A 1 100 ? -30.923 -20.825 -22.234 1.00 27.46  ? 84   ASN A O   1 
ATOM   709  C  CB  . ASN A 1 100 ? -31.961 -18.244 -23.935 1.00 33.71  ? 84   ASN A CB  1 
ATOM   710  C  CG  . ASN A 1 100 ? -32.064 -17.463 -25.218 1.00 58.62  ? 84   ASN A CG  1 
ATOM   711  O  OD1 . ASN A 1 100 ? -31.146 -16.731 -25.618 1.00 52.81  ? 84   ASN A OD1 1 
ATOM   712  N  ND2 . ASN A 1 100 ? -33.194 -17.598 -25.887 1.00 52.26  ? 84   ASN A ND2 1 
ATOM   713  N  N   . ASP A 1 101 ? -29.915 -18.932 -21.470 1.00 27.43  ? 85   ASP A N   1 
ATOM   714  C  CA  . ASP A 1 101 ? -29.689 -19.333 -20.070 1.00 28.94  ? 85   ASP A CA  1 
ATOM   715  C  C   . ASP A 1 101 ? -28.796 -20.565 -19.812 1.00 32.58  ? 85   ASP A C   1 
ATOM   716  O  O   . ASP A 1 101 ? -28.667 -20.968 -18.651 1.00 33.79  ? 85   ASP A O   1 
ATOM   717  C  CB  . ASP A 1 101 ? -31.027 -19.451 -19.297 1.00 32.53  ? 85   ASP A CB  1 
ATOM   718  C  CG  . ASP A 1 101 ? -32.008 -18.336 -19.568 1.00 46.59  ? 85   ASP A CG  1 
ATOM   719  O  OD1 . ASP A 1 101 ? -31.612 -17.151 -19.447 1.00 46.58  ? 85   ASP A OD1 1 
ATOM   720  O  OD2 . ASP A 1 101 ? -33.173 -18.643 -19.910 1.00 59.79  ? 85   ASP A OD2 1 
ATOM   721  N  N   . VAL A 1 102 ? -28.172 -21.161 -20.861 1.00 27.17  ? 86   VAL A N   1 
ATOM   722  C  CA  . VAL A 1 102 ? -27.338 -22.353 -20.695 1.00 25.99  ? 86   VAL A CA  1 
ATOM   723  C  C   . VAL A 1 102 ? -26.046 -22.082 -19.892 1.00 28.53  ? 86   VAL A C   1 
ATOM   724  O  O   . VAL A 1 102 ? -25.471 -21.000 -19.991 1.00 27.21  ? 86   VAL A O   1 
ATOM   725  C  CB  . VAL A 1 102 ? -27.066 -23.098 -22.041 1.00 28.96  ? 86   VAL A CB  1 
ATOM   726  C  CG1 . VAL A 1 102 ? -25.921 -22.455 -22.837 1.00 27.05  ? 86   VAL A CG1 1 
ATOM   727  C  CG2 . VAL A 1 102 ? -26.813 -24.593 -21.813 1.00 29.17  ? 86   VAL A CG2 1 
ATOM   728  N  N   . LEU A 1 103 ? -25.632 -23.059 -19.087 1.00 26.93  ? 87   LEU A N   1 
ATOM   729  C  CA  . LEU A 1 103 ? -24.391 -23.003 -18.334 1.00 27.06  ? 87   LEU A CA  1 
ATOM   730  C  C   . LEU A 1 103 ? -23.266 -23.470 -19.269 1.00 29.89  ? 87   LEU A C   1 
ATOM   731  O  O   . LEU A 1 103 ? -23.355 -24.549 -19.857 1.00 30.28  ? 87   LEU A O   1 
ATOM   732  C  CB  . LEU A 1 103 ? -24.465 -23.887 -17.072 1.00 28.13  ? 87   LEU A CB  1 
ATOM   733  C  CG  . LEU A 1 103 ? -23.264 -23.801 -16.113 1.00 33.61  ? 87   LEU A CG  1 
ATOM   734  C  CD1 . LEU A 1 103 ? -23.088 -22.376 -15.548 1.00 33.97  ? 87   LEU A CD1 1 
ATOM   735  C  CD2 . LEU A 1 103 ? -23.425 -24.778 -14.950 1.00 38.18  ? 87   LEU A CD2 1 
ATOM   736  N  N   . ILE A 1 104 ? -22.240 -22.628 -19.447 1.00 25.11  ? 88   ILE A N   1 
ATOM   737  C  CA  . ILE A 1 104 ? -21.117 -22.940 -20.330 1.00 23.17  ? 88   ILE A CA  1 
ATOM   738  C  C   . ILE A 1 104 ? -19.902 -23.356 -19.504 1.00 25.76  ? 88   ILE A C   1 
ATOM   739  O  O   . ILE A 1 104 ? -19.509 -22.635 -18.575 1.00 24.88  ? 88   ILE A O   1 
ATOM   740  C  CB  . ILE A 1 104 ? -20.782 -21.769 -21.301 1.00 24.24  ? 88   ILE A CB  1 
ATOM   741  C  CG1 . ILE A 1 104 ? -22.032 -21.281 -22.101 1.00 23.96  ? 88   ILE A CG1 1 
ATOM   742  C  CG2 . ILE A 1 104 ? -19.618 -22.153 -22.252 1.00 22.07  ? 88   ILE A CG2 1 
ATOM   743  C  CD1 . ILE A 1 104 ? -21.772 -19.956 -22.983 1.00 23.89  ? 88   ILE A CD1 1 
ATOM   744  N  N   . ASP A 1 105 ? -19.307 -24.502 -19.846 1.00 21.71  ? 89   ASP A N   1 
ATOM   745  C  CA  . ASP A 1 105 ? -18.090 -24.988 -19.188 1.00 21.80  ? 89   ASP A CA  1 
ATOM   746  C  C   . ASP A 1 105 ? -16.906 -24.711 -20.112 1.00 25.44  ? 89   ASP A C   1 
ATOM   747  O  O   . ASP A 1 105 ? -16.885 -25.150 -21.269 1.00 24.24  ? 89   ASP A O   1 
ATOM   748  C  CB  . ASP A 1 105 ? -18.181 -26.478 -18.813 1.00 23.52  ? 89   ASP A CB  1 
ATOM   749  C  CG  . ASP A 1 105 ? -17.018 -26.944 -17.955 1.00 27.80  ? 89   ASP A CG  1 
ATOM   750  O  OD1 . ASP A 1 105 ? -15.938 -27.185 -18.507 1.00 29.61  ? 89   ASP A OD1 1 
ATOM   751  O  OD2 . ASP A 1 105 ? -17.199 -27.075 -16.731 1.00 31.79  ? 89   ASP A OD2 1 
ATOM   752  N  N   . ILE A 1 106 ? -15.930 -23.946 -19.605 1.00 20.91  ? 90   ILE A N   1 
ATOM   753  C  CA  . ILE A 1 106 ? -14.748 -23.566 -20.386 1.00 19.45  ? 90   ILE A CA  1 
ATOM   754  C  C   . ILE A 1 106 ? -13.484 -24.002 -19.693 1.00 22.90  ? 90   ILE A C   1 
ATOM   755  O  O   . ILE A 1 106 ? -13.246 -23.621 -18.541 1.00 21.15  ? 90   ILE A O   1 
ATOM   756  C  CB  . ILE A 1 106 ? -14.767 -22.047 -20.732 1.00 21.76  ? 90   ILE A CB  1 
ATOM   757  C  CG1 . ILE A 1 106 ? -15.934 -21.741 -21.723 1.00 22.83  ? 90   ILE A CG1 1 
ATOM   758  C  CG2 . ILE A 1 106 ? -13.403 -21.592 -21.318 1.00 21.89  ? 90   ILE A CG2 1 
ATOM   759  C  CD1 . ILE A 1 106 ? -16.262 -20.298 -21.921 1.00 25.08  ? 90   ILE A CD1 1 
ATOM   760  N  N   . ARG A 1 107 ? -12.686 -24.841 -20.371 1.00 21.03  ? 91   ARG A N   1 
ATOM   761  C  CA  . ARG A 1 107 ? -11.436 -25.292 -19.771 1.00 22.62  ? 91   ARG A CA  1 
ATOM   762  C  C   . ARG A 1 107 ? -10.324 -25.436 -20.782 1.00 25.47  ? 91   ARG A C   1 
ATOM   763  O  O   . ARG A 1 107 ? -10.573 -25.790 -21.947 1.00 24.34  ? 91   ARG A O   1 
ATOM   764  C  CB  . ARG A 1 107 ? -11.613 -26.601 -18.951 1.00 26.64  ? 91   ARG A CB  1 
ATOM   765  C  CG  . ARG A 1 107 ? -11.841 -27.878 -19.758 1.00 43.40  ? 91   ARG A CG  1 
ATOM   766  C  CD  . ARG A 1 107 ? -12.185 -29.055 -18.859 1.00 59.16  ? 91   ARG A CD  1 
ATOM   767  N  NE  . ARG A 1 107 ? -13.584 -29.019 -18.419 1.00 69.65  ? 91   ARG A NE  1 
ATOM   768  C  CZ  . ARG A 1 107 ? -14.105 -29.818 -17.492 1.00 84.67  ? 91   ARG A CZ  1 
ATOM   769  N  NH1 . ARG A 1 107 ? -13.351 -30.733 -16.894 1.00 78.33  ? 91   ARG A NH1 1 
ATOM   770  N  NH2 . ARG A 1 107 ? -15.382 -29.707 -17.155 1.00 68.48  ? 91   ARG A NH2 1 
ATOM   771  N  N   . VAL A 1 108 ? -9.091  -25.182 -20.331 1.00 21.96  ? 92   VAL A N   1 
ATOM   772  C  CA  . VAL A 1 108 ? -7.920  -25.406 -21.179 1.00 22.14  ? 92   VAL A CA  1 
ATOM   773  C  C   . VAL A 1 108 ? -7.512  -26.855 -20.931 1.00 28.44  ? 92   VAL A C   1 
ATOM   774  O  O   . VAL A 1 108 ? -7.400  -27.275 -19.773 1.00 28.22  ? 92   VAL A O   1 
ATOM   775  C  CB  . VAL A 1 108 ? -6.740  -24.433 -20.947 1.00 25.89  ? 92   VAL A CB  1 
ATOM   776  C  CG1 . VAL A 1 108 ? -5.611  -24.721 -21.942 1.00 26.82  ? 92   VAL A CG1 1 
ATOM   777  C  CG2 . VAL A 1 108 ? -7.191  -22.974 -21.075 1.00 24.63  ? 92   VAL A CG2 1 
ATOM   778  N  N   . GLU A 1 109 ? -7.342  -27.615 -22.011 1.00 26.92  ? 93   GLU A N   1 
ATOM   779  C  CA  . GLU A 1 109 ? -6.901  -29.012 -21.973 1.00 29.06  ? 93   GLU A CA  1 
ATOM   780  C  C   . GLU A 1 109 ? -5.756  -29.077 -22.973 1.00 33.24  ? 93   GLU A C   1 
ATOM   781  O  O   . GLU A 1 109 ? -5.994  -29.015 -24.184 1.00 31.31  ? 93   GLU A O   1 
ATOM   782  C  CB  . GLU A 1 109 ? -8.041  -29.987 -22.341 1.00 31.01  ? 93   GLU A CB  1 
ATOM   783  C  CG  . GLU A 1 109 ? -9.140  -30.098 -21.291 1.00 47.32  ? 93   GLU A CG  1 
ATOM   784  C  CD  . GLU A 1 109 ? -9.381  -31.462 -20.663 1.00 77.05  ? 93   GLU A CD  1 
ATOM   785  O  OE1 . GLU A 1 109 ? -8.988  -32.491 -21.262 1.00 73.91  ? 93   GLU A OE1 1 
ATOM   786  O  OE2 . GLU A 1 109 ? -9.999  -31.497 -19.573 1.00 69.41  ? 93   GLU A OE2 1 
ATOM   787  N  N   . GLU A 1 110 ? -4.507  -29.067 -22.459 1.00 32.11  ? 94   GLU A N   1 
ATOM   788  C  CA  . GLU A 1 110 ? -3.293  -29.054 -23.290 1.00 32.54  ? 94   GLU A CA  1 
ATOM   789  C  C   . GLU A 1 110 ? -3.198  -27.699 -23.996 1.00 33.50  ? 94   GLU A C   1 
ATOM   790  O  O   . GLU A 1 110 ? -3.100  -26.674 -23.328 1.00 33.32  ? 94   GLU A O   1 
ATOM   791  N  N   . GLN A 1 111 ? -3.290  -27.691 -25.339 1.00 27.54  ? 95   GLN A N   1 
ATOM   792  C  CA  . GLN A 1 111 ? -3.245  -26.458 -26.131 1.00 25.41  ? 95   GLN A CA  1 
ATOM   793  C  C   . GLN A 1 111 ? -4.598  -26.120 -26.763 1.00 27.17  ? 95   GLN A C   1 
ATOM   794  O  O   . GLN A 1 111 ? -4.658  -25.336 -27.712 1.00 25.70  ? 95   GLN A O   1 
ATOM   795  C  CB  . GLN A 1 111 ? -2.172  -26.547 -27.214 1.00 26.33  ? 95   GLN A CB  1 
ATOM   796  C  CG  . GLN A 1 111 ? -0.782  -26.779 -26.665 1.00 27.27  ? 95   GLN A CG  1 
ATOM   797  C  CD  . GLN A 1 111 ? 0.182   -26.924 -27.805 1.00 36.41  ? 95   GLN A CD  1 
ATOM   798  O  OE1 . GLN A 1 111 ? 0.116   -27.885 -28.565 1.00 32.03  ? 95   GLN A OE1 1 
ATOM   799  N  NE2 . GLN A 1 111 ? 1.069   -25.962 -27.969 1.00 27.39  ? 95   GLN A NE2 1 
ATOM   800  N  N   . LYS A 1 112 ? -5.672  -26.739 -26.268 1.00 23.31  ? 96   LYS A N   1 
ATOM   801  C  CA  . LYS A 1 112 ? -6.999  -26.462 -26.811 1.00 23.26  ? 96   LYS A CA  1 
ATOM   802  C  C   . LYS A 1 112 ? -7.883  -25.823 -25.760 1.00 25.16  ? 96   LYS A C   1 
ATOM   803  O  O   . LYS A 1 112 ? -7.710  -26.053 -24.552 1.00 24.20  ? 96   LYS A O   1 
ATOM   804  C  CB  . LYS A 1 112 ? -7.672  -27.762 -27.333 1.00 25.82  ? 96   LYS A CB  1 
ATOM   805  C  CG  . LYS A 1 112 ? -6.896  -28.503 -28.436 1.00 40.68  ? 96   LYS A CG  1 
ATOM   806  C  CD  . LYS A 1 112 ? -6.818  -27.731 -29.769 1.00 51.29  ? 96   LYS A CD  1 
ATOM   807  C  CE  . LYS A 1 112 ? -5.995  -28.455 -30.813 1.00 64.71  ? 96   LYS A CE  1 
ATOM   808  N  NZ  . LYS A 1 112 ? -6.695  -29.651 -31.362 1.00 73.61  ? 96   LYS A NZ  1 
ATOM   809  N  N   . LEU A 1 113 ? -8.847  -25.043 -26.223 1.00 21.60  ? 97   LEU A N   1 
ATOM   810  C  CA  . LEU A 1 113 ? -9.858  -24.515 -25.325 1.00 20.60  ? 97   LEU A CA  1 
ATOM   811  C  C   . LEU A 1 113 ? -11.106 -25.360 -25.567 1.00 24.00  ? 97   LEU A C   1 
ATOM   812  O  O   . LEU A 1 113 ? -11.634 -25.381 -26.685 1.00 24.16  ? 97   LEU A O   1 
ATOM   813  C  CB  . LEU A 1 113 ? -10.144 -23.015 -25.527 1.00 19.97  ? 97   LEU A CB  1 
ATOM   814  C  CG  . LEU A 1 113 ? -11.057 -22.460 -24.431 1.00 24.26  ? 97   LEU A CG  1 
ATOM   815  C  CD1 . LEU A 1 113 ? -10.267 -22.144 -23.140 1.00 23.61  ? 97   LEU A CD1 1 
ATOM   816  C  CD2 . LEU A 1 113 ? -11.895 -21.286 -24.932 1.00 27.97  ? 97   LEU A CD2 1 
ATOM   817  N  N   . LEU A 1 114 ? -11.526 -26.098 -24.543 1.00 20.92  ? 98   LEU A N   1 
ATOM   818  C  CA  . LEU A 1 114 ? -12.715 -26.953 -24.585 1.00 22.73  ? 98   LEU A CA  1 
ATOM   819  C  C   . LEU A 1 114 ? -13.898 -26.187 -24.061 1.00 25.20  ? 98   LEU A C   1 
ATOM   820  O  O   . LEU A 1 114 ? -13.901 -25.766 -22.899 1.00 23.32  ? 98   LEU A O   1 
ATOM   821  C  CB  . LEU A 1 114 ? -12.505 -28.215 -23.732 1.00 25.02  ? 98   LEU A CB  1 
ATOM   822  C  CG  . LEU A 1 114 ? -12.090 -29.510 -24.435 1.00 33.88  ? 98   LEU A CG  1 
ATOM   823  C  CD1 . LEU A 1 114 ? -10.706 -29.418 -25.055 1.00 34.66  ? 98   LEU A CD1 1 
ATOM   824  C  CD2 . LEU A 1 114 ? -12.144 -30.677 -23.459 1.00 39.15  ? 98   LEU A CD2 1 
ATOM   825  N  N   . VAL A 1 115 ? -14.892 -25.981 -24.923 1.00 21.97  ? 99   VAL A N   1 
ATOM   826  C  CA  . VAL A 1 115 ? -16.150 -25.296 -24.599 1.00 22.08  ? 99   VAL A CA  1 
ATOM   827  C  C   . VAL A 1 115 ? -17.269 -26.382 -24.611 1.00 27.11  ? 99   VAL A C   1 
ATOM   828  O  O   . VAL A 1 115 ? -17.430 -27.096 -25.610 1.00 27.68  ? 99   VAL A O   1 
ATOM   829  C  CB  . VAL A 1 115 ? -16.426 -24.126 -25.587 1.00 25.29  ? 99   VAL A CB  1 
ATOM   830  C  CG1 . VAL A 1 115 ? -17.752 -23.421 -25.272 1.00 24.64  ? 99   VAL A CG1 1 
ATOM   831  C  CG2 . VAL A 1 115 ? -15.266 -23.115 -25.615 1.00 24.97  ? 99   VAL A CG2 1 
ATOM   832  N  N   . LYS A 1 116 ? -18.006 -26.528 -23.487 1.00 23.22  ? 100  LYS A N   1 
ATOM   833  C  CA  . LYS A 1 116 ? -19.092 -27.521 -23.351 1.00 23.03  ? 100  LYS A CA  1 
ATOM   834  C  C   . LYS A 1 116 ? -20.319 -26.855 -22.779 1.00 26.82  ? 100  LYS A C   1 
ATOM   835  O  O   . LYS A 1 116 ? -20.209 -26.097 -21.812 1.00 24.36  ? 100  LYS A O   1 
ATOM   836  C  CB  . LYS A 1 116 ? -18.691 -28.687 -22.436 1.00 25.14  ? 100  LYS A CB  1 
ATOM   837  C  CG  . LYS A 1 116 ? -17.662 -29.646 -23.030 1.00 48.24  ? 100  LYS A CG  1 
ATOM   838  C  CD  . LYS A 1 116 ? -17.539 -30.954 -22.237 1.00 65.91  ? 100  LYS A CD  1 
ATOM   839  C  CE  . LYS A 1 116 ? -16.687 -30.859 -20.985 1.00 81.76  ? 100  LYS A CE  1 
ATOM   840  N  NZ  . LYS A 1 116 ? -17.482 -30.455 -19.790 1.00 90.38  ? 100  LYS A NZ  1 
ATOM   841  N  N   . ALA A 1 117 ? -21.486 -27.102 -23.400 1.00 24.45  ? 101  ALA A N   1 
ATOM   842  C  CA  . ALA A 1 117 ? -22.788 -26.568 -22.964 1.00 24.65  ? 101  ALA A CA  1 
ATOM   843  C  C   . ALA A 1 117 ? -23.841 -27.591 -23.392 1.00 29.92  ? 101  ALA A C   1 
ATOM   844  O  O   . ALA A 1 117 ? -24.015 -27.836 -24.590 1.00 28.68  ? 101  ALA A O   1 
ATOM   845  C  CB  . ALA A 1 117 ? -23.059 -25.208 -23.606 1.00 24.53  ? 101  ALA A CB  1 
ATOM   846  N  N   . GLY A 1 118 ? -24.444 -28.252 -22.414 1.00 28.59  ? 102  GLY A N   1 
ATOM   847  C  CA  . GLY A 1 118 ? -25.398 -29.326 -22.674 1.00 29.97  ? 102  GLY A CA  1 
ATOM   848  C  C   . GLY A 1 118 ? -24.705 -30.447 -23.426 1.00 33.91  ? 102  GLY A C   1 
ATOM   849  O  O   . GLY A 1 118 ? -23.652 -30.920 -22.994 1.00 34.05  ? 102  GLY A O   1 
ATOM   850  N  N   . ARG A 1 119 ? -25.237 -30.806 -24.607 1.00 31.87  ? 103  ARG A N   1 
ATOM   851  C  CA  . ARG A 1 119 ? -24.673 -31.868 -25.449 1.00 31.88  ? 103  ARG A CA  1 
ATOM   852  C  C   . ARG A 1 119 ? -23.877 -31.274 -26.641 1.00 33.79  ? 103  ARG A C   1 
ATOM   853  O  O   . ARG A 1 119 ? -23.668 -31.950 -27.663 1.00 33.34  ? 103  ARG A O   1 
ATOM   854  C  CB  . ARG A 1 119 ? -25.776 -32.849 -25.905 1.00 35.10  ? 103  ARG A CB  1 
ATOM   855  C  CG  . ARG A 1 119 ? -26.296 -33.756 -24.779 1.00 45.49  ? 103  ARG A CG  1 
ATOM   856  N  N   . SER A 1 120 ? -23.449 -30.000 -26.499 1.00 27.33  ? 104  SER A N   1 
ATOM   857  C  CA  . SER A 1 120 ? -22.632 -29.306 -27.490 1.00 27.00  ? 104  SER A CA  1 
ATOM   858  C  C   . SER A 1 120 ? -21.197 -29.303 -26.983 1.00 28.90  ? 104  SER A C   1 
ATOM   859  O  O   . SER A 1 120 ? -20.959 -29.085 -25.787 1.00 27.64  ? 104  SER A O   1 
ATOM   860  C  CB  . SER A 1 120 ? -23.108 -27.872 -27.706 1.00 30.25  ? 104  SER A CB  1 
ATOM   861  O  OG  . SER A 1 120 ? -24.503 -27.817 -27.954 1.00 42.81  ? 104  SER A OG  1 
ATOM   862  N  N   . ARG A 1 121 ? -20.247 -29.573 -27.876 1.00 25.04  ? 105  ARG A N   1 
ATOM   863  C  CA  . ARG A 1 121 ? -18.806 -29.588 -27.555 1.00 24.21  ? 105  ARG A CA  1 
ATOM   864  C  C   . ARG A 1 121 ? -18.029 -28.868 -28.639 1.00 26.47  ? 105  ARG A C   1 
ATOM   865  O  O   . ARG A 1 121 ? -18.257 -29.116 -29.826 1.00 26.50  ? 105  ARG A O   1 
ATOM   866  C  CB  . ARG A 1 121 ? -18.278 -31.013 -27.389 1.00 25.18  ? 105  ARG A CB  1 
ATOM   867  C  CG  . ARG A 1 121 ? -18.615 -31.649 -26.045 1.00 39.97  ? 105  ARG A CG  1 
ATOM   868  N  N   . PHE A 1 122 ? -17.144 -27.947 -28.240 1.00 21.55  ? 106  PHE A N   1 
ATOM   869  C  CA  . PHE A 1 122 ? -16.321 -27.188 -29.195 1.00 21.32  ? 106  PHE A CA  1 
ATOM   870  C  C   . PHE A 1 122 ? -14.864 -27.223 -28.751 1.00 25.09  ? 106  PHE A C   1 
ATOM   871  O  O   . PHE A 1 122 ? -14.581 -27.060 -27.568 1.00 24.58  ? 106  PHE A O   1 
ATOM   872  C  CB  . PHE A 1 122 ? -16.793 -25.725 -29.347 1.00 22.29  ? 106  PHE A CB  1 
ATOM   873  C  CG  . PHE A 1 122 ? -18.254 -25.563 -29.693 1.00 24.32  ? 106  PHE A CG  1 
ATOM   874  C  CD1 . PHE A 1 122 ? -19.231 -25.583 -28.697 1.00 26.23  ? 106  PHE A CD1 1 
ATOM   875  C  CD2 . PHE A 1 122 ? -18.660 -25.411 -31.014 1.00 27.02  ? 106  PHE A CD2 1 
ATOM   876  C  CE1 . PHE A 1 122 ? -20.587 -25.472 -29.019 1.00 27.56  ? 106  PHE A CE1 1 
ATOM   877  C  CE2 . PHE A 1 122 ? -20.022 -25.271 -31.334 1.00 29.43  ? 106  PHE A CE2 1 
ATOM   878  C  CZ  . PHE A 1 122 ? -20.974 -25.314 -30.334 1.00 26.48  ? 106  PHE A CZ  1 
ATOM   879  N  N   . THR A 1 123 ? -13.955 -27.431 -29.698 1.00 22.30  ? 107  THR A N   1 
ATOM   880  C  CA  . THR A 1 123 ? -12.516 -27.449 -29.439 1.00 22.76  ? 107  THR A CA  1 
ATOM   881  C  C   . THR A 1 123 ? -11.934 -26.328 -30.257 1.00 24.35  ? 107  THR A C   1 
ATOM   882  O  O   . THR A 1 123 ? -12.027 -26.362 -31.483 1.00 22.05  ? 107  THR A O   1 
ATOM   883  C  CB  . THR A 1 123 ? -11.914 -28.808 -29.827 1.00 30.35  ? 107  THR A CB  1 
ATOM   884  O  OG1 . THR A 1 123 ? -12.433 -29.796 -28.941 1.00 28.04  ? 107  THR A OG1 1 
ATOM   885  C  CG2 . THR A 1 123 ? -10.393 -28.811 -29.770 1.00 31.44  ? 107  THR A CG2 1 
ATOM   886  N  N   . LEU A 1 124 ? -11.418 -25.306 -29.589 1.00 20.89  ? 108  LEU A N   1 
ATOM   887  C  CA  . LEU A 1 124 ? -10.832 -24.167 -30.278 1.00 20.57  ? 108  LEU A CA  1 
ATOM   888  C  C   . LEU A 1 124 ? -9.314  -24.177 -30.084 1.00 22.76  ? 108  LEU A C   1 
ATOM   889  O  O   . LEU A 1 124 ? -8.830  -24.594 -29.028 1.00 22.03  ? 108  LEU A O   1 
ATOM   890  C  CB  . LEU A 1 124 ? -11.413 -22.848 -29.731 1.00 20.85  ? 108  LEU A CB  1 
ATOM   891  C  CG  . LEU A 1 124 ? -12.892 -22.515 -30.036 1.00 26.14  ? 108  LEU A CG  1 
ATOM   892  C  CD1 . LEU A 1 124 ? -13.368 -21.354 -29.161 1.00 26.35  ? 108  LEU A CD1 1 
ATOM   893  C  CD2 . LEU A 1 124 ? -13.066 -22.087 -31.481 1.00 28.58  ? 108  LEU A CD2 1 
ATOM   894  N  N   . SER A 1 125 ? -8.581  -23.639 -31.068 1.00 20.06  ? 109  SER A N   1 
ATOM   895  C  CA  . SER A 1 125 ? -7.116  -23.512 -31.040 1.00 19.85  ? 109  SER A CA  1 
ATOM   896  C  C   . SER A 1 125 ? -6.790  -22.395 -30.032 1.00 24.71  ? 109  SER A C   1 
ATOM   897  O  O   . SER A 1 125 ? -7.664  -21.570 -29.725 1.00 22.23  ? 109  SER A O   1 
ATOM   898  C  CB  . SER A 1 125 ? -6.592  -23.093 -32.415 1.00 23.08  ? 109  SER A CB  1 
ATOM   899  O  OG  . SER A 1 125 ? -7.061  -21.797 -32.763 1.00 30.98  ? 109  SER A OG  1 
ATOM   900  N  N   . THR A 1 126 ? -5.577  -22.409 -29.487 1.00 22.16  ? 110  THR A N   1 
ATOM   901  C  CA  . THR A 1 126 ? -5.157  -21.389 -28.521 1.00 21.69  ? 110  THR A CA  1 
ATOM   902  C  C   . THR A 1 126 ? -3.771  -20.846 -28.818 1.00 24.85  ? 110  THR A C   1 
ATOM   903  O  O   . THR A 1 126 ? -2.989  -21.447 -29.568 1.00 22.31  ? 110  THR A O   1 
ATOM   904  C  CB  . THR A 1 126 ? -5.119  -21.938 -27.070 1.00 25.04  ? 110  THR A CB  1 
ATOM   905  O  OG1 . THR A 1 126 ? -4.023  -22.841 -26.903 1.00 24.78  ? 110  THR A OG1 1 
ATOM   906  C  CG2 . THR A 1 126 ? -6.443  -22.535 -26.586 1.00 24.43  ? 110  THR A CG2 1 
ATOM   907  N  N   . LEU A 1 127 ? -3.458  -19.708 -28.185 1.00 21.62  ? 111  LEU A N   1 
ATOM   908  C  CA  . LEU A 1 127 ? -2.113  -19.155 -28.164 1.00 21.77  ? 111  LEU A CA  1 
ATOM   909  C  C   . LEU A 1 127 ? -1.855  -18.736 -26.708 1.00 26.54  ? 111  LEU A C   1 
ATOM   910  O  O   . LEU A 1 127 ? -2.797  -18.262 -26.046 1.00 24.13  ? 111  LEU A O   1 
ATOM   911  C  CB  . LEU A 1 127 ? -1.899  -18.005 -29.155 1.00 21.16  ? 111  LEU A CB  1 
ATOM   912  C  CG  . LEU A 1 127 ? -1.844  -18.381 -30.659 1.00 24.91  ? 111  LEU A CG  1 
ATOM   913  C  CD1 . LEU A 1 127 ? -1.832  -17.148 -31.514 1.00 25.54  ? 111  LEU A CD1 1 
ATOM   914  C  CD2 . LEU A 1 127 ? -0.647  -19.297 -31.008 1.00 26.72  ? 111  LEU A CD2 1 
ATOM   915  N  N   . PRO A 1 128 ? -0.636  -18.967 -26.156 1.00 24.25  ? 112  PRO A N   1 
ATOM   916  C  CA  . PRO A 1 128 ? -0.391  -18.599 -24.748 1.00 23.61  ? 112  PRO A CA  1 
ATOM   917  C  C   . PRO A 1 128 ? -0.632  -17.118 -24.476 1.00 24.41  ? 112  PRO A C   1 
ATOM   918  O  O   . PRO A 1 128 ? -0.446  -16.297 -25.360 1.00 22.73  ? 112  PRO A O   1 
ATOM   919  C  CB  . PRO A 1 128 ? 1.095   -18.975 -24.526 1.00 26.77  ? 112  PRO A CB  1 
ATOM   920  C  CG  . PRO A 1 128 ? 1.412   -19.945 -25.609 1.00 31.98  ? 112  PRO A CG  1 
ATOM   921  C  CD  . PRO A 1 128 ? 0.578   -19.545 -26.781 1.00 27.05  ? 112  PRO A CD  1 
ATOM   922  N  N   . ALA A 1 129 ? -1.054  -16.791 -23.248 1.00 22.51  ? 113  ALA A N   1 
ATOM   923  C  CA  . ALA A 1 129 ? -1.273  -15.422 -22.758 1.00 23.12  ? 113  ALA A CA  1 
ATOM   924  C  C   . ALA A 1 129 ? 0.031   -14.625 -22.872 1.00 27.61  ? 113  ALA A C   1 
ATOM   925  O  O   . ALA A 1 129 ? 0.002   -13.421 -23.143 1.00 25.21  ? 113  ALA A O   1 
ATOM   926  C  CB  . ALA A 1 129 ? -1.686  -15.476 -21.303 1.00 24.37  ? 113  ALA A CB  1 
ATOM   927  N  N   . ASN A 1 130 ? 1.181   -15.321 -22.691 1.00 24.87  ? 114  ASN A N   1 
ATOM   928  C  CA  . ASN A 1 130 ? 2.531   -14.751 -22.781 1.00 26.05  ? 114  ASN A CA  1 
ATOM   929  C  C   . ASN A 1 130 ? 2.764   -14.126 -24.167 1.00 30.34  ? 114  ASN A C   1 
ATOM   930  O  O   . ASN A 1 130 ? 3.500   -13.153 -24.272 1.00 31.98  ? 114  ASN A O   1 
ATOM   931  C  CB  . ASN A 1 130 ? 3.599   -15.830 -22.462 1.00 30.71  ? 114  ASN A CB  1 
ATOM   932  C  CG  . ASN A 1 130 ? 5.022   -15.334 -22.568 1.00 75.07  ? 114  ASN A CG  1 
ATOM   933  O  OD1 . ASN A 1 130 ? 5.732   -15.615 -23.546 1.00 76.25  ? 114  ASN A OD1 1 
ATOM   934  N  ND2 . ASN A 1 130 ? 5.453   -14.539 -21.590 1.00 69.98  ? 114  ASN A ND2 1 
ATOM   935  N  N   . ASP A 1 131 ? 2.095   -14.648 -25.212 1.00 26.10  ? 115  ASP A N   1 
ATOM   936  C  CA  . ASP A 1 131 ? 2.216   -14.111 -26.572 1.00 26.93  ? 115  ASP A CA  1 
ATOM   937  C  C   . ASP A 1 131 ? 1.335   -12.863 -26.830 1.00 31.14  ? 115  ASP A C   1 
ATOM   938  O  O   . ASP A 1 131 ? 1.495   -12.214 -27.864 1.00 30.30  ? 115  ASP A O   1 
ATOM   939  C  CB  . ASP A 1 131 ? 1.878   -15.201 -27.617 1.00 29.14  ? 115  ASP A CB  1 
ATOM   940  C  CG  . ASP A 1 131 ? 2.891   -16.329 -27.813 1.00 36.14  ? 115  ASP A CG  1 
ATOM   941  O  OD1 . ASP A 1 131 ? 3.993   -16.269 -27.197 1.00 35.20  ? 115  ASP A OD1 1 
ATOM   942  O  OD2 . ASP A 1 131 ? 2.568   -17.294 -28.549 1.00 34.92  ? 115  ASP A OD2 1 
ATOM   943  N  N   . PHE A 1 132 ? 0.378   -12.555 -25.922 1.00 27.06  ? 116  PHE A N   1 
ATOM   944  C  CA  . PHE A 1 132 ? -0.566  -11.442 -26.102 1.00 25.29  ? 116  PHE A CA  1 
ATOM   945  C  C   . PHE A 1 132 ? 0.071   -10.063 -25.885 1.00 31.77  ? 116  PHE A C   1 
ATOM   946  O  O   . PHE A 1 132 ? 0.802   -9.901  -24.908 1.00 31.54  ? 116  PHE A O   1 
ATOM   947  C  CB  . PHE A 1 132 ? -1.799  -11.618 -25.195 1.00 25.22  ? 116  PHE A CB  1 
ATOM   948  C  CG  . PHE A 1 132 ? -2.986  -10.783 -25.593 1.00 24.88  ? 116  PHE A CG  1 
ATOM   949  C  CD1 . PHE A 1 132 ? -3.846  -11.205 -26.605 1.00 26.75  ? 116  PHE A CD1 1 
ATOM   950  C  CD2 . PHE A 1 132 ? -3.278  -9.597  -24.924 1.00 26.00  ? 116  PHE A CD2 1 
ATOM   951  C  CE1 . PHE A 1 132 ? -4.968  -10.445 -26.954 1.00 27.37  ? 116  PHE A CE1 1 
ATOM   952  C  CE2 . PHE A 1 132 ? -4.390  -8.824  -25.291 1.00 28.14  ? 116  PHE A CE2 1 
ATOM   953  C  CZ  . PHE A 1 132 ? -5.228  -9.255  -26.299 1.00 25.76  ? 116  PHE A CZ  1 
ATOM   954  N  N   . PRO A 1 133 ? -0.218  -9.057  -26.752 1.00 30.57  ? 117  PRO A N   1 
ATOM   955  C  CA  . PRO A 1 133 ? 0.391   -7.722  -26.566 1.00 31.98  ? 117  PRO A CA  1 
ATOM   956  C  C   . PRO A 1 133 ? 0.025   -7.049  -25.246 1.00 40.42  ? 117  PRO A C   1 
ATOM   957  O  O   . PRO A 1 133 ? -1.075  -7.230  -24.723 1.00 38.34  ? 117  PRO A O   1 
ATOM   958  C  CB  . PRO A 1 133 ? -0.141  -6.903  -27.746 1.00 33.39  ? 117  PRO A CB  1 
ATOM   959  C  CG  . PRO A 1 133 ? -0.654  -7.873  -28.703 1.00 37.56  ? 117  PRO A CG  1 
ATOM   960  C  CD  . PRO A 1 133 ? -1.078  -9.087  -27.949 1.00 32.19  ? 117  PRO A CD  1 
ATOM   961  N  N   . THR A 1 134 ? 0.965   -6.267  -24.710 1.00 41.14  ? 118  THR A N   1 
ATOM   962  C  CA  . THR A 1 134 ? 0.762   -5.552  -23.456 1.00 42.37  ? 118  THR A CA  1 
ATOM   963  C  C   . THR A 1 134 ? 0.809   -4.064  -23.712 1.00 47.31  ? 118  THR A C   1 
ATOM   964  O  O   . THR A 1 134 ? 1.541   -3.611  -24.600 1.00 46.86  ? 118  THR A O   1 
ATOM   965  C  CB  . THR A 1 134 ? 1.813   -5.972  -22.403 1.00 56.44  ? 118  THR A CB  1 
ATOM   966  O  OG1 . THR A 1 134 ? 3.126   -5.682  -22.892 1.00 60.35  ? 118  THR A OG1 1 
ATOM   967  C  CG2 . THR A 1 134 ? 1.703   -7.449  -22.004 1.00 55.68  ? 118  THR A CG2 1 
ATOM   968  N  N   . VAL A 1 135 ? 0.027   -3.304  -22.943 1.00 45.44  ? 119  VAL A N   1 
ATOM   969  C  CA  . VAL A 1 135 ? 0.033   -1.848  -23.042 1.00 46.12  ? 119  VAL A CA  1 
ATOM   970  C  C   . VAL A 1 135 ? 0.988   -1.319  -21.976 1.00 53.70  ? 119  VAL A C   1 
ATOM   971  O  O   . VAL A 1 135 ? 0.804   -1.592  -20.785 1.00 52.81  ? 119  VAL A O   1 
ATOM   972  C  CB  . VAL A 1 135 ? -1.380  -1.196  -22.985 1.00 48.93  ? 119  VAL A CB  1 
ATOM   973  C  CG1 . VAL A 1 135 ? -1.292  0.331   -23.057 1.00 48.59  ? 119  VAL A CG1 1 
ATOM   974  C  CG2 . VAL A 1 135 ? -2.274  -1.724  -24.104 1.00 48.03  ? 119  VAL A CG2 1 
ATOM   975  N  N   . GLU A 1 136 ? 2.032   -0.604  -22.422 1.00 54.31  ? 120  GLU A N   1 
ATOM   976  C  CA  . GLU A 1 136 ? 3.029   0.027   -21.563 1.00 56.34  ? 120  GLU A CA  1 
ATOM   977  C  C   . GLU A 1 136 ? 2.746   1.539   -21.578 1.00 63.53  ? 120  GLU A C   1 
ATOM   978  O  O   . GLU A 1 136 ? 3.464   2.320   -22.213 1.00 64.41  ? 120  GLU A O   1 
ATOM   979  C  CB  . GLU A 1 136 ? 4.460   -0.322  -22.025 1.00 58.46  ? 120  GLU A CB  1 
ATOM   980  N  N   . GLU A 1 137 ? 1.633   1.925   -20.924 1.00 60.65  ? 121  GLU A N   1 
ATOM   981  C  CA  . GLU A 1 137 ? 1.174   3.309   -20.826 1.00 60.70  ? 121  GLU A CA  1 
ATOM   982  C  C   . GLU A 1 137 ? 1.987   4.057   -19.777 1.00 65.73  ? 121  GLU A C   1 
ATOM   983  O  O   . GLU A 1 137 ? 2.133   3.577   -18.648 1.00 66.00  ? 121  GLU A O   1 
ATOM   984  C  CB  . GLU A 1 137 ? -0.330  3.361   -20.492 1.00 61.30  ? 121  GLU A CB  1 
ATOM   985  N  N   . GLY A 1 138 ? 2.508   5.223   -20.158 1.00 62.45  ? 122  GLY A N   1 
ATOM   986  C  CA  . GLY A 1 138 ? 3.291   6.081   -19.273 1.00 62.69  ? 122  GLY A CA  1 
ATOM   987  C  C   . GLY A 1 138 ? 2.476   6.688   -18.140 1.00 64.64  ? 122  GLY A C   1 
ATOM   988  O  O   . GLY A 1 138 ? 1.267   6.445   -18.058 1.00 63.36  ? 122  GLY A O   1 
ATOM   989  N  N   . PRO A 1 139 ? 3.094   7.492   -17.240 1.00 61.08  ? 123  PRO A N   1 
ATOM   990  C  CA  . PRO A 1 139 ? 2.319   8.085   -16.130 1.00 60.71  ? 123  PRO A CA  1 
ATOM   991  C  C   . PRO A 1 139 ? 1.178   9.009   -16.579 1.00 62.56  ? 123  PRO A C   1 
ATOM   992  O  O   . PRO A 1 139 ? 1.254   9.636   -17.642 1.00 61.50  ? 123  PRO A O   1 
ATOM   993  C  CB  . PRO A 1 139 ? 3.377   8.844   -15.317 1.00 63.62  ? 123  PRO A CB  1 
ATOM   994  C  CG  . PRO A 1 139 ? 4.685   8.238   -15.720 1.00 68.68  ? 123  PRO A CG  1 
ATOM   995  C  CD  . PRO A 1 139 ? 4.517   7.880   -17.161 1.00 63.57  ? 123  PRO A CD  1 
ATOM   996  N  N   . GLY A 1 140 ? 0.125   9.055   -15.767 1.00 57.26  ? 124  GLY A N   1 
ATOM   997  C  CA  . GLY A 1 140 ? -1.051  9.876   -16.023 1.00 55.35  ? 124  GLY A CA  1 
ATOM   998  C  C   . GLY A 1 140 ? -0.865  11.317  -15.595 1.00 57.46  ? 124  GLY A C   1 
ATOM   999  O  O   . GLY A 1 140 ? -0.658  11.592  -14.411 1.00 58.17  ? 124  GLY A O   1 
ATOM   1000 N  N   . SER A 1 141 ? -0.943  12.246  -16.562 1.00 51.39  ? 125  SER A N   1 
ATOM   1001 C  CA  . SER A 1 141 ? -0.822  13.694  -16.343 1.00 50.47  ? 125  SER A CA  1 
ATOM   1002 C  C   . SER A 1 141 ? -1.989  14.237  -15.508 1.00 49.93  ? 125  SER A C   1 
ATOM   1003 O  O   . SER A 1 141 ? -1.808  15.232  -14.790 1.00 50.22  ? 125  SER A O   1 
ATOM   1004 C  CB  . SER A 1 141 ? -0.779  14.434  -17.679 1.00 54.49  ? 125  SER A CB  1 
ATOM   1005 O  OG  . SER A 1 141 ? 0.439   14.216  -18.373 1.00 66.05  ? 125  SER A OG  1 
ATOM   1006 N  N   . LEU A 1 142 ? -3.191  13.600  -15.622 1.00 40.44  ? 126  LEU A N   1 
ATOM   1007 C  CA  . LEU A 1 142 ? -4.403  14.031  -14.924 1.00 38.04  ? 126  LEU A CA  1 
ATOM   1008 C  C   . LEU A 1 142 ? -5.446  12.932  -14.803 1.00 38.53  ? 126  LEU A C   1 
ATOM   1009 O  O   . LEU A 1 142 ? -5.759  12.254  -15.793 1.00 36.68  ? 126  LEU A O   1 
ATOM   1010 C  CB  . LEU A 1 142 ? -5.009  15.261  -15.638 1.00 37.74  ? 126  LEU A CB  1 
ATOM   1011 C  CG  . LEU A 1 142 ? -6.394  15.765  -15.194 1.00 42.62  ? 126  LEU A CG  1 
ATOM   1012 C  CD1 . LEU A 1 142 ? -6.344  16.390  -13.790 1.00 43.33  ? 126  LEU A CD1 1 
ATOM   1013 C  CD2 . LEU A 1 142 ? -6.950  16.768  -16.194 1.00 45.69  ? 126  LEU A CD2 1 
ATOM   1014 N  N   . ASN A 1 143 ? -6.029  12.788  -13.600 1.00 32.81  ? 127  ASN A N   1 
ATOM   1015 C  CA  . ASN A 1 143 ? -7.117  11.831  -13.394 1.00 31.41  ? 127  ASN A CA  1 
ATOM   1016 C  C   . ASN A 1 143 ? -8.340  12.491  -12.781 1.00 32.65  ? 127  ASN A C   1 
ATOM   1017 O  O   . ASN A 1 143 ? -8.216  13.392  -11.934 1.00 31.97  ? 127  ASN A O   1 
ATOM   1018 C  CB  . ASN A 1 143 ? -6.688  10.560  -12.648 1.00 36.76  ? 127  ASN A CB  1 
ATOM   1019 C  CG  . ASN A 1 143 ? -5.815  10.791  -11.458 1.00 71.71  ? 127  ASN A CG  1 
ATOM   1020 O  OD1 . ASN A 1 143 ? -6.270  11.250  -10.407 1.00 73.31  ? 127  ASN A OD1 1 
ATOM   1021 N  ND2 . ASN A 1 143 ? -4.544  10.444  -11.594 1.00 66.27  ? 127  ASN A ND2 1 
ATOM   1022 N  N   . PHE A 1 144 ? -9.520  12.097  -13.273 1.00 25.99  ? 128  PHE A N   1 
ATOM   1023 C  CA  . PHE A 1 144 ? -10.805 12.611  -12.799 1.00 25.18  ? 128  PHE A CA  1 
ATOM   1024 C  C   . PHE A 1 144 ? -11.918 11.592  -13.034 1.00 30.10  ? 128  PHE A C   1 
ATOM   1025 O  O   . PHE A 1 144 ? -11.768 10.685  -13.849 1.00 30.26  ? 128  PHE A O   1 
ATOM   1026 C  CB  . PHE A 1 144 ? -11.154 13.962  -13.484 1.00 25.22  ? 128  PHE A CB  1 
ATOM   1027 C  CG  . PHE A 1 144 ? -11.383 13.890  -14.981 1.00 24.50  ? 128  PHE A CG  1 
ATOM   1028 C  CD1 . PHE A 1 144 ? -12.657 13.687  -15.496 1.00 25.67  ? 128  PHE A CD1 1 
ATOM   1029 C  CD2 . PHE A 1 144 ? -10.335 14.084  -15.873 1.00 26.29  ? 128  PHE A CD2 1 
ATOM   1030 C  CE1 . PHE A 1 144 ? -12.877 13.634  -16.882 1.00 25.82  ? 128  PHE A CE1 1 
ATOM   1031 C  CE2 . PHE A 1 144 ? -10.555 14.045  -17.260 1.00 27.32  ? 128  PHE A CE2 1 
ATOM   1032 C  CZ  . PHE A 1 144 ? -11.821 13.812  -17.751 1.00 25.30  ? 128  PHE A CZ  1 
ATOM   1033 N  N   . SER A 1 145 ? -13.047 11.773  -12.357 1.00 28.57  ? 129  SER A N   1 
ATOM   1034 C  CA  . SER A 1 145 ? -14.219 10.932  -12.557 1.00 28.51  ? 129  SER A CA  1 
ATOM   1035 C  C   . SER A 1 145 ? -15.340 11.793  -13.104 1.00 30.13  ? 129  SER A C   1 
ATOM   1036 O  O   . SER A 1 145 ? -15.422 12.990  -12.796 1.00 28.72  ? 129  SER A O   1 
ATOM   1037 C  CB  . SER A 1 145 ? -14.649 10.248  -11.264 1.00 34.28  ? 129  SER A CB  1 
ATOM   1038 O  OG  . SER A 1 145 ? -15.191 11.192  -10.355 1.00 53.79  ? 129  SER A OG  1 
ATOM   1039 N  N   . ILE A 1 146 ? -16.177 11.206  -13.943 1.00 25.86  ? 130  ILE A N   1 
ATOM   1040 C  CA  . ILE A 1 146 ? -17.297 11.929  -14.544 1.00 25.85  ? 130  ILE A CA  1 
ATOM   1041 C  C   . ILE A 1 146 ? -18.448 10.963  -14.793 1.00 27.67  ? 130  ILE A C   1 
ATOM   1042 O  O   . ILE A 1 146 ? -18.221 9.756   -14.926 1.00 25.43  ? 130  ILE A O   1 
ATOM   1043 C  CB  . ILE A 1 146 ? -16.835 12.677  -15.844 1.00 28.33  ? 130  ILE A CB  1 
ATOM   1044 C  CG1 . ILE A 1 146 ? -17.836 13.774  -16.267 1.00 29.53  ? 130  ILE A CG1 1 
ATOM   1045 C  CG2 . ILE A 1 146 ? -16.458 11.705  -16.985 1.00 27.03  ? 130  ILE A CG2 1 
ATOM   1046 C  CD1 . ILE A 1 146 ? -17.364 14.719  -17.371 1.00 39.26  ? 130  ILE A CD1 1 
ATOM   1047 N  N   . ALA A 1 147 ? -19.685 11.487  -14.854 1.00 24.23  ? 131  ALA A N   1 
ATOM   1048 C  CA  . ALA A 1 147 ? -20.844 10.655  -15.165 1.00 23.28  ? 131  ALA A CA  1 
ATOM   1049 C  C   . ALA A 1 147 ? -20.698 10.139  -16.592 1.00 25.82  ? 131  ALA A C   1 
ATOM   1050 O  O   . ALA A 1 147 ? -20.275 10.889  -17.480 1.00 24.27  ? 131  ALA A O   1 
ATOM   1051 C  CB  . ALA A 1 147 ? -22.131 11.452  -15.031 1.00 24.79  ? 131  ALA A CB  1 
ATOM   1052 N  N   . GLN A 1 148 ? -20.973 8.843   -16.793 1.00 21.68  ? 132  GLN A N   1 
ATOM   1053 C  CA  . GLN A 1 148 ? -20.910 8.206   -18.112 1.00 21.33  ? 132  GLN A CA  1 
ATOM   1054 C  C   . GLN A 1 148 ? -21.785 8.954   -19.112 1.00 26.25  ? 132  GLN A C   1 
ATOM   1055 O  O   . GLN A 1 148 ? -21.331 9.221   -20.220 1.00 24.64  ? 132  GLN A O   1 
ATOM   1056 C  CB  . GLN A 1 148 ? -21.336 6.745   -18.043 1.00 22.15  ? 132  GLN A CB  1 
ATOM   1057 C  CG  . GLN A 1 148 ? -20.286 5.857   -17.392 1.00 25.59  ? 132  GLN A CG  1 
ATOM   1058 C  CD  . GLN A 1 148 ? -20.691 4.416   -17.377 1.00 29.21  ? 132  GLN A CD  1 
ATOM   1059 O  OE1 . GLN A 1 148 ? -21.255 3.889   -18.340 1.00 27.29  ? 132  GLN A OE1 1 
ATOM   1060 N  NE2 . GLN A 1 148 ? -20.381 3.744   -16.281 1.00 27.17  ? 132  GLN A NE2 1 
ATOM   1061 N  N   . SER A 1 149 ? -23.014 9.333   -18.697 1.00 24.66  ? 133  SER A N   1 
ATOM   1062 C  CA  . SER A 1 149 ? -23.987 10.054  -19.527 1.00 24.39  ? 133  SER A CA  1 
ATOM   1063 C  C   . SER A 1 149 ? -23.439 11.394  -20.012 1.00 25.95  ? 133  SER A C   1 
ATOM   1064 O  O   . SER A 1 149 ? -23.703 11.756  -21.158 1.00 25.52  ? 133  SER A O   1 
ATOM   1065 C  CB  . SER A 1 149 ? -25.298 10.275  -18.768 1.00 27.45  ? 133  SER A CB  1 
ATOM   1066 O  OG  . SER A 1 149 ? -25.125 11.261  -17.766 1.00 36.31  ? 133  SER A OG  1 
ATOM   1067 N  N   . LYS A 1 150 ? -22.672 12.107  -19.154 1.00 23.43  ? 134  LYS A N   1 
ATOM   1068 C  CA  . LYS A 1 150 ? -22.062 13.410  -19.460 1.00 22.37  ? 134  LYS A CA  1 
ATOM   1069 C  C   . LYS A 1 150 ? -20.953 13.251  -20.507 1.00 25.12  ? 134  LYS A C   1 
ATOM   1070 O  O   . LYS A 1 150 ? -20.954 13.977  -21.503 1.00 22.15  ? 134  LYS A O   1 
ATOM   1071 C  CB  . LYS A 1 150 ? -21.531 14.106  -18.194 1.00 24.98  ? 134  LYS A CB  1 
ATOM   1072 C  CG  . LYS A 1 150 ? -22.624 14.589  -17.254 1.00 37.60  ? 134  LYS A CG  1 
ATOM   1073 N  N   . LEU A 1 151 ? -20.042 12.269  -20.310 1.00 21.78  ? 135  LEU A N   1 
ATOM   1074 C  CA  . LEU A 1 151 ? -18.963 12.031  -21.268 1.00 21.52  ? 135  LEU A CA  1 
ATOM   1075 C  C   . LEU A 1 151 ? -19.542 11.534  -22.598 1.00 20.72  ? 135  LEU A C   1 
ATOM   1076 O  O   . LEU A 1 151 ? -19.096 11.987  -23.661 1.00 19.19  ? 135  LEU A O   1 
ATOM   1077 C  CB  . LEU A 1 151 ? -17.892 11.056  -20.711 1.00 21.91  ? 135  LEU A CB  1 
ATOM   1078 C  CG  . LEU A 1 151 ? -16.747 10.681  -21.674 1.00 25.59  ? 135  LEU A CG  1 
ATOM   1079 C  CD1 . LEU A 1 151 ? -15.958 11.919  -22.148 1.00 26.01  ? 135  LEU A CD1 1 
ATOM   1080 C  CD2 . LEU A 1 151 ? -15.818 9.653   -21.037 1.00 25.83  ? 135  LEU A CD2 1 
ATOM   1081 N  N   . ARG A 1 152 ? -20.582 10.674  -22.542 1.00 18.08  ? 136  ARG A N   1 
ATOM   1082 C  CA  . ARG A 1 152 ? -21.207 10.168  -23.773 1.00 18.73  ? 136  ARG A CA  1 
ATOM   1083 C  C   . ARG A 1 152 ? -21.831 11.340  -24.559 1.00 20.74  ? 136  ARG A C   1 
ATOM   1084 O  O   . ARG A 1 152 ? -21.710 11.387  -25.790 1.00 18.54  ? 136  ARG A O   1 
ATOM   1085 C  CB  . ARG A 1 152 ? -22.260 9.081   -23.511 1.00 20.78  ? 136  ARG A CB  1 
ATOM   1086 C  CG  . ARG A 1 152 ? -22.697 8.459   -24.836 1.00 23.72  ? 136  ARG A CG  1 
ATOM   1087 C  CD  . ARG A 1 152 ? -23.732 7.364   -24.768 1.00 26.42  ? 136  ARG A CD  1 
ATOM   1088 N  NE  . ARG A 1 152 ? -23.894 6.818   -26.120 1.00 28.12  ? 136  ARG A NE  1 
ATOM   1089 C  CZ  . ARG A 1 152 ? -24.133 5.543   -26.409 1.00 41.79  ? 136  ARG A CZ  1 
ATOM   1090 N  NH1 . ARG A 1 152 ? -24.268 4.647   -25.435 1.00 27.39  ? 136  ARG A NH1 1 
ATOM   1091 N  NH2 . ARG A 1 152 ? -24.229 5.150   -27.673 1.00 29.81  ? 136  ARG A NH2 1 
ATOM   1092 N  N   . ARG A 1 153 ? -22.467 12.268  -23.836 1.00 18.80  ? 137  ARG A N   1 
ATOM   1093 C  CA  . ARG A 1 153 ? -23.094 13.451  -24.431 1.00 19.26  ? 137  ARG A CA  1 
ATOM   1094 C  C   . ARG A 1 153 ? -22.046 14.257  -25.221 1.00 21.96  ? 137  ARG A C   1 
ATOM   1095 O  O   . ARG A 1 153 ? -22.297 14.572  -26.386 1.00 20.48  ? 137  ARG A O   1 
ATOM   1096 C  CB  . ARG A 1 153 ? -23.759 14.309  -23.339 1.00 19.53  ? 137  ARG A CB  1 
ATOM   1097 C  CG  . ARG A 1 153 ? -24.456 15.555  -23.883 1.00 30.21  ? 137  ARG A CG  1 
ATOM   1098 C  CD  . ARG A 1 153 ? -25.829 15.248  -24.448 1.00 51.53  ? 137  ARG A CD  1 
ATOM   1099 N  NE  . ARG A 1 153 ? -26.843 15.080  -23.403 1.00 60.68  ? 137  ARG A NE  1 
ATOM   1100 C  CZ  . ARG A 1 153 ? -27.605 16.062  -22.933 1.00 67.65  ? 137  ARG A CZ  1 
ATOM   1101 N  NH1 . ARG A 1 153 ? -27.469 17.299  -23.398 1.00 45.95  ? 137  ARG A NH1 1 
ATOM   1102 N  NH2 . ARG A 1 153 ? -28.503 15.816  -21.989 1.00 57.38  ? 137  ARG A NH2 1 
ATOM   1103 N  N   . LEU A 1 154 ? -20.852 14.538  -24.607 1.00 19.10  ? 138  LEU A N   1 
ATOM   1104 C  CA  . LEU A 1 154 ? -19.783 15.303  -25.269 1.00 18.15  ? 138  LEU A CA  1 
ATOM   1105 C  C   . LEU A 1 154 ? -19.391 14.649  -26.591 1.00 20.51  ? 138  LEU A C   1 
ATOM   1106 O  O   . LEU A 1 154 ? -19.191 15.335  -27.595 1.00 19.69  ? 138  LEU A O   1 
ATOM   1107 C  CB  . LEU A 1 154 ? -18.536 15.411  -24.375 1.00 18.29  ? 138  LEU A CB  1 
ATOM   1108 C  CG  . LEU A 1 154 ? -18.691 16.270  -23.108 1.00 23.65  ? 138  LEU A CG  1 
ATOM   1109 C  CD1 . LEU A 1 154 ? -17.409 16.289  -22.332 1.00 25.22  ? 138  LEU A CD1 1 
ATOM   1110 C  CD2 . LEU A 1 154 ? -19.053 17.699  -23.445 1.00 24.92  ? 138  LEU A CD2 1 
ATOM   1111 N  N   . ILE A 1 155 ? -19.266 13.318  -26.587 1.00 15.59  ? 139  ILE A N   1 
ATOM   1112 C  CA  . ILE A 1 155 ? -18.877 12.624  -27.815 1.00 13.97  ? 139  ILE A CA  1 
ATOM   1113 C  C   . ILE A 1 155 ? -19.991 12.630  -28.863 1.00 17.39  ? 139  ILE A C   1 
ATOM   1114 O  O   . ILE A 1 155 ? -19.737 12.960  -30.035 1.00 15.66  ? 139  ILE A O   1 
ATOM   1115 C  CB  . ILE A 1 155 ? -18.364 11.187  -27.494 1.00 16.01  ? 139  ILE A CB  1 
ATOM   1116 C  CG1 . ILE A 1 155 ? -17.177 11.232  -26.488 1.00 15.67  ? 139  ILE A CG1 1 
ATOM   1117 C  CG2 . ILE A 1 155 ? -17.996 10.456  -28.809 1.00 16.39  ? 139  ILE A CG2 1 
ATOM   1118 C  CD1 . ILE A 1 155 ? -16.850 9.843   -25.779 1.00 17.00  ? 139  ILE A CD1 1 
ATOM   1119 N  N   . ASP A 1 156 ? -21.189 12.182  -28.474 1.00 16.45  ? 140  ASP A N   1 
ATOM   1120 C  CA  . ASP A 1 156 ? -22.330 12.075  -29.386 1.00 17.26  ? 140  ASP A CA  1 
ATOM   1121 C  C   . ASP A 1 156 ? -22.788 13.427  -29.987 1.00 17.80  ? 140  ASP A C   1 
ATOM   1122 O  O   . ASP A 1 156 ? -23.238 13.438  -31.119 1.00 17.24  ? 140  ASP A O   1 
ATOM   1123 C  CB  . ASP A 1 156 ? -23.506 11.374  -28.694 1.00 19.31  ? 140  ASP A CB  1 
ATOM   1124 C  CG  . ASP A 1 156 ? -23.338 9.857   -28.546 1.00 21.45  ? 140  ASP A CG  1 
ATOM   1125 O  OD1 . ASP A 1 156 ? -22.377 9.294   -29.139 1.00 20.27  ? 140  ASP A OD1 1 
ATOM   1126 O  OD2 . ASP A 1 156 ? -24.139 9.248   -27.819 1.00 23.55  ? 140  ASP A OD2 1 
ATOM   1127 N  N   . ARG A 1 157 ? -22.616 14.538  -29.260 1.00 16.72  ? 141  ARG A N   1 
ATOM   1128 C  CA  . ARG A 1 157 ? -22.993 15.877  -29.755 1.00 17.41  ? 141  ARG A CA  1 
ATOM   1129 C  C   . ARG A 1 157 ? -21.996 16.431  -30.778 1.00 18.58  ? 141  ARG A C   1 
ATOM   1130 O  O   . ARG A 1 157 ? -22.288 17.452  -31.410 1.00 16.71  ? 141  ARG A O   1 
ATOM   1131 C  CB  . ARG A 1 157 ? -23.101 16.885  -28.594 1.00 19.26  ? 141  ARG A CB  1 
ATOM   1132 C  CG  . ARG A 1 157 ? -24.321 16.717  -27.683 1.00 30.67  ? 141  ARG A CG  1 
ATOM   1133 C  CD  . ARG A 1 157 ? -25.631 16.894  -28.399 1.00 44.16  ? 141  ARG A CD  1 
ATOM   1134 N  NE  . ARG A 1 157 ? -26.741 16.363  -27.609 1.00 56.37  ? 141  ARG A NE  1 
ATOM   1135 C  CZ  . ARG A 1 157 ? -27.615 17.113  -26.955 1.00 65.45  ? 141  ARG A CZ  1 
ATOM   1136 N  NH1 . ARG A 1 157 ? -27.511 18.433  -26.975 1.00 51.07  ? 141  ARG A NH1 1 
ATOM   1137 N  NH2 . ARG A 1 157 ? -28.604 16.551  -26.279 1.00 54.50  ? 141  ARG A NH2 1 
ATOM   1138 N  N   . THR A 1 158 ? -20.802 15.795  -30.924 1.00 14.86  ? 142  THR A N   1 
ATOM   1139 C  CA  . THR A 1 158 ? -19.730 16.336  -31.802 1.00 14.98  ? 142  THR A CA  1 
ATOM   1140 C  C   . THR A 1 158 ? -19.060 15.367  -32.809 1.00 17.71  ? 142  THR A C   1 
ATOM   1141 O  O   . THR A 1 158 ? -18.398 15.836  -33.745 1.00 16.76  ? 142  THR A O   1 
ATOM   1142 C  CB  . THR A 1 158 ? -18.591 16.921  -30.919 1.00 20.73  ? 142  THR A CB  1 
ATOM   1143 O  OG1 . THR A 1 158 ? -17.967 15.855  -30.180 1.00 16.20  ? 142  THR A OG1 1 
ATOM   1144 C  CG2 . THR A 1 158 ? -19.055 18.046  -29.957 1.00 18.58  ? 142  THR A CG2 1 
ATOM   1145 N  N   . SER A 1 159 ? -19.163 14.028  -32.593 1.00 12.82  ? 143  SER A N   1 
ATOM   1146 C  CA  . SER A 1 159 ? -18.432 13.018  -33.369 1.00 13.07  ? 143  SER A CA  1 
ATOM   1147 C  C   . SER A 1 159 ? -18.591 13.062  -34.881 1.00 16.74  ? 143  SER A C   1 
ATOM   1148 O  O   . SER A 1 159 ? -17.650 12.713  -35.593 1.00 16.36  ? 143  SER A O   1 
ATOM   1149 C  CB  . SER A 1 159 ? -18.676 11.613  -32.821 1.00 17.30  ? 143  SER A CB  1 
ATOM   1150 O  OG  . SER A 1 159 ? -19.991 11.170  -33.107 1.00 18.04  ? 143  SER A OG  1 
ATOM   1151 N  N   . PHE A 1 160 ? -19.767 13.505  -35.375 1.00 15.52  ? 144  PHE A N   1 
ATOM   1152 C  CA  . PHE A 1 160 ? -20.036 13.590  -36.828 1.00 15.01  ? 144  PHE A CA  1 
ATOM   1153 C  C   . PHE A 1 160 ? -19.071 14.561  -37.548 1.00 16.88  ? 144  PHE A C   1 
ATOM   1154 O  O   . PHE A 1 160 ? -18.897 14.473  -38.774 1.00 16.82  ? 144  PHE A O   1 
ATOM   1155 C  CB  . PHE A 1 160 ? -21.509 14.017  -37.081 1.00 15.00  ? 144  PHE A CB  1 
ATOM   1156 C  CG  . PHE A 1 160 ? -21.786 15.468  -36.686 1.00 15.28  ? 144  PHE A CG  1 
ATOM   1157 C  CD1 . PHE A 1 160 ? -21.484 16.516  -37.559 1.00 15.90  ? 144  PHE A CD1 1 
ATOM   1158 C  CD2 . PHE A 1 160 ? -22.253 15.785  -35.407 1.00 16.73  ? 144  PHE A CD2 1 
ATOM   1159 C  CE1 . PHE A 1 160 ? -21.722 17.853  -37.188 1.00 18.05  ? 144  PHE A CE1 1 
ATOM   1160 C  CE2 . PHE A 1 160 ? -22.483 17.124  -35.031 1.00 18.76  ? 144  PHE A CE2 1 
ATOM   1161 C  CZ  . PHE A 1 160 ? -22.224 18.147  -35.925 1.00 17.04  ? 144  PHE A CZ  1 
ATOM   1162 N  N   . ALA A 1 161 ? -18.515 15.549  -36.811 1.00 12.74  ? 145  ALA A N   1 
ATOM   1163 C  CA  . ALA A 1 161 ? -17.660 16.580  -37.411 1.00 12.33  ? 145  ALA A CA  1 
ATOM   1164 C  C   . ALA A 1 161 ? -16.183 16.179  -37.577 1.00 15.43  ? 145  ALA A C   1 
ATOM   1165 O  O   . ALA A 1 161 ? -15.411 16.937  -38.155 1.00 14.36  ? 145  ALA A O   1 
ATOM   1166 C  CB  . ALA A 1 161 ? -17.771 17.896  -36.623 1.00 13.08  ? 145  ALA A CB  1 
ATOM   1167 N  N   . MET A 1 162 ? -15.772 15.022  -37.038 1.00 13.77  ? 146  MET A N   1 
ATOM   1168 C  CA  . MET A 1 162 ? -14.359 14.606  -37.157 1.00 14.11  ? 146  MET A CA  1 
ATOM   1169 C  C   . MET A 1 162 ? -14.019 14.341  -38.625 1.00 19.40  ? 146  MET A C   1 
ATOM   1170 O  O   . MET A 1 162 ? -14.894 13.910  -39.399 1.00 18.05  ? 146  MET A O   1 
ATOM   1171 C  CB  . MET A 1 162 ? -14.100 13.305  -36.370 1.00 15.03  ? 146  MET A CB  1 
ATOM   1172 C  CG  . MET A 1 162 ? -14.388 13.405  -34.869 1.00 16.83  ? 146  MET A CG  1 
ATOM   1173 S  SD  . MET A 1 162 ? -13.878 11.895  -33.989 1.00 18.68  ? 146  MET A SD  1 
ATOM   1174 C  CE  . MET A 1 162 ? -15.094 10.682  -34.636 1.00 16.91  ? 146  MET A CE  1 
ATOM   1175 N  N   . ALA A 1 163 ? -12.755 14.607  -39.013 1.00 17.25  ? 147  ALA A N   1 
ATOM   1176 C  CA  . ALA A 1 163 ? -12.288 14.241  -40.359 1.00 16.59  ? 147  ALA A CA  1 
ATOM   1177 C  C   . ALA A 1 163 ? -12.153 12.691  -40.390 1.00 20.48  ? 147  ALA A C   1 
ATOM   1178 O  O   . ALA A 1 163 ? -12.119 12.045  -39.344 1.00 17.97  ? 147  ALA A O   1 
ATOM   1179 C  CB  . ALA A 1 163 ? -10.929 14.870  -40.640 1.00 17.46  ? 147  ALA A CB  1 
ATOM   1180 N  N   . GLN A 1 164 ? -12.083 12.129  -41.597 1.00 21.86  ? 148  GLN A N   1 
ATOM   1181 C  CA  . GLN A 1 164 ? -11.856 10.711  -41.856 1.00 23.52  ? 148  GLN A CA  1 
ATOM   1182 C  C   . GLN A 1 164 ? -10.787 10.632  -42.931 1.00 26.83  ? 148  GLN A C   1 
ATOM   1183 O  O   . GLN A 1 164 ? -10.970 11.155  -44.033 1.00 27.08  ? 148  GLN A O   1 
ATOM   1184 C  CB  . GLN A 1 164 ? -13.142 10.009  -42.307 1.00 25.13  ? 148  GLN A CB  1 
ATOM   1185 C  CG  . GLN A 1 164 ? -12.930 8.501   -42.511 1.00 42.81  ? 148  GLN A CG  1 
ATOM   1186 C  CD  . GLN A 1 164 ? -14.228 7.740   -42.612 1.00 68.64  ? 148  GLN A CD  1 
ATOM   1187 O  OE1 . GLN A 1 164 ? -15.053 7.967   -43.506 1.00 66.06  ? 148  GLN A OE1 1 
ATOM   1188 N  NE2 . GLN A 1 164 ? -14.417 6.788   -41.713 1.00 61.72  ? 148  GLN A NE2 1 
ATOM   1189 N  N   . GLN A 1 165 ? -9.661  10.015  -42.595 1.00 26.03  ? 149  GLN A N   1 
ATOM   1190 C  CA  . GLN A 1 165 ? -8.514  9.835   -43.501 1.00 26.67  ? 149  GLN A CA  1 
ATOM   1191 C  C   . GLN A 1 165 ? -7.950  11.138  -44.107 1.00 28.06  ? 149  GLN A C   1 
ATOM   1192 O  O   . GLN A 1 165 ? -7.444  11.127  -45.225 1.00 28.08  ? 149  GLN A O   1 
ATOM   1193 C  CB  . GLN A 1 165 ? -8.814  8.760   -44.575 1.00 28.23  ? 149  GLN A CB  1 
ATOM   1194 C  CG  . GLN A 1 165 ? -8.989  7.361   -43.995 1.00 44.91  ? 149  GLN A CG  1 
ATOM   1195 C  CD  . GLN A 1 165 ? -9.603  6.397   -44.984 1.00 70.76  ? 149  GLN A CD  1 
ATOM   1196 O  OE1 . GLN A 1 165 ? -10.559 6.715   -45.712 1.00 64.39  ? 149  GLN A OE1 1 
ATOM   1197 N  NE2 . GLN A 1 165 ? -9.091  5.177   -44.998 1.00 66.79  ? 149  GLN A NE2 1 
ATOM   1198 N  N   . ASP A 1 166 ? -8.036  12.265  -43.366 1.00 23.05  ? 150  ASP A N   1 
ATOM   1199 C  CA  . ASP A 1 166 ? -7.442  13.516  -43.842 1.00 22.62  ? 150  ASP A CA  1 
ATOM   1200 C  C   . ASP A 1 166 ? -5.920  13.351  -43.652 1.00 27.28  ? 150  ASP A C   1 
ATOM   1201 O  O   . ASP A 1 166 ? -5.490  12.761  -42.646 1.00 24.99  ? 150  ASP A O   1 
ATOM   1202 C  CB  . ASP A 1 166 ? -7.954  14.709  -43.002 1.00 23.39  ? 150  ASP A CB  1 
ATOM   1203 C  CG  . ASP A 1 166 ? -7.689  16.078  -43.602 1.00 26.12  ? 150  ASP A CG  1 
ATOM   1204 O  OD1 . ASP A 1 166 ? -6.496  16.429  -43.797 1.00 27.66  ? 150  ASP A OD1 1 
ATOM   1205 O  OD2 . ASP A 1 166 ? -8.667  16.808  -43.868 1.00 26.41  ? 150  ASP A OD2 1 
ATOM   1206 N  N   . VAL A 1 167 ? -5.115  13.865  -44.599 1.00 26.97  ? 151  VAL A N   1 
ATOM   1207 C  CA  . VAL A 1 167 ? -3.645  13.846  -44.477 1.00 29.25  ? 151  VAL A CA  1 
ATOM   1208 C  C   . VAL A 1 167 ? -3.247  14.637  -43.192 1.00 30.87  ? 151  VAL A C   1 
ATOM   1209 O  O   . VAL A 1 167 ? -2.241  14.313  -42.583 1.00 31.17  ? 151  VAL A O   1 
ATOM   1210 C  CB  . VAL A 1 167 ? -2.901  14.324  -45.758 1.00 36.00  ? 151  VAL A CB  1 
ATOM   1211 C  CG1 . VAL A 1 167 ? -1.395  14.084  -45.644 1.00 37.74  ? 151  VAL A CG1 1 
ATOM   1212 C  CG2 . VAL A 1 167 ? -3.438  13.617  -47.002 1.00 36.16  ? 151  VAL A CG2 1 
ATOM   1213 N  N   . ARG A 1 168 ? -4.108  15.578  -42.717 1.00 26.26  ? 152  ARG A N   1 
ATOM   1214 C  CA  . ARG A 1 168 ? -3.886  16.281  -41.445 1.00 25.12  ? 152  ARG A CA  1 
ATOM   1215 C  C   . ARG A 1 168 ? -4.456  15.327  -40.380 1.00 27.77  ? 152  ARG A C   1 
ATOM   1216 O  O   . ARG A 1 168 ? -5.608  15.468  -39.932 1.00 24.23  ? 152  ARG A O   1 
ATOM   1217 C  CB  . ARG A 1 168 ? -4.580  17.659  -41.418 1.00 23.80  ? 152  ARG A CB  1 
ATOM   1218 C  CG  . ARG A 1 168 ? -4.102  18.648  -42.494 1.00 28.11  ? 152  ARG A CG  1 
ATOM   1219 C  CD  . ARG A 1 168 ? -5.071  19.813  -42.617 1.00 28.21  ? 152  ARG A CD  1 
ATOM   1220 N  NE  . ARG A 1 168 ? -6.381  19.384  -43.137 1.00 23.46  ? 152  ARG A NE  1 
ATOM   1221 C  CZ  . ARG A 1 168 ? -7.349  20.210  -43.516 1.00 28.58  ? 152  ARG A CZ  1 
ATOM   1222 N  NH1 . ARG A 1 168 ? -7.180  21.529  -43.435 1.00 22.50  ? 152  ARG A NH1 1 
ATOM   1223 N  NH2 . ARG A 1 168 ? -8.498  19.727  -43.976 1.00 26.25  ? 152  ARG A NH2 1 
ATOM   1224 N  N   . TYR A 1 169 ? -3.646  14.299  -40.034 1.00 26.54  ? 153  TYR A N   1 
ATOM   1225 C  CA  . TYR A 1 169 ? -3.982  13.185  -39.138 1.00 26.02  ? 153  TYR A CA  1 
ATOM   1226 C  C   . TYR A 1 169 ? -4.565  13.641  -37.787 1.00 25.95  ? 153  TYR A C   1 
ATOM   1227 O  O   . TYR A 1 169 ? -5.401  12.942  -37.222 1.00 24.46  ? 153  TYR A O   1 
ATOM   1228 C  CB  . TYR A 1 169 ? -2.758  12.240  -38.971 1.00 29.59  ? 153  TYR A CB  1 
ATOM   1229 C  CG  . TYR A 1 169 ? -1.605  12.885  -38.228 1.00 35.58  ? 153  TYR A CG  1 
ATOM   1230 C  CD1 . TYR A 1 169 ? -0.685  13.696  -38.894 1.00 39.10  ? 153  TYR A CD1 1 
ATOM   1231 C  CD2 . TYR A 1 169 ? -1.473  12.747  -36.851 1.00 37.15  ? 153  TYR A CD2 1 
ATOM   1232 C  CE1 . TYR A 1 169 ? 0.331   14.358  -38.201 1.00 41.89  ? 153  TYR A CE1 1 
ATOM   1233 C  CE2 . TYR A 1 169 ? -0.461  13.399  -36.149 1.00 39.23  ? 153  TYR A CE2 1 
ATOM   1234 C  CZ  . TYR A 1 169 ? 0.447   14.195  -36.829 1.00 50.48  ? 153  TYR A CZ  1 
ATOM   1235 O  OH  . TYR A 1 169 ? 1.451   14.823  -36.130 1.00 54.88  ? 153  TYR A OH  1 
ATOM   1236 N  N   . TYR A 1 170 ? -4.147  14.836  -37.299 1.00 21.85  ? 154  TYR A N   1 
ATOM   1237 C  CA  . TYR A 1 170 ? -4.631  15.436  -36.047 1.00 20.74  ? 154  TYR A CA  1 
ATOM   1238 C  C   . TYR A 1 170 ? -6.120  15.832  -36.079 1.00 21.28  ? 154  TYR A C   1 
ATOM   1239 O  O   . TYR A 1 170 ? -6.675  16.149  -35.029 1.00 20.54  ? 154  TYR A O   1 
ATOM   1240 C  CB  . TYR A 1 170 ? -3.733  16.606  -35.581 1.00 23.37  ? 154  TYR A CB  1 
ATOM   1241 C  CG  . TYR A 1 170 ? -3.437  17.615  -36.669 1.00 25.94  ? 154  TYR A CG  1 
ATOM   1242 C  CD1 . TYR A 1 170 ? -2.359  17.443  -37.533 1.00 28.73  ? 154  TYR A CD1 1 
ATOM   1243 C  CD2 . TYR A 1 170 ? -4.269  18.714  -36.873 1.00 27.07  ? 154  TYR A CD2 1 
ATOM   1244 C  CE1 . TYR A 1 170 ? -2.114  18.336  -38.571 1.00 31.42  ? 154  TYR A CE1 1 
ATOM   1245 C  CE2 . TYR A 1 170 ? -4.008  19.637  -37.884 1.00 28.48  ? 154  TYR A CE2 1 
ATOM   1246 C  CZ  . TYR A 1 170 ? -2.924  19.448  -38.723 1.00 37.42  ? 154  TYR A CZ  1 
ATOM   1247 O  OH  . TYR A 1 170 ? -2.669  20.330  -39.736 1.00 42.22  ? 154  TYR A OH  1 
ATOM   1248 N  N   . LEU A 1 171 ? -6.764  15.825  -37.278 1.00 16.32  ? 155  LEU A N   1 
ATOM   1249 C  CA  . LEU A 1 171 ? -8.205  16.094  -37.422 1.00 15.80  ? 155  LEU A CA  1 
ATOM   1250 C  C   . LEU A 1 171 ? -9.034  14.778  -37.413 1.00 18.62  ? 155  LEU A C   1 
ATOM   1251 O  O   . LEU A 1 171 ? -10.262 14.834  -37.296 1.00 17.27  ? 155  LEU A O   1 
ATOM   1252 C  CB  . LEU A 1 171 ? -8.488  16.850  -38.731 1.00 15.85  ? 155  LEU A CB  1 
ATOM   1253 C  CG  . LEU A 1 171 ? -7.838  18.232  -38.891 1.00 21.46  ? 155  LEU A CG  1 
ATOM   1254 C  CD1 . LEU A 1 171 ? -8.281  18.883  -40.197 1.00 23.99  ? 155  LEU A CD1 1 
ATOM   1255 C  CD2 . LEU A 1 171 ? -8.112  19.128  -37.678 1.00 21.22  ? 155  LEU A CD2 1 
ATOM   1256 N  N   . ASN A 1 172 ? -8.368  13.600  -37.579 1.00 19.21  ? 156  ASN A N   1 
ATOM   1257 C  CA  . ASN A 1 172 ? -9.044  12.294  -37.644 1.00 18.45  ? 156  ASN A CA  1 
ATOM   1258 C  C   . ASN A 1 172 ? -9.334  11.739  -36.237 1.00 20.16  ? 156  ASN A C   1 
ATOM   1259 O  O   . ASN A 1 172 ? -8.993  10.596  -35.891 1.00 18.45  ? 156  ASN A O   1 
ATOM   1260 C  CB  . ASN A 1 172 ? -8.221  11.295  -38.482 1.00 20.60  ? 156  ASN A CB  1 
ATOM   1261 C  CG  . ASN A 1 172 ? -7.958  11.737  -39.899 1.00 24.53  ? 156  ASN A CG  1 
ATOM   1262 O  OD1 . ASN A 1 172 ? -8.800  12.378  -40.561 1.00 21.20  ? 156  ASN A OD1 1 
ATOM   1263 N  ND2 . ASN A 1 172 ? -6.772  11.394  -40.396 1.00 21.67  ? 156  ASN A ND2 1 
ATOM   1264 N  N   . GLY A 1 173 ? -9.971  12.570  -35.435 1.00 15.41  ? 157  GLY A N   1 
ATOM   1265 C  CA  . GLY A 1 173 ? -10.224 12.253  -34.044 1.00 15.97  ? 157  GLY A CA  1 
ATOM   1266 C  C   . GLY A 1 173 ? -10.904 13.403  -33.340 1.00 18.21  ? 157  GLY A C   1 
ATOM   1267 O  O   . GLY A 1 173 ? -11.393 14.330  -33.985 1.00 17.08  ? 157  GLY A O   1 
ATOM   1268 N  N   . MET A 1 174 ? -10.973 13.310  -32.024 1.00 14.78  ? 158  MET A N   1 
ATOM   1269 C  CA  . MET A 1 174 ? -11.673 14.287  -31.214 1.00 14.50  ? 158  MET A CA  1 
ATOM   1270 C  C   . MET A 1 174 ? -10.826 14.865  -30.121 1.00 17.17  ? 158  MET A C   1 
ATOM   1271 O  O   . MET A 1 174 ? -10.253 14.119  -29.325 1.00 16.54  ? 158  MET A O   1 
ATOM   1272 C  CB  . MET A 1 174 ? -12.907 13.624  -30.593 1.00 15.50  ? 158  MET A CB  1 
ATOM   1273 C  CG  . MET A 1 174 ? -13.773 14.590  -29.757 1.00 17.18  ? 158  MET A CG  1 
ATOM   1274 S  SD  . MET A 1 174 ? -15.302 13.821  -29.150 1.00 19.12  ? 158  MET A SD  1 
ATOM   1275 C  CE  . MET A 1 174 ? -16.073 13.381  -30.713 1.00 15.77  ? 158  MET A CE  1 
ATOM   1276 N  N   . LEU A 1 175 ? -10.841 16.206  -30.020 1.00 13.51  ? 159  LEU A N   1 
ATOM   1277 C  CA  . LEU A 1 175 ? -10.165 16.872  -28.928 1.00 13.57  ? 159  LEU A CA  1 
ATOM   1278 C  C   . LEU A 1 175 ? -11.013 16.718  -27.678 1.00 17.38  ? 159  LEU A C   1 
ATOM   1279 O  O   . LEU A 1 175 ? -12.223 16.988  -27.701 1.00 18.06  ? 159  LEU A O   1 
ATOM   1280 C  CB  . LEU A 1 175 ? -9.988  18.390  -29.213 1.00 12.71  ? 159  LEU A CB  1 
ATOM   1281 C  CG  . LEU A 1 175 ? -9.440  19.228  -28.027 1.00 16.94  ? 159  LEU A CG  1 
ATOM   1282 C  CD1 . LEU A 1 175 ? -7.979  18.861  -27.692 1.00 18.25  ? 159  LEU A CD1 1 
ATOM   1283 C  CD2 . LEU A 1 175 ? -9.580  20.745  -28.285 1.00 16.47  ? 159  LEU A CD2 1 
ATOM   1284 N  N   . LEU A 1 176 ? -10.375 16.340  -26.591 1.00 16.98  ? 160  LEU A N   1 
ATOM   1285 C  CA  . LEU A 1 176 ? -10.957 16.396  -25.247 1.00 17.91  ? 160  LEU A CA  1 
ATOM   1286 C  C   . LEU A 1 176 ? -10.055 17.376  -24.501 1.00 23.25  ? 160  LEU A C   1 
ATOM   1287 O  O   . LEU A 1 176 ? -8.825  17.217  -24.470 1.00 21.85  ? 160  LEU A O   1 
ATOM   1288 C  CB  . LEU A 1 176 ? -11.096 15.042  -24.534 1.00 17.51  ? 160  LEU A CB  1 
ATOM   1289 C  CG  . LEU A 1 176 ? -12.039 14.003  -25.210 1.00 21.71  ? 160  LEU A CG  1 
ATOM   1290 C  CD1 . LEU A 1 176 ? -12.047 12.681  -24.415 1.00 22.82  ? 160  LEU A CD1 1 
ATOM   1291 C  CD2 . LEU A 1 176 ? -13.508 14.534  -25.337 1.00 22.65  ? 160  LEU A CD2 1 
ATOM   1292 N  N   . GLU A 1 177 ? -10.670 18.433  -23.970 1.00 20.90  ? 161  GLU A N   1 
ATOM   1293 C  CA  . GLU A 1 177 ? -9.954  19.527  -23.349 1.00 22.00  ? 161  GLU A CA  1 
ATOM   1294 C  C   . GLU A 1 177 ? -10.460 19.843  -21.963 1.00 27.08  ? 161  GLU A C   1 
ATOM   1295 O  O   . GLU A 1 177 ? -11.670 19.985  -21.741 1.00 25.09  ? 161  GLU A O   1 
ATOM   1296 C  CB  . GLU A 1 177 ? -10.057 20.773  -24.249 1.00 23.16  ? 161  GLU A CB  1 
ATOM   1297 C  CG  . GLU A 1 177 ? -9.292  21.980  -23.744 1.00 29.52  ? 161  GLU A CG  1 
ATOM   1298 C  CD  . GLU A 1 177 ? -9.558  23.195  -24.601 1.00 37.97  ? 161  GLU A CD  1 
ATOM   1299 O  OE1 . GLU A 1 177 ? -8.826  23.383  -25.594 1.00 37.95  ? 161  GLU A OE1 1 
ATOM   1300 O  OE2 . GLU A 1 177 ? -10.540 23.917  -24.322 1.00 38.70  ? 161  GLU A OE2 1 
ATOM   1301 N  N   . VAL A 1 178 ? -9.506  19.971  -21.036 1.00 25.79  ? 162  VAL A N   1 
ATOM   1302 C  CA  . VAL A 1 178 ? -9.780  20.385  -19.676 1.00 26.50  ? 162  VAL A CA  1 
ATOM   1303 C  C   . VAL A 1 178 ? -9.284  21.824  -19.625 1.00 31.11  ? 162  VAL A C   1 
ATOM   1304 O  O   . VAL A 1 178 ? -8.126  22.099  -19.944 1.00 31.10  ? 162  VAL A O   1 
ATOM   1305 C  CB  . VAL A 1 178 ? -9.092  19.493  -18.604 1.00 31.25  ? 162  VAL A CB  1 
ATOM   1306 C  CG1 . VAL A 1 178 ? -9.369  20.042  -17.204 1.00 31.95  ? 162  VAL A CG1 1 
ATOM   1307 C  CG2 . VAL A 1 178 ? -9.554  18.038  -18.719 1.00 30.59  ? 162  VAL A CG2 1 
ATOM   1308 N  N   . ASN A 1 179 ? -10.166 22.733  -19.265 1.00 30.32  ? 163  ASN A N   1 
ATOM   1309 C  CA  . ASN A 1 179 ? -9.848  24.155  -19.129 1.00 32.47  ? 163  ASN A CA  1 
ATOM   1310 C  C   . ASN A 1 179 ? -10.720 24.671  -18.009 1.00 39.17  ? 163  ASN A C   1 
ATOM   1311 O  O   . ASN A 1 179 ? -11.947 24.703  -18.129 1.00 36.33  ? 163  ASN A O   1 
ATOM   1312 C  CB  . ASN A 1 179 ? -10.060 24.906  -20.439 1.00 34.96  ? 163  ASN A CB  1 
ATOM   1313 C  CG  . ASN A 1 179 ? -9.091  26.052  -20.658 1.00 64.66  ? 163  ASN A CG  1 
ATOM   1314 O  OD1 . ASN A 1 179 ? -8.270  26.402  -19.797 1.00 58.43  ? 163  ASN A OD1 1 
ATOM   1315 N  ND2 . ASN A 1 179 ? -9.157  26.653  -21.835 1.00 57.76  ? 163  ASN A ND2 1 
ATOM   1316 N  N   . GLY A 1 180 ? -10.073 24.986  -16.894 1.00 41.54  ? 164  GLY A N   1 
ATOM   1317 C  CA  . GLY A 1 180 ? -10.751 25.346  -15.655 1.00 43.29  ? 164  GLY A CA  1 
ATOM   1318 C  C   . GLY A 1 180 ? -11.234 24.031  -15.068 1.00 48.75  ? 164  GLY A C   1 
ATOM   1319 O  O   . GLY A 1 180 ? -10.478 23.051  -15.028 1.00 49.43  ? 164  GLY A O   1 
ATOM   1320 N  N   . GLY A 1 181 ? -12.503 23.981  -14.691 1.00 43.95  ? 165  GLY A N   1 
ATOM   1321 C  CA  . GLY A 1 181 ? -13.103 22.747  -14.198 1.00 41.80  ? 165  GLY A CA  1 
ATOM   1322 C  C   . GLY A 1 181 ? -13.891 22.059  -15.294 1.00 41.47  ? 165  GLY A C   1 
ATOM   1323 O  O   . GLY A 1 181 ? -14.370 20.940  -15.110 1.00 42.05  ? 165  GLY A O   1 
ATOM   1324 N  N   . THR A 1 182 ? -14.024 22.745  -16.450 1.00 34.19  ? 166  THR A N   1 
ATOM   1325 C  CA  . THR A 1 182 ? -14.792 22.350  -17.622 1.00 31.32  ? 166  THR A CA  1 
ATOM   1326 C  C   . THR A 1 182 ? -14.139 21.233  -18.458 1.00 29.62  ? 166  THR A C   1 
ATOM   1327 O  O   . THR A 1 182 ? -12.921 21.191  -18.618 1.00 29.21  ? 166  THR A O   1 
ATOM   1328 C  CB  . THR A 1 182 ? -15.059 23.602  -18.507 1.00 38.69  ? 166  THR A CB  1 
ATOM   1329 O  OG1 . THR A 1 182 ? -15.637 24.642  -17.707 1.00 43.15  ? 166  THR A OG1 1 
ATOM   1330 C  CG2 . THR A 1 182 ? -15.970 23.312  -19.715 1.00 37.48  ? 166  THR A CG2 1 
ATOM   1331 N  N   . LEU A 1 183 ? -14.978 20.373  -19.020 1.00 23.42  ? 167  LEU A N   1 
ATOM   1332 C  CA  . LEU A 1 183 ? -14.563 19.347  -19.976 1.00 21.08  ? 167  LEU A CA  1 
ATOM   1333 C  C   . LEU A 1 183 ? -15.240 19.687  -21.294 1.00 24.87  ? 167  LEU A C   1 
ATOM   1334 O  O   . LEU A 1 183 ? -16.467 19.848  -21.351 1.00 24.60  ? 167  LEU A O   1 
ATOM   1335 C  CB  . LEU A 1 183 ? -14.898 17.927  -19.546 1.00 20.18  ? 167  LEU A CB  1 
ATOM   1336 C  CG  . LEU A 1 183 ? -14.368 16.800  -20.480 1.00 23.59  ? 167  LEU A CG  1 
ATOM   1337 C  CD1 . LEU A 1 183 ? -12.836 16.863  -20.668 1.00 22.75  ? 167  LEU A CD1 1 
ATOM   1338 C  CD2 . LEU A 1 183 ? -14.777 15.433  -19.974 1.00 26.70  ? 167  LEU A CD2 1 
ATOM   1339 N  N   . ARG A 1 184 ? -14.435 19.804  -22.349 1.00 22.22  ? 168  ARG A N   1 
ATOM   1340 C  CA  . ARG A 1 184 ? -14.944 20.166  -23.666 1.00 19.81  ? 168  ARG A CA  1 
ATOM   1341 C  C   . ARG A 1 184 ? -14.488 19.188  -24.726 1.00 22.34  ? 168  ARG A C   1 
ATOM   1342 O  O   . ARG A 1 184 ? -13.337 18.740  -24.712 1.00 22.83  ? 168  ARG A O   1 
ATOM   1343 C  CB  . ARG A 1 184 ? -14.497 21.602  -24.011 1.00 20.29  ? 168  ARG A CB  1 
ATOM   1344 C  CG  . ARG A 1 184 ? -14.790 22.082  -25.433 1.00 27.70  ? 168  ARG A CG  1 
ATOM   1345 C  CD  . ARG A 1 184 ? -14.195 23.458  -25.631 1.00 28.18  ? 168  ARG A CD  1 
ATOM   1346 N  NE  . ARG A 1 184 ? -14.994 24.478  -24.952 1.00 35.30  ? 168  ARG A NE  1 
ATOM   1347 C  CZ  . ARG A 1 184 ? -14.703 25.774  -24.922 1.00 52.70  ? 168  ARG A CZ  1 
ATOM   1348 N  NH1 . ARG A 1 184 ? -13.607 26.233  -25.519 1.00 37.37  ? 168  ARG A NH1 1 
ATOM   1349 N  NH2 . ARG A 1 184 ? -15.512 26.624  -24.309 1.00 42.70  ? 168  ARG A NH2 1 
ATOM   1350 N  N   . SER A 1 185 ? -15.381 18.911  -25.675 1.00 17.38  ? 169  SER A N   1 
ATOM   1351 C  CA  . SER A 1 185 ? -15.070 18.086  -26.846 1.00 16.20  ? 169  SER A CA  1 
ATOM   1352 C  C   . SER A 1 185 ? -15.106 19.003  -28.038 1.00 18.46  ? 169  SER A C   1 
ATOM   1353 O  O   . SER A 1 185 ? -15.959 19.897  -28.109 1.00 18.23  ? 169  SER A O   1 
ATOM   1354 C  CB  . SER A 1 185 ? -16.088 16.968  -27.038 1.00 17.50  ? 169  SER A CB  1 
ATOM   1355 O  OG  . SER A 1 185 ? -17.407 17.481  -27.061 1.00 19.60  ? 169  SER A OG  1 
ATOM   1356 N  N   . VAL A 1 186 ? -14.186 18.786  -28.978 1.00 15.37  ? 170  VAL A N   1 
ATOM   1357 C  CA  . VAL A 1 186 ? -14.134 19.562  -30.211 1.00 14.12  ? 170  VAL A CA  1 
ATOM   1358 C  C   . VAL A 1 186 ? -13.771 18.608  -31.332 1.00 16.62  ? 170  VAL A C   1 
ATOM   1359 O  O   . VAL A 1 186 ? -12.832 17.805  -31.209 1.00 15.63  ? 170  VAL A O   1 
ATOM   1360 C  CB  . VAL A 1 186 ? -13.165 20.795  -30.213 1.00 17.26  ? 170  VAL A CB  1 
ATOM   1361 C  CG1 . VAL A 1 186 ? -13.355 21.628  -31.487 1.00 16.78  ? 170  VAL A CG1 1 
ATOM   1362 C  CG2 . VAL A 1 186 ? -13.322 21.679  -28.966 1.00 17.54  ? 170  VAL A CG2 1 
ATOM   1363 N  N   . ALA A 1 187 ? -14.495 18.735  -32.446 1.00 14.09  ? 171  ALA A N   1 
ATOM   1364 C  CA  . ALA A 1 187 ? -14.221 17.959  -33.652 1.00 13.76  ? 171  ALA A CA  1 
ATOM   1365 C  C   . ALA A 1 187 ? -14.407 18.851  -34.871 1.00 16.52  ? 171  ALA A C   1 
ATOM   1366 O  O   . ALA A 1 187 ? -15.349 19.656  -34.917 1.00 14.89  ? 171  ALA A O   1 
ATOM   1367 C  CB  . ALA A 1 187 ? -15.153 16.761  -33.734 1.00 13.88  ? 171  ALA A CB  1 
ATOM   1368 N  N   . THR A 1 188 ? -13.495 18.711  -35.847 1.00 13.85  ? 172  THR A N   1 
ATOM   1369 C  CA  . THR A 1 188 ? -13.535 19.449  -37.110 1.00 14.07  ? 172  THR A CA  1 
ATOM   1370 C  C   . THR A 1 188 ? -12.856 18.677  -38.222 1.00 18.77  ? 172  THR A C   1 
ATOM   1371 O  O   . THR A 1 188 ? -11.928 17.888  -37.981 1.00 17.92  ? 172  THR A O   1 
ATOM   1372 C  CB  . THR A 1 188 ? -12.965 20.870  -36.972 1.00 17.68  ? 172  THR A CB  1 
ATOM   1373 O  OG1 . THR A 1 188 ? -13.193 21.558  -38.208 1.00 20.20  ? 172  THR A OG1 1 
ATOM   1374 C  CG2 . THR A 1 188 ? -11.457 20.869  -36.619 1.00 17.06  ? 172  THR A CG2 1 
ATOM   1375 N  N   . ASP A 1 189 ? -13.329 18.910  -39.448 1.00 15.36  ? 173  ASP A N   1 
ATOM   1376 C  CA  . ASP A 1 189 ? -12.753 18.262  -40.623 1.00 16.84  ? 173  ASP A CA  1 
ATOM   1377 C  C   . ASP A 1 189 ? -12.126 19.337  -41.534 1.00 23.01  ? 173  ASP A C   1 
ATOM   1378 O  O   . ASP A 1 189 ? -11.834 19.081  -42.697 1.00 22.55  ? 173  ASP A O   1 
ATOM   1379 C  CB  . ASP A 1 189 ? -13.835 17.432  -41.349 1.00 17.47  ? 173  ASP A CB  1 
ATOM   1380 C  CG  . ASP A 1 189 ? -15.060 18.206  -41.841 1.00 19.99  ? 173  ASP A CG  1 
ATOM   1381 O  OD1 . ASP A 1 189 ? -15.088 19.470  -41.689 1.00 19.08  ? 173  ASP A OD1 1 
ATOM   1382 O  OD2 . ASP A 1 189 ? -15.987 17.562  -42.365 1.00 20.46  ? 173  ASP A OD2 1 
ATOM   1383 N  N   . GLY A 1 190 ? -12.011 20.555  -41.004 1.00 22.54  ? 174  GLY A N   1 
ATOM   1384 C  CA  . GLY A 1 190 ? -11.484 21.703  -41.732 1.00 24.40  ? 174  GLY A CA  1 
ATOM   1385 C  C   . GLY A 1 190 ? -12.539 22.508  -42.470 1.00 28.54  ? 174  GLY A C   1 
ATOM   1386 O  O   . GLY A 1 190 ? -12.256 23.619  -42.914 1.00 30.60  ? 174  GLY A O   1 
ATOM   1387 N  N   . HIS A 1 191 ? -13.769 21.981  -42.575 1.00 24.10  ? 175  HIS A N   1 
ATOM   1388 C  CA  . HIS A 1 191 ? -14.908 22.611  -43.244 1.00 23.95  ? 175  HIS A CA  1 
ATOM   1389 C  C   . HIS A 1 191 ? -16.019 22.987  -42.262 1.00 25.23  ? 175  HIS A C   1 
ATOM   1390 O  O   . HIS A 1 191 ? -16.681 24.006  -42.449 1.00 26.05  ? 175  HIS A O   1 
ATOM   1391 C  CB  . HIS A 1 191 ? -15.464 21.697  -44.354 1.00 25.62  ? 175  HIS A CB  1 
ATOM   1392 C  CG  . HIS A 1 191 ? -14.397 21.147  -45.254 1.00 30.07  ? 175  HIS A CG  1 
ATOM   1393 N  ND1 . HIS A 1 191 ? -13.698 21.967  -46.133 1.00 32.81  ? 175  HIS A ND1 1 
ATOM   1394 C  CD2 . HIS A 1 191 ? -13.922 19.884  -45.361 1.00 31.89  ? 175  HIS A CD2 1 
ATOM   1395 C  CE1 . HIS A 1 191 ? -12.824 21.182  -46.740 1.00 32.47  ? 175  HIS A CE1 1 
ATOM   1396 N  NE2 . HIS A 1 191 ? -12.920 19.917  -46.310 1.00 32.55  ? 175  HIS A NE2 1 
ATOM   1397 N  N   . ARG A 1 192 ? -16.269 22.138  -41.267 1.00 19.06  ? 176  ARG A N   1 
ATOM   1398 C  CA  . ARG A 1 192 ? -17.295 22.384  -40.247 1.00 17.19  ? 176  ARG A CA  1 
ATOM   1399 C  C   . ARG A 1 192 ? -16.759 21.927  -38.907 1.00 19.20  ? 176  ARG A C   1 
ATOM   1400 O  O   . ARG A 1 192 ? -15.817 21.125  -38.868 1.00 17.20  ? 176  ARG A O   1 
ATOM   1401 C  CB  . ARG A 1 192 ? -18.658 21.738  -40.575 1.00 15.72  ? 176  ARG A CB  1 
ATOM   1402 C  CG  . ARG A 1 192 ? -18.566 20.367  -41.270 1.00 18.84  ? 176  ARG A CG  1 
ATOM   1403 C  CD  . ARG A 1 192 ? -18.396 19.248  -40.264 1.00 16.29  ? 176  ARG A CD  1 
ATOM   1404 N  NE  . ARG A 1 192 ? -18.372 17.939  -40.924 1.00 18.55  ? 176  ARG A NE  1 
ATOM   1405 C  CZ  . ARG A 1 192 ? -19.450 17.208  -41.184 1.00 23.28  ? 176  ARG A CZ  1 
ATOM   1406 N  NH1 . ARG A 1 192 ? -20.653 17.644  -40.838 1.00 16.27  ? 176  ARG A NH1 1 
ATOM   1407 N  NH2 . ARG A 1 192 ? -19.329 16.016  -41.756 1.00 15.91  ? 176  ARG A NH2 1 
ATOM   1408 N  N   . LEU A 1 193 ? -17.329 22.454  -37.820 1.00 14.60  ? 177  LEU A N   1 
ATOM   1409 C  CA  . LEU A 1 193 ? -16.842 22.147  -36.471 1.00 13.90  ? 177  LEU A CA  1 
ATOM   1410 C  C   . LEU A 1 193 ? -18.018 21.963  -35.523 1.00 15.84  ? 177  LEU A C   1 
ATOM   1411 O  O   . LEU A 1 193 ? -19.079 22.562  -35.696 1.00 14.50  ? 177  LEU A O   1 
ATOM   1412 C  CB  . LEU A 1 193 ? -15.886 23.297  -36.001 1.00 13.72  ? 177  LEU A CB  1 
ATOM   1413 C  CG  . LEU A 1 193 ? -15.322 23.240  -34.532 1.00 17.37  ? 177  LEU A CG  1 
ATOM   1414 C  CD1 . LEU A 1 193 ? -13.940 23.898  -34.447 1.00 17.84  ? 177  LEU A CD1 1 
ATOM   1415 C  CD2 . LEU A 1 193 ? -16.274 23.926  -33.542 1.00 18.51  ? 177  LEU A CD2 1 
ATOM   1416 N  N   . ALA A 1 194 ? -17.816 21.111  -34.523 1.00 13.50  ? 178  ALA A N   1 
ATOM   1417 C  CA  . ALA A 1 194 ? -18.767 20.877  -33.439 1.00 12.99  ? 178  ALA A CA  1 
ATOM   1418 C  C   . ALA A 1 194 ? -17.989 20.930  -32.144 1.00 16.97  ? 178  ALA A C   1 
ATOM   1419 O  O   . ALA A 1 194 ? -16.867 20.396  -32.047 1.00 16.24  ? 178  ALA A O   1 
ATOM   1420 C  CB  . ALA A 1 194 ? -19.414 19.510  -33.580 1.00 12.41  ? 178  ALA A CB  1 
ATOM   1421 N  N   . MET A 1 195 ? -18.616 21.502  -31.133 1.00 13.54  ? 179  MET A N   1 
ATOM   1422 C  CA  . MET A 1 195 ? -18.036 21.543  -29.806 1.00 15.36  ? 179  MET A CA  1 
ATOM   1423 C  C   . MET A 1 195 ? -19.127 21.425  -28.784 1.00 19.25  ? 179  MET A C   1 
ATOM   1424 O  O   . MET A 1 195 ? -20.237 21.893  -29.023 1.00 16.87  ? 179  MET A O   1 
ATOM   1425 C  CB  . MET A 1 195 ? -17.128 22.783  -29.579 1.00 18.40  ? 179  MET A CB  1 
ATOM   1426 C  CG  . MET A 1 195 ? -17.819 24.098  -29.761 1.00 23.48  ? 179  MET A CG  1 
ATOM   1427 S  SD  . MET A 1 195 ? -16.710 25.521  -29.532 1.00 30.39  ? 179  MET A SD  1 
ATOM   1428 C  CE  . MET A 1 195 ? -16.361 25.379  -27.912 1.00 26.01  ? 179  MET A CE  1 
ATOM   1429 N  N   . CYS A 1 196 ? -18.792 20.852  -27.633 1.00 18.95  ? 180  CYS A N   1 
ATOM   1430 C  CA  . CYS A 1 196 ? -19.708 20.687  -26.511 1.00 19.93  ? 180  CYS A CA  1 
ATOM   1431 C  C   . CYS A 1 196 ? -18.898 20.854  -25.237 1.00 22.43  ? 180  CYS A C   1 
ATOM   1432 O  O   . CYS A 1 196 ? -17.785 20.325  -25.147 1.00 20.22  ? 180  CYS A O   1 
ATOM   1433 C  CB  . CYS A 1 196 ? -20.416 19.332  -26.565 1.00 20.51  ? 180  CYS A CB  1 
ATOM   1434 S  SG  . CYS A 1 196 ? -21.828 19.191  -25.421 1.00 24.54  ? 180  CYS A SG  1 
ATOM   1435 N  N   . SER A 1 197 ? -19.440 21.598  -24.264 1.00 21.54  ? 181  SER A N   1 
ATOM   1436 C  CA  . SER A 1 197 ? -18.747 21.885  -22.999 1.00 23.10  ? 181  SER A CA  1 
ATOM   1437 C  C   . SER A 1 197 ? -19.633 21.550  -21.806 1.00 29.28  ? 181  SER A C   1 
ATOM   1438 O  O   . SER A 1 197 ? -20.835 21.839  -21.821 1.00 28.36  ? 181  SER A O   1 
ATOM   1439 C  CB  . SER A 1 197 ? -18.333 23.353  -22.924 1.00 27.07  ? 181  SER A CB  1 
ATOM   1440 O  OG  . SER A 1 197 ? -17.554 23.758  -24.038 1.00 30.58  ? 181  SER A OG  1 
ATOM   1441 N  N   . LEU A 1 198 ? -19.041 20.957  -20.769 1.00 28.12  ? 182  LEU A N   1 
ATOM   1442 C  CA  . LEU A 1 198 ? -19.793 20.617  -19.568 1.00 30.93  ? 182  LEU A CA  1 
ATOM   1443 C  C   . LEU A 1 198 ? -18.989 21.022  -18.328 1.00 36.41  ? 182  LEU A C   1 
ATOM   1444 O  O   . LEU A 1 198 ? -17.767 20.862  -18.317 1.00 34.35  ? 182  LEU A O   1 
ATOM   1445 C  CB  . LEU A 1 198 ? -20.172 19.110  -19.553 1.00 31.53  ? 182  LEU A CB  1 
ATOM   1446 C  CG  . LEU A 1 198 ? -21.286 18.664  -20.558 1.00 38.20  ? 182  LEU A CG  1 
ATOM   1447 C  CD1 . LEU A 1 198 ? -21.477 17.154  -20.570 1.00 37.93  ? 182  LEU A CD1 1 
ATOM   1448 C  CD2 . LEU A 1 198 ? -22.640 19.362  -20.288 1.00 43.90  ? 182  LEU A CD2 1 
ATOM   1449 N  N   . ASP A 1 199 ? -19.644 21.615  -17.321 1.00 36.85  ? 183  ASP A N   1 
ATOM   1450 C  CA  . ASP A 1 199 ? -18.905 21.991  -16.117 1.00 39.45  ? 183  ASP A CA  1 
ATOM   1451 C  C   . ASP A 1 199 ? -18.759 20.750  -15.243 1.00 45.55  ? 183  ASP A C   1 
ATOM   1452 O  O   . ASP A 1 199 ? -19.692 20.364  -14.540 1.00 48.76  ? 183  ASP A O   1 
ATOM   1453 C  CB  . ASP A 1 199 ? -19.472 23.253  -15.407 1.00 43.26  ? 183  ASP A CB  1 
ATOM   1454 C  CG  . ASP A 1 199 ? -20.892 23.171  -14.883 1.00 60.84  ? 183  ASP A CG  1 
ATOM   1455 O  OD1 . ASP A 1 199 ? -21.737 22.525  -15.547 1.00 62.71  ? 183  ASP A OD1 1 
ATOM   1456 O  OD2 . ASP A 1 199 ? -21.172 23.793  -13.834 1.00 67.78  ? 183  ASP A OD2 1 
ATOM   1457 N  N   . ALA A 1 200 ? -17.609 20.066  -15.397 1.00 40.02  ? 184  ALA A N   1 
ATOM   1458 C  CA  . ALA A 1 200 ? -17.249 18.801  -14.746 1.00 40.33  ? 184  ALA A CA  1 
ATOM   1459 C  C   . ALA A 1 200 ? -16.512 18.925  -13.397 1.00 46.28  ? 184  ALA A C   1 
ATOM   1460 O  O   . ALA A 1 200 ? -16.358 17.911  -12.701 1.00 45.38  ? 184  ALA A O   1 
ATOM   1461 C  CB  . ALA A 1 200 ? -16.426 17.953  -15.704 1.00 40.24  ? 184  ALA A CB  1 
ATOM   1462 N  N   . GLN A 1 201 ? -16.034 20.143  -13.055 1.00 43.95  ? 185  GLN A N   1 
ATOM   1463 C  CA  . GLN A 1 201 ? -15.294 20.445  -11.823 1.00 45.82  ? 185  GLN A CA  1 
ATOM   1464 C  C   . GLN A 1 201 ? -14.151 19.436  -11.609 1.00 48.79  ? 185  GLN A C   1 
ATOM   1465 O  O   . GLN A 1 201 ? -14.183 18.626  -10.677 1.00 49.15  ? 185  GLN A O   1 
ATOM   1466 C  CB  . GLN A 1 201 ? -16.239 20.547  -10.605 1.00 48.17  ? 185  GLN A CB  1 
ATOM   1467 N  N   . ILE A 1 202 ? -13.191 19.447  -12.553 1.00 42.32  ? 186  ILE A N   1 
ATOM   1468 C  CA  . ILE A 1 202 ? -12.015 18.570  -12.597 1.00 39.79  ? 186  ILE A CA  1 
ATOM   1469 C  C   . ILE A 1 202 ? -10.881 19.196  -11.744 1.00 41.76  ? 186  ILE A C   1 
ATOM   1470 O  O   . ILE A 1 202 ? -10.664 20.406  -11.853 1.00 39.92  ? 186  ILE A O   1 
ATOM   1471 C  CB  . ILE A 1 202 ? -11.627 18.334  -14.099 1.00 40.87  ? 186  ILE A CB  1 
ATOM   1472 C  CG1 . ILE A 1 202 ? -12.744 17.528  -14.834 1.00 39.93  ? 186  ILE A CG1 1 
ATOM   1473 C  CG2 . ILE A 1 202 ? -10.238 17.682  -14.272 1.00 40.27  ? 186  ILE A CG2 1 
ATOM   1474 C  CD1 . ILE A 1 202 ? -12.728 17.597  -16.340 1.00 42.25  ? 186  ILE A CD1 1 
ATOM   1475 N  N   . PRO A 1 203 ? -10.133 18.410  -10.923 1.00 39.45  ? 187  PRO A N   1 
ATOM   1476 C  CA  . PRO A 1 203 ? -9.073  19.014  -10.090 1.00 39.71  ? 187  PRO A CA  1 
ATOM   1477 C  C   . PRO A 1 203 ? -7.820  19.463  -10.859 1.00 41.26  ? 187  PRO A C   1 
ATOM   1478 O  O   . PRO A 1 203 ? -6.707  18.976  -10.614 1.00 39.89  ? 187  PRO A O   1 
ATOM   1479 C  CB  . PRO A 1 203 ? -8.788  17.927  -9.044  1.00 42.20  ? 187  PRO A CB  1 
ATOM   1480 C  CG  . PRO A 1 203 ? -9.072  16.641  -9.775  1.00 45.56  ? 187  PRO A CG  1 
ATOM   1481 C  CD  . PRO A 1 203 ? -10.260 16.955  -10.655 1.00 40.53  ? 187  PRO A CD  1 
ATOM   1482 N  N   . SER A 1 204 ? -7.995  20.459  -11.752 1.00 36.30  ? 188  SER A N   1 
ATOM   1483 C  CA  . SER A 1 204 ? -6.899  20.997  -12.551 1.00 36.25  ? 188  SER A CA  1 
ATOM   1484 C  C   . SER A 1 204 ? -7.123  22.472  -12.822 1.00 39.41  ? 188  SER A C   1 
ATOM   1485 O  O   . SER A 1 204 ? -8.266  22.910  -12.949 1.00 37.35  ? 188  SER A O   1 
ATOM   1486 C  CB  . SER A 1 204 ? -6.789  20.248  -13.881 1.00 40.85  ? 188  SER A CB  1 
ATOM   1487 O  OG  . SER A 1 204 ? -5.578  20.590  -14.538 1.00 52.54  ? 188  SER A OG  1 
ATOM   1488 N  N   . GLN A 1 205 ? -6.036  23.240  -12.891 1.00 39.25  ? 189  GLN A N   1 
ATOM   1489 C  CA  . GLN A 1 205 ? -6.137  24.663  -13.204 1.00 40.62  ? 189  GLN A CA  1 
ATOM   1490 C  C   . GLN A 1 205 ? -5.596  24.990  -14.592 1.00 47.73  ? 189  GLN A C   1 
ATOM   1491 O  O   . GLN A 1 205 ? -6.031  25.972  -15.212 1.00 49.08  ? 189  GLN A O   1 
ATOM   1492 C  CB  . GLN A 1 205 ? -5.471  25.516  -12.126 1.00 42.76  ? 189  GLN A CB  1 
ATOM   1493 C  CG  . GLN A 1 205 ? -6.484  25.992  -11.098 1.00 52.80  ? 189  GLN A CG  1 
ATOM   1494 C  CD  . GLN A 1 205 ? -5.858  26.458  -9.813  1.00 61.47  ? 189  GLN A CD  1 
ATOM   1495 O  OE1 . GLN A 1 205 ? -4.638  26.569  -9.684  1.00 53.81  ? 189  GLN A OE1 1 
ATOM   1496 N  NE2 . GLN A 1 205 ? -6.692  26.756  -8.835  1.00 56.81  ? 189  GLN A NE2 1 
ATOM   1497 N  N   . ASP A 1 206 ? -4.657  24.165  -15.081 1.00 44.04  ? 190  ASP A N   1 
ATOM   1498 C  CA  . ASP A 1 206 ? -4.034  24.369  -16.387 1.00 43.34  ? 190  ASP A CA  1 
ATOM   1499 C  C   . ASP A 1 206 ? -4.844  23.726  -17.506 1.00 43.09  ? 190  ASP A C   1 
ATOM   1500 O  O   . ASP A 1 206 ? -5.577  22.756  -17.272 1.00 42.11  ? 190  ASP A O   1 
ATOM   1501 C  CB  . ASP A 1 206 ? -2.596  23.819  -16.396 1.00 45.95  ? 190  ASP A CB  1 
ATOM   1502 C  CG  . ASP A 1 206 ? -1.691  24.339  -15.286 1.00 58.63  ? 190  ASP A CG  1 
ATOM   1503 O  OD1 . ASP A 1 206 ? -2.012  25.401  -14.698 1.00 60.17  ? 190  ASP A OD1 1 
ATOM   1504 O  OD2 . ASP A 1 206 ? -0.658  23.694  -15.016 1.00 65.45  ? 190  ASP A OD2 1 
ATOM   1505 N  N   . ARG A 1 207 ? -4.706  24.270  -18.726 1.00 37.09  ? 191  ARG A N   1 
ATOM   1506 C  CA  . ARG A 1 207 ? -5.360  23.690  -19.888 1.00 35.18  ? 191  ARG A CA  1 
ATOM   1507 C  C   . ARG A 1 207 ? -4.639  22.379  -20.236 1.00 37.24  ? 191  ARG A C   1 
ATOM   1508 O  O   . ARG A 1 207 ? -3.403  22.355  -20.295 1.00 36.84  ? 191  ARG A O   1 
ATOM   1509 C  CB  . ARG A 1 207 ? -5.346  24.667  -21.083 1.00 35.80  ? 191  ARG A CB  1 
ATOM   1510 C  CG  . ARG A 1 207 ? -6.285  24.229  -22.226 1.00 45.72  ? 191  ARG A CG  1 
ATOM   1511 C  CD  . ARG A 1 207 ? -6.029  24.959  -23.538 1.00 54.97  ? 191  ARG A CD  1 
ATOM   1512 N  NE  . ARG A 1 207 ? -6.452  26.361  -23.486 1.00 70.21  ? 191  ARG A NE  1 
ATOM   1513 C  CZ  . ARG A 1 207 ? -7.170  26.973  -24.426 1.00 85.56  ? 191  ARG A CZ  1 
ATOM   1514 N  NH1 . ARG A 1 207 ? -7.563  26.311  -25.510 1.00 75.23  ? 191  ARG A NH1 1 
ATOM   1515 N  NH2 . ARG A 1 207 ? -7.505  28.248  -24.286 1.00 68.43  ? 191  ARG A NH2 1 
ATOM   1516 N  N   . HIS A 1 208 ? -5.413  21.280  -20.393 1.00 32.38  ? 192  HIS A N   1 
ATOM   1517 C  CA  . HIS A 1 208 ? -4.936  19.957  -20.793 1.00 32.47  ? 192  HIS A CA  1 
ATOM   1518 C  C   . HIS A 1 208 ? -5.687  19.594  -22.081 1.00 33.20  ? 192  HIS A C   1 
ATOM   1519 O  O   . HIS A 1 208 ? -6.903  19.772  -22.136 1.00 31.56  ? 192  HIS A O   1 
ATOM   1520 C  CB  . HIS A 1 208 ? -5.260  18.887  -19.739 1.00 34.34  ? 192  HIS A CB  1 
ATOM   1521 C  CG  . HIS A 1 208 ? -4.326  18.882  -18.573 1.00 39.93  ? 192  HIS A CG  1 
ATOM   1522 N  ND1 . HIS A 1 208 ? -4.467  19.782  -17.535 1.00 43.01  ? 192  HIS A ND1 1 
ATOM   1523 C  CD2 . HIS A 1 208 ? -3.282  18.063  -18.305 1.00 43.15  ? 192  HIS A CD2 1 
ATOM   1524 C  CE1 . HIS A 1 208 ? -3.484  19.513  -16.691 1.00 43.72  ? 192  HIS A CE1 1 
ATOM   1525 N  NE2 . HIS A 1 208 ? -2.755  18.476  -17.104 1.00 44.17  ? 192  HIS A NE2 1 
ATOM   1526 N  N   . GLN A 1 209 ? -4.976  19.060  -23.082 1.00 26.19  ? 193  GLN A N   1 
ATOM   1527 C  CA  . GLN A 1 209 ? -5.569  18.647  -24.351 1.00 22.88  ? 193  GLN A CA  1 
ATOM   1528 C  C   . GLN A 1 209 ? -5.062  17.256  -24.745 1.00 25.97  ? 193  GLN A C   1 
ATOM   1529 O  O   . GLN A 1 209 ? -3.869  16.965  -24.633 1.00 25.64  ? 193  GLN A O   1 
ATOM   1530 C  CB  . GLN A 1 209 ? -5.209  19.640  -25.479 1.00 22.97  ? 193  GLN A CB  1 
ATOM   1531 C  CG  . GLN A 1 209 ? -5.796  21.051  -25.373 1.00 22.83  ? 193  GLN A CG  1 
ATOM   1532 C  CD  . GLN A 1 209 ? -5.662  21.791  -26.687 1.00 31.45  ? 193  GLN A CD  1 
ATOM   1533 O  OE1 . GLN A 1 209 ? -4.767  21.526  -27.505 1.00 30.98  ? 193  GLN A OE1 1 
ATOM   1534 N  NE2 . GLN A 1 209 ? -6.547  22.736  -26.929 1.00 23.76  ? 193  GLN A NE2 1 
ATOM   1535 N  N   . VAL A 1 210 ? -5.971  16.420  -25.226 1.00 20.52  ? 194  VAL A N   1 
ATOM   1536 C  CA  . VAL A 1 210 ? -5.683  15.100  -25.789 1.00 20.06  ? 194  VAL A CA  1 
ATOM   1537 C  C   . VAL A 1 210 ? -6.536  14.945  -27.061 1.00 21.86  ? 194  VAL A C   1 
ATOM   1538 O  O   . VAL A 1 210 ? -7.687  15.403  -27.097 1.00 21.20  ? 194  VAL A O   1 
ATOM   1539 C  CB  . VAL A 1 210 ? -5.871  13.887  -24.817 1.00 24.01  ? 194  VAL A CB  1 
ATOM   1540 C  CG1 . VAL A 1 210 ? -5.037  14.027  -23.534 1.00 23.97  ? 194  VAL A CG1 1 
ATOM   1541 C  CG2 . VAL A 1 210 ? -7.348  13.614  -24.494 1.00 23.68  ? 194  VAL A CG2 1 
ATOM   1542 N  N   . ILE A 1 211 ? -5.990  14.274  -28.081 1.00 18.96  ? 195  ILE A N   1 
ATOM   1543 C  CA  . ILE A 1 211 ? -6.731  13.979  -29.312 1.00 16.98  ? 195  ILE A CA  1 
ATOM   1544 C  C   . ILE A 1 211 ? -6.935  12.468  -29.339 1.00 20.42  ? 195  ILE A C   1 
ATOM   1545 O  O   . ILE A 1 211 ? -5.963  11.715  -29.465 1.00 19.85  ? 195  ILE A O   1 
ATOM   1546 C  CB  . ILE A 1 211 ? -6.043  14.482  -30.613 1.00 18.56  ? 195  ILE A CB  1 
ATOM   1547 C  CG1 . ILE A 1 211 ? -5.619  15.984  -30.522 1.00 19.29  ? 195  ILE A CG1 1 
ATOM   1548 C  CG2 . ILE A 1 211 ? -6.948  14.226  -31.839 1.00 17.40  ? 195  ILE A CG2 1 
ATOM   1549 C  CD1 . ILE A 1 211 ? -4.689  16.487  -31.694 1.00 25.93  ? 195  ILE A CD1 1 
ATOM   1550 N  N   . VAL A 1 212 ? -8.190  12.025  -29.218 1.00 16.75  ? 196  VAL A N   1 
ATOM   1551 C  CA  . VAL A 1 212 ? -8.501  10.593  -29.234 1.00 15.46  ? 196  VAL A CA  1 
ATOM   1552 C  C   . VAL A 1 212 ? -8.778  10.205  -30.700 1.00 19.05  ? 196  VAL A C   1 
ATOM   1553 O  O   . VAL A 1 212 ? -9.630  10.858  -31.303 1.00 18.65  ? 196  VAL A O   1 
ATOM   1554 C  CB  . VAL A 1 212 ? -9.681  10.244  -28.293 1.00 17.61  ? 196  VAL A CB  1 
ATOM   1555 C  CG1 . VAL A 1 212 ? -9.944  8.742   -28.269 1.00 16.64  ? 196  VAL A CG1 1 
ATOM   1556 C  CG2 . VAL A 1 212 ? -9.449  10.777  -26.887 1.00 17.64  ? 196  VAL A CG2 1 
ATOM   1557 N  N   . PRO A 1 213 ? -8.098  9.170   -31.285 1.00 17.05  ? 197  PRO A N   1 
ATOM   1558 C  CA  . PRO A 1 213 ? -8.398  8.768   -32.678 1.00 17.01  ? 197  PRO A CA  1 
ATOM   1559 C  C   . PRO A 1 213 ? -9.878  8.456   -32.878 1.00 18.96  ? 197  PRO A C   1 
ATOM   1560 O  O   . PRO A 1 213 ? -10.567 8.043   -31.928 1.00 17.42  ? 197  PRO A O   1 
ATOM   1561 C  CB  . PRO A 1 213 ? -7.520  7.526   -32.900 1.00 19.30  ? 197  PRO A CB  1 
ATOM   1562 C  CG  . PRO A 1 213 ? -6.404  7.681   -31.922 1.00 23.50  ? 197  PRO A CG  1 
ATOM   1563 C  CD  . PRO A 1 213 ? -7.073  8.277   -30.703 1.00 18.73  ? 197  PRO A CD  1 
ATOM   1564 N  N   . ARG A 1 214 ? -10.368 8.724   -34.089 1.00 15.86  ? 198  ARG A N   1 
ATOM   1565 C  CA  . ARG A 1 214 ? -11.789 8.600   -34.418 1.00 16.45  ? 198  ARG A CA  1 
ATOM   1566 C  C   . ARG A 1 214 ? -12.380 7.238   -34.090 1.00 18.96  ? 198  ARG A C   1 
ATOM   1567 O  O   . ARG A 1 214 ? -13.457 7.171   -33.492 1.00 17.52  ? 198  ARG A O   1 
ATOM   1568 C  CB  . ARG A 1 214 ? -12.095 9.038   -35.861 1.00 17.02  ? 198  ARG A CB  1 
ATOM   1569 C  CG  . ARG A 1 214 ? -11.446 8.246   -36.993 1.00 24.43  ? 198  ARG A CG  1 
ATOM   1570 C  CD  . ARG A 1 214 ? -12.041 8.605   -38.370 1.00 25.82  ? 198  ARG A CD  1 
ATOM   1571 N  NE  . ARG A 1 214 ? -13.439 8.185   -38.451 1.00 26.03  ? 198  ARG A NE  1 
ATOM   1572 C  CZ  . ARG A 1 214 ? -14.484 9.003   -38.466 1.00 36.68  ? 198  ARG A CZ  1 
ATOM   1573 N  NH1 . ARG A 1 214 ? -14.306 10.318  -38.491 1.00 24.12  ? 198  ARG A NH1 1 
ATOM   1574 N  NH2 . ARG A 1 214 ? -15.720 8.510   -38.480 1.00 24.83  ? 198  ARG A NH2 1 
ATOM   1575 N  N   . LYS A 1 215 ? -11.662 6.155   -34.445 1.00 17.77  ? 199  LYS A N   1 
ATOM   1576 C  CA  . LYS A 1 215 ? -12.159 4.801   -34.175 1.00 18.52  ? 199  LYS A CA  1 
ATOM   1577 C  C   . LYS A 1 215 ? -12.307 4.555   -32.648 1.00 22.42  ? 199  LYS A C   1 
ATOM   1578 O  O   . LYS A 1 215 ? -13.337 4.054   -32.205 1.00 22.26  ? 199  LYS A O   1 
ATOM   1579 C  CB  . LYS A 1 215 ? -11.261 3.749   -34.870 1.00 21.30  ? 199  LYS A CB  1 
ATOM   1580 C  CG  . LYS A 1 215 ? -11.911 2.364   -34.906 1.00 26.24  ? 199  LYS A CG  1 
ATOM   1581 C  CD  . LYS A 1 215 ? -11.023 1.324   -35.598 1.00 38.44  ? 199  LYS A CD  1 
ATOM   1582 C  CE  . LYS A 1 215 ? -11.733 -0.007  -35.725 1.00 51.07  ? 199  LYS A CE  1 
ATOM   1583 N  NZ  . LYS A 1 215 ? -11.004 -0.938  -36.625 1.00 64.83  ? 199  LYS A NZ  1 
ATOM   1584 N  N   . GLY A 1 216 ? -11.326 5.007   -31.872 1.00 17.23  ? 200  GLY A N   1 
ATOM   1585 C  CA  . GLY A 1 216 ? -11.325 4.873   -30.422 1.00 17.61  ? 200  GLY A CA  1 
ATOM   1586 C  C   . GLY A 1 216 ? -12.415 5.659   -29.714 1.00 20.35  ? 200  GLY A C   1 
ATOM   1587 O  O   . GLY A 1 216 ? -13.077 5.147   -28.799 1.00 18.41  ? 200  GLY A O   1 
ATOM   1588 N  N   . ILE A 1 217 ? -12.604 6.931   -30.109 1.00 15.69  ? 201  ILE A N   1 
ATOM   1589 C  CA  . ILE A 1 217 ? -13.626 7.734   -29.459 1.00 13.86  ? 201  ILE A CA  1 
ATOM   1590 C  C   . ILE A 1 217 ? -15.053 7.214   -29.727 1.00 17.64  ? 201  ILE A C   1 
ATOM   1591 O  O   . ILE A 1 217 ? -15.877 7.224   -28.819 1.00 17.32  ? 201  ILE A O   1 
ATOM   1592 C  CB  . ILE A 1 217 ? -13.455 9.237   -29.742 1.00 15.63  ? 201  ILE A CB  1 
ATOM   1593 C  CG1 . ILE A 1 217 ? -14.178 10.101  -28.678 1.00 16.27  ? 201  ILE A CG1 1 
ATOM   1594 C  CG2 . ILE A 1 217 ? -13.834 9.559   -31.190 1.00 15.31  ? 201  ILE A CG2 1 
ATOM   1595 C  CD1 . ILE A 1 217 ? -13.407 10.183  -27.276 1.00 20.76  ? 201  ILE A CD1 1 
ATOM   1596 N  N   . LEU A 1 218 ? -15.306 6.722   -30.949 1.00 17.74  ? 202  LEU A N   1 
ATOM   1597 C  CA  . LEU A 1 218 ? -16.611 6.173   -31.320 1.00 17.87  ? 202  LEU A CA  1 
ATOM   1598 C  C   . LEU A 1 218 ? -16.881 4.926   -30.502 1.00 22.47  ? 202  LEU A C   1 
ATOM   1599 O  O   . LEU A 1 218 ? -17.975 4.782   -29.966 1.00 21.49  ? 202  LEU A O   1 
ATOM   1600 C  CB  . LEU A 1 218 ? -16.725 5.915   -32.825 1.00 17.22  ? 202  LEU A CB  1 
ATOM   1601 C  CG  . LEU A 1 218 ? -16.724 7.189   -33.725 1.00 20.88  ? 202  LEU A CG  1 
ATOM   1602 C  CD1 . LEU A 1 218 ? -16.631 6.820   -35.191 1.00 20.55  ? 202  LEU A CD1 1 
ATOM   1603 C  CD2 . LEU A 1 218 ? -17.937 8.088   -33.462 1.00 23.20  ? 202  LEU A CD2 1 
ATOM   1604 N  N   . GLU A 1 219 ? -15.836 4.115   -30.292 1.00 20.40  ? 203  GLU A N   1 
ATOM   1605 C  CA  . GLU A 1 219 ? -15.897 2.895   -29.485 1.00 20.65  ? 203  GLU A CA  1 
ATOM   1606 C  C   . GLU A 1 219 ? -16.207 3.266   -28.030 1.00 24.23  ? 203  GLU A C   1 
ATOM   1607 O  O   . GLU A 1 219 ? -17.141 2.696   -27.443 1.00 22.60  ? 203  GLU A O   1 
ATOM   1608 C  CB  . GLU A 1 219 ? -14.580 2.110   -29.602 1.00 21.60  ? 203  GLU A CB  1 
ATOM   1609 C  CG  . GLU A 1 219 ? -14.544 0.817   -28.780 1.00 31.78  ? 203  GLU A CG  1 
ATOM   1610 C  CD  . GLU A 1 219 ? -15.665 -0.195  -28.997 1.00 48.20  ? 203  GLU A CD  1 
ATOM   1611 O  OE1 . GLU A 1 219 ? -16.209 -0.274  -30.124 1.00 35.15  ? 203  GLU A OE1 1 
ATOM   1612 O  OE2 . GLU A 1 219 ? -15.979 -0.931  -28.035 1.00 36.14  ? 203  GLU A OE2 1 
ATOM   1613 N  N   . LEU A 1 220 ? -15.462 4.258   -27.470 1.00 20.27  ? 204  LEU A N   1 
ATOM   1614 C  CA  . LEU A 1 220 ? -15.685 4.727   -26.111 1.00 18.48  ? 204  LEU A CA  1 
ATOM   1615 C  C   . LEU A 1 220 ? -17.160 5.126   -25.867 1.00 22.55  ? 204  LEU A C   1 
ATOM   1616 O  O   . LEU A 1 220 ? -17.732 4.718   -24.846 1.00 21.49  ? 204  LEU A O   1 
ATOM   1617 C  CB  . LEU A 1 220 ? -14.739 5.894   -25.739 1.00 17.40  ? 204  LEU A CB  1 
ATOM   1618 C  CG  . LEU A 1 220 ? -14.855 6.434   -24.301 1.00 20.89  ? 204  LEU A CG  1 
ATOM   1619 C  CD1 . LEU A 1 220 ? -14.746 5.305   -23.246 1.00 19.83  ? 204  LEU A CD1 1 
ATOM   1620 C  CD2 . LEU A 1 220 ? -13.812 7.503   -24.043 1.00 24.49  ? 204  LEU A CD2 1 
ATOM   1621 N  N   . ALA A 1 221 ? -17.757 5.923   -26.784 1.00 21.56  ? 205  ALA A N   1 
ATOM   1622 C  CA  . ALA A 1 221 ? -19.143 6.406   -26.674 1.00 21.47  ? 205  ALA A CA  1 
ATOM   1623 C  C   . ALA A 1 221 ? -20.146 5.241   -26.576 1.00 27.10  ? 205  ALA A C   1 
ATOM   1624 O  O   . ALA A 1 221 ? -21.060 5.281   -25.740 1.00 25.56  ? 205  ALA A O   1 
ATOM   1625 C  CB  . ALA A 1 221 ? -19.491 7.301   -27.858 1.00 21.62  ? 205  ALA A CB  1 
ATOM   1626 N  N   . ARG A 1 222 ? -19.937 4.196   -27.401 1.00 26.00  ? 206  ARG A N   1 
ATOM   1627 C  CA  . ARG A 1 222 ? -20.796 2.994   -27.450 1.00 26.77  ? 206  ARG A CA  1 
ATOM   1628 C  C   . ARG A 1 222 ? -20.758 2.191   -26.157 1.00 31.46  ? 206  ARG A C   1 
ATOM   1629 O  O   . ARG A 1 222 ? -21.732 1.507   -25.843 1.00 31.78  ? 206  ARG A O   1 
ATOM   1630 C  CB  . ARG A 1 222 ? -20.428 2.096   -28.643 1.00 27.71  ? 206  ARG A CB  1 
ATOM   1631 C  CG  . ARG A 1 222 ? -20.801 2.673   -30.001 1.00 39.07  ? 206  ARG A CG  1 
ATOM   1632 C  CD  . ARG A 1 222 ? -20.341 1.734   -31.104 1.00 44.89  ? 206  ARG A CD  1 
ATOM   1633 N  NE  . ARG A 1 222 ? -20.044 2.450   -32.343 1.00 57.90  ? 206  ARG A NE  1 
ATOM   1634 C  CZ  . ARG A 1 222 ? -18.847 2.504   -32.920 1.00 59.36  ? 206  ARG A CZ  1 
ATOM   1635 N  NH1 . ARG A 1 222 ? -17.814 1.858   -32.390 1.00 35.82  ? 206  ARG A NH1 1 
ATOM   1636 N  NH2 . ARG A 1 222 ? -18.680 3.182   -34.046 1.00 48.93  ? 206  ARG A NH2 1 
ATOM   1637 N  N   . LEU A 1 223 ? -19.649 2.295   -25.399 1.00 27.09  ? 207  LEU A N   1 
ATOM   1638 C  CA  . LEU A 1 223 ? -19.439 1.607   -24.119 1.00 27.07  ? 207  LEU A CA  1 
ATOM   1639 C  C   . LEU A 1 223 ? -20.064 2.315   -22.907 1.00 29.81  ? 207  LEU A C   1 
ATOM   1640 O  O   . LEU A 1 223 ? -20.240 1.694   -21.858 1.00 28.32  ? 207  LEU A O   1 
ATOM   1641 C  CB  . LEU A 1 223 ? -17.926 1.462   -23.865 1.00 27.40  ? 207  LEU A CB  1 
ATOM   1642 C  CG  . LEU A 1 223 ? -17.101 0.614   -24.836 1.00 32.16  ? 207  LEU A CG  1 
ATOM   1643 C  CD1 . LEU A 1 223 ? -15.612 0.740   -24.522 1.00 32.66  ? 207  LEU A CD1 1 
ATOM   1644 C  CD2 . LEU A 1 223 ? -17.527 -0.854  -24.802 1.00 33.96  ? 207  LEU A CD2 1 
ATOM   1645 N  N   . LEU A 1 224 ? -20.301 3.633   -23.001 1.00 24.73  ? 208  LEU A N   1 
ATOM   1646 C  CA  . LEU A 1 224 ? -20.808 4.418   -21.876 1.00 25.09  ? 208  LEU A CA  1 
ATOM   1647 C  C   . LEU A 1 224 ? -22.338 4.303   -21.745 1.00 34.56  ? 208  LEU A C   1 
ATOM   1648 O  O   . LEU A 1 224 ? -23.050 5.295   -21.849 1.00 35.65  ? 208  LEU A O   1 
ATOM   1649 C  CB  . LEU A 1 224 ? -20.335 5.889   -22.018 1.00 24.14  ? 208  LEU A CB  1 
ATOM   1650 C  CG  . LEU A 1 224 ? -18.825 6.103   -22.026 1.00 25.67  ? 208  LEU A CG  1 
ATOM   1651 C  CD1 . LEU A 1 224 ? -18.488 7.519   -22.527 1.00 24.34  ? 208  LEU A CD1 1 
ATOM   1652 C  CD2 . LEU A 1 224 ? -18.220 5.866   -20.633 1.00 27.54  ? 208  LEU A CD2 1 
ATOM   1653 N  N   . THR A 1 225 ? -22.817 3.085   -21.463 1.00 35.16  ? 209  THR A N   1 
ATOM   1654 C  CA  . THR A 1 225 ? -24.233 2.698   -21.404 1.00 37.38  ? 209  THR A CA  1 
ATOM   1655 C  C   . THR A 1 225 ? -24.939 2.843   -20.047 1.00 46.35  ? 209  THR A C   1 
ATOM   1656 O  O   . THR A 1 225 ? -26.160 3.028   -20.032 1.00 47.02  ? 209  THR A O   1 
ATOM   1657 C  CB  . THR A 1 225 ? -24.424 1.300   -22.017 1.00 40.81  ? 209  THR A CB  1 
ATOM   1658 O  OG1 . THR A 1 225 ? -23.564 0.380   -21.339 1.00 36.47  ? 209  THR A OG1 1 
ATOM   1659 C  CG2 . THR A 1 225 ? -24.137 1.266   -23.521 1.00 37.35  ? 209  THR A CG2 1 
ATOM   1660 N  N   . GLU A 1 226 ? -24.193 2.743   -18.922 1.00 45.08  ? 210  GLU A N   1 
ATOM   1661 C  CA  . GLU A 1 226 ? -24.744 2.880   -17.563 1.00 46.43  ? 210  GLU A CA  1 
ATOM   1662 C  C   . GLU A 1 226 ? -25.270 4.327   -17.347 1.00 52.17  ? 210  GLU A C   1 
ATOM   1663 O  O   . GLU A 1 226 ? -24.490 5.239   -17.045 1.00 51.59  ? 210  GLU A O   1 
ATOM   1664 C  CB  . GLU A 1 226 ? -23.702 2.484   -16.491 1.00 47.99  ? 210  GLU A CB  1 
ATOM   1665 C  CG  . GLU A 1 226 ? -23.163 1.062   -16.597 1.00 57.99  ? 210  GLU A CG  1 
ATOM   1666 C  CD  . GLU A 1 226 ? -21.818 0.807   -15.935 1.00 83.07  ? 210  GLU A CD  1 
ATOM   1667 O  OE1 . GLU A 1 226 ? -21.583 1.332   -14.822 1.00 77.78  ? 210  GLU A OE1 1 
ATOM   1668 O  OE2 . GLU A 1 226 ? -21.000 0.063   -16.525 1.00 82.20  ? 210  GLU A OE2 1 
ATOM   1669 N  N   . GLN A 1 227 ? -26.599 4.520   -17.554 1.00 49.93  ? 211  GLN A N   1 
ATOM   1670 C  CA  . GLN A 1 227 ? -27.344 5.793   -17.457 1.00 49.80  ? 211  GLN A CA  1 
ATOM   1671 C  C   . GLN A 1 227 ? -27.055 6.651   -16.215 1.00 53.08  ? 211  GLN A C   1 
ATOM   1672 O  O   . GLN A 1 227 ? -27.036 7.879   -16.326 1.00 53.43  ? 211  GLN A O   1 
ATOM   1673 C  CB  . GLN A 1 227 ? -28.852 5.559   -17.618 1.00 51.47  ? 211  GLN A CB  1 
ATOM   1674 N  N   . ASP A 1 228 ? -26.821 6.010   -15.052 1.00 47.89  ? 212  ASP A N   1 
ATOM   1675 C  CA  . ASP A 1 228 ? -26.499 6.690   -13.794 1.00 47.86  ? 212  ASP A CA  1 
ATOM   1676 C  C   . ASP A 1 228 ? -25.085 6.311   -13.293 1.00 48.70  ? 212  ASP A C   1 
ATOM   1677 O  O   . ASP A 1 228 ? -24.715 6.645   -12.162 1.00 50.03  ? 212  ASP A O   1 
ATOM   1678 C  CB  . ASP A 1 228 ? -27.577 6.403   -12.725 1.00 50.78  ? 212  ASP A CB  1 
ATOM   1679 N  N   . GLY A 1 229 ? -24.308 5.657   -14.157 1.00 40.69  ? 213  GLY A N   1 
ATOM   1680 C  CA  . GLY A 1 229 ? -22.953 5.213   -13.853 1.00 38.67  ? 213  GLY A CA  1 
ATOM   1681 C  C   . GLY A 1 229 ? -21.868 6.266   -13.996 1.00 38.71  ? 213  GLY A C   1 
ATOM   1682 O  O   . GLY A 1 229 ? -22.019 7.247   -14.731 1.00 36.85  ? 213  GLY A O   1 
ATOM   1683 N  N   . GLU A 1 230 ? -20.759 6.051   -13.282 1.00 33.41  ? 214  GLU A N   1 
ATOM   1684 C  CA  . GLU A 1 230 ? -19.571 6.903   -13.298 1.00 31.84  ? 214  GLU A CA  1 
ATOM   1685 C  C   . GLU A 1 230 ? -18.495 6.250   -14.162 1.00 30.39  ? 214  GLU A C   1 
ATOM   1686 O  O   . GLU A 1 230 ? -18.517 5.032   -14.369 1.00 28.34  ? 214  GLU A O   1 
ATOM   1687 C  CB  . GLU A 1 230 ? -19.010 7.083   -11.875 1.00 34.25  ? 214  GLU A CB  1 
ATOM   1688 C  CG  . GLU A 1 230 ? -19.828 8.000   -10.982 1.00 48.02  ? 214  GLU A CG  1 
ATOM   1689 C  CD  . GLU A 1 230 ? -19.976 9.414   -11.506 1.00 59.79  ? 214  GLU A CD  1 
ATOM   1690 O  OE1 . GLU A 1 230 ? -21.104 9.774   -11.914 1.00 50.33  ? 214  GLU A OE1 1 
ATOM   1691 O  OE2 . GLU A 1 230 ? -18.954 10.135  -11.576 1.00 47.35  ? 214  GLU A OE2 1 
ATOM   1692 N  N   . VAL A 1 231 ? -17.547 7.069   -14.648 1.00 24.96  ? 215  VAL A N   1 
ATOM   1693 C  CA  . VAL A 1 231 ? -16.377 6.622   -15.398 1.00 23.39  ? 215  VAL A CA  1 
ATOM   1694 C  C   . VAL A 1 231 ? -15.132 7.359   -14.889 1.00 25.58  ? 215  VAL A C   1 
ATOM   1695 O  O   . VAL A 1 231 ? -15.164 8.572   -14.726 1.00 24.20  ? 215  VAL A O   1 
ATOM   1696 C  CB  . VAL A 1 231 ? -16.547 6.634   -16.951 1.00 25.13  ? 215  VAL A CB  1 
ATOM   1697 C  CG1 . VAL A 1 231 ? -16.882 8.029   -17.494 1.00 24.30  ? 215  VAL A CG1 1 
ATOM   1698 C  CG2 . VAL A 1 231 ? -15.322 6.036   -17.665 1.00 24.74  ? 215  VAL A CG2 1 
ATOM   1699 N  N   . GLY A 1 232 ? -14.078 6.601   -14.603 1.00 23.86  ? 216  GLY A N   1 
ATOM   1700 C  CA  . GLY A 1 232 ? -12.782 7.133   -14.196 1.00 23.71  ? 216  GLY A CA  1 
ATOM   1701 C  C   . GLY A 1 232 ? -11.962 7.387   -15.448 1.00 25.84  ? 216  GLY A C   1 
ATOM   1702 O  O   . GLY A 1 232 ? -11.907 6.521   -16.329 1.00 24.44  ? 216  GLY A O   1 
ATOM   1703 N  N   . ILE A 1 233 ? -11.379 8.602   -15.573 1.00 22.31  ? 217  ILE A N   1 
ATOM   1704 C  CA  . ILE A 1 233 ? -10.578 8.991   -16.737 1.00 20.16  ? 217  ILE A CA  1 
ATOM   1705 C  C   . ILE A 1 233 ? -9.141  9.285   -16.321 1.00 24.55  ? 217  ILE A C   1 
ATOM   1706 O  O   . ILE A 1 233 ? -8.908  9.978   -15.329 1.00 24.12  ? 217  ILE A O   1 
ATOM   1707 C  CB  . ILE A 1 233 ? -11.214 10.201  -17.513 1.00 23.05  ? 217  ILE A CB  1 
ATOM   1708 C  CG1 . ILE A 1 233 ? -12.694 9.925   -17.950 1.00 22.84  ? 217  ILE A CG1 1 
ATOM   1709 C  CG2 . ILE A 1 233 ? -10.336 10.657  -18.715 1.00 24.28  ? 217  ILE A CG2 1 
ATOM   1710 C  CD1 . ILE A 1 233 ? -12.926 8.815   -19.031 1.00 25.53  ? 217  ILE A CD1 1 
ATOM   1711 N  N   . VAL A 1 234 ? -8.182  8.792   -17.110 1.00 21.70  ? 218  VAL A N   1 
ATOM   1712 C  CA  . VAL A 1 234 ? -6.772  9.072   -16.919 1.00 23.51  ? 218  VAL A CA  1 
ATOM   1713 C  C   . VAL A 1 234 ? -6.263  9.657   -18.231 1.00 29.37  ? 218  VAL A C   1 
ATOM   1714 O  O   . VAL A 1 234 ? -6.363  9.013   -19.277 1.00 27.11  ? 218  VAL A O   1 
ATOM   1715 C  CB  . VAL A 1 234 ? -5.913  7.865   -16.445 1.00 27.85  ? 218  VAL A CB  1 
ATOM   1716 C  CG1 . VAL A 1 234 ? -4.451  8.272   -16.259 1.00 28.29  ? 218  VAL A CG1 1 
ATOM   1717 C  CG2 . VAL A 1 234 ? -6.462  7.242   -15.153 1.00 28.00  ? 218  VAL A CG2 1 
ATOM   1718 N  N   . LEU A 1 235 ? -5.763  10.898  -18.183 1.00 28.15  ? 219  LEU A N   1 
ATOM   1719 C  CA  . LEU A 1 235 ? -5.175  11.513  -19.362 1.00 28.36  ? 219  LEU A CA  1 
ATOM   1720 C  C   . LEU A 1 235 ? -3.659  11.390  -19.251 1.00 35.17  ? 219  LEU A C   1 
ATOM   1721 O  O   . LEU A 1 235 ? -3.044  11.925  -18.325 1.00 36.35  ? 219  LEU A O   1 
ATOM   1722 C  CB  . LEU A 1 235 ? -5.585  12.992  -19.545 1.00 28.15  ? 219  LEU A CB  1 
ATOM   1723 C  CG  . LEU A 1 235 ? -7.077  13.331  -19.623 1.00 31.33  ? 219  LEU A CG  1 
ATOM   1724 C  CD1 . LEU A 1 235 ? -7.273  14.837  -19.755 1.00 30.81  ? 219  LEU A CD1 1 
ATOM   1725 C  CD2 . LEU A 1 235 ? -7.782  12.599  -20.798 1.00 31.09  ? 219  LEU A CD2 1 
ATOM   1726 N  N   . GLY A 1 236 ? -3.082  10.641  -20.165 1.00 32.26  ? 220  GLY A N   1 
ATOM   1727 C  CA  . GLY A 1 236 ? -1.637  10.480  -20.232 1.00 33.95  ? 220  GLY A CA  1 
ATOM   1728 C  C   . GLY A 1 236 ? -1.090  11.345  -21.345 1.00 37.63  ? 220  GLY A C   1 
ATOM   1729 O  O   . GLY A 1 236 ? -1.857  11.992  -22.065 1.00 36.07  ? 220  GLY A O   1 
ATOM   1730 N  N   . GLN A 1 237 ? 0.235   11.352  -21.503 1.00 36.12  ? 221  GLN A N   1 
ATOM   1731 C  CA  . GLN A 1 237 ? 0.892   12.104  -22.574 1.00 36.16  ? 221  GLN A CA  1 
ATOM   1732 C  C   . GLN A 1 237 ? 0.663   11.422  -23.931 1.00 36.74  ? 221  GLN A C   1 
ATOM   1733 O  O   . GLN A 1 237 ? 0.563   12.116  -24.942 1.00 36.22  ? 221  GLN A O   1 
ATOM   1734 C  CB  . GLN A 1 237 ? 2.399   12.294  -22.294 1.00 39.22  ? 221  GLN A CB  1 
ATOM   1735 C  CG  . GLN A 1 237 ? 3.143   11.030  -21.839 1.00 65.75  ? 221  GLN A CG  1 
ATOM   1736 C  CD  . GLN A 1 237 ? 4.484   11.300  -21.179 1.00 89.34  ? 221  GLN A CD  1 
ATOM   1737 O  OE1 . GLN A 1 237 ? 4.757   12.389  -20.647 1.00 85.37  ? 221  GLN A OE1 1 
ATOM   1738 N  NE2 . GLN A 1 237 ? 5.338   10.283  -21.160 1.00 79.44  ? 221  GLN A NE2 1 
ATOM   1739 N  N   . HIS A 1 238 ? 0.547   10.076  -23.937 1.00 31.85  ? 222  HIS A N   1 
ATOM   1740 C  CA  . HIS A 1 238 ? 0.339   9.261   -25.140 1.00 30.93  ? 222  HIS A CA  1 
ATOM   1741 C  C   . HIS A 1 238 ? -0.890  8.319   -25.101 1.00 29.72  ? 222  HIS A C   1 
ATOM   1742 O  O   . HIS A 1 238 ? -1.123  7.594   -26.081 1.00 27.70  ? 222  HIS A O   1 
ATOM   1743 C  CB  . HIS A 1 238 ? 1.610   8.452   -25.463 1.00 33.23  ? 222  HIS A CB  1 
ATOM   1744 C  CG  . HIS A 1 238 ? 2.810   9.305   -25.716 1.00 38.08  ? 222  HIS A CG  1 
ATOM   1745 N  ND1 . HIS A 1 238 ? 2.893   10.122  -26.832 1.00 40.37  ? 222  HIS A ND1 1 
ATOM   1746 C  CD2 . HIS A 1 238 ? 3.933   9.457   -24.977 1.00 40.66  ? 222  HIS A CD2 1 
ATOM   1747 C  CE1 . HIS A 1 238 ? 4.057   10.743  -26.735 1.00 40.57  ? 222  HIS A CE1 1 
ATOM   1748 N  NE2 . HIS A 1 238 ? 4.713   10.380  -25.632 1.00 41.29  ? 222  HIS A NE2 1 
ATOM   1749 N  N   . HIS A 1 239 ? -1.656  8.330   -23.988 1.00 25.84  ? 223  HIS A N   1 
ATOM   1750 C  CA  A HIS A 1 239 ? -2.839  7.478   -23.838 0.50 25.23  ? 223  HIS A CA  1 
ATOM   1751 C  CA  B HIS A 1 239 ? -2.833  7.476   -23.822 0.50 24.88  ? 223  HIS A CA  1 
ATOM   1752 C  C   . HIS A 1 239 ? -3.968  8.174   -23.067 1.00 28.16  ? 223  HIS A C   1 
ATOM   1753 O  O   . HIS A 1 239 ? -3.741  9.164   -22.367 1.00 29.88  ? 223  HIS A O   1 
ATOM   1754 C  CB  A HIS A 1 239 ? -2.489  6.149   -23.125 0.50 26.05  ? 223  HIS A CB  1 
ATOM   1755 C  CB  B HIS A 1 239 ? -2.453  6.170   -23.084 0.50 25.37  ? 223  HIS A CB  1 
ATOM   1756 C  CG  A HIS A 1 239 ? -1.754  5.142   -23.958 0.50 29.58  ? 223  HIS A CG  1 
ATOM   1757 C  CG  B HIS A 1 239 ? -2.414  6.315   -21.590 0.50 28.84  ? 223  HIS A CG  1 
ATOM   1758 N  ND1 A HIS A 1 239 ? -0.369  5.088   -23.973 0.50 32.06  ? 223  HIS A ND1 1 
ATOM   1759 N  ND1 B HIS A 1 239 ? -1.302  6.832   -20.939 0.50 31.33  ? 223  HIS A ND1 1 
ATOM   1760 C  CD2 A HIS A 1 239 ? -2.238  4.139   -24.730 0.50 31.04  ? 223  HIS A CD2 1 
ATOM   1761 C  CD2 B HIS A 1 239 ? -3.369  6.039   -20.670 0.50 29.91  ? 223  HIS A CD2 1 
ATOM   1762 C  CE1 A HIS A 1 239 ? -0.057  4.079   -24.770 0.50 31.60  ? 223  HIS A CE1 1 
ATOM   1763 C  CE1 B HIS A 1 239 ? -1.616  6.845   -19.654 0.50 30.60  ? 223  HIS A CE1 1 
ATOM   1764 N  NE2 A HIS A 1 239 ? -1.148  3.478   -25.252 0.50 31.25  ? 223  HIS A NE2 1 
ATOM   1765 N  NE2 B HIS A 1 239 ? -2.850  6.382   -19.443 0.50 30.20  ? 223  HIS A NE2 1 
ATOM   1766 N  N   . ILE A 1 240 ? -5.171  7.606   -23.169 1.00 22.22  ? 224  ILE A N   1 
ATOM   1767 C  CA  . ILE A 1 240 ? -6.377  7.949   -22.445 1.00 21.43  ? 224  ILE A CA  1 
ATOM   1768 C  C   . ILE A 1 240 ? -6.885  6.593   -21.909 1.00 24.93  ? 224  ILE A C   1 
ATOM   1769 O  O   . ILE A 1 240 ? -6.912  5.598   -22.653 1.00 24.84  ? 224  ILE A O   1 
ATOM   1770 C  CB  . ILE A 1 240 ? -7.480  8.730   -23.230 1.00 22.99  ? 224  ILE A CB  1 
ATOM   1771 C  CG1 . ILE A 1 240 ? -8.725  8.964   -22.315 1.00 23.23  ? 224  ILE A CG1 1 
ATOM   1772 C  CG2 . ILE A 1 240 ? -7.894  8.028   -24.534 1.00 22.06  ? 224  ILE A CG2 1 
ATOM   1773 C  CD1 . ILE A 1 240 ? -9.772  10.060  -22.809 1.00 26.65  ? 224  ILE A CD1 1 
ATOM   1774 N  N   . ARG A 1 241 ? -7.232  6.542   -20.624 1.00 21.26  ? 225  ARG A N   1 
ATOM   1775 C  CA  . ARG A 1 241 ? -7.803  5.323   -20.054 1.00 20.80  ? 225  ARG A CA  1 
ATOM   1776 C  C   . ARG A 1 241 ? -9.140  5.683   -19.435 1.00 24.75  ? 225  ARG A C   1 
ATOM   1777 O  O   . ARG A 1 241 ? -9.242  6.710   -18.758 1.00 25.94  ? 225  ARG A O   1 
ATOM   1778 C  CB  . ARG A 1 241 ? -6.867  4.654   -19.027 1.00 19.82  ? 225  ARG A CB  1 
ATOM   1779 C  CG  . ARG A 1 241 ? -7.394  3.298   -18.503 1.00 25.34  ? 225  ARG A CG  1 
ATOM   1780 C  CD  . ARG A 1 241 ? -6.409  2.663   -17.521 1.00 32.42  ? 225  ARG A CD  1 
ATOM   1781 N  NE  . ARG A 1 241 ? -6.387  3.381   -16.245 1.00 52.89  ? 225  ARG A NE  1 
ATOM   1782 C  CZ  . ARG A 1 241 ? -5.419  3.292   -15.338 1.00 76.13  ? 225  ARG A CZ  1 
ATOM   1783 N  NH1 . ARG A 1 241 ? -4.360  2.523   -15.560 1.00 69.38  ? 225  ARG A NH1 1 
ATOM   1784 N  NH2 . ARG A 1 241 ? -5.491  3.988   -14.212 1.00 66.11  ? 225  ARG A NH2 1 
ATOM   1785 N  N   . ALA A 1 242 ? -10.166 4.868   -19.702 1.00 19.11  ? 226  ALA A N   1 
ATOM   1786 C  CA  . ALA A 1 242 ? -11.513 5.039   -19.151 1.00 18.92  ? 226  ALA A CA  1 
ATOM   1787 C  C   . ALA A 1 242 ? -11.905 3.734   -18.433 1.00 23.40  ? 226  ALA A C   1 
ATOM   1788 O  O   . ALA A 1 242 ? -11.898 2.671   -19.051 1.00 21.60  ? 226  ALA A O   1 
ATOM   1789 C  CB  . ALA A 1 242 ? -12.510 5.364   -20.259 1.00 19.03  ? 226  ALA A CB  1 
ATOM   1790 N  N   . THR A 1 243 ? -12.226 3.825   -17.135 1.00 23.18  ? 227  THR A N   1 
ATOM   1791 C  CA  . THR A 1 243 ? -12.569 2.663   -16.294 1.00 23.33  ? 227  THR A CA  1 
ATOM   1792 C  C   . THR A 1 243 ? -13.979 2.792   -15.693 1.00 29.01  ? 227  THR A C   1 
ATOM   1793 O  O   . THR A 1 243 ? -14.297 3.825   -15.076 1.00 27.12  ? 227  THR A O   1 
ATOM   1794 C  CB  . THR A 1 243 ? -11.503 2.517   -15.186 1.00 25.87  ? 227  THR A CB  1 
ATOM   1795 O  OG1 . THR A 1 243 ? -10.209 2.559   -15.785 1.00 22.86  ? 227  THR A OG1 1 
ATOM   1796 C  CG2 . THR A 1 243 ? -11.673 1.234   -14.350 1.00 29.30  ? 227  THR A CG2 1 
ATOM   1797 N  N   . THR A 1 244 ? -14.793 1.719   -15.817 1.00 28.18  ? 228  THR A N   1 
ATOM   1798 C  CA  . THR A 1 244 ? -16.169 1.675   -15.275 1.00 30.86  ? 228  THR A CA  1 
ATOM   1799 C  C   . THR A 1 244 ? -16.492 0.557   -14.279 1.00 39.74  ? 228  THR A C   1 
ATOM   1800 O  O   . THR A 1 244 ? -17.641 0.460   -13.826 1.00 42.87  ? 228  THR A O   1 
ATOM   1801 C  CB  . THR A 1 244 ? -17.204 1.601   -16.396 1.00 37.81  ? 228  THR A CB  1 
ATOM   1802 O  OG1 . THR A 1 244 ? -17.005 0.381   -17.122 1.00 34.68  ? 228  THR A OG1 1 
ATOM   1803 C  CG2 . THR A 1 244 ? -17.192 2.817   -17.301 1.00 32.13  ? 228  THR A CG2 1 
ATOM   1804 N  N   . GLY A 1 245 ? -15.547 -0.314  -13.973 1.00 35.94  ? 229  GLY A N   1 
ATOM   1805 C  CA  . GLY A 1 245 ? -15.893 -1.424  -13.081 1.00 36.40  ? 229  GLY A CA  1 
ATOM   1806 C  C   . GLY A 1 245 ? -16.193 -2.663  -13.907 1.00 36.19  ? 229  GLY A C   1 
ATOM   1807 O  O   . GLY A 1 245 ? -15.620 -3.718  -13.648 1.00 35.92  ? 229  GLY A O   1 
ATOM   1808 N  N   . GLU A 1 246 ? -17.034 -2.521  -14.967 1.00 30.32  ? 230  GLU A N   1 
ATOM   1809 C  CA  . GLU A 1 246 ? -17.296 -3.608  -15.917 1.00 28.89  ? 230  GLU A CA  1 
ATOM   1810 C  C   . GLU A 1 246 ? -16.227 -3.593  -17.030 1.00 27.94  ? 230  GLU A C   1 
ATOM   1811 O  O   . GLU A 1 246 ? -15.925 -4.643  -17.597 1.00 25.58  ? 230  GLU A O   1 
ATOM   1812 C  CB  . GLU A 1 246 ? -18.705 -3.515  -16.517 1.00 30.33  ? 230  GLU A CB  1 
ATOM   1813 N  N   . PHE A 1 247 ? -15.673 -2.408  -17.368 1.00 23.87  ? 231  PHE A N   1 
ATOM   1814 C  CA  . PHE A 1 247 ? -14.660 -2.365  -18.425 1.00 23.54  ? 231  PHE A CA  1 
ATOM   1815 C  C   . PHE A 1 247 ? -13.539 -1.376  -18.185 1.00 24.24  ? 231  PHE A C   1 
ATOM   1816 O  O   . PHE A 1 247 ? -13.721 -0.401  -17.460 1.00 22.37  ? 231  PHE A O   1 
ATOM   1817 C  CB  . PHE A 1 247 ? -15.283 -2.187  -19.835 1.00 26.15  ? 231  PHE A CB  1 
ATOM   1818 C  CG  . PHE A 1 247 ? -15.777 -0.794  -20.139 1.00 29.77  ? 231  PHE A CG  1 
ATOM   1819 C  CD1 . PHE A 1 247 ? -14.906 0.184   -20.619 1.00 34.14  ? 231  PHE A CD1 1 
ATOM   1820 C  CD2 . PHE A 1 247 ? -17.121 -0.468  -19.990 1.00 33.55  ? 231  PHE A CD2 1 
ATOM   1821 C  CE1 . PHE A 1 247 ? -15.361 1.485   -20.883 1.00 35.60  ? 231  PHE A CE1 1 
ATOM   1822 C  CE2 . PHE A 1 247 ? -17.576 0.832   -20.258 1.00 36.79  ? 231  PHE A CE2 1 
ATOM   1823 C  CZ  . PHE A 1 247 ? -16.691 1.800   -20.696 1.00 34.96  ? 231  PHE A CZ  1 
ATOM   1824 N  N   . THR A 1 248 ? -12.377 -1.647  -18.793 1.00 20.73  ? 232  THR A N   1 
ATOM   1825 C  CA  . THR A 1 248 ? -11.230 -0.753  -18.826 1.00 20.58  ? 232  THR A CA  1 
ATOM   1826 C  C   . THR A 1 248 ? -10.876 -0.580  -20.293 1.00 24.36  ? 232  THR A C   1 
ATOM   1827 O  O   . THR A 1 248 ? -10.512 -1.549  -20.981 1.00 21.99  ? 232  THR A O   1 
ATOM   1828 C  CB  . THR A 1 248 ? -10.052 -1.201  -17.957 1.00 25.88  ? 232  THR A CB  1 
ATOM   1829 O  OG1 . THR A 1 248 ? -10.513 -1.448  -16.637 1.00 24.18  ? 232  THR A OG1 1 
ATOM   1830 C  CG2 . THR A 1 248 ? -8.943  -0.143  -17.904 1.00 27.10  ? 232  THR A CG2 1 
ATOM   1831 N  N   . PHE A 1 249 ? -11.040 0.654   -20.783 1.00 20.30  ? 233  PHE A N   1 
ATOM   1832 C  CA  . PHE A 1 249 ? -10.757 1.018   -22.165 1.00 21.38  ? 233  PHE A CA  1 
ATOM   1833 C  C   . PHE A 1 249 ? -9.483  1.861   -22.203 1.00 22.63  ? 233  PHE A C   1 
ATOM   1834 O  O   . PHE A 1 249 ? -9.384  2.853   -21.480 1.00 20.96  ? 233  PHE A O   1 
ATOM   1835 C  CB  . PHE A 1 249 ? -11.957 1.805   -22.746 1.00 23.43  ? 233  PHE A CB  1 
ATOM   1836 C  CG  . PHE A 1 249 ? -11.721 2.558   -24.041 1.00 25.05  ? 233  PHE A CG  1 
ATOM   1837 C  CD1 . PHE A 1 249 ? -11.198 3.850   -24.029 1.00 29.01  ? 233  PHE A CD1 1 
ATOM   1838 C  CD2 . PHE A 1 249 ? -12.082 2.003   -25.261 1.00 28.09  ? 233  PHE A CD2 1 
ATOM   1839 C  CE1 . PHE A 1 249 ? -10.985 4.547   -25.218 1.00 30.85  ? 233  PHE A CE1 1 
ATOM   1840 C  CE2 . PHE A 1 249 ? -11.882 2.710   -26.453 1.00 30.73  ? 233  PHE A CE2 1 
ATOM   1841 C  CZ  . PHE A 1 249 ? -11.322 3.970   -26.421 1.00 29.10  ? 233  PHE A CZ  1 
ATOM   1842 N  N   . THR A 1 250 ? -8.535  1.488   -23.060 1.00 20.05  ? 234  THR A N   1 
ATOM   1843 C  CA  . THR A 1 250 ? -7.287  2.230   -23.236 1.00 20.63  ? 234  THR A CA  1 
ATOM   1844 C  C   . THR A 1 250 ? -7.105  2.534   -24.715 1.00 23.72  ? 234  THR A C   1 
ATOM   1845 O  O   . THR A 1 250 ? -7.179  1.623   -25.542 1.00 21.99  ? 234  THR A O   1 
ATOM   1846 C  CB  . THR A 1 250 ? -6.058  1.474   -22.644 1.00 25.77  ? 234  THR A CB  1 
ATOM   1847 O  OG1 . THR A 1 250 ? -6.295  1.148   -21.277 1.00 22.74  ? 234  THR A OG1 1 
ATOM   1848 C  CG2 . THR A 1 250 ? -4.766  2.284   -22.730 1.00 25.25  ? 234  THR A CG2 1 
ATOM   1849 N  N   . SER A 1 251 ? -6.804  3.799   -25.038 1.00 19.72  ? 235  SER A N   1 
ATOM   1850 C  CA  . SER A 1 251 ? -6.530  4.199   -26.410 1.00 18.19  ? 235  SER A CA  1 
ATOM   1851 C  C   . SER A 1 251 ? -5.254  4.981   -26.486 1.00 20.72  ? 235  SER A C   1 
ATOM   1852 O  O   . SER A 1 251 ? -4.990  5.841   -25.639 1.00 19.09  ? 235  SER A O   1 
ATOM   1853 C  CB  . SER A 1 251 ? -7.674  5.047   -26.979 1.00 19.60  ? 235  SER A CB  1 
ATOM   1854 O  OG  . SER A 1 251 ? -7.449  5.382   -28.341 1.00 19.65  ? 235  SER A OG  1 
ATOM   1855 N  N   . LYS A 1 252 ? -4.504  4.767   -27.567 1.00 18.44  ? 236  LYS A N   1 
ATOM   1856 C  CA  . LYS A 1 252 ? -3.354  5.591   -27.911 1.00 19.21  ? 236  LYS A CA  1 
ATOM   1857 C  C   . LYS A 1 252 ? -3.976  6.966   -28.298 1.00 22.59  ? 236  LYS A C   1 
ATOM   1858 O  O   . LYS A 1 252 ? -5.165  7.039   -28.647 1.00 20.03  ? 236  LYS A O   1 
ATOM   1859 C  CB  . LYS A 1 252 ? -2.640  5.024   -29.150 1.00 22.90  ? 236  LYS A CB  1 
ATOM   1860 C  CG  . LYS A 1 252 ? -1.738  3.823   -28.838 1.00 38.19  ? 236  LYS A CG  1 
ATOM   1861 C  CD  . LYS A 1 252 ? -1.229  3.134   -30.110 1.00 51.45  ? 236  LYS A CD  1 
ATOM   1862 C  CE  . LYS A 1 252 ? 0.104   3.643   -30.605 1.00 67.53  ? 236  LYS A CE  1 
ATOM   1863 N  NZ  . LYS A 1 252 ? 1.239   3.023   -29.869 1.00 81.72  ? 236  LYS A NZ  1 
ATOM   1864 N  N   . LEU A 1 253 ? -3.192  8.026   -28.213 1.00 20.20  ? 237  LEU A N   1 
ATOM   1865 C  CA  . LEU A 1 253 ? -3.665  9.355   -28.602 1.00 19.59  ? 237  LEU A CA  1 
ATOM   1866 C  C   . LEU A 1 253 ? -3.075  9.708   -29.958 1.00 25.32  ? 237  LEU A C   1 
ATOM   1867 O  O   . LEU A 1 253 ? -2.061  9.128   -30.367 1.00 25.58  ? 237  LEU A O   1 
ATOM   1868 C  CB  . LEU A 1 253 ? -3.248  10.414  -27.566 1.00 20.14  ? 237  LEU A CB  1 
ATOM   1869 C  CG  . LEU A 1 253 ? -3.763  10.270  -26.129 1.00 23.29  ? 237  LEU A CG  1 
ATOM   1870 C  CD1 . LEU A 1 253 ? -3.120  11.296  -25.224 1.00 24.00  ? 237  LEU A CD1 1 
ATOM   1871 C  CD2 . LEU A 1 253 ? -5.296  10.324  -26.059 1.00 26.03  ? 237  LEU A CD2 1 
ATOM   1872 N  N   . VAL A 1 254 ? -3.687  10.679  -30.654 1.00 21.37  ? 238  VAL A N   1 
ATOM   1873 C  CA  . VAL A 1 254 ? -3.116  11.161  -31.894 1.00 22.03  ? 238  VAL A CA  1 
ATOM   1874 C  C   . VAL A 1 254 ? -1.948  12.058  -31.466 1.00 26.22  ? 238  VAL A C   1 
ATOM   1875 O  O   . VAL A 1 254 ? -2.132  12.965  -30.646 1.00 25.51  ? 238  VAL A O   1 
ATOM   1876 C  CB  . VAL A 1 254 ? -4.138  11.895  -32.796 1.00 25.41  ? 238  VAL A CB  1 
ATOM   1877 C  CG1 . VAL A 1 254 ? -3.451  12.437  -34.048 1.00 26.38  ? 238  VAL A CG1 1 
ATOM   1878 C  CG2 . VAL A 1 254 ? -5.292  10.969  -33.174 1.00 24.17  ? 238  VAL A CG2 1 
ATOM   1879 N  N   . ASP A 1 255 ? -0.747  11.757  -31.991 1.00 25.69  ? 239  ASP A N   1 
ATOM   1880 C  CA  . ASP A 1 255 ? 0.490   12.481  -31.704 1.00 28.10  ? 239  ASP A CA  1 
ATOM   1881 C  C   . ASP A 1 255 ? 0.545   13.745  -32.555 1.00 32.68  ? 239  ASP A C   1 
ATOM   1882 O  O   . ASP A 1 255 ? 1.190   13.771  -33.601 1.00 34.49  ? 239  ASP A O   1 
ATOM   1883 C  CB  . ASP A 1 255 ? 1.721   11.556  -31.926 1.00 31.10  ? 239  ASP A CB  1 
ATOM   1884 C  CG  . ASP A 1 255 ? 3.080   12.172  -31.650 1.00 46.21  ? 239  ASP A CG  1 
ATOM   1885 O  OD1 . ASP A 1 255 ? 3.153   13.118  -30.840 1.00 48.18  ? 239  ASP A OD1 1 
ATOM   1886 O  OD2 . ASP A 1 255 ? 4.071   11.699  -32.238 1.00 56.22  ? 239  ASP A OD2 1 
ATOM   1887 N  N   . GLY A 1 256 ? -0.151  14.774  -32.093 1.00 28.27  ? 240  GLY A N   1 
ATOM   1888 C  CA  . GLY A 1 256 ? -0.247  16.061  -32.765 1.00 27.55  ? 240  GLY A CA  1 
ATOM   1889 C  C   . GLY A 1 256 ? -0.901  17.137  -31.919 1.00 29.87  ? 240  GLY A C   1 
ATOM   1890 O  O   . GLY A 1 256 ? -1.293  16.885  -30.776 1.00 29.76  ? 240  GLY A O   1 
ATOM   1891 N  N   . LYS A 1 257 ? -1.011  18.348  -32.480 1.00 25.67  ? 241  LYS A N   1 
ATOM   1892 C  CA  . LYS A 1 257 ? -1.589  19.520  -31.820 1.00 25.39  ? 241  LYS A CA  1 
ATOM   1893 C  C   . LYS A 1 257 ? -2.893  19.917  -32.495 1.00 27.32  ? 241  LYS A C   1 
ATOM   1894 O  O   . LYS A 1 257 ? -2.914  20.190  -33.698 1.00 26.82  ? 241  LYS A O   1 
ATOM   1895 C  CB  . LYS A 1 257 ? -0.589  20.698  -31.816 1.00 28.66  ? 241  LYS A CB  1 
ATOM   1896 N  N   . PHE A 1 258 ? -3.987  19.938  -31.726 1.00 23.04  ? 242  PHE A N   1 
ATOM   1897 C  CA  . PHE A 1 258 ? -5.289  20.289  -32.268 1.00 20.73  ? 242  PHE A CA  1 
ATOM   1898 C  C   . PHE A 1 258 ? -5.278  21.762  -32.713 1.00 26.93  ? 242  PHE A C   1 
ATOM   1899 O  O   . PHE A 1 258 ? -4.637  22.573  -32.040 1.00 27.65  ? 242  PHE A O   1 
ATOM   1900 C  CB  . PHE A 1 258 ? -6.420  20.033  -31.247 1.00 20.90  ? 242  PHE A CB  1 
ATOM   1901 C  CG  . PHE A 1 258 ? -7.771  19.847  -31.895 1.00 19.38  ? 242  PHE A CG  1 
ATOM   1902 C  CD1 . PHE A 1 258 ? -8.090  18.659  -32.558 1.00 21.04  ? 242  PHE A CD1 1 
ATOM   1903 C  CD2 . PHE A 1 258 ? -8.718  20.868  -31.874 1.00 20.69  ? 242  PHE A CD2 1 
ATOM   1904 C  CE1 . PHE A 1 258 ? -9.342  18.491  -33.174 1.00 21.31  ? 242  PHE A CE1 1 
ATOM   1905 C  CE2 . PHE A 1 258 ? -9.971  20.699  -32.492 1.00 21.77  ? 242  PHE A CE2 1 
ATOM   1906 C  CZ  . PHE A 1 258 ? -10.277 19.517  -33.134 1.00 19.58  ? 242  PHE A CZ  1 
ATOM   1907 N  N   . PRO A 1 259 ? -5.929  22.120  -33.843 1.00 22.83  ? 243  PRO A N   1 
ATOM   1908 C  CA  . PRO A 1 259 ? -5.949  23.538  -34.257 1.00 23.25  ? 243  PRO A CA  1 
ATOM   1909 C  C   . PRO A 1 259 ? -6.406  24.455  -33.138 1.00 26.67  ? 243  PRO A C   1 
ATOM   1910 O  O   . PRO A 1 259 ? -7.229  24.069  -32.297 1.00 23.19  ? 243  PRO A O   1 
ATOM   1911 C  CB  . PRO A 1 259 ? -7.023  23.575  -35.360 1.00 24.78  ? 243  PRO A CB  1 
ATOM   1912 C  CG  . PRO A 1 259 ? -7.074  22.206  -35.880 1.00 28.60  ? 243  PRO A CG  1 
ATOM   1913 C  CD  . PRO A 1 259 ? -6.701  21.272  -34.777 1.00 23.88  ? 243  PRO A CD  1 
ATOM   1914 N  N   . ASP A 1 260 ? -5.907  25.695  -33.167 1.00 27.16  ? 244  ASP A N   1 
ATOM   1915 C  CA  . ASP A 1 260 ? -6.334  26.769  -32.282 1.00 27.97  ? 244  ASP A CA  1 
ATOM   1916 C  C   . ASP A 1 260 ? -7.745  27.143  -32.805 1.00 33.00  ? 244  ASP A C   1 
ATOM   1917 O  O   . ASP A 1 260 ? -7.935  28.112  -33.550 1.00 33.51  ? 244  ASP A O   1 
ATOM   1918 C  CB  . ASP A 1 260 ? -5.344  27.946  -32.357 1.00 30.53  ? 244  ASP A CB  1 
ATOM   1919 C  CG  . ASP A 1 260 ? -5.597  29.058  -31.350 1.00 38.20  ? 244  ASP A CG  1 
ATOM   1920 O  OD1 . ASP A 1 260 ? -6.582  28.951  -30.572 1.00 38.15  ? 244  ASP A OD1 1 
ATOM   1921 O  OD2 . ASP A 1 260 ? -4.836  30.048  -31.359 1.00 38.97  ? 244  ASP A OD2 1 
ATOM   1922 N  N   . TYR A 1 261 ? -8.714  26.297  -32.450 1.00 28.33  ? 245  TYR A N   1 
ATOM   1923 C  CA  . TYR A 1 261 ? -10.107 26.374  -32.886 1.00 27.64  ? 245  TYR A CA  1 
ATOM   1924 C  C   . TYR A 1 261 ? -10.789 27.660  -32.427 1.00 33.64  ? 245  TYR A C   1 
ATOM   1925 O  O   . TYR A 1 261 ? -11.713 28.133  -33.096 1.00 33.20  ? 245  TYR A O   1 
ATOM   1926 C  CB  . TYR A 1 261 ? -10.905 25.109  -32.463 1.00 26.72  ? 245  TYR A CB  1 
ATOM   1927 C  CG  . TYR A 1 261 ? -11.100 25.004  -30.964 1.00 26.59  ? 245  TYR A CG  1 
ATOM   1928 C  CD1 . TYR A 1 261 ? -12.189 25.610  -30.336 1.00 27.75  ? 245  TYR A CD1 1 
ATOM   1929 C  CD2 . TYR A 1 261 ? -10.172 24.334  -30.163 1.00 25.73  ? 245  TYR A CD2 1 
ATOM   1930 C  CE1 . TYR A 1 261 ? -12.314 25.612  -28.945 1.00 28.04  ? 245  TYR A CE1 1 
ATOM   1931 C  CE2 . TYR A 1 261 ? -10.297 24.312  -28.775 1.00 26.16  ? 245  TYR A CE2 1 
ATOM   1932 C  CZ  . TYR A 1 261 ? -11.375 24.945  -28.170 1.00 32.02  ? 245  TYR A CZ  1 
ATOM   1933 O  OH  . TYR A 1 261 ? -11.488 24.929  -26.800 1.00 31.48  ? 245  TYR A OH  1 
ATOM   1934 N  N   . GLU A 1 262 ? -10.359 28.207  -31.265 1.00 30.44  ? 246  GLU A N   1 
ATOM   1935 C  CA  . GLU A 1 262 ? -10.929 29.439  -30.701 1.00 31.53  ? 246  GLU A CA  1 
ATOM   1936 C  C   . GLU A 1 262 ? -10.950 30.566  -31.726 1.00 34.19  ? 246  GLU A C   1 
ATOM   1937 O  O   . GLU A 1 262 ? -11.916 31.318  -31.775 1.00 33.70  ? 246  GLU A O   1 
ATOM   1938 C  CB  . GLU A 1 262 ? -10.126 29.880  -29.465 1.00 34.06  ? 246  GLU A CB  1 
ATOM   1939 C  CG  . GLU A 1 262 ? -11.014 30.416  -28.357 1.00 50.12  ? 246  GLU A CG  1 
ATOM   1940 C  CD  . GLU A 1 262 ? -11.600 29.365  -27.435 1.00 70.09  ? 246  GLU A CD  1 
ATOM   1941 O  OE1 . GLU A 1 262 ? -10.821 28.670  -26.743 1.00 69.43  ? 246  GLU A OE1 1 
ATOM   1942 O  OE2 . GLU A 1 262 ? -12.847 29.272  -27.369 1.00 66.26  ? 246  GLU A OE2 1 
ATOM   1943 N  N   . ARG A 1 263 ? -9.887  30.650  -32.566 1.00 32.00  ? 247  ARG A N   1 
ATOM   1944 C  CA  . ARG A 1 263 ? -9.698  31.660  -33.618 1.00 33.57  ? 247  ARG A CA  1 
ATOM   1945 C  C   . ARG A 1 263 ? -10.719 31.576  -34.770 1.00 38.20  ? 247  ARG A C   1 
ATOM   1946 O  O   . ARG A 1 263 ? -10.865 32.555  -35.506 1.00 37.74  ? 247  ARG A O   1 
ATOM   1947 C  CB  . ARG A 1 263 ? -8.264  31.593  -34.187 1.00 37.01  ? 247  ARG A CB  1 
ATOM   1948 C  CG  . ARG A 1 263 ? -7.153  31.882  -33.173 1.00 52.48  ? 247  ARG A CG  1 
ATOM   1949 C  CD  . ARG A 1 263 ? -5.796  31.992  -33.848 1.00 69.16  ? 247  ARG A CD  1 
ATOM   1950 N  NE  . ARG A 1 263 ? -5.518  33.353  -34.316 1.00 83.39  ? 247  ARG A NE  1 
ATOM   1951 C  CZ  . ARG A 1 263 ? -4.468  34.080  -33.941 1.00 98.84  ? 247  ARG A CZ  1 
ATOM   1952 N  NH1 . ARG A 1 263 ? -3.571  33.582  -33.096 1.00 81.43  ? 247  ARG A NH1 1 
ATOM   1953 N  NH2 . ARG A 1 263 ? -4.300  35.307  -34.417 1.00 89.11  ? 247  ARG A NH2 1 
ATOM   1954 N  N   . VAL A 1 264 ? -11.394 30.415  -34.944 1.00 33.94  ? 248  VAL A N   1 
ATOM   1955 C  CA  . VAL A 1 264 ? -12.355 30.191  -36.033 1.00 33.34  ? 248  VAL A CA  1 
ATOM   1956 C  C   . VAL A 1 264 ? -13.843 30.183  -35.624 1.00 32.99  ? 248  VAL A C   1 
ATOM   1957 O  O   . VAL A 1 264 ? -14.724 30.029  -36.475 1.00 31.33  ? 248  VAL A O   1 
ATOM   1958 C  CB  . VAL A 1 264 ? -11.964 29.011  -36.968 1.00 37.89  ? 248  VAL A CB  1 
ATOM   1959 C  CG1 . VAL A 1 264 ? -10.575 29.220  -37.576 1.00 38.99  ? 248  VAL A CG1 1 
ATOM   1960 C  CG2 . VAL A 1 264 ? -12.069 27.658  -36.262 1.00 36.97  ? 248  VAL A CG2 1 
ATOM   1961 N  N   . LEU A 1 265 ? -14.120 30.371  -34.327 1.00 27.59  ? 249  LEU A N   1 
ATOM   1962 C  CA  . LEU A 1 265 ? -15.480 30.465  -33.811 1.00 26.25  ? 249  LEU A CA  1 
ATOM   1963 C  C   . LEU A 1 265 ? -16.003 31.881  -34.190 1.00 30.63  ? 249  LEU A C   1 
ATOM   1964 O  O   . LEU A 1 265 ? -15.353 32.872  -33.818 1.00 28.89  ? 249  LEU A O   1 
ATOM   1965 C  CB  . LEU A 1 265 ? -15.481 30.285  -32.280 1.00 26.75  ? 249  LEU A CB  1 
ATOM   1966 C  CG  . LEU A 1 265 ? -14.954 28.954  -31.711 1.00 31.36  ? 249  LEU A CG  1 
ATOM   1967 C  CD1 . LEU A 1 265 ? -15.079 28.943  -30.195 1.00 31.60  ? 249  LEU A CD1 1 
ATOM   1968 C  CD2 . LEU A 1 265 ? -15.713 27.740  -32.305 1.00 30.28  ? 249  LEU A CD2 1 
ATOM   1969 N  N   . PRO A 1 266 ? -17.082 32.021  -35.012 1.00 27.85  ? 250  PRO A N   1 
ATOM   1970 C  CA  . PRO A 1 266 ? -17.523 33.384  -35.395 1.00 27.83  ? 250  PRO A CA  1 
ATOM   1971 C  C   . PRO A 1 266 ? -18.018 34.177  -34.190 1.00 31.62  ? 250  PRO A C   1 
ATOM   1972 O  O   . PRO A 1 266 ? -18.750 33.646  -33.354 1.00 30.12  ? 250  PRO A O   1 
ATOM   1973 C  CB  . PRO A 1 266 ? -18.610 33.151  -36.454 1.00 29.48  ? 250  PRO A CB  1 
ATOM   1974 C  CG  . PRO A 1 266 ? -19.040 31.755  -36.272 1.00 32.37  ? 250  PRO A CG  1 
ATOM   1975 C  CD  . PRO A 1 266 ? -17.955 30.978  -35.589 1.00 28.10  ? 250  PRO A CD  1 
ATOM   1976 N  N   . ARG A 1 267 ? -17.549 35.424  -34.069 1.00 31.28  ? 251  ARG A N   1 
ATOM   1977 C  CA  . ARG A 1 267 ? -17.900 36.286  -32.943 1.00 32.71  ? 251  ARG A CA  1 
ATOM   1978 C  C   . ARG A 1 267 ? -18.837 37.445  -33.321 1.00 37.36  ? 251  ARG A C   1 
ATOM   1979 O  O   . ARG A 1 267 ? -19.670 37.832  -32.504 1.00 38.09  ? 251  ARG A O   1 
ATOM   1980 C  CB  . ARG A 1 267 ? -16.637 36.807  -32.239 1.00 35.57  ? 251  ARG A CB  1 
ATOM   1981 N  N   . GLY A 1 268 ? -18.719 37.954  -34.542 1.00 33.97  ? 252  GLY A N   1 
ATOM   1982 C  CA  . GLY A 1 268 ? -19.532 39.078  -35.000 1.00 36.58  ? 252  GLY A CA  1 
ATOM   1983 C  C   . GLY A 1 268 ? -20.824 38.772  -35.741 1.00 41.29  ? 252  GLY A C   1 
ATOM   1984 O  O   . GLY A 1 268 ? -21.058 39.335  -36.823 1.00 44.34  ? 252  GLY A O   1 
ATOM   1985 N  N   . GLY A 1 269 ? -21.688 37.930  -35.153 1.00 31.19  ? 253  GLY A N   1 
ATOM   1986 C  CA  . GLY A 1 269 ? -22.980 37.622  -35.758 1.00 28.44  ? 253  GLY A CA  1 
ATOM   1987 C  C   . GLY A 1 269 ? -24.072 38.568  -35.286 1.00 27.19  ? 253  GLY A C   1 
ATOM   1988 O  O   . GLY A 1 269 ? -24.375 38.618  -34.094 1.00 27.12  ? 253  GLY A O   1 
ATOM   1989 N  N   . ASP A 1 270 ? -24.716 39.269  -36.218 1.00 21.80  ? 254  ASP A N   1 
ATOM   1990 C  CA  . ASP A 1 270 ? -25.756 40.271  -35.918 1.00 21.94  ? 254  ASP A CA  1 
ATOM   1991 C  C   . ASP A 1 270 ? -27.154 39.820  -36.365 1.00 25.73  ? 254  ASP A C   1 
ATOM   1992 O  O   . ASP A 1 270 ? -28.137 40.531  -36.144 1.00 24.08  ? 254  ASP A O   1 
ATOM   1993 C  CB  . ASP A 1 270 ? -25.392 41.596  -36.620 1.00 23.93  ? 254  ASP A CB  1 
ATOM   1994 C  CG  . ASP A 1 270 ? -25.273 41.474  -38.136 1.00 29.17  ? 254  ASP A CG  1 
ATOM   1995 O  OD1 . ASP A 1 270 ? -24.549 40.569  -38.606 1.00 28.50  ? 254  ASP A OD1 1 
ATOM   1996 O  OD2 . ASP A 1 270 ? -25.920 42.266  -38.848 1.00 32.34  ? 254  ASP A OD2 1 
ATOM   1997 N  N   . LYS A 1 271 ? -27.237 38.638  -37.003 1.00 22.28  ? 255  LYS A N   1 
ATOM   1998 C  CA  . LYS A 1 271 ? -28.496 38.151  -37.561 1.00 21.75  ? 255  LYS A CA  1 
ATOM   1999 C  C   . LYS A 1 271 ? -28.857 36.855  -36.886 1.00 27.18  ? 255  LYS A C   1 
ATOM   2000 O  O   . LYS A 1 271 ? -28.104 35.875  -36.971 1.00 27.96  ? 255  LYS A O   1 
ATOM   2001 C  CB  . LYS A 1 271 ? -28.411 38.009  -39.095 1.00 22.75  ? 255  LYS A CB  1 
ATOM   2002 C  CG  . LYS A 1 271 ? -28.174 39.342  -39.818 1.00 27.00  ? 255  LYS A CG  1 
ATOM   2003 C  CD  . LYS A 1 271 ? -27.923 39.163  -41.317 1.00 28.84  ? 255  LYS A CD  1 
ATOM   2004 C  CE  . LYS A 1 271 ? -27.483 40.433  -42.014 1.00 33.12  ? 255  LYS A CE  1 
ATOM   2005 N  NZ  . LYS A 1 271 ? -26.168 40.952  -41.497 1.00 26.99  ? 255  LYS A NZ  1 
ATOM   2006 N  N   . LEU A 1 272 ? -29.955 36.880  -36.130 1.00 22.29  ? 256  LEU A N   1 
ATOM   2007 C  CA  . LEU A 1 272 ? -30.408 35.684  -35.426 1.00 21.22  ? 256  LEU A CA  1 
ATOM   2008 C  C   . LEU A 1 272 ? -31.617 35.070  -36.133 1.00 24.10  ? 256  LEU A C   1 
ATOM   2009 O  O   . LEU A 1 272 ? -32.599 35.768  -36.418 1.00 22.59  ? 256  LEU A O   1 
ATOM   2010 C  CB  . LEU A 1 272 ? -30.737 35.983  -33.961 1.00 21.58  ? 256  LEU A CB  1 
ATOM   2011 C  CG  . LEU A 1 272 ? -31.436 34.864  -33.145 1.00 25.22  ? 256  LEU A CG  1 
ATOM   2012 C  CD1 . LEU A 1 272 ? -30.487 33.644  -32.881 1.00 24.38  ? 256  LEU A CD1 1 
ATOM   2013 C  CD2 . LEU A 1 272 ? -31.978 35.426  -31.834 1.00 27.45  ? 256  LEU A CD2 1 
ATOM   2014 N  N   . VAL A 1 273 ? -31.544 33.761  -36.388 1.00 20.09  ? 257  VAL A N   1 
ATOM   2015 C  CA  . VAL A 1 273 ? -32.642 33.007  -36.990 1.00 19.92  ? 257  VAL A CA  1 
ATOM   2016 C  C   . VAL A 1 273 ? -33.086 31.999  -35.928 1.00 22.88  ? 257  VAL A C   1 
ATOM   2017 O  O   . VAL A 1 273 ? -32.262 31.198  -35.480 1.00 21.39  ? 257  VAL A O   1 
ATOM   2018 C  CB  . VAL A 1 273 ? -32.294 32.241  -38.300 1.00 23.49  ? 257  VAL A CB  1 
ATOM   2019 C  CG1 . VAL A 1 273 ? -33.556 31.631  -38.920 1.00 22.65  ? 257  VAL A CG1 1 
ATOM   2020 C  CG2 . VAL A 1 273 ? -31.556 33.115  -39.315 1.00 24.50  ? 257  VAL A CG2 1 
ATOM   2021 N  N   . VAL A 1 274 ? -34.369 32.028  -35.541 1.00 19.50  ? 258  VAL A N   1 
ATOM   2022 C  CA  . VAL A 1 274 ? -34.922 31.001  -34.641 1.00 19.43  ? 258  VAL A CA  1 
ATOM   2023 C  C   . VAL A 1 274 ? -35.973 30.243  -35.476 1.00 21.21  ? 258  VAL A C   1 
ATOM   2024 O  O   . VAL A 1 274 ? -36.924 30.851  -35.987 1.00 21.09  ? 258  VAL A O   1 
ATOM   2025 C  CB  . VAL A 1 274 ? -35.492 31.500  -33.285 1.00 24.32  ? 258  VAL A CB  1 
ATOM   2026 C  CG1 . VAL A 1 274 ? -35.976 30.313  -32.435 1.00 22.76  ? 258  VAL A CG1 1 
ATOM   2027 C  CG2 . VAL A 1 274 ? -34.461 32.329  -32.507 1.00 25.25  ? 258  VAL A CG2 1 
ATOM   2028 N  N   . GLY A 1 275 ? -35.761 28.951  -35.656 1.00 18.79  ? 259  GLY A N   1 
ATOM   2029 C  CA  . GLY A 1 275 ? -36.665 28.143  -36.464 1.00 18.58  ? 259  GLY A CA  1 
ATOM   2030 C  C   . GLY A 1 275 ? -36.993 26.811  -35.832 1.00 20.10  ? 259  GLY A C   1 
ATOM   2031 O  O   . GLY A 1 275 ? -36.350 26.398  -34.860 1.00 19.49  ? 259  GLY A O   1 
ATOM   2032 N  N   . ASP A 1 276 ? -37.988 26.125  -36.390 1.00 17.86  ? 260  ASP A N   1 
ATOM   2033 C  CA  . ASP A 1 276 ? -38.354 24.798  -35.894 1.00 16.86  ? 260  ASP A CA  1 
ATOM   2034 C  C   . ASP A 1 276 ? -37.321 23.783  -36.406 1.00 17.99  ? 260  ASP A C   1 
ATOM   2035 O  O   . ASP A 1 276 ? -37.144 23.662  -37.617 1.00 16.63  ? 260  ASP A O   1 
ATOM   2036 C  CB  . ASP A 1 276 ? -39.785 24.419  -36.316 1.00 18.57  ? 260  ASP A CB  1 
ATOM   2037 C  CG  . ASP A 1 276 ? -40.192 23.098  -35.689 1.00 17.57  ? 260  ASP A CG  1 
ATOM   2038 O  OD1 . ASP A 1 276 ? -40.550 23.100  -34.471 1.00 18.66  ? 260  ASP A OD1 1 
ATOM   2039 O  OD2 . ASP A 1 276 ? -40.046 22.045  -36.367 1.00 16.07  ? 260  ASP A OD2 1 
ATOM   2040 N  N   . ARG A 1 277 ? -36.593 23.102  -35.483 1.00 15.50  ? 261  ARG A N   1 
ATOM   2041 C  CA  . ARG A 1 277 ? -35.530 22.135  -35.837 1.00 15.01  ? 261  ARG A CA  1 
ATOM   2042 C  C   . ARG A 1 277 ? -35.994 21.066  -36.838 1.00 17.69  ? 261  ARG A C   1 
ATOM   2043 O  O   . ARG A 1 277 ? -35.348 20.866  -37.874 1.00 14.73  ? 261  ARG A O   1 
ATOM   2044 C  CB  . ARG A 1 277 ? -34.954 21.466  -34.569 1.00 13.43  ? 261  ARG A CB  1 
ATOM   2045 C  CG  . ARG A 1 277 ? -33.797 20.479  -34.862 1.00 16.46  ? 261  ARG A CG  1 
ATOM   2046 C  CD  . ARG A 1 277 ? -33.755 19.347  -33.837 1.00 17.50  ? 261  ARG A CD  1 
ATOM   2047 N  NE  . ARG A 1 277 ? -34.824 18.365  -34.045 1.00 19.50  ? 261  ARG A NE  1 
ATOM   2048 C  CZ  . ARG A 1 277 ? -34.765 17.343  -34.899 1.00 24.22  ? 261  ARG A CZ  1 
ATOM   2049 N  NH1 . ARG A 1 277 ? -33.658 17.117  -35.607 1.00 16.94  ? 261  ARG A NH1 1 
ATOM   2050 N  NH2 . ARG A 1 277 ? -35.802 16.523  -35.034 1.00 16.08  ? 261  ARG A NH2 1 
ATOM   2051 N  N   . GLN A 1 278 ? -37.113 20.390  -36.516 1.00 16.70  ? 262  GLN A N   1 
ATOM   2052 C  CA  . GLN A 1 278 ? -37.638 19.301  -37.344 1.00 18.34  ? 262  GLN A CA  1 
ATOM   2053 C  C   . GLN A 1 278 ? -38.125 19.795  -38.698 1.00 19.95  ? 262  GLN A C   1 
ATOM   2054 O  O   . GLN A 1 278 ? -37.794 19.183  -39.718 1.00 19.64  ? 262  GLN A O   1 
ATOM   2055 C  CB  . GLN A 1 278 ? -38.732 18.529  -36.605 1.00 19.85  ? 262  GLN A CB  1 
ATOM   2056 C  CG  . GLN A 1 278 ? -39.039 17.203  -37.301 1.00 25.26  ? 262  GLN A CG  1 
ATOM   2057 C  CD  . GLN A 1 278 ? -39.878 16.249  -36.490 1.00 39.83  ? 262  GLN A CD  1 
ATOM   2058 O  OE1 . GLN A 1 278 ? -40.004 16.361  -35.259 1.00 27.01  ? 262  GLN A OE1 1 
ATOM   2059 N  NE2 . GLN A 1 278 ? -40.431 15.251  -37.171 1.00 39.75  ? 262  GLN A NE2 1 
ATOM   2060 N  N   . GLN A 1 279 ? -38.863 20.908  -38.707 1.00 16.81  ? 263  GLN A N   1 
ATOM   2061 C  CA  . GLN A 1 279 ? -39.369 21.499  -39.935 1.00 17.07  ? 263  GLN A CA  1 
ATOM   2062 C  C   . GLN A 1 279 ? -38.184 21.889  -40.839 1.00 19.04  ? 263  GLN A C   1 
ATOM   2063 O  O   . GLN A 1 279 ? -38.206 21.584  -42.035 1.00 16.52  ? 263  GLN A O   1 
ATOM   2064 C  CB  . GLN A 1 279 ? -40.265 22.707  -39.621 1.00 19.23  ? 263  GLN A CB  1 
ATOM   2065 C  CG  . GLN A 1 279 ? -40.877 23.264  -40.880 1.00 30.54  ? 263  GLN A CG  1 
ATOM   2066 C  CD  . GLN A 1 279 ? -41.805 24.411  -40.623 1.00 42.35  ? 263  GLN A CD  1 
ATOM   2067 O  OE1 . GLN A 1 279 ? -41.722 25.107  -39.598 1.00 34.24  ? 263  GLN A OE1 1 
ATOM   2068 N  NE2 . GLN A 1 279 ? -42.648 24.674  -41.611 1.00 33.94  ? 263  GLN A NE2 1 
ATOM   2069 N  N   . LEU A 1 280 ? -37.141 22.530  -40.260 1.00 15.77  ? 264  LEU A N   1 
ATOM   2070 C  CA  . LEU A 1 280 ? -35.937 22.897  -41.033 1.00 15.10  ? 264  LEU A CA  1 
ATOM   2071 C  C   . LEU A 1 280 ? -35.210 21.663  -41.569 1.00 18.28  ? 264  LEU A C   1 
ATOM   2072 O  O   . LEU A 1 280 ? -34.857 21.623  -42.760 1.00 16.20  ? 264  LEU A O   1 
ATOM   2073 C  CB  . LEU A 1 280 ? -34.972 23.778  -40.212 1.00 14.05  ? 264  LEU A CB  1 
ATOM   2074 C  CG  . LEU A 1 280 ? -35.435 25.222  -39.956 1.00 17.23  ? 264  LEU A CG  1 
ATOM   2075 C  CD1 . LEU A 1 280 ? -34.461 25.937  -39.007 1.00 17.62  ? 264  LEU A CD1 1 
ATOM   2076 C  CD2 . LEU A 1 280 ? -35.611 26.005  -41.257 1.00 20.96  ? 264  LEU A CD2 1 
ATOM   2077 N  N   . ARG A 1 281 ? -35.011 20.643  -40.704 1.00 16.26  ? 265  ARG A N   1 
ATOM   2078 C  CA  . ARG A 1 281 ? -34.325 19.429  -41.122 1.00 16.01  ? 265  ARG A CA  1 
ATOM   2079 C  C   . ARG A 1 281 ? -35.068 18.728  -42.265 1.00 18.14  ? 265  ARG A C   1 
ATOM   2080 O  O   . ARG A 1 281 ? -34.442 18.363  -43.261 1.00 15.55  ? 265  ARG A O   1 
ATOM   2081 C  CB  . ARG A 1 281 ? -34.045 18.470  -39.947 1.00 18.34  ? 265  ARG A CB  1 
ATOM   2082 C  CG  . ARG A 1 281 ? -32.780 17.627  -40.260 1.00 19.99  ? 265  ARG A CG  1 
ATOM   2083 C  CD  . ARG A 1 281 ? -32.329 16.666  -39.157 1.00 24.47  ? 265  ARG A CD  1 
ATOM   2084 N  NE  . ARG A 1 281 ? -31.136 15.883  -39.547 1.00 23.87  ? 265  ARG A NE  1 
ATOM   2085 C  CZ  . ARG A 1 281 ? -31.165 14.785  -40.296 1.00 40.61  ? 265  ARG A CZ  1 
ATOM   2086 N  NH1 . ARG A 1 281 ? -32.320 14.317  -40.760 1.00 28.30  ? 265  ARG A NH1 1 
ATOM   2087 N  NH2 . ARG A 1 281 ? -30.044 14.154  -40.599 1.00 39.21  ? 265  ARG A NH2 1 
ATOM   2088 N  N   . GLU A 1 282 ? -36.399 18.641  -42.160 1.00 17.14  ? 266  GLU A N   1 
ATOM   2089 C  CA  . GLU A 1 282 ? -37.230 18.002  -43.194 1.00 18.72  ? 266  GLU A CA  1 
ATOM   2090 C  C   . GLU A 1 282 ? -37.237 18.811  -44.504 1.00 20.97  ? 266  GLU A C   1 
ATOM   2091 O  O   . GLU A 1 282 ? -37.195 18.211  -45.592 1.00 19.47  ? 266  GLU A O   1 
ATOM   2092 C  CB  . GLU A 1 282 ? -38.642 17.711  -42.676 1.00 20.01  ? 266  GLU A CB  1 
ATOM   2093 C  CG  . GLU A 1 282 ? -38.644 16.586  -41.642 1.00 23.40  ? 266  GLU A CG  1 
ATOM   2094 C  CD  . GLU A 1 282 ? -39.892 16.428  -40.788 1.00 40.43  ? 266  GLU A CD  1 
ATOM   2095 O  OE1 . GLU A 1 282 ? -39.914 15.482  -39.969 1.00 37.00  ? 266  GLU A OE1 1 
ATOM   2096 O  OE2 . GLU A 1 282 ? -40.814 17.270  -40.885 1.00 38.16  ? 266  GLU A OE2 1 
ATOM   2097 N  N   . ALA A 1 283 ? -37.241 20.156  -44.398 1.00 17.78  ? 267  ALA A N   1 
ATOM   2098 C  CA  . ALA A 1 283 ? -37.201 21.032  -45.581 1.00 17.86  ? 267  ALA A CA  1 
ATOM   2099 C  C   . ALA A 1 283 ? -35.827 20.927  -46.268 1.00 17.47  ? 267  ALA A C   1 
ATOM   2100 O  O   . ALA A 1 283 ? -35.773 20.803  -47.489 1.00 16.02  ? 267  ALA A O   1 
ATOM   2101 C  CB  . ALA A 1 283 ? -37.478 22.483  -45.185 1.00 18.87  ? 267  ALA A CB  1 
ATOM   2102 N  N   . PHE A 1 284 ? -34.727 20.920  -45.487 1.00 14.71  ? 268  PHE A N   1 
ATOM   2103 C  CA  . PHE A 1 284 ? -33.364 20.795  -46.030 1.00 14.50  ? 268  PHE A CA  1 
ATOM   2104 C  C   . PHE A 1 284 ? -33.218 19.437  -46.740 1.00 17.74  ? 268  PHE A C   1 
ATOM   2105 O  O   . PHE A 1 284 ? -32.690 19.401  -47.860 1.00 18.66  ? 268  PHE A O   1 
ATOM   2106 C  CB  . PHE A 1 284 ? -32.295 20.944  -44.931 1.00 15.45  ? 268  PHE A CB  1 
ATOM   2107 C  CG  . PHE A 1 284 ? -32.094 22.324  -44.338 1.00 16.59  ? 268  PHE A CG  1 
ATOM   2108 C  CD1 . PHE A 1 284 ? -32.402 23.470  -45.064 1.00 20.69  ? 268  PHE A CD1 1 
ATOM   2109 C  CD2 . PHE A 1 284 ? -31.598 22.476  -43.050 1.00 17.20  ? 268  PHE A CD2 1 
ATOM   2110 C  CE1 . PHE A 1 284 ? -32.214 24.745  -44.510 1.00 22.30  ? 268  PHE A CE1 1 
ATOM   2111 C  CE2 . PHE A 1 284 ? -31.394 23.754  -42.508 1.00 20.13  ? 268  PHE A CE2 1 
ATOM   2112 C  CZ  . PHE A 1 284 ? -31.730 24.872  -43.228 1.00 18.62  ? 268  PHE A CZ  1 
ATOM   2113 N  N   . SER A 1 285 ? -33.707 18.353  -46.094 1.00 15.81  ? 269  SER A N   1 
ATOM   2114 C  CA  A SER A 1 285 ? -33.662 16.999  -46.649 0.50 16.10  ? 269  SER A CA  1 
ATOM   2115 C  CA  B SER A 1 285 ? -33.707 16.978  -46.618 0.50 16.11  ? 269  SER A CA  1 
ATOM   2116 C  C   . SER A 1 285 ? -34.446 16.901  -47.976 1.00 21.37  ? 269  SER A C   1 
ATOM   2117 O  O   . SER A 1 285 ? -33.920 16.344  -48.951 1.00 20.39  ? 269  SER A O   1 
ATOM   2118 C  CB  A SER A 1 285 ? -34.178 15.981  -45.637 0.50 17.73  ? 269  SER A CB  1 
ATOM   2119 C  CB  B SER A 1 285 ? -34.384 16.032  -45.624 0.50 17.83  ? 269  SER A CB  1 
ATOM   2120 O  OG  A SER A 1 285 ? -33.873 14.662  -46.060 0.50 20.31  ? 269  SER A OG  1 
ATOM   2121 O  OG  B SER A 1 285 ? -33.583 15.739  -44.492 0.50 22.46  ? 269  SER A OG  1 
ATOM   2122 N  N   . ARG A 1 286 ? -35.671 17.461  -48.034 1.00 19.54  ? 270  ARG A N   1 
ATOM   2123 C  CA  . ARG A 1 286 ? -36.526 17.455  -49.241 1.00 20.33  ? 270  ARG A CA  1 
ATOM   2124 C  C   . ARG A 1 286 ? -35.853 18.180  -50.386 1.00 21.74  ? 270  ARG A C   1 
ATOM   2125 O  O   . ARG A 1 286 ? -35.731 17.629  -51.478 1.00 20.02  ? 270  ARG A O   1 
ATOM   2126 C  CB  . ARG A 1 286 ? -37.873 18.155  -48.965 1.00 22.66  ? 270  ARG A CB  1 
ATOM   2127 C  CG  . ARG A 1 286 ? -38.888 17.236  -48.379 1.00 32.98  ? 270  ARG A CG  1 
ATOM   2128 C  CD  . ARG A 1 286 ? -40.291 17.791  -48.499 1.00 32.14  ? 270  ARG A CD  1 
ATOM   2129 N  NE  . ARG A 1 286 ? -40.465 18.909  -47.587 1.00 33.77  ? 270  ARG A NE  1 
ATOM   2130 C  CZ  . ARG A 1 286 ? -40.809 18.799  -46.311 1.00 31.31  ? 270  ARG A CZ  1 
ATOM   2131 N  NH1 . ARG A 1 286 ? -41.082 17.607  -45.787 1.00 19.59  ? 270  ARG A NH1 1 
ATOM   2132 N  NH2 . ARG A 1 286 ? -40.931 19.876  -45.563 1.00 28.39  ? 270  ARG A NH2 1 
ATOM   2133 N  N   . THR A 1 287 ? -35.420 19.423  -50.139 1.00 21.39  ? 271  THR A N   1 
ATOM   2134 C  CA  . THR A 1 287 ? -34.779 20.235  -51.172 1.00 22.05  ? 271  THR A CA  1 
ATOM   2135 C  C   . THR A 1 287 ? -33.463 19.616  -51.657 1.00 25.14  ? 271  THR A C   1 
ATOM   2136 O  O   . THR A 1 287 ? -33.183 19.673  -52.860 1.00 27.38  ? 271  THR A O   1 
ATOM   2137 C  CB  . THR A 1 287 ? -34.641 21.706  -50.723 1.00 27.21  ? 271  THR A CB  1 
ATOM   2138 O  OG1 . THR A 1 287 ? -33.723 21.770  -49.617 1.00 29.08  ? 271  THR A OG1 1 
ATOM   2139 C  CG2 . THR A 1 287 ? -36.001 22.354  -50.368 1.00 24.09  ? 271  THR A CG2 1 
ATOM   2140 N  N   . ALA A 1 288 ? -32.703 18.961  -50.745 1.00 21.14  ? 272  ALA A N   1 
ATOM   2141 C  CA  . ALA A 1 288 ? -31.432 18.269  -51.022 1.00 22.20  ? 272  ALA A CA  1 
ATOM   2142 C  C   . ALA A 1 288 ? -31.560 17.187  -52.121 1.00 26.41  ? 272  ALA A C   1 
ATOM   2143 O  O   . ALA A 1 288 ? -30.560 16.853  -52.749 1.00 26.83  ? 272  ALA A O   1 
ATOM   2144 C  CB  . ALA A 1 288 ? -30.896 17.623  -49.762 1.00 23.11  ? 272  ALA A CB  1 
ATOM   2145 N  N   . ILE A 1 289 ? -32.768 16.629  -52.323 1.00 21.98  ? 273  ILE A N   1 
ATOM   2146 C  CA  . ILE A 1 289 ? -33.018 15.580  -53.334 1.00 21.44  ? 273  ILE A CA  1 
ATOM   2147 C  C   . ILE A 1 289 ? -32.635 16.110  -54.729 1.00 26.90  ? 273  ILE A C   1 
ATOM   2148 O  O   . ILE A 1 289 ? -32.170 15.343  -55.583 1.00 26.32  ? 273  ILE A O   1 
ATOM   2149 C  CB  . ILE A 1 289 ? -34.498 15.097  -53.296 1.00 23.70  ? 273  ILE A CB  1 
ATOM   2150 C  CG1 . ILE A 1 289 ? -34.842 14.389  -51.952 1.00 21.77  ? 273  ILE A CG1 1 
ATOM   2151 C  CG2 . ILE A 1 289 ? -34.834 14.171  -54.508 1.00 25.96  ? 273  ILE A CG2 1 
ATOM   2152 C  CD1 . ILE A 1 289 ? -36.408 14.239  -51.744 1.00 22.38  ? 273  ILE A CD1 1 
ATOM   2153 N  N   . LEU A 1 290 ? -32.838 17.416  -54.946 1.00 23.68  ? 274  LEU A N   1 
ATOM   2154 C  CA  . LEU A 1 290 ? -32.508 18.045  -56.225 1.00 24.33  ? 274  LEU A CA  1 
ATOM   2155 C  C   . LEU A 1 290 ? -31.238 18.902  -56.187 1.00 29.60  ? 274  LEU A C   1 
ATOM   2156 O  O   . LEU A 1 290 ? -31.019 19.725  -57.080 1.00 30.67  ? 274  LEU A O   1 
ATOM   2157 C  CB  . LEU A 1 290 ? -33.729 18.735  -56.844 1.00 24.52  ? 274  LEU A CB  1 
ATOM   2158 C  CG  . LEU A 1 290 ? -34.954 17.813  -57.070 1.00 28.03  ? 274  LEU A CG  1 
ATOM   2159 C  CD1 . LEU A 1 290 ? -36.086 18.570  -57.711 1.00 28.95  ? 274  LEU A CD1 1 
ATOM   2160 C  CD2 . LEU A 1 290 ? -34.605 16.558  -57.919 1.00 28.11  ? 274  LEU A CD2 1 
ATOM   2161 N  N   . SER A 1 291 ? -30.389 18.691  -55.157 1.00 25.22  ? 275  SER A N   1 
ATOM   2162 C  CA  . SER A 1 291 ? -29.108 19.380  -55.059 1.00 26.07  ? 275  SER A CA  1 
ATOM   2163 C  C   . SER A 1 291 ? -28.066 18.551  -55.843 1.00 35.50  ? 275  SER A C   1 
ATOM   2164 O  O   . SER A 1 291 ? -28.337 17.396  -56.199 1.00 35.36  ? 275  SER A O   1 
ATOM   2165 C  CB  . SER A 1 291 ? -28.680 19.554  -53.604 1.00 28.63  ? 275  SER A CB  1 
ATOM   2166 O  OG  . SER A 1 291 ? -28.242 18.330  -53.041 1.00 31.47  ? 275  SER A OG  1 
ATOM   2167 N  N   . ASN A 1 292 ? -26.884 19.143  -56.104 1.00 34.78  ? 276  ASN A N   1 
ATOM   2168 C  CA  . ASN A 1 292 ? -25.757 18.485  -56.773 1.00 35.47  ? 276  ASN A CA  1 
ATOM   2169 C  C   . ASN A 1 292 ? -25.303 17.299  -55.888 1.00 40.10  ? 276  ASN A C   1 
ATOM   2170 O  O   . ASN A 1 292 ? -25.088 17.470  -54.685 1.00 38.24  ? 276  ASN A O   1 
ATOM   2171 C  CB  . ASN A 1 292 ? -24.621 19.497  -56.963 1.00 35.56  ? 276  ASN A CB  1 
ATOM   2172 C  CG  . ASN A 1 292 ? -23.453 18.986  -57.763 1.00 53.70  ? 276  ASN A CG  1 
ATOM   2173 O  OD1 . ASN A 1 292 ? -22.691 18.119  -57.319 1.00 47.45  ? 276  ASN A OD1 1 
ATOM   2174 N  ND2 . ASN A 1 292 ? -23.258 19.560  -58.940 1.00 43.30  ? 276  ASN A ND2 1 
ATOM   2175 N  N   . GLU A 1 293 ? -25.188 16.103  -56.485 1.00 39.59  ? 277  GLU A N   1 
ATOM   2176 C  CA  . GLU A 1 293 ? -24.815 14.861  -55.793 1.00 40.11  ? 277  GLU A CA  1 
ATOM   2177 C  C   . GLU A 1 293 ? -23.461 14.872  -55.061 1.00 45.18  ? 277  GLU A C   1 
ATOM   2178 O  O   . GLU A 1 293 ? -23.312 14.162  -54.063 1.00 45.41  ? 277  GLU A O   1 
ATOM   2179 C  CB  . GLU A 1 293 ? -24.942 13.655  -56.735 1.00 42.34  ? 277  GLU A CB  1 
ATOM   2180 C  CG  . GLU A 1 293 ? -26.385 13.319  -57.088 1.00 54.87  ? 277  GLU A CG  1 
ATOM   2181 C  CD  . GLU A 1 293 ? -26.617 12.212  -58.100 1.00 80.76  ? 277  GLU A CD  1 
ATOM   2182 O  OE1 . GLU A 1 293 ? -25.691 11.403  -58.342 1.00 81.40  ? 277  GLU A OE1 1 
ATOM   2183 O  OE2 . GLU A 1 293 ? -27.745 12.143  -58.639 1.00 74.24  ? 277  GLU A OE2 1 
ATOM   2184 N  N   . LYS A 1 294 ? -22.503 15.701  -55.522 1.00 41.71  ? 278  LYS A N   1 
ATOM   2185 C  CA  . LYS A 1 294 ? -21.171 15.814  -54.925 1.00 41.09  ? 278  LYS A CA  1 
ATOM   2186 C  C   . LYS A 1 294 ? -21.034 16.996  -53.970 1.00 43.82  ? 278  LYS A C   1 
ATOM   2187 O  O   . LYS A 1 294 ? -20.621 16.796  -52.821 1.00 44.19  ? 278  LYS A O   1 
ATOM   2188 C  CB  . LYS A 1 294 ? -20.091 15.882  -56.022 1.00 44.80  ? 278  LYS A CB  1 
ATOM   2189 N  N   . TYR A 1 295 ? -21.354 18.228  -54.448 1.00 38.06  ? 279  TYR A N   1 
ATOM   2190 C  CA  . TYR A 1 295 ? -21.245 19.463  -53.670 1.00 36.29  ? 279  TYR A CA  1 
ATOM   2191 C  C   . TYR A 1 295 ? -22.364 19.665  -52.636 1.00 34.64  ? 279  TYR A C   1 
ATOM   2192 O  O   . TYR A 1 295 ? -22.130 20.360  -51.646 1.00 33.90  ? 279  TYR A O   1 
ATOM   2193 C  CB  . TYR A 1 295 ? -21.108 20.685  -54.584 1.00 38.51  ? 279  TYR A CB  1 
ATOM   2194 N  N   . ARG A 1 296 ? -23.574 19.094  -52.885 1.00 28.08  ? 280  ARG A N   1 
ATOM   2195 C  CA  . ARG A 1 296 ? -24.774 19.161  -52.018 1.00 27.14  ? 280  ARG A CA  1 
ATOM   2196 C  C   . ARG A 1 296 ? -25.169 20.588  -51.590 1.00 29.56  ? 280  ARG A C   1 
ATOM   2197 O  O   . ARG A 1 296 ? -25.688 20.804  -50.488 1.00 28.21  ? 280  ARG A O   1 
ATOM   2198 C  CB  . ARG A 1 296 ? -24.611 18.223  -50.795 1.00 28.16  ? 280  ARG A CB  1 
ATOM   2199 C  CG  . ARG A 1 296 ? -24.330 16.768  -51.182 1.00 33.44  ? 280  ARG A CG  1 
ATOM   2200 C  CD  . ARG A 1 296 ? -25.600 15.977  -51.372 1.00 37.43  ? 280  ARG A CD  1 
ATOM   2201 N  NE  . ARG A 1 296 ? -26.267 15.750  -50.090 1.00 42.83  ? 280  ARG A NE  1 
ATOM   2202 C  CZ  . ARG A 1 296 ? -27.542 15.400  -49.962 1.00 51.81  ? 280  ARG A CZ  1 
ATOM   2203 N  NH1 . ARG A 1 296 ? -28.303 15.238  -51.037 1.00 29.13  ? 280  ARG A NH1 1 
ATOM   2204 N  NH2 . ARG A 1 296 ? -28.066 15.213  -48.757 1.00 42.52  ? 280  ARG A NH2 1 
ATOM   2205 N  N   . GLY A 1 297 ? -24.914 21.548  -52.474 1.00 25.18  ? 281  GLY A N   1 
ATOM   2206 C  CA  . GLY A 1 297 ? -25.183 22.943  -52.195 1.00 24.18  ? 281  GLY A CA  1 
ATOM   2207 C  C   . GLY A 1 297 ? -26.649 23.316  -52.207 1.00 27.30  ? 281  GLY A C   1 
ATOM   2208 O  O   . GLY A 1 297 ? -27.383 22.957  -53.135 1.00 27.28  ? 281  GLY A O   1 
ATOM   2209 N  N   . ILE A 1 298 ? -27.073 24.049  -51.169 1.00 24.24  ? 282  ILE A N   1 
ATOM   2210 C  CA  . ILE A 1 298 ? -28.419 24.608  -51.048 1.00 24.26  ? 282  ILE A CA  1 
ATOM   2211 C  C   . ILE A 1 298 ? -28.325 26.101  -50.780 1.00 27.74  ? 282  ILE A C   1 
ATOM   2212 O  O   . ILE A 1 298 ? -27.443 26.556  -50.055 1.00 27.81  ? 282  ILE A O   1 
ATOM   2213 C  CB  . ILE A 1 298 ? -29.397 23.875  -50.104 1.00 27.12  ? 282  ILE A CB  1 
ATOM   2214 C  CG1 . ILE A 1 298 ? -28.948 23.936  -48.631 1.00 27.33  ? 282  ILE A CG1 1 
ATOM   2215 C  CG2 . ILE A 1 298 ? -29.709 22.451  -50.605 1.00 27.99  ? 282  ILE A CG2 1 
ATOM   2216 C  CD1 . ILE A 1 298 ? -30.082 23.790  -47.644 1.00 37.14  ? 282  ILE A CD1 1 
ATOM   2217 N  N   . ARG A 1 299 ? -29.215 26.856  -51.395 1.00 23.54  ? 283  ARG A N   1 
ATOM   2218 C  CA  . ARG A 1 299 ? -29.247 28.307  -51.312 1.00 23.86  ? 283  ARG A CA  1 
ATOM   2219 C  C   . ARG A 1 299 ? -30.305 28.719  -50.290 1.00 26.88  ? 283  ARG A C   1 
ATOM   2220 O  O   . ARG A 1 299 ? -31.466 28.307  -50.416 1.00 26.38  ? 283  ARG A O   1 
ATOM   2221 C  CB  . ARG A 1 299 ? -29.610 28.833  -52.717 1.00 27.57  ? 283  ARG A CB  1 
ATOM   2222 C  CG  . ARG A 1 299 ? -29.205 30.258  -53.006 1.00 45.05  ? 283  ARG A CG  1 
ATOM   2223 C  CD  . ARG A 1 299 ? -29.538 30.605  -54.448 1.00 54.40  ? 283  ARG A CD  1 
ATOM   2224 N  NE  . ARG A 1 299 ? -28.607 30.003  -55.407 1.00 60.22  ? 283  ARG A NE  1 
ATOM   2225 C  CZ  . ARG A 1 299 ? -27.588 30.648  -55.969 1.00 70.30  ? 283  ARG A CZ  1 
ATOM   2226 N  NH1 . ARG A 1 299 ? -27.353 31.920  -55.672 1.00 52.13  ? 283  ARG A NH1 1 
ATOM   2227 N  NH2 . ARG A 1 299 ? -26.800 30.027  -56.836 1.00 55.34  ? 283  ARG A NH2 1 
ATOM   2228 N  N   . LEU A 1 300 ? -29.908 29.522  -49.278 1.00 23.32  ? 284  LEU A N   1 
ATOM   2229 C  CA  . LEU A 1 300 ? -30.830 30.034  -48.247 1.00 22.43  ? 284  LEU A CA  1 
ATOM   2230 C  C   . LEU A 1 300 ? -31.093 31.513  -48.524 1.00 26.74  ? 284  LEU A C   1 
ATOM   2231 O  O   . LEU A 1 300 ? -30.152 32.317  -48.565 1.00 26.79  ? 284  LEU A O   1 
ATOM   2232 C  CB  . LEU A 1 300 ? -30.246 29.875  -46.828 1.00 22.17  ? 284  LEU A CB  1 
ATOM   2233 C  CG  . LEU A 1 300 ? -30.309 28.472  -46.163 1.00 26.93  ? 284  LEU A CG  1 
ATOM   2234 C  CD1 . LEU A 1 300 ? -29.442 27.457  -46.884 1.00 29.63  ? 284  LEU A CD1 1 
ATOM   2235 C  CD2 . LEU A 1 300 ? -29.837 28.549  -44.718 1.00 26.70  ? 284  LEU A CD2 1 
ATOM   2236 N  N   . GLN A 1 301 ? -32.359 31.866  -48.731 1.00 22.83  ? 285  GLN A N   1 
ATOM   2237 C  CA  . GLN A 1 301 ? -32.729 33.264  -48.943 1.00 23.24  ? 285  GLN A CA  1 
ATOM   2238 C  C   . GLN A 1 301 ? -33.536 33.707  -47.746 1.00 24.85  ? 285  GLN A C   1 
ATOM   2239 O  O   . GLN A 1 301 ? -34.685 33.285  -47.572 1.00 23.15  ? 285  GLN A O   1 
ATOM   2240 C  CB  . GLN A 1 301 ? -33.486 33.457  -50.264 1.00 25.71  ? 285  GLN A CB  1 
ATOM   2241 C  CG  . GLN A 1 301 ? -32.590 33.323  -51.487 1.00 49.14  ? 285  GLN A CG  1 
ATOM   2242 C  CD  . GLN A 1 301 ? -33.262 33.869  -52.720 1.00 75.63  ? 285  GLN A CD  1 
ATOM   2243 O  OE1 . GLN A 1 301 ? -34.008 33.167  -53.411 1.00 69.54  ? 285  GLN A OE1 1 
ATOM   2244 N  NE2 . GLN A 1 301 ? -33.024 35.142  -53.013 1.00 71.97  ? 285  GLN A NE2 1 
ATOM   2245 N  N   . LEU A 1 302 ? -32.904 34.499  -46.877 1.00 22.20  ? 286  LEU A N   1 
ATOM   2246 C  CA  . LEU A 1 302 ? -33.563 34.987  -45.681 1.00 22.41  ? 286  LEU A CA  1 
ATOM   2247 C  C   . LEU A 1 302 ? -34.169 36.354  -45.890 1.00 27.13  ? 286  LEU A C   1 
ATOM   2248 O  O   . LEU A 1 302 ? -33.566 37.200  -46.544 1.00 28.04  ? 286  LEU A O   1 
ATOM   2249 C  CB  . LEU A 1 302 ? -32.599 35.002  -44.483 1.00 22.61  ? 286  LEU A CB  1 
ATOM   2250 C  CG  . LEU A 1 302 ? -32.287 33.614  -43.912 1.00 26.90  ? 286  LEU A CG  1 
ATOM   2251 C  CD1 . LEU A 1 302 ? -30.928 33.614  -43.235 1.00 26.79  ? 286  LEU A CD1 1 
ATOM   2252 C  CD2 . LEU A 1 302 ? -33.375 33.181  -42.938 1.00 28.84  ? 286  LEU A CD2 1 
ATOM   2253 N  N   . SER A 1 303 ? -35.371 36.554  -45.339 1.00 22.71  ? 287  SER A N   1 
ATOM   2254 C  CA  . SER A 1 303 ? -36.087 37.847  -45.338 1.00 23.20  ? 287  SER A CA  1 
ATOM   2255 C  C   . SER A 1 303 ? -36.959 37.863  -44.076 1.00 26.75  ? 287  SER A C   1 
ATOM   2256 O  O   . SER A 1 303 ? -36.989 36.857  -43.360 1.00 23.97  ? 287  SER A O   1 
ATOM   2257 C  CB  . SER A 1 303 ? -36.883 38.053  -46.629 1.00 25.79  ? 287  SER A CB  1 
ATOM   2258 O  OG  . SER A 1 303 ? -37.925 37.107  -46.801 1.00 27.67  ? 287  SER A OG  1 
ATOM   2259 N  N   . ASN A 1 304 ? -37.597 39.012  -43.743 1.00 25.49  ? 288  ASN A N   1 
ATOM   2260 C  CA  . ASN A 1 304 ? -38.401 39.120  -42.514 1.00 25.61  ? 288  ASN A CA  1 
ATOM   2261 C  C   . ASN A 1 304 ? -39.414 37.982  -42.355 1.00 26.09  ? 288  ASN A C   1 
ATOM   2262 O  O   . ASN A 1 304 ? -40.234 37.753  -43.248 1.00 26.04  ? 288  ASN A O   1 
ATOM   2263 C  CB  . ASN A 1 304 ? -39.081 40.509  -42.402 1.00 29.14  ? 288  ASN A CB  1 
ATOM   2264 C  CG  . ASN A 1 304 ? -39.492 40.864  -40.994 1.00 62.28  ? 288  ASN A CG  1 
ATOM   2265 O  OD1 . ASN A 1 304 ? -40.390 40.248  -40.406 1.00 56.75  ? 288  ASN A OD1 1 
ATOM   2266 N  ND2 . ASN A 1 304 ? -38.843 41.874  -40.419 1.00 58.82  ? 288  ASN A ND2 1 
ATOM   2267 N  N   . GLY A 1 305 ? -39.251 37.223  -41.264 1.00 22.24  ? 289  GLY A N   1 
ATOM   2268 C  CA  . GLY A 1 305 ? -40.072 36.088  -40.859 1.00 20.39  ? 289  GLY A CA  1 
ATOM   2269 C  C   . GLY A 1 305 ? -40.068 34.895  -41.800 1.00 23.24  ? 289  GLY A C   1 
ATOM   2270 O  O   . GLY A 1 305 ? -40.928 34.020  -41.675 1.00 20.95  ? 289  GLY A O   1 
ATOM   2271 N  N   . LEU A 1 306 ? -39.115 34.848  -42.758 1.00 20.50  ? 290  LEU A N   1 
ATOM   2272 C  CA  . LEU A 1 306 ? -39.137 33.827  -43.795 1.00 21.52  ? 290  LEU A CA  1 
ATOM   2273 C  C   . LEU A 1 306 ? -37.788 33.309  -44.264 1.00 23.31  ? 290  LEU A C   1 
ATOM   2274 O  O   . LEU A 1 306 ? -36.873 34.078  -44.533 1.00 21.81  ? 290  LEU A O   1 
ATOM   2275 C  CB  . LEU A 1 306 ? -39.897 34.426  -45.011 1.00 22.37  ? 290  LEU A CB  1 
ATOM   2276 C  CG  . LEU A 1 306 ? -40.299 33.482  -46.136 1.00 29.05  ? 290  LEU A CG  1 
ATOM   2277 C  CD1 . LEU A 1 306 ? -41.407 32.495  -45.667 1.00 29.63  ? 290  LEU A CD1 1 
ATOM   2278 C  CD2 . LEU A 1 306 ? -40.761 34.281  -47.351 1.00 32.99  ? 290  LEU A CD2 1 
ATOM   2279 N  N   . LEU A 1 307 ? -37.714 31.990  -44.463 1.00 19.81  ? 291  LEU A N   1 
ATOM   2280 C  CA  . LEU A 1 307 ? -36.546 31.360  -45.030 1.00 19.64  ? 291  LEU A CA  1 
ATOM   2281 C  C   . LEU A 1 307 ? -36.996 30.619  -46.283 1.00 23.67  ? 291  LEU A C   1 
ATOM   2282 O  O   . LEU A 1 307 ? -37.906 29.776  -46.222 1.00 23.43  ? 291  LEU A O   1 
ATOM   2283 C  CB  . LEU A 1 307 ? -35.870 30.387  -44.020 1.00 19.46  ? 291  LEU A CB  1 
ATOM   2284 C  CG  . LEU A 1 307 ? -34.821 29.403  -44.621 1.00 24.39  ? 291  LEU A CG  1 
ATOM   2285 C  CD1 . LEU A 1 307 ? -33.605 30.138  -45.187 1.00 24.28  ? 291  LEU A CD1 1 
ATOM   2286 C  CD2 . LEU A 1 307 ? -34.339 28.412  -43.573 1.00 26.30  ? 291  LEU A CD2 1 
ATOM   2287 N  N   . LYS A 1 308 ? -36.402 30.965  -47.421 1.00 19.79  ? 292  LYS A N   1 
ATOM   2288 C  CA  . LYS A 1 308 ? -36.687 30.271  -48.670 1.00 19.88  ? 292  LYS A CA  1 
ATOM   2289 C  C   . LYS A 1 308 ? -35.459 29.403  -48.963 1.00 24.11  ? 292  LYS A C   1 
ATOM   2290 O  O   . LYS A 1 308 ? -34.340 29.919  -48.963 1.00 24.27  ? 292  LYS A O   1 
ATOM   2291 C  CB  . LYS A 1 308 ? -36.951 31.278  -49.801 1.00 22.59  ? 292  LYS A CB  1 
ATOM   2292 C  CG  . LYS A 1 308 ? -37.611 30.669  -51.034 1.00 46.05  ? 292  LYS A CG  1 
ATOM   2293 C  CD  . LYS A 1 308 ? -37.750 31.692  -52.191 1.00 62.30  ? 292  LYS A CD  1 
ATOM   2294 C  CE  . LYS A 1 308 ? -38.855 32.713  -52.002 1.00 78.78  ? 292  LYS A CE  1 
ATOM   2295 N  NZ  . LYS A 1 308 ? -39.130 33.472  -53.250 1.00 90.87  ? 292  LYS A NZ  1 
ATOM   2296 N  N   . ILE A 1 309 ? -35.658 28.090  -49.170 1.00 20.31  ? 293  ILE A N   1 
ATOM   2297 C  CA  . ILE A 1 309 ? -34.570 27.137  -49.439 1.00 20.04  ? 293  ILE A CA  1 
ATOM   2298 C  C   . ILE A 1 309 ? -34.666 26.757  -50.911 1.00 25.53  ? 293  ILE A C   1 
ATOM   2299 O  O   . ILE A 1 309 ? -35.763 26.459  -51.392 1.00 25.07  ? 293  ILE A O   1 
ATOM   2300 C  CB  . ILE A 1 309 ? -34.636 25.883  -48.520 1.00 23.69  ? 293  ILE A CB  1 
ATOM   2301 C  CG1 . ILE A 1 309 ? -34.647 26.253  -47.019 1.00 23.94  ? 293  ILE A CG1 1 
ATOM   2302 C  CG2 . ILE A 1 309 ? -33.501 24.876  -48.832 1.00 25.79  ? 293  ILE A CG2 1 
ATOM   2303 C  CD1 . ILE A 1 309 ? -35.617 25.410  -46.252 1.00 25.93  ? 293  ILE A CD1 1 
ATOM   2304 N  N   . GLN A 1 310 ? -33.534 26.783  -51.624 1.00 21.41  ? 294  GLN A N   1 
ATOM   2305 C  CA  . GLN A 1 310 ? -33.520 26.434  -53.047 1.00 22.34  ? 294  GLN A CA  1 
ATOM   2306 C  C   . GLN A 1 310 ? -32.341 25.501  -53.380 1.00 24.71  ? 294  GLN A C   1 
ATOM   2307 O  O   . GLN A 1 310 ? -31.211 25.722  -52.927 1.00 23.89  ? 294  GLN A O   1 
ATOM   2308 C  CB  . GLN A 1 310 ? -33.507 27.711  -53.919 1.00 23.91  ? 294  GLN A CB  1 
ATOM   2309 C  CG  . GLN A 1 310 ? -33.538 27.457  -55.429 1.00 43.93  ? 294  GLN A CG  1 
ATOM   2310 C  CD  . GLN A 1 310 ? -33.351 28.725  -56.231 1.00 73.24  ? 294  GLN A CD  1 
ATOM   2311 O  OE1 . GLN A 1 310 ? -34.235 29.592  -56.292 1.00 70.73  ? 294  GLN A OE1 1 
ATOM   2312 N  NE2 . GLN A 1 310 ? -32.206 28.849  -56.891 1.00 63.54  ? 294  GLN A NE2 1 
ATOM   2313 N  N   . ALA A 1 311 ? -32.618 24.476  -54.179 1.00 23.03  ? 295  ALA A N   1 
ATOM   2314 C  CA  . ALA A 1 311 ? -31.590 23.552  -54.643 1.00 22.88  ? 295  ALA A CA  1 
ATOM   2315 C  C   . ALA A 1 311 ? -31.750 23.355  -56.133 1.00 27.15  ? 295  ALA A C   1 
ATOM   2316 O  O   . ALA A 1 311 ? -32.873 23.344  -56.625 1.00 26.72  ? 295  ALA A O   1 
ATOM   2317 C  CB  . ALA A 1 311 ? -31.673 22.219  -53.911 1.00 22.80  ? 295  ALA A CB  1 
ATOM   2318 N  N   . ASN A 1 312 ? -30.620 23.232  -56.838 1.00 25.96  ? 296  ASN A N   1 
ATOM   2319 C  CA  . ASN A 1 312 ? -30.511 23.020  -58.283 1.00 27.78  ? 296  ASN A CA  1 
ATOM   2320 C  C   . ASN A 1 312 ? -29.409 22.000  -58.516 1.00 32.03  ? 296  ASN A C   1 
ATOM   2321 O  O   . ASN A 1 312 ? -28.468 21.926  -57.729 1.00 31.37  ? 296  ASN A O   1 
ATOM   2322 C  CB  . ASN A 1 312 ? -30.141 24.332  -59.027 1.00 29.61  ? 296  ASN A CB  1 
ATOM   2323 C  CG  . ASN A 1 312 ? -31.224 25.365  -59.022 1.00 53.57  ? 296  ASN A CG  1 
ATOM   2324 O  OD1 . ASN A 1 312 ? -32.077 25.403  -59.917 1.00 54.00  ? 296  ASN A OD1 1 
ATOM   2325 N  ND2 . ASN A 1 312 ? -31.201 26.239  -58.025 1.00 37.96  ? 296  ASN A ND2 1 
ATOM   2326 N  N   . ASN A 1 313 ? -29.518 21.234  -59.593 1.00 30.80  ? 297  ASN A N   1 
ATOM   2327 C  CA  . ASN A 1 313 ? -28.509 20.233  -59.954 1.00 32.41  ? 297  ASN A CA  1 
ATOM   2328 C  C   . ASN A 1 313 ? -28.058 20.458  -61.427 1.00 40.76  ? 297  ASN A C   1 
ATOM   2329 O  O   . ASN A 1 313 ? -28.704 21.256  -62.122 1.00 40.62  ? 297  ASN A O   1 
ATOM   2330 C  CB  . ASN A 1 313 ? -29.049 18.804  -59.708 1.00 28.94  ? 297  ASN A CB  1 
ATOM   2331 C  CG  . ASN A 1 313 ? -30.277 18.405  -60.495 1.00 38.82  ? 297  ASN A CG  1 
ATOM   2332 O  OD1 . ASN A 1 313 ? -30.602 18.959  -61.548 1.00 34.73  ? 297  ASN A OD1 1 
ATOM   2333 N  ND2 . ASN A 1 313 ? -30.960 17.377  -60.017 1.00 32.69  ? 297  ASN A ND2 1 
ATOM   2334 N  N   . PRO A 1 314 ? -26.995 19.784  -61.941 1.00 40.10  ? 298  PRO A N   1 
ATOM   2335 C  CA  . PRO A 1 314 ? -26.571 20.048  -63.335 1.00 41.65  ? 298  PRO A CA  1 
ATOM   2336 C  C   . PRO A 1 314 ? -27.614 19.807  -64.434 1.00 47.84  ? 298  PRO A C   1 
ATOM   2337 O  O   . PRO A 1 314 ? -27.486 20.404  -65.502 1.00 50.10  ? 298  PRO A O   1 
ATOM   2338 C  CB  . PRO A 1 314 ? -25.325 19.171  -63.505 1.00 43.51  ? 298  PRO A CB  1 
ATOM   2339 C  CG  . PRO A 1 314 ? -24.820 18.961  -62.108 1.00 46.95  ? 298  PRO A CG  1 
ATOM   2340 C  CD  . PRO A 1 314 ? -26.071 18.837  -61.281 1.00 41.21  ? 298  PRO A CD  1 
ATOM   2341 N  N   . GLU A 1 315 ? -28.654 18.974  -64.172 1.00 43.28  ? 299  GLU A N   1 
ATOM   2342 C  CA  . GLU A 1 315 ? -29.736 18.650  -65.124 1.00 43.11  ? 299  GLU A CA  1 
ATOM   2343 C  C   . GLU A 1 315 ? -30.861 19.710  -65.138 1.00 44.84  ? 299  GLU A C   1 
ATOM   2344 O  O   . GLU A 1 315 ? -31.915 19.484  -65.738 1.00 43.90  ? 299  GLU A O   1 
ATOM   2345 C  CB  . GLU A 1 315 ? -30.330 17.250  -64.852 1.00 44.51  ? 299  GLU A CB  1 
ATOM   2346 C  CG  . GLU A 1 315 ? -29.320 16.124  -64.721 1.00 56.53  ? 299  GLU A CG  1 
ATOM   2347 C  CD  . GLU A 1 315 ? -28.979 15.823  -63.275 1.00 77.57  ? 299  GLU A CD  1 
ATOM   2348 O  OE1 . GLU A 1 315 ? -28.001 16.412  -62.759 1.00 71.67  ? 299  GLU A OE1 1 
ATOM   2349 O  OE2 . GLU A 1 315 ? -29.720 15.037  -62.643 1.00 70.65  ? 299  GLU A OE2 1 
ATOM   2350 N  N   . GLN A 1 316 ? -30.633 20.852  -64.455 1.00 41.05  ? 300  GLN A N   1 
ATOM   2351 C  CA  . GLN A 1 316 ? -31.542 22.001  -64.323 1.00 40.13  ? 300  GLN A CA  1 
ATOM   2352 C  C   . GLN A 1 316 ? -32.824 21.714  -63.525 1.00 39.14  ? 300  GLN A C   1 
ATOM   2353 O  O   . GLN A 1 316 ? -33.787 22.484  -63.583 1.00 38.70  ? 300  GLN A O   1 
ATOM   2354 C  CB  . GLN A 1 316 ? -31.790 22.732  -65.669 1.00 42.97  ? 300  GLN A CB  1 
ATOM   2355 N  N   . GLU A 1 317 ? -32.819 20.627  -62.730 1.00 31.52  ? 301  GLU A N   1 
ATOM   2356 C  CA  . GLU A 1 317 ? -33.951 20.341  -61.848 1.00 28.64  ? 301  GLU A CA  1 
ATOM   2357 C  C   . GLU A 1 317 ? -33.844 21.299  -60.658 1.00 30.07  ? 301  GLU A C   1 
ATOM   2358 O  O   . GLU A 1 317 ? -32.746 21.761  -60.348 1.00 30.27  ? 301  GLU A O   1 
ATOM   2359 C  CB  . GLU A 1 317 ? -33.960 18.876  -61.395 1.00 28.44  ? 301  GLU A CB  1 
ATOM   2360 C  CG  . GLU A 1 317 ? -34.190 17.918  -62.555 1.00 29.52  ? 301  GLU A CG  1 
ATOM   2361 C  CD  . GLU A 1 317 ? -34.039 16.447  -62.223 1.00 32.77  ? 301  GLU A CD  1 
ATOM   2362 O  OE1 . GLU A 1 317 ? -33.152 16.104  -61.409 1.00 36.96  ? 301  GLU A OE1 1 
ATOM   2363 O  OE2 . GLU A 1 317 ? -34.782 15.631  -62.814 1.00 31.99  ? 301  GLU A OE2 1 
ATOM   2364 N  N   . GLU A 1 318 ? -34.976 21.657  -60.044 1.00 24.73  ? 302  GLU A N   1 
ATOM   2365 C  CA  . GLU A 1 318 ? -34.974 22.610  -58.932 1.00 22.71  ? 302  GLU A CA  1 
ATOM   2366 C  C   . GLU A 1 318 ? -36.013 22.254  -57.855 1.00 26.00  ? 302  GLU A C   1 
ATOM   2367 O  O   . GLU A 1 318 ? -37.113 21.792  -58.173 1.00 25.91  ? 302  GLU A O   1 
ATOM   2368 C  CB  . GLU A 1 318 ? -35.228 24.035  -59.461 1.00 23.98  ? 302  GLU A CB  1 
ATOM   2369 C  CG  . GLU A 1 318 ? -35.058 25.120  -58.406 1.00 35.32  ? 302  GLU A CG  1 
ATOM   2370 C  CD  . GLU A 1 318 ? -35.351 26.513  -58.922 1.00 54.59  ? 302  GLU A CD  1 
ATOM   2371 O  OE1 . GLU A 1 318 ? -36.547 26.863  -59.032 1.00 48.04  ? 302  GLU A OE1 1 
ATOM   2372 O  OE2 . GLU A 1 318 ? -34.386 27.237  -59.256 1.00 48.48  ? 302  GLU A OE2 1 
ATOM   2373 N  N   . ALA A 1 319 ? -35.636 22.461  -56.591 1.00 24.02  ? 303  ALA A N   1 
ATOM   2374 C  CA  . ALA A 1 319 ? -36.514 22.254  -55.446 1.00 23.25  ? 303  ALA A CA  1 
ATOM   2375 C  C   . ALA A 1 319 ? -36.521 23.550  -54.644 1.00 26.16  ? 303  ALA A C   1 
ATOM   2376 O  O   . ALA A 1 319 ? -35.485 24.206  -54.515 1.00 25.20  ? 303  ALA A O   1 
ATOM   2377 C  CB  . ALA A 1 319 ? -36.031 21.104  -54.587 1.00 23.18  ? 303  ALA A CB  1 
ATOM   2378 N  N   . GLU A 1 320 ? -37.695 23.953  -54.174 1.00 22.88  ? 304  GLU A N   1 
ATOM   2379 C  CA  . GLU A 1 320 ? -37.828 25.189  -53.398 1.00 23.42  ? 304  GLU A CA  1 
ATOM   2380 C  C   . GLU A 1 320 ? -38.796 24.955  -52.239 1.00 27.11  ? 304  GLU A C   1 
ATOM   2381 O  O   . GLU A 1 320 ? -39.764 24.191  -52.363 1.00 25.76  ? 304  GLU A O   1 
ATOM   2382 C  CB  . GLU A 1 320 ? -38.317 26.329  -54.312 1.00 25.58  ? 304  GLU A CB  1 
ATOM   2383 C  CG  . GLU A 1 320 ? -38.125 27.728  -53.766 1.00 43.39  ? 304  GLU A CG  1 
ATOM   2384 C  CD  . GLU A 1 320 ? -38.438 28.824  -54.772 1.00 73.30  ? 304  GLU A CD  1 
ATOM   2385 O  OE1 . GLU A 1 320 ? -37.616 29.762  -54.896 1.00 61.93  ? 304  GLU A OE1 1 
ATOM   2386 O  OE2 . GLU A 1 320 ? -39.491 28.739  -55.448 1.00 69.21  ? 304  GLU A OE2 1 
ATOM   2387 N  N   . GLU A 1 321 ? -38.518 25.591  -51.102 1.00 22.16  ? 305  GLU A N   1 
ATOM   2388 C  CA  . GLU A 1 321 ? -39.405 25.466  -49.961 1.00 21.52  ? 305  GLU A CA  1 
ATOM   2389 C  C   . GLU A 1 321 ? -39.324 26.713  -49.127 1.00 23.22  ? 305  GLU A C   1 
ATOM   2390 O  O   . GLU A 1 321 ? -38.233 27.216  -48.884 1.00 23.56  ? 305  GLU A O   1 
ATOM   2391 C  CB  . GLU A 1 321 ? -39.095 24.225  -49.108 1.00 22.43  ? 305  GLU A CB  1 
ATOM   2392 C  CG  . GLU A 1 321 ? -40.257 23.873  -48.190 1.00 33.03  ? 305  GLU A CG  1 
ATOM   2393 C  CD  . GLU A 1 321 ? -40.193 22.537  -47.480 1.00 35.34  ? 305  GLU A CD  1 
ATOM   2394 O  OE1 . GLU A 1 321 ? -39.576 21.593  -48.021 1.00 31.08  ? 305  GLU A OE1 1 
ATOM   2395 O  OE2 . GLU A 1 321 ? -40.810 22.423  -46.398 1.00 33.81  ? 305  GLU A OE2 1 
ATOM   2396 N  N   . GLU A 1 322 ? -40.467 27.198  -48.692 1.00 20.15  ? 306  GLU A N   1 
ATOM   2397 C  CA  . GLU A 1 322 ? -40.543 28.357  -47.803 1.00 20.18  ? 306  GLU A CA  1 
ATOM   2398 C  C   . GLU A 1 322 ? -40.866 27.870  -46.400 1.00 23.92  ? 306  GLU A C   1 
ATOM   2399 O  O   . GLU A 1 322 ? -41.777 27.054  -46.212 1.00 23.71  ? 306  GLU A O   1 
ATOM   2400 C  CB  . GLU A 1 322 ? -41.591 29.364  -48.288 1.00 22.76  ? 306  GLU A CB  1 
ATOM   2401 C  CG  . GLU A 1 322 ? -41.237 30.015  -49.613 1.00 34.06  ? 306  GLU A CG  1 
ATOM   2402 C  CD  . GLU A 1 322 ? -42.214 31.073  -50.088 1.00 57.56  ? 306  GLU A CD  1 
ATOM   2403 O  OE1 . GLU A 1 322 ? -43.252 31.281  -49.417 1.00 44.51  ? 306  GLU A OE1 1 
ATOM   2404 O  OE2 . GLU A 1 322 ? -41.939 31.697  -51.138 1.00 54.69  ? 306  GLU A OE2 1 
ATOM   2405 N  N   . VAL A 1 323 ? -40.088 28.333  -45.420 1.00 20.22  ? 307  VAL A N   1 
ATOM   2406 C  CA  . VAL A 1 323 ? -40.290 27.969  -44.014 1.00 18.79  ? 307  VAL A CA  1 
ATOM   2407 C  C   . VAL A 1 323 ? -40.397 29.259  -43.196 1.00 22.39  ? 307  VAL A C   1 
ATOM   2408 O  O   . VAL A 1 323 ? -39.540 30.142  -43.329 1.00 20.98  ? 307  VAL A O   1 
ATOM   2409 C  CB  . VAL A 1 323 ? -39.169 27.020  -43.481 1.00 22.15  ? 307  VAL A CB  1 
ATOM   2410 C  CG1 . VAL A 1 323 ? -39.367 26.698  -41.995 1.00 21.32  ? 307  VAL A CG1 1 
ATOM   2411 C  CG2 . VAL A 1 323 ? -39.108 25.726  -44.295 1.00 21.84  ? 307  VAL A CG2 1 
ATOM   2412 N  N   . GLN A 1 324 ? -41.451 29.378  -42.375 1.00 18.62  ? 308  GLN A N   1 
ATOM   2413 C  CA  . GLN A 1 324 ? -41.580 30.548  -41.495 1.00 18.71  ? 308  GLN A CA  1 
ATOM   2414 C  C   . GLN A 1 324 ? -40.542 30.386  -40.386 1.00 20.36  ? 308  GLN A C   1 
ATOM   2415 O  O   . GLN A 1 324 ? -40.384 29.292  -39.833 1.00 19.57  ? 308  GLN A O   1 
ATOM   2416 C  CB  . GLN A 1 324 ? -42.991 30.636  -40.878 1.00 20.75  ? 308  GLN A CB  1 
ATOM   2417 C  CG  . GLN A 1 324 ? -44.057 31.136  -41.855 1.00 34.54  ? 308  GLN A CG  1 
ATOM   2418 C  CD  . GLN A 1 324 ? -45.364 31.444  -41.156 1.00 55.50  ? 308  GLN A CD  1 
ATOM   2419 O  OE1 . GLN A 1 324 ? -46.372 30.750  -41.335 1.00 44.26  ? 308  GLN A OE1 1 
ATOM   2420 N  NE2 . GLN A 1 324 ? -45.377 32.491  -40.335 1.00 51.40  ? 308  GLN A NE2 1 
ATOM   2421 N  N   . VAL A 1 325 ? -39.808 31.459  -40.109 1.00 18.02  ? 309  VAL A N   1 
ATOM   2422 C  CA  . VAL A 1 325 ? -38.790 31.529  -39.043 1.00 17.05  ? 309  VAL A CA  1 
ATOM   2423 C  C   . VAL A 1 325 ? -38.955 32.865  -38.277 1.00 22.60  ? 309  VAL A C   1 
ATOM   2424 O  O   . VAL A 1 325 ? -39.521 33.826  -38.804 1.00 22.32  ? 309  VAL A O   1 
ATOM   2425 C  CB  . VAL A 1 325 ? -37.321 31.389  -39.573 1.00 19.26  ? 309  VAL A CB  1 
ATOM   2426 C  CG1 . VAL A 1 325 ? -37.026 29.963  -40.061 1.00 18.93  ? 309  VAL A CG1 1 
ATOM   2427 C  CG2 . VAL A 1 325 ? -36.986 32.438  -40.648 1.00 19.14  ? 309  VAL A CG2 1 
ATOM   2428 N  N   . GLU A 1 326 ? -38.410 32.932  -37.067 1.00 20.01  ? 310  GLU A N   1 
ATOM   2429 C  CA  . GLU A 1 326 ? -38.337 34.186  -36.314 1.00 21.35  ? 310  GLU A CA  1 
ATOM   2430 C  C   . GLU A 1 326 ? -37.015 34.806  -36.793 1.00 24.82  ? 310  GLU A C   1 
ATOM   2431 O  O   . GLU A 1 326 ? -35.926 34.301  -36.469 1.00 22.26  ? 310  GLU A O   1 
ATOM   2432 C  CB  . GLU A 1 326 ? -38.291 33.924  -34.808 1.00 23.03  ? 310  GLU A CB  1 
ATOM   2433 C  CG  . GLU A 1 326 ? -39.532 33.266  -34.229 1.00 35.03  ? 310  GLU A CG  1 
ATOM   2434 C  CD  . GLU A 1 326 ? -39.355 32.689  -32.835 1.00 58.06  ? 310  GLU A CD  1 
ATOM   2435 O  OE1 . GLU A 1 326 ? -38.535 33.228  -32.054 1.00 48.58  ? 310  GLU A OE1 1 
ATOM   2436 O  OE2 . GLU A 1 326 ? -40.047 31.694  -32.521 1.00 52.85  ? 310  GLU A OE2 1 
ATOM   2437 N  N   . TYR A 1 327 ? -37.112 35.850  -37.640 1.00 23.60  ? 311  TYR A N   1 
ATOM   2438 C  CA  . TYR A 1 327 ? -35.957 36.519  -38.235 1.00 23.42  ? 311  TYR A CA  1 
ATOM   2439 C  C   . TYR A 1 327 ? -36.343 37.923  -38.686 1.00 27.94  ? 311  TYR A C   1 
ATOM   2440 O  O   . TYR A 1 327 ? -37.334 38.105  -39.411 1.00 25.00  ? 311  TYR A O   1 
ATOM   2441 C  CB  . TYR A 1 327 ? -35.428 35.725  -39.454 1.00 25.01  ? 311  TYR A CB  1 
ATOM   2442 C  CG  . TYR A 1 327 ? -34.271 36.384  -40.178 1.00 27.65  ? 311  TYR A CG  1 
ATOM   2443 C  CD1 . TYR A 1 327 ? -32.978 36.338  -39.655 1.00 30.37  ? 311  TYR A CD1 1 
ATOM   2444 C  CD2 . TYR A 1 327 ? -34.460 37.036  -41.396 1.00 28.42  ? 311  TYR A CD2 1 
ATOM   2445 C  CE1 . TYR A 1 327 ? -31.902 36.913  -40.331 1.00 31.48  ? 311  TYR A CE1 1 
ATOM   2446 C  CE2 . TYR A 1 327 ? -33.394 37.637  -42.070 1.00 29.83  ? 311  TYR A CE2 1 
ATOM   2447 C  CZ  . TYR A 1 327 ? -32.112 37.553  -41.542 1.00 35.65  ? 311  TYR A CZ  1 
ATOM   2448 O  OH  . TYR A 1 327 ? -31.043 38.133  -42.181 1.00 34.85  ? 311  TYR A OH  1 
ATOM   2449 N  N   . ASN A 1 328 ? -35.510 38.902  -38.307 1.00 26.93  ? 312  ASN A N   1 
ATOM   2450 C  CA  . ASN A 1 328 ? -35.713 40.290  -38.714 1.00 29.36  ? 312  ASN A CA  1 
ATOM   2451 C  C   . ASN A 1 328 ? -34.425 40.959  -39.214 1.00 36.88  ? 312  ASN A C   1 
ATOM   2452 O  O   . ASN A 1 328 ? -34.384 42.179  -39.370 1.00 37.07  ? 312  ASN A O   1 
ATOM   2453 C  CB  . ASN A 1 328 ? -36.449 41.089  -37.644 1.00 31.02  ? 312  ASN A CB  1 
ATOM   2454 C  CG  . ASN A 1 328 ? -35.756 41.140  -36.314 1.00 49.25  ? 312  ASN A CG  1 
ATOM   2455 O  OD1 . ASN A 1 328 ? -34.547 40.901  -36.195 1.00 39.69  ? 312  ASN A OD1 1 
ATOM   2456 N  ND2 . ASN A 1 328 ? -36.511 41.486  -35.283 1.00 44.03  ? 312  ASN A ND2 1 
ATOM   2457 N  N   . GLY A 1 329 ? -33.405 40.154  -39.532 1.00 36.05  ? 313  GLY A N   1 
ATOM   2458 C  CA  . GLY A 1 329 ? -32.180 40.685  -40.125 1.00 38.21  ? 313  GLY A CA  1 
ATOM   2459 C  C   . GLY A 1 329 ? -32.509 41.262  -41.495 1.00 45.12  ? 313  GLY A C   1 
ATOM   2460 O  O   . GLY A 1 329 ? -33.684 41.451  -41.852 1.00 47.16  ? 313  GLY A O   1 
ATOM   2461 N  N   . GLY A 1 330 ? -31.513 41.535  -42.298 1.00 40.48  ? 314  GLY A N   1 
ATOM   2462 C  CA  . GLY A 1 330 ? -31.883 42.035  -43.613 1.00 39.99  ? 314  GLY A CA  1 
ATOM   2463 C  C   . GLY A 1 330 ? -32.136 40.901  -44.580 1.00 40.34  ? 314  GLY A C   1 
ATOM   2464 O  O   . GLY A 1 330 ? -32.199 39.728  -44.186 1.00 40.58  ? 314  GLY A O   1 
ATOM   2465 N  N   . ASN A 1 331 ? -32.241 41.231  -45.852 1.00 32.49  ? 315  ASN A N   1 
ATOM   2466 C  CA  . ASN A 1 331 ? -32.314 40.216  -46.877 1.00 31.19  ? 315  ASN A CA  1 
ATOM   2467 C  C   . ASN A 1 331 ? -30.912 39.606  -46.926 1.00 32.80  ? 315  ASN A C   1 
ATOM   2468 O  O   . ASN A 1 331 ? -29.914 40.334  -46.939 1.00 30.63  ? 315  ASN A O   1 
ATOM   2469 C  CB  . ASN A 1 331 ? -32.689 40.822  -48.223 1.00 31.44  ? 315  ASN A CB  1 
ATOM   2470 C  CG  . ASN A 1 331 ? -34.145 41.206  -48.335 1.00 40.06  ? 315  ASN A CG  1 
ATOM   2471 O  OD1 . ASN A 1 331 ? -35.011 40.755  -47.569 1.00 34.72  ? 315  ASN A OD1 1 
ATOM   2472 N  ND2 . ASN A 1 331 ? -34.437 42.059  -49.290 1.00 32.13  ? 315  ASN A ND2 1 
ATOM   2473 N  N   . LEU A 1 332 ? -30.828 38.281  -46.807 1.00 27.94  ? 316  LEU A N   1 
ATOM   2474 C  CA  . LEU A 1 332 ? -29.517 37.643  -46.832 1.00 26.56  ? 316  LEU A CA  1 
ATOM   2475 C  C   . LEU A 1 332 ? -29.582 36.382  -47.639 1.00 27.50  ? 316  LEU A C   1 
ATOM   2476 O  O   . LEU A 1 332 ? -30.464 35.560  -47.418 1.00 26.49  ? 316  LEU A O   1 
ATOM   2477 C  CB  . LEU A 1 332 ? -28.976 37.382  -45.406 1.00 25.66  ? 316  LEU A CB  1 
ATOM   2478 C  CG  . LEU A 1 332 ? -27.682 36.530  -45.256 1.00 29.07  ? 316  LEU A CG  1 
ATOM   2479 C  CD1 . LEU A 1 332 ? -26.480 37.174  -45.929 1.00 28.50  ? 316  LEU A CD1 1 
ATOM   2480 C  CD2 . LEU A 1 332 ? -27.382 36.245  -43.806 1.00 32.09  ? 316  LEU A CD2 1 
ATOM   2481 N  N   . GLU A 1 333 ? -28.665 36.257  -48.595 1.00 24.30  ? 317  GLU A N   1 
ATOM   2482 C  CA  . GLU A 1 333 ? -28.523 35.068  -49.420 1.00 24.52  ? 317  GLU A CA  1 
ATOM   2483 C  C   . GLU A 1 333 ? -27.245 34.363  -48.988 1.00 26.18  ? 317  GLU A C   1 
ATOM   2484 O  O   . GLU A 1 333 ? -26.164 34.971  -48.984 1.00 26.10  ? 317  GLU A O   1 
ATOM   2485 C  CB  . GLU A 1 333 ? -28.473 35.426  -50.905 1.00 26.75  ? 317  GLU A CB  1 
ATOM   2486 C  CG  . GLU A 1 333 ? -28.593 34.202  -51.791 1.00 34.55  ? 317  GLU A CG  1 
ATOM   2487 C  CD  . GLU A 1 333 ? -28.636 34.495  -53.281 1.00 61.91  ? 317  GLU A CD  1 
ATOM   2488 O  OE1 . GLU A 1 333 ? -27.888 35.387  -53.746 1.00 49.38  ? 317  GLU A OE1 1 
ATOM   2489 O  OE2 . GLU A 1 333 ? -29.413 33.815  -53.988 1.00 63.52  ? 317  GLU A OE2 1 
ATOM   2490 N  N   . ILE A 1 334 ? -27.364 33.095  -48.605 1.00 21.66  ? 318  ILE A N   1 
ATOM   2491 C  CA  . ILE A 1 334 ? -26.213 32.331  -48.136 1.00 21.10  ? 318  ILE A CA  1 
ATOM   2492 C  C   . ILE A 1 334 ? -26.332 30.870  -48.584 1.00 24.61  ? 318  ILE A C   1 
ATOM   2493 O  O   . ILE A 1 334 ? -27.424 30.303  -48.556 1.00 24.02  ? 318  ILE A O   1 
ATOM   2494 C  CB  . ILE A 1 334 ? -25.978 32.527  -46.598 1.00 22.90  ? 318  ILE A CB  1 
ATOM   2495 C  CG1 . ILE A 1 334 ? -24.591 31.995  -46.143 1.00 22.15  ? 318  ILE A CG1 1 
ATOM   2496 C  CG2 . ILE A 1 334 ? -27.142 31.988  -45.738 1.00 22.60  ? 318  ILE A CG2 1 
ATOM   2497 C  CD1 . ILE A 1 334 ? -24.140 32.412  -44.678 1.00 24.90  ? 318  ILE A CD1 1 
ATOM   2498 N  N   . GLY A 1 335 ? -25.220 30.295  -49.025 1.00 20.74  ? 319  GLY A N   1 
ATOM   2499 C  CA  . GLY A 1 335 ? -25.202 28.918  -49.504 1.00 20.19  ? 319  GLY A CA  1 
ATOM   2500 C  C   . GLY A 1 335 ? -24.491 27.982  -48.548 1.00 23.35  ? 319  GLY A C   1 
ATOM   2501 O  O   . GLY A 1 335 ? -23.542 28.390  -47.882 1.00 22.99  ? 319  GLY A O   1 
ATOM   2502 N  N   . PHE A 1 336 ? -24.974 26.742  -48.440 1.00 20.91  ? 320  PHE A N   1 
ATOM   2503 C  CA  . PHE A 1 336 ? -24.373 25.729  -47.566 1.00 20.03  ? 320  PHE A CA  1 
ATOM   2504 C  C   . PHE A 1 336 ? -24.468 24.357  -48.161 1.00 24.74  ? 320  PHE A C   1 
ATOM   2505 O  O   . PHE A 1 336 ? -25.432 24.040  -48.886 1.00 23.39  ? 320  PHE A O   1 
ATOM   2506 C  CB  . PHE A 1 336 ? -25.079 25.663  -46.197 1.00 20.86  ? 320  PHE A CB  1 
ATOM   2507 C  CG  . PHE A 1 336 ? -24.868 26.852  -45.306 1.00 21.02  ? 320  PHE A CG  1 
ATOM   2508 C  CD1 . PHE A 1 336 ? -23.657 27.036  -44.644 1.00 22.78  ? 320  PHE A CD1 1 
ATOM   2509 C  CD2 . PHE A 1 336 ? -25.890 27.772  -45.095 1.00 22.91  ? 320  PHE A CD2 1 
ATOM   2510 C  CE1 . PHE A 1 336 ? -23.457 28.140  -43.820 1.00 24.67  ? 320  PHE A CE1 1 
ATOM   2511 C  CE2 . PHE A 1 336 ? -25.690 28.882  -44.274 1.00 26.35  ? 320  PHE A CE2 1 
ATOM   2512 C  CZ  . PHE A 1 336 ? -24.470 29.066  -43.654 1.00 25.51  ? 320  PHE A CZ  1 
ATOM   2513 N  N   . ASN A 1 337 ? -23.509 23.505  -47.756 1.00 21.61  ? 321  ASN A N   1 
ATOM   2514 C  CA  . ASN A 1 337 ? -23.519 22.084  -48.034 1.00 21.40  ? 321  ASN A CA  1 
ATOM   2515 C  C   . ASN A 1 337 ? -24.657 21.545  -47.114 1.00 21.99  ? 321  ASN A C   1 
ATOM   2516 O  O   . ASN A 1 337 ? -24.604 21.679  -45.876 1.00 17.97  ? 321  ASN A O   1 
ATOM   2517 C  CB  . ASN A 1 337 ? -22.160 21.475  -47.679 1.00 22.61  ? 321  ASN A CB  1 
ATOM   2518 C  CG  . ASN A 1 337 ? -22.083 19.967  -47.772 1.00 29.40  ? 321  ASN A CG  1 
ATOM   2519 O  OD1 . ASN A 1 337 ? -22.999 19.238  -47.386 1.00 26.61  ? 321  ASN A OD1 1 
ATOM   2520 N  ND2 . ASN A 1 337 ? -20.938 19.460  -48.210 1.00 23.60  ? 321  ASN A ND2 1 
ATOM   2521 N  N   . VAL A 1 338 ? -25.709 21.004  -47.738 1.00 18.98  ? 322  VAL A N   1 
ATOM   2522 C  CA  . VAL A 1 338 ? -26.884 20.533  -47.004 1.00 18.35  ? 322  VAL A CA  1 
ATOM   2523 C  C   . VAL A 1 338 ? -26.568 19.419  -46.005 1.00 19.55  ? 322  VAL A C   1 
ATOM   2524 O  O   . VAL A 1 338 ? -27.173 19.409  -44.938 1.00 17.30  ? 322  VAL A O   1 
ATOM   2525 C  CB  . VAL A 1 338 ? -28.105 20.225  -47.915 1.00 23.11  ? 322  VAL A CB  1 
ATOM   2526 C  CG1 . VAL A 1 338 ? -27.860 18.987  -48.766 1.00 23.99  ? 322  VAL A CG1 1 
ATOM   2527 C  CG2 . VAL A 1 338 ? -29.395 20.079  -47.096 1.00 22.10  ? 322  VAL A CG2 1 
ATOM   2528 N  N   . SER A 1 339 ? -25.605 18.521  -46.323 1.00 17.73  ? 323  SER A N   1 
ATOM   2529 C  CA  . SER A 1 339 ? -25.247 17.436  -45.400 1.00 17.68  ? 323  SER A CA  1 
ATOM   2530 C  C   . SER A 1 339 ? -24.694 18.007  -44.078 1.00 18.14  ? 323  SER A C   1 
ATOM   2531 O  O   . SER A 1 339 ? -25.025 17.493  -43.027 1.00 16.53  ? 323  SER A O   1 
ATOM   2532 C  CB  . SER A 1 339 ? -24.288 16.445  -46.054 1.00 24.05  ? 323  SER A CB  1 
ATOM   2533 O  OG  . SER A 1 339 ? -22.938 16.870  -45.986 1.00 36.28  ? 323  SER A OG  1 
ATOM   2534 N  N   . TYR A 1 340 ? -23.922 19.107  -44.148 1.00 15.11  ? 324  TYR A N   1 
ATOM   2535 C  CA  . TYR A 1 340 ? -23.384 19.768  -42.953 1.00 14.72  ? 324  TYR A CA  1 
ATOM   2536 C  C   . TYR A 1 340 ? -24.516 20.294  -42.055 1.00 16.71  ? 324  TYR A C   1 
ATOM   2537 O  O   . TYR A 1 340 ? -24.443 20.135  -40.830 1.00 15.19  ? 324  TYR A O   1 
ATOM   2538 C  CB  . TYR A 1 340 ? -22.420 20.907  -43.332 1.00 15.50  ? 324  TYR A CB  1 
ATOM   2539 C  CG  . TYR A 1 340 ? -21.140 20.510  -44.048 1.00 18.32  ? 324  TYR A CG  1 
ATOM   2540 C  CD1 . TYR A 1 340 ? -20.681 19.187  -44.027 1.00 19.91  ? 324  TYR A CD1 1 
ATOM   2541 C  CD2 . TYR A 1 340 ? -20.329 21.469  -44.645 1.00 19.41  ? 324  TYR A CD2 1 
ATOM   2542 C  CE1 . TYR A 1 340 ? -19.492 18.826  -44.662 1.00 20.57  ? 324  TYR A CE1 1 
ATOM   2543 C  CE2 . TYR A 1 340 ? -19.144 21.119  -45.288 1.00 20.75  ? 324  TYR A CE2 1 
ATOM   2544 C  CZ  . TYR A 1 340 ? -18.725 19.798  -45.287 1.00 24.33  ? 324  TYR A CZ  1 
ATOM   2545 O  OH  . TYR A 1 340 ? -17.541 19.473  -45.900 1.00 24.93  ? 324  TYR A OH  1 
ATOM   2546 N  N   . LEU A 1 341 ? -25.561 20.892  -42.665 1.00 14.76  ? 325  LEU A N   1 
ATOM   2547 C  CA  . LEU A 1 341 ? -26.743 21.399  -41.941 1.00 14.42  ? 325  LEU A CA  1 
ATOM   2548 C  C   . LEU A 1 341 ? -27.547 20.244  -41.356 1.00 17.63  ? 325  LEU A C   1 
ATOM   2549 O  O   . LEU A 1 341 ? -27.958 20.320  -40.198 1.00 15.69  ? 325  LEU A O   1 
ATOM   2550 C  CB  . LEU A 1 341 ? -27.633 22.246  -42.875 1.00 14.45  ? 325  LEU A CB  1 
ATOM   2551 C  CG  . LEU A 1 341 ? -27.008 23.563  -43.363 1.00 19.21  ? 325  LEU A CG  1 
ATOM   2552 C  CD1 . LEU A 1 341 ? -27.992 24.338  -44.235 1.00 20.08  ? 325  LEU A CD1 1 
ATOM   2553 C  CD2 . LEU A 1 341 ? -26.476 24.407  -42.174 1.00 19.60  ? 325  LEU A CD2 1 
ATOM   2554 N  N   . LEU A 1 342 ? -27.779 19.180  -42.155 1.00 13.49  ? 326  LEU A N   1 
ATOM   2555 C  CA  . LEU A 1 342 ? -28.506 18.010  -41.668 1.00 13.24  ? 326  LEU A CA  1 
ATOM   2556 C  C   . LEU A 1 342 ? -27.785 17.367  -40.456 1.00 15.16  ? 326  LEU A C   1 
ATOM   2557 O  O   . LEU A 1 342 ? -28.456 16.993  -39.494 1.00 13.59  ? 326  LEU A O   1 
ATOM   2558 C  CB  . LEU A 1 342 ? -28.711 16.967  -42.797 1.00 14.02  ? 326  LEU A CB  1 
ATOM   2559 C  CG  . LEU A 1 342 ? -29.641 17.412  -43.953 1.00 18.18  ? 326  LEU A CG  1 
ATOM   2560 C  CD1 . LEU A 1 342 ? -29.714 16.323  -45.062 1.00 19.88  ? 326  LEU A CD1 1 
ATOM   2561 C  CD2 . LEU A 1 342 ? -31.051 17.765  -43.423 1.00 20.69  ? 326  LEU A CD2 1 
ATOM   2562 N  N   . ASP A 1 343 ? -26.429 17.281  -40.504 1.00 13.73  ? 327  ASP A N   1 
ATOM   2563 C  CA  . ASP A 1 343 ? -25.636 16.694  -39.418 1.00 13.81  ? 327  ASP A CA  1 
ATOM   2564 C  C   . ASP A 1 343 ? -25.846 17.495  -38.122 1.00 15.23  ? 327  ASP A C   1 
ATOM   2565 O  O   . ASP A 1 343 ? -26.059 16.906  -37.060 1.00 13.71  ? 327  ASP A O   1 
ATOM   2566 C  CB  . ASP A 1 343 ? -24.135 16.657  -39.784 1.00 15.09  ? 327  ASP A CB  1 
ATOM   2567 C  CG  . ASP A 1 343 ? -23.722 15.615  -40.826 1.00 18.92  ? 327  ASP A CG  1 
ATOM   2568 O  OD1 . ASP A 1 343 ? -24.554 14.731  -41.157 1.00 18.12  ? 327  ASP A OD1 1 
ATOM   2569 O  OD2 . ASP A 1 343 ? -22.597 15.714  -41.334 1.00 17.75  ? 327  ASP A OD2 1 
ATOM   2570 N  N   . VAL A 1 344 ? -25.817 18.828  -38.219 1.00 12.48  ? 328  VAL A N   1 
ATOM   2571 C  CA  . VAL A 1 344 ? -25.988 19.683  -37.033 1.00 11.37  ? 328  VAL A CA  1 
ATOM   2572 C  C   . VAL A 1 344 ? -27.411 19.528  -36.468 1.00 14.30  ? 328  VAL A C   1 
ATOM   2573 O  O   . VAL A 1 344 ? -27.572 19.278  -35.274 1.00 13.47  ? 328  VAL A O   1 
ATOM   2574 C  CB  . VAL A 1 344 ? -25.682 21.172  -37.356 1.00 14.41  ? 328  VAL A CB  1 
ATOM   2575 C  CG1 . VAL A 1 344 ? -26.067 22.083  -36.180 1.00 14.71  ? 328  VAL A CG1 1 
ATOM   2576 C  CG2 . VAL A 1 344 ? -24.216 21.354  -37.741 1.00 14.98  ? 328  VAL A CG2 1 
ATOM   2577 N  N   . LEU A 1 345 ? -28.426 19.632  -37.330 1.00 11.05  ? 329  LEU A N   1 
ATOM   2578 C  CA  . LEU A 1 345 ? -29.823 19.544  -36.848 1.00 13.60  ? 329  LEU A CA  1 
ATOM   2579 C  C   . LEU A 1 345 ? -30.136 18.176  -36.215 1.00 16.65  ? 329  LEU A C   1 
ATOM   2580 O  O   . LEU A 1 345 ? -30.911 18.111  -35.253 1.00 14.56  ? 329  LEU A O   1 
ATOM   2581 C  CB  . LEU A 1 345 ? -30.814 19.874  -37.956 1.00 14.75  ? 329  LEU A CB  1 
ATOM   2582 C  CG  . LEU A 1 345 ? -30.759 21.302  -38.513 1.00 20.67  ? 329  LEU A CG  1 
ATOM   2583 C  CD1 . LEU A 1 345 ? -31.629 21.420  -39.724 1.00 22.87  ? 329  LEU A CD1 1 
ATOM   2584 C  CD2 . LEU A 1 345 ? -31.106 22.339  -37.477 1.00 21.81  ? 329  LEU A CD2 1 
ATOM   2585 N  N   . GLY A 1 346 ? -29.431 17.144  -36.688 1.00 14.94  ? 330  GLY A N   1 
ATOM   2586 C  CA  . GLY A 1 346 ? -29.517 15.782  -36.172 1.00 15.30  ? 330  GLY A CA  1 
ATOM   2587 C  C   . GLY A 1 346 ? -29.072 15.635  -34.723 1.00 19.02  ? 330  GLY A C   1 
ATOM   2588 O  O   . GLY A 1 346 ? -29.499 14.692  -34.057 1.00 19.70  ? 330  GLY A O   1 
ATOM   2589 N  N   . VAL A 1 347 ? -28.219 16.559  -34.206 1.00 14.59  ? 331  VAL A N   1 
ATOM   2590 C  CA  . VAL A 1 347 ? -27.743 16.549  -32.796 1.00 15.05  ? 331  VAL A CA  1 
ATOM   2591 C  C   . VAL A 1 347 ? -28.373 17.660  -31.895 1.00 19.36  ? 331  VAL A C   1 
ATOM   2592 O  O   . VAL A 1 347 ? -28.085 17.757  -30.692 1.00 20.05  ? 331  VAL A O   1 
ATOM   2593 C  CB  . VAL A 1 347 ? -26.194 16.492  -32.657 1.00 17.77  ? 331  VAL A CB  1 
ATOM   2594 C  CG1 . VAL A 1 347 ? -25.617 15.221  -33.302 1.00 17.79  ? 331  VAL A CG1 1 
ATOM   2595 C  CG2 . VAL A 1 347 ? -25.540 17.755  -33.220 1.00 16.60  ? 331  VAL A CG2 1 
ATOM   2596 N  N   . ILE A 1 348 ? -29.197 18.511  -32.483 1.00 14.36  ? 332  ILE A N   1 
ATOM   2597 C  CA  . ILE A 1 348 ? -29.933 19.525  -31.731 1.00 14.96  ? 332  ILE A CA  1 
ATOM   2598 C  C   . ILE A 1 348 ? -31.074 18.802  -30.947 1.00 18.09  ? 332  ILE A C   1 
ATOM   2599 O  O   . ILE A 1 348 ? -31.887 18.123  -31.552 1.00 18.20  ? 332  ILE A O   1 
ATOM   2600 C  CB  . ILE A 1 348 ? -30.450 20.661  -32.660 1.00 16.47  ? 332  ILE A CB  1 
ATOM   2601 C  CG1 . ILE A 1 348 ? -29.291 21.467  -33.332 1.00 16.52  ? 332  ILE A CG1 1 
ATOM   2602 C  CG2 . ILE A 1 348 ? -31.470 21.586  -31.931 1.00 15.56  ? 332  ILE A CG2 1 
ATOM   2603 C  CD1 . ILE A 1 348 ? -28.337 22.310  -32.322 1.00 19.57  ? 332  ILE A CD1 1 
ATOM   2604 N  N   . GLY A 1 349 ? -31.076 18.916  -29.622 1.00 16.09  ? 333  GLY A N   1 
ATOM   2605 C  CA  . GLY A 1 349 ? -32.081 18.265  -28.769 1.00 17.02  ? 333  GLY A CA  1 
ATOM   2606 C  C   . GLY A 1 349 ? -33.336 19.073  -28.460 1.00 20.83  ? 333  GLY A C   1 
ATOM   2607 O  O   . GLY A 1 349 ? -34.321 18.522  -27.944 1.00 18.96  ? 333  GLY A O   1 
ATOM   2608 N  N   . THR A 1 350 ? -33.302 20.399  -28.740 1.00 16.01  ? 334  THR A N   1 
ATOM   2609 C  CA  . THR A 1 350 ? -34.422 21.318  -28.511 1.00 16.30  ? 334  THR A CA  1 
ATOM   2610 C  C   . THR A 1 350 ? -35.283 21.359  -29.772 1.00 19.06  ? 334  THR A C   1 
ATOM   2611 O  O   . THR A 1 350 ? -34.766 21.134  -30.863 1.00 17.86  ? 334  THR A O   1 
ATOM   2612 C  CB  . THR A 1 350 ? -33.921 22.725  -28.115 1.00 21.59  ? 334  THR A CB  1 
ATOM   2613 O  OG1 . THR A 1 350 ? -32.964 23.174  -29.093 1.00 18.01  ? 334  THR A OG1 1 
ATOM   2614 C  CG2 . THR A 1 350 ? -33.291 22.746  -26.687 1.00 19.44  ? 334  THR A CG2 1 
ATOM   2615 N  N   . GLU A 1 351 ? -36.574 21.687  -29.634 1.00 17.13  ? 335  GLU A N   1 
ATOM   2616 C  CA  . GLU A 1 351 ? -37.478 21.747  -30.797 1.00 15.50  ? 335  GLU A CA  1 
ATOM   2617 C  C   . GLU A 1 351 ? -37.171 22.960  -31.673 1.00 18.59  ? 335  GLU A C   1 
ATOM   2618 O  O   . GLU A 1 351 ? -37.508 22.962  -32.856 1.00 19.83  ? 335  GLU A O   1 
ATOM   2619 C  CB  . GLU A 1 351 ? -38.961 21.719  -30.363 1.00 16.25  ? 335  GLU A CB  1 
ATOM   2620 C  CG  . GLU A 1 351 ? -39.495 23.017  -29.795 1.00 19.19  ? 335  GLU A CG  1 
ATOM   2621 C  CD  . GLU A 1 351 ? -40.703 22.784  -28.908 1.00 20.43  ? 335  GLU A CD  1 
ATOM   2622 O  OE1 . GLU A 1 351 ? -40.725 21.751  -28.204 1.00 21.91  ? 335  GLU A OE1 1 
ATOM   2623 O  OE2 . GLU A 1 351 ? -41.642 23.605  -28.956 1.00 24.07  ? 335  GLU A OE2 1 
ATOM   2624 N  N   . GLN A 1 352 ? -36.591 24.008  -31.075 1.00 15.11  ? 336  GLN A N   1 
ATOM   2625 C  CA  . GLN A 1 352 ? -36.181 25.195  -31.836 1.00 15.77  ? 336  GLN A CA  1 
ATOM   2626 C  C   . GLN A 1 352 ? -34.652 25.188  -31.969 1.00 19.77  ? 336  GLN A C   1 
ATOM   2627 O  O   . GLN A 1 352 ? -33.949 24.597  -31.132 1.00 19.02  ? 336  GLN A O   1 
ATOM   2628 C  CB  . GLN A 1 352 ? -36.667 26.493  -31.184 1.00 16.81  ? 336  GLN A CB  1 
ATOM   2629 C  CG  . GLN A 1 352 ? -38.175 26.705  -31.356 1.00 20.21  ? 336  GLN A CG  1 
ATOM   2630 C  CD  . GLN A 1 352 ? -38.622 28.067  -30.854 1.00 39.87  ? 336  GLN A CD  1 
ATOM   2631 O  OE1 . GLN A 1 352 ? -38.282 28.503  -29.758 1.00 37.11  ? 336  GLN A OE1 1 
ATOM   2632 N  NE2 . GLN A 1 352 ? -39.400 28.762  -31.640 1.00 31.99  ? 336  GLN A NE2 1 
ATOM   2633 N  N   . VAL A 1 353 ? -34.148 25.809  -33.034 1.00 14.73  ? 337  VAL A N   1 
ATOM   2634 C  CA  . VAL A 1 353 ? -32.712 25.902  -33.293 1.00 12.94  ? 337  VAL A CA  1 
ATOM   2635 C  C   . VAL A 1 353 ? -32.359 27.361  -33.574 1.00 17.44  ? 337  VAL A C   1 
ATOM   2636 O  O   . VAL A 1 353 ? -33.155 28.083  -34.184 1.00 17.25  ? 337  VAL A O   1 
ATOM   2637 C  CB  . VAL A 1 353 ? -32.258 24.943  -34.423 1.00 15.88  ? 337  VAL A CB  1 
ATOM   2638 C  CG1 . VAL A 1 353 ? -32.939 25.254  -35.767 1.00 15.64  ? 337  VAL A CG1 1 
ATOM   2639 C  CG2 . VAL A 1 353 ? -30.738 24.918  -34.572 1.00 15.21  ? 337  VAL A CG2 1 
ATOM   2640 N  N   . ARG A 1 354 ? -31.166 27.781  -33.133 1.00 14.07  ? 338  ARG A N   1 
ATOM   2641 C  CA  . ARG A 1 354 ? -30.698 29.139  -33.351 1.00 14.46  ? 338  ARG A CA  1 
ATOM   2642 C  C   . ARG A 1 354 ? -29.542 29.155  -34.340 1.00 18.23  ? 338  ARG A C   1 
ATOM   2643 O  O   . ARG A 1 354 ? -28.548 28.431  -34.149 1.00 17.19  ? 338  ARG A O   1 
ATOM   2644 C  CB  . ARG A 1 354 ? -30.218 29.783  -32.030 1.00 17.79  ? 338  ARG A CB  1 
ATOM   2645 C  CG  . ARG A 1 354 ? -31.297 30.178  -31.032 1.00 23.13  ? 338  ARG A CG  1 
ATOM   2646 C  CD  . ARG A 1 354 ? -30.646 30.888  -29.831 1.00 26.33  ? 338  ARG A CD  1 
ATOM   2647 N  NE  . ARG A 1 354 ? -29.904 29.958  -28.976 1.00 24.95  ? 338  ARG A NE  1 
ATOM   2648 C  CZ  . ARG A 1 354 ? -28.865 30.291  -28.207 1.00 40.84  ? 338  ARG A CZ  1 
ATOM   2649 N  NH1 . ARG A 1 354 ? -28.400 31.540  -28.204 1.00 32.71  ? 338  ARG A NH1 1 
ATOM   2650 N  NH2 . ARG A 1 354 ? -28.278 29.377  -27.445 1.00 23.78  ? 338  ARG A NH2 1 
ATOM   2651 N  N   . PHE A 1 355 ? -29.678 29.947  -35.404 1.00 14.50  ? 339  PHE A N   1 
ATOM   2652 C  CA  . PHE A 1 355 ? -28.572 30.187  -36.339 1.00 14.34  ? 339  PHE A CA  1 
ATOM   2653 C  C   . PHE A 1 355 ? -28.188 31.651  -36.129 1.00 21.29  ? 339  PHE A C   1 
ATOM   2654 O  O   . PHE A 1 355 ? -29.059 32.537  -36.185 1.00 23.10  ? 339  PHE A O   1 
ATOM   2655 C  CB  . PHE A 1 355 ? -28.971 30.023  -37.809 1.00 16.04  ? 339  PHE A CB  1 
ATOM   2656 C  CG  . PHE A 1 355 ? -29.153 28.601  -38.252 1.00 17.75  ? 339  PHE A CG  1 
ATOM   2657 C  CD1 . PHE A 1 355 ? -30.296 27.891  -37.906 1.00 20.53  ? 339  PHE A CD1 1 
ATOM   2658 C  CD2 . PHE A 1 355 ? -28.203 27.983  -39.059 1.00 20.79  ? 339  PHE A CD2 1 
ATOM   2659 C  CE1 . PHE A 1 355 ? -30.476 26.564  -38.344 1.00 21.63  ? 339  PHE A CE1 1 
ATOM   2660 C  CE2 . PHE A 1 355 ? -28.390 26.665  -39.508 1.00 23.35  ? 339  PHE A CE2 1 
ATOM   2661 C  CZ  . PHE A 1 355 ? -29.514 25.966  -39.131 1.00 21.62  ? 339  PHE A CZ  1 
ATOM   2662 N  N   . ILE A 1 356 ? -26.907 31.899  -35.932 1.00 17.18  ? 340  ILE A N   1 
ATOM   2663 C  CA  . ILE A 1 356 ? -26.367 33.257  -35.786 1.00 18.47  ? 340  ILE A CA  1 
ATOM   2664 C  C   . ILE A 1 356 ? -25.461 33.473  -36.997 1.00 21.46  ? 340  ILE A C   1 
ATOM   2665 O  O   . ILE A 1 356 ? -24.478 32.743  -37.180 1.00 18.07  ? 340  ILE A O   1 
ATOM   2666 C  CB  . ILE A 1 356 ? -25.656 33.476  -34.429 1.00 22.00  ? 340  ILE A CB  1 
ATOM   2667 C  CG1 . ILE A 1 356 ? -26.639 33.261  -33.247 1.00 22.57  ? 340  ILE A CG1 1 
ATOM   2668 C  CG2 . ILE A 1 356 ? -25.016 34.880  -34.380 1.00 22.76  ? 340  ILE A CG2 1 
ATOM   2669 C  CD1 . ILE A 1 356 ? -25.943 32.935  -31.911 1.00 32.09  ? 340  ILE A CD1 1 
ATOM   2670 N  N   . LEU A 1 357 ? -25.844 34.438  -37.848 1.00 19.91  ? 341  LEU A N   1 
ATOM   2671 C  CA  . LEU A 1 357 ? -25.181 34.743  -39.110 1.00 19.05  ? 341  LEU A CA  1 
ATOM   2672 C  C   . LEU A 1 357 ? -24.735 36.201  -39.174 1.00 23.56  ? 341  LEU A C   1 
ATOM   2673 O  O   . LEU A 1 357 ? -25.197 37.021  -38.383 1.00 22.62  ? 341  LEU A O   1 
ATOM   2674 C  CB  . LEU A 1 357 ? -26.164 34.466  -40.274 1.00 18.61  ? 341  LEU A CB  1 
ATOM   2675 C  CG  . LEU A 1 357 ? -26.917 33.136  -40.241 1.00 22.49  ? 341  LEU A CG  1 
ATOM   2676 C  CD1 . LEU A 1 357 ? -28.038 33.138  -41.257 1.00 22.65  ? 341  LEU A CD1 1 
ATOM   2677 C  CD2 . LEU A 1 357 ? -25.980 31.976  -40.524 1.00 22.97  ? 341  LEU A CD2 1 
ATOM   2678 N  N   . SER A 1 358 ? -23.863 36.509  -40.144 1.00 20.13  ? 342  SER A N   1 
ATOM   2679 C  CA  . SER A 1 358 ? -23.407 37.876  -40.379 1.00 22.48  ? 342  SER A CA  1 
ATOM   2680 C  C   . SER A 1 358 ? -23.624 38.193  -41.859 1.00 28.70  ? 342  SER A C   1 
ATOM   2681 O  O   . SER A 1 358 ? -24.664 38.754  -42.194 1.00 31.89  ? 342  SER A O   1 
ATOM   2682 C  CB  . SER A 1 358 ? -21.976 38.086  -39.880 1.00 24.93  ? 342  SER A CB  1 
ATOM   2683 O  OG  . SER A 1 358 ? -21.068 37.119  -40.377 1.00 27.08  ? 342  SER A OG  1 
ATOM   2684 N  N   . ASP A 1 359 ? -22.747 37.728  -42.746 1.00 23.18  ? 343  ASP A N   1 
ATOM   2685 C  CA  . ASP A 1 359 ? -22.892 37.949  -44.184 1.00 23.04  ? 343  ASP A CA  1 
ATOM   2686 C  C   . ASP A 1 359 ? -22.784 36.628  -44.973 1.00 26.42  ? 343  ASP A C   1 
ATOM   2687 O  O   . ASP A 1 359 ? -22.578 35.566  -44.377 1.00 25.01  ? 343  ASP A O   1 
ATOM   2688 C  CB  . ASP A 1 359 ? -21.887 39.014  -44.668 1.00 24.65  ? 343  ASP A CB  1 
ATOM   2689 C  CG  . ASP A 1 359 ? -20.439 38.704  -44.323 1.00 32.97  ? 343  ASP A CG  1 
ATOM   2690 O  OD1 . ASP A 1 359 ? -19.984 37.584  -44.621 1.00 31.61  ? 343  ASP A OD1 1 
ATOM   2691 O  OD2 . ASP A 1 359 ? -19.753 39.597  -43.786 1.00 44.69  ? 343  ASP A OD2 1 
ATOM   2692 N  N   . SER A 1 360 ? -22.903 36.704  -46.312 1.00 24.56  ? 344  SER A N   1 
ATOM   2693 C  CA  . SER A 1 360 ? -22.882 35.541  -47.205 1.00 25.43  ? 344  SER A CA  1 
ATOM   2694 C  C   . SER A 1 360 ? -21.569 34.736  -47.200 1.00 29.88  ? 344  SER A C   1 
ATOM   2695 O  O   . SER A 1 360 ? -21.587 33.554  -47.541 1.00 30.14  ? 344  SER A O   1 
ATOM   2696 C  CB  . SER A 1 360 ? -23.230 35.979  -48.629 1.00 30.13  ? 344  SER A CB  1 
ATOM   2697 O  OG  . SER A 1 360 ? -22.286 36.910  -49.134 1.00 43.12  ? 344  SER A OG  1 
ATOM   2698 N  N   . ASN A 1 361 ? -20.438 35.373  -46.831 1.00 28.40  ? 345  ASN A N   1 
ATOM   2699 C  CA  . ASN A 1 361 ? -19.117 34.741  -46.853 1.00 28.60  ? 345  ASN A CA  1 
ATOM   2700 C  C   . ASN A 1 361 ? -18.543 34.356  -45.495 1.00 32.36  ? 345  ASN A C   1 
ATOM   2701 O  O   . ASN A 1 361 ? -17.381 33.940  -45.416 1.00 33.67  ? 345  ASN A O   1 
ATOM   2702 C  CB  . ASN A 1 361 ? -18.125 35.605  -47.651 1.00 29.44  ? 345  ASN A CB  1 
ATOM   2703 C  CG  . ASN A 1 361 ? -18.614 35.926  -49.044 1.00 52.49  ? 345  ASN A CG  1 
ATOM   2704 O  OD1 . ASN A 1 361 ? -18.762 37.097  -49.411 1.00 50.65  ? 345  ASN A OD1 1 
ATOM   2705 N  ND2 . ASN A 1 361 ? -18.953 34.896  -49.817 1.00 37.90  ? 345  ASN A ND2 1 
ATOM   2706 N  N   . SER A 1 362 ? -19.339 34.495  -44.435 1.00 25.60  ? 346  SER A N   1 
ATOM   2707 C  CA  . SER A 1 362 ? -18.893 34.162  -43.091 1.00 23.12  ? 346  SER A CA  1 
ATOM   2708 C  C   . SER A 1 362 ? -19.648 32.957  -42.538 1.00 23.30  ? 346  SER A C   1 
ATOM   2709 O  O   . SER A 1 362 ? -20.802 32.682  -42.923 1.00 19.38  ? 346  SER A O   1 
ATOM   2710 C  CB  . SER A 1 362 ? -18.989 35.374  -42.167 1.00 26.57  ? 346  SER A CB  1 
ATOM   2711 O  OG  . SER A 1 362 ? -18.320 36.509  -42.698 1.00 31.89  ? 346  SER A OG  1 
ATOM   2712 N  N   . SER A 1 363 ? -18.973 32.222  -41.653 1.00 20.83  ? 347  SER A N   1 
ATOM   2713 C  CA  . SER A 1 363 ? -19.502 31.006  -41.030 1.00 19.27  ? 347  SER A CA  1 
ATOM   2714 C  C   . SER A 1 363 ? -20.812 31.226  -40.265 1.00 24.17  ? 347  SER A C   1 
ATOM   2715 O  O   . SER A 1 363 ? -21.027 32.301  -39.681 1.00 24.33  ? 347  SER A O   1 
ATOM   2716 C  CB  . SER A 1 363 ? -18.471 30.410  -40.077 1.00 22.28  ? 347  SER A CB  1 
ATOM   2717 O  OG  . SER A 1 363 ? -17.295 30.042  -40.774 1.00 29.60  ? 347  SER A OG  1 
ATOM   2718 N  N   . ALA A 1 364 ? -21.679 30.202  -40.282 1.00 19.89  ? 348  ALA A N   1 
ATOM   2719 C  CA  . ALA A 1 364 ? -22.900 30.165  -39.489 1.00 18.76  ? 348  ALA A CA  1 
ATOM   2720 C  C   . ALA A 1 364 ? -22.477 29.589  -38.141 1.00 20.79  ? 348  ALA A C   1 
ATOM   2721 O  O   . ALA A 1 364 ? -21.647 28.668  -38.092 1.00 19.64  ? 348  ALA A O   1 
ATOM   2722 C  CB  . ALA A 1 364 ? -23.920 29.220  -40.121 1.00 19.54  ? 348  ALA A CB  1 
ATOM   2723 N  N   . LEU A 1 365 ? -23.047 30.129  -37.055 1.00 16.80  ? 349  LEU A N   1 
ATOM   2724 C  CA  . LEU A 1 365 ? -22.905 29.619  -35.704 1.00 15.51  ? 349  LEU A CA  1 
ATOM   2725 C  C   . LEU A 1 365 ? -24.286 29.070  -35.299 1.00 18.95  ? 349  LEU A C   1 
ATOM   2726 O  O   . LEU A 1 365 ? -25.285 29.773  -35.410 1.00 19.98  ? 349  LEU A O   1 
ATOM   2727 C  CB  . LEU A 1 365 ? -22.464 30.722  -34.746 1.00 15.34  ? 349  LEU A CB  1 
ATOM   2728 C  CG  . LEU A 1 365 ? -22.325 30.336  -33.254 1.00 18.36  ? 349  LEU A CG  1 
ATOM   2729 C  CD1 . LEU A 1 365 ? -21.260 29.254  -33.055 1.00 18.05  ? 349  LEU A CD1 1 
ATOM   2730 C  CD2 . LEU A 1 365 ? -22.005 31.559  -32.436 1.00 21.43  ? 349  LEU A CD2 1 
ATOM   2731 N  N   . VAL A 1 366 ? -24.338 27.822  -34.861 1.00 14.78  ? 350  VAL A N   1 
ATOM   2732 C  CA  . VAL A 1 366 ? -25.604 27.166  -34.523 1.00 14.72  ? 350  VAL A CA  1 
ATOM   2733 C  C   . VAL A 1 366 ? -25.589 26.699  -33.064 1.00 18.37  ? 350  VAL A C   1 
ATOM   2734 O  O   . VAL A 1 366 ? -24.598 26.096  -32.607 1.00 17.34  ? 350  VAL A O   1 
ATOM   2735 C  CB  . VAL A 1 366 ? -25.930 25.980  -35.490 1.00 18.08  ? 350  VAL A CB  1 
ATOM   2736 C  CG1 . VAL A 1 366 ? -27.369 25.487  -35.321 1.00 17.58  ? 350  VAL A CG1 1 
ATOM   2737 C  CG2 . VAL A 1 366 ? -25.664 26.326  -36.954 1.00 18.23  ? 350  VAL A CG2 1 
ATOM   2738 N  N   . HIS A 1 367 ? -26.696 26.955  -32.349 1.00 15.53  ? 351  HIS A N   1 
ATOM   2739 C  CA  . HIS A 1 367 ? -26.886 26.492  -30.980 1.00 15.21  ? 351  HIS A CA  1 
ATOM   2740 C  C   . HIS A 1 367 ? -28.284 25.849  -30.810 1.00 19.02  ? 351  HIS A C   1 
ATOM   2741 O  O   . HIS A 1 367 ? -29.214 26.115  -31.597 1.00 16.82  ? 351  HIS A O   1 
ATOM   2742 C  CB  . HIS A 1 367 ? -26.813 27.673  -29.987 1.00 16.82  ? 351  HIS A CB  1 
ATOM   2743 C  CG  . HIS A 1 367 ? -25.514 28.426  -29.949 1.00 20.88  ? 351  HIS A CG  1 
ATOM   2744 N  ND1 . HIS A 1 367 ? -24.352 27.845  -29.464 1.00 22.77  ? 351  HIS A ND1 1 
ATOM   2745 C  CD2 . HIS A 1 367 ? -25.280 29.739  -30.183 1.00 22.61  ? 351  HIS A CD2 1 
ATOM   2746 C  CE1 . HIS A 1 367 ? -23.430 28.798  -29.519 1.00 22.75  ? 351  HIS A CE1 1 
ATOM   2747 N  NE2 . HIS A 1 367 ? -23.944 29.956  -29.932 1.00 22.78  ? 351  HIS A NE2 1 
ATOM   2748 N  N   . GLU A 1 368 ? -28.458 25.130  -29.696 1.00 17.40  ? 352  GLU A N   1 
ATOM   2749 C  CA  . GLU A 1 368 ? -29.766 24.656  -29.220 1.00 17.71  ? 352  GLU A CA  1 
ATOM   2750 C  C   . GLU A 1 368 ? -30.533 25.928  -28.748 1.00 21.11  ? 352  GLU A C   1 
ATOM   2751 O  O   . GLU A 1 368 ? -29.943 27.019  -28.639 1.00 21.35  ? 352  GLU A O   1 
ATOM   2752 C  CB  . GLU A 1 368 ? -29.623 23.645  -28.068 1.00 18.50  ? 352  GLU A CB  1 
ATOM   2753 C  CG  . GLU A 1 368 ? -28.980 22.333  -28.468 1.00 18.02  ? 352  GLU A CG  1 
ATOM   2754 C  CD  . GLU A 1 368 ? -29.160 21.251  -27.422 1.00 23.66  ? 352  GLU A CD  1 
ATOM   2755 O  OE1 . GLU A 1 368 ? -28.999 21.547  -26.219 1.00 25.04  ? 352  GLU A OE1 1 
ATOM   2756 O  OE2 . GLU A 1 368 ? -29.514 20.117  -27.804 1.00 21.75  ? 352  GLU A OE2 1 
ATOM   2757 N  N   . ALA A 1 369 ? -31.854 25.815  -28.533 1.00 18.82  ? 353  ALA A N   1 
ATOM   2758 C  CA  . ALA A 1 369 ? -32.706 26.970  -28.231 1.00 19.69  ? 353  ALA A CA  1 
ATOM   2759 C  C   . ALA A 1 369 ? -32.412 27.717  -26.934 1.00 23.80  ? 353  ALA A C   1 
ATOM   2760 O  O   . ALA A 1 369 ? -32.485 28.945  -26.906 1.00 23.49  ? 353  ALA A O   1 
ATOM   2761 C  CB  . ALA A 1 369 ? -34.175 26.552  -28.235 1.00 20.40  ? 353  ALA A CB  1 
ATOM   2762 N  N   . ASP A 1 370 ? -32.112 26.966  -25.879 1.00 23.20  ? 354  ASP A N   1 
ATOM   2763 C  CA  . ASP A 1 370 ? -32.021 27.456  -24.504 1.00 24.52  ? 354  ASP A CA  1 
ATOM   2764 C  C   . ASP A 1 370 ? -30.642 27.518  -23.834 1.00 27.55  ? 354  ASP A C   1 
ATOM   2765 O  O   . ASP A 1 370 ? -30.570 27.913  -22.666 1.00 27.97  ? 354  ASP A O   1 
ATOM   2766 C  CB  . ASP A 1 370 ? -33.003 26.622  -23.630 1.00 26.51  ? 354  ASP A CB  1 
ATOM   2767 C  CG  . ASP A 1 370 ? -32.653 25.147  -23.446 1.00 33.17  ? 354  ASP A CG  1 
ATOM   2768 O  OD1 . ASP A 1 370 ? -31.774 24.636  -24.186 1.00 33.34  ? 354  ASP A OD1 1 
ATOM   2769 O  OD2 . ASP A 1 370 ? -33.267 24.497  -22.575 1.00 42.81  ? 354  ASP A OD2 1 
ATOM   2770 N  N   . ASN A 1 371 ? -29.568 27.109  -24.527 1.00 23.76  ? 355  ASN A N   1 
ATOM   2771 C  CA  . ASN A 1 371 ? -28.229 27.100  -23.932 1.00 23.55  ? 355  ASN A CA  1 
ATOM   2772 C  C   . ASN A 1 371 ? -27.129 27.227  -24.996 1.00 26.84  ? 355  ASN A C   1 
ATOM   2773 O  O   . ASN A 1 371 ? -27.343 26.886  -26.172 1.00 24.05  ? 355  ASN A O   1 
ATOM   2774 C  CB  . ASN A 1 371 ? -28.040 25.793  -23.122 1.00 24.50  ? 355  ASN A CB  1 
ATOM   2775 C  CG  . ASN A 1 371 ? -27.866 24.583  -24.011 1.00 33.98  ? 355  ASN A CG  1 
ATOM   2776 O  OD1 . ASN A 1 371 ? -26.753 24.257  -24.400 1.00 25.92  ? 355  ASN A OD1 1 
ATOM   2777 N  ND2 . ASN A 1 371 ? -28.954 23.951  -24.445 1.00 25.57  ? 355  ASN A ND2 1 
ATOM   2778 N  N   . ASP A 1 372 ? -25.934 27.647  -24.551 1.00 23.93  ? 356  ASP A N   1 
ATOM   2779 C  CA  . ASP A 1 372 ? -24.746 27.757  -25.401 1.00 23.85  ? 356  ASP A CA  1 
ATOM   2780 C  C   . ASP A 1 372 ? -23.708 26.635  -25.097 1.00 26.97  ? 356  ASP A C   1 
ATOM   2781 O  O   . ASP A 1 372 ? -22.556 26.754  -25.500 1.00 28.05  ? 356  ASP A O   1 
ATOM   2782 C  CB  . ASP A 1 372 ? -24.109 29.151  -25.300 1.00 25.51  ? 356  ASP A CB  1 
ATOM   2783 C  CG  . ASP A 1 372 ? -24.982 30.308  -25.756 1.00 38.25  ? 356  ASP A CG  1 
ATOM   2784 O  OD1 . ASP A 1 372 ? -25.806 30.109  -26.680 1.00 38.50  ? 356  ASP A OD1 1 
ATOM   2785 O  OD2 . ASP A 1 372 ? -24.816 31.425  -25.214 1.00 43.10  ? 356  ASP A OD2 1 
ATOM   2786 N  N   . ASP A 1 373 ? -24.123 25.550  -24.425 1.00 22.72  ? 357  ASP A N   1 
ATOM   2787 C  CA  . ASP A 1 373 ? -23.242 24.413  -24.105 1.00 22.87  ? 357  ASP A CA  1 
ATOM   2788 C  C   . ASP A 1 373 ? -22.674 23.741  -25.360 1.00 24.99  ? 357  ASP A C   1 
ATOM   2789 O  O   . ASP A 1 373 ? -21.520 23.328  -25.356 1.00 24.69  ? 357  ASP A O   1 
ATOM   2790 C  CB  . ASP A 1 373 ? -23.942 23.384  -23.216 1.00 24.81  ? 357  ASP A CB  1 
ATOM   2791 C  CG  . ASP A 1 373 ? -24.461 23.947  -21.901 1.00 35.08  ? 357  ASP A CG  1 
ATOM   2792 O  OD1 . ASP A 1 373 ? -23.881 24.934  -21.409 1.00 34.06  ? 357  ASP A OD1 1 
ATOM   2793 O  OD2 . ASP A 1 373 ? -25.443 23.392  -21.368 1.00 43.90  ? 357  ASP A OD2 1 
ATOM   2794 N  N   . SER A 1 374 ? -23.488 23.647  -26.421 1.00 20.38  ? 358  SER A N   1 
ATOM   2795 C  CA  . SER A 1 374 ? -23.092 23.078  -27.712 1.00 19.44  ? 358  SER A CA  1 
ATOM   2796 C  C   . SER A 1 374 ? -22.985 24.216  -28.708 1.00 21.42  ? 358  SER A C   1 
ATOM   2797 O  O   . SER A 1 374 ? -23.726 25.194  -28.601 1.00 22.82  ? 358  SER A O   1 
ATOM   2798 C  CB  . SER A 1 374 ? -24.125 22.065  -28.202 1.00 21.87  ? 358  SER A CB  1 
ATOM   2799 O  OG  . SER A 1 374 ? -24.146 20.934  -27.348 1.00 30.37  ? 358  SER A OG  1 
ATOM   2800 N  N   . ALA A 1 375 ? -22.023 24.127  -29.631 1.00 16.63  ? 359  ALA A N   1 
ATOM   2801 C  CA  . ALA A 1 375 ? -21.842 25.138  -30.672 1.00 15.99  ? 359  ALA A CA  1 
ATOM   2802 C  C   . ALA A 1 375 ? -21.354 24.455  -31.943 1.00 18.48  ? 359  ALA A C   1 
ATOM   2803 O  O   . ALA A 1 375 ? -20.471 23.589  -31.889 1.00 17.84  ? 359  ALA A O   1 
ATOM   2804 C  CB  . ALA A 1 375 ? -20.854 26.218  -30.221 1.00 17.02  ? 359  ALA A CB  1 
ATOM   2805 N  N   . TYR A 1 376 ? -21.947 24.835  -33.069 1.00 14.65  ? 360  TYR A N   1 
ATOM   2806 C  CA  . TYR A 1 376 ? -21.650 24.245  -34.378 1.00 13.78  ? 360  TYR A CA  1 
ATOM   2807 C  C   . TYR A 1 376 ? -21.303 25.348  -35.333 1.00 18.10  ? 360  TYR A C   1 
ATOM   2808 O  O   . TYR A 1 376 ? -22.003 26.369  -35.396 1.00 18.11  ? 360  TYR A O   1 
ATOM   2809 C  CB  . TYR A 1 376 ? -22.851 23.412  -34.892 1.00 13.76  ? 360  TYR A CB  1 
ATOM   2810 C  CG  . TYR A 1 376 ? -23.236 22.342  -33.892 1.00 14.08  ? 360  TYR A CG  1 
ATOM   2811 C  CD1 . TYR A 1 376 ? -22.526 21.144  -33.822 1.00 14.98  ? 360  TYR A CD1 1 
ATOM   2812 C  CD2 . TYR A 1 376 ? -24.179 22.599  -32.895 1.00 14.59  ? 360  TYR A CD2 1 
ATOM   2813 C  CE1 . TYR A 1 376 ? -22.784 20.206  -32.827 1.00 15.27  ? 360  TYR A CE1 1 
ATOM   2814 C  CE2 . TYR A 1 376 ? -24.476 21.648  -31.915 1.00 14.34  ? 360  TYR A CE2 1 
ATOM   2815 C  CZ  . TYR A 1 376 ? -23.740 20.478  -31.856 1.00 14.65  ? 360  TYR A CZ  1 
ATOM   2816 O  OH  . TYR A 1 376 ? -23.989 19.546  -30.896 1.00 16.53  ? 360  TYR A OH  1 
ATOM   2817 N  N   . VAL A 1 377 ? -20.238 25.143  -36.100 1.00 15.48  ? 361  VAL A N   1 
ATOM   2818 C  CA  . VAL A 1 377 ? -19.788 26.166  -37.043 1.00 15.43  ? 361  VAL A CA  1 
ATOM   2819 C  C   . VAL A 1 377 ? -19.850 25.525  -38.425 1.00 17.23  ? 361  VAL A C   1 
ATOM   2820 O  O   . VAL A 1 377 ? -19.370 24.405  -38.593 1.00 15.55  ? 361  VAL A O   1 
ATOM   2821 C  CB  . VAL A 1 377 ? -18.353 26.663  -36.689 1.00 19.25  ? 361  VAL A CB  1 
ATOM   2822 C  CG1 . VAL A 1 377 ? -17.846 27.686  -37.709 1.00 19.14  ? 361  VAL A CG1 1 
ATOM   2823 C  CG2 . VAL A 1 377 ? -18.291 27.230  -35.263 1.00 18.83  ? 361  VAL A CG2 1 
ATOM   2824 N  N   . VAL A 1 378 ? -20.458 26.210  -39.395 1.00 14.88  ? 362  VAL A N   1 
ATOM   2825 C  CA  . VAL A 1 378 ? -20.534 25.702  -40.770 1.00 15.71  ? 362  VAL A CA  1 
ATOM   2826 C  C   . VAL A 1 378 ? -20.094 26.832  -41.691 1.00 21.60  ? 362  VAL A C   1 
ATOM   2827 O  O   . VAL A 1 378 ? -20.678 27.936  -41.678 1.00 19.31  ? 362  VAL A O   1 
ATOM   2828 C  CB  . VAL A 1 378 ? -21.924 25.128  -41.175 1.00 17.91  ? 362  VAL A CB  1 
ATOM   2829 C  CG1 . VAL A 1 378 ? -21.900 24.573  -42.611 1.00 17.32  ? 362  VAL A CG1 1 
ATOM   2830 C  CG2 . VAL A 1 378 ? -22.410 24.062  -40.196 1.00 16.61  ? 362  VAL A CG2 1 
ATOM   2831 N  N   . MET A 1 379 ? -19.033 26.566  -42.451 1.00 21.42  ? 363  MET A N   1 
ATOM   2832 C  CA  . MET A 1 379 ? -18.537 27.529  -43.435 1.00 24.13  ? 363  MET A CA  1 
ATOM   2833 C  C   . MET A 1 379 ? -19.500 27.550  -44.603 1.00 25.62  ? 363  MET A C   1 
ATOM   2834 O  O   . MET A 1 379 ? -19.899 26.490  -45.087 1.00 23.55  ? 363  MET A O   1 
ATOM   2835 C  CB  . MET A 1 379 ? -17.155 27.140  -43.964 1.00 28.50  ? 363  MET A CB  1 
ATOM   2836 C  CG  . MET A 1 379 ? -16.090 27.332  -42.973 1.00 35.13  ? 363  MET A CG  1 
ATOM   2837 S  SD  . MET A 1 379 ? -14.591 27.804  -43.828 1.00 43.39  ? 363  MET A SD  1 
ATOM   2838 C  CE  . MET A 1 379 ? -14.441 29.520  -43.259 1.00 40.71  ? 363  MET A CE  1 
ATOM   2839 N  N   . PRO A 1 380 ? -19.854 28.738  -45.106 1.00 24.18  ? 364  PRO A N   1 
ATOM   2840 C  CA  . PRO A 1 380 ? -20.746 28.779  -46.264 1.00 24.67  ? 364  PRO A CA  1 
ATOM   2841 C  C   . PRO A 1 380 ? -20.025 28.478  -47.583 1.00 28.90  ? 364  PRO A C   1 
ATOM   2842 O  O   . PRO A 1 380 ? -18.795 28.523  -47.660 1.00 27.15  ? 364  PRO A O   1 
ATOM   2843 C  CB  . PRO A 1 380 ? -21.282 30.215  -46.235 1.00 26.75  ? 364  PRO A CB  1 
ATOM   2844 C  CG  . PRO A 1 380 ? -20.205 31.003  -45.619 1.00 32.07  ? 364  PRO A CG  1 
ATOM   2845 C  CD  . PRO A 1 380 ? -19.479 30.092  -44.660 1.00 27.09  ? 364  PRO A CD  1 
ATOM   2846 N  N   . MET A 1 381 ? -20.804 28.176  -48.610 1.00 26.26  ? 365  MET A N   1 
ATOM   2847 C  CA  . MET A 1 381 ? -20.298 27.970  -49.967 1.00 27.63  ? 365  MET A CA  1 
ATOM   2848 C  C   . MET A 1 381 ? -20.268 29.334  -50.681 1.00 32.43  ? 365  MET A C   1 
ATOM   2849 O  O   . MET A 1 381 ? -20.848 30.294  -50.174 1.00 34.24  ? 365  MET A O   1 
ATOM   2850 C  CB  . MET A 1 381 ? -21.183 26.971  -50.705 1.00 29.50  ? 365  MET A CB  1 
ATOM   2851 C  CG  . MET A 1 381 ? -20.981 25.551  -50.206 1.00 33.38  ? 365  MET A CG  1 
ATOM   2852 S  SD  . MET A 1 381 ? -22.191 24.447  -50.926 1.00 37.36  ? 365  MET A SD  1 
ATOM   2853 C  CE  . MET A 1 381 ? -21.382 24.018  -52.427 1.00 34.34  ? 365  MET A CE  1 
ATOM   2854 N  N   . ARG A 1 382 ? -19.561 29.417  -51.836 1.00 28.29  ? 366  ARG A N   1 
ATOM   2855 C  CA  . ARG A 1 382 ? -19.329 30.573  -52.729 1.00 36.72  ? 366  ARG A CA  1 
ATOM   2856 C  C   . ARG A 1 382 ? -18.148 31.449  -52.344 1.00 78.56  ? 366  ARG A C   1 
ATOM   2857 O  O   . ARG A 1 382 ? -17.027 31.159  -52.756 1.00 45.22  ? 366  ARG A O   1 
ATOM   2858 C  CB  . ARG A 1 382 ? -20.587 31.391  -53.087 1.00 34.47  ? 366  ARG A CB  1 
ATOM   2859 C  CG  . ARG A 1 382 ? -21.620 30.596  -53.851 1.00 35.52  ? 366  ARG A CG  1 
ATOM   2860 C  CD  . ARG A 1 382 ? -22.772 31.438  -54.417 1.00 48.21  ? 366  ARG A CD  1 
ATOM   2861 N  NE  . ARG A 1 382 ? -23.178 32.574  -53.579 1.00 58.34  ? 366  ARG A NE  1 
ATOM   2862 C  CZ  . ARG A 1 382 ? -24.262 32.596  -52.807 1.00 72.03  ? 366  ARG A CZ  1 
ATOM   2863 N  NH1 . ARG A 1 382 ? -25.062 31.536  -52.740 1.00 58.22  ? 366  ARG A NH1 1 
ATOM   2864 N  NH2 . ARG A 1 382 ? -24.554 33.675  -52.093 1.00 58.19  ? 366  ARG A NH2 1 
ATOM   2865 N  N   . HIS B 1 16  ? -49.829 19.625  -71.029 1.00 67.56  ? 0    HIS B N   1 
ATOM   2866 C  CA  . HIS B 1 16  ? -51.233 19.757  -70.642 1.00 66.63  ? 0    HIS B CA  1 
ATOM   2867 C  C   . HIS B 1 16  ? -51.566 18.929  -69.389 1.00 62.93  ? 0    HIS B C   1 
ATOM   2868 O  O   . HIS B 1 16  ? -52.369 19.368  -68.567 1.00 60.88  ? 0    HIS B O   1 
ATOM   2869 C  CB  . HIS B 1 16  ? -52.156 19.337  -71.793 1.00 69.58  ? 0    HIS B CB  1 
ATOM   2870 C  CG  . HIS B 1 16  ? -52.131 20.234  -72.984 1.00 75.21  ? 0    HIS B CG  1 
ATOM   2871 N  ND1 . HIS B 1 16  ? -52.770 21.461  -72.978 1.00 77.48  ? 0    HIS B ND1 1 
ATOM   2872 C  CD2 . HIS B 1 16  ? -51.604 20.023  -74.213 1.00 78.42  ? 0    HIS B CD2 1 
ATOM   2873 C  CE1 . HIS B 1 16  ? -52.574 21.971  -74.181 1.00 78.52  ? 0    HIS B CE1 1 
ATOM   2874 N  NE2 . HIS B 1 16  ? -51.876 21.144  -74.957 1.00 79.40  ? 0    HIS B NE2 1 
ATOM   2875 N  N   . MET B 1 17  ? -50.970 17.730  -69.260 1.00 56.17  ? 1    MET B N   1 
ATOM   2876 C  CA  . MET B 1 17  ? -51.194 16.808  -68.141 1.00 53.08  ? 1    MET B CA  1 
ATOM   2877 C  C   . MET B 1 17  ? -51.148 17.518  -66.773 1.00 50.26  ? 1    MET B C   1 
ATOM   2878 O  O   . MET B 1 17  ? -50.200 18.257  -66.494 1.00 46.78  ? 1    MET B O   1 
ATOM   2879 C  CB  . MET B 1 17  ? -50.185 15.648  -68.188 1.00 55.28  ? 1    MET B CB  1 
ATOM   2880 C  CG  . MET B 1 17  ? -50.642 14.423  -67.422 1.00 58.44  ? 1    MET B CG  1 
ATOM   2881 S  SD  . MET B 1 17  ? -49.349 13.174  -67.194 1.00 61.97  ? 1    MET B SD  1 
ATOM   2882 C  CE  . MET B 1 17  ? -48.611 13.776  -65.684 1.00 56.24  ? 1    MET B CE  1 
ATOM   2883 N  N   . HIS B 1 18  ? -52.214 17.348  -65.969 1.00 44.84  ? 2    HIS B N   1 
ATOM   2884 C  CA  . HIS B 1 18  ? -52.343 17.942  -64.633 1.00 42.87  ? 2    HIS B CA  1 
ATOM   2885 C  C   . HIS B 1 18  ? -53.304 17.138  -63.753 1.00 45.13  ? 2    HIS B C   1 
ATOM   2886 O  O   . HIS B 1 18  ? -54.375 16.758  -64.209 1.00 46.01  ? 2    HIS B O   1 
ATOM   2887 C  CB  . HIS B 1 18  ? -52.764 19.426  -64.698 1.00 44.42  ? 2    HIS B CB  1 
ATOM   2888 C  CG  . HIS B 1 18  ? -53.162 20.002  -63.371 1.00 47.49  ? 2    HIS B CG  1 
ATOM   2889 N  ND1 . HIS B 1 18  ? -54.470 20.371  -63.109 1.00 50.24  ? 2    HIS B ND1 1 
ATOM   2890 C  CD2 . HIS B 1 18  ? -52.413 20.224  -62.260 1.00 47.48  ? 2    HIS B CD2 1 
ATOM   2891 C  CE1 . HIS B 1 18  ? -54.474 20.814  -61.860 1.00 48.59  ? 2    HIS B CE1 1 
ATOM   2892 N  NE2 . HIS B 1 18  ? -53.257 20.746  -61.310 1.00 47.10  ? 2    HIS B NE2 1 
ATOM   2893 N  N   . PHE B 1 19  ? -52.918 16.886  -62.490 1.00 39.06  ? 3    PHE B N   1 
ATOM   2894 C  CA  . PHE B 1 19  ? -53.741 16.159  -61.520 1.00 37.19  ? 3    PHE B CA  1 
ATOM   2895 C  C   . PHE B 1 19  ? -53.342 16.479  -60.074 1.00 41.15  ? 3    PHE B C   1 
ATOM   2896 O  O   . PHE B 1 19  ? -52.230 16.956  -59.822 1.00 39.73  ? 3    PHE B O   1 
ATOM   2897 C  CB  . PHE B 1 19  ? -53.726 14.636  -61.776 1.00 37.77  ? 3    PHE B CB  1 
ATOM   2898 C  CG  . PHE B 1 19  ? -52.411 13.920  -61.564 1.00 36.49  ? 3    PHE B CG  1 
ATOM   2899 C  CD1 . PHE B 1 19  ? -51.474 13.838  -62.587 1.00 38.72  ? 3    PHE B CD1 1 
ATOM   2900 C  CD2 . PHE B 1 19  ? -52.118 13.315  -60.347 1.00 35.81  ? 3    PHE B CD2 1 
ATOM   2901 C  CE1 . PHE B 1 19  ? -50.268 13.167  -62.398 1.00 38.65  ? 3    PHE B CE1 1 
ATOM   2902 C  CE2 . PHE B 1 19  ? -50.906 12.652  -60.154 1.00 37.54  ? 3    PHE B CE2 1 
ATOM   2903 C  CZ  . PHE B 1 19  ? -49.990 12.580  -61.183 1.00 36.24  ? 3    PHE B CZ  1 
ATOM   2904 N  N   . THR B 1 20  ? -54.263 16.214  -59.131 1.00 38.44  ? 4    THR B N   1 
ATOM   2905 C  CA  . THR B 1 20  ? -54.032 16.368  -57.690 1.00 36.88  ? 4    THR B CA  1 
ATOM   2906 C  C   . THR B 1 20  ? -54.235 14.991  -57.060 1.00 39.88  ? 4    THR B C   1 
ATOM   2907 O  O   . THR B 1 20  ? -55.108 14.230  -57.504 1.00 40.26  ? 4    THR B O   1 
ATOM   2908 C  CB  . THR B 1 20  ? -54.881 17.476  -57.043 1.00 46.74  ? 4    THR B CB  1 
ATOM   2909 O  OG1 . THR B 1 20  ? -56.262 17.143  -57.112 1.00 54.27  ? 4    THR B OG1 1 
ATOM   2910 C  CG2 . THR B 1 20  ? -54.633 18.848  -57.647 1.00 43.80  ? 4    THR B CG2 1 
ATOM   2911 N  N   . ILE B 1 21  ? -53.404 14.653  -56.063 1.00 33.65  ? 5    ILE B N   1 
ATOM   2912 C  CA  . ILE B 1 21  ? -53.431 13.348  -55.395 1.00 32.93  ? 5    ILE B CA  1 
ATOM   2913 C  C   . ILE B 1 21  ? -52.872 13.459  -53.965 1.00 37.41  ? 5    ILE B C   1 
ATOM   2914 O  O   . ILE B 1 21  ? -51.906 14.188  -53.758 1.00 36.16  ? 5    ILE B O   1 
ATOM   2915 C  CB  . ILE B 1 21  ? -52.658 12.287  -56.266 1.00 35.55  ? 5    ILE B CB  1 
ATOM   2916 C  CG1 . ILE B 1 21  ? -52.851 10.834  -55.762 1.00 35.24  ? 5    ILE B CG1 1 
ATOM   2917 C  CG2 . ILE B 1 21  ? -51.160 12.657  -56.498 1.00 35.17  ? 5    ILE B CG2 1 
ATOM   2918 C  CD1 . ILE B 1 21  ? -52.413 9.739   -56.756 1.00 35.88  ? 5    ILE B CD1 1 
ATOM   2919 N  N   . GLN B 1 22  ? -53.459 12.728  -52.990 1.00 34.53  ? 6    GLN B N   1 
ATOM   2920 C  CA  . GLN B 1 22  ? -52.933 12.700  -51.615 1.00 33.45  ? 6    GLN B CA  1 
ATOM   2921 C  C   . GLN B 1 22  ? -51.608 11.936  -51.611 1.00 34.79  ? 6    GLN B C   1 
ATOM   2922 O  O   . GLN B 1 22  ? -51.467 10.949  -52.340 1.00 32.99  ? 6    GLN B O   1 
ATOM   2923 C  CB  . GLN B 1 22  ? -53.918 12.025  -50.634 1.00 35.44  ? 6    GLN B CB  1 
ATOM   2924 C  CG  . GLN B 1 22  ? -55.118 12.891  -50.225 1.00 50.52  ? 6    GLN B CG  1 
ATOM   2925 C  CD  . GLN B 1 22  ? -54.785 13.997  -49.241 1.00 69.35  ? 6    GLN B CD  1 
ATOM   2926 O  OE1 . GLN B 1 22  ? -54.828 15.189  -49.572 1.00 64.15  ? 6    GLN B OE1 1 
ATOM   2927 N  NE2 . GLN B 1 22  ? -54.494 13.636  -47.998 1.00 59.59  ? 6    GLN B NE2 1 
ATOM   2928 N  N   . ARG B 1 23  ? -50.635 12.396  -50.786 1.00 30.78  ? 7    ARG B N   1 
ATOM   2929 C  CA  . ARG B 1 23  ? -49.315 11.774  -50.636 1.00 29.86  ? 7    ARG B CA  1 
ATOM   2930 C  C   . ARG B 1 23  ? -49.381 10.232  -50.604 1.00 33.85  ? 7    ARG B C   1 
ATOM   2931 O  O   . ARG B 1 23  ? -48.752 9.565   -51.433 1.00 31.92  ? 7    ARG B O   1 
ATOM   2932 C  CB  . ARG B 1 23  ? -48.598 12.311  -49.371 1.00 27.73  ? 7    ARG B CB  1 
ATOM   2933 C  CG  . ARG B 1 23  ? -47.261 11.633  -49.110 1.00 29.38  ? 7    ARG B CG  1 
ATOM   2934 C  CD  . ARG B 1 23  ? -46.770 11.902  -47.711 1.00 31.69  ? 7    ARG B CD  1 
ATOM   2935 N  NE  . ARG B 1 23  ? -45.525 11.192  -47.430 1.00 32.41  ? 7    ARG B NE  1 
ATOM   2936 C  CZ  . ARG B 1 23  ? -45.451 10.000  -46.850 1.00 39.18  ? 7    ARG B CZ  1 
ATOM   2937 N  NH1 . ARG B 1 23  ? -46.557 9.355   -46.494 1.00 33.99  ? 7    ARG B NH1 1 
ATOM   2938 N  NH2 . ARG B 1 23  ? -44.271 9.439   -46.627 1.00 28.90  ? 7    ARG B NH2 1 
ATOM   2939 N  N   . GLU B 1 24  ? -50.164 9.694   -49.657 1.00 31.42  ? 8    GLU B N   1 
ATOM   2940 C  CA  . GLU B 1 24  ? -50.332 8.265   -49.401 1.00 31.84  ? 8    GLU B CA  1 
ATOM   2941 C  C   . GLU B 1 24  ? -50.891 7.496   -50.607 1.00 36.23  ? 8    GLU B C   1 
ATOM   2942 O  O   . GLU B 1 24  ? -50.372 6.420   -50.925 1.00 35.38  ? 8    GLU B O   1 
ATOM   2943 C  CB  . GLU B 1 24  ? -51.178 8.036   -48.129 1.00 33.54  ? 8    GLU B CB  1 
ATOM   2944 C  CG  . GLU B 1 24  ? -50.499 8.472   -46.835 1.00 41.04  ? 8    GLU B CG  1 
ATOM   2945 C  CD  . GLU B 1 24  ? -50.287 9.965   -46.653 1.00 57.14  ? 8    GLU B CD  1 
ATOM   2946 O  OE1 . GLU B 1 24  ? -51.109 10.757  -47.171 1.00 46.50  ? 8    GLU B OE1 1 
ATOM   2947 O  OE2 . GLU B 1 24  ? -49.261 10.340  -46.042 1.00 45.96  ? 8    GLU B OE2 1 
ATOM   2948 N  N   . ALA B 1 25  ? -51.897 8.078   -51.310 1.00 33.84  ? 9    ALA B N   1 
ATOM   2949 C  CA  . ALA B 1 25  ? -52.504 7.474   -52.510 1.00 34.90  ? 9    ALA B CA  1 
ATOM   2950 C  C   . ALA B 1 25  ? -51.461 7.341   -53.631 1.00 37.54  ? 9    ALA B C   1 
ATOM   2951 O  O   . ALA B 1 25  ? -51.440 6.332   -54.332 1.00 37.26  ? 9    ALA B O   1 
ATOM   2952 C  CB  . ALA B 1 25  ? -53.675 8.316   -52.984 1.00 37.09  ? 9    ALA B CB  1 
ATOM   2953 N  N   . LEU B 1 26  ? -50.584 8.355   -53.784 1.00 31.39  ? 10   LEU B N   1 
ATOM   2954 C  CA  . LEU B 1 26  ? -49.524 8.323   -54.785 1.00 29.95  ? 10   LEU B CA  1 
ATOM   2955 C  C   . LEU B 1 26  ? -48.379 7.398   -54.365 1.00 31.28  ? 10   LEU B C   1 
ATOM   2956 O  O   . LEU B 1 26  ? -47.845 6.672   -55.202 1.00 29.17  ? 10   LEU B O   1 
ATOM   2957 C  CB  . LEU B 1 26  ? -49.000 9.756   -55.088 1.00 29.04  ? 10   LEU B CB  1 
ATOM   2958 C  CG  . LEU B 1 26  ? -47.799 9.870   -56.057 1.00 32.22  ? 10   LEU B CG  1 
ATOM   2959 C  CD1 . LEU B 1 26  ? -48.099 9.238   -57.429 1.00 31.74  ? 10   LEU B CD1 1 
ATOM   2960 C  CD2 . LEU B 1 26  ? -47.347 11.311  -56.206 1.00 32.55  ? 10   LEU B CD2 1 
ATOM   2961 N  N   . LEU B 1 27  ? -47.993 7.443   -53.079 1.00 28.60  ? 11   LEU B N   1 
ATOM   2962 C  CA  . LEU B 1 27  ? -46.864 6.682   -52.552 1.00 28.49  ? 11   LEU B CA  1 
ATOM   2963 C  C   . LEU B 1 27  ? -46.956 5.179   -52.727 1.00 31.94  ? 11   LEU B C   1 
ATOM   2964 O  O   . LEU B 1 27  ? -45.961 4.578   -53.124 1.00 30.79  ? 11   LEU B O   1 
ATOM   2965 C  CB  . LEU B 1 27  ? -46.578 7.058   -51.077 1.00 27.66  ? 11   LEU B CB  1 
ATOM   2966 C  CG  . LEU B 1 27  ? -45.225 6.664   -50.489 1.00 32.42  ? 11   LEU B CG  1 
ATOM   2967 C  CD1 . LEU B 1 27  ? -44.048 7.300   -51.265 1.00 32.42  ? 11   LEU B CD1 1 
ATOM   2968 C  CD2 . LEU B 1 27  ? -45.155 7.066   -49.026 1.00 33.40  ? 11   LEU B CD2 1 
ATOM   2969 N  N   . LYS B 1 28  ? -48.134 4.576   -52.446 1.00 30.50  ? 12   LYS B N   1 
ATOM   2970 C  CA  . LYS B 1 28  ? -48.346 3.123   -52.537 1.00 31.39  ? 12   LYS B CA  1 
ATOM   2971 C  C   . LYS B 1 28  ? -47.957 2.526   -53.908 1.00 35.55  ? 12   LYS B C   1 
ATOM   2972 O  O   . LYS B 1 28  ? -47.009 1.738   -53.931 1.00 34.30  ? 12   LYS B O   1 
ATOM   2973 C  CB  . LYS B 1 28  ? -49.757 2.705   -52.072 1.00 34.67  ? 12   LYS B CB  1 
ATOM   2974 N  N   . PRO B 1 29  ? -48.554 2.944   -55.059 1.00 34.24  ? 13   PRO B N   1 
ATOM   2975 C  CA  . PRO B 1 29  ? -48.115 2.374   -56.350 1.00 34.43  ? 13   PRO B CA  1 
ATOM   2976 C  C   . PRO B 1 29  ? -46.732 2.864   -56.794 1.00 35.67  ? 13   PRO B C   1 
ATOM   2977 O  O   . PRO B 1 29  ? -46.005 2.092   -57.419 1.00 35.22  ? 13   PRO B O   1 
ATOM   2978 C  CB  . PRO B 1 29  ? -49.219 2.800   -57.324 1.00 37.65  ? 13   PRO B CB  1 
ATOM   2979 C  CG  . PRO B 1 29  ? -49.760 4.047   -56.752 1.00 42.11  ? 13   PRO B CG  1 
ATOM   2980 C  CD  . PRO B 1 29  ? -49.678 3.885   -55.252 1.00 36.89  ? 13   PRO B CD  1 
ATOM   2981 N  N   . LEU B 1 30  ? -46.361 4.129   -56.463 1.00 30.93  ? 14   LEU B N   1 
ATOM   2982 C  CA  . LEU B 1 30  ? -45.052 4.696   -56.803 1.00 29.70  ? 14   LEU B CA  1 
ATOM   2983 C  C   . LEU B 1 30  ? -43.909 3.866   -56.227 1.00 32.54  ? 14   LEU B C   1 
ATOM   2984 O  O   . LEU B 1 30  ? -42.977 3.527   -56.959 1.00 32.48  ? 14   LEU B O   1 
ATOM   2985 C  CB  . LEU B 1 30  ? -44.940 6.164   -56.358 1.00 29.73  ? 14   LEU B CB  1 
ATOM   2986 C  CG  . LEU B 1 30  ? -43.791 6.999   -56.932 1.00 33.80  ? 14   LEU B CG  1 
ATOM   2987 C  CD1 . LEU B 1 30  ? -43.711 6.893   -58.471 1.00 34.82  ? 14   LEU B CD1 1 
ATOM   2988 C  CD2 . LEU B 1 30  ? -43.943 8.455   -56.522 1.00 32.27  ? 14   LEU B CD2 1 
ATOM   2989 N  N   . GLN B 1 31  ? -43.999 3.509   -54.932 1.00 29.06  ? 15   GLN B N   1 
ATOM   2990 C  CA  . GLN B 1 31  ? -42.987 2.681   -54.258 1.00 28.85  ? 15   GLN B CA  1 
ATOM   2991 C  C   . GLN B 1 31  ? -42.852 1.317   -54.925 1.00 33.17  ? 15   GLN B C   1 
ATOM   2992 O  O   . GLN B 1 31  ? -41.732 0.867   -55.160 1.00 31.50  ? 15   GLN B O   1 
ATOM   2993 C  CB  . GLN B 1 31  ? -43.319 2.497   -52.767 1.00 29.34  ? 15   GLN B CB  1 
ATOM   2994 C  CG  . GLN B 1 31  ? -43.004 3.704   -51.915 1.00 39.70  ? 15   GLN B CG  1 
ATOM   2995 C  CD  . GLN B 1 31  ? -43.174 3.412   -50.441 1.00 49.68  ? 15   GLN B CD  1 
ATOM   2996 O  OE1 . GLN B 1 31  ? -42.297 3.708   -49.639 1.00 47.15  ? 15   GLN B OE1 1 
ATOM   2997 N  NE2 . GLN B 1 31  ? -44.310 2.848   -50.044 1.00 39.58  ? 15   GLN B NE2 1 
ATOM   2998 N  N   . LEU B 1 32  ? -43.994 0.682   -55.250 1.00 32.16  ? 16   LEU B N   1 
ATOM   2999 C  CA  . LEU B 1 32  ? -44.034 -0.629  -55.907 1.00 33.00  ? 16   LEU B CA  1 
ATOM   3000 C  C   . LEU B 1 32  ? -43.409 -0.558  -57.276 1.00 34.50  ? 16   LEU B C   1 
ATOM   3001 O  O   . LEU B 1 32  ? -42.528 -1.351  -57.582 1.00 32.75  ? 16   LEU B O   1 
ATOM   3002 C  CB  . LEU B 1 32  ? -45.476 -1.165  -56.010 1.00 34.61  ? 16   LEU B CB  1 
ATOM   3003 C  CG  . LEU B 1 32  ? -46.205 -1.531  -54.697 1.00 40.67  ? 16   LEU B CG  1 
ATOM   3004 C  CD1 . LEU B 1 32  ? -47.533 -2.217  -54.990 1.00 41.99  ? 16   LEU B CD1 1 
ATOM   3005 C  CD2 . LEU B 1 32  ? -45.353 -2.435  -53.796 1.00 44.28  ? 16   LEU B CD2 1 
ATOM   3006 N  N   . VAL B 1 33  ? -43.816 0.445   -58.078 1.00 30.86  ? 17   VAL B N   1 
ATOM   3007 C  CA  . VAL B 1 33  ? -43.331 0.653   -59.435 1.00 31.39  ? 17   VAL B CA  1 
ATOM   3008 C  C   . VAL B 1 33  ? -41.833 1.003   -59.468 1.00 36.38  ? 17   VAL B C   1 
ATOM   3009 O  O   . VAL B 1 33  ? -41.095 0.364   -60.217 1.00 34.69  ? 17   VAL B O   1 
ATOM   3010 C  CB  . VAL B 1 33  ? -44.251 1.644   -60.197 1.00 36.28  ? 17   VAL B CB  1 
ATOM   3011 C  CG1 . VAL B 1 33  ? -43.583 2.195   -61.442 1.00 38.03  ? 17   VAL B CG1 1 
ATOM   3012 C  CG2 . VAL B 1 33  ? -45.583 0.988   -60.543 1.00 36.41  ? 17   VAL B CG2 1 
ATOM   3013 N  N   . ALA B 1 34  ? -41.377 1.950   -58.612 1.00 36.56  ? 18   ALA B N   1 
ATOM   3014 C  CA  . ALA B 1 34  ? -39.964 2.360   -58.537 1.00 37.87  ? 18   ALA B CA  1 
ATOM   3015 C  C   . ALA B 1 34  ? -39.036 1.199   -58.181 1.00 41.80  ? 18   ALA B C   1 
ATOM   3016 O  O   . ALA B 1 34  ? -37.888 1.190   -58.623 1.00 43.15  ? 18   ALA B O   1 
ATOM   3017 C  CB  . ALA B 1 34  ? -39.782 3.498   -57.549 1.00 38.54  ? 18   ALA B CB  1 
ATOM   3018 N  N   . GLY B 1 35  ? -39.564 0.222   -57.448 1.00 37.73  ? 19   GLY B N   1 
ATOM   3019 C  CA  . GLY B 1 35  ? -38.862 -0.994  -57.051 1.00 38.04  ? 19   GLY B CA  1 
ATOM   3020 C  C   . GLY B 1 35  ? -38.381 -1.859  -58.207 1.00 44.36  ? 19   GLY B C   1 
ATOM   3021 O  O   . GLY B 1 35  ? -37.380 -2.565  -58.059 1.00 45.23  ? 19   GLY B O   1 
ATOM   3022 N  N   . VAL B 1 36  ? -39.075 -1.816  -59.375 1.00 40.40  ? 20   VAL B N   1 
ATOM   3023 C  CA  . VAL B 1 36  ? -38.673 -2.605  -60.550 1.00 40.65  ? 20   VAL B CA  1 
ATOM   3024 C  C   . VAL B 1 36  ? -37.735 -1.812  -61.475 1.00 45.52  ? 20   VAL B C   1 
ATOM   3025 O  O   . VAL B 1 36  ? -37.131 -2.384  -62.384 1.00 45.37  ? 20   VAL B O   1 
ATOM   3026 C  CB  . VAL B 1 36  ? -39.841 -3.292  -61.319 1.00 45.02  ? 20   VAL B CB  1 
ATOM   3027 C  CG1 . VAL B 1 36  ? -40.660 -4.206  -60.410 1.00 44.55  ? 20   VAL B CG1 1 
ATOM   3028 C  CG2 . VAL B 1 36  ? -40.733 -2.284  -62.039 1.00 45.35  ? 20   VAL B CG2 1 
ATOM   3029 N  N   . VAL B 1 37  ? -37.623 -0.492  -61.233 1.00 42.61  ? 21   VAL B N   1 
ATOM   3030 C  CA  . VAL B 1 37  ? -36.793 0.426   -62.014 1.00 44.19  ? 21   VAL B CA  1 
ATOM   3031 C  C   . VAL B 1 37  ? -35.324 0.326   -61.559 1.00 49.84  ? 21   VAL B C   1 
ATOM   3032 O  O   . VAL B 1 37  ? -35.026 0.531   -60.374 1.00 49.92  ? 21   VAL B O   1 
ATOM   3033 C  CB  . VAL B 1 37  ? -37.347 1.879   -61.952 1.00 47.72  ? 21   VAL B CB  1 
ATOM   3034 C  CG1 . VAL B 1 37  ? -36.416 2.854   -62.650 1.00 48.60  ? 21   VAL B CG1 1 
ATOM   3035 C  CG2 . VAL B 1 37  ? -38.752 1.963   -62.547 1.00 47.81  ? 21   VAL B CG2 1 
ATOM   3036 N  N   . GLU B 1 38  ? -34.427 -0.011  -62.505 1.00 46.98  ? 22   GLU B N   1 
ATOM   3037 C  CA  . GLU B 1 38  ? -32.984 -0.160  -62.297 1.00 83.40  ? 22   GLU B CA  1 
ATOM   3038 C  C   . GLU B 1 38  ? -32.209 0.363   -63.507 1.00 122.89 ? 22   GLU B C   1 
ATOM   3039 O  O   . GLU B 1 38  ? -32.578 0.090   -64.651 1.00 87.60  ? 22   GLU B O   1 
ATOM   3040 C  CB  . GLU B 1 38  ? -32.625 -1.631  -62.031 1.00 84.54  ? 22   GLU B CB  1 
ATOM   3041 N  N   . THR B 1 42  ? -28.521 1.905   -69.334 1.00 67.11  ? 26   THR B N   1 
ATOM   3042 C  CA  . THR B 1 42  ? -27.941 2.493   -70.538 1.00 68.65  ? 26   THR B CA  1 
ATOM   3043 C  C   . THR B 1 42  ? -28.935 3.444   -71.228 1.00 71.80  ? 26   THR B C   1 
ATOM   3044 O  O   . THR B 1 42  ? -28.600 4.604   -71.478 1.00 72.21  ? 26   THR B O   1 
ATOM   3045 C  CB  . THR B 1 42  ? -27.417 1.389   -71.474 1.00 78.91  ? 26   THR B CB  1 
ATOM   3046 N  N   . LEU B 1 43  ? -30.150 2.941   -71.538 1.00 66.25  ? 27   LEU B N   1 
ATOM   3047 C  CA  . LEU B 1 43  ? -31.239 3.698   -72.163 1.00 64.97  ? 27   LEU B CA  1 
ATOM   3048 C  C   . LEU B 1 43  ? -31.839 4.608   -71.059 1.00 62.80  ? 27   LEU B C   1 
ATOM   3049 O  O   . LEU B 1 43  ? -32.282 4.079   -70.032 1.00 60.66  ? 27   LEU B O   1 
ATOM   3050 C  CB  . LEU B 1 43  ? -32.279 2.703   -72.733 1.00 65.38  ? 27   LEU B CB  1 
ATOM   3051 C  CG  . LEU B 1 43  ? -33.510 3.258   -73.455 1.00 70.79  ? 27   LEU B CG  1 
ATOM   3052 C  CD1 . LEU B 1 43  ? -33.152 3.819   -74.827 1.00 73.20  ? 27   LEU B CD1 1 
ATOM   3053 C  CD2 . LEU B 1 43  ? -34.559 2.177   -73.618 1.00 72.80  ? 27   LEU B CD2 1 
ATOM   3054 N  N   . PRO B 1 44  ? -31.786 5.964   -71.202 1.00 56.02  ? 28   PRO B N   1 
ATOM   3055 C  CA  . PRO B 1 44  ? -32.266 6.845   -70.112 1.00 52.92  ? 28   PRO B CA  1 
ATOM   3056 C  C   . PRO B 1 44  ? -33.711 6.652   -69.645 1.00 51.42  ? 28   PRO B C   1 
ATOM   3057 O  O   . PRO B 1 44  ? -33.954 6.671   -68.431 1.00 49.58  ? 28   PRO B O   1 
ATOM   3058 C  CB  . PRO B 1 44  ? -31.997 8.258   -70.643 1.00 55.72  ? 28   PRO B CB  1 
ATOM   3059 C  CG  . PRO B 1 44  ? -30.961 8.085   -71.699 1.00 62.44  ? 28   PRO B CG  1 
ATOM   3060 C  CD  . PRO B 1 44  ? -31.248 6.757   -72.327 1.00 59.08  ? 28   PRO B CD  1 
ATOM   3061 N  N   . VAL B 1 45  ? -34.653 6.409   -70.589 1.00 46.18  ? 29   VAL B N   1 
ATOM   3062 C  CA  . VAL B 1 45  ? -36.079 6.204   -70.284 1.00 44.79  ? 29   VAL B CA  1 
ATOM   3063 C  C   . VAL B 1 45  ? -36.374 5.018   -69.328 1.00 47.48  ? 29   VAL B C   1 
ATOM   3064 O  O   . VAL B 1 45  ? -37.346 5.081   -68.566 1.00 44.98  ? 29   VAL B O   1 
ATOM   3065 C  CB  . VAL B 1 45  ? -36.989 6.254   -71.539 1.00 49.69  ? 29   VAL B CB  1 
ATOM   3066 C  CG1 . VAL B 1 45  ? -36.890 4.974   -72.365 1.00 50.60  ? 29   VAL B CG1 1 
ATOM   3067 C  CG2 . VAL B 1 45  ? -38.438 6.570   -71.174 1.00 48.77  ? 29   VAL B CG2 1 
ATOM   3068 N  N   . LEU B 1 46  ? -35.504 3.980   -69.336 1.00 44.28  ? 30   LEU B N   1 
ATOM   3069 C  CA  . LEU B 1 46  ? -35.614 2.793   -68.489 1.00 43.22  ? 30   LEU B CA  1 
ATOM   3070 C  C   . LEU B 1 46  ? -35.574 3.121   -66.982 1.00 44.84  ? 30   LEU B C   1 
ATOM   3071 O  O   . LEU B 1 46  ? -36.164 2.387   -66.190 1.00 42.68  ? 30   LEU B O   1 
ATOM   3072 C  CB  . LEU B 1 46  ? -34.527 1.771   -68.850 1.00 44.16  ? 30   LEU B CB  1 
ATOM   3073 N  N   . SER B 1 47  ? -34.908 4.240   -66.608 1.00 40.94  ? 31   SER B N   1 
ATOM   3074 C  CA  . SER B 1 47  ? -34.774 4.739   -65.237 1.00 39.40  ? 31   SER B CA  1 
ATOM   3075 C  C   . SER B 1 47  ? -35.969 5.633   -64.834 1.00 40.36  ? 31   SER B C   1 
ATOM   3076 O  O   . SER B 1 47  ? -35.995 6.158   -63.720 1.00 38.19  ? 31   SER B O   1 
ATOM   3077 C  CB  . SER B 1 47  ? -33.461 5.504   -65.080 1.00 43.51  ? 31   SER B CB  1 
ATOM   3078 O  OG  . SER B 1 47  ? -32.347 4.629   -65.146 1.00 53.42  ? 31   SER B OG  1 
ATOM   3079 N  N   . ASN B 1 48  ? -36.964 5.780   -65.734 1.00 36.51  ? 32   ASN B N   1 
ATOM   3080 C  CA  . ASN B 1 48  ? -38.141 6.614   -65.498 1.00 35.45  ? 32   ASN B CA  1 
ATOM   3081 C  C   . ASN B 1 48  ? -39.435 5.845   -65.260 1.00 36.29  ? 32   ASN B C   1 
ATOM   3082 O  O   . ASN B 1 48  ? -39.559 4.675   -65.633 1.00 35.90  ? 32   ASN B O   1 
ATOM   3083 C  CB  . ASN B 1 48  ? -38.326 7.633   -66.646 1.00 37.36  ? 32   ASN B CB  1 
ATOM   3084 C  CG  . ASN B 1 48  ? -37.365 8.801   -66.642 1.00 46.96  ? 32   ASN B CG  1 
ATOM   3085 O  OD1 . ASN B 1 48  ? -36.386 8.838   -65.894 1.00 39.77  ? 32   ASN B OD1 1 
ATOM   3086 N  ND2 . ASN B 1 48  ? -37.620 9.792   -67.495 1.00 39.99  ? 32   ASN B ND2 1 
ATOM   3087 N  N   . VAL B 1 49  ? -40.390 6.506   -64.593 1.00 30.50  ? 33   VAL B N   1 
ATOM   3088 C  CA  . VAL B 1 49  ? -41.737 5.985   -64.365 1.00 29.20  ? 33   VAL B CA  1 
ATOM   3089 C  C   . VAL B 1 49  ? -42.668 6.630   -65.400 1.00 33.34  ? 33   VAL B C   1 
ATOM   3090 O  O   . VAL B 1 49  ? -42.664 7.854   -65.550 1.00 33.16  ? 33   VAL B O   1 
ATOM   3091 C  CB  . VAL B 1 49  ? -42.256 6.144   -62.899 1.00 30.38  ? 33   VAL B CB  1 
ATOM   3092 C  CG1 . VAL B 1 49  ? -42.226 7.593   -62.420 1.00 29.40  ? 33   VAL B CG1 1 
ATOM   3093 C  CG2 . VAL B 1 49  ? -43.661 5.555   -62.738 1.00 30.12  ? 33   VAL B CG2 1 
ATOM   3094 N  N   . LEU B 1 50  ? -43.453 5.814   -66.103 1.00 32.17  ? 34   LEU B N   1 
ATOM   3095 C  CA  . LEU B 1 50  ? -44.413 6.317   -67.089 1.00 33.43  ? 34   LEU B CA  1 
ATOM   3096 C  C   . LEU B 1 50  ? -45.685 6.670   -66.329 1.00 36.78  ? 34   LEU B C   1 
ATOM   3097 O  O   . LEU B 1 50  ? -46.249 5.831   -65.618 1.00 35.22  ? 34   LEU B O   1 
ATOM   3098 C  CB  . LEU B 1 50  ? -44.691 5.278   -68.195 1.00 34.35  ? 34   LEU B CB  1 
ATOM   3099 C  CG  . LEU B 1 50  ? -45.862 5.588   -69.146 1.00 39.66  ? 34   LEU B CG  1 
ATOM   3100 C  CD1 . LEU B 1 50  ? -45.531 6.737   -70.095 1.00 40.39  ? 34   LEU B CD1 1 
ATOM   3101 C  CD2 . LEU B 1 50  ? -46.270 4.353   -69.959 1.00 43.04  ? 34   LEU B CD2 1 
ATOM   3102 N  N   . LEU B 1 51  ? -46.084 7.930   -66.432 1.00 33.16  ? 35   LEU B N   1 
ATOM   3103 C  CA  . LEU B 1 51  ? -47.274 8.472   -65.793 1.00 33.09  ? 35   LEU B CA  1 
ATOM   3104 C  C   . LEU B 1 51  ? -48.300 8.715   -66.887 1.00 40.18  ? 35   LEU B C   1 
ATOM   3105 O  O   . LEU B 1 51  ? -48.013 9.430   -67.857 1.00 40.38  ? 35   LEU B O   1 
ATOM   3106 C  CB  . LEU B 1 51  ? -46.917 9.802   -65.119 1.00 32.64  ? 35   LEU B CB  1 
ATOM   3107 C  CG  . LEU B 1 51  ? -46.724 9.846   -63.602 1.00 36.12  ? 35   LEU B CG  1 
ATOM   3108 C  CD1 . LEU B 1 51  ? -45.795 8.758   -63.093 1.00 35.75  ? 35   LEU B CD1 1 
ATOM   3109 C  CD2 . LEU B 1 51  ? -46.258 11.217  -63.160 1.00 37.02  ? 35   LEU B CD2 1 
ATOM   3110 N  N   . VAL B 1 52  ? -49.478 8.096   -66.753 1.00 38.13  ? 36   VAL B N   1 
ATOM   3111 C  CA  . VAL B 1 52  ? -50.570 8.258   -67.722 1.00 40.37  ? 36   VAL B CA  1 
ATOM   3112 C  C   . VAL B 1 52  ? -51.847 8.634   -66.968 1.00 43.79  ? 36   VAL B C   1 
ATOM   3113 O  O   . VAL B 1 52  ? -52.238 7.935   -66.031 1.00 42.23  ? 36   VAL B O   1 
ATOM   3114 C  CB  . VAL B 1 52  ? -50.776 7.002   -68.625 1.00 45.10  ? 36   VAL B CB  1 
ATOM   3115 C  CG1 . VAL B 1 52  ? -51.931 7.201   -69.611 1.00 46.84  ? 36   VAL B CG1 1 
ATOM   3116 C  CG2 . VAL B 1 52  ? -49.501 6.639   -69.382 1.00 45.04  ? 36   VAL B CG2 1 
ATOM   3117 N  N   . VAL B 1 53  ? -52.478 9.735   -67.381 1.00 42.12  ? 37   VAL B N   1 
ATOM   3118 C  CA  . VAL B 1 53  ? -53.751 10.207  -66.850 1.00 43.11  ? 37   VAL B CA  1 
ATOM   3119 C  C   . VAL B 1 53  ? -54.779 10.042  -67.978 1.00 49.61  ? 37   VAL B C   1 
ATOM   3120 O  O   . VAL B 1 53  ? -54.593 10.595  -69.058 1.00 49.12  ? 37   VAL B O   1 
ATOM   3121 C  CB  . VAL B 1 53  ? -53.686 11.660  -66.313 1.00 47.16  ? 37   VAL B CB  1 
ATOM   3122 C  CG1 . VAL B 1 53  ? -55.074 12.169  -65.910 1.00 48.02  ? 37   VAL B CG1 1 
ATOM   3123 C  CG2 . VAL B 1 53  ? -52.707 11.775  -65.144 1.00 44.61  ? 37   VAL B CG2 1 
ATOM   3124 N  N   . GLU B 1 54  ? -55.800 9.207   -67.744 1.00 48.87  ? 38   GLU B N   1 
ATOM   3125 C  CA  . GLU B 1 54  ? -56.890 8.911   -68.678 1.00 51.64  ? 38   GLU B CA  1 
ATOM   3126 C  C   . GLU B 1 54  ? -58.170 8.859   -67.848 1.00 57.11  ? 38   GLU B C   1 
ATOM   3127 O  O   . GLU B 1 54  ? -58.277 8.032   -66.934 1.00 54.66  ? 38   GLU B O   1 
ATOM   3128 C  CB  . GLU B 1 54  ? -56.642 7.581   -69.418 1.00 53.75  ? 38   GLU B CB  1 
ATOM   3129 N  N   . GLY B 1 55  ? -59.084 9.792   -68.121 1.00 56.98  ? 39   GLY B N   1 
ATOM   3130 C  CA  . GLY B 1 55  ? -60.337 9.933   -67.387 1.00 57.64  ? 39   GLY B CA  1 
ATOM   3131 C  C   . GLY B 1 55  ? -60.053 10.333  -65.954 1.00 59.93  ? 39   GLY B C   1 
ATOM   3132 O  O   . GLY B 1 55  ? -59.429 11.372  -65.712 1.00 58.48  ? 39   GLY B O   1 
ATOM   3133 N  N   . GLN B 1 56  ? -60.446 9.478   -64.998 1.00 55.50  ? 40   GLN B N   1 
ATOM   3134 C  CA  . GLN B 1 56  ? -60.170 9.717   -63.577 1.00 53.47  ? 40   GLN B CA  1 
ATOM   3135 C  C   . GLN B 1 56  ? -59.201 8.641   -63.053 1.00 55.12  ? 40   GLN B C   1 
ATOM   3136 O  O   . GLN B 1 56  ? -59.245 8.260   -61.878 1.00 53.64  ? 40   GLN B O   1 
ATOM   3137 C  CB  . GLN B 1 56  ? -61.476 9.791   -62.754 1.00 55.26  ? 40   GLN B CB  1 
ATOM   3138 C  CG  . GLN B 1 56  ? -62.349 11.012  -63.042 1.00 65.01  ? 40   GLN B CG  1 
ATOM   3139 C  CD  . GLN B 1 56  ? -61.655 12.318  -62.746 1.00 76.99  ? 40   GLN B CD  1 
ATOM   3140 O  OE1 . GLN B 1 56  ? -61.423 12.684  -61.587 1.00 70.01  ? 40   GLN B OE1 1 
ATOM   3141 N  NE2 . GLN B 1 56  ? -61.304 13.045  -63.796 1.00 64.59  ? 40   GLN B NE2 1 
ATOM   3142 N  N   . GLN B 1 57  ? -58.330 8.139   -63.949 1.00 50.49  ? 41   GLN B N   1 
ATOM   3143 C  CA  . GLN B 1 57  ? -57.363 7.111   -63.598 1.00 48.10  ? 41   GLN B CA  1 
ATOM   3144 C  C   . GLN B 1 57  ? -55.926 7.498   -63.896 1.00 48.25  ? 41   GLN B C   1 
ATOM   3145 O  O   . GLN B 1 57  ? -55.584 7.905   -65.007 1.00 49.51  ? 41   GLN B O   1 
ATOM   3146 C  CB  . GLN B 1 57  ? -57.705 5.758   -64.243 1.00 50.47  ? 41   GLN B CB  1 
ATOM   3147 C  CG  . GLN B 1 57  ? -56.813 4.624   -63.730 1.00 60.96  ? 41   GLN B CG  1 
ATOM   3148 C  CD  . GLN B 1 57  ? -57.246 3.283   -64.228 1.00 71.16  ? 41   GLN B CD  1 
ATOM   3149 O  OE1 . GLN B 1 57  ? -56.999 2.914   -65.380 1.00 70.01  ? 41   GLN B OE1 1 
ATOM   3150 N  NE2 . GLN B 1 57  ? -57.888 2.523   -63.359 1.00 55.43  ? 41   GLN B NE2 1 
ATOM   3151 N  N   . LEU B 1 58  ? -55.082 7.322   -62.892 1.00 40.63  ? 42   LEU B N   1 
ATOM   3152 C  CA  . LEU B 1 58  ? -53.654 7.526   -63.016 1.00 37.59  ? 42   LEU B CA  1 
ATOM   3153 C  C   . LEU B 1 58  ? -53.016 6.144   -63.106 1.00 39.08  ? 42   LEU B C   1 
ATOM   3154 O  O   . LEU B 1 58  ? -53.306 5.277   -62.283 1.00 37.59  ? 42   LEU B O   1 
ATOM   3155 C  CB  . LEU B 1 58  ? -53.086 8.297   -61.800 1.00 35.15  ? 42   LEU B CB  1 
ATOM   3156 C  CG  . LEU B 1 58  ? -51.546 8.395   -61.715 1.00 36.74  ? 42   LEU B CG  1 
ATOM   3157 C  CD1 . LEU B 1 58  ? -50.966 9.288   -62.847 1.00 36.34  ? 42   LEU B CD1 1 
ATOM   3158 C  CD2 . LEU B 1 58  ? -51.106 8.901   -60.351 1.00 37.16  ? 42   LEU B CD2 1 
ATOM   3159 N  N   . SER B 1 59  ? -52.147 5.944   -64.101 1.00 35.25  ? 43   SER B N   1 
ATOM   3160 C  CA  . SER B 1 59  ? -51.391 4.702   -64.234 1.00 34.57  ? 43   SER B CA  1 
ATOM   3161 C  C   . SER B 1 59  ? -49.924 5.028   -64.075 1.00 36.95  ? 43   SER B C   1 
ATOM   3162 O  O   . SER B 1 59  ? -49.446 6.062   -64.579 1.00 36.04  ? 43   SER B O   1 
ATOM   3163 C  CB  . SER B 1 59  ? -51.650 4.026   -65.572 1.00 38.45  ? 43   SER B CB  1 
ATOM   3164 O  OG  . SER B 1 59  ? -52.923 3.403   -65.528 1.00 46.76  ? 43   SER B OG  1 
ATOM   3165 N  N   . LEU B 1 60  ? -49.222 4.154   -63.357 1.00 31.74  ? 44   LEU B N   1 
ATOM   3166 C  CA  . LEU B 1 60  ? -47.797 4.282   -63.097 1.00 30.89  ? 44   LEU B CA  1 
ATOM   3167 C  C   . LEU B 1 60  ? -47.140 3.015   -63.586 1.00 34.44  ? 44   LEU B C   1 
ATOM   3168 O  O   . LEU B 1 60  ? -47.478 1.925   -63.111 1.00 33.08  ? 44   LEU B O   1 
ATOM   3169 C  CB  . LEU B 1 60  ? -47.519 4.515   -61.593 1.00 29.37  ? 44   LEU B CB  1 
ATOM   3170 C  CG  . LEU B 1 60  ? -48.133 5.778   -60.983 1.00 34.52  ? 44   LEU B CG  1 
ATOM   3171 C  CD1 . LEU B 1 60  ? -49.490 5.480   -60.352 1.00 35.13  ? 44   LEU B CD1 1 
ATOM   3172 C  CD2 . LEU B 1 60  ? -47.212 6.379   -59.950 1.00 36.63  ? 44   LEU B CD2 1 
ATOM   3173 N  N   . THR B 1 61  ? -46.230 3.140   -64.563 1.00 32.17  ? 45   THR B N   1 
ATOM   3174 C  CA  . THR B 1 61  ? -45.564 1.955   -65.122 1.00 32.93  ? 45   THR B CA  1 
ATOM   3175 C  C   . THR B 1 61  ? -44.044 2.044   -64.966 1.00 37.25  ? 45   THR B C   1 
ATOM   3176 O  O   . THR B 1 61  ? -43.437 3.095   -65.214 1.00 36.54  ? 45   THR B O   1 
ATOM   3177 C  CB  . THR B 1 61  ? -46.029 1.703   -66.574 1.00 39.62  ? 45   THR B CB  1 
ATOM   3178 O  OG1 . THR B 1 61  ? -47.462 1.690   -66.616 1.00 36.42  ? 45   THR B OG1 1 
ATOM   3179 C  CG2 . THR B 1 61  ? -45.492 0.397   -67.161 1.00 39.94  ? 45   THR B CG2 1 
ATOM   3180 N  N   . GLY B 1 62  ? -43.467 0.931   -64.544 1.00 34.24  ? 46   GLY B N   1 
ATOM   3181 C  CA  . GLY B 1 62  ? -42.035 0.755   -64.371 1.00 33.51  ? 46   GLY B CA  1 
ATOM   3182 C  C   . GLY B 1 62  ? -41.619 -0.540  -65.028 1.00 36.61  ? 46   GLY B C   1 
ATOM   3183 O  O   . GLY B 1 62  ? -42.367 -1.522  -64.984 1.00 36.50  ? 46   GLY B O   1 
ATOM   3184 N  N   . THR B 1 63  ? -40.435 -0.553  -65.653 1.00 33.43  ? 47   THR B N   1 
ATOM   3185 C  CA  . THR B 1 63  ? -39.923 -1.753  -66.327 1.00 35.40  ? 47   THR B CA  1 
ATOM   3186 C  C   . THR B 1 63  ? -38.397 -1.816  -66.291 1.00 40.82  ? 47   THR B C   1 
ATOM   3187 O  O   . THR B 1 63  ? -37.733 -0.781  -66.175 1.00 39.17  ? 47   THR B O   1 
ATOM   3188 C  CB  . THR B 1 63  ? -40.512 -1.895  -67.762 1.00 41.00  ? 47   THR B CB  1 
ATOM   3189 O  OG1 . THR B 1 63  ? -40.217 -3.196  -68.292 1.00 41.29  ? 47   THR B OG1 1 
ATOM   3190 C  CG2 . THR B 1 63  ? -40.033 -0.795  -68.722 1.00 40.77  ? 47   THR B CG2 1 
ATOM   3191 N  N   . ASP B 1 64  ? -37.852 -3.040  -66.370 1.00 38.39  ? 48   ASP B N   1 
ATOM   3192 C  CA  . ASP B 1 64  ? -36.414 -3.274  -66.464 1.00 38.44  ? 48   ASP B CA  1 
ATOM   3193 C  C   . ASP B 1 64  ? -36.159 -4.106  -67.745 1.00 44.13  ? 48   ASP B C   1 
ATOM   3194 O  O   . ASP B 1 64  ? -35.061 -4.639  -67.939 1.00 44.68  ? 48   ASP B O   1 
ATOM   3195 C  CB  . ASP B 1 64  ? -35.884 -3.984  -65.196 1.00 37.77  ? 48   ASP B CB  1 
ATOM   3196 C  CG  . ASP B 1 64  ? -36.311 -5.434  -65.007 1.00 41.92  ? 48   ASP B CG  1 
ATOM   3197 O  OD1 . ASP B 1 64  ? -37.216 -5.893  -65.742 1.00 43.07  ? 48   ASP B OD1 1 
ATOM   3198 O  OD2 . ASP B 1 64  ? -35.756 -6.100  -64.105 1.00 41.40  ? 48   ASP B OD2 1 
ATOM   3199 N  N   . LEU B 1 65  ? -37.212 -4.212  -68.594 1.00 41.11  ? 49   LEU B N   1 
ATOM   3200 C  CA  . LEU B 1 65  ? -37.333 -4.977  -69.850 1.00 43.03  ? 49   LEU B CA  1 
ATOM   3201 C  C   . LEU B 1 65  ? -37.692 -6.462  -69.664 1.00 46.58  ? 49   LEU B C   1 
ATOM   3202 O  O   . LEU B 1 65  ? -38.255 -7.063  -70.585 1.00 47.86  ? 49   LEU B O   1 
ATOM   3203 C  CB  . LEU B 1 65  ? -36.176 -4.780  -70.847 1.00 44.94  ? 49   LEU B CB  1 
ATOM   3204 C  CG  . LEU B 1 65  ? -35.914 -3.342  -71.312 1.00 50.86  ? 49   LEU B CG  1 
ATOM   3205 C  CD1 . LEU B 1 65  ? -34.610 -3.263  -72.070 1.00 52.99  ? 49   LEU B CD1 1 
ATOM   3206 C  CD2 . LEU B 1 65  ? -37.071 -2.803  -72.150 1.00 53.50  ? 49   LEU B CD2 1 
ATOM   3207 N  N   . GLU B 1 66  ? -37.369 -7.051  -68.486 1.00 40.53  ? 50   GLU B N   1 
ATOM   3208 C  CA  . GLU B 1 66  ? -37.704 -8.447  -68.155 1.00 39.73  ? 50   GLU B CA  1 
ATOM   3209 C  C   . GLU B 1 66  ? -39.088 -8.479  -67.480 1.00 40.79  ? 50   GLU B C   1 
ATOM   3210 O  O   . GLU B 1 66  ? -39.939 -9.293  -67.837 1.00 39.67  ? 50   GLU B O   1 
ATOM   3211 C  CB  . GLU B 1 66  ? -36.625 -9.117  -67.268 1.00 40.51  ? 50   GLU B CB  1 
ATOM   3212 C  CG  . GLU B 1 66  ? -36.833 -10.632 -67.163 1.00 56.18  ? 50   GLU B CG  1 
ATOM   3213 C  CD  . GLU B 1 66  ? -35.646 -11.524 -66.830 1.00 72.22  ? 50   GLU B CD  1 
ATOM   3214 O  OE1 . GLU B 1 66  ? -35.148 -11.463 -65.679 1.00 53.13  ? 50   GLU B OE1 1 
ATOM   3215 O  OE2 . GLU B 1 66  ? -35.281 -12.357 -67.693 1.00 57.15  ? 50   GLU B OE2 1 
ATOM   3216 N  N   . VAL B 1 67  ? -39.306 -7.569  -66.517 1.00 36.48  ? 51   VAL B N   1 
ATOM   3217 C  CA  . VAL B 1 67  ? -40.578 -7.423  -65.815 1.00 35.60  ? 51   VAL B CA  1 
ATOM   3218 C  C   . VAL B 1 67  ? -41.161 -6.027  -66.045 1.00 40.20  ? 51   VAL B C   1 
ATOM   3219 O  O   . VAL B 1 67  ? -40.414 -5.066  -66.243 1.00 38.93  ? 51   VAL B O   1 
ATOM   3220 C  CB  . VAL B 1 67  ? -40.516 -7.756  -64.299 1.00 38.40  ? 51   VAL B CB  1 
ATOM   3221 C  CG1 . VAL B 1 67  ? -40.122 -9.209  -64.064 1.00 37.64  ? 51   VAL B CG1 1 
ATOM   3222 C  CG2 . VAL B 1 67  ? -39.602 -6.798  -63.529 1.00 37.66  ? 51   VAL B CG2 1 
ATOM   3223 N  N   . GLU B 1 68  ? -42.489 -5.926  -65.966 1.00 37.14  ? 52   GLU B N   1 
ATOM   3224 C  CA  . GLU B 1 68  ? -43.220 -4.680  -66.068 1.00 37.05  ? 52   GLU B CA  1 
ATOM   3225 C  C   . GLU B 1 68  ? -44.252 -4.633  -64.947 1.00 39.12  ? 52   GLU B C   1 
ATOM   3226 O  O   . GLU B 1 68  ? -45.000 -5.600  -64.758 1.00 39.82  ? 52   GLU B O   1 
ATOM   3227 C  CB  . GLU B 1 68  ? -43.897 -4.556  -67.440 1.00 40.12  ? 52   GLU B CB  1 
ATOM   3228 C  CG  . GLU B 1 68  ? -44.470 -3.169  -67.665 1.00 47.39  ? 52   GLU B CG  1 
ATOM   3229 C  CD  . GLU B 1 68  ? -45.557 -3.087  -68.715 1.00 63.97  ? 52   GLU B CD  1 
ATOM   3230 O  OE1 . GLU B 1 68  ? -45.345 -2.374  -69.721 1.00 54.15  ? 52   GLU B OE1 1 
ATOM   3231 O  OE2 . GLU B 1 68  ? -46.631 -3.702  -68.518 1.00 49.88  ? 52   GLU B OE2 1 
ATOM   3232 N  N   . LEU B 1 69  ? -44.264 -3.534  -64.180 1.00 33.62  ? 53   LEU B N   1 
ATOM   3233 C  CA  . LEU B 1 69  ? -45.243 -3.355  -63.115 1.00 32.61  ? 53   LEU B CA  1 
ATOM   3234 C  C   . LEU B 1 69  ? -46.065 -2.108  -63.373 1.00 36.19  ? 53   LEU B C   1 
ATOM   3235 O  O   . LEU B 1 69  ? -45.500 -1.040  -63.614 1.00 35.32  ? 53   LEU B O   1 
ATOM   3236 C  CB  . LEU B 1 69  ? -44.621 -3.331  -61.705 1.00 31.26  ? 53   LEU B CB  1 
ATOM   3237 C  CG  . LEU B 1 69  ? -45.638 -3.376  -60.539 1.00 36.50  ? 53   LEU B CG  1 
ATOM   3238 C  CD1 . LEU B 1 69  ? -46.449 -4.679  -60.531 1.00 36.92  ? 53   LEU B CD1 1 
ATOM   3239 C  CD2 . LEU B 1 69  ? -44.958 -3.181  -59.203 1.00 38.39  ? 53   LEU B CD2 1 
ATOM   3240 N  N   . VAL B 1 70  ? -47.400 -2.262  -63.354 1.00 34.26  ? 54   VAL B N   1 
ATOM   3241 C  CA  . VAL B 1 70  ? -48.360 -1.172  -63.567 1.00 35.10  ? 54   VAL B CA  1 
ATOM   3242 C  C   . VAL B 1 70  ? -49.200 -1.026  -62.296 1.00 39.84  ? 54   VAL B C   1 
ATOM   3243 O  O   . VAL B 1 70  ? -49.823 -1.985  -61.850 1.00 40.24  ? 54   VAL B O   1 
ATOM   3244 C  CB  . VAL B 1 70  ? -49.258 -1.358  -64.837 1.00 40.40  ? 54   VAL B CB  1 
ATOM   3245 C  CG1 . VAL B 1 70  ? -50.118 -0.120  -65.108 1.00 40.85  ? 54   VAL B CG1 1 
ATOM   3246 C  CG2 . VAL B 1 70  ? -48.431 -1.707  -66.072 1.00 41.03  ? 54   VAL B CG2 1 
ATOM   3247 N  N   . GLY B 1 71  ? -49.171 0.159   -61.713 1.00 35.87  ? 55   GLY B N   1 
ATOM   3248 C  CA  . GLY B 1 71  ? -49.975 0.507   -60.550 1.00 34.82  ? 55   GLY B CA  1 
ATOM   3249 C  C   . GLY B 1 71  ? -51.045 1.476   -61.005 1.00 40.15  ? 55   GLY B C   1 
ATOM   3250 O  O   . GLY B 1 71  ? -50.781 2.320   -61.866 1.00 39.50  ? 55   GLY B O   1 
ATOM   3251 N  N   . ARG B 1 72  ? -52.268 1.343   -60.479 1.00 38.03  ? 56   ARG B N   1 
ATOM   3252 C  CA  . ARG B 1 72  ? -53.372 2.226   -60.870 1.00 39.45  ? 56   ARG B CA  1 
ATOM   3253 C  C   . ARG B 1 72  ? -54.035 2.886   -59.658 1.00 43.57  ? 56   ARG B C   1 
ATOM   3254 O  O   . ARG B 1 72  ? -54.196 2.244   -58.621 1.00 42.76  ? 56   ARG B O   1 
ATOM   3255 C  CB  . ARG B 1 72  ? -54.395 1.476   -61.751 1.00 42.10  ? 56   ARG B CB  1 
ATOM   3256 C  CG  . ARG B 1 72  ? -53.859 1.146   -63.145 1.00 50.64  ? 56   ARG B CG  1 
ATOM   3257 C  CD  . ARG B 1 72  ? -54.674 0.107   -63.893 1.00 63.82  ? 56   ARG B CD  1 
ATOM   3258 N  NE  . ARG B 1 72  ? -54.264 -1.256  -63.544 1.00 69.25  ? 56   ARG B NE  1 
ATOM   3259 C  CZ  . ARG B 1 72  ? -54.993 -2.087  -62.807 1.00 85.45  ? 56   ARG B CZ  1 
ATOM   3260 N  NH1 . ARG B 1 72  ? -56.187 -1.716  -62.362 1.00 77.24  ? 56   ARG B NH1 1 
ATOM   3261 N  NH2 . ARG B 1 72  ? -54.540 -3.302  -62.524 1.00 68.65  ? 56   ARG B NH2 1 
ATOM   3262 N  N   . VAL B 1 73  ? -54.363 4.183   -59.776 1.00 41.45  ? 57   VAL B N   1 
ATOM   3263 C  CA  . VAL B 1 73  ? -55.023 4.981   -58.732 1.00 42.13  ? 57   VAL B CA  1 
ATOM   3264 C  C   . VAL B 1 73  ? -56.213 5.697   -59.344 1.00 48.27  ? 57   VAL B C   1 
ATOM   3265 O  O   . VAL B 1 73  ? -56.096 6.229   -60.447 1.00 48.73  ? 57   VAL B O   1 
ATOM   3266 C  CB  . VAL B 1 73  ? -54.114 6.039   -58.015 1.00 45.64  ? 57   VAL B CB  1 
ATOM   3267 C  CG1 . VAL B 1 73  ? -54.567 6.257   -56.574 1.00 44.82  ? 57   VAL B CG1 1 
ATOM   3268 C  CG2 . VAL B 1 73  ? -52.633 5.678   -58.066 1.00 44.56  ? 57   VAL B CG2 1 
ATOM   3269 N  N   . VAL B 1 74  ? -57.335 5.759   -58.608 1.00 45.94  ? 58   VAL B N   1 
ATOM   3270 C  CA  . VAL B 1 74  ? -58.530 6.476   -59.042 1.00 47.59  ? 58   VAL B CA  1 
ATOM   3271 C  C   . VAL B 1 74  ? -58.418 7.900   -58.488 1.00 51.89  ? 58   VAL B C   1 
ATOM   3272 O  O   . VAL B 1 74  ? -58.278 8.086   -57.270 1.00 50.80  ? 58   VAL B O   1 
ATOM   3273 C  CB  . VAL B 1 74  ? -59.866 5.782   -58.645 1.00 52.25  ? 58   VAL B CB  1 
ATOM   3274 C  CG1 . VAL B 1 74  ? -61.070 6.537   -59.218 1.00 53.62  ? 58   VAL B CG1 1 
ATOM   3275 C  CG2 . VAL B 1 74  ? -59.890 4.322   -59.097 1.00 52.26  ? 58   VAL B CG2 1 
ATOM   3276 N  N   . LEU B 1 75  ? -58.427 8.897   -59.386 1.00 49.59  ? 59   LEU B N   1 
ATOM   3277 C  CA  . LEU B 1 75  ? -58.306 10.306  -59.004 1.00 49.26  ? 59   LEU B CA  1 
ATOM   3278 C  C   . LEU B 1 75  ? -59.677 10.888  -58.652 1.00 57.54  ? 59   LEU B C   1 
ATOM   3279 O  O   . LEU B 1 75  ? -60.609 10.798  -59.453 1.00 58.88  ? 59   LEU B O   1 
ATOM   3280 C  CB  . LEU B 1 75  ? -57.590 11.132  -60.098 1.00 48.87  ? 59   LEU B CB  1 
ATOM   3281 C  CG  . LEU B 1 75  ? -56.147 10.710  -60.437 1.00 51.04  ? 59   LEU B CG  1 
ATOM   3282 C  CD1 . LEU B 1 75  ? -55.761 11.157  -61.835 1.00 51.18  ? 59   LEU B CD1 1 
ATOM   3283 C  CD2 . LEU B 1 75  ? -55.141 11.237  -59.399 1.00 50.53  ? 59   LEU B CD2 1 
ATOM   3284 N  N   . GLU B 1 76  ? -59.805 11.443  -57.432 1.00 55.37  ? 60   GLU B N   1 
ATOM   3285 C  CA  . GLU B 1 76  ? -61.052 12.016  -56.914 1.00 56.97  ? 60   GLU B CA  1 
ATOM   3286 C  C   . GLU B 1 76  ? -61.376 13.388  -57.508 1.00 62.49  ? 60   GLU B C   1 
ATOM   3287 O  O   . GLU B 1 76  ? -62.534 13.650  -57.831 1.00 64.17  ? 60   GLU B O   1 
ATOM   3288 C  CB  . GLU B 1 76  ? -61.019 12.087  -55.378 1.00 57.53  ? 60   GLU B CB  1 
ATOM   3289 N  N   . ASP B 1 77  ? -60.365 14.268  -57.625 1.00 57.71  ? 61   ASP B N   1 
ATOM   3290 C  CA  . ASP B 1 77  ? -60.524 15.622  -58.161 1.00 57.67  ? 61   ASP B CA  1 
ATOM   3291 C  C   . ASP B 1 77  ? -60.284 15.668  -59.671 1.00 60.75  ? 61   ASP B C   1 
ATOM   3292 O  O   . ASP B 1 77  ? -59.740 14.717  -60.231 1.00 59.78  ? 61   ASP B O   1 
ATOM   3293 C  CB  . ASP B 1 77  ? -59.596 16.604  -57.420 1.00 58.21  ? 61   ASP B CB  1 
ATOM   3294 N  N   . ALA B 1 78  ? -60.677 16.784  -60.320 1.00 57.87  ? 62   ALA B N   1 
ATOM   3295 C  CA  . ALA B 1 78  ? -60.532 17.012  -61.763 1.00 59.00  ? 62   ALA B CA  1 
ATOM   3296 C  C   . ALA B 1 78  ? -59.084 16.842  -62.249 1.00 61.49  ? 62   ALA B C   1 
ATOM   3297 O  O   . ALA B 1 78  ? -58.148 17.314  -61.590 1.00 59.85  ? 62   ALA B O   1 
ATOM   3298 C  CB  . ALA B 1 78  ? -61.057 18.396  -62.131 1.00 60.85  ? 62   ALA B CB  1 
ATOM   3299 N  N   . ALA B 1 79  ? -58.910 16.143  -63.389 1.00 57.54  ? 63   ALA B N   1 
ATOM   3300 C  CA  . ALA B 1 79  ? -57.598 15.873  -63.970 1.00 55.82  ? 63   ALA B CA  1 
ATOM   3301 C  C   . ALA B 1 79  ? -57.553 16.062  -65.481 1.00 58.86  ? 63   ALA B C   1 
ATOM   3302 O  O   . ALA B 1 79  ? -58.452 15.594  -66.189 1.00 60.10  ? 63   ALA B O   1 
ATOM   3303 C  CB  . ALA B 1 79  ? -57.151 14.463  -63.612 1.00 55.72  ? 63   ALA B CB  1 
ATOM   3304 N  N   . GLU B 1 80  ? -56.503 16.744  -65.980 1.00 52.64  ? 64   GLU B N   1 
ATOM   3305 C  CA  . GLU B 1 80  ? -56.302 16.920  -67.424 1.00 52.90  ? 64   GLU B CA  1 
ATOM   3306 C  C   . GLU B 1 80  ? -55.450 15.738  -67.893 1.00 54.68  ? 64   GLU B C   1 
ATOM   3307 O  O   . GLU B 1 80  ? -54.476 15.398  -67.203 1.00 52.90  ? 64   GLU B O   1 
ATOM   3308 C  CB  . GLU B 1 80  ? -55.639 18.260  -67.766 1.00 53.95  ? 64   GLU B CB  1 
ATOM   3309 C  CG  . GLU B 1 80  ? -56.576 19.448  -67.645 1.00 65.10  ? 64   GLU B CG  1 
ATOM   3310 C  CD  . GLU B 1 80  ? -56.711 19.982  -66.234 1.00 83.38  ? 64   GLU B CD  1 
ATOM   3311 O  OE1 . GLU B 1 80  ? -55.848 20.790  -65.822 1.00 75.29  ? 64   GLU B OE1 1 
ATOM   3312 O  OE2 . GLU B 1 80  ? -57.648 19.551  -65.523 1.00 75.54  ? 64   GLU B OE2 1 
ATOM   3313 N  N   . PRO B 1 81  ? -55.828 15.056  -69.002 1.00 50.67  ? 65   PRO B N   1 
ATOM   3314 C  CA  . PRO B 1 81  ? -55.085 13.852  -69.411 1.00 49.52  ? 65   PRO B CA  1 
ATOM   3315 C  C   . PRO B 1 81  ? -53.714 14.124  -70.009 1.00 51.57  ? 65   PRO B C   1 
ATOM   3316 O  O   . PRO B 1 81  ? -53.402 15.259  -70.381 1.00 51.62  ? 65   PRO B O   1 
ATOM   3317 C  CB  . PRO B 1 81  ? -56.020 13.207  -70.448 1.00 52.87  ? 65   PRO B CB  1 
ATOM   3318 C  CG  . PRO B 1 81  ? -56.745 14.342  -71.041 1.00 58.45  ? 65   PRO B CG  1 
ATOM   3319 C  CD  . PRO B 1 81  ? -56.973 15.305  -69.908 1.00 53.58  ? 65   PRO B CD  1 
ATOM   3320 N  N   . GLY B 1 82  ? -52.933 13.063  -70.141 1.00 47.37  ? 66   GLY B N   1 
ATOM   3321 C  CA  . GLY B 1 82  ? -51.611 13.141  -70.735 1.00 47.03  ? 66   GLY B CA  1 
ATOM   3322 C  C   . GLY B 1 82  ? -50.690 12.017  -70.337 1.00 48.73  ? 66   GLY B C   1 
ATOM   3323 O  O   . GLY B 1 82  ? -51.041 11.159  -69.522 1.00 47.60  ? 66   GLY B O   1 
ATOM   3324 N  N   . GLU B 1 83  ? -49.511 12.008  -70.947 1.00 45.49  ? 67   GLU B N   1 
ATOM   3325 C  CA  . GLU B 1 83  ? -48.489 10.991  -70.698 1.00 44.15  ? 67   GLU B CA  1 
ATOM   3326 C  C   . GLU B 1 83  ? -47.101 11.595  -70.706 1.00 45.96  ? 67   GLU B C   1 
ATOM   3327 O  O   . GLU B 1 83  ? -46.804 12.495  -71.508 1.00 46.10  ? 67   GLU B O   1 
ATOM   3328 C  CB  . GLU B 1 83  ? -48.618 9.744   -71.595 1.00 46.61  ? 67   GLU B CB  1 
ATOM   3329 C  CG  . GLU B 1 83  ? -49.018 9.976   -73.040 1.00 61.63  ? 67   GLU B CG  1 
ATOM   3330 C  CD  . GLU B 1 83  ? -49.089 8.698   -73.857 1.00 95.53  ? 67   GLU B CD  1 
ATOM   3331 O  OE1 . GLU B 1 83  ? -49.987 7.865   -73.592 1.00 91.25  ? 67   GLU B OE1 1 
ATOM   3332 O  OE2 . GLU B 1 83  ? -48.243 8.527   -74.765 1.00 94.99  ? 67   GLU B OE2 1 
ATOM   3333 N  N   . ILE B 1 84  ? -46.284 11.156  -69.738 1.00 39.26  ? 68   ILE B N   1 
ATOM   3334 C  CA  . ILE B 1 84  ? -44.933 11.652  -69.510 1.00 38.05  ? 68   ILE B CA  1 
ATOM   3335 C  C   . ILE B 1 84  ? -44.130 10.616  -68.710 1.00 39.65  ? 68   ILE B C   1 
ATOM   3336 O  O   . ILE B 1 84  ? -44.712 9.780   -68.008 1.00 39.76  ? 68   ILE B O   1 
ATOM   3337 C  CB  . ILE B 1 84  ? -45.013 13.021  -68.765 1.00 40.50  ? 68   ILE B CB  1 
ATOM   3338 C  CG1 . ILE B 1 84  ? -43.807 13.910  -69.089 1.00 42.19  ? 68   ILE B CG1 1 
ATOM   3339 C  CG2 . ILE B 1 84  ? -45.252 12.876  -67.242 1.00 39.30  ? 68   ILE B CG2 1 
ATOM   3340 N  N   . THR B 1 85  ? -42.801 10.670  -68.825 1.00 34.40  ? 69   THR B N   1 
ATOM   3341 C  CA  . THR B 1 85  ? -41.942 9.801   -68.021 1.00 33.38  ? 69   THR B CA  1 
ATOM   3342 C  C   . THR B 1 85  ? -41.106 10.731  -67.156 1.00 37.03  ? 69   THR B C   1 
ATOM   3343 O  O   . THR B 1 85  ? -40.755 11.838  -67.584 1.00 36.14  ? 69   THR B O   1 
ATOM   3344 C  CB  . THR B 1 85  ? -41.112 8.767   -68.819 1.00 36.24  ? 69   THR B CB  1 
ATOM   3345 O  OG1 . THR B 1 85  ? -39.898 9.366   -69.275 1.00 37.09  ? 69   THR B OG1 1 
ATOM   3346 C  CG2 . THR B 1 85  ? -41.889 8.081   -69.963 1.00 39.38  ? 69   THR B CG2 1 
ATOM   3347 N  N   . VAL B 1 86  ? -40.891 10.336  -65.909 1.00 34.01  ? 70   VAL B N   1 
ATOM   3348 C  CA  . VAL B 1 86  ? -40.121 11.110  -64.938 1.00 33.73  ? 70   VAL B CA  1 
ATOM   3349 C  C   . VAL B 1 86  ? -39.175 10.171  -64.138 1.00 35.45  ? 70   VAL B C   1 
ATOM   3350 O  O   . VAL B 1 86  ? -39.550 9.018   -63.916 1.00 32.12  ? 70   VAL B O   1 
ATOM   3351 C  CB  . VAL B 1 86  ? -41.020 11.979  -63.998 1.00 38.85  ? 70   VAL B CB  1 
ATOM   3352 C  CG1 . VAL B 1 86  ? -41.763 13.058  -64.770 1.00 40.65  ? 70   VAL B CG1 1 
ATOM   3353 C  CG2 . VAL B 1 86  ? -41.996 11.137  -63.182 1.00 37.67  ? 70   VAL B CG2 1 
ATOM   3354 N  N   . PRO B 1 87  ? -37.984 10.651  -63.672 1.00 33.97  ? 71   PRO B N   1 
ATOM   3355 C  CA  . PRO B 1 87  ? -37.106 9.799   -62.847 1.00 32.92  ? 71   PRO B CA  1 
ATOM   3356 C  C   . PRO B 1 87  ? -37.894 9.215   -61.670 1.00 34.17  ? 71   PRO B C   1 
ATOM   3357 O  O   . PRO B 1 87  ? -38.469 9.959   -60.869 1.00 31.48  ? 71   PRO B O   1 
ATOM   3358 C  CB  . PRO B 1 87  ? -36.015 10.774  -62.367 1.00 34.56  ? 71   PRO B CB  1 
ATOM   3359 C  CG  . PRO B 1 87  ? -36.003 11.850  -63.360 1.00 40.86  ? 71   PRO B CG  1 
ATOM   3360 C  CD  . PRO B 1 87  ? -37.406 11.999  -63.844 1.00 36.49  ? 71   PRO B CD  1 
ATOM   3361 N  N   . ALA B 1 88  ? -38.001 7.890   -61.652 1.00 31.34  ? 72   ALA B N   1 
ATOM   3362 C  CA  . ALA B 1 88  ? -38.775 7.121   -60.685 1.00 30.29  ? 72   ALA B CA  1 
ATOM   3363 C  C   . ALA B 1 88  ? -38.271 7.277   -59.260 1.00 30.79  ? 72   ALA B C   1 
ATOM   3364 O  O   . ALA B 1 88  ? -39.080 7.544   -58.366 1.00 28.18  ? 72   ALA B O   1 
ATOM   3365 C  CB  . ALA B 1 88  ? -38.791 5.652   -61.078 1.00 31.16  ? 72   ALA B CB  1 
ATOM   3366 N  N   . ARG B 1 89  ? -36.952 7.091   -59.043 1.00 27.95  ? 73   ARG B N   1 
ATOM   3367 C  CA  . ARG B 1 89  ? -36.353 7.210   -57.697 1.00 27.92  ? 73   ARG B CA  1 
ATOM   3368 C  C   . ARG B 1 89  ? -36.544 8.614   -57.112 1.00 28.94  ? 73   ARG B C   1 
ATOM   3369 O  O   . ARG B 1 89  ? -36.957 8.739   -55.951 1.00 25.58  ? 73   ARG B O   1 
ATOM   3370 C  CB  . ARG B 1 89  ? -34.871 6.756   -57.699 1.00 30.92  ? 73   ARG B CB  1 
ATOM   3371 C  CG  . ARG B 1 89  ? -34.154 6.816   -56.335 1.00 41.82  ? 73   ARG B CG  1 
ATOM   3372 C  CD  . ARG B 1 89  ? -34.821 6.006   -55.228 1.00 57.62  ? 73   ARG B CD  1 
ATOM   3373 N  NE  . ARG B 1 89  ? -33.841 5.331   -54.377 1.00 74.42  ? 73   ARG B NE  1 
ATOM   3374 C  CZ  . ARG B 1 89  ? -33.587 4.025   -54.411 1.00 91.10  ? 73   ARG B CZ  1 
ATOM   3375 N  NH1 . ARG B 1 89  ? -34.254 3.232   -55.242 1.00 77.58  ? 73   ARG B NH1 1 
ATOM   3376 N  NH2 . ARG B 1 89  ? -32.673 3.501   -53.605 1.00 80.12  ? 73   ARG B NH2 1 
ATOM   3377 N  N   . LYS B 1 90  ? -36.287 9.666   -57.923 1.00 26.18  ? 74   LYS B N   1 
ATOM   3378 C  CA  . LYS B 1 90  ? -36.470 11.059  -57.486 1.00 25.75  ? 74   LYS B CA  1 
ATOM   3379 C  C   . LYS B 1 90  ? -37.920 11.354  -57.124 1.00 26.77  ? 74   LYS B C   1 
ATOM   3380 O  O   . LYS B 1 90  ? -38.158 11.916  -56.061 1.00 24.57  ? 74   LYS B O   1 
ATOM   3381 C  CB  . LYS B 1 90  ? -35.949 12.063  -58.533 1.00 29.39  ? 74   LYS B CB  1 
ATOM   3382 C  CG  . LYS B 1 90  ? -34.442 12.217  -58.509 1.00 36.46  ? 74   LYS B CG  1 
ATOM   3383 C  CD  . LYS B 1 90  ? -33.948 13.128  -59.614 1.00 40.69  ? 74   LYS B CD  1 
ATOM   3384 C  CE  . LYS B 1 90  ? -32.452 13.247  -59.535 1.00 41.21  ? 74   LYS B CE  1 
ATOM   3385 N  NZ  . LYS B 1 90  ? -31.879 13.816  -60.783 1.00 46.31  ? 74   LYS B NZ  1 
ATOM   3386 N  N   . LEU B 1 91  ? -38.890 10.935  -57.973 1.00 25.91  ? 75   LEU B N   1 
ATOM   3387 C  CA  . LEU B 1 91  ? -40.310 11.167  -57.670 1.00 25.11  ? 75   LEU B CA  1 
ATOM   3388 C  C   . LEU B 1 91  ? -40.746 10.400  -56.417 1.00 26.08  ? 75   LEU B C   1 
ATOM   3389 O  O   . LEU B 1 91  ? -41.483 10.948  -55.596 1.00 23.26  ? 75   LEU B O   1 
ATOM   3390 C  CB  . LEU B 1 91  ? -41.229 10.855  -58.864 1.00 25.46  ? 75   LEU B CB  1 
ATOM   3391 C  CG  . LEU B 1 91  ? -42.704 11.265  -58.706 1.00 29.34  ? 75   LEU B CG  1 
ATOM   3392 C  CD1 . LEU B 1 91  ? -42.866 12.811  -58.666 1.00 30.64  ? 75   LEU B CD1 1 
ATOM   3393 C  CD2 . LEU B 1 91  ? -43.572 10.644  -59.796 1.00 33.09  ? 75   LEU B CD2 1 
ATOM   3394 N  N   . MET B 1 92  ? -40.287 9.146   -56.269 1.00 24.24  ? 76   MET B N   1 
ATOM   3395 C  CA  . MET B 1 92  ? -40.618 8.364   -55.068 1.00 22.91  ? 76   MET B CA  1 
ATOM   3396 C  C   . MET B 1 92  ? -40.040 9.055   -53.826 1.00 24.65  ? 76   MET B C   1 
ATOM   3397 O  O   . MET B 1 92  ? -40.764 9.226   -52.837 1.00 23.63  ? 76   MET B O   1 
ATOM   3398 C  CB  . MET B 1 92  ? -40.097 6.925   -55.169 1.00 24.67  ? 76   MET B CB  1 
ATOM   3399 C  CG  . MET B 1 92  ? -40.368 6.110   -53.899 1.00 28.20  ? 76   MET B CG  1 
ATOM   3400 S  SD  . MET B 1 92  ? -39.590 4.492   -54.010 1.00 32.90  ? 76   MET B SD  1 
ATOM   3401 N  N   . ASP B 1 93  ? -38.742 9.449   -53.874 1.00 22.20  ? 77   ASP B N   1 
ATOM   3402 C  CA  . ASP B 1 93  ? -38.093 10.119  -52.732 1.00 21.25  ? 77   ASP B CA  1 
ATOM   3403 C  C   . ASP B 1 93  ? -38.783 11.422  -52.350 1.00 23.75  ? 77   ASP B C   1 
ATOM   3404 O  O   . ASP B 1 93  ? -38.916 11.703  -51.172 1.00 21.82  ? 77   ASP B O   1 
ATOM   3405 C  CB  . ASP B 1 93  ? -36.593 10.362  -52.980 1.00 23.76  ? 77   ASP B CB  1 
ATOM   3406 C  CG  . ASP B 1 93  ? -35.740 9.101   -53.031 1.00 27.71  ? 77   ASP B CG  1 
ATOM   3407 O  OD1 . ASP B 1 93  ? -36.242 8.033   -52.653 1.00 27.48  ? 77   ASP B OD1 1 
ATOM   3408 O  OD2 . ASP B 1 93  ? -34.569 9.195   -53.453 1.00 31.71  ? 77   ASP B OD2 1 
ATOM   3409 N  N   . ILE B 1 94  ? -39.248 12.191  -53.341 1.00 21.10  ? 78   ILE B N   1 
ATOM   3410 C  CA  . ILE B 1 94  ? -39.960 13.446  -53.106 1.00 20.54  ? 78   ILE B CA  1 
ATOM   3411 C  C   . ILE B 1 94  ? -41.279 13.153  -52.387 1.00 23.06  ? 78   ILE B C   1 
ATOM   3412 O  O   . ILE B 1 94  ? -41.542 13.736  -51.336 1.00 21.20  ? 78   ILE B O   1 
ATOM   3413 C  CB  . ILE B 1 94  ? -40.142 14.260  -54.421 1.00 23.06  ? 78   ILE B CB  1 
ATOM   3414 C  CG1 . ILE B 1 94  ? -38.774 14.834  -54.872 1.00 23.33  ? 78   ILE B CG1 1 
ATOM   3415 C  CG2 . ILE B 1 94  ? -41.178 15.403  -54.208 1.00 23.29  ? 78   ILE B CG2 1 
ATOM   3416 C  CD1 . ILE B 1 94  ? -38.732 15.389  -56.292 1.00 26.97  ? 78   ILE B CD1 1 
ATOM   3417 N  N   . CYS B 1 95  ? -42.070 12.222  -52.929 1.00 23.14  ? 79   CYS B N   1 
ATOM   3418 C  CA  . CYS B 1 95  ? -43.357 11.830  -52.363 1.00 24.72  ? 79   CYS B CA  1 
ATOM   3419 C  C   . CYS B 1 95  ? -43.178 11.334  -50.908 1.00 25.30  ? 79   CYS B C   1 
ATOM   3420 O  O   . CYS B 1 95  ? -43.893 11.783  -50.007 1.00 23.54  ? 79   CYS B O   1 
ATOM   3421 C  CB  . CYS B 1 95  ? -44.017 10.766  -53.234 1.00 27.43  ? 79   CYS B CB  1 
ATOM   3422 S  SG  . CYS B 1 95  ? -45.712 10.364  -52.742 1.00 32.90  ? 79   CYS B SG  1 
ATOM   3423 N  N   . LYS B 1 96  ? -42.201 10.438  -50.695 1.00 22.71  ? 80   LYS B N   1 
ATOM   3424 C  CA  . LYS B 1 96  ? -41.877 9.875   -49.374 1.00 22.02  ? 80   LYS B CA  1 
ATOM   3425 C  C   . LYS B 1 96  ? -41.530 10.989  -48.358 1.00 24.13  ? 80   LYS B C   1 
ATOM   3426 O  O   . LYS B 1 96  ? -41.959 10.930  -47.201 1.00 22.56  ? 80   LYS B O   1 
ATOM   3427 C  CB  . LYS B 1 96  ? -40.680 8.932   -49.514 1.00 25.47  ? 80   LYS B CB  1 
ATOM   3428 C  CG  . LYS B 1 96  ? -40.554 7.891   -48.404 1.00 43.29  ? 80   LYS B CG  1 
ATOM   3429 C  CD  . LYS B 1 96  ? -40.495 6.465   -48.982 1.00 59.98  ? 80   LYS B CD  1 
ATOM   3430 C  CE  . LYS B 1 96  ? -39.177 6.078   -49.634 1.00 67.90  ? 80   LYS B CE  1 
ATOM   3431 N  NZ  . LYS B 1 96  ? -39.164 4.648   -50.060 1.00 66.44  ? 80   LYS B NZ  1 
ATOM   3432 N  N   . SER B 1 97  ? -40.727 11.974  -48.793 1.00 21.67  ? 81   SER B N   1 
ATOM   3433 C  CA  . SER B 1 97  ? -40.253 13.071  -47.946 1.00 21.43  ? 81   SER B CA  1 
ATOM   3434 C  C   . SER B 1 97  ? -41.329 14.087  -47.582 1.00 26.28  ? 81   SER B C   1 
ATOM   3435 O  O   . SER B 1 97  ? -41.122 14.878  -46.651 1.00 25.12  ? 81   SER B O   1 
ATOM   3436 C  CB  . SER B 1 97  ? -39.082 13.780  -48.623 1.00 23.81  ? 81   SER B CB  1 
ATOM   3437 O  OG  . SER B 1 97  ? -39.503 14.582  -49.719 1.00 27.99  ? 81   SER B OG  1 
ATOM   3438 N  N   . LEU B 1 98  ? -42.431 14.142  -48.364 1.00 22.24  ? 82   LEU B N   1 
ATOM   3439 C  CA  . LEU B 1 98  ? -43.474 15.144  -48.120 1.00 23.62  ? 82   LEU B CA  1 
ATOM   3440 C  C   . LEU B 1 98  ? -44.258 14.882  -46.833 1.00 29.25  ? 82   LEU B C   1 
ATOM   3441 O  O   . LEU B 1 98  ? -44.374 13.722  -46.446 1.00 27.67  ? 82   LEU B O   1 
ATOM   3442 C  CB  . LEU B 1 98  ? -44.419 15.309  -49.338 1.00 24.05  ? 82   LEU B CB  1 
ATOM   3443 C  CG  . LEU B 1 98  ? -43.806 16.000  -50.572 1.00 29.09  ? 82   LEU B CG  1 
ATOM   3444 C  CD1 . LEU B 1 98  ? -44.662 15.764  -51.810 1.00 30.86  ? 82   LEU B CD1 1 
ATOM   3445 C  CD2 . LEU B 1 98  ? -43.576 17.494  -50.349 1.00 32.69  ? 82   LEU B CD2 1 
ATOM   3446 N  N   . PRO B 1 99  ? -44.796 15.937  -46.161 1.00 30.41  ? 83   PRO B N   1 
ATOM   3447 C  CA  . PRO B 1 99  ? -45.591 15.704  -44.938 1.00 31.08  ? 83   PRO B CA  1 
ATOM   3448 C  C   . PRO B 1 99  ? -46.794 14.787  -45.175 1.00 36.77  ? 83   PRO B C   1 
ATOM   3449 O  O   . PRO B 1 99  ? -47.365 14.771  -46.277 1.00 36.11  ? 83   PRO B O   1 
ATOM   3450 C  CB  . PRO B 1 99  ? -46.067 17.106  -44.551 1.00 32.67  ? 83   PRO B CB  1 
ATOM   3451 C  CG  . PRO B 1 99  ? -45.141 18.042  -45.227 1.00 37.03  ? 83   PRO B CG  1 
ATOM   3452 C  CD  . PRO B 1 99  ? -44.751 17.375  -46.503 1.00 32.11  ? 83   PRO B CD  1 
ATOM   3453 N  N   . ASN B 1 100 ? -47.179 14.029  -44.132 1.00 33.93  ? 84   ASN B N   1 
ATOM   3454 C  CA  . ASN B 1 100 ? -48.308 13.091  -44.160 1.00 34.74  ? 84   ASN B CA  1 
ATOM   3455 C  C   . ASN B 1 100 ? -49.602 13.815  -44.511 1.00 37.92  ? 84   ASN B C   1 
ATOM   3456 O  O   . ASN B 1 100 ? -49.770 14.976  -44.146 1.00 36.47  ? 84   ASN B O   1 
ATOM   3457 C  CB  . ASN B 1 100 ? -48.469 12.398  -42.792 1.00 38.31  ? 84   ASN B CB  1 
ATOM   3458 C  CG  . ASN B 1 100 ? -47.252 11.635  -42.303 1.00 62.18  ? 84   ASN B CG  1 
ATOM   3459 O  OD1 . ASN B 1 100 ? -46.309 11.334  -43.049 1.00 54.08  ? 84   ASN B OD1 1 
ATOM   3460 N  ND2 . ASN B 1 100 ? -47.262 11.290  -41.023 1.00 55.02  ? 84   ASN B ND2 1 
ATOM   3461 N  N   . ASP B 1 101 ? -50.479 13.141  -45.272 1.00 36.52  ? 85   ASP B N   1 
ATOM   3462 C  CA  . ASP B 1 101 ? -51.801 13.622  -45.701 1.00 38.23  ? 85   ASP B CA  1 
ATOM   3463 C  C   . ASP B 1 101 ? -51.807 14.933  -46.520 1.00 42.72  ? 85   ASP B C   1 
ATOM   3464 O  O   . ASP B 1 101 ? -52.858 15.568  -46.608 1.00 45.85  ? 85   ASP B O   1 
ATOM   3465 C  CB  . ASP B 1 101 ? -52.784 13.717  -44.504 1.00 40.70  ? 85   ASP B CB  1 
ATOM   3466 C  CG  . ASP B 1 101 ? -52.719 12.573  -43.519 1.00 52.49  ? 85   ASP B CG  1 
ATOM   3467 O  OD1 . ASP B 1 101 ? -52.892 11.407  -43.947 1.00 53.88  ? 85   ASP B OD1 1 
ATOM   3468 O  OD2 . ASP B 1 101 ? -52.499 12.839  -42.319 1.00 59.69  ? 85   ASP B OD2 1 
ATOM   3469 N  N   . VAL B 1 102 ? -50.657 15.347  -47.106 1.00 35.45  ? 86   VAL B N   1 
ATOM   3470 C  CA  . VAL B 1 102 ? -50.612 16.566  -47.920 1.00 33.87  ? 86   VAL B CA  1 
ATOM   3471 C  C   . VAL B 1 102 ? -51.147 16.283  -49.336 1.00 35.72  ? 86   VAL B C   1 
ATOM   3472 O  O   . VAL B 1 102 ? -50.923 15.197  -49.882 1.00 34.48  ? 86   VAL B O   1 
ATOM   3473 C  CB  . VAL B 1 102 ? -49.219 17.274  -47.923 1.00 36.26  ? 86   VAL B CB  1 
ATOM   3474 C  CG1 . VAL B 1 102 ? -48.228 16.607  -48.880 1.00 35.22  ? 86   VAL B CG1 1 
ATOM   3475 C  CG2 . VAL B 1 102 ? -49.354 18.759  -48.242 1.00 36.38  ? 86   VAL B CG2 1 
ATOM   3476 N  N   . LEU B 1 103 ? -51.841 17.264  -49.916 1.00 32.85  ? 87   LEU B N   1 
ATOM   3477 C  CA  . LEU B 1 103 ? -52.351 17.174  -51.280 1.00 33.70  ? 87   LEU B CA  1 
ATOM   3478 C  C   . LEU B 1 103 ? -51.193 17.547  -52.222 1.00 36.14  ? 87   LEU B C   1 
ATOM   3479 O  O   . LEU B 1 103 ? -50.515 18.563  -52.009 1.00 36.51  ? 87   LEU B O   1 
ATOM   3480 C  CB  . LEU B 1 103 ? -53.560 18.120  -51.465 1.00 35.32  ? 87   LEU B CB  1 
ATOM   3481 C  CG  . LEU B 1 103 ? -54.350 18.021  -52.781 1.00 42.88  ? 87   LEU B CG  1 
ATOM   3482 C  CD1 . LEU B 1 103 ? -55.025 16.635  -52.941 1.00 44.58  ? 87   LEU B CD1 1 
ATOM   3483 C  CD2 . LEU B 1 103 ? -55.404 19.100  -52.846 1.00 46.86  ? 87   LEU B CD2 1 
ATOM   3484 N  N   . ILE B 1 104 ? -50.918 16.685  -53.211 1.00 30.53  ? 88   ILE B N   1 
ATOM   3485 C  CA  . ILE B 1 104 ? -49.846 16.935  -54.170 1.00 28.96  ? 88   ILE B CA  1 
ATOM   3486 C  C   . ILE B 1 104 ? -50.468 17.333  -55.507 1.00 33.89  ? 88   ILE B C   1 
ATOM   3487 O  O   . ILE B 1 104 ? -51.298 16.591  -56.042 1.00 36.04  ? 88   ILE B O   1 
ATOM   3488 C  CB  . ILE B 1 104 ? -48.891 15.707  -54.327 1.00 29.99  ? 88   ILE B CB  1 
ATOM   3489 C  CG1 . ILE B 1 104 ? -48.256 15.273  -52.982 1.00 28.28  ? 88   ILE B CG1 1 
ATOM   3490 C  CG2 . ILE B 1 104 ? -47.807 15.972  -55.389 1.00 29.16  ? 88   ILE B CG2 1 
ATOM   3491 C  CD1 . ILE B 1 104 ? -47.649 13.868  -53.034 1.00 28.09  ? 88   ILE B CD1 1 
ATOM   3492 N  N   . ASP B 1 105 ? -50.028 18.464  -56.061 1.00 29.40  ? 89   ASP B N   1 
ATOM   3493 C  CA  . ASP B 1 105 ? -50.471 18.962  -57.362 1.00 30.18  ? 89   ASP B CA  1 
ATOM   3494 C  C   . ASP B 1 105 ? -49.354 18.689  -58.367 1.00 34.44  ? 89   ASP B C   1 
ATOM   3495 O  O   . ASP B 1 105 ? -48.219 19.117  -58.158 1.00 35.16  ? 89   ASP B O   1 
ATOM   3496 C  CB  . ASP B 1 105 ? -50.785 20.462  -57.282 1.00 31.84  ? 89   ASP B CB  1 
ATOM   3497 C  CG  . ASP B 1 105 ? -51.321 21.037  -58.576 1.00 40.57  ? 89   ASP B CG  1 
ATOM   3498 O  OD1 . ASP B 1 105 ? -50.506 21.296  -59.496 1.00 40.06  ? 89   ASP B OD1 1 
ATOM   3499 O  OD2 . ASP B 1 105 ? -52.547 21.224  -58.672 1.00 43.55  ? 89   ASP B OD2 1 
ATOM   3500 N  N   . ILE B 1 106 ? -49.660 17.939  -59.425 1.00 30.85  ? 90   ILE B N   1 
ATOM   3501 C  CA  . ILE B 1 106 ? -48.670 17.579  -60.438 1.00 30.84  ? 90   ILE B CA  1 
ATOM   3502 C  C   . ILE B 1 106 ? -49.138 18.051  -61.804 1.00 36.71  ? 90   ILE B C   1 
ATOM   3503 O  O   . ILE B 1 106 ? -50.291 17.821  -62.184 1.00 36.02  ? 90   ILE B O   1 
ATOM   3504 C  CB  . ILE B 1 106 ? -48.318 16.061  -60.398 1.00 33.19  ? 90   ILE B CB  1 
ATOM   3505 C  CG1 . ILE B 1 106 ? -47.608 15.667  -59.079 1.00 31.53  ? 90   ILE B CG1 1 
ATOM   3506 C  CG2 . ILE B 1 106 ? -47.525 15.587  -61.632 1.00 34.25  ? 90   ILE B CG2 1 
ATOM   3507 C  CD1 . ILE B 1 106 ? -47.697 14.161  -58.749 1.00 32.60  ? 90   ILE B CD1 1 
ATOM   3508 N  N   . ARG B 1 107 ? -48.239 18.726  -62.531 1.00 35.45  ? 91   ARG B N   1 
ATOM   3509 C  CA  . ARG B 1 107 ? -48.510 19.198  -63.883 1.00 36.92  ? 91   ARG B CA  1 
ATOM   3510 C  C   . ARG B 1 107 ? -47.273 19.142  -64.763 1.00 40.75  ? 91   ARG B C   1 
ATOM   3511 O  O   . ARG B 1 107 ? -46.150 19.220  -64.266 1.00 39.03  ? 91   ARG B O   1 
ATOM   3512 C  CB  . ARG B 1 107 ? -49.169 20.604  -63.883 1.00 39.02  ? 91   ARG B CB  1 
ATOM   3513 C  CG  . ARG B 1 107 ? -48.239 21.768  -63.578 1.00 53.46  ? 91   ARG B CG  1 
ATOM   3514 C  CD  . ARG B 1 107 ? -48.979 23.096  -63.532 1.00 68.02  ? 91   ARG B CD  1 
ATOM   3515 N  NE  . ARG B 1 107 ? -49.547 23.362  -62.206 1.00 77.20  ? 91   ARG B NE  1 
ATOM   3516 C  CZ  . ARG B 1 107 ? -50.834 23.604  -61.971 1.00 91.61  ? 91   ARG B CZ  1 
ATOM   3517 N  NH1 . ARG B 1 107 ? -51.706 23.637  -62.973 1.00 84.55  ? 91   ARG B NH1 1 
ATOM   3518 N  NH2 . ARG B 1 107 ? -51.257 23.826  -60.733 1.00 71.15  ? 91   ARG B NH2 1 
ATOM   3519 N  N   . VAL B 1 108 ? -47.484 19.033  -66.078 1.00 39.50  ? 92   VAL B N   1 
ATOM   3520 C  CA  . VAL B 1 108 ? -46.406 19.010  -67.056 1.00 40.71  ? 92   VAL B CA  1 
ATOM   3521 C  C   . VAL B 1 108 ? -46.423 20.383  -67.717 1.00 48.02  ? 92   VAL B C   1 
ATOM   3522 O  O   . VAL B 1 108 ? -47.465 20.804  -68.220 1.00 49.12  ? 92   VAL B O   1 
ATOM   3523 C  CB  . VAL B 1 108 ? -46.539 17.860  -68.101 1.00 44.91  ? 92   VAL B CB  1 
ATOM   3524 C  CG1 . VAL B 1 108 ? -45.485 17.979  -69.206 1.00 45.00  ? 92   VAL B CG1 1 
ATOM   3525 C  CG2 . VAL B 1 108 ? -46.464 16.487  -67.437 1.00 43.70  ? 92   VAL B CG2 1 
ATOM   3526 N  N   . GLU B 1 109 ? -45.274 21.057  -67.727 1.00 46.21  ? 93   GLU B N   1 
ATOM   3527 C  CA  . GLU B 1 109 ? -45.102 22.374  -68.334 1.00 48.73  ? 93   GLU B CA  1 
ATOM   3528 C  C   . GLU B 1 109 ? -43.748 22.407  -69.039 1.00 54.07  ? 93   GLU B C   1 
ATOM   3529 O  O   . GLU B 1 109 ? -42.716 22.283  -68.375 1.00 53.04  ? 93   GLU B O   1 
ATOM   3530 C  CB  . GLU B 1 109 ? -45.194 23.470  -67.258 1.00 49.72  ? 93   GLU B CB  1 
ATOM   3531 C  CG  . GLU B 1 109 ? -46.440 24.334  -67.360 1.00 65.19  ? 93   GLU B CG  1 
ATOM   3532 C  CD  . GLU B 1 109 ? -46.512 25.433  -66.314 1.00 92.06  ? 93   GLU B CD  1 
ATOM   3533 O  OE1 . GLU B 1 109 ? -45.659 26.349  -66.349 1.00 88.33  ? 93   GLU B OE1 1 
ATOM   3534 O  OE2 . GLU B 1 109 ? -47.426 25.378  -65.459 1.00 89.10  ? 93   GLU B OE2 1 
ATOM   3535 N  N   . GLU B 1 110 ? -43.763 22.528  -70.386 1.00 52.98  ? 94   GLU B N   1 
ATOM   3536 C  CA  . GLU B 1 110 ? -42.589 22.579  -71.271 1.00 53.32  ? 94   GLU B CA  1 
ATOM   3537 C  C   . GLU B 1 110 ? -41.543 21.505  -70.963 1.00 53.85  ? 94   GLU B C   1 
ATOM   3538 O  O   . GLU B 1 110 ? -40.448 21.837  -70.499 1.00 52.16  ? 94   GLU B O   1 
ATOM   3539 N  N   . GLN B 1 111 ? -41.902 20.227  -71.174 1.00 49.47  ? 95   GLN B N   1 
ATOM   3540 C  CA  . GLN B 1 111 ? -41.056 19.045  -70.935 1.00 48.40  ? 95   GLN B CA  1 
ATOM   3541 C  C   . GLN B 1 111 ? -40.527 18.900  -69.482 1.00 47.60  ? 95   GLN B C   1 
ATOM   3542 O  O   . GLN B 1 111 ? -39.551 18.177  -69.245 1.00 45.68  ? 95   GLN B O   1 
ATOM   3543 C  CB  . GLN B 1 111 ? -39.929 18.932  -71.982 1.00 51.31  ? 95   GLN B CB  1 
ATOM   3544 N  N   . LYS B 1 112 ? -41.169 19.587  -68.518 1.00 43.04  ? 96   LYS B N   1 
ATOM   3545 C  CA  . LYS B 1 112 ? -40.791 19.504  -67.105 1.00 41.04  ? 96   LYS B CA  1 
ATOM   3546 C  C   . LYS B 1 112 ? -41.988 19.079  -66.259 1.00 41.93  ? 96   LYS B C   1 
ATOM   3547 O  O   . LYS B 1 112 ? -43.129 19.442  -66.566 1.00 42.79  ? 96   LYS B O   1 
ATOM   3548 C  CB  . LYS B 1 112 ? -40.207 20.846  -66.583 1.00 44.99  ? 96   LYS B CB  1 
ATOM   3549 C  CG  . LYS B 1 112 ? -38.939 21.335  -67.298 1.00 60.56  ? 96   LYS B CG  1 
ATOM   3550 C  CD  . LYS B 1 112 ? -37.682 20.552  -66.900 1.00 72.01  ? 96   LYS B CD  1 
ATOM   3551 C  CE  . LYS B 1 112 ? -36.504 20.852  -67.800 1.00 86.75  ? 96   LYS B CE  1 
ATOM   3552 N  NZ  . LYS B 1 112 ? -35.885 22.170  -67.488 1.00 100.22 ? 96   LYS B NZ  1 
ATOM   3553 N  N   . LEU B 1 113 ? -41.736 18.312  -65.205 1.00 34.53  ? 97   LEU B N   1 
ATOM   3554 C  CA  . LEU B 1 113 ? -42.809 17.924  -64.303 1.00 33.05  ? 97   LEU B CA  1 
ATOM   3555 C  C   . LEU B 1 113 ? -42.710 18.832  -63.084 1.00 33.79  ? 97   LEU B C   1 
ATOM   3556 O  O   . LEU B 1 113 ? -41.667 18.875  -62.437 1.00 33.04  ? 97   LEU B O   1 
ATOM   3557 C  CB  . LEU B 1 113 ? -42.742 16.451  -63.888 1.00 32.37  ? 97   LEU B CB  1 
ATOM   3558 C  CG  . LEU B 1 113 ? -44.022 15.931  -63.237 1.00 37.06  ? 97   LEU B CG  1 
ATOM   3559 C  CD1 . LEU B 1 113 ? -44.939 15.301  -64.278 1.00 39.12  ? 97   LEU B CD1 1 
ATOM   3560 C  CD2 . LEU B 1 113 ? -43.714 14.921  -62.141 1.00 39.97  ? 97   LEU B CD2 1 
ATOM   3561 N  N   . LEU B 1 114 ? -43.776 19.596  -62.826 1.00 30.91  ? 98   LEU B N   1 
ATOM   3562 C  CA  . LEU B 1 114 ? -43.896 20.550  -61.733 1.00 31.44  ? 98   LEU B CA  1 
ATOM   3563 C  C   . LEU B 1 114 ? -44.747 19.918  -60.635 1.00 34.75  ? 98   LEU B C   1 
ATOM   3564 O  O   . LEU B 1 114 ? -45.884 19.512  -60.875 1.00 34.21  ? 98   LEU B O   1 
ATOM   3565 C  CB  . LEU B 1 114 ? -44.501 21.881  -62.249 1.00 33.45  ? 98   LEU B CB  1 
ATOM   3566 C  CG  . LEU B 1 114 ? -43.530 22.898  -62.887 1.00 41.01  ? 98   LEU B CG  1 
ATOM   3567 C  CD1 . LEU B 1 114 ? -42.873 22.362  -64.142 1.00 43.02  ? 98   LEU B CD1 1 
ATOM   3568 C  CD2 . LEU B 1 114 ? -44.255 24.195  -63.252 1.00 47.00  ? 98   LEU B CD2 1 
ATOM   3569 N  N   . VAL B 1 115 ? -44.159 19.789  -59.442 1.00 31.34  ? 99   VAL B N   1 
ATOM   3570 C  CA  . VAL B 1 115 ? -44.771 19.158  -58.270 1.00 31.02  ? 99   VAL B CA  1 
ATOM   3571 C  C   . VAL B 1 115 ? -44.907 20.219  -57.170 1.00 34.98  ? 99   VAL B C   1 
ATOM   3572 O  O   . VAL B 1 115 ? -43.899 20.811  -56.764 1.00 32.92  ? 99   VAL B O   1 
ATOM   3573 C  CB  . VAL B 1 115 ? -43.933 17.929  -57.809 1.00 34.24  ? 99   VAL B CB  1 
ATOM   3574 C  CG1 . VAL B 1 115 ? -44.456 17.336  -56.493 1.00 32.75  ? 99   VAL B CG1 1 
ATOM   3575 C  CG2 . VAL B 1 115 ? -43.867 16.858  -58.896 1.00 35.01  ? 99   VAL B CG2 1 
ATOM   3576 N  N   . LYS B 1 116 ? -46.150 20.468  -56.713 1.00 31.52  ? 100  LYS B N   1 
ATOM   3577 C  CA  . LYS B 1 116 ? -46.431 21.424  -55.631 1.00 30.68  ? 100  LYS B CA  1 
ATOM   3578 C  C   . LYS B 1 116 ? -47.164 20.712  -54.490 1.00 32.05  ? 100  LYS B C   1 
ATOM   3579 O  O   . LYS B 1 116 ? -48.096 19.950  -54.741 1.00 33.17  ? 100  LYS B O   1 
ATOM   3580 C  CB  . LYS B 1 116 ? -47.265 22.623  -56.132 1.00 34.56  ? 100  LYS B CB  1 
ATOM   3581 C  CG  . LYS B 1 116 ? -46.582 23.469  -57.207 1.00 52.16  ? 100  LYS B CG  1 
ATOM   3582 C  CD  . LYS B 1 116 ? -47.421 24.684  -57.598 1.00 60.92  ? 100  LYS B CD  1 
ATOM   3583 N  N   . ALA B 1 117 ? -46.706 20.909  -53.249 1.00 25.37  ? 101  ALA B N   1 
ATOM   3584 C  CA  . ALA B 1 117 ? -47.330 20.332  -52.048 1.00 24.69  ? 101  ALA B CA  1 
ATOM   3585 C  C   . ALA B 1 117 ? -47.007 21.243  -50.862 1.00 29.66  ? 101  ALA B C   1 
ATOM   3586 O  O   . ALA B 1 117 ? -45.830 21.437  -50.537 1.00 28.18  ? 101  ALA B O   1 
ATOM   3587 C  CB  . ALA B 1 117 ? -46.828 18.916  -51.802 1.00 24.74  ? 101  ALA B CB  1 
ATOM   3588 N  N   . GLY B 1 118 ? -48.046 21.839  -50.273 1.00 26.51  ? 102  GLY B N   1 
ATOM   3589 C  CA  . GLY B 1 118 ? -47.895 22.788  -49.177 1.00 26.16  ? 102  GLY B CA  1 
ATOM   3590 C  C   . GLY B 1 118 ? -47.044 23.959  -49.629 1.00 29.16  ? 102  GLY B C   1 
ATOM   3591 O  O   . GLY B 1 118 ? -47.318 24.556  -50.670 1.00 29.06  ? 102  GLY B O   1 
ATOM   3592 N  N   . ARG B 1 119 ? -45.933 24.214  -48.912 1.00 26.73  ? 103  ARG B N   1 
ATOM   3593 C  CA  . ARG B 1 119 ? -44.996 25.296  -49.248 1.00 27.56  ? 103  ARG B CA  1 
ATOM   3594 C  C   . ARG B 1 119 ? -43.790 24.790  -50.099 1.00 30.45  ? 103  ARG B C   1 
ATOM   3595 O  O   . ARG B 1 119 ? -42.797 25.509  -50.231 1.00 29.34  ? 103  ARG B O   1 
ATOM   3596 C  CB  . ARG B 1 119 ? -44.492 25.964  -47.936 1.00 29.64  ? 103  ARG B CB  1 
ATOM   3597 C  CG  . ARG B 1 119 ? -45.544 26.834  -47.244 1.00 40.20  ? 103  ARG B CG  1 
ATOM   3598 C  CD  . ARG B 1 119 ? -45.267 28.306  -47.458 1.00 52.97  ? 103  ARG B CD  1 
ATOM   3599 N  NE  . ARG B 1 119 ? -45.564 29.090  -46.263 1.00 52.86  ? 103  ARG B NE  1 
ATOM   3600 C  CZ  . ARG B 1 119 ? -45.207 30.357  -46.088 1.00 63.30  ? 103  ARG B CZ  1 
ATOM   3601 N  NH1 . ARG B 1 119 ? -44.530 31.002  -47.032 1.00 38.28  ? 103  ARG B NH1 1 
ATOM   3602 N  NH2 . ARG B 1 119 ? -45.518 30.989  -44.966 1.00 61.36  ? 103  ARG B NH2 1 
ATOM   3603 N  N   . SER B 1 120 ? -43.860 23.539  -50.611 1.00 26.33  ? 104  SER B N   1 
ATOM   3604 C  CA  . SER B 1 120 ? -42.786 22.907  -51.386 1.00 25.78  ? 104  SER B CA  1 
ATOM   3605 C  C   . SER B 1 120 ? -43.096 22.916  -52.877 1.00 29.43  ? 104  SER B C   1 
ATOM   3606 O  O   . SER B 1 120 ? -44.258 22.757  -53.275 1.00 28.61  ? 104  SER B O   1 
ATOM   3607 C  CB  . SER B 1 120 ? -42.562 21.459  -50.941 1.00 26.63  ? 104  SER B CB  1 
ATOM   3608 O  OG  . SER B 1 120 ? -42.244 21.350  -49.565 1.00 34.80  ? 104  SER B OG  1 
ATOM   3609 N  N   . ARG B 1 121 ? -42.042 23.094  -53.693 1.00 25.70  ? 105  ARG B N   1 
ATOM   3610 C  CA  . ARG B 1 121 ? -42.107 23.087  -55.153 1.00 27.43  ? 105  ARG B CA  1 
ATOM   3611 C  C   . ARG B 1 121 ? -40.926 22.282  -55.715 1.00 29.86  ? 105  ARG B C   1 
ATOM   3612 O  O   . ARG B 1 121 ? -39.799 22.416  -55.235 1.00 29.28  ? 105  ARG B O   1 
ATOM   3613 C  CB  . ARG B 1 121 ? -42.095 24.526  -55.723 1.00 29.50  ? 105  ARG B CB  1 
ATOM   3614 C  CG  . ARG B 1 121 ? -43.410 25.285  -55.539 1.00 46.71  ? 105  ARG B CG  1 
ATOM   3615 C  CD  . ARG B 1 121 ? -43.275 26.762  -55.878 1.00 65.58  ? 105  ARG B CD  1 
ATOM   3616 N  NE  . ARG B 1 121 ? -43.076 26.985  -57.313 1.00 83.78  ? 105  ARG B NE  1 
ATOM   3617 C  CZ  . ARG B 1 121 ? -44.014 27.426  -58.146 1.00 101.93 ? 105  ARG B CZ  1 
ATOM   3618 N  NH1 . ARG B 1 121 ? -45.229 27.721  -57.696 1.00 86.24  ? 105  ARG B NH1 1 
ATOM   3619 N  NH2 . ARG B 1 121 ? -43.743 27.585  -59.434 1.00 93.96  ? 105  ARG B NH2 1 
ATOM   3620 N  N   . PHE B 1 122 ? -41.184 21.457  -56.731 1.00 26.06  ? 106  PHE B N   1 
ATOM   3621 C  CA  . PHE B 1 122 ? -40.150 20.651  -57.385 1.00 25.01  ? 106  PHE B CA  1 
ATOM   3622 C  C   . PHE B 1 122 ? -40.366 20.694  -58.895 1.00 30.36  ? 106  PHE B C   1 
ATOM   3623 O  O   . PHE B 1 122 ? -41.501 20.644  -59.355 1.00 30.63  ? 106  PHE B O   1 
ATOM   3624 C  CB  . PHE B 1 122 ? -40.188 19.181  -56.912 1.00 24.80  ? 106  PHE B CB  1 
ATOM   3625 C  CG  . PHE B 1 122 ? -40.099 19.004  -55.413 1.00 24.17  ? 106  PHE B CG  1 
ATOM   3626 C  CD1 . PHE B 1 122 ? -41.239 19.066  -54.619 1.00 26.37  ? 106  PHE B CD1 1 
ATOM   3627 C  CD2 . PHE B 1 122 ? -38.877 18.770  -54.797 1.00 25.14  ? 106  PHE B CD2 1 
ATOM   3628 C  CE1 . PHE B 1 122 ? -41.152 18.923  -53.229 1.00 25.99  ? 106  PHE B CE1 1 
ATOM   3629 C  CE2 . PHE B 1 122 ? -38.791 18.621  -53.407 1.00 26.48  ? 106  PHE B CE2 1 
ATOM   3630 C  CZ  . PHE B 1 122 ? -39.930 18.693  -52.637 1.00 24.30  ? 106  PHE B CZ  1 
ATOM   3631 N  N   . THR B 1 123 ? -39.275 20.802  -59.649 1.00 27.21  ? 107  THR B N   1 
ATOM   3632 C  CA  . THR B 1 123 ? -39.275 20.771  -61.113 1.00 27.53  ? 107  THR B CA  1 
ATOM   3633 C  C   . THR B 1 123 ? -38.371 19.601  -61.512 1.00 31.98  ? 107  THR B C   1 
ATOM   3634 O  O   . THR B 1 123 ? -37.185 19.622  -61.192 1.00 31.39  ? 107  THR B O   1 
ATOM   3635 C  CB  . THR B 1 123 ? -38.820 22.115  -61.707 1.00 34.28  ? 107  THR B CB  1 
ATOM   3636 O  OG1 . THR B 1 123 ? -39.645 23.156  -61.192 1.00 34.86  ? 107  THR B OG1 1 
ATOM   3637 C  CG2 . THR B 1 123 ? -38.883 22.125  -63.230 1.00 36.14  ? 107  THR B CG2 1 
ATOM   3638 N  N   . LEU B 1 124 ? -38.945 18.563  -62.145 1.00 29.66  ? 108  LEU B N   1 
ATOM   3639 C  CA  . LEU B 1 124 ? -38.219 17.362  -62.572 1.00 29.14  ? 108  LEU B CA  1 
ATOM   3640 C  C   . LEU B 1 124 ? -38.047 17.319  -64.084 1.00 33.67  ? 108  LEU B C   1 
ATOM   3641 O  O   . LEU B 1 124 ? -38.930 17.761  -64.822 1.00 31.11  ? 108  LEU B O   1 
ATOM   3642 C  CB  . LEU B 1 124 ? -38.922 16.073  -62.098 1.00 29.14  ? 108  LEU B CB  1 
ATOM   3643 C  CG  . LEU B 1 124 ? -39.029 15.850  -60.585 1.00 32.58  ? 108  LEU B CG  1 
ATOM   3644 C  CD1 . LEU B 1 124 ? -39.781 14.562  -60.284 1.00 33.77  ? 108  LEU B CD1 1 
ATOM   3645 C  CD2 . LEU B 1 124 ? -37.665 15.765  -59.953 1.00 36.30  ? 108  LEU B CD2 1 
ATOM   3646 N  N   . SER B 1 125 ? -36.914 16.751  -64.546 1.00 33.98  ? 109  SER B N   1 
ATOM   3647 C  CA  . SER B 1 125 ? -36.662 16.591  -65.979 1.00 36.36  ? 109  SER B CA  1 
ATOM   3648 C  C   . SER B 1 125 ? -37.528 15.431  -66.448 1.00 39.24  ? 109  SER B C   1 
ATOM   3649 O  O   . SER B 1 125 ? -37.881 14.558  -65.642 1.00 36.53  ? 109  SER B O   1 
ATOM   3650 C  CB  . SER B 1 125 ? -35.180 16.341  -66.256 1.00 42.23  ? 109  SER B CB  1 
ATOM   3651 O  OG  . SER B 1 125 ? -34.784 15.009  -65.965 1.00 55.69  ? 109  SER B OG  1 
ATOM   3652 N  N   . THR B 1 126 ? -37.942 15.455  -67.719 1.00 36.60  ? 110  THR B N   1 
ATOM   3653 C  CA  . THR B 1 126 ? -38.807 14.405  -68.240 1.00 35.78  ? 110  THR B CA  1 
ATOM   3654 C  C   . THR B 1 126 ? -38.234 13.831  -69.523 1.00 40.32  ? 110  THR B C   1 
ATOM   3655 O  O   . THR B 1 126 ? -37.371 14.450  -70.162 1.00 40.40  ? 110  THR B O   1 
ATOM   3656 C  CB  . THR B 1 126 ? -40.254 14.927  -68.501 1.00 40.86  ? 110  THR B CB  1 
ATOM   3657 O  OG1 . THR B 1 126 ? -40.297 15.759  -69.671 1.00 45.99  ? 110  THR B OG1 1 
ATOM   3658 C  CG2 . THR B 1 126 ? -40.898 15.615  -67.302 1.00 38.37  ? 110  THR B CG2 1 
ATOM   3659 N  N   . LEU B 1 127 ? -38.754 12.669  -69.920 1.00 37.58  ? 111  LEU B N   1 
ATOM   3660 C  CA  . LEU B 1 127 ? -38.459 12.060  -71.222 1.00 39.44  ? 111  LEU B CA  1 
ATOM   3661 C  C   . LEU B 1 127 ? -39.808 11.656  -71.832 1.00 44.66  ? 111  LEU B C   1 
ATOM   3662 O  O   . LEU B 1 127 ? -40.702 11.267  -71.078 1.00 43.12  ? 111  LEU B O   1 
ATOM   3663 C  CB  . LEU B 1 127 ? -37.489 10.866  -71.110 1.00 39.58  ? 111  LEU B CB  1 
ATOM   3664 C  CG  . LEU B 1 127 ? -36.069 11.184  -70.603 1.00 43.58  ? 111  LEU B CG  1 
ATOM   3665 C  CD1 . LEU B 1 127 ? -35.339 9.912   -70.195 1.00 43.41  ? 111  LEU B CD1 1 
ATOM   3666 C  CD2 . LEU B 1 127 ? -35.264 12.003  -71.628 1.00 45.13  ? 111  LEU B CD2 1 
ATOM   3667 N  N   . PRO B 1 128 ? -40.012 11.797  -73.168 1.00 44.21  ? 112  PRO B N   1 
ATOM   3668 C  CA  . PRO B 1 128 ? -41.327 11.481  -73.759 1.00 44.63  ? 112  PRO B CA  1 
ATOM   3669 C  C   . PRO B 1 128 ? -41.855 10.078  -73.499 1.00 47.07  ? 112  PRO B C   1 
ATOM   3670 O  O   . PRO B 1 128 ? -41.086 9.114   -73.487 1.00 45.96  ? 112  PRO B O   1 
ATOM   3671 C  CB  . PRO B 1 128 ? -41.110 11.725  -75.262 1.00 48.56  ? 112  PRO B CB  1 
ATOM   3672 C  CG  . PRO B 1 128 ? -40.002 12.702  -75.320 1.00 53.62  ? 112  PRO B CG  1 
ATOM   3673 C  CD  . PRO B 1 128 ? -39.083 12.310  -74.194 1.00 47.39  ? 112  PRO B CD  1 
ATOM   3674 N  N   . ALA B 1 129 ? -43.185 9.969   -73.338 1.00 44.01  ? 113  ALA B N   1 
ATOM   3675 C  CA  . ALA B 1 129 ? -43.894 8.703   -73.129 1.00 44.36  ? 113  ALA B CA  1 
ATOM   3676 C  C   . ALA B 1 129 ? -43.776 7.757   -74.339 1.00 51.46  ? 113  ALA B C   1 
ATOM   3677 O  O   . ALA B 1 129 ? -43.899 6.538   -74.177 1.00 48.61  ? 113  ALA B O   1 
ATOM   3678 C  CB  . ALA B 1 129 ? -45.351 8.975   -72.820 1.00 45.41  ? 113  ALA B CB  1 
ATOM   3679 N  N   . ASN B 1 130 ? -43.511 8.320   -75.544 1.00 52.25  ? 114  ASN B N   1 
ATOM   3680 C  CA  . ASN B 1 130 ? -43.339 7.528   -76.771 1.00 54.90  ? 114  ASN B CA  1 
ATOM   3681 C  C   . ASN B 1 130 ? -42.078 6.640   -76.737 1.00 59.60  ? 114  ASN B C   1 
ATOM   3682 O  O   . ASN B 1 130 ? -42.056 5.605   -77.396 1.00 60.44  ? 114  ASN B O   1 
ATOM   3683 C  CB  . ASN B 1 130 ? -43.400 8.400   -78.043 1.00 61.03  ? 114  ASN B CB  1 
ATOM   3684 C  CG  . ASN B 1 130 ? -42.712 9.741   -77.937 1.00 96.97  ? 114  ASN B CG  1 
ATOM   3685 O  OD1 . ASN B 1 130 ? -41.512 9.878   -78.197 1.00 95.70  ? 114  ASN B OD1 1 
ATOM   3686 N  ND2 . ASN B 1 130 ? -43.469 10.768  -77.575 1.00 90.72  ? 114  ASN B ND2 1 
ATOM   3687 N  N   . ASP B 1 131 ? -41.056 7.031   -75.943 1.00 55.64  ? 115  ASP B N   1 
ATOM   3688 C  CA  . ASP B 1 131 ? -39.797 6.294   -75.757 1.00 55.48  ? 115  ASP B CA  1 
ATOM   3689 C  C   . ASP B 1 131 ? -40.000 5.072   -74.835 1.00 56.84  ? 115  ASP B C   1 
ATOM   3690 O  O   . ASP B 1 131 ? -39.170 4.157   -74.839 1.00 56.96  ? 115  ASP B O   1 
ATOM   3691 C  CB  . ASP B 1 131 ? -38.733 7.207   -75.098 1.00 56.87  ? 115  ASP B CB  1 
ATOM   3692 C  CG  . ASP B 1 131 ? -38.352 8.497   -75.812 1.00 69.64  ? 115  ASP B CG  1 
ATOM   3693 O  OD1 . ASP B 1 131 ? -38.913 8.769   -76.897 1.00 72.30  ? 115  ASP B OD1 1 
ATOM   3694 O  OD2 . ASP B 1 131 ? -37.486 9.233   -75.284 1.00 71.66  ? 115  ASP B OD2 1 
ATOM   3695 N  N   . PHE B 1 132 ? -41.076 5.081   -74.026 1.00 50.50  ? 116  PHE B N   1 
ATOM   3696 C  CA  . PHE B 1 132 ? -41.375 4.037   -73.041 1.00 48.49  ? 116  PHE B CA  1 
ATOM   3697 C  C   . PHE B 1 132 ? -41.946 2.757   -73.672 1.00 55.64  ? 116  PHE B C   1 
ATOM   3698 O  O   . PHE B 1 132 ? -42.905 2.838   -74.435 1.00 57.27  ? 116  PHE B O   1 
ATOM   3699 C  CB  . PHE B 1 132 ? -42.291 4.578   -71.936 1.00 47.68  ? 116  PHE B CB  1 
ATOM   3700 C  CG  . PHE B 1 132 ? -42.171 3.832   -70.630 1.00 46.22  ? 116  PHE B CG  1 
ATOM   3701 C  CD1 . PHE B 1 132 ? -42.960 2.715   -70.374 1.00 48.16  ? 116  PHE B CD1 1 
ATOM   3702 C  CD2 . PHE B 1 132 ? -41.268 4.243   -69.655 1.00 45.61  ? 116  PHE B CD2 1 
ATOM   3703 C  CE1 . PHE B 1 132 ? -42.837 2.015   -69.167 1.00 46.99  ? 116  PHE B CE1 1 
ATOM   3704 C  CE2 . PHE B 1 132 ? -41.157 3.552   -68.444 1.00 46.68  ? 116  PHE B CE2 1 
ATOM   3705 C  CZ  . PHE B 1 132 ? -41.938 2.441   -68.210 1.00 44.45  ? 116  PHE B CZ  1 
ATOM   3706 N  N   . PRO B 1 133 ? -41.377 1.569   -73.365 1.00 53.51  ? 117  PRO B N   1 
ATOM   3707 C  CA  . PRO B 1 133 ? -41.880 0.322   -73.997 1.00 57.79  ? 117  PRO B CA  1 
ATOM   3708 C  C   . PRO B 1 133 ? -43.291 -0.096  -73.585 1.00 84.66  ? 117  PRO B C   1 
ATOM   3709 O  O   . PRO B 1 133 ? -43.693 0.105   -72.442 1.00 48.68  ? 117  PRO B O   1 
ATOM   3710 C  CB  . PRO B 1 133 ? -40.845 -0.741  -73.603 1.00 58.41  ? 117  PRO B CB  1 
ATOM   3711 C  CG  . PRO B 1 133 ? -39.708 -0.007  -72.972 1.00 60.88  ? 117  PRO B CG  1 
ATOM   3712 C  CD  . PRO B 1 133 ? -40.230 1.302   -72.472 1.00 54.88  ? 117  PRO B CD  1 
ATOM   3713 N  N   . GLY B 1 138 ? -49.660 -11.321 -75.498 1.00 80.84  ? 122  GLY B N   1 
ATOM   3714 C  CA  . GLY B 1 138 ? -50.384 -12.280 -76.320 1.00 82.27  ? 122  GLY B CA  1 
ATOM   3715 C  C   . GLY B 1 138 ? -51.530 -12.983 -75.610 1.00 85.86  ? 122  GLY B C   1 
ATOM   3716 O  O   . GLY B 1 138 ? -51.729 -12.776 -74.408 1.00 83.97  ? 122  GLY B O   1 
ATOM   3717 N  N   . PRO B 1 139 ? -52.307 -13.840 -76.328 1.00 83.60  ? 123  PRO B N   1 
ATOM   3718 C  CA  . PRO B 1 139 ? -53.433 -14.539 -75.678 1.00 83.04  ? 123  PRO B CA  1 
ATOM   3719 C  C   . PRO B 1 139 ? -52.997 -15.536 -74.605 1.00 84.51  ? 123  PRO B C   1 
ATOM   3720 O  O   . PRO B 1 139 ? -51.953 -16.181 -74.734 1.00 83.56  ? 123  PRO B O   1 
ATOM   3721 C  CB  . PRO B 1 139 ? -54.145 -15.241 -76.844 1.00 86.99  ? 123  PRO B CB  1 
ATOM   3722 C  CG  . PRO B 1 139 ? -53.627 -14.583 -78.083 1.00 92.94  ? 123  PRO B CG  1 
ATOM   3723 C  CD  . PRO B 1 139 ? -52.223 -14.195 -77.758 1.00 87.12  ? 123  PRO B CD  1 
ATOM   3724 N  N   . GLY B 1 140 ? -53.804 -15.633 -73.552 1.00 79.61  ? 124  GLY B N   1 
ATOM   3725 C  CA  . GLY B 1 140 ? -53.557 -16.517 -72.421 1.00 77.32  ? 124  GLY B CA  1 
ATOM   3726 C  C   . GLY B 1 140 ? -54.035 -17.931 -72.661 1.00 80.80  ? 124  GLY B C   1 
ATOM   3727 O  O   . GLY B 1 140 ? -55.204 -18.145 -72.996 1.00 82.14  ? 124  GLY B O   1 
ATOM   3728 N  N   . SER B 1 141 ? -53.120 -18.899 -72.502 1.00 74.91  ? 125  SER B N   1 
ATOM   3729 C  CA  . SER B 1 141 ? -53.387 -20.329 -72.666 1.00 74.51  ? 125  SER B CA  1 
ATOM   3730 C  C   . SER B 1 141 ? -54.239 -20.848 -71.506 1.00 74.52  ? 125  SER B C   1 
ATOM   3731 O  O   . SER B 1 141 ? -55.074 -21.735 -71.704 1.00 74.87  ? 125  SER B O   1 
ATOM   3732 C  CB  . SER B 1 141 ? -52.078 -21.110 -72.745 1.00 77.85  ? 125  SER B CB  1 
ATOM   3733 O  OG  . SER B 1 141 ? -51.316 -20.733 -73.880 1.00 89.39  ? 125  SER B OG  1 
ATOM   3734 N  N   . LEU B 1 142 ? -54.028 -20.285 -70.299 1.00 66.91  ? 126  LEU B N   1 
ATOM   3735 C  CA  . LEU B 1 142 ? -54.752 -20.657 -69.087 1.00 64.70  ? 126  LEU B CA  1 
ATOM   3736 C  C   . LEU B 1 142 ? -54.981 -19.452 -68.175 1.00 64.66  ? 126  LEU B C   1 
ATOM   3737 O  O   . LEU B 1 142 ? -54.075 -18.641 -67.988 1.00 63.22  ? 126  LEU B O   1 
ATOM   3738 C  CB  . LEU B 1 142 ? -54.000 -21.776 -68.346 1.00 63.37  ? 126  LEU B CB  1 
ATOM   3739 C  CG  . LEU B 1 142 ? -54.713 -22.409 -67.159 1.00 67.59  ? 126  LEU B CG  1 
ATOM   3740 C  CD1 . LEU B 1 142 ? -55.647 -23.523 -67.604 1.00 69.26  ? 126  LEU B CD1 1 
ATOM   3741 C  CD2 . LEU B 1 142 ? -53.717 -22.929 -66.166 1.00 68.16  ? 126  LEU B CD2 1 
ATOM   3742 N  N   . ASN B 1 143 ? -56.195 -19.352 -67.603 1.00 59.25  ? 127  ASN B N   1 
ATOM   3743 C  CA  . ASN B 1 143 ? -56.591 -18.275 -66.698 1.00 57.45  ? 127  ASN B CA  1 
ATOM   3744 C  C   . ASN B 1 143 ? -57.224 -18.849 -65.432 1.00 58.64  ? 127  ASN B C   1 
ATOM   3745 O  O   . ASN B 1 143 ? -58.126 -19.690 -65.519 1.00 59.03  ? 127  ASN B O   1 
ATOM   3746 C  CB  . ASN B 1 143 ? -57.571 -17.300 -67.383 1.00 60.81  ? 127  ASN B CB  1 
ATOM   3747 C  CG  . ASN B 1 143 ? -57.253 -16.967 -68.822 1.00 87.96  ? 127  ASN B CG  1 
ATOM   3748 O  OD1 . ASN B 1 143 ? -58.031 -17.256 -69.732 1.00 88.62  ? 127  ASN B OD1 1 
ATOM   3749 N  ND2 . ASN B 1 143 ? -56.101 -16.368 -69.067 1.00 79.84  ? 127  ASN B ND2 1 
ATOM   3750 N  N   . PHE B 1 144 ? -56.762 -18.390 -64.258 1.00 51.72  ? 128  PHE B N   1 
ATOM   3751 C  CA  . PHE B 1 144 ? -57.295 -18.835 -62.968 1.00 49.84  ? 128  PHE B CA  1 
ATOM   3752 C  C   . PHE B 1 144 ? -57.137 -17.775 -61.882 1.00 54.26  ? 128  PHE B C   1 
ATOM   3753 O  O   . PHE B 1 144 ? -56.351 -16.841 -62.045 1.00 52.84  ? 128  PHE B O   1 
ATOM   3754 C  CB  . PHE B 1 144 ? -56.663 -20.178 -62.535 1.00 49.53  ? 128  PHE B CB  1 
ATOM   3755 C  CG  . PHE B 1 144 ? -55.190 -20.136 -62.191 1.00 47.98  ? 128  PHE B CG  1 
ATOM   3756 C  CD1 . PHE B 1 144 ? -54.224 -20.364 -63.164 1.00 49.69  ? 128  PHE B CD1 1 
ATOM   3757 C  CD2 . PHE B 1 144 ? -54.770 -19.917 -60.881 1.00 47.29  ? 128  PHE B CD2 1 
ATOM   3758 C  CE1 . PHE B 1 144 ? -52.862 -20.355 -62.838 1.00 48.42  ? 128  PHE B CE1 1 
ATOM   3759 C  CE2 . PHE B 1 144 ? -53.409 -19.905 -60.558 1.00 47.80  ? 128  PHE B CE2 1 
ATOM   3760 C  CZ  . PHE B 1 144 ? -52.466 -20.131 -61.536 1.00 45.65  ? 128  PHE B CZ  1 
ATOM   3761 N  N   . SER B 1 145 ? -57.863 -17.942 -60.762 1.00 51.94  ? 129  SER B N   1 
ATOM   3762 C  CA  . SER B 1 145 ? -57.791 -17.042 -59.613 1.00 50.98  ? 129  SER B CA  1 
ATOM   3763 C  C   . SER B 1 145 ? -57.334 -17.817 -58.387 1.00 51.89  ? 129  SER B C   1 
ATOM   3764 O  O   . SER B 1 145 ? -57.820 -18.920 -58.132 1.00 51.26  ? 129  SER B O   1 
ATOM   3765 C  CB  . SER B 1 145 ? -59.133 -16.358 -59.362 1.00 56.64  ? 129  SER B CB  1 
ATOM   3766 O  OG  . SER B 1 145 ? -59.043 -15.452 -58.274 1.00 66.51  ? 129  SER B OG  1 
ATOM   3767 N  N   . ILE B 1 146 ? -56.384 -17.244 -57.639 1.00 45.99  ? 130  ILE B N   1 
ATOM   3768 C  CA  . ILE B 1 146 ? -55.832 -17.876 -56.445 1.00 43.71  ? 130  ILE B CA  1 
ATOM   3769 C  C   . ILE B 1 146 ? -55.712 -16.868 -55.303 1.00 46.24  ? 130  ILE B C   1 
ATOM   3770 O  O   . ILE B 1 146 ? -55.552 -15.665 -55.552 1.00 45.12  ? 130  ILE B O   1 
ATOM   3771 C  CB  . ILE B 1 146 ? -54.488 -18.607 -56.792 1.00 45.95  ? 130  ILE B CB  1 
ATOM   3772 C  CG1 . ILE B 1 146 ? -54.035 -19.579 -55.673 1.00 45.59  ? 130  ILE B CG1 1 
ATOM   3773 C  CG2 . ILE B 1 146 ? -53.359 -17.632 -57.215 1.00 46.12  ? 130  ILE B CG2 1 
ATOM   3774 C  CD1 . ILE B 1 146 ? -53.103 -20.698 -56.100 1.00 46.51  ? 130  ILE B CD1 1 
ATOM   3775 N  N   . ALA B 1 147 ? -55.796 -17.353 -54.047 1.00 42.87  ? 131  ALA B N   1 
ATOM   3776 C  CA  . ALA B 1 147 ? -55.574 -16.499 -52.879 1.00 41.80  ? 131  ALA B CA  1 
ATOM   3777 C  C   . ALA B 1 147 ? -54.086 -16.111 -52.929 1.00 43.46  ? 131  ALA B C   1 
ATOM   3778 O  O   . ALA B 1 147 ? -53.243 -16.957 -53.267 1.00 40.72  ? 131  ALA B O   1 
ATOM   3779 C  CB  . ALA B 1 147 ? -55.889 -17.258 -51.596 1.00 42.28  ? 131  ALA B CB  1 
ATOM   3780 N  N   . GLN B 1 148 ? -53.782 -14.815 -52.712 1.00 40.22  ? 132  GLN B N   1 
ATOM   3781 C  CA  . GLN B 1 148 ? -52.419 -14.273 -52.763 1.00 38.44  ? 132  GLN B CA  1 
ATOM   3782 C  C   . GLN B 1 148 ? -51.482 -15.033 -51.828 1.00 41.51  ? 132  GLN B C   1 
ATOM   3783 O  O   . GLN B 1 148 ? -50.343 -15.325 -52.199 1.00 39.61  ? 132  GLN B O   1 
ATOM   3784 C  CB  . GLN B 1 148 ? -52.414 -12.776 -52.421 1.00 39.14  ? 132  GLN B CB  1 
ATOM   3785 C  CG  . GLN B 1 148 ? -52.965 -11.899 -53.538 1.00 42.71  ? 132  GLN B CG  1 
ATOM   3786 C  CD  . GLN B 1 148 ? -52.969 -10.433 -53.178 1.00 51.37  ? 132  GLN B CD  1 
ATOM   3787 O  OE1 . GLN B 1 148 ? -52.072 -9.928  -52.491 1.00 41.89  ? 132  GLN B OE1 1 
ATOM   3788 N  NE2 . GLN B 1 148 ? -53.965 -9.707  -53.675 1.00 43.50  ? 132  GLN B NE2 1 
ATOM   3789 N  N   . SER B 1 149 ? -51.991 -15.367 -50.623 1.00 38.55  ? 133  SER B N   1 
ATOM   3790 C  CA  . SER B 1 149 ? -51.335 -16.109 -49.550 1.00 37.56  ? 133  SER B CA  1 
ATOM   3791 C  C   . SER B 1 149 ? -50.811 -17.469 -50.052 1.00 38.55  ? 133  SER B C   1 
ATOM   3792 O  O   . SER B 1 149 ? -49.733 -17.903 -49.636 1.00 36.43  ? 133  SER B O   1 
ATOM   3793 C  CB  . SER B 1 149 ? -52.337 -16.337 -48.416 1.00 43.06  ? 133  SER B CB  1 
ATOM   3794 O  OG  . SER B 1 149 ? -51.719 -16.840 -47.244 1.00 56.26  ? 133  SER B OG  1 
ATOM   3795 N  N   . LYS B 1 150 ? -51.596 -18.127 -50.931 1.00 35.26  ? 134  LYS B N   1 
ATOM   3796 C  CA  . LYS B 1 150 ? -51.320 -19.439 -51.515 1.00 35.05  ? 134  LYS B CA  1 
ATOM   3797 C  C   . LYS B 1 150 ? -50.240 -19.358 -52.565 1.00 36.90  ? 134  LYS B C   1 
ATOM   3798 O  O   . LYS B 1 150 ? -49.317 -20.179 -52.542 1.00 34.86  ? 134  LYS B O   1 
ATOM   3799 C  CB  . LYS B 1 150 ? -52.598 -20.086 -52.089 1.00 38.48  ? 134  LYS B CB  1 
ATOM   3800 C  CG  . LYS B 1 150 ? -53.546 -20.598 -51.007 1.00 52.71  ? 134  LYS B CG  1 
ATOM   3801 C  CD  . LYS B 1 150 ? -54.913 -20.982 -51.562 1.00 63.44  ? 134  LYS B CD  1 
ATOM   3802 C  CE  . LYS B 1 150 ? -55.071 -22.471 -51.782 1.00 75.55  ? 134  LYS B CE  1 
ATOM   3803 N  NZ  . LYS B 1 150 ? -56.415 -22.814 -52.321 1.00 83.01  ? 134  LYS B NZ  1 
ATOM   3804 N  N   . LEU B 1 151 ? -50.351 -18.385 -53.502 1.00 32.70  ? 135  LEU B N   1 
ATOM   3805 C  CA  . LEU B 1 151 ? -49.333 -18.218 -54.535 1.00 31.68  ? 135  LEU B CA  1 
ATOM   3806 C  C   . LEU B 1 151 ? -48.005 -17.786 -53.898 1.00 31.44  ? 135  LEU B C   1 
ATOM   3807 O  O   . LEU B 1 151 ? -46.953 -18.323 -54.264 1.00 29.25  ? 135  LEU B O   1 
ATOM   3808 C  CB  . LEU B 1 151 ? -49.776 -17.256 -55.646 1.00 32.45  ? 135  LEU B CB  1 
ATOM   3809 C  CG  . LEU B 1 151 ? -48.772 -17.014 -56.791 1.00 37.27  ? 135  LEU B CG  1 
ATOM   3810 C  CD1 . LEU B 1 151 ? -48.464 -18.301 -57.575 1.00 37.55  ? 135  LEU B CD1 1 
ATOM   3811 C  CD2 . LEU B 1 151 ? -49.281 -15.946 -57.733 1.00 39.36  ? 135  LEU B CD2 1 
ATOM   3812 N  N   . ARG B 1 152 ? -48.058 -16.868 -52.912 1.00 27.98  ? 136  ARG B N   1 
ATOM   3813 C  CA  . ARG B 1 152 ? -46.847 -16.434 -52.204 1.00 26.54  ? 136  ARG B CA  1 
ATOM   3814 C  C   . ARG B 1 152 ? -46.183 -17.632 -51.483 1.00 28.74  ? 136  ARG B C   1 
ATOM   3815 O  O   . ARG B 1 152 ? -44.955 -17.729 -51.458 1.00 26.79  ? 136  ARG B O   1 
ATOM   3816 C  CB  . ARG B 1 152 ? -47.134 -15.309 -51.208 1.00 25.67  ? 136  ARG B CB  1 
ATOM   3817 C  CG  . ARG B 1 152 ? -45.864 -14.569 -50.842 1.00 34.13  ? 136  ARG B CG  1 
ATOM   3818 C  CD  . ARG B 1 152 ? -46.005 -13.659 -49.649 1.00 31.97  ? 136  ARG B CD  1 
ATOM   3819 N  NE  . ARG B 1 152 ? -44.687 -13.165 -49.272 1.00 32.72  ? 136  ARG B NE  1 
ATOM   3820 C  CZ  . ARG B 1 152 ? -44.360 -11.885 -49.137 1.00 47.09  ? 136  ARG B CZ  1 
ATOM   3821 N  NH1 . ARG B 1 152 ? -45.268 -10.935 -49.338 1.00 38.81  ? 136  ARG B NH1 1 
ATOM   3822 N  NH2 . ARG B 1 152 ? -43.123 -11.544 -48.806 1.00 33.40  ? 136  ARG B NH2 1 
ATOM   3823 N  N   . ARG B 1 153 ? -46.999 -18.525 -50.904 1.00 27.08  ? 137  ARG B N   1 
ATOM   3824 C  CA  . ARG B 1 153 ? -46.519 -19.721 -50.205 1.00 26.18  ? 137  ARG B CA  1 
ATOM   3825 C  C   . ARG B 1 153 ? -45.714 -20.603 -51.177 1.00 27.55  ? 137  ARG B C   1 
ATOM   3826 O  O   . ARG B 1 153 ? -44.612 -21.001 -50.835 1.00 25.81  ? 137  ARG B O   1 
ATOM   3827 C  CB  . ARG B 1 153 ? -47.697 -20.519 -49.590 1.00 28.53  ? 137  ARG B CB  1 
ATOM   3828 C  CG  . ARG B 1 153 ? -47.251 -21.603 -48.599 1.00 38.99  ? 137  ARG B CG  1 
ATOM   3829 C  CD  . ARG B 1 153 ? -48.070 -22.877 -48.735 1.00 54.69  ? 137  ARG B CD  1 
ATOM   3830 N  NE  . ARG B 1 153 ? -47.790 -23.806 -47.638 1.00 66.88  ? 137  ARG B NE  1 
ATOM   3831 C  CZ  . ARG B 1 153 ? -47.976 -25.123 -47.687 1.00 86.50  ? 137  ARG B CZ  1 
ATOM   3832 N  NH1 . ARG B 1 153 ? -48.439 -25.695 -48.794 1.00 73.39  ? 137  ARG B NH1 1 
ATOM   3833 N  NH2 . ARG B 1 153 ? -47.694 -25.878 -46.634 1.00 76.59  ? 137  ARG B NH2 1 
ATOM   3834 N  N   . LEU B 1 154 ? -46.234 -20.848 -52.395 1.00 25.34  ? 138  LEU B N   1 
ATOM   3835 C  CA  . LEU B 1 154 ? -45.554 -21.681 -53.405 1.00 24.41  ? 138  LEU B CA  1 
ATOM   3836 C  C   . LEU B 1 154 ? -44.171 -21.137 -53.746 1.00 24.65  ? 138  LEU B C   1 
ATOM   3837 O  O   . LEU B 1 154 ? -43.204 -21.906 -53.834 1.00 21.32  ? 138  LEU B O   1 
ATOM   3838 C  CB  . LEU B 1 154 ? -46.388 -21.815 -54.683 1.00 25.39  ? 138  LEU B CB  1 
ATOM   3839 C  CG  . LEU B 1 154 ? -47.687 -22.611 -54.584 1.00 31.47  ? 138  LEU B CG  1 
ATOM   3840 C  CD1 . LEU B 1 154 ? -48.454 -22.502 -55.854 1.00 32.48  ? 138  LEU B CD1 1 
ATOM   3841 C  CD2 . LEU B 1 154 ? -47.435 -24.096 -54.248 1.00 33.84  ? 138  LEU B CD2 1 
ATOM   3842 N  N   . ILE B 1 155 ? -44.068 -19.793 -53.886 1.00 21.00  ? 139  ILE B N   1 
ATOM   3843 C  CA  . ILE B 1 155 ? -42.809 -19.144 -54.202 1.00 19.90  ? 139  ILE B CA  1 
ATOM   3844 C  C   . ILE B 1 155 ? -41.884 -19.170 -52.993 1.00 22.59  ? 139  ILE B C   1 
ATOM   3845 O  O   . ILE B 1 155 ? -40.728 -19.595 -53.128 1.00 20.43  ? 139  ILE B O   1 
ATOM   3846 C  CB  . ILE B 1 155 ? -43.004 -17.691 -54.747 1.00 22.29  ? 139  ILE B CB  1 
ATOM   3847 C  CG1 . ILE B 1 155 ? -43.958 -17.676 -55.966 1.00 24.51  ? 139  ILE B CG1 1 
ATOM   3848 C  CG2 . ILE B 1 155 ? -41.637 -17.072 -55.092 1.00 21.04  ? 139  ILE B CG2 1 
ATOM   3849 C  CD1 . ILE B 1 155 ? -44.680 -16.372 -56.209 1.00 29.44  ? 139  ILE B CD1 1 
ATOM   3850 N  N   . ASP B 1 156 ? -42.359 -18.670 -51.830 1.00 19.77  ? 140  ASP B N   1 
ATOM   3851 C  CA  . ASP B 1 156 ? -41.531 -18.585 -50.624 1.00 19.20  ? 140  ASP B CA  1 
ATOM   3852 C  C   . ASP B 1 156 ? -41.057 -19.938 -50.100 1.00 21.73  ? 140  ASP B C   1 
ATOM   3853 O  O   . ASP B 1 156 ? -39.984 -19.991 -49.519 1.00 20.57  ? 140  ASP B O   1 
ATOM   3854 C  CB  . ASP B 1 156 ? -42.230 -17.800 -49.496 1.00 20.54  ? 140  ASP B CB  1 
ATOM   3855 C  CG  . ASP B 1 156 ? -42.364 -16.295 -49.720 1.00 24.24  ? 140  ASP B CG  1 
ATOM   3856 O  OD1 . ASP B 1 156 ? -41.700 -15.762 -50.644 1.00 24.09  ? 140  ASP B OD1 1 
ATOM   3857 O  OD2 . ASP B 1 156 ? -43.088 -15.650 -48.944 1.00 26.30  ? 140  ASP B OD2 1 
ATOM   3858 N  N   . ARG B 1 157 ? -41.830 -21.012 -50.304 1.00 19.57  ? 141  ARG B N   1 
ATOM   3859 C  CA  . ARG B 1 157 ? -41.409 -22.342 -49.828 1.00 19.96  ? 141  ARG B CA  1 
ATOM   3860 C  C   . ARG B 1 157 ? -40.335 -22.973 -50.733 1.00 23.40  ? 141  ARG B C   1 
ATOM   3861 O  O   . ARG B 1 157 ? -39.785 -24.007 -50.362 1.00 21.27  ? 141  ARG B O   1 
ATOM   3862 C  CB  . ARG B 1 157 ? -42.612 -23.304 -49.709 1.00 24.11  ? 141  ARG B CB  1 
ATOM   3863 C  CG  . ARG B 1 157 ? -43.580 -22.992 -48.562 1.00 36.69  ? 141  ARG B CG  1 
ATOM   3864 C  CD  . ARG B 1 157 ? -42.966 -23.103 -47.181 1.00 46.78  ? 141  ARG B CD  1 
ATOM   3865 N  NE  . ARG B 1 157 ? -43.905 -22.680 -46.139 1.00 59.04  ? 141  ARG B NE  1 
ATOM   3866 C  CZ  . ARG B 1 157 ? -44.698 -23.505 -45.462 1.00 69.59  ? 141  ARG B CZ  1 
ATOM   3867 N  NH1 . ARG B 1 157 ? -44.668 -24.810 -45.699 1.00 54.10  ? 141  ARG B NH1 1 
ATOM   3868 N  NH2 . ARG B 1 157 ? -45.526 -23.031 -44.541 1.00 52.64  ? 141  ARG B NH2 1 
ATOM   3869 N  N   . THR B 1 158 ? -40.055 -22.383 -51.925 1.00 19.50  ? 142  THR B N   1 
ATOM   3870 C  CA  . THR B 1 158 ? -39.122 -22.992 -52.892 1.00 18.30  ? 142  THR B CA  1 
ATOM   3871 C  C   . THR B 1 158 ? -38.027 -22.074 -53.508 1.00 21.29  ? 142  THR B C   1 
ATOM   3872 O  O   . THR B 1 158 ? -37.045 -22.586 -54.078 1.00 19.93  ? 142  THR B O   1 
ATOM   3873 C  CB  . THR B 1 158 ? -39.926 -23.626 -54.072 1.00 20.96  ? 142  THR B CB  1 
ATOM   3874 O  OG1 . THR B 1 158 ? -40.572 -22.598 -54.839 1.00 20.12  ? 142  THR B OG1 1 
ATOM   3875 C  CG2 . THR B 1 158 ? -40.953 -24.675 -53.625 1.00 20.48  ? 142  THR B CG2 1 
ATOM   3876 N  N   . SER B 1 159 ? -38.191 -20.740 -53.421 1.00 18.98  ? 143  SER B N   1 
ATOM   3877 C  CA  . SER B 1 159 ? -37.311 -19.786 -54.109 1.00 18.01  ? 143  SER B CA  1 
ATOM   3878 C  C   . SER B 1 159 ? -35.816 -19.884 -53.811 1.00 21.94  ? 143  SER B C   1 
ATOM   3879 O  O   . SER B 1 159 ? -35.009 -19.614 -54.701 1.00 21.35  ? 143  SER B O   1 
ATOM   3880 C  CB  . SER B 1 159 ? -37.822 -18.348 -53.987 1.00 19.27  ? 143  SER B CB  1 
ATOM   3881 O  OG  . SER B 1 159 ? -37.685 -17.869 -52.656 1.00 21.01  ? 143  SER B OG  1 
ATOM   3882 N  N   . PHE B 1 160 ? -35.450 -20.330 -52.598 1.00 19.29  ? 144  PHE B N   1 
ATOM   3883 C  CA  . PHE B 1 160 ? -34.047 -20.459 -52.216 1.00 19.22  ? 144  PHE B CA  1 
ATOM   3884 C  C   . PHE B 1 160 ? -33.293 -21.496 -53.083 1.00 23.40  ? 144  PHE B C   1 
ATOM   3885 O  O   . PHE B 1 160 ? -32.069 -21.444 -53.139 1.00 23.36  ? 144  PHE B O   1 
ATOM   3886 C  CB  . PHE B 1 160 ? -33.930 -20.843 -50.726 1.00 19.73  ? 144  PHE B CB  1 
ATOM   3887 C  CG  . PHE B 1 160 ? -34.425 -22.243 -50.418 1.00 20.41  ? 144  PHE B CG  1 
ATOM   3888 C  CD1 . PHE B 1 160 ? -33.581 -23.345 -50.544 1.00 22.76  ? 144  PHE B CD1 1 
ATOM   3889 C  CD2 . PHE B 1 160 ? -35.749 -22.466 -50.041 1.00 21.69  ? 144  PHE B CD2 1 
ATOM   3890 C  CE1 . PHE B 1 160 ? -34.035 -24.636 -50.228 1.00 23.13  ? 144  PHE B CE1 1 
ATOM   3891 C  CE2 . PHE B 1 160 ? -36.207 -23.759 -49.766 1.00 22.88  ? 144  PHE B CE2 1 
ATOM   3892 C  CZ  . PHE B 1 160 ? -35.351 -24.835 -49.866 1.00 20.33  ? 144  PHE B CZ  1 
ATOM   3893 N  N   . ALA B 1 161 ? -34.007 -22.469 -53.688 1.00 20.21  ? 145  ALA B N   1 
ATOM   3894 C  CA  . ALA B 1 161 ? -33.383 -23.547 -54.454 1.00 20.26  ? 145  ALA B CA  1 
ATOM   3895 C  C   . ALA B 1 161 ? -33.108 -23.218 -55.937 1.00 23.40  ? 145  ALA B C   1 
ATOM   3896 O  O   . ALA B 1 161 ? -32.523 -24.035 -56.633 1.00 21.85  ? 145  ALA B O   1 
ATOM   3897 C  CB  . ALA B 1 161 ? -34.202 -24.826 -54.332 1.00 21.00  ? 145  ALA B CB  1 
ATOM   3898 N  N   . MET B 1 162 ? -33.518 -22.036 -56.404 1.00 20.84  ? 146  MET B N   1 
ATOM   3899 C  CA  . MET B 1 162 ? -33.283 -21.608 -57.790 1.00 22.26  ? 146  MET B CA  1 
ATOM   3900 C  C   . MET B 1 162 ? -31.798 -21.402 -58.021 1.00 27.89  ? 146  MET B C   1 
ATOM   3901 O  O   . MET B 1 162 ? -31.107 -20.925 -57.124 1.00 25.42  ? 146  MET B O   1 
ATOM   3902 C  CB  . MET B 1 162 ? -33.985 -20.284 -58.080 1.00 22.63  ? 146  MET B CB  1 
ATOM   3903 C  CG  . MET B 1 162 ? -35.490 -20.369 -58.004 1.00 24.51  ? 146  MET B CG  1 
ATOM   3904 S  SD  . MET B 1 162 ? -36.287 -18.851 -58.600 1.00 26.53  ? 146  MET B SD  1 
ATOM   3905 C  CE  . MET B 1 162 ? -35.716 -17.629 -57.352 1.00 23.26  ? 146  MET B CE  1 
ATOM   3906 N  N   . ALA B 1 163 ? -31.316 -21.755 -59.215 1.00 28.40  ? 147  ALA B N   1 
ATOM   3907 C  CA  . ALA B 1 163 ? -29.925 -21.486 -59.599 1.00 29.69  ? 147  ALA B CA  1 
ATOM   3908 C  C   . ALA B 1 163 ? -29.761 -19.968 -59.849 1.00 34.65  ? 147  ALA B C   1 
ATOM   3909 O  O   . ALA B 1 163 ? -30.760 -19.250 -59.996 1.00 31.75  ? 147  ALA B O   1 
ATOM   3910 C  CB  . ALA B 1 163 ? -29.565 -22.274 -60.850 1.00 31.62  ? 147  ALA B CB  1 
ATOM   3911 N  N   . GLN B 1 164 ? -28.504 -19.482 -59.842 1.00 35.36  ? 148  GLN B N   1 
ATOM   3912 C  CA  . GLN B 1 164 ? -28.157 -18.078 -60.081 1.00 37.69  ? 148  GLN B CA  1 
ATOM   3913 C  C   . GLN B 1 164 ? -26.988 -18.058 -61.058 1.00 46.75  ? 148  GLN B C   1 
ATOM   3914 O  O   . GLN B 1 164 ? -25.900 -18.537 -60.719 1.00 48.58  ? 148  GLN B O   1 
ATOM   3915 C  CB  . GLN B 1 164 ? -27.775 -17.381 -58.764 1.00 38.53  ? 148  GLN B CB  1 
ATOM   3916 C  CG  . GLN B 1 164 ? -28.123 -15.893 -58.735 1.00 58.48  ? 148  GLN B CG  1 
ATOM   3917 C  CD  . GLN B 1 164 ? -27.940 -15.243 -57.378 1.00 77.08  ? 148  GLN B CD  1 
ATOM   3918 O  OE1 . GLN B 1 164 ? -27.612 -14.054 -57.282 1.00 74.06  ? 148  GLN B OE1 1 
ATOM   3919 N  NE2 . GLN B 1 164 ? -28.180 -15.982 -56.296 1.00 65.79  ? 148  GLN B NE2 1 
ATOM   3920 N  N   . GLN B 1 165 ? -27.236 -17.585 -62.297 1.00 44.70  ? 149  GLN B N   1 
ATOM   3921 C  CA  . GLN B 1 165 ? -26.244 -17.484 -63.387 1.00 45.47  ? 149  GLN B CA  1 
ATOM   3922 C  C   . GLN B 1 165 ? -25.617 -18.836 -63.812 1.00 50.29  ? 149  GLN B C   1 
ATOM   3923 O  O   . GLN B 1 165 ? -24.478 -18.883 -64.295 1.00 51.05  ? 149  GLN B O   1 
ATOM   3924 C  CB  . GLN B 1 165 ? -25.185 -16.397 -63.097 1.00 46.89  ? 149  GLN B CB  1 
ATOM   3925 C  CG  . GLN B 1 165 ? -25.767 -14.984 -62.997 1.00 66.39  ? 149  GLN B CG  1 
ATOM   3926 C  CD  . GLN B 1 165 ? -24.817 -13.978 -62.382 1.00 90.29  ? 149  GLN B CD  1 
ATOM   3927 O  OE1 . GLN B 1 165 ? -24.184 -14.217 -61.343 1.00 84.78  ? 149  GLN B OE1 1 
ATOM   3928 N  NE2 . GLN B 1 165 ? -24.741 -12.800 -62.984 1.00 84.63  ? 149  GLN B NE2 1 
ATOM   3929 N  N   . ASP B 1 166 ? -26.378 -19.935 -63.652 1.00 44.96  ? 150  ASP B N   1 
ATOM   3930 C  CA  . ASP B 1 166 ? -25.929 -21.268 -64.056 1.00 44.47  ? 150  ASP B CA  1 
ATOM   3931 C  C   . ASP B 1 166 ? -26.003 -21.353 -65.573 1.00 48.63  ? 150  ASP B C   1 
ATOM   3932 O  O   . ASP B 1 166 ? -26.925 -20.782 -66.172 1.00 47.28  ? 150  ASP B O   1 
ATOM   3933 C  CB  . ASP B 1 166 ? -26.820 -22.353 -63.428 1.00 44.75  ? 150  ASP B CB  1 
ATOM   3934 C  CG  . ASP B 1 166 ? -26.254 -23.760 -63.493 1.00 54.43  ? 150  ASP B CG  1 
ATOM   3935 O  OD1 . ASP B 1 166 ? -26.325 -24.380 -64.578 1.00 53.94  ? 150  ASP B OD1 1 
ATOM   3936 O  OD2 . ASP B 1 166 ? -25.818 -24.271 -62.441 1.00 62.28  ? 150  ASP B OD2 1 
ATOM   3937 N  N   . VAL B 1 167 ? -25.050 -22.086 -66.194 1.00 46.49  ? 151  VAL B N   1 
ATOM   3938 C  CA  . VAL B 1 167 ? -25.001 -22.290 -67.649 1.00 48.28  ? 151  VAL B CA  1 
ATOM   3939 C  C   . VAL B 1 167 ? -26.319 -22.921 -68.173 1.00 52.25  ? 151  VAL B C   1 
ATOM   3940 O  O   . VAL B 1 167 ? -26.785 -22.557 -69.254 1.00 52.82  ? 151  VAL B O   1 
ATOM   3941 C  CB  . VAL B 1 167 ? -23.686 -22.976 -68.133 1.00 53.27  ? 151  VAL B CB  1 
ATOM   3942 C  CG1 . VAL B 1 167 ? -23.663 -24.478 -67.842 1.00 52.75  ? 151  VAL B CG1 1 
ATOM   3943 C  CG2 . VAL B 1 167 ? -23.418 -22.695 -69.609 1.00 55.14  ? 151  VAL B CG2 1 
ATOM   3944 N  N   . ARG B 1 168 ? -26.964 -23.782 -67.345 1.00 46.82  ? 152  ARG B N   1 
ATOM   3945 C  CA  . ARG B 1 168 ? -28.280 -24.356 -67.634 1.00 45.97  ? 152  ARG B CA  1 
ATOM   3946 C  C   . ARG B 1 168 ? -29.287 -23.250 -67.262 1.00 45.83  ? 152  ARG B C   1 
ATOM   3947 O  O   . ARG B 1 168 ? -29.753 -23.176 -66.125 1.00 43.72  ? 152  ARG B O   1 
ATOM   3948 C  CB  . ARG B 1 168 ? -28.512 -25.640 -66.812 1.00 45.25  ? 152  ARG B CB  1 
ATOM   3949 C  CG  . ARG B 1 168 ? -27.762 -26.855 -67.349 1.00 55.09  ? 152  ARG B CG  1 
ATOM   3950 C  CD  . ARG B 1 168 ? -27.045 -27.628 -66.254 1.00 64.78  ? 152  ARG B CD  1 
ATOM   3951 N  NE  . ARG B 1 168 ? -27.955 -28.217 -65.267 1.00 73.33  ? 152  ARG B NE  1 
ATOM   3952 C  CZ  . ARG B 1 168 ? -28.523 -29.415 -65.378 1.00 90.82  ? 152  ARG B CZ  1 
ATOM   3953 N  NH1 . ARG B 1 168 ? -28.299 -30.168 -66.450 1.00 88.56  ? 152  ARG B NH1 1 
ATOM   3954 N  NH2 . ARG B 1 168 ? -29.325 -29.866 -64.425 1.00 70.99  ? 152  ARG B NH2 1 
ATOM   3955 N  N   . TYR B 1 169 ? -29.533 -22.340 -68.218 1.00 42.29  ? 153  TYR B N   1 
ATOM   3956 C  CA  . TYR B 1 169 ? -30.366 -21.135 -68.107 1.00 40.23  ? 153  TYR B CA  1 
ATOM   3957 C  C   . TYR B 1 169 ? -31.779 -21.335 -67.552 1.00 40.88  ? 153  TYR B C   1 
ATOM   3958 O  O   . TYR B 1 169 ? -32.278 -20.456 -66.845 1.00 39.38  ? 153  TYR B O   1 
ATOM   3959 C  CB  . TYR B 1 169 ? -30.381 -20.355 -69.443 1.00 41.92  ? 153  TYR B CB  1 
ATOM   3960 C  CG  . TYR B 1 169 ? -31.240 -20.986 -70.519 1.00 43.31  ? 153  TYR B CG  1 
ATOM   3961 C  CD1 . TYR B 1 169 ? -30.718 -21.943 -71.384 1.00 46.35  ? 153  TYR B CD1 1 
ATOM   3962 C  CD2 . TYR B 1 169 ? -32.569 -20.605 -70.692 1.00 43.74  ? 153  TYR B CD2 1 
ATOM   3963 C  CE1 . TYR B 1 169 ? -31.503 -22.519 -72.385 1.00 47.83  ? 153  TYR B CE1 1 
ATOM   3964 C  CE2 . TYR B 1 169 ? -33.369 -21.189 -71.672 1.00 45.75  ? 153  TYR B CE2 1 
ATOM   3965 C  CZ  . TYR B 1 169 ? -32.828 -22.140 -72.521 1.00 52.34  ? 153  TYR B CZ  1 
ATOM   3966 O  OH  . TYR B 1 169 ? -33.612 -22.728 -73.479 1.00 55.17  ? 153  TYR B OH  1 
ATOM   3967 N  N   . TYR B 1 170 ? -32.410 -22.487 -67.877 1.00 37.38  ? 154  TYR B N   1 
ATOM   3968 C  CA  . TYR B 1 170 ? -33.759 -22.876 -67.443 1.00 36.14  ? 154  TYR B CA  1 
ATOM   3969 C  C   . TYR B 1 170 ? -33.870 -23.151 -65.923 1.00 36.04  ? 154  TYR B C   1 
ATOM   3970 O  O   . TYR B 1 170 ? -34.981 -23.336 -65.424 1.00 33.42  ? 154  TYR B O   1 
ATOM   3971 C  CB  . TYR B 1 170 ? -34.287 -24.070 -68.256 1.00 38.00  ? 154  TYR B CB  1 
ATOM   3972 C  CG  . TYR B 1 170 ? -33.293 -25.201 -68.380 1.00 39.66  ? 154  TYR B CG  1 
ATOM   3973 C  CD1 . TYR B 1 170 ? -33.106 -26.108 -67.339 1.00 39.44  ? 154  TYR B CD1 1 
ATOM   3974 C  CD2 . TYR B 1 170 ? -32.525 -25.358 -69.531 1.00 41.72  ? 154  TYR B CD2 1 
ATOM   3975 C  CE1 . TYR B 1 170 ? -32.174 -27.136 -67.436 1.00 41.16  ? 154  TYR B CE1 1 
ATOM   3976 C  CE2 . TYR B 1 170 ? -31.607 -26.400 -69.650 1.00 43.37  ? 154  TYR B CE2 1 
ATOM   3977 C  CZ  . TYR B 1 170 ? -31.431 -27.283 -68.596 1.00 48.13  ? 154  TYR B CZ  1 
ATOM   3978 O  OH  . TYR B 1 170 ? -30.514 -28.297 -68.686 1.00 48.55  ? 154  TYR B OH  1 
ATOM   3979 N  N   . LEU B 1 171 ? -32.727 -23.194 -65.208 1.00 32.17  ? 155  LEU B N   1 
ATOM   3980 C  CA  . LEU B 1 171 ? -32.656 -23.381 -63.748 1.00 30.33  ? 155  LEU B CA  1 
ATOM   3981 C  C   . LEU B 1 171 ? -32.583 -22.055 -63.000 1.00 33.03  ? 155  LEU B C   1 
ATOM   3982 O  O   . LEU B 1 171 ? -32.795 -22.029 -61.782 1.00 29.23  ? 155  LEU B O   1 
ATOM   3983 C  CB  . LEU B 1 171 ? -31.456 -24.256 -63.365 1.00 30.15  ? 155  LEU B CB  1 
ATOM   3984 C  CG  . LEU B 1 171 ? -31.463 -25.697 -63.894 1.00 34.53  ? 155  LEU B CG  1 
ATOM   3985 C  CD1 . LEU B 1 171 ? -30.315 -26.484 -63.312 1.00 35.11  ? 155  LEU B CD1 1 
ATOM   3986 C  CD2 . LEU B 1 171 ? -32.783 -26.395 -63.609 1.00 33.99  ? 155  LEU B CD2 1 
ATOM   3987 N  N   . ASN B 1 172 ? -32.283 -20.938 -63.730 1.00 31.89  ? 156  ASN B N   1 
ATOM   3988 C  CA  . ASN B 1 172 ? -32.188 -19.591 -63.131 1.00 31.40  ? 156  ASN B CA  1 
ATOM   3989 C  C   . ASN B 1 172 ? -33.581 -18.939 -63.000 1.00 33.15  ? 156  ASN B C   1 
ATOM   3990 O  O   . ASN B 1 172 ? -33.785 -17.790 -63.397 1.00 30.62  ? 156  ASN B O   1 
ATOM   3991 C  CB  . ASN B 1 172 ? -31.227 -18.703 -63.955 1.00 34.80  ? 156  ASN B CB  1 
ATOM   3992 C  CG  . ASN B 1 172 ? -29.828 -19.253 -64.074 1.00 48.22  ? 156  ASN B CG  1 
ATOM   3993 O  OD1 . ASN B 1 172 ? -29.269 -19.824 -63.131 1.00 37.31  ? 156  ASN B OD1 1 
ATOM   3994 N  ND2 . ASN B 1 172 ? -29.216 -19.055 -65.232 1.00 39.87  ? 156  ASN B ND2 1 
ATOM   3995 N  N   . GLY B 1 173 ? -34.514 -19.705 -62.442 1.00 29.59  ? 157  GLY B N   1 
ATOM   3996 C  CA  . GLY B 1 173 ? -35.911 -19.334 -62.272 1.00 27.88  ? 157  GLY B CA  1 
ATOM   3997 C  C   . GLY B 1 173 ? -36.731 -20.437 -61.629 1.00 26.83  ? 157  GLY B C   1 
ATOM   3998 O  O   . GLY B 1 173 ? -36.167 -21.404 -61.104 1.00 24.05  ? 157  GLY B O   1 
ATOM   3999 N  N   . MET B 1 174 ? -38.070 -20.287 -61.652 1.00 22.60  ? 158  MET B N   1 
ATOM   4000 C  CA  . MET B 1 174 ? -38.975 -21.236 -60.979 1.00 22.33  ? 158  MET B CA  1 
ATOM   4001 C  C   . MET B 1 174 ? -40.005 -21.806 -61.915 1.00 25.42  ? 158  MET B C   1 
ATOM   4002 O  O   . MET B 1 174 ? -40.659 -21.061 -62.660 1.00 27.07  ? 158  MET B O   1 
ATOM   4003 C  CB  . MET B 1 174 ? -39.679 -20.521 -59.814 1.00 22.63  ? 158  MET B CB  1 
ATOM   4004 C  CG  . MET B 1 174 ? -40.627 -21.400 -58.983 1.00 24.10  ? 158  MET B CG  1 
ATOM   4005 S  SD  . MET B 1 174 ? -41.333 -20.491 -57.572 1.00 24.90  ? 158  MET B SD  1 
ATOM   4006 C  CE  . MET B 1 174 ? -39.836 -20.145 -56.641 1.00 20.14  ? 158  MET B CE  1 
ATOM   4007 N  N   . LEU B 1 175 ? -40.194 -23.124 -61.830 1.00 23.55  ? 159  LEU B N   1 
ATOM   4008 C  CA  . LEU B 1 175 ? -41.225 -23.807 -62.593 1.00 24.00  ? 159  LEU B CA  1 
ATOM   4009 C  C   . LEU B 1 175 ? -42.556 -23.623 -61.868 1.00 28.42  ? 159  LEU B C   1 
ATOM   4010 O  O   . LEU B 1 175 ? -42.630 -23.808 -60.648 1.00 26.08  ? 159  LEU B O   1 
ATOM   4011 C  CB  . LEU B 1 175 ? -40.925 -25.322 -62.743 1.00 23.78  ? 159  LEU B CB  1 
ATOM   4012 C  CG  . LEU B 1 175 ? -42.018 -26.148 -63.467 1.00 28.29  ? 159  LEU B CG  1 
ATOM   4013 C  CD1 . LEU B 1 175 ? -42.078 -25.847 -64.965 1.00 29.96  ? 159  LEU B CD1 1 
ATOM   4014 C  CD2 . LEU B 1 175 ? -41.879 -27.665 -63.192 1.00 28.97  ? 159  LEU B CD2 1 
ATOM   4015 N  N   . LEU B 1 176 ? -43.586 -23.249 -62.625 1.00 27.59  ? 160  LEU B N   1 
ATOM   4016 C  CA  . LEU B 1 176 ? -44.981 -23.187 -62.184 1.00 29.46  ? 160  LEU B CA  1 
ATOM   4017 C  C   . LEU B 1 176 ? -45.731 -24.144 -63.091 1.00 36.92  ? 160  LEU B C   1 
ATOM   4018 O  O   . LEU B 1 176 ? -45.748 -23.969 -64.316 1.00 37.77  ? 160  LEU B O   1 
ATOM   4019 C  CB  . LEU B 1 176 ? -45.590 -21.778 -62.224 1.00 29.77  ? 160  LEU B CB  1 
ATOM   4020 C  CG  . LEU B 1 176 ? -45.144 -20.761 -61.156 1.00 32.91  ? 160  LEU B CG  1 
ATOM   4021 C  CD1 . LEU B 1 176 ? -45.118 -21.348 -59.718 1.00 30.43  ? 160  LEU B CD1 1 
ATOM   4022 C  CD2 . LEU B 1 176 ? -43.842 -20.117 -61.531 1.00 38.30  ? 160  LEU B CD2 1 
ATOM   4023 N  N   . GLU B 1 177 ? -46.282 -25.195 -62.493 1.00 34.66  ? 161  GLU B N   1 
ATOM   4024 C  CA  . GLU B 1 177 ? -46.936 -26.283 -63.202 1.00 36.26  ? 161  GLU B CA  1 
ATOM   4025 C  C   . GLU B 1 177 ? -48.369 -26.533 -62.723 1.00 42.22  ? 161  GLU B C   1 
ATOM   4026 O  O   . GLU B 1 177 ? -48.629 -26.594 -61.513 1.00 40.11  ? 161  GLU B O   1 
ATOM   4027 C  CB  . GLU B 1 177 ? -46.077 -27.548 -63.028 1.00 37.32  ? 161  GLU B CB  1 
ATOM   4028 C  CG  . GLU B 1 177 ? -46.554 -28.788 -63.762 1.00 46.99  ? 161  GLU B CG  1 
ATOM   4029 C  CD  . GLU B 1 177 ? -45.761 -30.002 -63.337 1.00 58.60  ? 161  GLU B CD  1 
ATOM   4030 O  OE1 . GLU B 1 177 ? -44.662 -30.213 -63.895 1.00 46.84  ? 161  GLU B OE1 1 
ATOM   4031 O  OE2 . GLU B 1 177 ? -46.198 -30.697 -62.393 1.00 54.92  ? 161  GLU B OE2 1 
ATOM   4032 N  N   . VAL B 1 178 ? -49.288 -26.698 -63.691 1.00 41.91  ? 162  VAL B N   1 
ATOM   4033 C  CA  . VAL B 1 178 ? -50.683 -27.057 -63.440 1.00 43.28  ? 162  VAL B CA  1 
ATOM   4034 C  C   . VAL B 1 178 ? -50.878 -28.495 -63.937 1.00 49.27  ? 162  VAL B C   1 
ATOM   4035 O  O   . VAL B 1 178 ? -50.529 -28.810 -65.075 1.00 49.35  ? 162  VAL B O   1 
ATOM   4036 C  CB  . VAL B 1 178 ? -51.759 -26.067 -64.003 1.00 48.35  ? 162  VAL B CB  1 
ATOM   4037 C  CG1 . VAL B 1 178 ? -51.551 -24.645 -63.482 1.00 47.21  ? 162  VAL B CG1 1 
ATOM   4038 C  CG2 . VAL B 1 178 ? -51.828 -26.088 -65.530 1.00 49.83  ? 162  VAL B CG2 1 
ATOM   4039 N  N   . ASN B 1 179 ? -51.350 -29.374 -63.054 1.00 48.07  ? 163  ASN B N   1 
ATOM   4040 C  CA  . ASN B 1 179 ? -51.614 -30.779 -63.363 1.00 49.28  ? 163  ASN B CA  1 
ATOM   4041 C  C   . ASN B 1 179 ? -52.767 -31.217 -62.484 1.00 54.65  ? 163  ASN B C   1 
ATOM   4042 O  O   . ASN B 1 179 ? -52.664 -31.167 -61.254 1.00 52.34  ? 163  ASN B O   1 
ATOM   4043 C  CB  . ASN B 1 179 ? -50.368 -31.648 -63.161 1.00 51.76  ? 163  ASN B CB  1 
ATOM   4044 C  CG  . ASN B 1 179 ? -50.473 -32.995 -63.838 1.00 79.22  ? 163  ASN B CG  1 
ATOM   4045 O  OD1 . ASN B 1 179 ? -50.554 -33.102 -65.068 1.00 72.28  ? 163  ASN B OD1 1 
ATOM   4046 N  ND2 . ASN B 1 179 ? -50.467 -34.059 -63.046 1.00 73.40  ? 163  ASN B ND2 1 
ATOM   4047 N  N   . GLY B 1 180 ? -53.876 -31.579 -63.131 1.00 54.83  ? 164  GLY B N   1 
ATOM   4048 C  CA  . GLY B 1 180 ? -55.132 -31.906 -62.469 1.00 55.77  ? 164  GLY B CA  1 
ATOM   4049 C  C   . GLY B 1 180 ? -55.731 -30.598 -61.987 1.00 61.13  ? 164  GLY B C   1 
ATOM   4050 O  O   . GLY B 1 180 ? -55.856 -29.641 -62.762 1.00 61.33  ? 164  GLY B O   1 
ATOM   4051 N  N   . GLY B 1 181 ? -56.012 -30.531 -60.693 1.00 57.67  ? 165  GLY B N   1 
ATOM   4052 C  CA  . GLY B 1 181 ? -56.493 -29.315 -60.046 1.00 56.96  ? 165  GLY B CA  1 
ATOM   4053 C  C   . GLY B 1 181 ? -55.448 -28.783 -59.082 1.00 58.76  ? 165  GLY B C   1 
ATOM   4054 O  O   . GLY B 1 181 ? -55.777 -28.016 -58.174 1.00 59.39  ? 165  GLY B O   1 
ATOM   4055 N  N   . THR B 1 182 ? -54.170 -29.207 -59.272 1.00 51.15  ? 166  THR B N   1 
ATOM   4056 C  CA  . THR B 1 182 ? -53.018 -28.841 -58.435 1.00 47.53  ? 166  THR B CA  1 
ATOM   4057 C  C   . THR B 1 182 ? -52.113 -27.773 -59.082 1.00 45.57  ? 166  THR B C   1 
ATOM   4058 O  O   . THR B 1 182 ? -51.819 -27.838 -60.274 1.00 46.09  ? 166  THR B O   1 
ATOM   4059 C  CB  . THR B 1 182 ? -52.203 -30.114 -58.093 1.00 54.59  ? 166  THR B CB  1 
ATOM   4060 O  OG1 . THR B 1 182 ? -53.084 -31.160 -57.676 1.00 56.78  ? 166  THR B OG1 1 
ATOM   4061 C  CG2 . THR B 1 182 ? -51.147 -29.885 -57.013 1.00 53.41  ? 166  THR B CG2 1 
ATOM   4062 N  N   . LEU B 1 183 ? -51.648 -26.821 -58.281 1.00 37.60  ? 167  LEU B N   1 
ATOM   4063 C  CA  . LEU B 1 183 ? -50.663 -25.827 -58.727 1.00 34.93  ? 167  LEU B CA  1 
ATOM   4064 C  C   . LEU B 1 183 ? -49.357 -26.156 -57.978 1.00 34.68  ? 167  LEU B C   1 
ATOM   4065 O  O   . LEU B 1 183 ? -49.349 -26.263 -56.748 1.00 32.36  ? 167  LEU B O   1 
ATOM   4066 C  CB  . LEU B 1 183 ? -51.110 -24.370 -58.498 1.00 34.63  ? 167  LEU B CB  1 
ATOM   4067 C  CG  . LEU B 1 183 ? -50.121 -23.266 -58.950 1.00 37.48  ? 167  LEU B CG  1 
ATOM   4068 C  CD1 . LEU B 1 183 ? -49.754 -23.374 -60.434 1.00 36.90  ? 167  LEU B CD1 1 
ATOM   4069 C  CD2 . LEU B 1 183 ? -50.659 -21.888 -58.634 1.00 39.28  ? 167  LEU B CD2 1 
ATOM   4070 N  N   . ARG B 1 184 ? -48.278 -26.365 -58.740 1.00 30.95  ? 168  ARG B N   1 
ATOM   4071 C  CA  . ARG B 1 184 ? -46.978 -26.758 -58.221 1.00 28.52  ? 168  ARG B CA  1 
ATOM   4072 C  C   . ARG B 1 184 ? -45.848 -25.813 -58.636 1.00 31.45  ? 168  ARG B C   1 
ATOM   4073 O  O   . ARG B 1 184 ? -45.745 -25.427 -59.805 1.00 31.36  ? 168  ARG B O   1 
ATOM   4074 C  CB  . ARG B 1 184 ? -46.653 -28.194 -58.683 1.00 27.59  ? 168  ARG B CB  1 
ATOM   4075 C  CG  . ARG B 1 184 ? -45.266 -28.684 -58.274 1.00 31.54  ? 168  ARG B CG  1 
ATOM   4076 C  CD  . ARG B 1 184 ? -45.012 -30.111 -58.703 1.00 34.54  ? 168  ARG B CD  1 
ATOM   4077 N  NE  . ARG B 1 184 ? -45.808 -31.047 -57.914 1.00 39.39  ? 168  ARG B NE  1 
ATOM   4078 C  CZ  . ARG B 1 184 ? -45.873 -32.355 -58.133 1.00 52.70  ? 168  ARG B CZ  1 
ATOM   4079 N  NH1 . ARG B 1 184 ? -45.173 -32.908 -59.118 1.00 39.88  ? 168  ARG B NH1 1 
ATOM   4080 N  NH2 . ARG B 1 184 ? -46.623 -33.124 -57.357 1.00 41.21  ? 168  ARG B NH2 1 
ATOM   4081 N  N   . SER B 1 185 ? -44.966 -25.514 -57.674 1.00 26.42  ? 169  SER B N   1 
ATOM   4082 C  CA  . SER B 1 185 ? -43.761 -24.715 -57.867 1.00 24.93  ? 169  SER B CA  1 
ATOM   4083 C  C   . SER B 1 185 ? -42.579 -25.663 -57.690 1.00 26.31  ? 169  SER B C   1 
ATOM   4084 O  O   . SER B 1 185 ? -42.634 -26.546 -56.825 1.00 24.03  ? 169  SER B O   1 
ATOM   4085 C  CB  . SER B 1 185 ? -43.687 -23.572 -56.858 1.00 25.40  ? 169  SER B CB  1 
ATOM   4086 O  OG  . SER B 1 185 ? -43.719 -24.040 -55.521 1.00 22.86  ? 169  SER B OG  1 
ATOM   4087 N  N   . VAL B 1 186 ? -41.555 -25.540 -58.554 1.00 20.98  ? 170  VAL B N   1 
ATOM   4088 C  CA  . VAL B 1 186 ? -40.340 -26.373 -58.484 1.00 19.77  ? 170  VAL B CA  1 
ATOM   4089 C  C   . VAL B 1 186 ? -39.130 -25.483 -58.749 1.00 23.89  ? 170  VAL B C   1 
ATOM   4090 O  O   . VAL B 1 186 ? -39.132 -24.719 -59.707 1.00 23.89  ? 170  VAL B O   1 
ATOM   4091 C  CB  . VAL B 1 186 ? -40.316 -27.612 -59.446 1.00 22.76  ? 170  VAL B CB  1 
ATOM   4092 C  CG1 . VAL B 1 186 ? -39.136 -28.516 -59.107 1.00 22.91  ? 170  VAL B CG1 1 
ATOM   4093 C  CG2 . VAL B 1 186 ? -41.617 -28.423 -59.401 1.00 22.51  ? 170  VAL B CG2 1 
ATOM   4094 N  N   . ALA B 1 187 ? -38.090 -25.613 -57.927 1.00 20.60  ? 171  ALA B N   1 
ATOM   4095 C  CA  . ALA B 1 187 ? -36.847 -24.859 -58.088 1.00 19.70  ? 171  ALA B CA  1 
ATOM   4096 C  C   . ALA B 1 187 ? -35.678 -25.781 -57.771 1.00 23.24  ? 171  ALA B C   1 
ATOM   4097 O  O   . ALA B 1 187 ? -35.756 -26.599 -56.842 1.00 21.45  ? 171  ALA B O   1 
ATOM   4098 C  CB  . ALA B 1 187 ? -36.835 -23.631 -57.167 1.00 19.38  ? 171  ALA B CB  1 
ATOM   4099 N  N   . THR B 1 188 ? -34.627 -25.707 -58.591 1.00 21.42  ? 172  THR B N   1 
ATOM   4100 C  CA  . THR B 1 188 ? -33.415 -26.524 -58.433 1.00 22.29  ? 172  THR B CA  1 
ATOM   4101 C  C   . THR B 1 188 ? -32.177 -25.860 -59.037 1.00 27.56  ? 172  THR B C   1 
ATOM   4102 O  O   . THR B 1 188 ? -32.293 -25.110 -60.001 1.00 27.01  ? 172  THR B O   1 
ATOM   4103 C  CB  . THR B 1 188 ? -33.620 -27.996 -58.891 1.00 24.88  ? 172  THR B CB  1 
ATOM   4104 O  OG1 . THR B 1 188 ? -32.501 -28.778 -58.453 1.00 26.29  ? 172  THR B OG1 1 
ATOM   4105 C  CG2 . THR B 1 188 ? -33.815 -28.137 -60.416 1.00 25.76  ? 172  THR B CG2 1 
ATOM   4106 N  N   . ASP B 1 189 ? -31.010 -26.106 -58.430 1.00 25.60  ? 173  ASP B N   1 
ATOM   4107 C  CA  . ASP B 1 189 ? -29.734 -25.600 -58.945 1.00 26.00  ? 173  ASP B CA  1 
ATOM   4108 C  C   . ASP B 1 189 ? -28.809 -26.785 -59.376 1.00 30.50  ? 173  ASP B C   1 
ATOM   4109 O  O   . ASP B 1 189 ? -27.632 -26.573 -59.645 1.00 30.93  ? 173  ASP B O   1 
ATOM   4110 C  CB  . ASP B 1 189 ? -29.064 -24.671 -57.918 1.00 26.07  ? 173  ASP B CB  1 
ATOM   4111 C  CG  . ASP B 1 189 ? -28.713 -25.313 -56.590 1.00 29.08  ? 173  ASP B CG  1 
ATOM   4112 O  OD1 . ASP B 1 189 ? -28.874 -26.558 -56.459 1.00 28.65  ? 173  ASP B OD1 1 
ATOM   4113 O  OD2 . ASP B 1 189 ? -28.270 -24.587 -55.690 1.00 29.36  ? 173  ASP B OD2 1 
ATOM   4114 N  N   . GLY B 1 190 ? -29.356 -28.010 -59.378 1.00 27.42  ? 174  GLY B N   1 
ATOM   4115 C  CA  . GLY B 1 190 ? -28.635 -29.241 -59.709 1.00 28.52  ? 174  GLY B CA  1 
ATOM   4116 C  C   . GLY B 1 190 ? -27.980 -29.933 -58.521 1.00 32.50  ? 174  GLY B C   1 
ATOM   4117 O  O   . GLY B 1 190 ? -27.464 -31.048 -58.655 1.00 31.80  ? 174  GLY B O   1 
ATOM   4118 N  N   . HIS B 1 191 ? -27.982 -29.266 -57.350 1.00 28.85  ? 175  HIS B N   1 
ATOM   4119 C  CA  . HIS B 1 191 ? -27.409 -29.762 -56.096 1.00 28.79  ? 175  HIS B CA  1 
ATOM   4120 C  C   . HIS B 1 191 ? -28.511 -30.040 -55.080 1.00 30.39  ? 175  HIS B C   1 
ATOM   4121 O  O   . HIS B 1 191 ? -28.376 -30.911 -54.227 1.00 29.36  ? 175  HIS B O   1 
ATOM   4122 C  CB  . HIS B 1 191 ? -26.433 -28.717 -55.517 1.00 30.26  ? 175  HIS B CB  1 
ATOM   4123 C  CG  . HIS B 1 191 ? -25.303 -28.395 -56.445 1.00 35.59  ? 175  HIS B CG  1 
ATOM   4124 N  ND1 . HIS B 1 191 ? -24.257 -29.280 -56.639 1.00 38.72  ? 175  HIS B ND1 1 
ATOM   4125 C  CD2 . HIS B 1 191 ? -25.125 -27.324 -57.251 1.00 38.55  ? 175  HIS B CD2 1 
ATOM   4126 C  CE1 . HIS B 1 191 ? -23.473 -28.718 -57.547 1.00 39.27  ? 175  HIS B CE1 1 
ATOM   4127 N  NE2 . HIS B 1 191 ? -23.949 -27.534 -57.936 1.00 39.59  ? 175  HIS B NE2 1 
ATOM   4128 N  N   . ARG B 1 192 ? -29.576 -29.251 -55.141 1.00 25.12  ? 176  ARG B N   1 
ATOM   4129 C  CA  . ARG B 1 192 ? -30.703 -29.341 -54.232 1.00 22.98  ? 176  ARG B CA  1 
ATOM   4130 C  C   . ARG B 1 192 ? -31.958 -28.881 -54.945 1.00 25.59  ? 176  ARG B C   1 
ATOM   4131 O  O   . ARG B 1 192 ? -31.874 -28.139 -55.936 1.00 24.78  ? 176  ARG B O   1 
ATOM   4132 C  CB  . ARG B 1 192 ? -30.440 -28.591 -52.897 1.00 21.34  ? 176  ARG B CB  1 
ATOM   4133 C  CG  . ARG B 1 192 ? -29.702 -27.245 -53.018 1.00 22.49  ? 176  ARG B CG  1 
ATOM   4134 C  CD  . ARG B 1 192 ? -30.619 -26.112 -53.392 1.00 26.20  ? 176  ARG B CD  1 
ATOM   4135 N  NE  . ARG B 1 192 ? -29.926 -24.815 -53.371 1.00 26.66  ? 176  ARG B NE  1 
ATOM   4136 C  CZ  . ARG B 1 192 ? -29.745 -24.053 -52.295 1.00 28.77  ? 176  ARG B CZ  1 
ATOM   4137 N  NH1 . ARG B 1 192 ? -30.204 -24.441 -51.106 1.00 17.44  ? 176  ARG B NH1 1 
ATOM   4138 N  NH2 . ARG B 1 192 ? -29.099 -22.900 -52.395 1.00 25.89  ? 176  ARG B NH2 1 
ATOM   4139 N  N   . LEU B 1 193 ? -33.113 -29.366 -54.484 1.00 20.52  ? 177  LEU B N   1 
ATOM   4140 C  CA  . LEU B 1 193 ? -34.403 -29.070 -55.102 1.00 19.44  ? 177  LEU B CA  1 
ATOM   4141 C  C   . LEU B 1 193 ? -35.443 -28.774 -54.019 1.00 21.66  ? 177  LEU B C   1 
ATOM   4142 O  O   . LEU B 1 193 ? -35.371 -29.298 -52.902 1.00 18.73  ? 177  LEU B O   1 
ATOM   4143 C  CB  . LEU B 1 193 ? -34.846 -30.264 -55.990 1.00 19.70  ? 177  LEU B CB  1 
ATOM   4144 C  CG  . LEU B 1 193 ? -36.242 -30.198 -56.659 1.00 23.58  ? 177  LEU B CG  1 
ATOM   4145 C  CD1 . LEU B 1 193 ? -36.239 -30.874 -58.027 1.00 24.64  ? 177  LEU B CD1 1 
ATOM   4146 C  CD2 . LEU B 1 193 ? -37.343 -30.780 -55.750 1.00 23.64  ? 177  LEU B CD2 1 
ATOM   4147 N  N   . ALA B 1 194 ? -36.405 -27.920 -54.370 1.00 18.67  ? 178  ALA B N   1 
ATOM   4148 C  CA  . ALA B 1 194 ? -37.542 -27.567 -53.520 1.00 18.45  ? 178  ALA B CA  1 
ATOM   4149 C  C   . ALA B 1 194 ? -38.785 -27.613 -54.397 1.00 22.94  ? 178  ALA B C   1 
ATOM   4150 O  O   . ALA B 1 194 ? -38.771 -27.159 -55.556 1.00 23.27  ? 178  ALA B O   1 
ATOM   4151 C  CB  . ALA B 1 194 ? -37.362 -26.165 -52.942 1.00 18.12  ? 178  ALA B CB  1 
ATOM   4152 N  N   . MET B 1 195 ? -39.850 -28.189 -53.862 1.00 19.33  ? 179  MET B N   1 
ATOM   4153 C  CA  . MET B 1 195 ? -41.131 -28.250 -54.560 1.00 20.05  ? 179  MET B CA  1 
ATOM   4154 C  C   . MET B 1 195 ? -42.261 -28.091 -53.565 1.00 24.73  ? 179  MET B C   1 
ATOM   4155 O  O   . MET B 1 195 ? -42.131 -28.478 -52.395 1.00 21.94  ? 179  MET B O   1 
ATOM   4156 C  CB  . MET B 1 195 ? -41.280 -29.511 -55.418 1.00 22.63  ? 179  MET B CB  1 
ATOM   4157 C  CG  . MET B 1 195 ? -41.263 -30.800 -54.617 1.00 27.27  ? 179  MET B CG  1 
ATOM   4158 S  SD  . MET B 1 195 ? -41.222 -32.243 -55.697 1.00 34.02  ? 179  MET B SD  1 
ATOM   4159 C  CE  . MET B 1 195 ? -42.828 -32.154 -56.429 1.00 31.48  ? 179  MET B CE  1 
ATOM   4160 N  N   . CYS B 1 196 ? -43.328 -27.459 -54.017 1.00 23.93  ? 180  CYS B N   1 
ATOM   4161 C  CA  . CYS B 1 196 ? -44.516 -27.200 -53.222 1.00 25.31  ? 180  CYS B CA  1 
ATOM   4162 C  C   . CYS B 1 196 ? -45.723 -27.351 -54.127 1.00 28.76  ? 180  CYS B C   1 
ATOM   4163 O  O   . CYS B 1 196 ? -45.709 -26.891 -55.275 1.00 26.82  ? 180  CYS B O   1 
ATOM   4164 C  CB  . CYS B 1 196 ? -44.462 -25.822 -52.560 1.00 26.78  ? 180  CYS B CB  1 
ATOM   4165 S  SG  . CYS B 1 196 ? -45.722 -25.576 -51.267 1.00 31.79  ? 180  CYS B SG  1 
ATOM   4166 N  N   . SER B 1 197 ? -46.745 -28.036 -53.618 1.00 27.63  ? 181  SER B N   1 
ATOM   4167 C  CA  . SER B 1 197 ? -47.989 -28.350 -54.329 1.00 30.61  ? 181  SER B CA  1 
ATOM   4168 C  C   . SER B 1 197 ? -49.197 -27.938 -53.479 1.00 38.95  ? 181  SER B C   1 
ATOM   4169 O  O   . SER B 1 197 ? -49.154 -28.024 -52.245 1.00 38.31  ? 181  SER B O   1 
ATOM   4170 C  CB  . SER B 1 197 ? -48.047 -29.845 -54.633 1.00 34.77  ? 181  SER B CB  1 
ATOM   4171 O  OG  . SER B 1 197 ? -47.041 -30.236 -55.556 1.00 38.99  ? 181  SER B OG  1 
ATOM   4172 N  N   . LEU B 1 198 ? -50.251 -27.448 -54.139 1.00 39.28  ? 182  LEU B N   1 
ATOM   4173 C  CA  . LEU B 1 198 ? -51.493 -27.025 -53.491 1.00 41.66  ? 182  LEU B CA  1 
ATOM   4174 C  C   . LEU B 1 198 ? -52.651 -27.270 -54.439 1.00 48.54  ? 182  LEU B C   1 
ATOM   4175 O  O   . LEU B 1 198 ? -52.495 -27.065 -55.642 1.00 47.46  ? 182  LEU B O   1 
ATOM   4176 C  CB  . LEU B 1 198 ? -51.454 -25.524 -53.107 1.00 42.35  ? 182  LEU B CB  1 
ATOM   4177 C  CG  . LEU B 1 198 ? -50.700 -25.123 -51.824 1.00 47.91  ? 182  LEU B CG  1 
ATOM   4178 C  CD1 . LEU B 1 198 ? -50.422 -23.615 -51.789 1.00 47.66  ? 182  LEU B CD1 1 
ATOM   4179 C  CD2 . LEU B 1 198 ? -51.449 -25.577 -50.553 1.00 53.62  ? 182  LEU B CD2 1 
ATOM   4180 N  N   . ASP B 1 199 ? -53.811 -27.712 -53.920 1.00 48.75  ? 183  ASP B N   1 
ATOM   4181 C  CA  . ASP B 1 199 ? -54.970 -27.875 -54.799 1.00 51.65  ? 183  ASP B CA  1 
ATOM   4182 C  C   . ASP B 1 199 ? -55.548 -26.481 -55.079 1.00 58.03  ? 183  ASP B C   1 
ATOM   4183 O  O   . ASP B 1 199 ? -55.680 -25.664 -54.162 1.00 57.56  ? 183  ASP B O   1 
ATOM   4184 C  CB  . ASP B 1 199 ? -56.015 -28.883 -54.267 1.00 54.95  ? 183  ASP B CB  1 
ATOM   4185 C  CG  . ASP B 1 199 ? -56.417 -28.733 -52.811 1.00 70.18  ? 183  ASP B CG  1 
ATOM   4186 O  OD1 . ASP B 1 199 ? -57.016 -27.685 -52.461 1.00 71.87  ? 183  ASP B OD1 1 
ATOM   4187 O  OD2 . ASP B 1 199 ? -56.201 -29.691 -52.036 1.00 75.52  ? 183  ASP B OD2 1 
ATOM   4188 N  N   . ALA B 1 200 ? -55.748 -26.170 -56.358 1.00 56.74  ? 184  ALA B N   1 
ATOM   4189 C  CA  . ALA B 1 200 ? -56.260 -24.870 -56.786 1.00 58.37  ? 184  ALA B CA  1 
ATOM   4190 C  C   . ALA B 1 200 ? -57.547 -24.994 -57.622 1.00 67.53  ? 184  ALA B C   1 
ATOM   4191 O  O   . ALA B 1 200 ? -58.247 -23.993 -57.819 1.00 68.36  ? 184  ALA B O   1 
ATOM   4192 C  CB  . ALA B 1 200 ? -55.185 -24.121 -57.557 1.00 58.38  ? 184  ALA B CB  1 
ATOM   4193 N  N   . GLN B 1 201 ? -57.863 -26.228 -58.079 1.00 67.10  ? 185  GLN B N   1 
ATOM   4194 C  CA  . GLN B 1 201 ? -59.026 -26.603 -58.898 1.00 70.19  ? 185  GLN B CA  1 
ATOM   4195 C  C   . GLN B 1 201 ? -59.091 -25.831 -60.231 1.00 77.20  ? 185  GLN B C   1 
ATOM   4196 O  O   . GLN B 1 201 ? -60.084 -25.161 -60.532 1.00 78.13  ? 185  GLN B O   1 
ATOM   4197 C  CB  . GLN B 1 201 ? -60.343 -26.542 -58.095 1.00 72.53  ? 185  GLN B CB  1 
ATOM   4198 N  N   . ILE B 1 202 ? -58.005 -25.932 -61.020 1.00 74.32  ? 186  ILE B N   1 
ATOM   4199 C  CA  . ILE B 1 202 ? -57.866 -25.273 -62.317 1.00 75.00  ? 186  ILE B CA  1 
ATOM   4200 C  C   . ILE B 1 202 ? -58.225 -26.251 -63.449 1.00 81.92  ? 186  ILE B C   1 
ATOM   4201 O  O   . ILE B 1 202 ? -57.603 -27.314 -63.547 1.00 81.23  ? 186  ILE B O   1 
ATOM   4202 C  CB  . ILE B 1 202 ? -56.450 -24.650 -62.523 1.00 76.74  ? 186  ILE B CB  1 
ATOM   4203 C  CG1 . ILE B 1 202 ? -55.992 -23.816 -61.301 1.00 75.28  ? 186  ILE B CG1 1 
ATOM   4204 C  CG2 . ILE B 1 202 ? -56.402 -23.816 -63.811 1.00 78.78  ? 186  ILE B CG2 1 
ATOM   4205 C  CD1 . ILE B 1 202 ? -54.456 -23.636 -61.181 1.00 78.66  ? 186  ILE B CD1 1 
ATOM   4206 N  N   . PRO B 1 203 ? -59.196 -25.913 -64.331 1.00 81.16  ? 187  PRO B N   1 
ATOM   4207 C  CA  . PRO B 1 203 ? -59.499 -26.813 -65.452 1.00 82.93  ? 187  PRO B CA  1 
ATOM   4208 C  C   . PRO B 1 203 ? -58.398 -26.675 -66.509 1.00 87.82  ? 187  PRO B C   1 
ATOM   4209 O  O   . PRO B 1 203 ? -58.292 -25.640 -67.174 1.00 87.47  ? 187  PRO B O   1 
ATOM   4210 C  CB  . PRO B 1 203 ? -60.880 -26.335 -65.939 1.00 86.35  ? 187  PRO B CB  1 
ATOM   4211 C  CG  . PRO B 1 203 ? -61.289 -25.211 -65.004 1.00 89.89  ? 187  PRO B CG  1 
ATOM   4212 C  CD  . PRO B 1 203 ? -60.034 -24.701 -64.390 1.00 83.41  ? 187  PRO B CD  1 
ATOM   4213 N  N   . SER B 1 204 ? -57.525 -27.693 -66.596 1.00 84.76  ? 188  SER B N   1 
ATOM   4214 C  CA  . SER B 1 204 ? -56.389 -27.692 -67.516 1.00 84.86  ? 188  SER B CA  1 
ATOM   4215 C  C   . SER B 1 204 ? -56.510 -28.702 -68.649 1.00 91.03  ? 188  SER B C   1 
ATOM   4216 O  O   . SER B 1 204 ? -56.113 -28.383 -69.773 1.00 91.79  ? 188  SER B O   1 
ATOM   4217 C  CB  . SER B 1 204 ? -55.078 -27.896 -66.759 1.00 86.66  ? 188  SER B CB  1 
ATOM   4218 O  OG  . SER B 1 204 ? -55.045 -29.126 -66.052 1.00 93.61  ? 188  SER B OG  1 
ATOM   4219 N  N   . GLN B 1 205 ? -57.029 -29.924 -68.354 1.00 87.99  ? 189  GLN B N   1 
ATOM   4220 C  CA  . GLN B 1 205 ? -57.176 -31.061 -69.284 1.00 89.24  ? 189  GLN B CA  1 
ATOM   4221 C  C   . GLN B 1 205 ? -55.807 -31.636 -69.697 1.00 92.16  ? 189  GLN B C   1 
ATOM   4222 O  O   . GLN B 1 205 ? -55.617 -32.855 -69.666 1.00 91.84  ? 189  GLN B O   1 
ATOM   4223 C  CB  . GLN B 1 205 ? -58.059 -30.728 -70.504 1.00 92.68  ? 189  GLN B CB  1 
ATOM   4224 N  N   . ASP B 1 206 ? -54.860 -30.746 -70.059 1.00 87.33  ? 190  ASP B N   1 
ATOM   4225 C  CA  . ASP B 1 206 ? -53.476 -31.041 -70.430 1.00 85.90  ? 190  ASP B CA  1 
ATOM   4226 C  C   . ASP B 1 206 ? -52.531 -30.239 -69.517 1.00 85.46  ? 190  ASP B C   1 
ATOM   4227 O  O   . ASP B 1 206 ? -52.833 -29.091 -69.168 1.00 85.03  ? 190  ASP B O   1 
ATOM   4228 C  CB  . ASP B 1 206 ? -53.224 -30.694 -71.906 1.00 89.30  ? 190  ASP B CB  1 
ATOM   4229 N  N   . ARG B 1 207 ? -51.399 -30.854 -69.123 1.00 78.23  ? 191  ARG B N   1 
ATOM   4230 C  CA  . ARG B 1 207 ? -50.391 -30.250 -68.247 1.00 74.77  ? 191  ARG B CA  1 
ATOM   4231 C  C   . ARG B 1 207 ? -49.702 -29.038 -68.890 1.00 75.36  ? 191  ARG B C   1 
ATOM   4232 O  O   . ARG B 1 207 ? -49.200 -29.136 -70.015 1.00 76.12  ? 191  ARG B O   1 
ATOM   4233 C  CB  . ARG B 1 207 ? -49.345 -31.303 -67.825 1.00 73.72  ? 191  ARG B CB  1 
ATOM   4234 C  CG  . ARG B 1 207 ? -48.370 -30.818 -66.747 1.00 81.46  ? 191  ARG B CG  1 
ATOM   4235 C  CD  . ARG B 1 207 ? -47.133 -31.689 -66.630 1.00 88.83  ? 191  ARG B CD  1 
ATOM   4236 N  NE  . ARG B 1 207 ? -46.207 -31.491 -67.748 1.00 95.64  ? 191  ARG B NE  1 
ATOM   4237 C  CZ  . ARG B 1 207 ? -45.042 -32.119 -67.879 1.00 108.56 ? 191  ARG B CZ  1 
ATOM   4238 N  NH1 . ARG B 1 207 ? -44.639 -32.988 -66.960 1.00 96.25  ? 191  ARG B NH1 1 
ATOM   4239 N  NH2 . ARG B 1 207 ? -44.269 -31.880 -68.930 1.00 93.73  ? 191  ARG B NH2 1 
ATOM   4240 N  N   . HIS B 1 208 ? -49.677 -27.900 -68.166 1.00 67.21  ? 192  HIS B N   1 
ATOM   4241 C  CA  . HIS B 1 208 ? -48.995 -26.690 -68.618 1.00 65.11  ? 192  HIS B CA  1 
ATOM   4242 C  C   . HIS B 1 208 ? -47.871 -26.322 -67.663 1.00 59.86  ? 192  HIS B C   1 
ATOM   4243 O  O   . HIS B 1 208 ? -48.030 -26.414 -66.445 1.00 57.20  ? 192  HIS B O   1 
ATOM   4244 C  CB  . HIS B 1 208 ? -49.955 -25.514 -68.830 1.00 67.11  ? 192  HIS B CB  1 
ATOM   4245 C  CG  . HIS B 1 208 ? -49.396 -24.445 -69.723 1.00 71.77  ? 192  HIS B CG  1 
ATOM   4246 N  ND1 . HIS B 1 208 ? -49.248 -23.138 -69.283 1.00 73.20  ? 192  HIS B ND1 1 
ATOM   4247 C  CD2 . HIS B 1 208 ? -48.967 -24.523 -71.006 1.00 75.14  ? 192  HIS B CD2 1 
ATOM   4248 C  CE1 . HIS B 1 208 ? -48.744 -22.467 -70.307 1.00 73.52  ? 192  HIS B CE1 1 
ATOM   4249 N  NE2 . HIS B 1 208 ? -48.554 -23.257 -71.364 1.00 75.14  ? 192  HIS B NE2 1 
ATOM   4250 N  N   . GLN B 1 209 ? -46.726 -25.942 -68.236 1.00 51.82  ? 193  GLN B N   1 
ATOM   4251 C  CA  . GLN B 1 209 ? -45.517 -25.564 -67.519 1.00 47.69  ? 193  GLN B CA  1 
ATOM   4252 C  C   . GLN B 1 209 ? -45.011 -24.207 -67.983 1.00 47.14  ? 193  GLN B C   1 
ATOM   4253 O  O   . GLN B 1 209 ? -44.986 -23.919 -69.184 1.00 47.87  ? 193  GLN B O   1 
ATOM   4254 C  CB  . GLN B 1 209 ? -44.412 -26.599 -67.769 1.00 48.51  ? 193  GLN B CB  1 
ATOM   4255 C  CG  . GLN B 1 209 ? -44.622 -27.966 -67.128 1.00 46.41  ? 193  GLN B CG  1 
ATOM   4256 C  CD  . GLN B 1 209 ? -43.353 -28.795 -67.155 1.00 58.19  ? 193  GLN B CD  1 
ATOM   4257 O  OE1 . GLN B 1 209 ? -42.509 -28.677 -68.051 1.00 50.60  ? 193  GLN B OE1 1 
ATOM   4258 N  NE2 . GLN B 1 209 ? -43.190 -29.671 -66.179 1.00 49.31  ? 193  GLN B NE2 1 
ATOM   4259 N  N   . VAL B 1 210 ? -44.599 -23.373 -67.032 1.00 38.83  ? 194  VAL B N   1 
ATOM   4260 C  CA  . VAL B 1 210 ? -43.977 -22.079 -67.305 1.00 37.37  ? 194  VAL B CA  1 
ATOM   4261 C  C   . VAL B 1 210 ? -42.764 -21.931 -66.388 1.00 39.47  ? 194  VAL B C   1 
ATOM   4262 O  O   . VAL B 1 210 ? -42.812 -22.404 -65.242 1.00 37.52  ? 194  VAL B O   1 
ATOM   4263 C  CB  . VAL B 1 210 ? -44.927 -20.827 -67.242 1.00 40.77  ? 194  VAL B CB  1 
ATOM   4264 C  CG1 . VAL B 1 210 ? -46.075 -20.925 -68.251 1.00 41.69  ? 194  VAL B CG1 1 
ATOM   4265 C  CG2 . VAL B 1 210 ? -45.461 -20.555 -65.832 1.00 39.18  ? 194  VAL B CG2 1 
ATOM   4266 N  N   . ILE B 1 211 ? -41.688 -21.277 -66.877 1.00 33.82  ? 195  ILE B N   1 
ATOM   4267 C  CA  . ILE B 1 211 ? -40.522 -20.984 -66.037 1.00 31.16  ? 195  ILE B CA  1 
ATOM   4268 C  C   . ILE B 1 211 ? -40.442 -19.470 -65.883 1.00 32.88  ? 195  ILE B C   1 
ATOM   4269 O  O   . ILE B 1 211 ? -40.304 -18.755 -66.885 1.00 32.77  ? 195  ILE B O   1 
ATOM   4270 C  CB  . ILE B 1 211 ? -39.180 -21.597 -66.517 1.00 34.41  ? 195  ILE B CB  1 
ATOM   4271 C  CG1 . ILE B 1 211 ? -39.306 -23.111 -66.826 1.00 35.08  ? 195  ILE B CG1 1 
ATOM   4272 C  CG2 . ILE B 1 211 ? -38.065 -21.313 -65.494 1.00 34.29  ? 195  ILE B CG2 1 
ATOM   4273 C  CD1 . ILE B 1 211 ? -38.163 -23.687 -67.646 1.00 40.83  ? 195  ILE B CD1 1 
ATOM   4274 N  N   . VAL B 1 212 ? -40.557 -18.984 -64.641 1.00 28.84  ? 196  VAL B N   1 
ATOM   4275 C  CA  . VAL B 1 212 ? -40.468 -17.542 -64.361 1.00 27.76  ? 196  VAL B CA  1 
ATOM   4276 C  C   . VAL B 1 212 ? -39.014 -17.213 -63.983 1.00 31.75  ? 196  VAL B C   1 
ATOM   4277 O  O   . VAL B 1 212 ? -38.471 -17.895 -63.114 1.00 30.48  ? 196  VAL B O   1 
ATOM   4278 C  CB  . VAL B 1 212 ? -41.500 -17.055 -63.308 1.00 29.99  ? 196  VAL B CB  1 
ATOM   4279 C  CG1 . VAL B 1 212 ? -41.490 -15.527 -63.181 1.00 29.54  ? 196  VAL B CG1 1 
ATOM   4280 C  CG2 . VAL B 1 212 ? -42.907 -17.533 -63.661 1.00 30.12  ? 196  VAL B CG2 1 
ATOM   4281 N  N   . PRO B 1 213 ? -38.346 -16.206 -64.621 1.00 29.55  ? 197  PRO B N   1 
ATOM   4282 C  CA  . PRO B 1 213 ? -36.960 -15.884 -64.233 1.00 28.60  ? 197  PRO B CA  1 
ATOM   4283 C  C   . PRO B 1 213 ? -36.856 -15.558 -62.751 1.00 29.70  ? 197  PRO B C   1 
ATOM   4284 O  O   . PRO B 1 213 ? -37.796 -15.004 -62.172 1.00 27.75  ? 197  PRO B O   1 
ATOM   4285 C  CB  . PRO B 1 213 ? -36.614 -14.657 -65.090 1.00 31.13  ? 197  PRO B CB  1 
ATOM   4286 C  CG  . PRO B 1 213 ? -37.575 -14.683 -66.214 1.00 37.22  ? 197  PRO B CG  1 
ATOM   4287 C  CD  . PRO B 1 213 ? -38.833 -15.278 -65.657 1.00 32.54  ? 197  PRO B CD  1 
ATOM   4288 N  N   . ARG B 1 214 ? -35.729 -15.926 -62.128 1.00 27.55  ? 198  ARG B N   1 
ATOM   4289 C  CA  . ARG B 1 214 ? -35.529 -15.707 -60.688 1.00 26.42  ? 198  ARG B CA  1 
ATOM   4290 C  C   . ARG B 1 214 ? -35.840 -14.282 -60.178 1.00 28.82  ? 198  ARG B C   1 
ATOM   4291 O  O   . ARG B 1 214 ? -36.505 -14.140 -59.137 1.00 25.24  ? 198  ARG B O   1 
ATOM   4292 C  CB  . ARG B 1 214 ? -34.150 -16.211 -60.227 1.00 28.48  ? 198  ARG B CB  1 
ATOM   4293 C  CG  . ARG B 1 214 ? -32.941 -15.509 -60.862 1.00 33.51  ? 198  ARG B CG  1 
ATOM   4294 C  CD  . ARG B 1 214 ? -31.660 -15.877 -60.141 1.00 38.51  ? 198  ARG B CD  1 
ATOM   4295 N  NE  . ARG B 1 214 ? -31.633 -15.326 -58.790 1.00 40.55  ? 198  ARG B NE  1 
ATOM   4296 C  CZ  . ARG B 1 214 ? -31.715 -16.048 -57.678 1.00 51.16  ? 198  ARG B CZ  1 
ATOM   4297 N  NH1 . ARG B 1 214 ? -31.792 -17.372 -57.741 1.00 39.54  ? 198  ARG B NH1 1 
ATOM   4298 N  NH2 . ARG B 1 214 ? -31.710 -15.453 -56.494 1.00 37.92  ? 198  ARG B NH2 1 
ATOM   4299 N  N   . LYS B 1 215 ? -35.409 -13.233 -60.926 1.00 27.23  ? 199  LYS B N   1 
ATOM   4300 C  CA  . LYS B 1 215 ? -35.664 -11.846 -60.521 1.00 26.33  ? 199  LYS B CA  1 
ATOM   4301 C  C   . LYS B 1 215 ? -37.180 -11.545 -60.486 1.00 29.59  ? 199  LYS B C   1 
ATOM   4302 O  O   . LYS B 1 215 ? -37.668 -11.041 -59.481 1.00 29.74  ? 199  LYS B O   1 
ATOM   4303 C  CB  . LYS B 1 215 ? -34.892 -10.849 -61.411 1.00 29.36  ? 199  LYS B CB  1 
ATOM   4304 C  CG  . LYS B 1 215 ? -34.706 -9.485  -60.738 1.00 39.05  ? 199  LYS B CG  1 
ATOM   4305 C  CD  . LYS B 1 215 ? -33.991 -8.500  -61.654 1.00 53.39  ? 199  LYS B CD  1 
ATOM   4306 C  CE  . LYS B 1 215 ? -33.692 -7.197  -60.954 1.00 69.29  ? 199  LYS B CE  1 
ATOM   4307 N  NZ  . LYS B 1 215 ? -32.871 -6.295  -61.806 1.00 82.75  ? 199  LYS B NZ  1 
ATOM   4308 N  N   . GLY B 1 216 ? -37.894 -11.939 -61.540 1.00 28.05  ? 200  GLY B N   1 
ATOM   4309 C  CA  . GLY B 1 216 ? -39.339 -11.771 -61.672 1.00 28.00  ? 200  GLY B CA  1 
ATOM   4310 C  C   . GLY B 1 216 ? -40.161 -12.519 -60.636 1.00 28.57  ? 200  GLY B C   1 
ATOM   4311 O  O   . GLY B 1 216 ? -41.071 -11.941 -60.029 1.00 27.30  ? 200  GLY B O   1 
ATOM   4312 N  N   . ILE B 1 217 ? -39.827 -13.797 -60.389 1.00 22.62  ? 201  ILE B N   1 
ATOM   4313 C  CA  . ILE B 1 217 ? -40.580 -14.555 -59.387 1.00 22.06  ? 201  ILE B CA  1 
ATOM   4314 C  C   . ILE B 1 217 ? -40.388 -14.016 -57.951 1.00 25.44  ? 201  ILE B C   1 
ATOM   4315 O  O   . ILE B 1 217 ? -41.363 -13.982 -57.184 1.00 23.31  ? 201  ILE B O   1 
ATOM   4316 C  CB  . ILE B 1 217 ? -40.353 -16.081 -59.500 1.00 25.00  ? 201  ILE B CB  1 
ATOM   4317 C  CG1 . ILE B 1 217 ? -41.536 -16.888 -58.888 1.00 26.05  ? 201  ILE B CG1 1 
ATOM   4318 C  CG2 . ILE B 1 217 ? -39.001 -16.481 -58.928 1.00 23.64  ? 201  ILE B CG2 1 
ATOM   4319 C  CD1 . ILE B 1 217 ? -42.892 -16.788 -59.689 1.00 31.76  ? 201  ILE B CD1 1 
ATOM   4320 N  N   . LEU B 1 218 ? -39.144 -13.583 -57.598 1.00 22.75  ? 202  LEU B N   1 
ATOM   4321 C  CA  . LEU B 1 218 ? -38.888 -13.041 -56.257 1.00 23.64  ? 202  LEU B CA  1 
ATOM   4322 C  C   . LEU B 1 218 ? -39.646 -11.727 -56.047 1.00 28.26  ? 202  LEU B C   1 
ATOM   4323 O  O   . LEU B 1 218 ? -40.148 -11.484 -54.945 1.00 27.10  ? 202  LEU B O   1 
ATOM   4324 C  CB  . LEU B 1 218 ? -37.386 -12.869 -55.975 1.00 23.24  ? 202  LEU B CB  1 
ATOM   4325 C  CG  . LEU B 1 218 ? -36.559 -14.157 -55.877 1.00 26.31  ? 202  LEU B CG  1 
ATOM   4326 C  CD1 . LEU B 1 218 ? -35.079 -13.843 -55.922 1.00 26.46  ? 202  LEU B CD1 1 
ATOM   4327 C  CD2 . LEU B 1 218 ? -36.904 -14.961 -54.627 1.00 26.67  ? 202  LEU B CD2 1 
ATOM   4328 N  N   . GLU B 1 219 ? -39.777 -10.917 -57.125 1.00 26.87  ? 203  GLU B N   1 
ATOM   4329 C  CA  . GLU B 1 219 ? -40.507 -9.648  -57.124 1.00 27.39  ? 203  GLU B CA  1 
ATOM   4330 C  C   . GLU B 1 219 ? -42.001 -9.930  -56.938 1.00 32.10  ? 203  GLU B C   1 
ATOM   4331 O  O   . GLU B 1 219 ? -42.628 -9.321  -56.065 1.00 29.95  ? 203  GLU B O   1 
ATOM   4332 C  CB  . GLU B 1 219 ? -40.215 -8.864  -58.425 1.00 29.78  ? 203  GLU B CB  1 
ATOM   4333 C  CG  . GLU B 1 219 ? -41.037 -7.599  -58.635 1.00 41.86  ? 203  GLU B CG  1 
ATOM   4334 C  CD  . GLU B 1 219 ? -40.896 -6.488  -57.608 1.00 61.05  ? 203  GLU B CD  1 
ATOM   4335 O  OE1 . GLU B 1 219 ? -39.791 -6.325  -57.041 1.00 53.53  ? 203  GLU B OE1 1 
ATOM   4336 O  OE2 . GLU B 1 219 ? -41.881 -5.740  -57.417 1.00 52.79  ? 203  GLU B OE2 1 
ATOM   4337 N  N   . LEU B 1 220 ? -42.544 -10.916 -57.696 1.00 30.74  ? 204  LEU B N   1 
ATOM   4338 C  CA  . LEU B 1 220 ? -43.943 -11.323 -57.585 1.00 30.01  ? 204  LEU B CA  1 
ATOM   4339 C  C   . LEU B 1 220 ? -44.318 -11.699 -56.152 1.00 32.57  ? 204  LEU B C   1 
ATOM   4340 O  O   . LEU B 1 220 ? -45.350 -11.215 -55.670 1.00 31.61  ? 204  LEU B O   1 
ATOM   4341 C  CB  . LEU B 1 220 ? -44.288 -12.447 -58.576 1.00 30.93  ? 204  LEU B CB  1 
ATOM   4342 C  CG  . LEU B 1 220 ? -45.768 -12.849 -58.700 1.00 35.98  ? 204  LEU B CG  1 
ATOM   4343 C  CD1 . LEU B 1 220 ? -46.679 -11.626 -58.950 1.00 36.14  ? 204  LEU B CD1 1 
ATOM   4344 C  CD2 . LEU B 1 220 ? -45.954 -13.889 -59.777 1.00 37.48  ? 204  LEU B CD2 1 
ATOM   4345 N  N   . ALA B 1 221 ? -43.470 -12.513 -55.459 1.00 27.44  ? 205  ALA B N   1 
ATOM   4346 C  CA  . ALA B 1 221 ? -43.722 -12.925 -54.067 1.00 26.07  ? 205  ALA B CA  1 
ATOM   4347 C  C   . ALA B 1 221 ? -43.835 -11.723 -53.140 1.00 32.21  ? 205  ALA B C   1 
ATOM   4348 O  O   . ALA B 1 221 ? -44.787 -11.652 -52.353 1.00 30.66  ? 205  ALA B O   1 
ATOM   4349 C  CB  . ALA B 1 221 ? -42.640 -13.873 -53.570 1.00 26.13  ? 205  ALA B CB  1 
ATOM   4350 N  N   . ARG B 1 222 ? -42.895 -10.754 -53.279 1.00 29.66  ? 206  ARG B N   1 
ATOM   4351 C  CA  . ARG B 1 222 ? -42.870 -9.513  -52.490 1.00 29.72  ? 206  ARG B CA  1 
ATOM   4352 C  C   . ARG B 1 222 ? -44.131 -8.644  -52.711 1.00 34.36  ? 206  ARG B C   1 
ATOM   4353 O  O   . ARG B 1 222 ? -44.497 -7.881  -51.819 1.00 33.30  ? 206  ARG B O   1 
ATOM   4354 C  CB  . ARG B 1 222 ? -41.597 -8.705  -52.773 1.00 29.15  ? 206  ARG B CB  1 
ATOM   4355 C  CG  . ARG B 1 222 ? -40.332 -9.304  -52.153 1.00 34.57  ? 206  ARG B CG  1 
ATOM   4356 C  CD  . ARG B 1 222 ? -39.136 -8.358  -52.228 1.00 37.47  ? 206  ARG B CD  1 
ATOM   4357 N  NE  . ARG B 1 222 ? -38.842 -7.902  -53.593 1.00 44.33  ? 206  ARG B NE  1 
ATOM   4358 C  CZ  . ARG B 1 222 ? -37.940 -8.457  -54.402 1.00 54.68  ? 206  ARG B CZ  1 
ATOM   4359 N  NH1 . ARG B 1 222 ? -37.221 -9.500  -53.994 1.00 36.98  ? 206  ARG B NH1 1 
ATOM   4360 N  NH2 . ARG B 1 222 ? -37.742 -7.970  -55.617 1.00 41.55  ? 206  ARG B NH2 1 
ATOM   4361 N  N   . LEU B 1 223 ? -44.790 -8.776  -53.878 1.00 32.50  ? 207  LEU B N   1 
ATOM   4362 C  CA  . LEU B 1 223 ? -45.999 -8.022  -54.230 1.00 33.48  ? 207  LEU B CA  1 
ATOM   4363 C  C   . LEU B 1 223 ? -47.293 -8.592  -53.636 1.00 39.24  ? 207  LEU B C   1 
ATOM   4364 O  O   . LEU B 1 223 ? -48.248 -7.843  -53.432 1.00 38.70  ? 207  LEU B O   1 
ATOM   4365 C  CB  . LEU B 1 223 ? -46.130 -7.894  -55.753 1.00 34.42  ? 207  LEU B CB  1 
ATOM   4366 C  CG  . LEU B 1 223 ? -45.106 -6.993  -56.441 1.00 39.30  ? 207  LEU B CG  1 
ATOM   4367 C  CD1 . LEU B 1 223 ? -45.096 -7.234  -57.939 1.00 39.88  ? 207  LEU B CD1 1 
ATOM   4368 C  CD2 . LEU B 1 223 ? -45.366 -5.502  -56.134 1.00 42.55  ? 207  LEU B CD2 1 
ATOM   4369 N  N   . LEU B 1 224 ? -47.333 -9.915  -53.373 1.00 36.74  ? 208  LEU B N   1 
ATOM   4370 C  CA  . LEU B 1 224 ? -48.508 -10.615 -52.829 1.00 37.71  ? 208  LEU B CA  1 
ATOM   4371 C  C   . LEU B 1 224 ? -48.618 -10.406 -51.305 1.00 45.96  ? 208  LEU B C   1 
ATOM   4372 O  O   . LEU B 1 224 ? -48.248 -11.279 -50.516 1.00 46.04  ? 208  LEU B O   1 
ATOM   4373 C  CB  . LEU B 1 224 ? -48.468 -12.108 -53.225 1.00 37.62  ? 208  LEU B CB  1 
ATOM   4374 C  CG  . LEU B 1 224 ? -48.345 -12.410 -54.734 1.00 42.65  ? 208  LEU B CG  1 
ATOM   4375 C  CD1 . LEU B 1 224 ? -47.711 -13.775 -54.975 1.00 42.67  ? 208  LEU B CD1 1 
ATOM   4376 C  CD2 . LEU B 1 224 ? -49.684 -12.283 -55.456 1.00 45.32  ? 208  LEU B CD2 1 
ATOM   4377 N  N   . THR B 1 225 ? -49.105 -9.218  -50.898 1.00 45.60  ? 209  THR B N   1 
ATOM   4378 C  CA  . THR B 1 225 ? -49.214 -8.827  -49.485 1.00 46.51  ? 209  THR B CA  1 
ATOM   4379 C  C   . THR B 1 225 ? -50.621 -8.963  -48.875 1.00 54.04  ? 209  THR B C   1 
ATOM   4380 O  O   . THR B 1 225 ? -50.743 -9.027  -47.648 1.00 53.61  ? 209  THR B O   1 
ATOM   4381 C  CB  . THR B 1 225 ? -48.582 -7.439  -49.237 1.00 52.24  ? 209  THR B CB  1 
ATOM   4382 O  OG1 . THR B 1 225 ? -49.103 -6.509  -50.188 1.00 53.39  ? 209  THR B OG1 1 
ATOM   4383 C  CG2 . THR B 1 225 ? -47.063 -7.458  -49.317 1.00 49.44  ? 209  THR B CG2 1 
ATOM   4384 N  N   . GLU B 1 226 ? -51.669 -8.998  -49.722 1.00 53.51  ? 210  GLU B N   1 
ATOM   4385 C  CA  . GLU B 1 226 ? -53.066 -9.126  -49.299 1.00 54.98  ? 210  GLU B CA  1 
ATOM   4386 C  C   . GLU B 1 226 ? -53.296 -10.459 -48.594 1.00 60.00  ? 210  GLU B C   1 
ATOM   4387 O  O   . GLU B 1 226 ? -53.399 -11.491 -49.262 1.00 59.76  ? 210  GLU B O   1 
ATOM   4388 N  N   . GLN B 1 227 ? -53.342 -10.426 -47.237 1.00 57.32  ? 211  GLN B N   1 
ATOM   4389 C  CA  . GLN B 1 227 ? -53.543 -11.576 -46.338 1.00 57.23  ? 211  GLN B CA  1 
ATOM   4390 C  C   . GLN B 1 227 ? -54.761 -12.429 -46.708 1.00 62.62  ? 211  GLN B C   1 
ATOM   4391 O  O   . GLN B 1 227 ? -54.664 -13.656 -46.702 1.00 62.78  ? 211  GLN B O   1 
ATOM   4392 N  N   . ASP B 1 228 ? -55.891 -11.780 -47.048 1.00 60.15  ? 212  ASP B N   1 
ATOM   4393 C  CA  . ASP B 1 228 ? -57.133 -12.447 -47.461 1.00 61.07  ? 212  ASP B CA  1 
ATOM   4394 C  C   . ASP B 1 228 ? -57.586 -12.028 -48.874 1.00 64.09  ? 212  ASP B C   1 
ATOM   4395 O  O   . ASP B 1 228 ? -58.753 -12.223 -49.244 1.00 65.22  ? 212  ASP B O   1 
ATOM   4396 C  CB  . ASP B 1 228 ? -58.242 -12.240 -46.411 1.00 63.93  ? 212  ASP B CB  1 
ATOM   4397 C  CG  . ASP B 1 228 ? -58.156 -13.215 -45.256 1.00 75.85  ? 212  ASP B CG  1 
ATOM   4398 O  OD1 . ASP B 1 228 ? -58.635 -14.361 -45.411 1.00 76.80  ? 212  ASP B OD1 1 
ATOM   4399 O  OD2 . ASP B 1 228 ? -57.593 -12.839 -44.202 1.00 82.17  ? 212  ASP B OD2 1 
ATOM   4400 N  N   . GLY B 1 229 ? -56.647 -11.480 -49.650 1.00 57.94  ? 213  GLY B N   1 
ATOM   4401 C  CA  . GLY B 1 229 ? -56.889 -11.022 -51.016 1.00 57.24  ? 213  GLY B CA  1 
ATOM   4402 C  C   . GLY B 1 229 ? -56.768 -12.097 -52.079 1.00 58.00  ? 213  GLY B C   1 
ATOM   4403 O  O   . GLY B 1 229 ? -56.290 -13.204 -51.809 1.00 57.67  ? 213  GLY B O   1 
ATOM   4404 N  N   . GLU B 1 230 ? -57.205 -11.767 -53.299 1.00 52.44  ? 214  GLU B N   1 
ATOM   4405 C  CA  . GLU B 1 230 ? -57.164 -12.649 -54.467 1.00 51.94  ? 214  GLU B CA  1 
ATOM   4406 C  C   . GLU B 1 230 ? -56.276 -12.073 -55.575 1.00 53.45  ? 214  GLU B C   1 
ATOM   4407 O  O   . GLU B 1 230 ? -55.981 -10.872 -55.581 1.00 52.81  ? 214  GLU B O   1 
ATOM   4408 C  CB  . GLU B 1 230 ? -58.583 -12.925 -55.000 1.00 54.79  ? 214  GLU B CB  1 
ATOM   4409 N  N   . VAL B 1 231 ? -55.838 -12.944 -56.501 1.00 47.70  ? 215  VAL B N   1 
ATOM   4410 C  CA  . VAL B 1 231 ? -54.989 -12.589 -57.641 1.00 46.00  ? 215  VAL B CA  1 
ATOM   4411 C  C   . VAL B 1 231 ? -55.377 -13.406 -58.866 1.00 48.56  ? 215  VAL B C   1 
ATOM   4412 O  O   . VAL B 1 231 ? -55.511 -14.632 -58.798 1.00 47.88  ? 215  VAL B O   1 
ATOM   4413 C  CB  . VAL B 1 231 ? -53.445 -12.572 -57.336 1.00 48.10  ? 215  VAL B CB  1 
ATOM   4414 C  CG1 . VAL B 1 231 ? -52.936 -13.904 -56.778 1.00 47.11  ? 215  VAL B CG1 1 
ATOM   4415 C  CG2 . VAL B 1 231 ? -52.623 -12.142 -58.555 1.00 47.89  ? 215  VAL B CG2 1 
ATOM   4416 N  N   . GLY B 1 232 ? -55.592 -12.698 -59.962 1.00 44.58  ? 216  GLY B N   1 
ATOM   4417 C  CA  . GLY B 1 232 ? -55.945 -13.280 -61.243 1.00 44.86  ? 216  GLY B CA  1 
ATOM   4418 C  C   . GLY B 1 232 ? -54.683 -13.629 -61.987 1.00 47.12  ? 216  GLY B C   1 
ATOM   4419 O  O   . GLY B 1 232 ? -53.834 -12.762 -62.201 1.00 46.49  ? 216  GLY B O   1 
ATOM   4420 N  N   . ILE B 1 233 ? -54.523 -14.907 -62.339 1.00 42.61  ? 217  ILE B N   1 
ATOM   4421 C  CA  . ILE B 1 233 ? -53.337 -15.361 -63.056 1.00 41.56  ? 217  ILE B CA  1 
ATOM   4422 C  C   . ILE B 1 233 ? -53.663 -15.700 -64.491 1.00 48.18  ? 217  ILE B C   1 
ATOM   4423 O  O   . ILE B 1 233 ? -54.634 -16.418 -64.759 1.00 49.96  ? 217  ILE B O   1 
ATOM   4424 C  CB  . ILE B 1 233 ? -52.592 -16.529 -62.328 1.00 42.47  ? 217  ILE B CB  1 
ATOM   4425 C  CG1 . ILE B 1 233 ? -52.254 -16.196 -60.841 1.00 41.13  ? 217  ILE B CG1 1 
ATOM   4426 C  CG2 . ILE B 1 233 ? -51.353 -17.016 -63.120 1.00 41.49  ? 217  ILE B CG2 1 
ATOM   4427 C  CD1 . ILE B 1 233 ? -51.281 -15.004 -60.578 1.00 43.55  ? 217  ILE B CD1 1 
ATOM   4428 N  N   . VAL B 1 234 ? -52.829 -15.204 -65.411 1.00 45.40  ? 218  VAL B N   1 
ATOM   4429 C  CA  . VAL B 1 234 ? -52.929 -15.493 -66.838 1.00 46.71  ? 218  VAL B CA  1 
ATOM   4430 C  C   . VAL B 1 234 ? -51.592 -16.100 -67.259 1.00 50.72  ? 218  VAL B C   1 
ATOM   4431 O  O   . VAL B 1 234 ? -50.544 -15.464 -67.106 1.00 48.74  ? 218  VAL B O   1 
ATOM   4432 C  CB  . VAL B 1 234 ? -53.298 -14.248 -67.695 1.00 52.57  ? 218  VAL B CB  1 
ATOM   4433 C  CG1 . VAL B 1 234 ? -53.230 -14.565 -69.189 1.00 53.50  ? 218  VAL B CG1 1 
ATOM   4434 C  CG2 . VAL B 1 234 ? -54.670 -13.685 -67.317 1.00 53.20  ? 218  VAL B CG2 1 
ATOM   4435 N  N   . LEU B 1 235 ? -51.627 -17.337 -67.761 1.00 49.32  ? 219  LEU B N   1 
ATOM   4436 C  CA  . LEU B 1 235 ? -50.431 -18.029 -68.232 1.00 49.78  ? 219  LEU B CA  1 
ATOM   4437 C  C   . LEU B 1 235 ? -50.406 -17.927 -69.745 1.00 58.27  ? 219  LEU B C   1 
ATOM   4438 O  O   . LEU B 1 235 ? -51.267 -18.500 -70.419 1.00 59.71  ? 219  LEU B O   1 
ATOM   4439 C  CB  . LEU B 1 235 ? -50.388 -19.514 -67.784 1.00 49.00  ? 219  LEU B CB  1 
ATOM   4440 C  CG  . LEU B 1 235 ? -50.327 -19.831 -66.278 1.00 52.18  ? 219  LEU B CG  1 
ATOM   4441 C  CD1 . LEU B 1 235 ? -50.326 -21.334 -66.048 1.00 52.33  ? 219  LEU B CD1 1 
ATOM   4442 C  CD2 . LEU B 1 235 ? -49.101 -19.213 -65.609 1.00 51.58  ? 219  LEU B CD2 1 
ATOM   4443 N  N   . GLY B 1 236 ? -49.456 -17.150 -70.255 1.00 56.17  ? 220  GLY B N   1 
ATOM   4444 C  CA  . GLY B 1 236 ? -49.266 -16.947 -71.686 1.00 58.03  ? 220  GLY B CA  1 
ATOM   4445 C  C   . GLY B 1 236 ? -48.213 -17.880 -72.245 1.00 63.11  ? 220  GLY B C   1 
ATOM   4446 O  O   . GLY B 1 236 ? -47.693 -18.741 -71.525 1.00 61.19  ? 220  GLY B O   1 
ATOM   4447 N  N   . GLN B 1 237 ? -47.883 -17.707 -73.533 1.00 61.96  ? 221  GLN B N   1 
ATOM   4448 C  CA  . GLN B 1 237 ? -46.883 -18.528 -74.215 1.00 62.48  ? 221  GLN B CA  1 
ATOM   4449 C  C   . GLN B 1 237 ? -45.453 -18.104 -73.866 1.00 63.88  ? 221  GLN B C   1 
ATOM   4450 O  O   . GLN B 1 237 ? -44.602 -18.967 -73.648 1.00 62.93  ? 221  GLN B O   1 
ATOM   4451 C  CB  . GLN B 1 237 ? -47.110 -18.517 -75.738 1.00 66.35  ? 221  GLN B CB  1 
ATOM   4452 N  N   . HIS B 1 238 ? -45.191 -16.783 -73.809 1.00 59.40  ? 222  HIS B N   1 
ATOM   4453 C  CA  . HIS B 1 238 ? -43.868 -16.236 -73.491 1.00 57.50  ? 222  HIS B CA  1 
ATOM   4454 C  C   . HIS B 1 238 ? -43.907 -15.222 -72.331 1.00 56.56  ? 222  HIS B C   1 
ATOM   4455 O  O   . HIS B 1 238 ? -42.905 -14.552 -72.064 1.00 53.54  ? 222  HIS B O   1 
ATOM   4456 C  CB  . HIS B 1 238 ? -43.227 -15.625 -74.749 1.00 60.04  ? 222  HIS B CB  1 
ATOM   4457 N  N   . HIS B 1 239 ? -45.059 -15.141 -71.628 1.00 52.01  ? 223  HIS B N   1 
ATOM   4458 C  CA  . HIS B 1 239 ? -45.281 -14.231 -70.508 1.00 50.15  ? 223  HIS B CA  1 
ATOM   4459 C  C   . HIS B 1 239 ? -46.198 -14.802 -69.421 1.00 48.52  ? 223  HIS B C   1 
ATOM   4460 O  O   . HIS B 1 239 ? -46.985 -15.711 -69.669 1.00 48.41  ? 223  HIS B O   1 
ATOM   4461 C  CB  . HIS B 1 239 ? -45.893 -12.906 -71.021 1.00 52.72  ? 223  HIS B CB  1 
ATOM   4462 C  CG  . HIS B 1 239 ? -44.914 -11.977 -71.668 1.00 57.39  ? 223  HIS B CG  1 
ATOM   4463 N  ND1 . HIS B 1 239 ? -44.599 -12.082 -73.010 1.00 61.04  ? 223  HIS B ND1 1 
ATOM   4464 C  CD2 . HIS B 1 239 ? -44.236 -10.929 -71.140 1.00 59.15  ? 223  HIS B CD2 1 
ATOM   4465 C  CE1 . HIS B 1 239 ? -43.731 -11.113 -73.254 1.00 60.92  ? 223  HIS B CE1 1 
ATOM   4466 N  NE2 . HIS B 1 239 ? -43.486 -10.387 -72.162 1.00 60.06  ? 223  HIS B NE2 1 
ATOM   4467 N  N   . ILE B 1 240 ? -46.109 -14.235 -68.217 1.00 41.50  ? 224  ILE B N   1 
ATOM   4468 C  CA  . ILE B 1 240 ? -47.015 -14.508 -67.110 1.00 39.24  ? 224  ILE B CA  1 
ATOM   4469 C  C   . ILE B 1 240 ? -47.580 -13.152 -66.639 1.00 43.31  ? 224  ILE B C   1 
ATOM   4470 O  O   . ILE B 1 240 ? -46.834 -12.172 -66.541 1.00 42.17  ? 224  ILE B O   1 
ATOM   4471 C  CB  . ILE B 1 240 ? -46.426 -15.378 -65.953 1.00 39.82  ? 224  ILE B CB  1 
ATOM   4472 C  CG1 . ILE B 1 240 ? -47.540 -15.746 -64.931 1.00 39.24  ? 224  ILE B CG1 1 
ATOM   4473 C  CG2 . ILE B 1 240 ? -45.183 -14.713 -65.285 1.00 36.58  ? 224  ILE B CG2 1 
ATOM   4474 C  CD1 . ILE B 1 240 ? -47.118 -16.659 -63.676 1.00 42.58  ? 224  ILE B CD1 1 
ATOM   4475 N  N   . ARG B 1 241 ? -48.896 -13.101 -66.373 1.00 40.91  ? 225  ARG B N   1 
ATOM   4476 C  CA  . ARG B 1 241 ? -49.548 -11.887 -65.900 1.00 41.21  ? 225  ARG B CA  1 
ATOM   4477 C  C   . ARG B 1 241 ? -50.277 -12.157 -64.583 1.00 45.42  ? 225  ARG B C   1 
ATOM   4478 O  O   . ARG B 1 241 ? -51.030 -13.131 -64.464 1.00 46.09  ? 225  ARG B O   1 
ATOM   4479 C  CB  . ARG B 1 241 ? -50.492 -11.301 -66.981 1.00 42.54  ? 225  ARG B CB  1 
ATOM   4480 C  CG  . ARG B 1 241 ? -50.996 -9.890  -66.679 1.00 56.07  ? 225  ARG B CG  1 
ATOM   4481 C  CD  . ARG B 1 241 ? -52.026 -9.412  -67.688 1.00 69.98  ? 225  ARG B CD  1 
ATOM   4482 N  NE  . ARG B 1 241 ? -51.401 -8.894  -68.906 1.00 83.97  ? 225  ARG B NE  1 
ATOM   4483 C  CZ  . ARG B 1 241 ? -51.483 -9.470  -70.102 1.00 102.02 ? 225  ARG B CZ  1 
ATOM   4484 N  NH1 . ARG B 1 241 ? -52.177 -10.592 -70.262 1.00 91.52  ? 225  ARG B NH1 1 
ATOM   4485 N  NH2 . ARG B 1 241 ? -50.877 -8.927  -71.150 1.00 89.83  ? 225  ARG B NH2 1 
ATOM   4486 N  N   . ALA B 1 242 ? -50.013 -11.313 -63.588 1.00 40.25  ? 226  ALA B N   1 
ATOM   4487 C  CA  . ALA B 1 242 ? -50.650 -11.375 -62.275 1.00 40.08  ? 226  ALA B CA  1 
ATOM   4488 C  C   . ALA B 1 242 ? -51.343 -10.032 -62.039 1.00 46.54  ? 226  ALA B C   1 
ATOM   4489 O  O   . ALA B 1 242 ? -50.692 -8.988  -62.140 1.00 45.54  ? 226  ALA B O   1 
ATOM   4490 C  CB  . ALA B 1 242 ? -49.614 -11.650 -61.190 1.00 39.02  ? 226  ALA B CB  1 
ATOM   4491 N  N   . THR B 1 243 ? -52.668 -10.064 -61.775 1.00 45.66  ? 227  THR B N   1 
ATOM   4492 C  CA  . THR B 1 243 ? -53.511 -8.878  -61.566 1.00 46.29  ? 227  THR B CA  1 
ATOM   4493 C  C   . THR B 1 243 ? -54.251 -8.939  -60.215 1.00 51.98  ? 227  THR B C   1 
ATOM   4494 O  O   . THR B 1 243 ? -54.874 -9.958  -59.899 1.00 51.52  ? 227  THR B O   1 
ATOM   4495 C  CB  . THR B 1 243 ? -54.464 -8.688  -62.771 1.00 51.50  ? 227  THR B CB  1 
ATOM   4496 O  OG1 . THR B 1 243 ? -53.750 -8.872  -63.997 1.00 45.98  ? 227  THR B OG1 1 
ATOM   4497 C  CG2 . THR B 1 243 ? -55.156 -7.326  -62.776 1.00 49.88  ? 227  THR B CG2 1 
ATOM   4498 N  N   . THR B 1 244 ? -54.173 -7.844  -59.424 1.00 49.86  ? 228  THR B N   1 
ATOM   4499 C  CA  . THR B 1 244 ? -54.811 -7.710  -58.101 1.00 50.03  ? 228  THR B CA  1 
ATOM   4500 C  C   . THR B 1 244 ? -55.796 -6.512  -58.027 1.00 57.08  ? 228  THR B C   1 
ATOM   4501 O  O   . THR B 1 244 ? -56.228 -6.134  -56.927 1.00 57.24  ? 228  THR B O   1 
ATOM   4502 C  CB  . THR B 1 244 ? -53.747 -7.578  -56.993 1.00 56.57  ? 228  THR B CB  1 
ATOM   4503 O  OG1 . THR B 1 244 ? -52.959 -6.405  -57.229 1.00 55.81  ? 228  THR B OG1 1 
ATOM   4504 C  CG2 . THR B 1 244 ? -52.868 -8.816  -56.850 1.00 52.27  ? 228  THR B CG2 1 
ATOM   4505 N  N   . GLY B 1 245 ? -56.117 -5.919  -59.178 1.00 54.58  ? 229  GLY B N   1 
ATOM   4506 C  CA  . GLY B 1 245 ? -57.008 -4.767  -59.243 1.00 55.99  ? 229  GLY B CA  1 
ATOM   4507 C  C   . GLY B 1 245 ? -56.250 -3.456  -59.167 1.00 61.05  ? 229  GLY B C   1 
ATOM   4508 O  O   . GLY B 1 245 ? -56.498 -2.552  -59.968 1.00 62.50  ? 229  GLY B O   1 
ATOM   4509 N  N   . GLU B 1 246 ? -55.314 -3.344  -58.206 1.00 55.93  ? 230  GLU B N   1 
ATOM   4510 C  CA  . GLU B 1 246 ? -54.464 -2.158  -58.055 1.00 54.97  ? 230  GLU B CA  1 
ATOM   4511 C  C   . GLU B 1 246 ? -53.157 -2.277  -58.848 1.00 55.81  ? 230  GLU B C   1 
ATOM   4512 O  O   . GLU B 1 246 ? -52.637 -1.262  -59.317 1.00 55.56  ? 230  GLU B O   1 
ATOM   4513 C  CB  . GLU B 1 246 ? -54.228 -1.771  -56.582 1.00 55.30  ? 230  GLU B CB  1 
ATOM   4514 C  CG  . GLU B 1 246 ? -53.815 -2.904  -55.658 1.00 67.83  ? 230  GLU B CG  1 
ATOM   4515 C  CD  . GLU B 1 246 ? -53.970 -2.585  -54.181 1.00 93.06  ? 230  GLU B CD  1 
ATOM   4516 O  OE1 . GLU B 1 246 ? -52.938 -2.531  -53.474 1.00 85.17  ? 230  GLU B OE1 1 
ATOM   4517 O  OE2 . GLU B 1 246 ? -55.121 -2.385  -53.729 1.00 92.08  ? 230  GLU B OE2 1 
ATOM   4518 N  N   . PHE B 1 247 ? -52.653 -3.513  -59.036 1.00 49.00  ? 231  PHE B N   1 
ATOM   4519 C  CA  . PHE B 1 247 ? -51.427 -3.731  -59.796 1.00 47.15  ? 231  PHE B CA  1 
ATOM   4520 C  C   . PHE B 1 247 ? -51.535 -4.759  -60.909 1.00 49.23  ? 231  PHE B C   1 
ATOM   4521 O  O   . PHE B 1 247 ? -52.341 -5.691  -60.830 1.00 49.24  ? 231  PHE B O   1 
ATOM   4522 C  CB  . PHE B 1 247 ? -50.230 -4.023  -58.874 1.00 47.63  ? 231  PHE B CB  1 
ATOM   4523 N  N   . THR B 1 248 ? -50.727 -4.567  -61.964 1.00 44.03  ? 232  THR B N   1 
ATOM   4524 C  CA  . THR B 1 248 ? -50.603 -5.481  -63.091 1.00 43.69  ? 232  THR B CA  1 
ATOM   4525 C  C   . THR B 1 248 ? -49.121 -5.795  -63.240 1.00 44.65  ? 232  THR B C   1 
ATOM   4526 O  O   . THR B 1 248 ? -48.326 -4.917  -63.583 1.00 42.12  ? 232  THR B O   1 
ATOM   4527 C  CB  . THR B 1 248 ? -51.307 -4.967  -64.364 1.00 53.26  ? 232  THR B CB  1 
ATOM   4528 O  OG1 . THR B 1 248 ? -52.706 -4.826  -64.096 1.00 53.19  ? 232  THR B OG1 1 
ATOM   4529 C  CG2 . THR B 1 248 ? -51.123 -5.909  -65.555 1.00 52.65  ? 232  THR B CG2 1 
ATOM   4530 N  N   . PHE B 1 249 ? -48.748 -7.042  -62.901 1.00 39.93  ? 233  PHE B N   1 
ATOM   4531 C  CA  . PHE B 1 249 ? -47.376 -7.518  -62.981 1.00 39.10  ? 233  PHE B CA  1 
ATOM   4532 C  C   . PHE B 1 249 ? -47.256 -8.390  -64.213 1.00 42.76  ? 233  PHE B C   1 
ATOM   4533 O  O   . PHE B 1 249 ? -48.033 -9.340  -64.380 1.00 41.26  ? 233  PHE B O   1 
ATOM   4534 C  CB  . PHE B 1 249 ? -46.994 -8.298  -61.701 1.00 40.43  ? 233  PHE B CB  1 
ATOM   4535 C  CG  . PHE B 1 249 ? -45.682 -9.050  -61.764 1.00 42.81  ? 233  PHE B CG  1 
ATOM   4536 C  CD1 . PHE B 1 249 ? -44.488 -8.431  -61.407 1.00 46.28  ? 233  PHE B CD1 1 
ATOM   4537 C  CD2 . PHE B 1 249 ? -45.636 -10.369 -62.208 1.00 46.09  ? 233  PHE B CD2 1 
ATOM   4538 C  CE1 . PHE B 1 249 ? -43.275 -9.130  -61.460 1.00 46.98  ? 233  PHE B CE1 1 
ATOM   4539 C  CE2 . PHE B 1 249 ? -44.421 -11.061 -62.279 1.00 48.66  ? 233  PHE B CE2 1 
ATOM   4540 C  CZ  . PHE B 1 249 ? -43.250 -10.438 -61.895 1.00 46.04  ? 233  PHE B CZ  1 
ATOM   4541 N  N   . THR B 1 250 ? -46.278 -8.083  -65.067 1.00 39.62  ? 234  THR B N   1 
ATOM   4542 C  CA  . THR B 1 250 ? -46.025 -8.859  -66.276 1.00 39.95  ? 234  THR B CA  1 
ATOM   4543 C  C   . THR B 1 250 ? -44.565 -9.247  -66.313 1.00 40.89  ? 234  THR B C   1 
ATOM   4544 O  O   . THR B 1 250 ? -43.689 -8.399  -66.136 1.00 39.24  ? 234  THR B O   1 
ATOM   4545 C  CB  . THR B 1 250 ? -46.511 -8.111  -67.535 1.00 48.16  ? 234  THR B CB  1 
ATOM   4546 O  OG1 . THR B 1 250 ? -47.892 -7.786  -67.357 1.00 46.55  ? 234  THR B OG1 1 
ATOM   4547 C  CG2 . THR B 1 250 ? -46.344 -8.932  -68.821 1.00 50.16  ? 234  THR B CG2 1 
ATOM   4548 N  N   . SER B 1 251 ? -44.304 -10.538 -66.502 1.00 36.51  ? 235  SER B N   1 
ATOM   4549 C  CA  . SER B 1 251 ? -42.940 -11.040 -66.578 1.00 35.30  ? 235  SER B CA  1 
ATOM   4550 C  C   . SER B 1 251 ? -42.754 -11.876 -67.812 1.00 39.50  ? 235  SER B C   1 
ATOM   4551 O  O   . SER B 1 251 ? -43.662 -12.627 -68.194 1.00 39.26  ? 235  SER B O   1 
ATOM   4552 C  CB  . SER B 1 251 ? -42.592 -11.864 -65.340 1.00 35.95  ? 235  SER B CB  1 
ATOM   4553 O  OG  . SER B 1 251 ? -41.249 -12.317 -65.394 1.00 39.43  ? 235  SER B OG  1 
ATOM   4554 N  N   . LYS B 1 252 ? -41.559 -11.790 -68.415 1.00 36.23  ? 236  LYS B N   1 
ATOM   4555 C  CA  . LYS B 1 252 ? -41.209 -12.637 -69.549 1.00 37.64  ? 236  LYS B CA  1 
ATOM   4556 C  C   . LYS B 1 252 ? -40.947 -14.037 -68.985 1.00 39.84  ? 236  LYS B C   1 
ATOM   4557 O  O   . LYS B 1 252 ? -40.685 -14.164 -67.787 1.00 35.67  ? 236  LYS B O   1 
ATOM   4558 C  CB  . LYS B 1 252 ? -39.950 -12.120 -70.252 1.00 42.23  ? 236  LYS B CB  1 
ATOM   4559 N  N   . LEU B 1 253 ? -41.056 -15.076 -69.825 1.00 38.25  ? 237  LEU B N   1 
ATOM   4560 C  CA  . LEU B 1 253 ? -40.804 -16.452 -69.390 1.00 38.86  ? 237  LEU B CA  1 
ATOM   4561 C  C   . LEU B 1 253 ? -39.453 -16.908 -69.887 1.00 44.14  ? 237  LEU B C   1 
ATOM   4562 O  O   . LEU B 1 253 ? -38.969 -16.401 -70.900 1.00 46.85  ? 237  LEU B O   1 
ATOM   4563 C  CB  . LEU B 1 253 ? -41.910 -17.423 -69.863 1.00 39.57  ? 237  LEU B CB  1 
ATOM   4564 C  CG  . LEU B 1 253 ? -43.346 -17.158 -69.368 1.00 43.46  ? 237  LEU B CG  1 
ATOM   4565 C  CD1 . LEU B 1 253 ? -44.310 -18.163 -69.953 1.00 43.86  ? 237  LEU B CD1 1 
ATOM   4566 C  CD2 . LEU B 1 253 ? -43.446 -17.120 -67.823 1.00 44.44  ? 237  LEU B CD2 1 
ATOM   4567 N  N   . VAL B 1 254 ? -38.839 -17.849 -69.169 1.00 39.63  ? 238  VAL B N   1 
ATOM   4568 C  CA  . VAL B 1 254 ? -37.557 -18.448 -69.542 1.00 40.01  ? 238  VAL B CA  1 
ATOM   4569 C  C   . VAL B 1 254 ? -37.906 -19.446 -70.642 1.00 43.93  ? 238  VAL B C   1 
ATOM   4570 O  O   . VAL B 1 254 ? -38.681 -20.380 -70.397 1.00 43.22  ? 238  VAL B O   1 
ATOM   4571 C  CB  . VAL B 1 254 ? -36.837 -19.130 -68.345 1.00 42.86  ? 238  VAL B CB  1 
ATOM   4572 C  CG1 . VAL B 1 254 ? -35.543 -19.811 -68.793 1.00 43.43  ? 238  VAL B CG1 1 
ATOM   4573 C  CG2 . VAL B 1 254 ? -36.561 -18.135 -67.216 1.00 41.41  ? 238  VAL B CG2 1 
ATOM   4574 N  N   . ASP B 1 255 ? -37.385 -19.213 -71.859 1.00 41.92  ? 239  ASP B N   1 
ATOM   4575 C  CA  . ASP B 1 255 ? -37.657 -20.065 -73.018 1.00 43.80  ? 239  ASP B CA  1 
ATOM   4576 C  C   . ASP B 1 255 ? -36.864 -21.377 -73.003 1.00 46.65  ? 239  ASP B C   1 
ATOM   4577 O  O   . ASP B 1 255 ? -35.886 -21.541 -73.740 1.00 46.33  ? 239  ASP B O   1 
ATOM   4578 C  CB  . ASP B 1 255 ? -37.472 -19.282 -74.339 1.00 48.22  ? 239  ASP B CB  1 
ATOM   4579 C  CG  . ASP B 1 255 ? -38.084 -19.932 -75.574 1.00 59.65  ? 239  ASP B CG  1 
ATOM   4580 O  OD1 . ASP B 1 255 ? -38.717 -21.013 -75.437 1.00 60.83  ? 239  ASP B OD1 1 
ATOM   4581 O  OD2 . ASP B 1 255 ? -37.955 -19.349 -76.674 1.00 63.59  ? 239  ASP B OD2 1 
ATOM   4582 N  N   . GLY B 1 256 ? -37.334 -22.317 -72.190 1.00 42.96  ? 240  GLY B N   1 
ATOM   4583 C  CA  . GLY B 1 256 ? -36.748 -23.646 -72.081 1.00 43.01  ? 240  GLY B CA  1 
ATOM   4584 C  C   . GLY B 1 256 ? -37.658 -24.641 -71.391 1.00 46.04  ? 240  GLY B C   1 
ATOM   4585 O  O   . GLY B 1 256 ? -38.711 -24.268 -70.857 1.00 45.66  ? 240  GLY B O   1 
ATOM   4586 N  N   . LYS B 1 257 ? -37.259 -25.914 -71.413 1.00 42.17  ? 241  LYS B N   1 
ATOM   4587 C  CA  . LYS B 1 257 ? -37.996 -26.990 -70.765 1.00 41.45  ? 241  LYS B CA  1 
ATOM   4588 C  C   . LYS B 1 257 ? -37.342 -27.265 -69.420 1.00 43.86  ? 241  LYS B C   1 
ATOM   4589 O  O   . LYS B 1 257 ? -36.115 -27.437 -69.326 1.00 43.37  ? 241  LYS B O   1 
ATOM   4590 C  CB  . LYS B 1 257 ? -38.032 -28.271 -71.633 1.00 45.56  ? 241  LYS B CB  1 
ATOM   4591 N  N   . PHE B 1 258 ? -38.155 -27.279 -68.369 1.00 38.47  ? 242  PHE B N   1 
ATOM   4592 C  CA  . PHE B 1 258 ? -37.638 -27.562 -67.044 1.00 35.56  ? 242  PHE B CA  1 
ATOM   4593 C  C   . PHE B 1 258 ? -37.244 -29.056 -66.996 1.00 41.39  ? 242  PHE B C   1 
ATOM   4594 O  O   . PHE B 1 258 ? -37.918 -29.853 -67.662 1.00 41.38  ? 242  PHE B O   1 
ATOM   4595 C  CB  . PHE B 1 258 ? -38.691 -27.225 -65.978 1.00 35.06  ? 242  PHE B CB  1 
ATOM   4596 C  CG  . PHE B 1 258 ? -38.087 -26.991 -64.614 1.00 33.27  ? 242  PHE B CG  1 
ATOM   4597 C  CD1 . PHE B 1 258 ? -37.443 -25.796 -64.317 1.00 33.48  ? 242  PHE B CD1 1 
ATOM   4598 C  CD2 . PHE B 1 258 ? -38.150 -27.974 -63.626 1.00 33.72  ? 242  PHE B CD2 1 
ATOM   4599 C  CE1 . PHE B 1 258 ? -36.882 -25.581 -63.053 1.00 33.14  ? 242  PHE B CE1 1 
ATOM   4600 C  CE2 . PHE B 1 258 ? -37.573 -27.763 -62.369 1.00 34.15  ? 242  PHE B CE2 1 
ATOM   4601 C  CZ  . PHE B 1 258 ? -36.949 -26.564 -62.090 1.00 31.22  ? 242  PHE B CZ  1 
ATOM   4602 N  N   . PRO B 1 259 ? -36.137 -29.457 -66.307 1.00 38.72  ? 243  PRO B N   1 
ATOM   4603 C  CA  . PRO B 1 259 ? -35.766 -30.895 -66.285 1.00 39.42  ? 243  PRO B CA  1 
ATOM   4604 C  C   . PRO B 1 259 ? -36.876 -31.789 -65.758 1.00 42.81  ? 243  PRO B C   1 
ATOM   4605 O  O   . PRO B 1 259 ? -37.766 -31.321 -65.040 1.00 40.60  ? 243  PRO B O   1 
ATOM   4606 C  CB  . PRO B 1 259 ? -34.566 -30.947 -65.327 1.00 40.36  ? 243  PRO B CB  1 
ATOM   4607 C  CG  . PRO B 1 259 ? -34.025 -29.569 -65.310 1.00 44.40  ? 243  PRO B CG  1 
ATOM   4608 C  CD  . PRO B 1 259 ? -35.196 -28.651 -65.501 1.00 39.52  ? 243  PRO B CD  1 
ATOM   4609 N  N   . ASP B 1 260 ? -36.809 -33.090 -66.097 1.00 41.28  ? 244  ASP B N   1 
ATOM   4610 C  CA  . ASP B 1 260 ? -37.760 -34.077 -65.605 1.00 41.19  ? 244  ASP B CA  1 
ATOM   4611 C  C   . ASP B 1 260 ? -37.374 -34.305 -64.128 1.00 43.91  ? 244  ASP B C   1 
ATOM   4612 O  O   . ASP B 1 260 ? -36.611 -35.229 -63.814 1.00 42.51  ? 244  ASP B O   1 
ATOM   4613 C  CB  . ASP B 1 260 ? -37.666 -35.371 -66.451 1.00 44.31  ? 244  ASP B CB  1 
ATOM   4614 C  CG  . ASP B 1 260 ? -38.704 -36.443 -66.155 1.00 54.41  ? 244  ASP B CG  1 
ATOM   4615 O  OD1 . ASP B 1 260 ? -39.532 -36.241 -65.226 1.00 53.28  ? 244  ASP B OD1 1 
ATOM   4616 O  OD2 . ASP B 1 260 ? -38.692 -37.485 -66.850 1.00 61.58  ? 244  ASP B OD2 1 
ATOM   4617 N  N   . TYR B 1 261 ? -37.852 -33.390 -63.244 1.00 40.52  ? 245  TYR B N   1 
ATOM   4618 C  CA  . TYR B 1 261 ? -37.584 -33.368 -61.799 1.00 39.52  ? 245  TYR B CA  1 
ATOM   4619 C  C   . TYR B 1 261 ? -38.082 -34.629 -61.075 1.00 47.00  ? 245  TYR B C   1 
ATOM   4620 O  O   . TYR B 1 261 ? -37.501 -35.011 -60.056 1.00 46.25  ? 245  TYR B O   1 
ATOM   4621 C  CB  . TYR B 1 261 ? -38.137 -32.078 -61.127 1.00 39.02  ? 245  TYR B CB  1 
ATOM   4622 C  CG  . TYR B 1 261 ? -39.646 -31.958 -61.176 1.00 39.09  ? 245  TYR B CG  1 
ATOM   4623 C  CD1 . TYR B 1 261 ? -40.445 -32.538 -60.190 1.00 39.92  ? 245  TYR B CD1 1 
ATOM   4624 C  CD2 . TYR B 1 261 ? -40.280 -31.264 -62.206 1.00 39.99  ? 245  TYR B CD2 1 
ATOM   4625 C  CE1 . TYR B 1 261 ? -41.836 -32.473 -60.255 1.00 40.17  ? 245  TYR B CE1 1 
ATOM   4626 C  CE2 . TYR B 1 261 ? -41.670 -31.192 -62.282 1.00 40.95  ? 245  TYR B CE2 1 
ATOM   4627 C  CZ  . TYR B 1 261 ? -42.444 -31.795 -61.300 1.00 48.15  ? 245  TYR B CZ  1 
ATOM   4628 O  OH  . TYR B 1 261 ? -43.813 -31.732 -61.366 1.00 51.43  ? 245  TYR B OH  1 
ATOM   4629 N  N   . GLU B 1 262 ? -39.165 -35.258 -61.593 1.00 46.42  ? 246  GLU B N   1 
ATOM   4630 C  CA  . GLU B 1 262 ? -39.763 -36.488 -61.040 1.00 47.44  ? 246  GLU B CA  1 
ATOM   4631 C  C   . GLU B 1 262 ? -38.733 -37.621 -60.925 1.00 53.68  ? 246  GLU B C   1 
ATOM   4632 O  O   . GLU B 1 262 ? -38.834 -38.434 -60.010 1.00 53.16  ? 246  GLU B O   1 
ATOM   4633 C  CB  . GLU B 1 262 ? -40.975 -36.950 -61.872 1.00 49.70  ? 246  GLU B CB  1 
ATOM   4634 C  CG  . GLU B 1 262 ? -42.176 -36.022 -61.796 1.00 61.17  ? 246  GLU B CG  1 
ATOM   4635 C  CD  . GLU B 1 262 ? -42.317 -35.018 -62.928 1.00 90.35  ? 246  GLU B CD  1 
ATOM   4636 O  OE1 . GLU B 1 262 ? -41.290 -34.449 -63.369 1.00 82.26  ? 246  GLU B OE1 1 
ATOM   4637 O  OE2 . GLU B 1 262 ? -43.469 -34.780 -63.358 1.00 89.26  ? 246  GLU B OE2 1 
ATOM   4638 N  N   . ARG B 1 263 ? -37.730 -37.643 -61.830 1.00 52.39  ? 247  ARG B N   1 
ATOM   4639 C  CA  . ARG B 1 263 ? -36.643 -38.629 -61.852 1.00 53.15  ? 247  ARG B CA  1 
ATOM   4640 C  C   . ARG B 1 263 ? -35.494 -38.271 -60.882 1.00 56.64  ? 247  ARG B C   1 
ATOM   4641 O  O   . ARG B 1 263 ? -34.630 -39.113 -60.624 1.00 57.17  ? 247  ARG B O   1 
ATOM   4642 C  CB  . ARG B 1 263 ? -36.115 -38.812 -63.290 1.00 55.68  ? 247  ARG B CB  1 
ATOM   4643 N  N   . VAL B 1 264 ? -35.489 -37.038 -60.345 1.00 52.09  ? 248  VAL B N   1 
ATOM   4644 C  CA  . VAL B 1 264 ? -34.467 -36.555 -59.404 1.00 50.56  ? 248  VAL B CA  1 
ATOM   4645 C  C   . VAL B 1 264 ? -34.903 -36.860 -57.947 1.00 49.30  ? 248  VAL B C   1 
ATOM   4646 O  O   . VAL B 1 264 ? -34.065 -36.898 -57.034 1.00 48.28  ? 248  VAL B O   1 
ATOM   4647 C  CB  . VAL B 1 264 ? -34.133 -35.050 -59.653 1.00 55.51  ? 248  VAL B CB  1 
ATOM   4648 C  CG1 . VAL B 1 264 ? -33.012 -34.548 -58.741 1.00 55.26  ? 248  VAL B CG1 1 
ATOM   4649 C  CG2 . VAL B 1 264 ? -33.766 -34.803 -61.116 1.00 56.56  ? 248  VAL B CG2 1 
ATOM   4650 N  N   . LEU B 1 265 ? -36.209 -37.111 -57.746 1.00 41.07  ? 249  LEU B N   1 
ATOM   4651 C  CA  . LEU B 1 265 ? -36.765 -37.388 -56.429 1.00 37.96  ? 249  LEU B CA  1 
ATOM   4652 C  C   . LEU B 1 265 ? -36.319 -38.771 -55.904 1.00 37.26  ? 249  LEU B C   1 
ATOM   4653 O  O   . LEU B 1 265 ? -36.510 -39.776 -56.597 1.00 34.15  ? 249  LEU B O   1 
ATOM   4654 C  CB  . LEU B 1 265 ? -38.300 -37.228 -56.420 1.00 38.32  ? 249  LEU B CB  1 
ATOM   4655 C  CG  . LEU B 1 265 ? -38.870 -35.889 -56.964 1.00 43.97  ? 249  LEU B CG  1 
ATOM   4656 C  CD1 . LEU B 1 265 ? -40.386 -35.881 -56.910 1.00 45.06  ? 249  LEU B CD1 1 
ATOM   4657 C  CD2 . LEU B 1 265 ? -38.322 -34.677 -56.205 1.00 44.66  ? 249  LEU B CD2 1 
ATOM   4658 N  N   . PRO B 1 266 ? -35.647 -38.821 -54.725 1.00 31.68  ? 250  PRO B N   1 
ATOM   4659 C  CA  . PRO B 1 266 ? -35.194 -40.122 -54.197 1.00 30.97  ? 250  PRO B CA  1 
ATOM   4660 C  C   . PRO B 1 266 ? -36.386 -41.010 -53.843 1.00 36.04  ? 250  PRO B C   1 
ATOM   4661 O  O   . PRO B 1 266 ? -37.358 -40.540 -53.249 1.00 34.60  ? 250  PRO B O   1 
ATOM   4662 C  CB  . PRO B 1 266 ? -34.340 -39.744 -52.980 1.00 31.65  ? 250  PRO B CB  1 
ATOM   4663 C  CG  . PRO B 1 266 ? -34.825 -38.403 -52.574 1.00 35.01  ? 250  PRO B CG  1 
ATOM   4664 C  CD  . PRO B 1 266 ? -35.315 -37.711 -53.800 1.00 31.62  ? 250  PRO B CD  1 
ATOM   4665 N  N   . ARG B 1 267 ? -36.339 -42.266 -54.306 1.00 35.50  ? 251  ARG B N   1 
ATOM   4666 C  CA  . ARG B 1 267 ? -37.388 -43.265 -54.106 1.00 36.81  ? 251  ARG B CA  1 
ATOM   4667 C  C   . ARG B 1 267 ? -36.924 -44.407 -53.203 1.00 42.04  ? 251  ARG B C   1 
ATOM   4668 O  O   . ARG B 1 267 ? -37.761 -45.111 -52.645 1.00 43.23  ? 251  ARG B O   1 
ATOM   4669 C  CB  . ARG B 1 267 ? -37.876 -43.809 -55.468 1.00 38.06  ? 251  ARG B CB  1 
ATOM   4670 N  N   . GLY B 1 268 ? -35.607 -44.556 -53.058 1.00 39.26  ? 252  GLY B N   1 
ATOM   4671 C  CA  . GLY B 1 268 ? -34.963 -45.593 -52.260 1.00 40.02  ? 252  GLY B CA  1 
ATOM   4672 C  C   . GLY B 1 268 ? -35.234 -45.563 -50.765 1.00 43.87  ? 252  GLY B C   1 
ATOM   4673 O  O   . GLY B 1 268 ? -35.431 -46.625 -50.163 1.00 46.12  ? 252  GLY B O   1 
ATOM   4674 N  N   . GLY B 1 269 ? -35.260 -44.352 -50.192 1.00 35.34  ? 253  GLY B N   1 
ATOM   4675 C  CA  . GLY B 1 269 ? -35.456 -44.045 -48.771 1.00 33.02  ? 253  GLY B CA  1 
ATOM   4676 C  C   . GLY B 1 269 ? -35.955 -45.141 -47.846 1.00 33.66  ? 253  GLY B C   1 
ATOM   4677 O  O   . GLY B 1 269 ? -37.115 -45.540 -47.930 1.00 36.34  ? 253  GLY B O   1 
ATOM   4678 N  N   . ASP B 1 270 ? -35.092 -45.621 -46.951 1.00 26.12  ? 254  ASP B N   1 
ATOM   4679 C  CA  . ASP B 1 270 ? -35.421 -46.697 -45.995 1.00 25.57  ? 254  ASP B CA  1 
ATOM   4680 C  C   . ASP B 1 270 ? -35.290 -46.249 -44.535 1.00 27.65  ? 254  ASP B C   1 
ATOM   4681 O  O   . ASP B 1 270 ? -35.562 -47.024 -43.616 1.00 26.31  ? 254  ASP B O   1 
ATOM   4682 C  CB  . ASP B 1 270 ? -34.526 -47.932 -46.260 1.00 27.68  ? 254  ASP B CB  1 
ATOM   4683 C  CG  . ASP B 1 270 ? -33.017 -47.688 -46.197 1.00 36.62  ? 254  ASP B CG  1 
ATOM   4684 O  OD1 . ASP B 1 270 ? -32.604 -46.533 -45.979 1.00 39.50  ? 254  ASP B OD1 1 
ATOM   4685 O  OD2 . ASP B 1 270 ? -32.257 -48.651 -46.355 1.00 38.19  ? 254  ASP B OD2 1 
ATOM   4686 N  N   . LYS B 1 271 ? -34.836 -45.014 -44.321 1.00 22.34  ? 255  LYS B N   1 
ATOM   4687 C  CA  . LYS B 1 271 ? -34.645 -44.479 -42.974 1.00 21.79  ? 255  LYS B CA  1 
ATOM   4688 C  C   . LYS B 1 271 ? -35.475 -43.225 -42.765 1.00 25.29  ? 255  LYS B C   1 
ATOM   4689 O  O   . LYS B 1 271 ? -35.287 -42.256 -43.496 1.00 25.96  ? 255  LYS B O   1 
ATOM   4690 C  CB  . LYS B 1 271 ? -33.160 -44.196 -42.703 1.00 22.99  ? 255  LYS B CB  1 
ATOM   4691 C  CG  . LYS B 1 271 ? -32.306 -45.435 -42.770 1.00 19.88  ? 255  LYS B CG  1 
ATOM   4692 C  CD  . LYS B 1 271 ? -30.810 -45.145 -42.731 1.00 24.57  ? 255  LYS B CD  1 
ATOM   4693 C  CE  . LYS B 1 271 ? -29.998 -46.408 -42.939 1.00 24.63  ? 255  LYS B CE  1 
ATOM   4694 N  NZ  . LYS B 1 271 ? -30.088 -46.927 -44.347 1.00 28.48  ? 255  LYS B NZ  1 
ATOM   4695 N  N   . LEU B 1 272 ? -36.401 -43.259 -41.790 1.00 21.99  ? 256  LEU B N   1 
ATOM   4696 C  CA  . LEU B 1 272 ? -37.260 -42.131 -41.418 1.00 22.27  ? 256  LEU B CA  1 
ATOM   4697 C  C   . LEU B 1 272 ? -36.769 -41.531 -40.103 1.00 25.26  ? 256  LEU B C   1 
ATOM   4698 O  O   . LEU B 1 272 ? -36.810 -42.187 -39.059 1.00 24.22  ? 256  LEU B O   1 
ATOM   4699 C  CB  . LEU B 1 272 ? -38.751 -42.524 -41.325 1.00 23.46  ? 256  LEU B CB  1 
ATOM   4700 C  CG  . LEU B 1 272 ? -39.721 -41.457 -40.744 1.00 28.61  ? 256  LEU B CG  1 
ATOM   4701 C  CD1 . LEU B 1 272 ? -39.796 -40.166 -41.643 1.00 27.87  ? 256  LEU B CD1 1 
ATOM   4702 C  CD2 . LEU B 1 272 ? -41.106 -42.049 -40.520 1.00 30.64  ? 256  LEU B CD2 1 
ATOM   4703 N  N   . VAL B 1 273 ? -36.335 -40.265 -40.150 1.00 20.56  ? 257  VAL B N   1 
ATOM   4704 C  CA  . VAL B 1 273 ? -35.843 -39.564 -38.960 1.00 20.60  ? 257  VAL B CA  1 
ATOM   4705 C  C   . VAL B 1 273 ? -36.795 -38.414 -38.694 1.00 23.62  ? 257  VAL B C   1 
ATOM   4706 O  O   . VAL B 1 273 ? -37.042 -37.601 -39.597 1.00 21.99  ? 257  VAL B O   1 
ATOM   4707 C  CB  . VAL B 1 273 ? -34.391 -39.038 -39.174 1.00 24.66  ? 257  VAL B CB  1 
ATOM   4708 C  CG1 . VAL B 1 273 ? -33.882 -38.285 -37.940 1.00 24.30  ? 257  VAL B CG1 1 
ATOM   4709 C  CG2 . VAL B 1 273 ? -33.450 -40.180 -39.538 1.00 25.04  ? 257  VAL B CG2 1 
ATOM   4710 N  N   . VAL B 1 274 ? -37.330 -38.348 -37.476 1.00 19.22  ? 258  VAL B N   1 
ATOM   4711 C  CA  . VAL B 1 274 ? -38.226 -37.253 -37.084 1.00 19.92  ? 258  VAL B CA  1 
ATOM   4712 C  C   . VAL B 1 274 ? -37.496 -36.464 -35.995 1.00 22.87  ? 258  VAL B C   1 
ATOM   4713 O  O   . VAL B 1 274 ? -37.136 -37.021 -34.946 1.00 21.94  ? 258  VAL B O   1 
ATOM   4714 C  CB  . VAL B 1 274 ? -39.650 -37.711 -36.644 1.00 24.92  ? 258  VAL B CB  1 
ATOM   4715 C  CG1 . VAL B 1 274 ? -40.556 -36.502 -36.376 1.00 25.01  ? 258  VAL B CG1 1 
ATOM   4716 C  CG2 . VAL B 1 274 ? -40.290 -38.632 -37.691 1.00 25.24  ? 258  VAL B CG2 1 
ATOM   4717 N  N   . GLY B 1 275 ? -37.271 -35.188 -36.265 1.00 19.86  ? 259  GLY B N   1 
ATOM   4718 C  CA  . GLY B 1 275 ? -36.550 -34.336 -35.332 1.00 19.14  ? 259  GLY B CA  1 
ATOM   4719 C  C   . GLY B 1 275 ? -37.183 -32.983 -35.125 1.00 21.25  ? 259  GLY B C   1 
ATOM   4720 O  O   . GLY B 1 275 ? -38.075 -32.575 -35.879 1.00 18.16  ? 259  GLY B O   1 
ATOM   4721 N  N   . ASP B 1 276 ? -36.678 -32.273 -34.120 1.00 17.50  ? 260  ASP B N   1 
ATOM   4722 C  CA  . ASP B 1 276 ? -37.130 -30.933 -33.804 1.00 17.04  ? 260  ASP B CA  1 
ATOM   4723 C  C   . ASP B 1 276 ? -36.502 -29.951 -34.812 1.00 19.27  ? 260  ASP B C   1 
ATOM   4724 O  O   . ASP B 1 276 ? -35.273 -29.874 -34.891 1.00 16.44  ? 260  ASP B O   1 
ATOM   4725 C  CB  . ASP B 1 276 ? -36.775 -30.561 -32.359 1.00 17.95  ? 260  ASP B CB  1 
ATOM   4726 C  CG  . ASP B 1 276 ? -37.433 -29.244 -32.000 1.00 22.77  ? 260  ASP B CG  1 
ATOM   4727 O  OD1 . ASP B 1 276 ? -38.670 -29.234 -31.826 1.00 23.68  ? 260  ASP B OD1 1 
ATOM   4728 O  OD2 . ASP B 1 276 ? -36.732 -28.203 -32.019 1.00 18.75  ? 260  ASP B OD2 1 
ATOM   4729 N  N   . ARG B 1 277 ? -37.331 -29.265 -35.626 1.00 16.19  ? 261  ARG B N   1 
ATOM   4730 C  CA  . ARG B 1 277 ? -36.840 -28.320 -36.650 1.00 15.76  ? 261  ARG B CA  1 
ATOM   4731 C  C   . ARG B 1 277 ? -35.834 -27.307 -36.082 1.00 17.96  ? 261  ARG B C   1 
ATOM   4732 O  O   . ARG B 1 277 ? -34.723 -27.172 -36.607 1.00 16.62  ? 261  ARG B O   1 
ATOM   4733 C  CB  . ARG B 1 277 ? -38.016 -27.600 -37.354 1.00 17.35  ? 261  ARG B CB  1 
ATOM   4734 C  CG  . ARG B 1 277 ? -37.601 -26.724 -38.540 1.00 22.63  ? 261  ARG B CG  1 
ATOM   4735 C  CD  . ARG B 1 277 ? -38.460 -25.459 -38.666 1.00 19.43  ? 261  ARG B CD  1 
ATOM   4736 N  NE  . ARG B 1 277 ? -38.134 -24.467 -37.626 1.00 20.97  ? 261  ARG B NE  1 
ATOM   4737 C  CZ  . ARG B 1 277 ? -37.139 -23.578 -37.683 1.00 29.89  ? 261  ARG B CZ  1 
ATOM   4738 N  NH1 . ARG B 1 277 ? -36.367 -23.494 -38.768 1.00 20.30  ? 261  ARG B NH1 1 
ATOM   4739 N  NH2 . ARG B 1 277 ? -36.913 -22.760 -36.663 1.00 18.92  ? 261  ARG B NH2 1 
ATOM   4740 N  N   . GLN B 1 278 ? -36.232 -26.602 -35.016 1.00 17.64  ? 262  GLN B N   1 
ATOM   4741 C  CA  . GLN B 1 278 ? -35.398 -25.576 -34.389 1.00 17.66  ? 262  GLN B CA  1 
ATOM   4742 C  C   . GLN B 1 278 ? -34.101 -26.137 -33.811 1.00 19.28  ? 262  GLN B C   1 
ATOM   4743 O  O   . GLN B 1 278 ? -33.054 -25.552 -34.056 1.00 18.71  ? 262  GLN B O   1 
ATOM   4744 C  CB  . GLN B 1 278 ? -36.155 -24.820 -33.316 1.00 17.90  ? 262  GLN B CB  1 
ATOM   4745 C  CG  . GLN B 1 278 ? -35.407 -23.554 -32.891 1.00 23.57  ? 262  GLN B CG  1 
ATOM   4746 C  CD  . GLN B 1 278 ? -36.062 -22.872 -31.715 1.00 39.15  ? 262  GLN B CD  1 
ATOM   4747 O  OE1 . GLN B 1 278 ? -37.174 -23.213 -31.311 1.00 32.27  ? 262  GLN B OE1 1 
ATOM   4748 N  NE2 . GLN B 1 278 ? -35.352 -21.933 -31.099 1.00 39.34  ? 262  GLN B NE2 1 
ATOM   4749 N  N   . GLN B 1 279 ? -34.185 -27.226 -33.034 1.00 17.91  ? 263  GLN B N   1 
ATOM   4750 C  CA  . GLN B 1 279 ? -33.008 -27.862 -32.442 1.00 18.79  ? 263  GLN B CA  1 
ATOM   4751 C  C   . GLN B 1 279 ? -32.011 -28.253 -33.554 1.00 20.87  ? 263  GLN B C   1 
ATOM   4752 O  O   . GLN B 1 279 ? -30.830 -27.978 -33.415 1.00 19.71  ? 263  GLN B O   1 
ATOM   4753 C  CB  . GLN B 1 279 ? -33.406 -29.089 -31.620 1.00 20.67  ? 263  GLN B CB  1 
ATOM   4754 C  CG  . GLN B 1 279 ? -32.248 -29.700 -30.855 1.00 32.53  ? 263  GLN B CG  1 
ATOM   4755 C  CD  . GLN B 1 279 ? -32.686 -30.867 -30.004 1.00 43.42  ? 263  GLN B CD  1 
ATOM   4756 O  OE1 . GLN B 1 279 ? -33.710 -31.524 -30.266 1.00 33.34  ? 263  GLN B OE1 1 
ATOM   4757 N  NE2 . GLN B 1 279 ? -31.888 -31.174 -28.989 1.00 35.03  ? 263  GLN B NE2 1 
ATOM   4758 N  N   . LEU B 1 280 ? -32.502 -28.859 -34.647 1.00 16.32  ? 264  LEU B N   1 
ATOM   4759 C  CA  . LEU B 1 280 ? -31.642 -29.255 -35.752 1.00 16.45  ? 264  LEU B CA  1 
ATOM   4760 C  C   . LEU B 1 280 ? -31.026 -28.042 -36.435 1.00 20.11  ? 264  LEU B C   1 
ATOM   4761 O  O   . LEU B 1 280 ? -29.820 -28.037 -36.685 1.00 17.62  ? 264  LEU B O   1 
ATOM   4762 C  CB  . LEU B 1 280 ? -32.421 -30.114 -36.765 1.00 15.77  ? 264  LEU B CB  1 
ATOM   4763 C  CG  . LEU B 1 280 ? -32.680 -31.558 -36.293 1.00 19.70  ? 264  LEU B CG  1 
ATOM   4764 C  CD1 . LEU B 1 280 ? -33.775 -32.241 -37.153 1.00 20.28  ? 264  LEU B CD1 1 
ATOM   4765 C  CD2 . LEU B 1 280 ? -31.402 -32.376 -36.296 1.00 21.11  ? 264  LEU B CD2 1 
ATOM   4766 N  N   . ARG B 1 281 ? -31.849 -27.028 -36.758 1.00 18.58  ? 265  ARG B N   1 
ATOM   4767 C  CA  . ARG B 1 281 ? -31.333 -25.846 -37.448 1.00 18.91  ? 265  ARG B CA  1 
ATOM   4768 C  C   . ARG B 1 281 ? -30.220 -25.149 -36.626 1.00 19.80  ? 265  ARG B C   1 
ATOM   4769 O  O   . ARG B 1 281 ? -29.165 -24.877 -37.169 1.00 18.60  ? 265  ARG B O   1 
ATOM   4770 C  CB  . ARG B 1 281 ? -32.442 -24.887 -37.899 1.00 20.58  ? 265  ARG B CB  1 
ATOM   4771 C  CG  . ARG B 1 281 ? -31.994 -24.096 -39.160 1.00 29.10  ? 265  ARG B CG  1 
ATOM   4772 C  CD  . ARG B 1 281 ? -33.008 -23.106 -39.718 1.00 36.03  ? 265  ARG B CD  1 
ATOM   4773 N  NE  . ARG B 1 281 ? -32.513 -22.337 -40.886 1.00 33.36  ? 265  ARG B NE  1 
ATOM   4774 C  CZ  . ARG B 1 281 ? -31.765 -21.235 -40.815 1.00 53.59  ? 265  ARG B CZ  1 
ATOM   4775 N  NH1 . ARG B 1 281 ? -31.361 -20.768 -39.635 1.00 38.25  ? 265  ARG B NH1 1 
ATOM   4776 N  NH2 . ARG B 1 281 ? -31.383 -20.613 -41.924 1.00 49.18  ? 265  ARG B NH2 1 
ATOM   4777 N  N   . GLU B 1 282 ? -30.444 -24.992 -35.310 1.00 17.87  ? 266  GLU B N   1 
ATOM   4778 C  CA  . GLU B 1 282 ? -29.507 -24.378 -34.375 1.00 19.11  ? 266  GLU B CA  1 
ATOM   4779 C  C   . GLU B 1 282 ? -28.228 -25.198 -34.229 1.00 21.77  ? 266  GLU B C   1 
ATOM   4780 O  O   . GLU B 1 282 ? -27.138 -24.628 -34.242 1.00 20.65  ? 266  GLU B O   1 
ATOM   4781 C  CB  . GLU B 1 282 ? -30.174 -24.119 -33.025 1.00 20.59  ? 266  GLU B CB  1 
ATOM   4782 C  CG  . GLU B 1 282 ? -31.156 -22.959 -33.127 1.00 26.07  ? 266  GLU B CG  1 
ATOM   4783 C  CD  . GLU B 1 282 ? -31.925 -22.623 -31.867 1.00 37.60  ? 266  GLU B CD  1 
ATOM   4784 O  OE1 . GLU B 1 282 ? -32.770 -21.703 -31.932 1.00 38.40  ? 266  GLU B OE1 1 
ATOM   4785 O  OE2 . GLU B 1 282 ? -31.695 -23.274 -30.825 1.00 36.76  ? 266  GLU B OE2 1 
ATOM   4786 N  N   . ALA B 1 283 ? -28.360 -26.534 -34.145 1.00 18.04  ? 267  ALA B N   1 
ATOM   4787 C  CA  . ALA B 1 283 ? -27.218 -27.427 -34.044 1.00 17.83  ? 267  ALA B CA  1 
ATOM   4788 C  C   . ALA B 1 283 ? -26.384 -27.393 -35.338 1.00 20.14  ? 267  ALA B C   1 
ATOM   4789 O  O   . ALA B 1 283 ? -25.169 -27.323 -35.252 1.00 19.23  ? 267  ALA B O   1 
ATOM   4790 C  CB  . ALA B 1 283 ? -27.681 -28.846 -33.738 1.00 18.36  ? 267  ALA B CB  1 
ATOM   4791 N  N   . PHE B 1 284 ? -27.031 -27.443 -36.532 1.00 16.84  ? 268  PHE B N   1 
ATOM   4792 C  CA  . PHE B 1 284 ? -26.331 -27.384 -37.813 1.00 17.48  ? 268  PHE B CA  1 
ATOM   4793 C  C   . PHE B 1 284 ? -25.571 -26.050 -37.916 1.00 22.38  ? 268  PHE B C   1 
ATOM   4794 O  O   . PHE B 1 284 ? -24.388 -26.053 -38.256 1.00 22.18  ? 268  PHE B O   1 
ATOM   4795 C  CB  . PHE B 1 284 ? -27.310 -27.500 -38.994 1.00 19.23  ? 268  PHE B CB  1 
ATOM   4796 C  CG  . PHE B 1 284 ? -27.970 -28.849 -39.196 1.00 20.87  ? 268  PHE B CG  1 
ATOM   4797 C  CD1 . PHE B 1 284 ? -27.459 -29.998 -38.590 1.00 25.20  ? 268  PHE B CD1 1 
ATOM   4798 C  CD2 . PHE B 1 284 ? -29.116 -28.970 -39.974 1.00 22.08  ? 268  PHE B CD2 1 
ATOM   4799 C  CE1 . PHE B 1 284 ? -28.072 -31.243 -38.782 1.00 26.14  ? 268  PHE B CE1 1 
ATOM   4800 C  CE2 . PHE B 1 284 ? -29.711 -30.223 -40.183 1.00 24.55  ? 268  PHE B CE2 1 
ATOM   4801 C  CZ  . PHE B 1 284 ? -29.204 -31.338 -39.561 1.00 24.31  ? 268  PHE B CZ  1 
ATOM   4802 N  N   . SER B 1 285 ? -26.234 -24.950 -37.549 1.00 19.84  ? 269  SER B N   1 
ATOM   4803 C  CA  . SER B 1 285 ? -25.650 -23.611 -37.608 1.00 21.03  ? 269  SER B CA  1 
ATOM   4804 C  C   . SER B 1 285 ? -24.437 -23.464 -36.638 1.00 24.68  ? 269  SER B C   1 
ATOM   4805 O  O   . SER B 1 285 ? -23.370 -23.042 -37.087 1.00 24.58  ? 269  SER B O   1 
ATOM   4806 C  CB  . SER B 1 285 ? -26.714 -22.540 -37.365 1.00 24.04  ? 269  SER B CB  1 
ATOM   4807 O  OG  . SER B 1 285 ? -26.222 -21.307 -37.860 1.00 34.80  ? 269  SER B OG  1 
ATOM   4808 N  N   . ARG B 1 286 ? -24.598 -23.851 -35.344 1.00 19.80  ? 270  ARG B N   1 
ATOM   4809 C  CA  . ARG B 1 286 ? -23.541 -23.806 -34.321 1.00 20.06  ? 270  ARG B CA  1 
ATOM   4810 C  C   . ARG B 1 286 ? -22.334 -24.643 -34.753 1.00 20.69  ? 270  ARG B C   1 
ATOM   4811 O  O   . ARG B 1 286 ? -21.203 -24.166 -34.691 1.00 19.03  ? 270  ARG B O   1 
ATOM   4812 C  CB  . ARG B 1 286 ? -24.018 -24.414 -32.991 1.00 23.29  ? 270  ARG B CB  1 
ATOM   4813 C  CG  . ARG B 1 286 ? -24.775 -23.489 -32.122 1.00 36.41  ? 270  ARG B CG  1 
ATOM   4814 C  CD  . ARG B 1 286 ? -24.748 -23.969 -30.684 1.00 31.35  ? 270  ARG B CD  1 
ATOM   4815 N  NE  . ARG B 1 286 ? -25.609 -25.124 -30.501 1.00 44.28  ? 270  ARG B NE  1 
ATOM   4816 C  CZ  . ARG B 1 286 ? -26.931 -25.067 -30.392 1.00 47.35  ? 270  ARG B CZ  1 
ATOM   4817 N  NH1 . ARG B 1 286 ? -27.559 -23.894 -30.411 1.00 32.30  ? 270  ARG B NH1 1 
ATOM   4818 N  NH2 . ARG B 1 286 ? -27.633 -26.174 -30.247 1.00 41.01  ? 270  ARG B NH2 1 
ATOM   4819 N  N   . THR B 1 287 ? -22.569 -25.907 -35.160 1.00 17.55  ? 271  THR B N   1 
ATOM   4820 C  CA  . THR B 1 287 ? -21.466 -26.782 -35.566 1.00 18.85  ? 271  THR B CA  1 
ATOM   4821 C  C   . THR B 1 287 ? -20.679 -26.243 -36.742 1.00 22.87  ? 271  THR B C   1 
ATOM   4822 O  O   . THR B 1 287 ? -19.452 -26.314 -36.700 1.00 23.31  ? 271  THR B O   1 
ATOM   4823 C  CB  . THR B 1 287 ? -21.904 -28.231 -35.736 1.00 25.96  ? 271  THR B CB  1 
ATOM   4824 O  OG1 . THR B 1 287 ? -22.841 -28.266 -36.811 1.00 29.59  ? 271  THR B OG1 1 
ATOM   4825 C  CG2 . THR B 1 287 ? -22.528 -28.799 -34.458 1.00 23.58  ? 271  THR B CG2 1 
ATOM   4826 N  N   . ALA B 1 288 ? -21.379 -25.603 -37.724 1.00 19.54  ? 272  ALA B N   1 
ATOM   4827 C  CA  . ALA B 1 288 ? -20.810 -24.989 -38.931 1.00 21.49  ? 272  ALA B CA  1 
ATOM   4828 C  C   . ALA B 1 288 ? -19.796 -23.858 -38.641 1.00 24.90  ? 272  ALA B C   1 
ATOM   4829 O  O   . ALA B 1 288 ? -18.982 -23.540 -39.515 1.00 24.95  ? 272  ALA B O   1 
ATOM   4830 C  CB  . ALA B 1 288 ? -21.921 -24.439 -39.806 1.00 22.52  ? 272  ALA B CB  1 
ATOM   4831 N  N   . ILE B 1 289 ? -19.835 -23.264 -37.426 1.00 21.61  ? 273  ILE B N   1 
ATOM   4832 C  CA  . ILE B 1 289 ? -18.894 -22.196 -37.021 1.00 21.19  ? 273  ILE B CA  1 
ATOM   4833 C  C   . ILE B 1 289 ? -17.461 -22.731 -37.168 1.00 23.92  ? 273  ILE B C   1 
ATOM   4834 O  O   . ILE B 1 289 ? -16.579 -22.005 -37.625 1.00 24.39  ? 273  ILE B O   1 
ATOM   4835 C  CB  . ILE B 1 289 ? -19.199 -21.679 -35.574 1.00 23.32  ? 273  ILE B CB  1 
ATOM   4836 C  CG1 . ILE B 1 289 ? -20.635 -21.057 -35.469 1.00 21.88  ? 273  ILE B CG1 1 
ATOM   4837 C  CG2 . ILE B 1 289 ? -18.102 -20.714 -35.044 1.00 24.22  ? 273  ILE B CG2 1 
ATOM   4838 C  CD1 . ILE B 1 289 ? -21.126 -20.776 -34.020 1.00 22.24  ? 273  ILE B CD1 1 
ATOM   4839 N  N   . LEU B 1 290 ? -17.263 -24.025 -36.841 1.00 21.18  ? 274  LEU B N   1 
ATOM   4840 C  CA  . LEU B 1 290 ? -15.977 -24.723 -36.928 1.00 21.34  ? 274  LEU B CA  1 
ATOM   4841 C  C   . LEU B 1 290 ? -15.786 -25.585 -38.178 1.00 25.95  ? 274  LEU B C   1 
ATOM   4842 O  O   . LEU B 1 290 ? -14.826 -26.351 -38.248 1.00 24.03  ? 274  LEU B O   1 
ATOM   4843 C  CB  . LEU B 1 290 ? -15.584 -25.434 -35.617 1.00 21.23  ? 274  LEU B CB  1 
ATOM   4844 C  CG  . LEU B 1 290 ? -15.526 -24.510 -34.365 1.00 24.85  ? 274  LEU B CG  1 
ATOM   4845 C  CD1 . LEU B 1 290 ? -15.112 -25.300 -33.130 1.00 25.50  ? 274  LEU B CD1 1 
ATOM   4846 C  CD2 . LEU B 1 290 ? -14.594 -23.330 -34.591 1.00 26.03  ? 274  LEU B CD2 1 
ATOM   4847 N  N   . SER B 1 291 ? -16.666 -25.404 -39.189 1.00 23.11  ? 275  SER B N   1 
ATOM   4848 C  CA  . SER B 1 291 ? -16.496 -26.076 -40.478 1.00 23.77  ? 275  SER B CA  1 
ATOM   4849 C  C   . SER B 1 291 ? -15.448 -25.280 -41.329 1.00 29.25  ? 275  SER B C   1 
ATOM   4850 O  O   . SER B 1 291 ? -15.159 -24.103 -41.042 1.00 26.40  ? 275  SER B O   1 
ATOM   4851 C  CB  . SER B 1 291 ? -17.827 -26.161 -41.229 1.00 25.15  ? 275  SER B CB  1 
ATOM   4852 O  OG  . SER B 1 291 ? -18.254 -24.884 -41.680 1.00 29.40  ? 275  SER B OG  1 
ATOM   4853 N  N   . ASN B 1 292 ? -14.920 -25.931 -42.380 1.00 29.34  ? 276  ASN B N   1 
ATOM   4854 C  CA  . ASN B 1 292 ? -13.974 -25.352 -43.344 1.00 31.39  ? 276  ASN B CA  1 
ATOM   4855 C  C   . ASN B 1 292 ? -14.713 -24.211 -44.072 1.00 36.06  ? 276  ASN B C   1 
ATOM   4856 O  O   . ASN B 1 292 ? -15.811 -24.417 -44.594 1.00 33.93  ? 276  ASN B O   1 
ATOM   4857 C  CB  . ASN B 1 292 ? -13.502 -26.436 -44.328 1.00 36.26  ? 276  ASN B CB  1 
ATOM   4858 C  CG  . ASN B 1 292 ? -12.388 -26.014 -45.258 1.00 50.46  ? 276  ASN B CG  1 
ATOM   4859 O  OD1 . ASN B 1 292 ? -12.545 -25.111 -46.086 1.00 43.10  ? 276  ASN B OD1 1 
ATOM   4860 N  ND2 . ASN B 1 292 ? -11.257 -26.713 -45.193 1.00 40.16  ? 276  ASN B ND2 1 
ATOM   4861 N  N   . GLU B 1 293 ? -14.150 -22.991 -44.023 1.00 35.94  ? 277  GLU B N   1 
ATOM   4862 C  CA  . GLU B 1 293 ? -14.754 -21.790 -44.626 1.00 36.96  ? 277  GLU B CA  1 
ATOM   4863 C  C   . GLU B 1 293 ? -15.006 -21.897 -46.144 1.00 42.82  ? 277  GLU B C   1 
ATOM   4864 O  O   . GLU B 1 293 ? -15.957 -21.292 -46.648 1.00 42.43  ? 277  GLU B O   1 
ATOM   4865 C  CB  . GLU B 1 293 ? -13.920 -20.539 -44.296 1.00 39.09  ? 277  GLU B CB  1 
ATOM   4866 N  N   . LYS B 1 294 ? -14.186 -22.692 -46.850 1.00 41.78  ? 278  LYS B N   1 
ATOM   4867 C  CA  . LYS B 1 294 ? -14.292 -22.881 -48.299 1.00 43.39  ? 278  LYS B CA  1 
ATOM   4868 C  C   . LYS B 1 294 ? -15.324 -23.934 -48.738 1.00 48.07  ? 278  LYS B C   1 
ATOM   4869 O  O   . LYS B 1 294 ? -15.811 -23.861 -49.873 1.00 49.47  ? 278  LYS B O   1 
ATOM   4870 C  CB  . LYS B 1 294 ? -12.912 -23.192 -48.903 1.00 47.40  ? 278  LYS B CB  1 
ATOM   4871 N  N   . TYR B 1 295 ? -15.648 -24.911 -47.866 1.00 42.01  ? 279  TYR B N   1 
ATOM   4872 C  CA  . TYR B 1 295 ? -16.562 -25.996 -48.230 1.00 40.84  ? 279  TYR B CA  1 
ATOM   4873 C  C   . TYR B 1 295 ? -17.847 -26.060 -47.425 1.00 40.01  ? 279  TYR B C   1 
ATOM   4874 O  O   . TYR B 1 295 ? -18.858 -26.558 -47.941 1.00 38.86  ? 279  TYR B O   1 
ATOM   4875 C  CB  . TYR B 1 295 ? -15.838 -27.354 -48.255 1.00 43.71  ? 279  TYR B CB  1 
ATOM   4876 C  CG  . TYR B 1 295 ? -14.513 -27.328 -48.985 1.00 49.04  ? 279  TYR B CG  1 
ATOM   4877 C  CD1 . TYR B 1 295 ? -14.447 -27.023 -50.342 1.00 52.55  ? 279  TYR B CD1 1 
ATOM   4878 C  CD2 . TYR B 1 295 ? -13.324 -27.619 -48.323 1.00 51.08  ? 279  TYR B CD2 1 
ATOM   4879 C  CE1 . TYR B 1 295 ? -13.229 -26.988 -51.019 1.00 56.18  ? 279  TYR B CE1 1 
ATOM   4880 C  CE2 . TYR B 1 295 ? -12.098 -27.592 -48.989 1.00 53.88  ? 279  TYR B CE2 1 
ATOM   4881 C  CZ  . TYR B 1 295 ? -12.056 -27.273 -50.338 1.00 65.24  ? 279  TYR B CZ  1 
ATOM   4882 O  OH  . TYR B 1 295 ? -10.854 -27.243 -51.008 1.00 70.90  ? 279  TYR B OH  1 
ATOM   4883 N  N   . ARG B 1 296 ? -17.810 -25.581 -46.162 1.00 32.24  ? 280  ARG B N   1 
ATOM   4884 C  CA  . ARG B 1 296 ? -18.968 -25.509 -45.263 1.00 30.45  ? 280  ARG B CA  1 
ATOM   4885 C  C   . ARG B 1 296 ? -19.709 -26.849 -45.108 1.00 33.19  ? 280  ARG B C   1 
ATOM   4886 O  O   . ARG B 1 296 ? -20.944 -26.897 -45.077 1.00 33.28  ? 280  ARG B O   1 
ATOM   4887 C  CB  . ARG B 1 296 ? -19.907 -24.348 -45.675 1.00 30.99  ? 280  ARG B CB  1 
ATOM   4888 C  CG  . ARG B 1 296 ? -19.239 -22.962 -45.668 1.00 39.99  ? 280  ARG B CG  1 
ATOM   4889 C  CD  . ARG B 1 296 ? -19.180 -22.344 -44.281 1.00 41.36  ? 280  ARG B CD  1 
ATOM   4890 N  NE  . ARG B 1 296 ? -20.516 -22.119 -43.722 1.00 46.24  ? 280  ARG B NE  1 
ATOM   4891 C  CZ  . ARG B 1 296 ? -20.751 -21.850 -42.444 1.00 53.82  ? 280  ARG B CZ  1 
ATOM   4892 N  NH1 . ARG B 1 296 ? -19.747 -21.779 -41.577 1.00 35.95  ? 280  ARG B NH1 1 
ATOM   4893 N  NH2 . ARG B 1 296 ? -21.995 -21.666 -42.016 1.00 35.39  ? 280  ARG B NH2 1 
ATOM   4894 N  N   . GLY B 1 297 ? -18.929 -27.920 -45.010 1.00 28.86  ? 281  GLY B N   1 
ATOM   4895 C  CA  . GLY B 1 297 ? -19.438 -29.275 -44.856 1.00 28.81  ? 281  GLY B CA  1 
ATOM   4896 C  C   . GLY B 1 297 ? -19.621 -29.686 -43.408 1.00 30.60  ? 281  GLY B C   1 
ATOM   4897 O  O   . GLY B 1 297 ? -18.830 -29.305 -42.544 1.00 30.45  ? 281  GLY B O   1 
ATOM   4898 N  N   . ILE B 1 298 ? -20.695 -30.433 -43.122 1.00 25.70  ? 282  ILE B N   1 
ATOM   4899 C  CA  . ILE B 1 298 ? -20.923 -31.035 -41.799 1.00 23.06  ? 282  ILE B CA  1 
ATOM   4900 C  C   . ILE B 1 298 ? -21.101 -32.547 -41.984 1.00 27.24  ? 282  ILE B C   1 
ATOM   4901 O  O   . ILE B 1 298 ? -21.541 -32.994 -43.049 1.00 26.69  ? 282  ILE B O   1 
ATOM   4902 C  CB  . ILE B 1 298 ? -22.044 -30.401 -40.938 1.00 24.44  ? 282  ILE B CB  1 
ATOM   4903 C  CG1 . ILE B 1 298 ? -23.445 -30.510 -41.620 1.00 23.55  ? 282  ILE B CG1 1 
ATOM   4904 C  CG2 . ILE B 1 298 ? -21.681 -28.966 -40.503 1.00 26.59  ? 282  ILE B CG2 1 
ATOM   4905 C  CD1 . ILE B 1 298 ? -24.644 -30.235 -40.688 1.00 26.98  ? 282  ILE B CD1 1 
ATOM   4906 N  N   . ARG B 1 299 ? -20.718 -33.326 -40.970 1.00 22.79  ? 283  ARG B N   1 
ATOM   4907 C  CA  . ARG B 1 299 ? -20.869 -34.771 -40.986 1.00 22.19  ? 283  ARG B CA  1 
ATOM   4908 C  C   . ARG B 1 299 ? -21.999 -35.154 -40.032 1.00 24.79  ? 283  ARG B C   1 
ATOM   4909 O  O   . ARG B 1 299 ? -22.029 -34.676 -38.888 1.00 24.24  ? 283  ARG B O   1 
ATOM   4910 C  CB  . ARG B 1 299 ? -19.560 -35.437 -40.555 1.00 22.60  ? 283  ARG B CB  1 
ATOM   4911 C  CG  . ARG B 1 299 ? -19.579 -36.973 -40.635 1.00 31.96  ? 283  ARG B CG  1 
ATOM   4912 C  CD  . ARG B 1 299 ? -18.328 -37.590 -40.027 1.00 38.66  ? 283  ARG B CD  1 
ATOM   4913 N  NE  . ARG B 1 299 ? -18.270 -37.350 -38.584 1.00 52.39  ? 283  ARG B NE  1 
ATOM   4914 C  CZ  . ARG B 1 299 ? -17.253 -37.690 -37.798 1.00 69.33  ? 283  ARG B CZ  1 
ATOM   4915 N  NH1 . ARG B 1 299 ? -16.191 -38.312 -38.303 1.00 53.73  ? 283  ARG B NH1 1 
ATOM   4916 N  NH2 . ARG B 1 299 ? -17.291 -37.418 -36.499 1.00 50.63  ? 283  ARG B NH2 1 
ATOM   4917 N  N   . LEU B 1 300 ? -22.918 -36.019 -40.504 1.00 20.89  ? 284  LEU B N   1 
ATOM   4918 C  CA  . LEU B 1 300 ? -24.032 -36.541 -39.711 1.00 20.54  ? 284  LEU B CA  1 
ATOM   4919 C  C   . LEU B 1 300 ? -23.744 -38.018 -39.405 1.00 23.85  ? 284  LEU B C   1 
ATOM   4920 O  O   . LEU B 1 300 ? -23.446 -38.792 -40.319 1.00 23.30  ? 284  LEU B O   1 
ATOM   4921 C  CB  . LEU B 1 300 ? -25.392 -36.410 -40.483 1.00 20.98  ? 284  LEU B CB  1 
ATOM   4922 C  CG  . LEU B 1 300 ? -26.091 -35.014 -40.476 1.00 26.95  ? 284  LEU B CG  1 
ATOM   4923 C  CD1 . LEU B 1 300 ? -25.239 -33.931 -41.101 1.00 29.73  ? 284  LEU B CD1 1 
ATOM   4924 C  CD2 . LEU B 1 300 ? -27.434 -35.070 -41.188 1.00 27.57  ? 284  LEU B CD2 1 
ATOM   4925 N  N   . GLN B 1 301 ? -23.831 -38.405 -38.133 1.00 20.01  ? 285  GLN B N   1 
ATOM   4926 C  CA  . GLN B 1 301 ? -23.719 -39.817 -37.746 1.00 20.02  ? 285  GLN B CA  1 
ATOM   4927 C  C   . GLN B 1 301 ? -25.004 -40.166 -37.050 1.00 23.11  ? 285  GLN B C   1 
ATOM   4928 O  O   . GLN B 1 301 ? -25.272 -39.691 -35.936 1.00 21.46  ? 285  GLN B O   1 
ATOM   4929 C  CB  . GLN B 1 301 ? -22.494 -40.102 -36.862 1.00 22.34  ? 285  GLN B CB  1 
ATOM   4930 C  CG  . GLN B 1 301 ? -21.177 -40.073 -37.638 1.00 31.33  ? 285  GLN B CG  1 
ATOM   4931 C  CD  . GLN B 1 301 ? -19.949 -40.314 -36.785 1.00 49.11  ? 285  GLN B CD  1 
ATOM   4932 O  OE1 . GLN B 1 301 ? -18.930 -40.797 -37.270 1.00 48.05  ? 285  GLN B OE1 1 
ATOM   4933 N  NE2 . GLN B 1 301 ? -19.994 -39.970 -35.505 1.00 38.42  ? 285  GLN B NE2 1 
ATOM   4934 N  N   . LEU B 1 302 ? -25.847 -40.915 -37.769 1.00 20.26  ? 286  LEU B N   1 
ATOM   4935 C  CA  . LEU B 1 302 ? -27.151 -41.334 -37.311 1.00 20.30  ? 286  LEU B CA  1 
ATOM   4936 C  C   . LEU B 1 302 ? -27.088 -42.741 -36.720 1.00 23.52  ? 286  LEU B C   1 
ATOM   4937 O  O   . LEU B 1 302 ? -26.475 -43.642 -37.297 1.00 24.06  ? 286  LEU B O   1 
ATOM   4938 C  CB  . LEU B 1 302 ? -28.120 -41.302 -38.499 1.00 20.49  ? 286  LEU B CB  1 
ATOM   4939 C  CG  . LEU B 1 302 ? -29.576 -41.698 -38.253 1.00 24.38  ? 286  LEU B CG  1 
ATOM   4940 C  CD1 . LEU B 1 302 ? -30.320 -40.632 -37.451 1.00 23.68  ? 286  LEU B CD1 1 
ATOM   4941 C  CD2 . LEU B 1 302 ? -30.300 -41.948 -39.580 1.00 28.13  ? 286  LEU B CD2 1 
ATOM   4942 N  N   . SER B 1 303 ? -27.742 -42.917 -35.587 1.00 18.94  ? 287  SER B N   1 
ATOM   4943 C  CA  . SER B 1 303 ? -27.883 -44.224 -34.917 1.00 20.10  ? 287  SER B CA  1 
ATOM   4944 C  C   . SER B 1 303 ? -29.239 -44.212 -34.172 1.00 25.63  ? 287  SER B C   1 
ATOM   4945 O  O   . SER B 1 303 ? -29.903 -43.173 -34.166 1.00 23.52  ? 287  SER B O   1 
ATOM   4946 C  CB  . SER B 1 303 ? -26.704 -44.487 -33.980 1.00 23.08  ? 287  SER B CB  1 
ATOM   4947 O  OG  . SER B 1 303 ? -26.630 -43.516 -32.949 1.00 24.19  ? 287  SER B OG  1 
ATOM   4948 N  N   . ASN B 1 304 ? -29.664 -45.343 -33.571 1.00 23.16  ? 288  ASN B N   1 
ATOM   4949 C  CA  . ASN B 1 304 ? -30.934 -45.409 -32.851 1.00 23.45  ? 288  ASN B CA  1 
ATOM   4950 C  C   . ASN B 1 304 ? -31.145 -44.203 -31.919 1.00 26.71  ? 288  ASN B C   1 
ATOM   4951 O  O   . ASN B 1 304 ? -30.316 -43.956 -31.037 1.00 25.21  ? 288  ASN B O   1 
ATOM   4952 C  CB  . ASN B 1 304 ? -31.024 -46.708 -32.020 1.00 26.70  ? 288  ASN B CB  1 
ATOM   4953 C  CG  . ASN B 1 304 ? -31.318 -47.930 -32.832 1.00 50.11  ? 288  ASN B CG  1 
ATOM   4954 O  OD1 . ASN B 1 304 ? -32.291 -47.978 -33.593 1.00 43.16  ? 288  ASN B OD1 1 
ATOM   4955 N  ND2 . ASN B 1 304 ? -30.512 -48.965 -32.646 1.00 46.12  ? 288  ASN B ND2 1 
ATOM   4956 N  N   . GLY B 1 305 ? -32.233 -43.463 -32.156 1.00 23.05  ? 289  GLY B N   1 
ATOM   4957 C  CA  . GLY B 1 305 ? -32.648 -42.310 -31.362 1.00 22.99  ? 289  GLY B CA  1 
ATOM   4958 C  C   . GLY B 1 305 ? -31.651 -41.161 -31.267 1.00 23.64  ? 289  GLY B C   1 
ATOM   4959 O  O   . GLY B 1 305 ? -31.823 -40.265 -30.437 1.00 23.82  ? 289  GLY B O   1 
ATOM   4960 N  N   . LEU B 1 306 ? -30.617 -41.148 -32.129 1.00 19.18  ? 290  LEU B N   1 
ATOM   4961 C  CA  . LEU B 1 306 ? -29.558 -40.125 -32.006 1.00 20.09  ? 290  LEU B CA  1 
ATOM   4962 C  C   . LEU B 1 306 ? -28.940 -39.638 -33.316 1.00 22.26  ? 290  LEU B C   1 
ATOM   4963 O  O   . LEU B 1 306 ? -28.545 -40.449 -34.162 1.00 20.43  ? 290  LEU B O   1 
ATOM   4964 C  CB  . LEU B 1 306 ? -28.441 -40.699 -31.099 1.00 21.51  ? 290  LEU B CB  1 
ATOM   4965 C  CG  . LEU B 1 306 ? -27.206 -39.817 -30.797 1.00 26.36  ? 290  LEU B CG  1 
ATOM   4966 C  CD1 . LEU B 1 306 ? -27.542 -38.696 -29.830 1.00 25.98  ? 290  LEU B CD1 1 
ATOM   4967 C  CD2 . LEU B 1 306 ? -26.086 -40.662 -30.202 1.00 31.47  ? 290  LEU B CD2 1 
ATOM   4968 N  N   . LEU B 1 307 ? -28.749 -38.311 -33.421 1.00 19.29  ? 291  LEU B N   1 
ATOM   4969 C  CA  . LEU B 1 307 ? -28.058 -37.744 -34.559 1.00 18.99  ? 291  LEU B CA  1 
ATOM   4970 C  C   . LEU B 1 307 ? -26.865 -36.960 -34.010 1.00 22.65  ? 291  LEU B C   1 
ATOM   4971 O  O   . LEU B 1 307 ? -27.052 -36.003 -33.243 1.00 21.98  ? 291  LEU B O   1 
ATOM   4972 C  CB  . LEU B 1 307 ? -28.967 -36.832 -35.414 1.00 19.06  ? 291  LEU B CB  1 
ATOM   4973 C  CG  . LEU B 1 307 ? -28.271 -36.186 -36.642 1.00 23.59  ? 291  LEU B CG  1 
ATOM   4974 C  CD1 . LEU B 1 307 ? -28.054 -37.194 -37.772 1.00 23.85  ? 291  LEU B CD1 1 
ATOM   4975 C  CD2 . LEU B 1 307 ? -29.083 -35.003 -37.175 1.00 25.81  ? 291  LEU B CD2 1 
ATOM   4976 N  N   . LYS B 1 308 ? -25.651 -37.389 -34.379 1.00 20.21  ? 292  LYS B N   1 
ATOM   4977 C  CA  . LYS B 1 308 ? -24.404 -36.706 -34.004 1.00 21.04  ? 292  LYS B CA  1 
ATOM   4978 C  C   . LYS B 1 308 ? -24.048 -35.817 -35.195 1.00 24.14  ? 292  LYS B C   1 
ATOM   4979 O  O   . LYS B 1 308 ? -24.115 -36.267 -36.340 1.00 23.67  ? 292  LYS B O   1 
ATOM   4980 C  CB  . LYS B 1 308 ? -23.268 -37.696 -33.722 1.00 23.54  ? 292  LYS B CB  1 
ATOM   4981 C  CG  . LYS B 1 308 ? -23.471 -38.551 -32.483 1.00 33.35  ? 292  LYS B CG  1 
ATOM   4982 C  CD  . LYS B 1 308 ? -22.210 -39.350 -32.160 1.00 45.09  ? 292  LYS B CD  1 
ATOM   4983 C  CE  . LYS B 1 308 ? -22.443 -40.343 -31.050 1.00 57.26  ? 292  LYS B CE  1 
ATOM   4984 N  NZ  . LYS B 1 308 ? -21.268 -41.230 -30.837 1.00 69.10  ? 292  LYS B NZ  1 
ATOM   4985 N  N   . ILE B 1 309 ? -23.771 -34.551 -34.924 1.00 20.38  ? 293  ILE B N   1 
ATOM   4986 C  CA  . ILE B 1 309 ? -23.447 -33.520 -35.920 1.00 21.16  ? 293  ILE B CA  1 
ATOM   4987 C  C   . ILE B 1 309 ? -22.029 -33.056 -35.605 1.00 25.39  ? 293  ILE B C   1 
ATOM   4988 O  O   . ILE B 1 309 ? -21.750 -32.647 -34.474 1.00 24.13  ? 293  ILE B O   1 
ATOM   4989 C  CB  . ILE B 1 309 ? -24.457 -32.341 -35.887 1.00 23.87  ? 293  ILE B CB  1 
ATOM   4990 C  CG1 . ILE B 1 309 ? -25.913 -32.820 -36.070 1.00 24.11  ? 293  ILE B CG1 1 
ATOM   4991 C  CG2 . ILE B 1 309 ? -24.099 -31.262 -36.927 1.00 25.19  ? 293  ILE B CG2 1 
ATOM   4992 C  CD1 . ILE B 1 309 ? -26.884 -31.953 -35.378 1.00 29.81  ? 293  ILE B CD1 1 
ATOM   4993 N  N   . GLN B 1 310 ? -21.148 -33.098 -36.610 1.00 22.92  ? 294  GLN B N   1 
ATOM   4994 C  CA  . GLN B 1 310 ? -19.734 -32.766 -36.442 1.00 23.23  ? 294  GLN B CA  1 
ATOM   4995 C  C   . GLN B 1 310 ? -19.222 -31.894 -37.577 1.00 27.80  ? 294  GLN B C   1 
ATOM   4996 O  O   . GLN B 1 310 ? -19.639 -32.044 -38.723 1.00 27.88  ? 294  GLN B O   1 
ATOM   4997 C  CB  . GLN B 1 310 ? -18.927 -34.096 -36.374 1.00 24.82  ? 294  GLN B CB  1 
ATOM   4998 C  CG  . GLN B 1 310 ? -17.425 -33.972 -36.037 1.00 38.56  ? 294  GLN B CG  1 
ATOM   4999 C  CD  . GLN B 1 310 ? -16.503 -33.795 -37.235 1.00 56.70  ? 294  GLN B CD  1 
ATOM   5000 O  OE1 . GLN B 1 310 ? -16.912 -33.844 -38.410 1.00 48.02  ? 294  GLN B OE1 1 
ATOM   5001 N  NE2 . GLN B 1 310 ? -15.227 -33.555 -36.959 1.00 45.50  ? 294  GLN B NE2 1 
ATOM   5002 N  N   . ALA B 1 311 ? -18.263 -31.026 -37.260 1.00 25.28  ? 295  ALA B N   1 
ATOM   5003 C  CA  . ALA B 1 311 ? -17.549 -30.203 -38.224 1.00 24.12  ? 295  ALA B CA  1 
ATOM   5004 C  C   . ALA B 1 311 ? -16.124 -29.950 -37.723 1.00 27.52  ? 295  ALA B C   1 
ATOM   5005 O  O   . ALA B 1 311 ? -15.889 -29.894 -36.510 1.00 26.27  ? 295  ALA B O   1 
ATOM   5006 C  CB  . ALA B 1 311 ? -18.273 -28.885 -38.470 1.00 23.67  ? 295  ALA B CB  1 
ATOM   5007 N  N   . ASN B 1 312 ? -15.175 -29.841 -38.660 1.00 25.21  ? 296  ASN B N   1 
ATOM   5008 C  CA  . ASN B 1 312 ? -13.773 -29.531 -38.383 1.00 27.01  ? 296  ASN B CA  1 
ATOM   5009 C  C   . ASN B 1 312 ? -13.188 -28.637 -39.469 1.00 31.99  ? 296  ASN B C   1 
ATOM   5010 O  O   . ASN B 1 312 ? -13.747 -28.553 -40.567 1.00 31.49  ? 296  ASN B O   1 
ATOM   5011 C  CB  . ASN B 1 312 ? -12.929 -30.765 -38.060 1.00 30.30  ? 296  ASN B CB  1 
ATOM   5012 C  CG  . ASN B 1 312 ? -12.733 -31.693 -39.222 1.00 48.40  ? 296  ASN B CG  1 
ATOM   5013 O  OD1 . ASN B 1 312 ? -11.868 -31.485 -40.071 1.00 55.63  ? 296  ASN B OD1 1 
ATOM   5014 N  ND2 . ASN B 1 312 ? -13.508 -32.748 -39.266 1.00 43.43  ? 296  ASN B ND2 1 
ATOM   5015 N  N   . ASN B 1 313 ? -12.136 -27.894 -39.132 1.00 28.95  ? 297  ASN B N   1 
ATOM   5016 C  CA  . ASN B 1 313 ? -11.523 -26.934 -40.052 1.00 30.12  ? 297  ASN B CA  1 
ATOM   5017 C  C   . ASN B 1 313 ? -10.007 -27.199 -40.222 1.00 35.68  ? 297  ASN B C   1 
ATOM   5018 O  O   . ASN B 1 313 ? -9.474  -28.066 -39.504 1.00 34.45  ? 297  ASN B O   1 
ATOM   5019 C  CB  . ASN B 1 313 ? -11.837 -25.495 -39.590 1.00 28.89  ? 297  ASN B CB  1 
ATOM   5020 C  CG  . ASN B 1 313 ? -11.200 -25.070 -38.281 1.00 34.29  ? 297  ASN B CG  1 
ATOM   5021 O  OD1 . ASN B 1 313 ? -10.282 -25.719 -37.742 1.00 28.83  ? 297  ASN B OD1 1 
ATOM   5022 N  ND2 . ASN B 1 313 ? -11.711 -23.979 -37.729 1.00 28.88  ? 297  ASN B ND2 1 
ATOM   5023 N  N   . PRO B 1 314 ? -9.278  -26.495 -41.128 1.00 35.86  ? 298  PRO B N   1 
ATOM   5024 C  CA  . PRO B 1 314 ? -7.826  -26.779 -41.264 1.00 38.55  ? 298  PRO B CA  1 
ATOM   5025 C  C   . PRO B 1 314 ? -6.971  -26.442 -40.022 1.00 44.01  ? 298  PRO B C   1 
ATOM   5026 O  O   . PRO B 1 314 ? -5.853  -26.939 -39.908 1.00 45.74  ? 298  PRO B O   1 
ATOM   5027 C  CB  . PRO B 1 314 ? -7.398  -25.969 -42.501 1.00 41.17  ? 298  PRO B CB  1 
ATOM   5028 C  CG  . PRO B 1 314 ? -8.678  -25.525 -43.169 1.00 43.66  ? 298  PRO B CG  1 
ATOM   5029 C  CD  . PRO B 1 314 ? -9.717  -25.456 -42.087 1.00 37.50  ? 298  PRO B CD  1 
ATOM   5030 N  N   . GLU B 1 315 ? -7.515  -25.652 -39.075 1.00 39.85  ? 299  GLU B N   1 
ATOM   5031 C  CA  . GLU B 1 315 ? -6.849  -25.265 -37.820 1.00 40.34  ? 299  GLU B CA  1 
ATOM   5032 C  C   . GLU B 1 315 ? -6.992  -26.358 -36.719 1.00 42.29  ? 299  GLU B C   1 
ATOM   5033 O  O   . GLU B 1 315 ? -6.634  -26.119 -35.559 1.00 41.91  ? 299  GLU B O   1 
ATOM   5034 C  CB  . GLU B 1 315 ? -7.393  -23.913 -37.315 1.00 41.14  ? 299  GLU B CB  1 
ATOM   5035 C  CG  . GLU B 1 315 ? -7.170  -22.740 -38.259 1.00 55.24  ? 299  GLU B CG  1 
ATOM   5036 C  CD  . GLU B 1 315 ? -8.428  -22.270 -38.968 1.00 76.92  ? 299  GLU B CD  1 
ATOM   5037 O  OE1 . GLU B 1 315 ? -8.879  -22.966 -39.907 1.00 70.90  ? 299  GLU B OE1 1 
ATOM   5038 O  OE2 . GLU B 1 315 ? -8.965  -21.205 -38.586 1.00 67.70  ? 299  GLU B OE2 1 
ATOM   5039 N  N   . GLN B 1 316 ? -7.530  -27.541 -37.091 1.00 37.77  ? 300  GLN B N   1 
ATOM   5040 C  CA  . GLN B 1 316 ? -7.821  -28.692 -36.215 1.00 37.52  ? 300  GLN B CA  1 
ATOM   5041 C  C   . GLN B 1 316 ? -8.890  -28.378 -35.147 1.00 38.06  ? 300  GLN B C   1 
ATOM   5042 O  O   . GLN B 1 316 ? -9.038  -29.118 -34.171 1.00 38.62  ? 300  GLN B O   1 
ATOM   5043 C  CB  . GLN B 1 316 ? -6.548  -29.346 -35.625 1.00 41.19  ? 300  GLN B CB  1 
ATOM   5044 C  CG  . GLN B 1 316 ? -6.012  -30.523 -36.438 1.00 66.75  ? 300  GLN B CG  1 
ATOM   5045 C  CD  . GLN B 1 316 ? -5.574  -30.127 -37.826 1.00 93.51  ? 300  GLN B CD  1 
ATOM   5046 O  OE1 . GLN B 1 316 ? -6.284  -30.357 -38.812 1.00 89.91  ? 300  GLN B OE1 1 
ATOM   5047 N  NE2 . GLN B 1 316 ? -4.408  -29.502 -37.929 1.00 89.69  ? 300  GLN B NE2 1 
ATOM   5048 N  N   . GLU B 1 317 ? -9.651  -27.292 -35.354 1.00 30.39  ? 301  GLU B N   1 
ATOM   5049 C  CA  . GLU B 1 317 ? -10.765 -26.952 -34.461 1.00 27.86  ? 301  GLU B CA  1 
ATOM   5050 C  C   . GLU B 1 317 ? -11.952 -27.865 -34.800 1.00 29.86  ? 301  GLU B C   1 
ATOM   5051 O  O   . GLU B 1 317 ? -12.136 -28.242 -35.963 1.00 28.31  ? 301  GLU B O   1 
ATOM   5052 C  CB  . GLU B 1 317 ? -11.124 -25.471 -34.530 1.00 27.69  ? 301  GLU B CB  1 
ATOM   5053 C  CG  . GLU B 1 317 ? -9.966  -24.590 -34.077 1.00 31.00  ? 301  GLU B CG  1 
ATOM   5054 C  CD  . GLU B 1 317 ? -10.182 -23.109 -34.273 1.00 32.74  ? 301  GLU B CD  1 
ATOM   5055 O  OE1 . GLU B 1 317 ? -10.838 -22.731 -35.271 1.00 32.30  ? 301  GLU B OE1 1 
ATOM   5056 O  OE2 . GLU B 1 317 ? -9.706  -22.322 -33.423 1.00 30.72  ? 301  GLU B OE2 1 
ATOM   5057 N  N   . GLU B 1 318 ? -12.713 -28.270 -33.782 1.00 25.81  ? 302  GLU B N   1 
ATOM   5058 C  CA  . GLU B 1 318 ? -13.799 -29.241 -33.943 1.00 24.28  ? 302  GLU B CA  1 
ATOM   5059 C  C   . GLU B 1 318 ? -15.018 -28.891 -33.109 1.00 26.70  ? 302  GLU B C   1 
ATOM   5060 O  O   . GLU B 1 318 ? -14.891 -28.483 -31.952 1.00 26.18  ? 302  GLU B O   1 
ATOM   5061 C  CB  . GLU B 1 318 ? -13.290 -30.630 -33.529 1.00 25.53  ? 302  GLU B CB  1 
ATOM   5062 C  CG  . GLU B 1 318 ? -14.291 -31.756 -33.737 1.00 35.76  ? 302  GLU B CG  1 
ATOM   5063 C  CD  . GLU B 1 318 ? -13.649 -33.122 -33.681 1.00 44.94  ? 302  GLU B CD  1 
ATOM   5064 O  OE1 . GLU B 1 318 ? -12.991 -33.432 -32.660 1.00 38.57  ? 302  GLU B OE1 1 
ATOM   5065 O  OE2 . GLU B 1 318 ? -13.743 -33.854 -34.692 1.00 37.04  ? 302  GLU B OE2 1 
ATOM   5066 N  N   . ALA B 1 319 ? -16.187 -29.074 -33.710 1.00 23.33  ? 303  ALA B N   1 
ATOM   5067 C  CA  . ALA B 1 319 ? -17.491 -28.911 -33.087 1.00 22.74  ? 303  ALA B CA  1 
ATOM   5068 C  C   . ALA B 1 319 ? -18.231 -30.236 -33.188 1.00 25.56  ? 303  ALA B C   1 
ATOM   5069 O  O   . ALA B 1 319 ? -18.148 -30.947 -34.208 1.00 22.17  ? 303  ALA B O   1 
ATOM   5070 C  CB  . ALA B 1 319 ? -18.283 -27.825 -33.778 1.00 22.72  ? 303  ALA B CB  1 
ATOM   5071 N  N   . GLU B 1 320 ? -18.966 -30.562 -32.122 1.00 23.89  ? 304  GLU B N   1 
ATOM   5072 C  CA  . GLU B 1 320 ? -19.780 -31.769 -32.048 1.00 24.54  ? 304  GLU B CA  1 
ATOM   5073 C  C   . GLU B 1 320 ? -21.042 -31.493 -31.256 1.00 27.96  ? 304  GLU B C   1 
ATOM   5074 O  O   . GLU B 1 320 ? -20.989 -30.869 -30.184 1.00 26.73  ? 304  GLU B O   1 
ATOM   5075 C  CB  . GLU B 1 320 ? -19.007 -32.928 -31.397 1.00 27.35  ? 304  GLU B CB  1 
ATOM   5076 C  CG  . GLU B 1 320 ? -18.284 -33.801 -32.394 1.00 45.35  ? 304  GLU B CG  1 
ATOM   5077 C  CD  . GLU B 1 320 ? -17.991 -35.195 -31.876 1.00 70.99  ? 304  GLU B CD  1 
ATOM   5078 O  OE1 . GLU B 1 320 ? -18.744 -36.131 -32.234 1.00 50.90  ? 304  GLU B OE1 1 
ATOM   5079 O  OE2 . GLU B 1 320 ? -17.025 -35.345 -31.093 1.00 67.41  ? 304  GLU B OE2 1 
ATOM   5080 N  N   . GLU B 1 321 ? -22.183 -31.920 -31.805 1.00 23.60  ? 305  GLU B N   1 
ATOM   5081 C  CA  . GLU B 1 321 ? -23.459 -31.774 -31.121 1.00 23.25  ? 305  GLU B CA  1 
ATOM   5082 C  C   . GLU B 1 321 ? -24.280 -33.037 -31.277 1.00 26.01  ? 305  GLU B C   1 
ATOM   5083 O  O   . GLU B 1 321 ? -24.297 -33.632 -32.353 1.00 25.82  ? 305  GLU B O   1 
ATOM   5084 C  CB  . GLU B 1 321 ? -24.243 -30.524 -31.553 1.00 24.72  ? 305  GLU B CB  1 
ATOM   5085 C  CG  . GLU B 1 321 ? -25.111 -30.030 -30.402 1.00 37.06  ? 305  GLU B CG  1 
ATOM   5086 C  CD  . GLU B 1 321 ? -25.992 -28.822 -30.638 1.00 49.47  ? 305  GLU B CD  1 
ATOM   5087 O  OE1 . GLU B 1 321 ? -27.178 -28.873 -30.240 1.00 41.81  ? 305  GLU B OE1 1 
ATOM   5088 O  OE2 . GLU B 1 321 ? -25.496 -27.811 -31.183 1.00 39.11  ? 305  GLU B OE2 1 
ATOM   5089 N  N   . GLU B 1 322 ? -24.912 -33.464 -30.186 1.00 21.75  ? 306  GLU B N   1 
ATOM   5090 C  CA  . GLU B 1 322 ? -25.753 -34.659 -30.183 1.00 22.11  ? 306  GLU B CA  1 
ATOM   5091 C  C   . GLU B 1 322 ? -27.196 -34.192 -30.046 1.00 25.52  ? 306  GLU B C   1 
ATOM   5092 O  O   . GLU B 1 322 ? -27.517 -33.404 -29.139 1.00 25.46  ? 306  GLU B O   1 
ATOM   5093 C  CB  . GLU B 1 322 ? -25.371 -35.596 -29.040 1.00 24.80  ? 306  GLU B CB  1 
ATOM   5094 C  CG  . GLU B 1 322 ? -24.014 -36.260 -29.227 1.00 36.55  ? 306  GLU B CG  1 
ATOM   5095 C  CD  . GLU B 1 322 ? -23.620 -37.237 -28.136 1.00 55.78  ? 306  GLU B CD  1 
ATOM   5096 O  OE1 . GLU B 1 322 ? -24.208 -37.171 -27.032 1.00 43.17  ? 306  GLU B OE1 1 
ATOM   5097 O  OE2 . GLU B 1 322 ? -22.707 -38.061 -28.380 1.00 51.39  ? 306  GLU B OE2 1 
ATOM   5098 N  N   . VAL B 1 323 ? -28.038 -34.591 -31.002 1.00 20.17  ? 307  VAL B N   1 
ATOM   5099 C  CA  . VAL B 1 323 ? -29.462 -34.226 -31.014 1.00 19.69  ? 307  VAL B CA  1 
ATOM   5100 C  C   . VAL B 1 323 ? -30.304 -35.518 -30.906 1.00 23.25  ? 307  VAL B C   1 
ATOM   5101 O  O   . VAL B 1 323 ? -30.119 -36.448 -31.703 1.00 21.08  ? 307  VAL B O   1 
ATOM   5102 C  CB  . VAL B 1 323 ? -29.832 -33.382 -32.283 1.00 22.55  ? 307  VAL B CB  1 
ATOM   5103 C  CG1 . VAL B 1 323 ? -31.345 -33.128 -32.376 1.00 21.74  ? 307  VAL B CG1 1 
ATOM   5104 C  CG2 . VAL B 1 323 ? -29.067 -32.057 -32.320 1.00 22.66  ? 307  VAL B CG2 1 
ATOM   5105 N  N   . GLN B 1 324 ? -31.234 -35.566 -29.939 1.00 21.17  ? 308  GLN B N   1 
ATOM   5106 C  CA  . GLN B 1 324 ? -32.144 -36.709 -29.826 1.00 21.91  ? 308  GLN B CA  1 
ATOM   5107 C  C   . GLN B 1 324 ? -33.130 -36.630 -31.004 1.00 22.83  ? 308  GLN B C   1 
ATOM   5108 O  O   . GLN B 1 324 ? -33.673 -35.564 -31.285 1.00 22.08  ? 308  GLN B O   1 
ATOM   5109 C  CB  . GLN B 1 324 ? -32.927 -36.677 -28.503 1.00 24.42  ? 308  GLN B CB  1 
ATOM   5110 C  CG  . GLN B 1 324 ? -32.095 -37.123 -27.304 1.00 52.37  ? 308  GLN B CG  1 
ATOM   5111 C  CD  . GLN B 1 324 ? -32.928 -37.201 -26.050 1.00 74.66  ? 308  GLN B CD  1 
ATOM   5112 O  OE1 . GLN B 1 324 ? -32.835 -36.343 -25.162 1.00 70.54  ? 308  GLN B OE1 1 
ATOM   5113 N  NE2 . GLN B 1 324 ? -33.774 -38.225 -25.958 1.00 63.78  ? 308  GLN B NE2 1 
ATOM   5114 N  N   . VAL B 1 325 ? -33.317 -37.734 -31.709 1.00 19.76  ? 309  VAL B N   1 
ATOM   5115 C  CA  . VAL B 1 325 ? -34.255 -37.795 -32.833 1.00 17.59  ? 309  VAL B CA  1 
ATOM   5116 C  C   . VAL B 1 325 ? -35.156 -39.035 -32.654 1.00 23.60  ? 309  VAL B C   1 
ATOM   5117 O  O   . VAL B 1 325 ? -34.805 -39.952 -31.898 1.00 23.48  ? 309  VAL B O   1 
ATOM   5118 C  CB  . VAL B 1 325 ? -33.542 -37.764 -34.222 1.00 19.51  ? 309  VAL B CB  1 
ATOM   5119 C  CG1 . VAL B 1 325 ? -32.833 -36.412 -34.465 1.00 19.32  ? 309  VAL B CG1 1 
ATOM   5120 C  CG2 . VAL B 1 325 ? -32.568 -38.936 -34.402 1.00 19.62  ? 309  VAL B CG2 1 
ATOM   5121 N  N   . GLU B 1 326 ? -36.295 -39.079 -33.371 1.00 21.79  ? 310  GLU B N   1 
ATOM   5122 C  CA  . GLU B 1 326 ? -37.159 -40.267 -33.376 1.00 22.15  ? 310  GLU B CA  1 
ATOM   5123 C  C   . GLU B 1 326 ? -36.679 -41.057 -34.563 1.00 25.28  ? 310  GLU B C   1 
ATOM   5124 O  O   . GLU B 1 326 ? -36.857 -40.645 -35.733 1.00 24.02  ? 310  GLU B O   1 
ATOM   5125 C  CB  . GLU B 1 326 ? -38.645 -39.899 -33.494 1.00 23.85  ? 310  GLU B CB  1 
ATOM   5126 C  CG  . GLU B 1 326 ? -39.218 -39.254 -32.241 1.00 37.13  ? 310  GLU B CG  1 
ATOM   5127 C  CD  . GLU B 1 326 ? -40.556 -38.562 -32.442 1.00 62.72  ? 310  GLU B CD  1 
ATOM   5128 O  OE1 . GLU B 1 326 ? -41.440 -39.139 -33.119 1.00 41.59  ? 310  GLU B OE1 1 
ATOM   5129 O  OE2 . GLU B 1 326 ? -40.721 -37.438 -31.915 1.00 66.17  ? 310  GLU B OE2 1 
ATOM   5130 N  N   . TYR B 1 327 ? -35.935 -42.129 -34.263 1.00 21.48  ? 311  TYR B N   1 
ATOM   5131 C  CA  . TYR B 1 327 ? -35.341 -42.987 -35.283 1.00 21.10  ? 311  TYR B CA  1 
ATOM   5132 C  C   . TYR B 1 327 ? -34.997 -44.345 -34.698 1.00 24.82  ? 311  TYR B C   1 
ATOM   5133 O  O   . TYR B 1 327 ? -34.284 -44.440 -33.695 1.00 23.14  ? 311  TYR B O   1 
ATOM   5134 C  CB  . TYR B 1 327 ? -34.081 -42.337 -35.905 1.00 21.84  ? 311  TYR B CB  1 
ATOM   5135 C  CG  . TYR B 1 327 ? -33.363 -43.236 -36.884 1.00 23.89  ? 311  TYR B CG  1 
ATOM   5136 C  CD1 . TYR B 1 327 ? -33.960 -43.609 -38.087 1.00 25.38  ? 311  TYR B CD1 1 
ATOM   5137 C  CD2 . TYR B 1 327 ? -32.128 -43.797 -36.566 1.00 26.31  ? 311  TYR B CD2 1 
ATOM   5138 C  CE1 . TYR B 1 327 ? -33.326 -44.479 -38.972 1.00 26.03  ? 311  TYR B CE1 1 
ATOM   5139 C  CE2 . TYR B 1 327 ? -31.503 -44.706 -37.425 1.00 27.21  ? 311  TYR B CE2 1 
ATOM   5140 C  CZ  . TYR B 1 327 ? -32.096 -45.026 -38.635 1.00 32.04  ? 311  TYR B CZ  1 
ATOM   5141 O  OH  . TYR B 1 327 ? -31.465 -45.885 -39.498 1.00 32.41  ? 311  TYR B OH  1 
ATOM   5142 N  N   . ASN B 1 328 ? -35.475 -45.395 -35.357 1.00 23.42  ? 312  ASN B N   1 
ATOM   5143 C  CA  . ASN B 1 328 ? -35.176 -46.777 -34.962 1.00 24.74  ? 312  ASN B CA  1 
ATOM   5144 C  C   . ASN B 1 328 ? -34.763 -47.444 -36.254 1.00 30.58  ? 312  ASN B C   1 
ATOM   5145 O  O   . ASN B 1 328 ? -35.605 -47.647 -37.150 1.00 29.56  ? 312  ASN B O   1 
ATOM   5146 C  CB  . ASN B 1 328 ? -36.394 -47.457 -34.337 1.00 29.81  ? 312  ASN B CB  1 
ATOM   5147 N  N   . GLY B 1 329 ? -33.453 -47.634 -36.388 1.00 28.30  ? 313  GLY B N   1 
ATOM   5148 C  CA  . GLY B 1 329 ? -32.825 -48.248 -37.556 1.00 28.20  ? 313  GLY B CA  1 
ATOM   5149 C  C   . GLY B 1 329 ? -31.329 -48.457 -37.415 1.00 32.65  ? 313  GLY B C   1 
ATOM   5150 O  O   . GLY B 1 329 ? -30.771 -48.326 -36.313 1.00 31.47  ? 313  GLY B O   1 
ATOM   5151 N  N   . GLY B 1 330 ? -30.683 -48.776 -38.542 1.00 29.30  ? 314  GLY B N   1 
ATOM   5152 C  CA  . GLY B 1 330 ? -29.240 -48.988 -38.598 1.00 28.61  ? 314  GLY B CA  1 
ATOM   5153 C  C   . GLY B 1 330 ? -28.465 -47.691 -38.605 1.00 30.71  ? 314  GLY B C   1 
ATOM   5154 O  O   . GLY B 1 330 ? -29.060 -46.606 -38.644 1.00 30.10  ? 314  GLY B O   1 
ATOM   5155 N  N   . ASN B 1 331 ? -27.124 -47.791 -38.563 1.00 25.61  ? 315  ASN B N   1 
ATOM   5156 C  CA  . ASN B 1 331 ? -26.245 -46.626 -38.590 1.00 24.83  ? 315  ASN B CA  1 
ATOM   5157 C  C   . ASN B 1 331 ? -26.095 -46.043 -39.976 1.00 27.95  ? 315  ASN B C   1 
ATOM   5158 O  O   . ASN B 1 331 ? -26.177 -46.765 -40.980 1.00 27.13  ? 315  ASN B O   1 
ATOM   5159 C  CB  . ASN B 1 331 ? -24.860 -46.967 -38.048 1.00 24.54  ? 315  ASN B CB  1 
ATOM   5160 C  CG  . ASN B 1 331 ? -24.802 -47.301 -36.577 1.00 35.37  ? 315  ASN B CG  1 
ATOM   5161 O  OD1 . ASN B 1 331 ? -25.790 -47.221 -35.831 1.00 28.37  ? 315  ASN B OD1 1 
ATOM   5162 N  ND2 . ASN B 1 331 ? -23.635 -47.750 -36.143 1.00 31.33  ? 315  ASN B ND2 1 
ATOM   5163 N  N   . LEU B 1 332 ? -25.815 -44.730 -40.029 1.00 23.37  ? 316  LEU B N   1 
ATOM   5164 C  CA  . LEU B 1 332 ? -25.548 -44.025 -41.278 1.00 21.55  ? 316  LEU B CA  1 
ATOM   5165 C  C   . LEU B 1 332 ? -24.627 -42.847 -41.021 1.00 25.61  ? 316  LEU B C   1 
ATOM   5166 O  O   . LEU B 1 332 ? -24.901 -42.014 -40.132 1.00 24.01  ? 316  LEU B O   1 
ATOM   5167 C  CB  . LEU B 1 332 ? -26.857 -43.540 -41.947 1.00 20.22  ? 316  LEU B CB  1 
ATOM   5168 C  CG  . LEU B 1 332 ? -26.714 -42.608 -43.181 1.00 22.49  ? 316  LEU B CG  1 
ATOM   5169 C  CD1 . LEU B 1 332 ? -26.081 -43.361 -44.391 1.00 21.33  ? 316  LEU B CD1 1 
ATOM   5170 C  CD2 . LEU B 1 332 ? -28.073 -42.010 -43.560 1.00 24.62  ? 316  LEU B CD2 1 
ATOM   5171 N  N   . GLU B 1 333 ? -23.551 -42.763 -41.819 1.00 21.98  ? 317  GLU B N   1 
ATOM   5172 C  CA  . GLU B 1 333 ? -22.648 -41.626 -41.798 1.00 22.88  ? 317  GLU B CA  1 
ATOM   5173 C  C   . GLU B 1 333 ? -22.805 -40.909 -43.144 1.00 26.53  ? 317  GLU B C   1 
ATOM   5174 O  O   . GLU B 1 333 ? -22.621 -41.529 -44.191 1.00 27.12  ? 317  GLU B O   1 
ATOM   5175 C  CB  . GLU B 1 333 ? -21.194 -42.053 -41.545 1.00 25.20  ? 317  GLU B CB  1 
ATOM   5176 C  CG  . GLU B 1 333 ? -20.271 -40.858 -41.418 1.00 33.72  ? 317  GLU B CG  1 
ATOM   5177 C  CD  . GLU B 1 333 ? -18.820 -41.240 -41.232 1.00 52.04  ? 317  GLU B CD  1 
ATOM   5178 O  OE1 . GLU B 1 333 ? -18.163 -41.595 -42.237 1.00 51.72  ? 317  GLU B OE1 1 
ATOM   5179 O  OE2 . GLU B 1 333 ? -18.353 -41.232 -40.071 1.00 39.78  ? 317  GLU B OE2 1 
ATOM   5180 N  N   . ILE B 1 334 ? -23.163 -39.615 -43.122 1.00 22.13  ? 318  ILE B N   1 
ATOM   5181 C  CA  . ILE B 1 334 ? -23.414 -38.889 -44.369 1.00 20.99  ? 318  ILE B CA  1 
ATOM   5182 C  C   . ILE B 1 334 ? -22.991 -37.430 -44.215 1.00 24.13  ? 318  ILE B C   1 
ATOM   5183 O  O   . ILE B 1 334 ? -23.129 -36.871 -43.133 1.00 22.56  ? 318  ILE B O   1 
ATOM   5184 C  CB  . ILE B 1 334 ? -24.912 -39.089 -44.795 1.00 22.90  ? 318  ILE B CB  1 
ATOM   5185 C  CG1 . ILE B 1 334 ? -25.212 -38.559 -46.223 1.00 23.33  ? 318  ILE B CG1 1 
ATOM   5186 C  CG2 . ILE B 1 334 ? -25.907 -38.546 -43.754 1.00 22.70  ? 318  ILE B CG2 1 
ATOM   5187 C  CD1 . ILE B 1 334 ? -26.655 -38.987 -46.783 1.00 22.61  ? 318  ILE B CD1 1 
ATOM   5188 N  N   . GLY B 1 335 ? -22.428 -36.859 -45.276 1.00 22.36  ? 319  GLY B N   1 
ATOM   5189 C  CA  . GLY B 1 335 ? -21.979 -35.471 -45.279 1.00 22.56  ? 319  GLY B CA  1 
ATOM   5190 C  C   . GLY B 1 335 ? -22.896 -34.572 -46.078 1.00 24.10  ? 319  GLY B C   1 
ATOM   5191 O  O   . GLY B 1 335 ? -23.527 -35.028 -47.038 1.00 23.92  ? 319  GLY B O   1 
ATOM   5192 N  N   . PHE B 1 336 ? -22.991 -33.301 -45.677 1.00 20.31  ? 320  PHE B N   1 
ATOM   5193 C  CA  . PHE B 1 336 ? -23.796 -32.282 -46.364 1.00 18.81  ? 320  PHE B CA  1 
ATOM   5194 C  C   . PHE B 1 336 ? -23.181 -30.911 -46.304 1.00 24.67  ? 320  PHE B C   1 
ATOM   5195 O  O   . PHE B 1 336 ? -22.531 -30.551 -45.314 1.00 24.39  ? 320  PHE B O   1 
ATOM   5196 C  CB  . PHE B 1 336 ? -25.224 -32.184 -45.777 1.00 19.32  ? 320  PHE B CB  1 
ATOM   5197 C  CG  . PHE B 1 336 ? -26.135 -33.339 -46.088 1.00 19.52  ? 320  PHE B CG  1 
ATOM   5198 C  CD1 . PHE B 1 336 ? -26.698 -33.481 -47.352 1.00 21.81  ? 320  PHE B CD1 1 
ATOM   5199 C  CD2 . PHE B 1 336 ? -26.414 -34.300 -45.125 1.00 19.44  ? 320  PHE B CD2 1 
ATOM   5200 C  CE1 . PHE B 1 336 ? -27.529 -34.571 -47.640 1.00 22.72  ? 320  PHE B CE1 1 
ATOM   5201 C  CE2 . PHE B 1 336 ? -27.246 -35.388 -45.414 1.00 22.64  ? 320  PHE B CE2 1 
ATOM   5202 C  CZ  . PHE B 1 336 ? -27.803 -35.510 -46.666 1.00 21.42  ? 320  PHE B CZ  1 
ATOM   5203 N  N   . ASN B 1 337 ? -23.511 -30.092 -47.313 1.00 22.70  ? 321  ASN B N   1 
ATOM   5204 C  CA  . ASN B 1 337 ? -23.219 -28.672 -47.333 1.00 22.62  ? 321  ASN B CA  1 
ATOM   5205 C  C   . ASN B 1 337 ? -24.234 -28.103 -46.301 1.00 23.69  ? 321  ASN B C   1 
ATOM   5206 O  O   . ASN B 1 337 ? -25.463 -28.292 -46.426 1.00 20.27  ? 321  ASN B O   1 
ATOM   5207 C  CB  . ASN B 1 337 ? -23.436 -28.111 -48.748 1.00 28.38  ? 321  ASN B CB  1 
ATOM   5208 C  CG  . ASN B 1 337 ? -23.426 -26.596 -48.877 1.00 42.71  ? 321  ASN B CG  1 
ATOM   5209 O  OD1 . ASN B 1 337 ? -23.975 -25.850 -48.049 1.00 27.35  ? 321  ASN B OD1 1 
ATOM   5210 N  ND2 . ASN B 1 337 ? -22.880 -26.112 -49.982 1.00 37.09  ? 321  ASN B ND2 1 
ATOM   5211 N  N   . VAL B 1 338 ? -23.707 -27.513 -45.216 1.00 21.15  ? 322  VAL B N   1 
ATOM   5212 C  CA  . VAL B 1 338 ? -24.571 -26.983 -44.161 1.00 20.74  ? 322  VAL B CA  1 
ATOM   5213 C  C   . VAL B 1 338 ? -25.596 -25.949 -44.659 1.00 21.62  ? 322  VAL B C   1 
ATOM   5214 O  O   . VAL B 1 338 ? -26.734 -25.984 -44.195 1.00 21.23  ? 322  VAL B O   1 
ATOM   5215 C  CB  . VAL B 1 338 ? -23.802 -26.547 -42.886 1.00 25.64  ? 322  VAL B CB  1 
ATOM   5216 C  CG1 . VAL B 1 338 ? -23.064 -25.219 -43.107 1.00 25.61  ? 322  VAL B CG1 1 
ATOM   5217 C  CG2 . VAL B 1 338 ? -24.746 -26.468 -41.677 1.00 25.27  ? 322  VAL B CG2 1 
ATOM   5218 N  N   . SER B 1 339 ? -25.220 -25.064 -45.623 1.00 18.81  ? 323  SER B N   1 
ATOM   5219 C  CA  . SER B 1 339 ? -26.140 -24.038 -46.120 1.00 18.49  ? 323  SER B CA  1 
ATOM   5220 C  C   . SER B 1 339 ? -27.404 -24.631 -46.771 1.00 21.19  ? 323  SER B C   1 
ATOM   5221 O  O   . SER B 1 339 ? -28.484 -24.096 -46.576 1.00 19.33  ? 323  SER B O   1 
ATOM   5222 C  CB  . SER B 1 339 ? -25.446 -23.037 -47.040 1.00 23.37  ? 323  SER B CB  1 
ATOM   5223 O  OG  . SER B 1 339 ? -25.414 -23.516 -48.373 1.00 35.32  ? 323  SER B OG  1 
ATOM   5224 N  N   . TYR B 1 340 ? -27.264 -25.768 -47.476 1.00 17.65  ? 324  TYR B N   1 
ATOM   5225 C  CA  . TYR B 1 340 ? -28.401 -26.460 -48.091 1.00 17.81  ? 324  TYR B CA  1 
ATOM   5226 C  C   . TYR B 1 340 ? -29.392 -26.955 -47.033 1.00 19.75  ? 324  TYR B C   1 
ATOM   5227 O  O   . TYR B 1 340 ? -30.601 -26.868 -47.238 1.00 17.28  ? 324  TYR B O   1 
ATOM   5228 C  CB  . TYR B 1 340 ? -27.904 -27.641 -48.919 1.00 18.57  ? 324  TYR B CB  1 
ATOM   5229 C  CG  . TYR B 1 340 ? -27.093 -27.289 -50.143 1.00 20.87  ? 324  TYR B CG  1 
ATOM   5230 C  CD1 . TYR B 1 340 ? -27.065 -25.983 -50.640 1.00 22.63  ? 324  TYR B CD1 1 
ATOM   5231 C  CD2 . TYR B 1 340 ? -26.398 -28.269 -50.843 1.00 23.05  ? 324  TYR B CD2 1 
ATOM   5232 C  CE1 . TYR B 1 340 ? -26.368 -25.671 -51.805 1.00 25.07  ? 324  TYR B CE1 1 
ATOM   5233 C  CE2 . TYR B 1 340 ? -25.657 -27.958 -51.976 1.00 24.69  ? 324  TYR B CE2 1 
ATOM   5234 C  CZ  . TYR B 1 340 ? -25.654 -26.661 -52.460 1.00 29.31  ? 324  TYR B CZ  1 
ATOM   5235 O  OH  . TYR B 1 340 ? -24.947 -26.369 -53.594 1.00 31.31  ? 324  TYR B OH  1 
ATOM   5236 N  N   . LEU B 1 341 ? -28.873 -27.458 -45.905 1.00 17.07  ? 325  LEU B N   1 
ATOM   5237 C  CA  . LEU B 1 341 ? -29.706 -27.945 -44.807 1.00 17.06  ? 325  LEU B CA  1 
ATOM   5238 C  C   . LEU B 1 341 ? -30.402 -26.773 -44.119 1.00 19.28  ? 325  LEU B C   1 
ATOM   5239 O  O   . LEU B 1 341 ? -31.618 -26.834 -43.887 1.00 16.75  ? 325  LEU B O   1 
ATOM   5240 C  CB  . LEU B 1 341 ? -28.878 -28.772 -43.806 1.00 17.88  ? 325  LEU B CB  1 
ATOM   5241 C  CG  . LEU B 1 341 ? -28.286 -30.108 -44.338 1.00 21.82  ? 325  LEU B CG  1 
ATOM   5242 C  CD1 . LEU B 1 341 ? -27.609 -30.917 -43.205 1.00 21.49  ? 325  LEU B CD1 1 
ATOM   5243 C  CD2 . LEU B 1 341 ? -29.363 -30.958 -45.031 1.00 23.83  ? 325  LEU B CD2 1 
ATOM   5244 N  N   . LEU B 1 342 ? -29.650 -25.668 -43.886 1.00 18.28  ? 326  LEU B N   1 
ATOM   5245 C  CA  . LEU B 1 342 ? -30.180 -24.451 -43.259 1.00 18.26  ? 326  LEU B CA  1 
ATOM   5246 C  C   . LEU B 1 342 ? -31.304 -23.827 -44.087 1.00 19.89  ? 326  LEU B C   1 
ATOM   5247 O  O   . LEU B 1 342 ? -32.349 -23.485 -43.531 1.00 18.18  ? 326  LEU B O   1 
ATOM   5248 C  CB  . LEU B 1 342 ? -29.052 -23.440 -42.963 1.00 18.93  ? 326  LEU B CB  1 
ATOM   5249 C  CG  . LEU B 1 342 ? -28.000 -23.888 -41.920 1.00 23.99  ? 326  LEU B CG  1 
ATOM   5250 C  CD1 . LEU B 1 342 ? -26.966 -22.777 -41.685 1.00 25.24  ? 326  LEU B CD1 1 
ATOM   5251 C  CD2 . LEU B 1 342 ? -28.636 -24.256 -40.598 1.00 25.25  ? 326  LEU B CD2 1 
ATOM   5252 N  N   . ASP B 1 343 ? -31.124 -23.756 -45.420 1.00 17.36  ? 327  ASP B N   1 
ATOM   5253 C  CA  . ASP B 1 343 ? -32.147 -23.236 -46.337 1.00 16.23  ? 327  ASP B CA  1 
ATOM   5254 C  C   . ASP B 1 343 ? -33.467 -24.038 -46.213 1.00 18.30  ? 327  ASP B C   1 
ATOM   5255 O  O   . ASP B 1 343 ? -34.546 -23.447 -46.101 1.00 17.24  ? 327  ASP B O   1 
ATOM   5256 C  CB  . ASP B 1 343 ? -31.626 -23.280 -47.783 1.00 17.79  ? 327  ASP B CB  1 
ATOM   5257 C  CG  . ASP B 1 343 ? -30.518 -22.284 -48.098 1.00 22.43  ? 327  ASP B CG  1 
ATOM   5258 O  OD1 . ASP B 1 343 ? -30.283 -21.363 -47.274 1.00 21.52  ? 327  ASP B OD1 1 
ATOM   5259 O  OD2 . ASP B 1 343 ? -29.864 -22.450 -49.132 1.00 21.33  ? 327  ASP B OD2 1 
ATOM   5260 N  N   . VAL B 1 344 ? -33.373 -25.390 -46.245 1.00 14.39  ? 328  VAL B N   1 
ATOM   5261 C  CA  . VAL B 1 344 ? -34.560 -26.266 -46.119 1.00 13.94  ? 328  VAL B CA  1 
ATOM   5262 C  C   . VAL B 1 344 ? -35.247 -26.042 -44.770 1.00 17.23  ? 328  VAL B C   1 
ATOM   5263 O  O   . VAL B 1 344 ? -36.459 -25.829 -44.720 1.00 16.74  ? 328  VAL B O   1 
ATOM   5264 C  CB  . VAL B 1 344 ? -34.166 -27.752 -46.327 1.00 16.10  ? 328  VAL B CB  1 
ATOM   5265 C  CG1 . VAL B 1 344 ? -35.319 -28.695 -45.937 1.00 16.48  ? 328  VAL B CG1 1 
ATOM   5266 C  CG2 . VAL B 1 344 ? -33.753 -28.004 -47.780 1.00 15.86  ? 328  VAL B CG2 1 
ATOM   5267 N  N   . LEU B 1 345 ? -34.479 -26.095 -43.675 1.00 15.67  ? 329  LEU B N   1 
ATOM   5268 C  CA  . LEU B 1 345 ? -35.074 -25.935 -42.344 1.00 16.85  ? 329  LEU B CA  1 
ATOM   5269 C  C   . LEU B 1 345 ? -35.747 -24.558 -42.126 1.00 18.79  ? 329  LEU B C   1 
ATOM   5270 O  O   . LEU B 1 345 ? -36.789 -24.479 -41.472 1.00 17.30  ? 329  LEU B O   1 
ATOM   5271 C  CB  . LEU B 1 345 ? -34.058 -26.282 -41.249 1.00 17.08  ? 329  LEU B CB  1 
ATOM   5272 C  CG  . LEU B 1 345 ? -33.618 -27.762 -41.167 1.00 21.10  ? 329  LEU B CG  1 
ATOM   5273 C  CD1 . LEU B 1 345 ? -32.625 -27.949 -40.059 1.00 22.32  ? 329  LEU B CD1 1 
ATOM   5274 C  CD2 . LEU B 1 345 ? -34.795 -28.711 -40.920 1.00 21.65  ? 329  LEU B CD2 1 
ATOM   5275 N  N   . GLY B 1 346 ? -35.224 -23.536 -42.810 1.00 17.46  ? 330  GLY B N   1 
ATOM   5276 C  CA  . GLY B 1 346 ? -35.753 -22.180 -42.786 1.00 18.32  ? 330  GLY B CA  1 
ATOM   5277 C  C   . GLY B 1 346 ? -37.143 -22.039 -43.385 1.00 21.77  ? 330  GLY B C   1 
ATOM   5278 O  O   . GLY B 1 346 ? -37.839 -21.072 -43.073 1.00 21.84  ? 330  GLY B O   1 
ATOM   5279 N  N   . VAL B 1 347 ? -37.576 -23.000 -44.246 1.00 17.45  ? 331  VAL B N   1 
ATOM   5280 C  CA  . VAL B 1 347 ? -38.913 -22.972 -44.864 1.00 17.70  ? 331  VAL B CA  1 
ATOM   5281 C  C   . VAL B 1 347 ? -39.905 -24.035 -44.282 1.00 21.22  ? 331  VAL B C   1 
ATOM   5282 O  O   . VAL B 1 347 ? -41.075 -24.069 -44.675 1.00 20.71  ? 331  VAL B O   1 
ATOM   5283 C  CB  . VAL B 1 347 ? -38.884 -22.989 -46.421 1.00 21.08  ? 331  VAL B CB  1 
ATOM   5284 C  CG1 . VAL B 1 347 ? -38.131 -21.781 -46.981 1.00 21.45  ? 331  VAL B CG1 1 
ATOM   5285 C  CG2 . VAL B 1 347 ? -38.290 -24.297 -46.943 1.00 19.86  ? 331  VAL B CG2 1 
ATOM   5286 N  N   . ILE B 1 348 ? -39.440 -24.902 -43.367 1.00 17.40  ? 332  ILE B N   1 
ATOM   5287 C  CA  . ILE B 1 348 ? -40.324 -25.877 -42.729 1.00 17.42  ? 332  ILE B CA  1 
ATOM   5288 C  C   . ILE B 1 348 ? -41.211 -25.112 -41.697 1.00 20.47  ? 332  ILE B C   1 
ATOM   5289 O  O   . ILE B 1 348 ? -40.685 -24.435 -40.812 1.00 19.10  ? 332  ILE B O   1 
ATOM   5290 C  CB  . ILE B 1 348 ? -39.512 -27.046 -42.080 1.00 19.71  ? 332  ILE B CB  1 
ATOM   5291 C  CG1 . ILE B 1 348 ? -38.726 -27.891 -43.151 1.00 20.00  ? 332  ILE B CG1 1 
ATOM   5292 C  CG2 . ILE B 1 348 ? -40.403 -27.924 -41.164 1.00 17.44  ? 332  ILE B CG2 1 
ATOM   5293 C  CD1 . ILE B 1 348 ? -39.618 -28.832 -44.126 1.00 23.52  ? 332  ILE B CD1 1 
ATOM   5294 N  N   . GLY B 1 349 ? -42.528 -25.217 -41.857 1.00 19.08  ? 333  GLY B N   1 
ATOM   5295 C  CA  . GLY B 1 349 ? -43.488 -24.500 -41.017 1.00 19.85  ? 333  GLY B CA  1 
ATOM   5296 C  C   . GLY B 1 349 ? -43.942 -25.212 -39.760 1.00 23.76  ? 333  GLY B C   1 
ATOM   5297 O  O   . GLY B 1 349 ? -44.559 -24.583 -38.900 1.00 25.21  ? 333  GLY B O   1 
ATOM   5298 N  N   . THR B 1 350 ? -43.678 -26.527 -39.665 1.00 19.11  ? 334  THR B N   1 
ATOM   5299 C  CA  . THR B 1 350 ? -44.078 -27.389 -38.536 1.00 18.79  ? 334  THR B CA  1 
ATOM   5300 C  C   . THR B 1 350 ? -42.954 -27.488 -37.515 1.00 20.87  ? 334  THR B C   1 
ATOM   5301 O  O   . THR B 1 350 ? -41.773 -27.372 -37.874 1.00 18.73  ? 334  THR B O   1 
ATOM   5302 C  CB  . THR B 1 350 ? -44.459 -28.802 -39.021 1.00 22.67  ? 334  THR B CB  1 
ATOM   5303 O  OG1 . THR B 1 350 ? -43.368 -29.321 -39.808 1.00 17.48  ? 334  THR B OG1 1 
ATOM   5304 C  CG2 . THR B 1 350 ? -45.768 -28.818 -39.835 1.00 22.81  ? 334  THR B CG2 1 
ATOM   5305 N  N   . GLU B 1 351 ? -43.312 -27.783 -36.256 1.00 17.83  ? 335  GLU B N   1 
ATOM   5306 C  CA  . GLU B 1 351 ? -42.315 -27.883 -35.189 1.00 17.33  ? 335  GLU B CA  1 
ATOM   5307 C  C   . GLU B 1 351 ? -41.330 -29.033 -35.451 1.00 18.74  ? 335  GLU B C   1 
ATOM   5308 O  O   . GLU B 1 351 ? -40.144 -28.879 -35.201 1.00 17.62  ? 335  GLU B O   1 
ATOM   5309 C  CB  . GLU B 1 351 ? -43.021 -28.108 -33.850 1.00 17.92  ? 335  GLU B CB  1 
ATOM   5310 C  CG  . GLU B 1 351 ? -42.065 -28.188 -32.675 1.00 19.07  ? 335  GLU B CG  1 
ATOM   5311 C  CD  . GLU B 1 351 ? -42.856 -28.378 -31.396 1.00 20.70  ? 335  GLU B CD  1 
ATOM   5312 O  OE1 . GLU B 1 351 ? -43.332 -27.356 -30.864 1.00 20.16  ? 335  GLU B OE1 1 
ATOM   5313 O  OE2 . GLU B 1 351 ? -43.140 -29.535 -31.024 1.00 21.70  ? 335  GLU B OE2 1 
ATOM   5314 N  N   . GLN B 1 352 ? -41.841 -30.166 -35.941 1.00 16.09  ? 336  GLN B N   1 
ATOM   5315 C  CA  . GLN B 1 352 ? -41.026 -31.319 -36.283 1.00 15.36  ? 336  GLN B CA  1 
ATOM   5316 C  C   . GLN B 1 352 ? -40.747 -31.340 -37.786 1.00 20.47  ? 336  GLN B C   1 
ATOM   5317 O  O   . GLN B 1 352 ? -41.509 -30.775 -38.580 1.00 19.76  ? 336  GLN B O   1 
ATOM   5318 C  CB  . GLN B 1 352 ? -41.692 -32.629 -35.838 1.00 17.39  ? 336  GLN B CB  1 
ATOM   5319 C  CG  . GLN B 1 352 ? -41.783 -32.794 -34.298 1.00 26.67  ? 336  GLN B CG  1 
ATOM   5320 C  CD  . GLN B 1 352 ? -42.208 -34.190 -33.903 1.00 49.15  ? 336  GLN B CD  1 
ATOM   5321 O  OE1 . GLN B 1 352 ? -43.243 -34.707 -34.337 1.00 46.60  ? 336  GLN B OE1 1 
ATOM   5322 N  NE2 . GLN B 1 352 ? -41.417 -34.837 -33.063 1.00 47.81  ? 336  GLN B NE2 1 
ATOM   5323 N  N   . VAL B 1 353 ? -39.656 -32.020 -38.171 1.00 16.36  ? 337  VAL B N   1 
ATOM   5324 C  CA  . VAL B 1 353 ? -39.242 -32.160 -39.561 1.00 14.95  ? 337  VAL B CA  1 
ATOM   5325 C  C   . VAL B 1 353 ? -38.968 -33.640 -39.834 1.00 19.11  ? 337  VAL B C   1 
ATOM   5326 O  O   . VAL B 1 353 ? -38.432 -34.347 -38.970 1.00 19.03  ? 337  VAL B O   1 
ATOM   5327 C  CB  . VAL B 1 353 ? -38.024 -31.243 -39.885 1.00 17.86  ? 337  VAL B CB  1 
ATOM   5328 C  CG1 . VAL B 1 353 ? -36.811 -31.534 -38.996 1.00 16.76  ? 337  VAL B CG1 1 
ATOM   5329 C  CG2 . VAL B 1 353 ? -37.637 -31.284 -41.370 1.00 17.49  ? 337  VAL B CG2 1 
ATOM   5330 N  N   . ARG B 1 354 ? -39.304 -34.087 -41.034 1.00 16.73  ? 338  ARG B N   1 
ATOM   5331 C  CA  . ARG B 1 354 ? -39.029 -35.458 -41.424 1.00 16.90  ? 338  ARG B CA  1 
ATOM   5332 C  C   . ARG B 1 354 ? -37.908 -35.511 -42.452 1.00 19.90  ? 338  ARG B C   1 
ATOM   5333 O  O   . ARG B 1 354 ? -37.977 -34.842 -43.491 1.00 17.93  ? 338  ARG B O   1 
ATOM   5334 C  CB  . ARG B 1 354 ? -40.278 -36.160 -41.980 1.00 19.64  ? 338  ARG B CB  1 
ATOM   5335 C  CG  . ARG B 1 354 ? -41.377 -36.396 -40.973 1.00 25.01  ? 338  ARG B CG  1 
ATOM   5336 C  CD  . ARG B 1 354 ? -42.501 -37.183 -41.632 1.00 31.84  ? 338  ARG B CD  1 
ATOM   5337 N  NE  . ARG B 1 354 ? -43.314 -36.333 -42.497 1.00 34.82  ? 338  ARG B NE  1 
ATOM   5338 C  CZ  . ARG B 1 354 ? -43.766 -36.682 -43.701 1.00 45.83  ? 338  ARG B CZ  1 
ATOM   5339 N  NH1 . ARG B 1 354 ? -43.477 -37.879 -44.211 1.00 36.77  ? 338  ARG B NH1 1 
ATOM   5340 N  NH2 . ARG B 1 354 ? -44.518 -35.846 -44.397 1.00 23.80  ? 338  ARG B NH2 1 
ATOM   5341 N  N   . PHE B 1 355 ? -36.882 -36.318 -42.161 1.00 17.01  ? 339  PHE B N   1 
ATOM   5342 C  CA  . PHE B 1 355 ? -35.802 -36.594 -43.111 1.00 16.83  ? 339  PHE B CA  1 
ATOM   5343 C  C   . PHE B 1 355 ? -35.955 -38.053 -43.527 1.00 21.41  ? 339  PHE B C   1 
ATOM   5344 O  O   . PHE B 1 355 ? -36.119 -38.921 -42.665 1.00 21.27  ? 339  PHE B O   1 
ATOM   5345 C  CB  . PHE B 1 355 ? -34.412 -36.386 -42.481 1.00 18.33  ? 339  PHE B CB  1 
ATOM   5346 C  CG  . PHE B 1 355 ? -33.955 -34.953 -42.406 1.00 19.20  ? 339  PHE B CG  1 
ATOM   5347 C  CD1 . PHE B 1 355 ? -34.446 -34.099 -41.419 1.00 21.03  ? 339  PHE B CD1 1 
ATOM   5348 C  CD2 . PHE B 1 355 ? -32.998 -34.465 -43.293 1.00 21.28  ? 339  PHE B CD2 1 
ATOM   5349 C  CE1 . PHE B 1 355 ? -34.040 -32.755 -41.367 1.00 21.39  ? 339  PHE B CE1 1 
ATOM   5350 C  CE2 . PHE B 1 355 ? -32.564 -33.129 -43.215 1.00 23.78  ? 339  PHE B CE2 1 
ATOM   5351 C  CZ  . PHE B 1 355 ? -33.099 -32.285 -42.259 1.00 21.92  ? 339  PHE B CZ  1 
ATOM   5352 N  N   . ILE B 1 356 ? -35.908 -38.315 -44.825 1.00 19.03  ? 340  ILE B N   1 
ATOM   5353 C  CA  . ILE B 1 356 ? -35.973 -39.682 -45.368 1.00 20.32  ? 340  ILE B CA  1 
ATOM   5354 C  C   . ILE B 1 356 ? -34.646 -39.910 -46.073 1.00 22.89  ? 340  ILE B C   1 
ATOM   5355 O  O   . ILE B 1 356 ? -34.298 -39.186 -47.004 1.00 22.42  ? 340  ILE B O   1 
ATOM   5356 C  CB  . ILE B 1 356 ? -37.227 -39.953 -46.238 1.00 23.89  ? 340  ILE B CB  1 
ATOM   5357 C  CG1 . ILE B 1 356 ? -38.530 -39.776 -45.399 1.00 26.13  ? 340  ILE B CG1 1 
ATOM   5358 C  CG2 . ILE B 1 356 ? -37.172 -41.363 -46.867 1.00 22.90  ? 340  ILE B CG2 1 
ATOM   5359 C  CD1 . ILE B 1 356 ? -39.723 -39.255 -46.193 1.00 37.62  ? 340  ILE B CD1 1 
ATOM   5360 N  N   . LEU B 1 357 ? -33.859 -40.850 -45.547 1.00 19.24  ? 341  LEU B N   1 
ATOM   5361 C  CA  . LEU B 1 357 ? -32.504 -41.113 -46.033 1.00 18.26  ? 341  LEU B CA  1 
ATOM   5362 C  C   . LEU B 1 357 ? -32.333 -42.565 -46.494 1.00 22.10  ? 341  LEU B C   1 
ATOM   5363 O  O   . LEU B 1 357 ? -33.189 -43.400 -46.209 1.00 21.36  ? 341  LEU B O   1 
ATOM   5364 C  CB  . LEU B 1 357 ? -31.528 -40.837 -44.875 1.00 17.64  ? 341  LEU B CB  1 
ATOM   5365 C  CG  . LEU B 1 357 ? -31.596 -39.434 -44.239 1.00 22.96  ? 341  LEU B CG  1 
ATOM   5366 C  CD1 . LEU B 1 357 ? -30.891 -39.415 -42.892 1.00 23.67  ? 341  LEU B CD1 1 
ATOM   5367 C  CD2 . LEU B 1 357 ? -31.010 -38.405 -45.169 1.00 24.21  ? 341  LEU B CD2 1 
ATOM   5368 N  N   . SER B 1 358 ? -31.228 -42.860 -47.190 1.00 19.19  ? 342  SER B N   1 
ATOM   5369 C  CA  . SER B 1 358 ? -30.927 -44.248 -47.572 1.00 21.21  ? 342  SER B CA  1 
ATOM   5370 C  C   . SER B 1 358 ? -29.442 -44.514 -47.268 1.00 26.68  ? 342  SER B C   1 
ATOM   5371 O  O   . SER B 1 358 ? -29.127 -44.846 -46.130 1.00 27.78  ? 342  SER B O   1 
ATOM   5372 C  CB  . SER B 1 358 ? -31.344 -44.559 -49.008 1.00 23.34  ? 342  SER B CB  1 
ATOM   5373 O  OG  . SER B 1 358 ? -30.702 -43.707 -49.936 1.00 27.76  ? 342  SER B OG  1 
ATOM   5374 N  N   . ASP B 1 359 ? -28.537 -44.237 -48.207 1.00 23.95  ? 343  ASP B N   1 
ATOM   5375 C  CA  . ASP B 1 359 ? -27.105 -44.432 -47.972 1.00 24.36  ? 343  ASP B CA  1 
ATOM   5376 C  C   . ASP B 1 359 ? -26.297 -43.125 -48.049 1.00 27.05  ? 343  ASP B C   1 
ATOM   5377 O  O   . ASP B 1 359 ? -26.855 -42.064 -48.329 1.00 25.05  ? 343  ASP B O   1 
ATOM   5378 C  CB  . ASP B 1 359 ? -26.536 -45.529 -48.904 1.00 25.66  ? 343  ASP B CB  1 
ATOM   5379 C  CG  . ASP B 1 359 ? -26.686 -45.232 -50.382 1.00 35.47  ? 343  ASP B CG  1 
ATOM   5380 O  OD1 . ASP B 1 359 ? -26.191 -44.179 -50.831 1.00 34.20  ? 343  ASP B OD1 1 
ATOM   5381 O  OD2 . ASP B 1 359 ? -27.231 -46.092 -51.106 1.00 49.29  ? 343  ASP B OD2 1 
ATOM   5382 N  N   . SER B 1 360 ? -24.968 -43.218 -47.825 1.00 25.96  ? 344  SER B N   1 
ATOM   5383 C  CA  . SER B 1 360 ? -24.047 -42.075 -47.796 1.00 26.28  ? 344  SER B CA  1 
ATOM   5384 C  C   . SER B 1 360 ? -23.905 -41.341 -49.128 1.00 30.36  ? 344  SER B C   1 
ATOM   5385 O  O   . SER B 1 360 ? -23.538 -40.166 -49.132 1.00 31.41  ? 344  SER B O   1 
ATOM   5386 C  CB  . SER B 1 360 ? -22.676 -42.514 -47.280 1.00 30.14  ? 344  SER B CB  1 
ATOM   5387 O  OG  . SER B 1 360 ? -22.105 -43.511 -48.110 1.00 42.61  ? 344  SER B OG  1 
ATOM   5388 N  N   . ASN B 1 361 ? -24.213 -42.020 -50.246 1.00 27.86  ? 345  ASN B N   1 
ATOM   5389 C  CA  . ASN B 1 361 ? -24.081 -41.444 -51.584 1.00 28.78  ? 345  ASN B CA  1 
ATOM   5390 C  C   . ASN B 1 361 ? -25.412 -41.015 -52.227 1.00 30.74  ? 345  ASN B C   1 
ATOM   5391 O  O   . ASN B 1 361 ? -25.425 -40.572 -53.378 1.00 32.72  ? 345  ASN B O   1 
ATOM   5392 C  CB  . ASN B 1 361 ? -23.259 -42.385 -52.505 1.00 32.36  ? 345  ASN B CB  1 
ATOM   5393 C  CG  . ASN B 1 361 ? -21.837 -42.589 -52.034 1.00 54.02  ? 345  ASN B CG  1 
ATOM   5394 O  OD1 . ASN B 1 361 ? -21.417 -43.708 -51.727 1.00 57.33  ? 345  ASN B OD1 1 
ATOM   5395 N  ND2 . ASN B 1 361 ? -21.074 -41.510 -51.917 1.00 42.87  ? 345  ASN B ND2 1 
ATOM   5396 N  N   . SER B 1 362 ? -26.512 -41.108 -51.471 1.00 24.26  ? 346  SER B N   1 
ATOM   5397 C  CA  . SER B 1 362 ? -27.843 -40.751 -51.947 1.00 23.00  ? 346  SER B CA  1 
ATOM   5398 C  C   . SER B 1 362 ? -28.404 -39.511 -51.231 1.00 24.52  ? 346  SER B C   1 
ATOM   5399 O  O   . SER B 1 362 ? -28.061 -39.204 -50.078 1.00 21.80  ? 346  SER B O   1 
ATOM   5400 C  CB  . SER B 1 362 ? -28.789 -41.941 -51.855 1.00 26.98  ? 346  SER B CB  1 
ATOM   5401 O  OG  . SER B 1 362 ? -28.221 -43.118 -52.414 1.00 31.29  ? 346  SER B OG  1 
ATOM   5402 N  N   . SER B 1 363 ? -29.268 -38.797 -51.939 1.00 22.77  ? 347  SER B N   1 
ATOM   5403 C  CA  A SER B 1 363 ? -29.865 -37.558 -51.442 0.50 21.32  ? 347  SER B CA  1 
ATOM   5404 C  CA  B SER B 1 363 ? -29.857 -37.560 -51.434 0.50 21.38  ? 347  SER B CA  1 
ATOM   5405 C  C   . SER B 1 363 ? -30.785 -37.754 -50.236 1.00 25.03  ? 347  SER B C   1 
ATOM   5406 O  O   . SER B 1 363 ? -31.325 -38.855 -50.015 1.00 24.18  ? 347  SER B O   1 
ATOM   5407 C  CB  A SER B 1 363 ? -30.622 -36.846 -52.560 0.50 24.28  ? 347  SER B CB  1 
ATOM   5408 C  CB  B SER B 1 363 ? -30.592 -36.833 -52.554 0.50 24.57  ? 347  SER B CB  1 
ATOM   5409 O  OG  A SER B 1 363 ? -29.778 -36.498 -53.645 0.50 27.16  ? 347  SER B OG  1 
ATOM   5410 O  OG  B SER B 1 363 ? -31.669 -37.621 -53.032 0.50 27.98  ? 347  SER B OG  1 
ATOM   5411 N  N   . ALA B 1 364 ? -30.961 -36.679 -49.461 1.00 20.95  ? 348  ALA B N   1 
ATOM   5412 C  CA  . ALA B 1 364 ? -31.877 -36.638 -48.339 1.00 20.10  ? 348  ALA B CA  1 
ATOM   5413 C  C   . ALA B 1 364 ? -33.189 -36.103 -48.978 1.00 22.91  ? 348  ALA B C   1 
ATOM   5414 O  O   . ALA B 1 364 ? -33.142 -35.266 -49.887 1.00 22.94  ? 348  ALA B O   1 
ATOM   5415 C  CB  . ALA B 1 364 ? -31.379 -35.642 -47.291 1.00 20.17  ? 348  ALA B CB  1 
ATOM   5416 N  N   . LEU B 1 365 ? -34.321 -36.607 -48.524 1.00 19.36  ? 349  LEU B N   1 
ATOM   5417 C  CA  . LEU B 1 365 ? -35.667 -36.160 -48.886 1.00 19.09  ? 349  LEU B CA  1 
ATOM   5418 C  C   . LEU B 1 365 ? -36.250 -35.586 -47.581 1.00 20.43  ? 349  LEU B C   1 
ATOM   5419 O  O   . LEU B 1 365 ? -36.234 -36.267 -46.547 1.00 19.83  ? 349  LEU B O   1 
ATOM   5420 C  CB  . LEU B 1 365 ? -36.543 -37.314 -49.393 1.00 19.22  ? 349  LEU B CB  1 
ATOM   5421 C  CG  . LEU B 1 365 ? -38.036 -36.993 -49.638 1.00 21.98  ? 349  LEU B CG  1 
ATOM   5422 C  CD1 . LEU B 1 365 ? -38.210 -35.877 -50.720 1.00 22.11  ? 349  LEU B CD1 1 
ATOM   5423 C  CD2 . LEU B 1 365 ? -38.780 -38.239 -50.093 1.00 24.86  ? 349  LEU B CD2 1 
ATOM   5424 N  N   . VAL B 1 366 ? -36.692 -34.333 -47.618 1.00 15.82  ? 350  VAL B N   1 
ATOM   5425 C  CA  . VAL B 1 366 ? -37.186 -33.653 -46.409 1.00 15.80  ? 350  VAL B CA  1 
ATOM   5426 C  C   . VAL B 1 366 ? -38.643 -33.186 -46.594 1.00 20.00  ? 350  VAL B C   1 
ATOM   5427 O  O   . VAL B 1 366 ? -38.980 -32.618 -47.640 1.00 19.42  ? 350  VAL B O   1 
ATOM   5428 C  CB  . VAL B 1 366 ? -36.272 -32.461 -45.985 1.00 18.17  ? 350  VAL B CB  1 
ATOM   5429 C  CG1 . VAL B 1 366 ? -36.658 -31.936 -44.596 1.00 16.41  ? 350  VAL B CG1 1 
ATOM   5430 C  CG2 . VAL B 1 366 ? -34.785 -32.842 -46.007 1.00 18.14  ? 350  VAL B CG2 1 
ATOM   5431 N  N   . HIS B 1 367 ? -39.468 -33.362 -45.552 1.00 16.24  ? 351  HIS B N   1 
ATOM   5432 C  CA  . HIS B 1 367 ? -40.858 -32.914 -45.532 1.00 17.44  ? 351  HIS B CA  1 
ATOM   5433 C  C   . HIS B 1 367 ? -41.193 -32.265 -44.180 1.00 20.26  ? 351  HIS B C   1 
ATOM   5434 O  O   . HIS B 1 367 ? -40.512 -32.509 -43.175 1.00 18.38  ? 351  HIS B O   1 
ATOM   5435 C  CB  . HIS B 1 367 ? -41.829 -34.102 -45.714 1.00 18.38  ? 351  HIS B CB  1 
ATOM   5436 C  CG  . HIS B 1 367 ? -41.732 -34.869 -47.004 1.00 21.78  ? 351  HIS B CG  1 
ATOM   5437 N  ND1 . HIS B 1 367 ? -42.124 -34.312 -48.206 1.00 23.80  ? 351  HIS B ND1 1 
ATOM   5438 C  CD2 . HIS B 1 367 ? -41.476 -36.184 -47.196 1.00 23.42  ? 351  HIS B CD2 1 
ATOM   5439 C  CE1 . HIS B 1 367 ? -42.005 -35.284 -49.105 1.00 23.51  ? 351  HIS B CE1 1 
ATOM   5440 N  NE2 . HIS B 1 367 ? -41.621 -36.429 -48.539 1.00 23.74  ? 351  HIS B NE2 1 
ATOM   5441 N  N   . GLU B 1 368 ? -42.306 -31.504 -44.145 1.00 17.68  ? 352  GLU B N   1 
ATOM   5442 C  CA  . GLU B 1 368 ? -42.875 -30.992 -42.902 1.00 17.44  ? 352  GLU B CA  1 
ATOM   5443 C  C   . GLU B 1 368 ? -43.417 -32.227 -42.120 1.00 21.47  ? 352  GLU B C   1 
ATOM   5444 O  O   . GLU B 1 368 ? -43.526 -33.339 -42.671 1.00 20.51  ? 352  GLU B O   1 
ATOM   5445 C  CB  . GLU B 1 368 ? -44.011 -30.003 -43.201 1.00 18.72  ? 352  GLU B CB  1 
ATOM   5446 C  CG  . GLU B 1 368 ? -43.525 -28.716 -43.863 1.00 16.25  ? 352  GLU B CG  1 
ATOM   5447 C  CD  . GLU B 1 368 ? -44.571 -27.623 -43.857 1.00 21.69  ? 352  GLU B CD  1 
ATOM   5448 O  OE1 . GLU B 1 368 ? -45.766 -27.927 -44.073 1.00 28.05  ? 352  GLU B OE1 1 
ATOM   5449 O  OE2 . GLU B 1 368 ? -44.202 -26.468 -43.580 1.00 25.44  ? 352  GLU B OE2 1 
ATOM   5450 N  N   . ALA B 1 369 ? -43.745 -32.039 -40.843 1.00 20.19  ? 353  ALA B N   1 
ATOM   5451 C  CA  . ALA B 1 369 ? -44.209 -33.123 -39.961 1.00 21.80  ? 353  ALA B CA  1 
ATOM   5452 C  C   . ALA B 1 369 ? -45.431 -33.931 -40.415 1.00 27.34  ? 353  ALA B C   1 
ATOM   5453 O  O   . ALA B 1 369 ? -45.390 -35.155 -40.381 1.00 26.91  ? 353  ALA B O   1 
ATOM   5454 C  CB  . ALA B 1 369 ? -44.461 -32.571 -38.563 1.00 22.39  ? 353  ALA B CB  1 
ATOM   5455 N  N   . ASP B 1 370 ? -46.503 -33.239 -40.820 1.00 26.51  ? 354  ASP B N   1 
ATOM   5456 C  CA  . ASP B 1 370 ? -47.829 -33.802 -41.081 1.00 27.89  ? 354  ASP B CA  1 
ATOM   5457 C  C   . ASP B 1 370 ? -48.330 -33.864 -42.542 1.00 31.75  ? 354  ASP B C   1 
ATOM   5458 O  O   . ASP B 1 370 ? -49.470 -34.271 -42.762 1.00 33.38  ? 354  ASP B O   1 
ATOM   5459 C  CB  . ASP B 1 370 ? -48.849 -33.035 -40.215 1.00 30.09  ? 354  ASP B CB  1 
ATOM   5460 C  CG  . ASP B 1 370 ? -48.998 -31.558 -40.554 1.00 40.62  ? 354  ASP B CG  1 
ATOM   5461 O  OD1 . ASP B 1 370 ? -48.224 -31.051 -41.406 1.00 40.71  ? 354  ASP B OD1 1 
ATOM   5462 O  OD2 . ASP B 1 370 ? -49.877 -30.908 -39.974 1.00 51.76  ? 354  ASP B OD2 1 
ATOM   5463 N  N   . ASN B 1 371 ? -47.512 -33.448 -43.519 1.00 27.13  ? 355  ASN B N   1 
ATOM   5464 C  CA  . ASN B 1 371 ? -47.925 -33.449 -44.923 1.00 26.50  ? 355  ASN B CA  1 
ATOM   5465 C  C   . ASN B 1 371 ? -46.752 -33.622 -45.882 1.00 27.54  ? 355  ASN B C   1 
ATOM   5466 O  O   . ASN B 1 371 ? -45.601 -33.303 -45.535 1.00 25.04  ? 355  ASN B O   1 
ATOM   5467 C  CB  . ASN B 1 371 ? -48.721 -32.168 -45.255 1.00 26.72  ? 355  ASN B CB  1 
ATOM   5468 C  CG  . ASN B 1 371 ? -47.876 -30.919 -45.338 1.00 38.25  ? 355  ASN B CG  1 
ATOM   5469 O  OD1 . ASN B 1 371 ? -47.403 -30.558 -46.406 1.00 27.15  ? 355  ASN B OD1 1 
ATOM   5470 N  ND2 . ASN B 1 371 ? -47.636 -30.243 -44.210 1.00 30.93  ? 355  ASN B ND2 1 
ATOM   5471 N  N   . ASP B 1 372 ? -47.072 -34.058 -47.118 1.00 25.54  ? 356  ASP B N   1 
ATOM   5472 C  CA  . ASP B 1 372 ? -46.111 -34.235 -48.204 1.00 26.26  ? 356  ASP B CA  1 
ATOM   5473 C  C   . ASP B 1 372 ? -46.244 -33.161 -49.312 1.00 30.24  ? 356  ASP B C   1 
ATOM   5474 O  O   . ASP B 1 372 ? -45.658 -33.338 -50.382 1.00 30.76  ? 356  ASP B O   1 
ATOM   5475 C  CB  . ASP B 1 372 ? -46.270 -35.644 -48.819 1.00 28.81  ? 356  ASP B CB  1 
ATOM   5476 C  CG  . ASP B 1 372 ? -45.778 -36.780 -47.942 1.00 38.50  ? 356  ASP B CG  1 
ATOM   5477 O  OD1 . ASP B 1 372 ? -44.988 -36.510 -46.993 1.00 37.27  ? 356  ASP B OD1 1 
ATOM   5478 O  OD2 . ASP B 1 372 ? -46.134 -37.943 -48.229 1.00 44.01  ? 356  ASP B OD2 1 
ATOM   5479 N  N   . ASP B 1 373 ? -47.002 -32.068 -49.062 1.00 27.40  ? 357  ASP B N   1 
ATOM   5480 C  CA  . ASP B 1 373 ? -47.265 -30.990 -50.047 1.00 28.59  ? 357  ASP B CA  1 
ATOM   5481 C  C   . ASP B 1 373 ? -46.009 -30.247 -50.486 1.00 29.75  ? 357  ASP B C   1 
ATOM   5482 O  O   . ASP B 1 373 ? -45.917 -29.830 -51.636 1.00 29.45  ? 357  ASP B O   1 
ATOM   5483 C  CB  . ASP B 1 373 ? -48.355 -30.008 -49.560 1.00 31.42  ? 357  ASP B CB  1 
ATOM   5484 C  CG  . ASP B 1 373 ? -49.680 -30.689 -49.211 1.00 41.51  ? 357  ASP B CG  1 
ATOM   5485 O  OD1 . ASP B 1 373 ? -50.013 -31.715 -49.853 1.00 40.65  ? 357  ASP B OD1 1 
ATOM   5486 O  OD2 . ASP B 1 373 ? -50.346 -30.233 -48.260 1.00 48.66  ? 357  ASP B OD2 1 
ATOM   5487 N  N   . SER B 1 374 ? -45.050 -30.115 -49.571 1.00 24.91  ? 358  SER B N   1 
ATOM   5488 C  CA  . SER B 1 374 ? -43.734 -29.537 -49.787 1.00 24.50  ? 358  SER B CA  1 
ATOM   5489 C  C   . SER B 1 374 ? -42.729 -30.679 -49.733 1.00 26.16  ? 358  SER B C   1 
ATOM   5490 O  O   . SER B 1 374 ? -42.897 -31.606 -48.927 1.00 25.15  ? 358  SER B O   1 
ATOM   5491 C  CB  . SER B 1 374 ? -43.401 -28.536 -48.681 1.00 28.03  ? 358  SER B CB  1 
ATOM   5492 O  OG  . SER B 1 374 ? -44.185 -27.365 -48.839 1.00 39.24  ? 358  SER B OG  1 
ATOM   5493 N  N   . ALA B 1 375 ? -41.709 -30.646 -50.606 1.00 20.54  ? 359  ALA B N   1 
ATOM   5494 C  CA  . ALA B 1 375 ? -40.660 -31.669 -50.593 1.00 19.52  ? 359  ALA B CA  1 
ATOM   5495 C  C   . ALA B 1 375 ? -39.336 -31.055 -50.973 1.00 22.72  ? 359  ALA B C   1 
ATOM   5496 O  O   . ALA B 1 375 ? -39.265 -30.249 -51.908 1.00 22.25  ? 359  ALA B O   1 
ATOM   5497 C  CB  . ALA B 1 375 ? -41.003 -32.848 -51.507 1.00 20.40  ? 359  ALA B CB  1 
ATOM   5498 N  N   . TYR B 1 376 ? -38.290 -31.457 -50.251 1.00 18.40  ? 360  TYR B N   1 
ATOM   5499 C  CA  . TYR B 1 376 ? -36.946 -30.930 -50.434 1.00 17.87  ? 360  TYR B CA  1 
ATOM   5500 C  C   . TYR B 1 376 ? -35.939 -32.043 -50.599 1.00 22.06  ? 360  TYR B C   1 
ATOM   5501 O  O   . TYR B 1 376 ? -35.935 -33.019 -49.840 1.00 22.04  ? 360  TYR B O   1 
ATOM   5502 C  CB  . TYR B 1 376 ? -36.572 -30.020 -49.253 1.00 17.42  ? 360  TYR B CB  1 
ATOM   5503 C  CG  . TYR B 1 376 ? -37.608 -28.941 -49.028 1.00 17.48  ? 360  TYR B CG  1 
ATOM   5504 C  CD1 . TYR B 1 376 ? -37.573 -27.757 -49.758 1.00 18.23  ? 360  TYR B CD1 1 
ATOM   5505 C  CD2 . TYR B 1 376 ? -38.681 -29.144 -48.165 1.00 17.59  ? 360  TYR B CD2 1 
ATOM   5506 C  CE1 . TYR B 1 376 ? -38.567 -26.790 -49.617 1.00 17.77  ? 360  TYR B CE1 1 
ATOM   5507 C  CE2 . TYR B 1 376 ? -39.674 -28.174 -48.002 1.00 18.29  ? 360  TYR B CE2 1 
ATOM   5508 C  CZ  . TYR B 1 376 ? -39.616 -27.002 -48.738 1.00 21.19  ? 360  TYR B CZ  1 
ATOM   5509 O  OH  . TYR B 1 376 ? -40.601 -26.046 -48.620 1.00 21.05  ? 360  TYR B OH  1 
ATOM   5510 N  N   . VAL B 1 377 ? -35.072 -31.879 -51.583 1.00 18.62  ? 361  VAL B N   1 
ATOM   5511 C  CA  . VAL B 1 377 ? -34.044 -32.864 -51.910 1.00 17.47  ? 361  VAL B CA  1 
ATOM   5512 C  C   . VAL B 1 377 ? -32.691 -32.181 -51.757 1.00 21.15  ? 361  VAL B C   1 
ATOM   5513 O  O   . VAL B 1 377 ? -32.530 -31.042 -52.223 1.00 20.12  ? 361  VAL B O   1 
ATOM   5514 C  CB  . VAL B 1 377 ? -34.240 -33.452 -53.340 1.00 21.50  ? 361  VAL B CB  1 
ATOM   5515 C  CG1 . VAL B 1 377 ? -33.176 -34.508 -53.660 1.00 22.25  ? 361  VAL B CG1 1 
ATOM   5516 C  CG2 . VAL B 1 377 ? -35.642 -34.035 -53.521 1.00 21.38  ? 361  VAL B CG2 1 
ATOM   5517 N  N   . VAL B 1 378 ? -31.758 -32.842 -51.063 1.00 17.95  ? 362  VAL B N   1 
ATOM   5518 C  CA  . VAL B 1 378 ? -30.393 -32.343 -50.863 1.00 18.96  ? 362  VAL B CA  1 
ATOM   5519 C  C   . VAL B 1 378 ? -29.404 -33.468 -51.196 1.00 21.11  ? 362  VAL B C   1 
ATOM   5520 O  O   . VAL B 1 378 ? -29.376 -34.482 -50.500 1.00 19.14  ? 362  VAL B O   1 
ATOM   5521 C  CB  . VAL B 1 378 ? -30.102 -31.745 -49.447 1.00 21.99  ? 362  VAL B CB  1 
ATOM   5522 C  CG1 . VAL B 1 378 ? -28.687 -31.146 -49.390 1.00 21.74  ? 362  VAL B CG1 1 
ATOM   5523 C  CG2 . VAL B 1 378 ? -31.157 -30.711 -49.018 1.00 21.32  ? 362  VAL B CG2 1 
ATOM   5524 N  N   . MET B 1 379 ? -28.559 -33.247 -52.212 1.00 21.56  ? 363  MET B N   1 
ATOM   5525 C  CA  . MET B 1 379 ? -27.506 -34.190 -52.591 1.00 23.30  ? 363  MET B CA  1 
ATOM   5526 C  C   . MET B 1 379 ? -26.437 -34.169 -51.481 1.00 26.38  ? 363  MET B C   1 
ATOM   5527 O  O   . MET B 1 379 ? -26.099 -33.094 -50.964 1.00 25.15  ? 363  MET B O   1 
ATOM   5528 C  CB  . MET B 1 379 ? -26.872 -33.816 -53.945 1.00 27.95  ? 363  MET B CB  1 
ATOM   5529 C  CG  . MET B 1 379 ? -27.756 -34.151 -55.136 1.00 34.47  ? 363  MET B CG  1 
ATOM   5530 S  SD  . MET B 1 379 ? -26.917 -33.876 -56.711 1.00 42.93  ? 363  MET B SD  1 
ATOM   5531 C  CE  . MET B 1 379 ? -26.064 -35.462 -56.910 1.00 40.67  ? 363  MET B CE  1 
ATOM   5532 N  N   . PRO B 1 380 ? -25.904 -35.344 -51.102 1.00 25.25  ? 364  PRO B N   1 
ATOM   5533 C  CA  . PRO B 1 380 ? -24.879 -35.360 -50.060 1.00 25.55  ? 364  PRO B CA  1 
ATOM   5534 C  C   . PRO B 1 380 ? -23.519 -34.916 -50.593 1.00 30.30  ? 364  PRO B C   1 
ATOM   5535 O  O   . PRO B 1 380 ? -23.320 -34.790 -51.810 1.00 28.50  ? 364  PRO B O   1 
ATOM   5536 C  CB  . PRO B 1 380 ? -24.864 -36.829 -49.616 1.00 27.20  ? 364  PRO B CB  1 
ATOM   5537 C  CG  . PRO B 1 380 ? -25.195 -37.595 -50.868 1.00 31.35  ? 364  PRO B CG  1 
ATOM   5538 C  CD  . PRO B 1 380 ? -26.157 -36.702 -51.639 1.00 26.47  ? 364  PRO B CD  1 
ATOM   5539 N  N   . MET B 1 381 ? -22.601 -34.674 -49.657 1.00 29.67  ? 365  MET B N   1 
ATOM   5540 C  CA  . MET B 1 381 ? -21.202 -34.312 -49.865 1.00 33.23  ? 365  MET B CA  1 
ATOM   5541 C  C   . MET B 1 381 ? -20.347 -35.525 -49.495 1.00 38.87  ? 365  MET B C   1 
ATOM   5542 O  O   . MET B 1 381 ? -20.665 -36.229 -48.524 1.00 37.35  ? 365  MET B O   1 
ATOM   5543 C  CB  . MET B 1 381 ? -20.841 -33.175 -48.906 1.00 36.63  ? 365  MET B CB  1 
ATOM   5544 C  CG  . MET B 1 381 ? -20.710 -31.836 -49.566 1.00 42.06  ? 365  MET B CG  1 
ATOM   5545 S  SD  . MET B 1 381 ? -20.193 -30.566 -48.377 1.00 46.77  ? 365  MET B SD  1 
ATOM   5546 C  CE  . MET B 1 381 ? -18.522 -31.087 -48.061 1.00 44.45  ? 365  MET B CE  1 
ATOM   5547 N  N   . ARG B 1 382 ? -19.239 -35.750 -50.234 1.00 38.71  ? 366  ARG B N   1 
ATOM   5548 C  CA  . ARG B 1 382 ? -18.326 -36.863 -49.950 1.00 40.31  ? 366  ARG B CA  1 
ATOM   5549 C  C   . ARG B 1 382 ? -17.582 -36.612 -48.627 1.00 45.52  ? 366  ARG B C   1 
ATOM   5550 O  O   . ARG B 1 382 ? -17.057 -35.511 -48.411 1.00 44.76  ? 366  ARG B O   1 
ATOM   5551 C  CB  . ARG B 1 382 ? -17.340 -37.076 -51.114 1.00 43.07  ? 366  ARG B CB  1 
ATOM   5552 N  N   . LEU B 1 383 ? -17.599 -37.619 -47.725 1.00 43.45  ? 367  LEU B N   1 
ATOM   5553 C  CA  . LEU B 1 383 ? -16.948 -37.560 -46.410 1.00 70.38  ? 367  LEU B CA  1 
ATOM   5554 C  C   . LEU B 1 383 ? -15.569 -38.222 -46.436 1.00 94.54  ? 367  LEU B C   1 
ATOM   5555 O  O   . LEU B 1 383 ? -14.908 -38.240 -47.474 1.00 54.31  ? 367  LEU B O   1 
ATOM   5556 C  CB  . LEU B 1 383 ? -17.833 -38.208 -45.335 1.00 69.56  ? 367  LEU B CB  1 
HETATM 5557 NA NA  . NA  C 2 .   ? -41.237 20.706  -34.390 1.00 11.35  1 1001 NA  A NA  1 
HETATM 5558 O  O   . HOH D 3 .   ? -3.283  22.577  -40.662 1.00 35.38  ? 1101 HOH A O   1 
HETATM 5559 O  O   . HOH D 3 .   ? 1.326   -21.999 -21.858 1.00 38.76  ? 1102 HOH A O   1 
HETATM 5560 O  O   . HOH D 3 .   ? 8.480   -21.003 -18.269 1.00 41.24  ? 1103 HOH A O   1 
HETATM 5561 O  O   . HOH D 3 .   ? 2.128   -16.507 -31.022 1.00 37.16  ? 1104 HOH A O   1 
HETATM 5562 O  O   . HOH D 3 .   ? -41.133 25.366  -33.230 1.00 23.82  ? 1105 HOH A O   1 
HETATM 5563 O  O   . HOH D 3 .   ? -24.153 -27.067 -19.645 1.00 33.05  ? 1106 HOH A O   1 
HETATM 5564 O  O   . HOH D 3 .   ? -3.672  -29.705 -27.028 1.00 50.33  ? 1107 HOH A O   1 
HETATM 5565 O  O   . HOH D 3 .   ? -26.705 21.930  -55.493 1.00 28.94  ? 1108 HOH A O   1 
HETATM 5566 O  O   . HOH D 3 .   ? -40.518 18.450  -33.693 1.00 25.07  ? 1109 HOH A O   1 
HETATM 5567 O  O   . HOH D 3 .   ? 27.530  -18.693 -5.678  1.00 52.34  ? 1110 HOH A O   1 
HETATM 5568 O  O   . HOH D 3 .   ? -1.341  21.096  -14.797 1.00 51.05  ? 1111 HOH A O   1 
HETATM 5569 O  O   . HOH D 3 .   ? -36.270 41.211  -45.226 1.00 28.52  ? 1112 HOH A O   1 
HETATM 5570 O  O   . HOH D 3 .   ? -1.820  -24.614 -22.121 1.00 30.23  ? 1113 HOH A O   1 
HETATM 5571 O  O   . HOH D 3 .   ? -28.347 -22.510 -15.974 1.00 42.36  ? 1114 HOH A O   1 
HETATM 5572 O  O   . HOH D 3 .   ? -3.027  -14.469 -13.943 1.00 42.74  ? 1115 HOH A O   1 
HETATM 5573 O  O   . HOH D 3 .   ? 3.598   -19.808 -28.689 1.00 27.98  ? 1116 HOH A O   1 
HETATM 5574 O  O   . HOH D 3 .   ? -33.174 15.744  -31.945 1.00 32.24  ? 1117 HOH A O   1 
HETATM 5575 O  O   . HOH D 3 .   ? -41.682 25.748  -30.655 1.00 24.22  ? 1118 HOH A O   1 
HETATM 5576 O  O   . HOH D 3 .   ? -6.919  13.178  -8.577  1.00 51.56  ? 1119 HOH A O   1 
HETATM 5577 O  O   . HOH D 3 .   ? -35.599 44.328  -40.555 1.00 59.74  ? 1120 HOH A O   1 
HETATM 5578 O  O   . HOH D 3 .   ? -18.781 32.233  -49.194 1.00 41.61  ? 1121 HOH A O   1 
HETATM 5579 O  O   . HOH D 3 .   ? -23.068 41.721  -40.614 1.00 36.19  ? 1122 HOH A O   1 
HETATM 5580 O  O   . HOH D 3 .   ? -31.307 39.273  -36.162 1.00 36.30  ? 1123 HOH A O   1 
HETATM 5581 O  O   . HOH D 3 .   ? -7.562  -9.837  -10.418 1.00 35.05  ? 1124 HOH A O   1 
HETATM 5582 O  O   . HOH D 3 .   ? -43.472 27.266  -42.185 1.00 35.35  ? 1125 HOH A O   1 
HETATM 5583 O  O   . HOH D 3 .   ? 7.662   -19.687 -26.388 1.00 31.01  ? 1126 HOH A O   1 
HETATM 5584 O  O   . HOH D 3 .   ? -8.970  -11.420 -8.717  1.00 32.30  ? 1127 HOH A O   1 
HETATM 5585 O  O   . HOH D 3 .   ? -9.838  22.135  -44.672 1.00 27.25  ? 1128 HOH A O   1 
HETATM 5586 O  O   . HOH D 3 .   ? -6.711  28.693  -36.060 1.00 31.84  ? 1129 HOH A O   1 
HETATM 5587 O  O   . HOH D 3 .   ? -20.354 13.937  -13.486 1.00 35.35  ? 1130 HOH A O   1 
HETATM 5588 O  O   . HOH D 3 .   ? -28.215 24.735  -55.303 1.00 28.84  ? 1131 HOH A O   1 
HETATM 5589 O  O   . HOH D 3 .   ? -29.512 27.000  -55.757 1.00 41.51  ? 1132 HOH A O   1 
HETATM 5590 O  O   . HOH D 3 .   ? -23.992 22.334  -55.146 1.00 33.67  ? 1133 HOH A O   1 
HETATM 5591 O  O   . HOH D 3 .   ? -38.007 21.807  -27.066 1.00 18.84  ? 1134 HOH A O   1 
HETATM 5592 O  O   . HOH D 3 .   ? -14.714 24.749  -46.249 1.00 34.66  ? 1135 HOH A O   1 
HETATM 5593 O  O   . HOH D 3 .   ? -35.934 14.450  -37.190 1.00 31.41  ? 1136 HOH A O   1 
HETATM 5594 O  O   . HOH D 3 .   ? 3.516   -26.755 -17.522 1.00 26.70  ? 1137 HOH A O   1 
HETATM 5595 O  O   . HOH D 3 .   ? 0.911   -23.493 -26.270 1.00 32.50  ? 1138 HOH A O   1 
HETATM 5596 O  O   . HOH D 3 .   ? -36.856 24.748  -28.144 1.00 18.76  ? 1139 HOH A O   1 
HETATM 5597 O  O   . HOH D 3 .   ? -6.032  -16.747 -8.465  1.00 36.14  ? 1140 HOH A O   1 
HETATM 5598 O  O   . HOH D 3 .   ? -27.489 -25.322 -18.263 1.00 37.70  ? 1141 HOH A O   1 
HETATM 5599 O  O   . HOH D 3 .   ? 0.803   -14.517 -32.993 1.00 45.54  ? 1142 HOH A O   1 
HETATM 5600 O  O   . HOH D 3 .   ? -0.478  18.956  -41.492 1.00 38.51  ? 1143 HOH A O   1 
HETATM 5601 O  O   . HOH D 3 .   ? -41.852 19.395  -36.468 1.00 21.55  ? 1144 HOH A O   1 
HETATM 5602 O  O   . HOH D 3 .   ? -17.703 24.346  -46.092 1.00 33.32  ? 1145 HOH A O   1 
HETATM 5603 O  O   . HOH D 3 .   ? 26.073  -21.492 -6.358  1.00 37.76  ? 1146 HOH A O   1 
HETATM 5604 O  O   . HOH D 3 .   ? -37.876 42.276  -47.948 1.00 57.63  ? 1147 HOH A O   1 
HETATM 5605 O  O   . HOH D 3 .   ? -21.182 33.470  -56.037 1.00 49.84  ? 1148 HOH A O   1 
HETATM 5606 O  O   . HOH D 3 .   ? -25.210 22.196  -59.356 1.00 30.38  ? 1149 HOH A O   1 
HETATM 5607 O  O   . HOH D 3 .   ? -24.019 42.406  -43.611 1.00 52.27  ? 1150 HOH A O   1 
HETATM 5608 O  O   . HOH D 3 .   ? -29.551 29.051  -58.919 1.00 59.45  ? 1151 HOH A O   1 
HETATM 5609 O  O   . HOH D 3 .   ? 0.507   15.208  -28.493 1.00 45.67  ? 1152 HOH A O   1 
HETATM 5610 O  O   . HOH D 3 .   ? -40.425 26.167  -26.832 1.00 60.88  ? 1153 HOH A O   1 
HETATM 5611 O  O   . HOH D 3 .   ? -3.737  23.465  -37.850 1.00 36.64  ? 1154 HOH A O   1 
HETATM 5612 O  O   . HOH D 3 .   ? -15.551 34.650  -53.858 1.00 43.28  ? 1155 HOH A O   1 
HETATM 5613 O  O   . HOH D 3 .   ? -39.303 45.906  -41.220 1.00 57.15  ? 1156 HOH A O   1 
HETATM 5614 O  O   . HOH D 3 .   ? 18.735  -22.746 -15.058 1.00 20.27  ? 1157 HOH A O   1 
HETATM 5615 O  O   . HOH D 3 .   ? -3.380  -10.369 -17.325 1.00 39.05  ? 1158 HOH A O   1 
HETATM 5616 O  O   . HOH D 3 .   ? -4.977  25.726  -37.315 1.00 39.16  ? 1159 HOH A O   1 
HETATM 5617 O  O   . HOH D 3 .   ? -26.989 -24.545 -14.062 1.00 41.43  ? 1160 HOH A O   1 
HETATM 5618 O  O   . HOH D 3 .   ? -0.969  -22.215 -23.207 1.00 54.77  ? 1161 HOH A O   1 
HETATM 5619 O  O   . HOH D 3 .   ? -26.316 24.873  -27.854 1.00 18.22  ? 1162 HOH A O   1 
HETATM 5620 O  O   . HOH D 3 .   ? -21.767 20.229  -39.931 1.00 13.99  ? 1163 HOH A O   1 
HETATM 5621 O  O   . HOH D 3 .   ? -22.205 12.857  -33.587 1.00 16.99  ? 1164 HOH A O   1 
HETATM 5622 O  O   . HOH D 3 .   ? -21.005 24.447  -46.571 1.00 22.24  ? 1165 HOH A O   1 
HETATM 5623 O  O   . HOH D 3 .   ? -11.434 16.719  -35.341 1.00 15.54  ? 1166 HOH A O   1 
HETATM 5624 O  O   . HOH D 3 .   ? -8.004  -10.503 -19.830 1.00 17.70  ? 1167 HOH A O   1 
HETATM 5625 O  O   . HOH D 3 .   ? -20.427 9.223   -31.181 1.00 17.56  ? 1168 HOH A O   1 
HETATM 5626 O  O   . HOH D 3 .   ? -15.185 -27.760 -20.985 1.00 22.32  ? 1169 HOH A O   1 
HETATM 5627 O  O   . HOH D 3 .   ? -35.028 15.285  -40.558 1.00 27.52  ? 1170 HOH A O   1 
HETATM 5628 O  O   . HOH D 3 .   ? -9.078  6.027   -36.028 1.00 20.99  ? 1171 HOH A O   1 
HETATM 5629 O  O   . HOH D 3 .   ? -22.930 34.387  -41.911 1.00 19.47  ? 1172 HOH A O   1 
HETATM 5630 O  O   . HOH D 3 .   ? -7.464  -1.236  -21.223 1.00 22.27  ? 1173 HOH A O   1 
HETATM 5631 O  O   . HOH D 3 .   ? -3.203  14.021  -28.292 1.00 21.40  ? 1174 HOH A O   1 
HETATM 5632 O  O   . HOH D 3 .   ? -16.541 -20.574 -12.649 1.00 24.38  ? 1175 HOH A O   1 
HETATM 5633 O  O   . HOH D 3 .   ? -21.239 35.131  -34.222 1.00 23.08  ? 1176 HOH A O   1 
HETATM 5634 O  O   . HOH D 3 .   ? -3.915  19.261  -28.950 1.00 25.64  ? 1177 HOH A O   1 
HETATM 5635 O  O   . HOH D 3 .   ? -22.236 34.361  -36.577 1.00 21.28  ? 1178 HOH A O   1 
HETATM 5636 O  O   . HOH D 3 .   ? -3.536  22.807  -29.495 1.00 28.77  ? 1179 HOH A O   1 
HETATM 5637 O  O   . HOH D 3 .   ? -22.573 6.679   -29.706 1.00 22.11  ? 1180 HOH A O   1 
HETATM 5638 O  O   . HOH D 3 .   ? -24.052 8.535   -16.116 1.00 30.60  ? 1181 HOH A O   1 
HETATM 5639 O  O   . HOH D 3 .   ? -39.532 27.026  -38.540 1.00 25.86  ? 1182 HOH A O   1 
HETATM 5640 O  O   . HOH D 3 .   ? -37.778 15.529  -45.603 1.00 24.97  ? 1183 HOH A O   1 
HETATM 5641 O  O   . HOH D 3 .   ? -21.073 -28.381 -19.318 1.00 50.44  ? 1184 HOH A O   1 
HETATM 5642 O  O   . HOH D 3 .   ? -29.799 -18.625 -28.112 1.00 38.31  ? 1185 HOH A O   1 
HETATM 5643 O  O   . HOH D 3 .   ? -0.402  9.678   -33.835 1.00 29.45  ? 1186 HOH A O   1 
HETATM 5644 O  O   . HOH D 3 .   ? -7.558  8.364   -36.419 1.00 22.05  ? 1187 HOH A O   1 
HETATM 5645 O  O   . HOH D 3 .   ? -19.562 -18.606 -12.637 1.00 33.09  ? 1188 HOH A O   1 
HETATM 5646 O  O   . HOH D 3 .   ? -9.128  8.336   -40.136 1.00 30.81  ? 1189 HOH A O   1 
HETATM 5647 O  O   . HOH D 3 .   ? -11.429 -13.140 -34.063 1.00 24.16  ? 1190 HOH A O   1 
HETATM 5648 O  O   . HOH D 3 .   ? -7.047  -8.873  -29.583 1.00 20.77  ? 1191 HOH A O   1 
HETATM 5649 O  O   . HOH D 3 .   ? -22.752 31.984  -49.305 1.00 25.34  ? 1192 HOH A O   1 
HETATM 5650 O  O   . HOH D 3 .   ? -6.759  24.351  -29.324 1.00 23.87  ? 1193 HOH A O   1 
HETATM 5651 O  O   . HOH D 3 .   ? -20.999 21.991  -37.715 1.00 14.68  ? 1194 HOH A O   1 
HETATM 5652 O  O   . HOH D 3 .   ? -27.061 38.479  -49.326 1.00 29.84  ? 1195 HOH A O   1 
HETATM 5653 O  O   . HOH D 3 .   ? -16.856 11.797  -38.590 1.00 31.76  ? 1196 HOH A O   1 
HETATM 5654 O  O   . HOH D 3 .   ? -11.312 16.779  -43.922 1.00 20.57  ? 1197 HOH A O   1 
HETATM 5655 O  O   . HOH D 3 .   ? -31.590 12.726  -55.170 1.00 35.73  ? 1198 HOH A O   1 
HETATM 5656 O  O   . HOH D 3 .   ? -9.135  -11.523 -14.093 1.00 26.26  ? 1199 HOH A O   1 
HETATM 5657 O  O   . HOH D 3 .   ? -16.420 14.865  -41.450 1.00 28.94  ? 1200 HOH A O   1 
HETATM 5658 O  O   . HOH D 3 .   ? -2.739  16.935  -28.406 1.00 25.77  ? 1201 HOH A O   1 
HETATM 5659 O  O   . HOH D 3 .   ? -20.232 6.372   -31.152 1.00 22.62  ? 1202 HOH A O   1 
HETATM 5660 O  O   . HOH D 3 .   ? -39.717 37.226  -37.614 1.00 29.33  ? 1203 HOH A O   1 
HETATM 5661 O  O   . HOH D 3 .   ? -34.280 38.248  -35.316 1.00 40.75  ? 1204 HOH A O   1 
HETATM 5662 O  O   . HOH D 3 .   ? -3.910  -24.855 -30.166 1.00 37.32  ? 1205 HOH A O   1 
HETATM 5663 O  O   . HOH D 3 .   ? -21.114 -33.698 -27.961 1.00 49.13  ? 1206 HOH A O   1 
HETATM 5664 O  O   . HOH D 3 .   ? -26.001 14.171  -36.944 1.00 23.01  ? 1207 HOH A O   1 
HETATM 5665 O  O   . HOH D 3 .   ? 7.904   -17.763 -21.367 1.00 53.38  ? 1208 HOH A O   1 
HETATM 5666 O  O   . HOH D 3 .   ? -30.095 15.968  -57.466 1.00 32.75  ? 1209 HOH A O   1 
HETATM 5667 O  O   . HOH D 3 .   ? -26.243 21.910  -25.587 1.00 25.44  ? 1210 HOH A O   1 
HETATM 5668 O  O   . HOH D 3 .   ? -16.331 33.281  -40.702 1.00 36.52  ? 1211 HOH A O   1 
HETATM 5669 O  O   . HOH D 3 .   ? -15.333 30.779  -38.989 1.00 31.37  ? 1212 HOH A O   1 
HETATM 5670 O  O   . HOH D 3 .   ? -12.249 -15.879 -34.928 1.00 21.18  ? 1213 HOH A O   1 
HETATM 5671 O  O   . HOH D 3 .   ? -40.409 20.752  -43.261 1.00 37.36  ? 1214 HOH A O   1 
HETATM 5672 O  O   . HOH D 3 .   ? -28.683 31.182  -24.078 1.00 49.27  ? 1215 HOH A O   1 
HETATM 5673 O  O   . HOH D 3 .   ? -7.209  -7.203  -33.626 1.00 29.47  ? 1216 HOH A O   1 
HETATM 5674 O  O   . HOH D 3 .   ? -22.446 35.043  -31.621 1.00 30.69  ? 1217 HOH A O   1 
HETATM 5675 O  O   . HOH D 3 .   ? -20.713 34.879  -38.869 1.00 23.22  ? 1218 HOH A O   1 
HETATM 5676 O  O   . HOH D 3 .   ? -30.829 14.327  -29.855 1.00 43.70  ? 1219 HOH A O   1 
HETATM 5677 O  O   . HOH D 3 .   ? -3.603  -22.418 -14.888 1.00 31.93  ? 1220 HOH A O   1 
HETATM 5678 O  O   . HOH D 3 .   ? -1.533  -22.040 -25.850 1.00 31.26  ? 1221 HOH A O   1 
HETATM 5679 O  O   . HOH D 3 .   ? -9.234  5.041   -16.061 1.00 25.69  ? 1222 HOH A O   1 
HETATM 5680 O  O   . HOH D 3 .   ? -4.410  -16.680 -13.335 1.00 35.79  ? 1223 HOH A O   1 
HETATM 5681 O  O   . HOH D 3 .   ? -25.354 10.459  -31.999 1.00 53.12  ? 1224 HOH A O   1 
HETATM 5682 O  O   . HOH D 3 .   ? -1.328  -11.699 -19.681 1.00 49.55  ? 1225 HOH A O   1 
HETATM 5683 O  O   . HOH D 3 .   ? -27.935 13.100  -38.363 1.00 37.83  ? 1226 HOH A O   1 
HETATM 5684 O  O   . HOH D 3 .   ? -19.776 -8.012  -17.157 1.00 33.35  ? 1227 HOH A O   1 
HETATM 5685 O  O   . HOH D 3 .   ? -5.581  -19.505 -31.483 1.00 22.72  ? 1228 HOH A O   1 
HETATM 5686 O  O   . HOH D 3 .   ? -13.219 -0.310  -32.151 1.00 40.65  ? 1229 HOH A O   1 
HETATM 5687 O  O   . HOH D 3 .   ? -9.391  8.446   -12.760 1.00 31.88  ? 1230 HOH A O   1 
HETATM 5688 O  O   . HOH D 3 .   ? -26.584 19.903  -29.561 1.00 21.53  ? 1231 HOH A O   1 
HETATM 5689 O  O   . HOH D 3 .   ? -9.320  5.818   -13.404 1.00 33.01  ? 1232 HOH A O   1 
HETATM 5690 O  O   . HOH D 3 .   ? -3.450  5.049   -17.103 1.00 41.77  ? 1233 HOH A O   1 
HETATM 5691 O  O   . HOH D 3 .   ? -28.397 15.072  -29.382 1.00 37.15  ? 1234 HOH A O   1 
HETATM 5692 O  O   . HOH D 3 .   ? -28.815 -20.608 -32.231 1.00 34.76  ? 1235 HOH A O   1 
HETATM 5693 O  O   . HOH D 3 .   ? -21.613 -10.199 -17.407 1.00 29.16  ? 1236 HOH A O   1 
HETATM 5694 O  O   . HOH D 3 .   ? -8.032  27.064  -29.246 1.00 29.61  ? 1237 HOH A O   1 
HETATM 5695 O  O   . HOH D 3 .   ? -24.305 12.331  -35.527 1.00 23.88  ? 1238 HOH A O   1 
HETATM 5696 O  O   . HOH D 3 .   ? -16.011 33.115  -29.495 1.00 49.94  ? 1239 HOH A O   1 
HETATM 5697 O  O   . HOH D 3 .   ? -26.604 11.275  -34.135 1.00 45.49  ? 1240 HOH A O   1 
HETATM 5698 O  O   . HOH D 3 .   ? -5.683  -7.340  -19.870 1.00 33.53  ? 1241 HOH A O   1 
HETATM 5699 O  O   . HOH D 3 .   ? -18.581 32.643  -30.917 1.00 49.90  ? 1242 HOH A O   1 
HETATM 5700 O  O   . HOH D 3 .   ? -19.836 12.664  -11.281 1.00 50.52  ? 1243 HOH A O   1 
HETATM 5701 O  O   . HOH D 3 .   ? -2.584  -3.660  -26.874 1.00 38.80  ? 1244 HOH A O   1 
HETATM 5702 O  O   . HOH D 3 .   ? -12.564 14.216  -43.667 1.00 24.36  ? 1245 HOH A O   1 
HETATM 5703 O  O   . HOH D 3 .   ? -22.795 -17.125 -14.405 1.00 28.97  ? 1246 HOH A O   1 
HETATM 5704 O  O   . HOH D 3 .   ? -12.878 33.621  -32.768 1.00 48.00  ? 1247 HOH A O   1 
HETATM 5705 O  O   . HOH D 3 .   ? -41.416 29.975  -36.604 1.00 58.08  ? 1248 HOH A O   1 
HETATM 5706 O  O   . HOH D 3 .   ? -5.110  9.421   -38.992 1.00 37.50  ? 1249 HOH A O   1 
HETATM 5707 O  O   . HOH D 3 .   ? -20.099 -9.586  -12.943 1.00 33.10  ? 1250 HOH A O   1 
HETATM 5708 O  O   . HOH D 3 .   ? -4.469  -30.577 -19.526 1.00 46.24  ? 1251 HOH A O   1 
HETATM 5709 O  O   . HOH D 3 .   ? -43.010 34.406  -39.971 1.00 48.29  ? 1252 HOH A O   1 
HETATM 5710 O  O   . HOH D 3 .   ? -0.037  -20.283 -18.830 1.00 39.46  ? 1253 HOH A O   1 
HETATM 5711 O  O   . HOH D 3 .   ? -15.230 3.736   -12.085 1.00 57.74  ? 1254 HOH A O   1 
HETATM 5712 O  O   . HOH D 3 .   ? 7.348   -18.305 -18.421 1.00 61.18  ? 1255 HOH A O   1 
HETATM 5713 O  O   . HOH D 3 .   ? -0.988  14.015  -26.546 1.00 45.05  ? 1256 HOH A O   1 
HETATM 5714 O  O   . HOH D 3 .   ? 1.055   7.906   -21.986 1.00 38.65  ? 1257 HOH A O   1 
HETATM 5715 O  O   . HOH D 3 .   ? -15.196 6.667   -11.058 1.00 42.36  ? 1258 HOH A O   1 
HETATM 5716 O  O   . HOH D 3 .   ? -23.569 -16.908 -33.582 1.00 29.14  ? 1259 HOH A O   1 
HETATM 5717 O  O   . HOH D 3 .   ? -23.708 8.753   -33.209 1.00 44.77  ? 1260 HOH A O   1 
HETATM 5718 O  O   . HOH D 3 .   ? -19.579 -23.699 -7.315  1.00 53.69  ? 1261 HOH A O   1 
HETATM 5719 O  O   . HOH D 3 .   ? -20.167 9.954   -35.710 1.00 32.23  ? 1262 HOH A O   1 
HETATM 5720 O  O   . HOH D 3 .   ? -2.498  15.962  -21.444 1.00 56.81  ? 1263 HOH A O   1 
HETATM 5721 O  O   . HOH D 3 .   ? -6.074  -9.514  -17.690 1.00 34.12  ? 1264 HOH A O   1 
HETATM 5722 O  O   . HOH D 3 .   ? -19.050 -7.658  -31.276 1.00 40.55  ? 1265 HOH A O   1 
HETATM 5723 O  O   . HOH D 3 .   ? -6.360  -2.384  -18.424 1.00 38.54  ? 1266 HOH A O   1 
HETATM 5724 O  O   . HOH D 3 .   ? -37.023 34.890  -48.043 1.00 25.44  ? 1267 HOH A O   1 
HETATM 5725 O  O   . HOH D 3 .   ? 0.761   10.750  -28.455 1.00 52.11  ? 1268 HOH A O   1 
HETATM 5726 O  O   . HOH D 3 .   ? -23.906 37.340  -31.635 1.00 39.55  ? 1269 HOH A O   1 
HETATM 5727 O  O   . HOH D 3 .   ? -3.926  1.426   -26.284 1.00 46.79  ? 1270 HOH A O   1 
HETATM 5728 O  O   . HOH D 3 .   ? -8.041  -3.665  -16.633 1.00 35.04  ? 1271 HOH A O   1 
HETATM 5729 O  O   . HOH D 3 .   ? -9.643  13.351  -8.953  1.00 46.61  ? 1272 HOH A O   1 
HETATM 5730 O  O   . HOH D 3 .   ? -24.477 13.393  -43.544 1.00 45.75  ? 1273 HOH A O   1 
HETATM 5731 O  O   . HOH D 3 .   ? -9.858  -19.177 -9.115  1.00 37.02  ? 1274 HOH A O   1 
HETATM 5732 O  O   . HOH D 3 .   ? -8.212  1.280   -14.412 1.00 35.35  ? 1275 HOH A O   1 
HETATM 5733 O  O   . HOH D 3 .   ? -28.751 -27.062 -23.269 1.00 43.57  ? 1276 HOH A O   1 
HETATM 5734 O  O   . HOH D 3 .   ? -33.082 14.517  -36.838 1.00 26.30  ? 1277 HOH A O   1 
HETATM 5735 O  O   . HOH D 3 .   ? -19.702 12.590  -40.402 1.00 35.57  ? 1278 HOH A O   1 
HETATM 5736 O  O   . HOH D 3 .   ? -26.930 13.623  -45.553 1.00 48.17  ? 1279 HOH A O   1 
HETATM 5737 O  O   . HOH D 3 .   ? -19.199 24.624  -26.244 1.00 35.84  ? 1280 HOH A O   1 
HETATM 5738 O  O   . HOH D 3 .   ? -24.385 2.089   -27.100 1.00 35.05  ? 1281 HOH A O   1 
HETATM 5739 O  O   . HOH D 3 .   ? -27.721 38.191  -32.512 1.00 54.37  ? 1282 HOH A O   1 
HETATM 5740 O  O   . HOH D 3 .   ? -33.498 37.368  -49.135 1.00 47.80  ? 1283 HOH A O   1 
HETATM 5741 O  O   . HOH D 3 .   ? -13.148 14.056  -10.489 1.00 37.99  ? 1284 HOH A O   1 
HETATM 5742 O  O   . HOH D 3 .   ? -24.199 39.412  -47.104 1.00 43.20  ? 1285 HOH A O   1 
HETATM 5743 O  O   . HOH D 3 .   ? -34.160 -16.890 -28.384 1.00 56.79  ? 1286 HOH A O   1 
HETATM 5744 O  O   . HOH D 3 .   ? -9.457  -6.625  -15.227 1.00 27.32  ? 1287 HOH A O   1 
HETATM 5745 O  O   . HOH D 3 .   ? -25.659 -20.667 -13.225 1.00 42.82  ? 1288 HOH A O   1 
HETATM 5746 O  O   . HOH D 3 .   ? -28.069 15.326  -54.074 1.00 37.15  ? 1289 HOH A O   1 
HETATM 5747 O  O   . HOH D 3 .   ? 4.451   -17.868 -25.037 1.00 29.35  ? 1290 HOH A O   1 
HETATM 5748 O  O   . HOH D 3 .   ? 0.436   9.071   -38.484 1.00 59.92  ? 1291 HOH A O   1 
HETATM 5749 O  O   . HOH D 3 .   ? -21.621 14.995  -43.747 1.00 36.32  ? 1292 HOH A O   1 
HETATM 5750 O  O   . HOH D 3 .   ? -27.381 14.033  -41.172 1.00 31.97  ? 1293 HOH A O   1 
HETATM 5751 O  O   . HOH D 3 .   ? -17.956 -4.487  -21.114 1.00 55.80  ? 1294 HOH A O   1 
HETATM 5752 O  O   . HOH D 3 .   ? -25.469 10.765  -22.874 1.00 32.62  ? 1295 HOH A O   1 
HETATM 5753 O  O   . HOH D 3 .   ? -21.288 -1.104  -22.424 1.00 47.48  ? 1296 HOH A O   1 
HETATM 5754 O  O   . HOH D 3 .   ? -42.186 19.684  -39.169 1.00 37.94  ? 1297 HOH A O   1 
HETATM 5755 O  O   . HOH D 3 .   ? -17.582 12.838  -9.863  1.00 50.70  ? 1298 HOH A O   1 
HETATM 5756 O  O   . HOH D 3 .   ? -22.715 22.151  -18.022 1.00 46.63  ? 1299 HOH A O   1 
HETATM 5757 O  O   . HOH D 3 .   ? -10.748 -2.032  -33.141 1.00 37.14  ? 1300 HOH A O   1 
HETATM 5758 O  O   . HOH D 3 .   ? -17.044 -3.155  -28.922 1.00 39.70  ? 1301 HOH A O   1 
HETATM 5759 O  O   . HOH D 3 .   ? -23.149 -19.582 -12.979 1.00 44.48  ? 1302 HOH A O   1 
HETATM 5760 O  O   . HOH D 3 .   ? -40.198 38.224  -45.912 1.00 26.57  ? 1303 HOH A O   1 
HETATM 5761 O  O   . HOH D 3 .   ? -2.332  -20.091 -17.167 1.00 29.08  ? 1304 HOH A O   1 
HETATM 5762 O  O   . HOH D 3 .   ? -4.546  26.328  -29.029 1.00 50.61  ? 1305 HOH A O   1 
HETATM 5763 O  O   . HOH D 3 .   ? -3.265  -27.666 -20.144 1.00 42.12  ? 1306 HOH A O   1 
HETATM 5764 O  O   . HOH D 3 .   ? -35.119 30.767  -54.127 1.00 55.56  ? 1307 HOH A O   1 
HETATM 5765 O  O   . HOH D 3 .   ? -31.372 11.612  -42.281 1.00 57.59  ? 1308 HOH A O   1 
HETATM 5766 O  O   . HOH D 3 .   ? -42.071 18.575  -42.910 1.00 40.98  ? 1309 HOH A O   1 
HETATM 5767 O  O   . HOH D 3 .   ? -20.840 4.963   -33.602 1.00 32.13  ? 1310 HOH A O   1 
HETATM 5768 O  O   . HOH D 3 .   ? -10.942 9.031   -10.800 1.00 41.75  ? 1311 HOH A O   1 
HETATM 5769 O  O   . HOH D 3 .   ? -2.514  7.143   -32.566 1.00 39.63  ? 1312 HOH A O   1 
HETATM 5770 O  O   . HOH D 3 .   ? -27.109 10.370  -38.121 1.00 54.35  ? 1313 HOH A O   1 
HETATM 5771 O  O   . HOH D 3 .   ? -28.238 -16.336 -17.467 1.00 43.75  ? 1314 HOH A O   1 
HETATM 5772 O  O   . HOH D 3 .   ? -3.108  -7.545  -21.203 1.00 59.74  ? 1315 HOH A O   1 
HETATM 5773 O  O   . HOH D 3 .   ? 4.505   -19.246 -17.439 1.00 46.10  ? 1316 HOH A O   1 
HETATM 5774 O  O   . HOH D 3 .   ? -43.825 33.908  -50.104 1.00 42.37  ? 1317 HOH A O   1 
HETATM 5775 O  O   . HOH D 3 .   ? -21.853 -12.555 -34.379 1.00 67.86  ? 1318 HOH A O   1 
HETATM 5776 O  O   . HOH D 3 .   ? -5.801  -6.143  -35.695 1.00 48.05  ? 1319 HOH A O   1 
HETATM 5777 O  O   . HOH D 3 .   ? 3.582   9.245   -39.731 1.00 59.76  ? 1320 HOH A O   1 
HETATM 5778 O  O   . HOH D 3 .   ? -2.177  19.031  -22.791 1.00 43.52  ? 1321 HOH A O   1 
HETATM 5779 O  O   . HOH D 3 .   ? -31.748 31.663  -56.827 1.00 64.58  ? 1322 HOH A O   1 
HETATM 5780 O  O   . HOH D 3 .   ? -2.493  1.995   -33.609 1.00 47.98  ? 1323 HOH A O   1 
HETATM 5781 O  O   . HOH D 3 .   ? -15.812 36.265  -36.248 1.00 50.02  ? 1324 HOH A O   1 
HETATM 5782 O  O   . HOH D 3 .   ? -30.690 -23.426 -20.762 1.00 46.20  ? 1325 HOH A O   1 
HETATM 5783 O  O   . HOH D 3 .   ? -1.662  -19.356 -21.519 1.00 24.58  ? 1326 HOH A O   1 
HETATM 5784 O  O   . HOH D 3 .   ? -36.041 36.443  -51.203 1.00 57.59  ? 1327 HOH A O   1 
HETATM 5785 O  O   . HOH D 3 .   ? -15.193 2.636   -33.749 1.00 28.01  ? 1328 HOH A O   1 
HETATM 5786 O  O   . HOH D 3 .   ? -24.620 6.716   -20.294 1.00 36.69  ? 1329 HOH A O   1 
HETATM 5787 O  O   . HOH D 3 .   ? -22.517 -6.565  -24.663 1.00 38.78  ? 1330 HOH A O   1 
HETATM 5788 O  O   . HOH D 3 .   ? -33.935 30.464  -28.844 1.00 34.07  ? 1331 HOH A O   1 
HETATM 5789 O  O   . HOH D 3 .   ? -4.932  5.566   -34.904 1.00 35.83  ? 1332 HOH A O   1 
HETATM 5790 O  O   . HOH D 3 .   ? -16.351 17.231  -44.957 1.00 29.08  ? 1333 HOH A O   1 
HETATM 5791 O  O   . HOH D 3 .   ? -11.917 -12.791 -6.549  1.00 37.35  ? 1334 HOH A O   1 
HETATM 5792 O  O   . HOH D 3 .   ? 1.356   -17.884 -20.869 1.00 36.62  ? 1335 HOH A O   1 
HETATM 5793 O  O   . HOH D 3 .   ? -20.548 16.621  -48.433 1.00 41.13  ? 1336 HOH A O   1 
HETATM 5794 O  O   . HOH D 3 .   ? -17.630 -24.435 -11.858 1.00 41.61  ? 1337 HOH A O   1 
HETATM 5795 O  O   . HOH D 3 .   ? -23.382 32.725  -29.477 1.00 35.41  ? 1338 HOH A O   1 
HETATM 5796 O  O   . HOH D 3 .   ? -36.593 30.208  -28.554 1.00 46.29  ? 1339 HOH A O   1 
HETATM 5797 O  O   . HOH D 3 .   ? -18.282 -15.100 -6.642  1.00 39.08  ? 1340 HOH A O   1 
HETATM 5798 O  O   . HOH D 3 .   ? -28.854 34.198  -29.562 1.00 37.09  ? 1341 HOH A O   1 
HETATM 5799 O  O   . HOH D 3 .   ? -9.483  1.298   -32.583 1.00 34.39  ? 1342 HOH A O   1 
HETATM 5800 O  O   . HOH D 3 .   ? -3.230  -5.474  -25.001 1.00 35.88  ? 1343 HOH A O   1 
HETATM 5801 O  O   . HOH D 3 .   ? -5.788  -16.419 -33.986 1.00 33.70  ? 1344 HOH A O   1 
HETATM 5802 O  O   . HOH D 3 .   ? -25.480 10.729  -25.813 1.00 35.75  ? 1345 HOH A O   1 
HETATM 5803 O  O   . HOH D 3 .   ? -29.211 14.310  -59.407 1.00 38.08  ? 1346 HOH A O   1 
HETATM 5804 O  O   . HOH D 3 .   ? -42.347 24.352  -45.184 1.00 39.39  ? 1347 HOH A O   1 
HETATM 5805 O  O   . HOH D 3 .   ? -17.987 2.810   -12.500 1.00 51.80  ? 1348 HOH A O   1 
HETATM 5806 O  O   . HOH D 3 .   ? -19.331 -0.976  -29.976 1.00 46.09  ? 1349 HOH A O   1 
HETATM 5807 O  O   . HOH D 3 .   ? -10.272 5.072   -38.442 1.00 37.93  ? 1350 HOH A O   1 
HETATM 5808 O  O   . HOH D 3 .   ? -26.356 15.841  -59.695 1.00 52.02  ? 1351 HOH A O   1 
HETATM 5809 O  O   . HOH D 3 .   ? -25.724 -10.931 -22.416 1.00 41.15  ? 1352 HOH A O   1 
HETATM 5810 O  O   . HOH D 3 .   ? -32.706 -20.620 -26.867 1.00 38.43  ? 1353 HOH A O   1 
HETATM 5811 O  O   . HOH D 3 .   ? -5.738  -11.566 -39.730 1.00 57.23  ? 1354 HOH A O   1 
HETATM 5812 O  O   . HOH D 3 .   ? -34.337 11.605  -49.315 1.00 41.84  ? 1355 HOH A O   1 
HETATM 5813 O  O   . HOH D 3 .   ? -8.937  -1.621  -14.571 1.00 40.69  ? 1356 HOH A O   1 
HETATM 5814 O  O   . HOH D 3 .   ? -11.516 4.392   -11.816 1.00 39.00  ? 1357 HOH A O   1 
HETATM 5815 O  O   . HOH D 3 .   ? -3.136  -21.031 -32.962 1.00 43.32  ? 1358 HOH A O   1 
HETATM 5816 O  O   . HOH D 3 .   ? -4.184  -22.993 -34.841 1.00 43.99  ? 1359 HOH A O   1 
HETATM 5817 O  O   . HOH E 3 .   ? -38.903 -25.005 -31.508 1.00 25.34  ? 401  HOH B O   1 
HETATM 5818 O  O   . HOH E 3 .   ? -49.255 -29.249 -38.156 1.00 29.79  ? 402  HOH B O   1 
HETATM 5819 O  O   . HOH E 3 .   ? -54.459 17.383  -71.426 1.00 37.19  ? 403  HOH B O   1 
HETATM 5820 O  O   . HOH E 3 .   ? -41.812 -25.546 -29.791 1.00 14.11  ? 404  HOH B O   1 
HETATM 5821 O  O   . HOH E 3 .   ? -39.952 -31.519 -31.529 1.00 37.54  ? 405  HOH B O   1 
HETATM 5822 O  O   . HOH E 3 .   ? -44.638 -21.978 -38.471 1.00 36.88  ? 406  HOH B O   1 
HETATM 5823 O  O   . HOH E 3 .   ? -28.285 -47.565 -34.973 1.00 26.99  ? 407  HOH B O   1 
HETATM 5824 O  O   . HOH E 3 .   ? -55.060 21.701  -71.613 1.00 51.95  ? 408  HOH B O   1 
HETATM 5825 O  O   . HOH E 3 .   ? -30.189 -47.635 -47.729 1.00 37.99  ? 409  HOH B O   1 
HETATM 5826 O  O   . HOH E 3 .   ? -49.292 9.199   -43.613 1.00 46.24  ? 410  HOH B O   1 
HETATM 5827 O  O   . HOH E 3 .   ? -31.692 -33.626 -27.915 1.00 30.43  ? 411  HOH B O   1 
HETATM 5828 O  O   . HOH E 3 .   ? -36.885 -26.659 -29.826 1.00 21.17  ? 412  HOH B O   1 
HETATM 5829 O  O   . HOH E 3 .   ? -44.896 -31.046 -32.518 1.00 35.30  ? 413  HOH B O   1 
HETATM 5830 O  O   . HOH E 3 .   ? -38.940 -26.678 -33.970 1.00 16.99  ? 414  HOH B O   1 
HETATM 5831 O  O   . HOH E 3 .   ? -28.830 -49.404 -43.859 1.00 51.71  ? 415  HOH B O   1 
HETATM 5832 O  O   . HOH E 3 .   ? -37.123 -23.149 -76.383 1.00 44.62  ? 416  HOH B O   1 
HETATM 5833 O  O   . HOH E 3 .   ? -49.877 -34.722 -47.480 1.00 38.89  ? 417  HOH B O   1 
HETATM 5834 O  O   . HOH E 3 .   ? -19.110 -27.490 -50.692 1.00 47.74  ? 418  HOH B O   1 
HETATM 5835 O  O   . HOH E 3 .   ? -36.695 -45.687 -40.157 1.00 29.21  ? 419  HOH B O   1 
HETATM 5836 O  O   . HOH E 3 .   ? -34.619 -20.936 -36.312 1.00 39.37  ? 420  HOH B O   1 
HETATM 5837 O  O   . HOH E 3 .   ? -37.294 -24.123 -28.495 1.00 23.49  ? 421  HOH B O   1 
HETATM 5838 O  O   . HOH E 3 .   ? -57.456 -20.012 -53.535 1.00 45.58  ? 422  HOH B O   1 
HETATM 5839 O  O   . HOH E 3 .   ? -44.967 -30.684 -35.699 1.00 23.45  ? 423  HOH B O   1 
HETATM 5840 O  O   . HOH E 3 .   ? -53.259 19.661  -48.046 1.00 35.33  ? 424  HOH B O   1 
HETATM 5841 O  O   . HOH E 3 .   ? -52.333 -9.099  -76.046 1.00 61.14  ? 425  HOH B O   1 
HETATM 5842 O  O   . HOH E 3 .   ? -40.096 -21.290 -39.231 1.00 61.29  ? 426  HOH B O   1 
HETATM 5843 O  O   . HOH E 3 .   ? -21.210 -26.252 -55.952 1.00 59.29  ? 427  HOH B O   1 
HETATM 5844 O  O   . HOH E 3 .   ? -36.884 -28.887 -28.329 1.00 49.70  ? 428  HOH B O   1 
HETATM 5845 O  O   . HOH E 3 .   ? -43.942 -31.328 -46.444 1.00 22.59  ? 429  HOH B O   1 
HETATM 5846 O  O   . HOH E 3 .   ? -34.842 -23.911 -60.834 1.00 23.09  ? 430  HOH B O   1 
HETATM 5847 O  O   . HOH E 3 .   ? -31.276 -26.916 -50.065 1.00 18.01  ? 431  HOH B O   1 
HETATM 5848 O  O   . HOH E 3 .   ? -16.023 -28.464 -43.309 1.00 30.32  ? 432  HOH B O   1 
HETATM 5849 O  O   . HOH E 3 .   ? -29.759 -27.452 -31.023 1.00 26.34  ? 433  HOH B O   1 
HETATM 5850 O  O   . HOH E 3 .   ? -37.374 -19.345 -50.235 1.00 20.02  ? 434  HOH B O   1 
HETATM 5851 O  O   . HOH E 3 .   ? -32.159 -41.377 -50.485 1.00 24.04  ? 435  HOH B O   1 
HETATM 5852 O  O   . HOH E 3 .   ? -33.497 -28.695 -50.910 1.00 21.23  ? 436  HOH B O   1 
HETATM 5853 O  O   . HOH E 3 .   ? -21.845 -38.562 -47.581 1.00 27.57  ? 437  HOH B O   1 
HETATM 5854 O  O   . HOH E 3 .   ? -31.046 -32.355 -57.013 1.00 65.54  ? 438  HOH B O   1 
HETATM 5855 O  O   . HOH E 3 .   ? -39.383 -15.750 -52.364 1.00 25.17  ? 439  HOH B O   1 
HETATM 5856 O  O   . HOH E 3 .   ? -15.548 -30.952 -30.011 1.00 37.84  ? 440  HOH B O   1 
HETATM 5857 O  O   . HOH E 3 .   ? -29.324 -40.935 -47.960 1.00 23.31  ? 441  HOH B O   1 
HETATM 5858 O  O   . HOH E 3 .   ? -39.410 -13.037 -52.739 1.00 26.73  ? 442  HOH B O   1 
HETATM 5859 O  O   . HOH E 3 .   ? -16.807 -32.718 -41.692 1.00 54.48  ? 443  HOH B O   1 
HETATM 5860 O  O   . HOH E 3 .   ? -46.146 25.222  -53.072 1.00 41.12  ? 444  HOH B O   1 
HETATM 5861 O  O   . HOH E 3 .   ? -22.867 -30.484 -51.662 1.00 31.26  ? 445  HOH B O   1 
HETATM 5862 O  O   . HOH E 3 .   ? -34.079 8.961   -60.220 1.00 29.29  ? 446  HOH B O   1 
HETATM 5863 O  O   . HOH E 3 .   ? -24.578 -31.253 -49.674 1.00 25.87  ? 447  HOH B O   1 
HETATM 5864 O  O   . HOH E 3 .   ? -43.765 -8.232  -49.133 1.00 39.82  ? 448  HOH B O   1 
HETATM 5865 O  O   . HOH E 3 .   ? -36.320 -43.384 -31.577 1.00 33.23  ? 449  HOH B O   1 
HETATM 5866 O  O   . HOH E 3 .   ? -16.252 -30.134 -41.323 1.00 47.94  ? 450  HOH B O   1 
HETATM 5867 O  O   . HOH E 3 .   ? -45.865 -28.342 -46.795 1.00 32.30  ? 451  HOH B O   1 
HETATM 5868 O  O   . HOH E 3 .   ? -32.574 -42.631 -53.035 1.00 29.25  ? 452  HOH B O   1 
HETATM 5869 O  O   . HOH E 3 .   ? -27.164 -21.841 -33.875 1.00 28.69  ? 453  HOH B O   1 
HETATM 5870 O  O   . HOH E 3 .   ? -38.999 -45.405 -44.321 1.00 57.28  ? 454  HOH B O   1 
HETATM 5871 O  O   . HOH E 3 .   ? -47.689 21.414  -60.242 1.00 32.68  ? 455  HOH B O   1 
HETATM 5872 O  O   . HOH E 3 .   ? -34.734 -20.780 -46.391 1.00 31.79  ? 456  HOH B O   1 
HETATM 5873 O  O   . HOH E 3 .   ? -38.891 1.961   -66.168 1.00 30.94  ? 457  HOH B O   1 
HETATM 5874 O  O   . HOH E 3 .   ? -44.813 -30.896 -53.891 1.00 36.52  ? 458  HOH B O   1 
HETATM 5875 O  O   . HOH E 3 .   ? -48.325 4.172   -66.975 1.00 26.90  ? 459  HOH B O   1 
HETATM 5876 O  O   . HOH E 3 .   ? -33.353 9.908   -65.147 1.00 51.88  ? 460  HOH B O   1 
HETATM 5877 O  O   . HOH E 3 .   ? -27.705 -44.614 -30.655 1.00 26.98  ? 461  HOH B O   1 
HETATM 5878 O  O   . HOH E 3 .   ? -11.150 -28.714 -43.231 1.00 45.31  ? 462  HOH B O   1 
HETATM 5879 O  O   . HOH E 3 .   ? -52.907 4.149   -54.094 1.00 33.96  ? 463  HOH B O   1 
HETATM 5880 O  O   . HOH E 3 .   ? -44.660 12.333  -73.328 1.00 25.13  ? 464  HOH B O   1 
HETATM 5881 O  O   . HOH E 3 .   ? -14.288 -22.572 -38.963 1.00 23.73  ? 465  HOH B O   1 
HETATM 5882 O  O   . HOH E 3 .   ? -43.726 -36.705 -38.630 1.00 33.36  ? 466  HOH B O   1 
HETATM 5883 O  O   . HOH E 3 .   ? -26.846 -20.493 -44.661 1.00 37.84  ? 467  HOH B O   1 
HETATM 5884 O  O   . HOH E 3 .   ? -23.138 -43.077 -34.301 1.00 42.94  ? 468  HOH B O   1 
HETATM 5885 O  O   . HOH E 3 .   ? -16.671 -19.390 -38.206 1.00 31.08  ? 469  HOH B O   1 
HETATM 5886 O  O   . HOH E 3 .   ? -39.034 -42.191 -37.093 1.00 41.69  ? 470  HOH B O   1 
HETATM 5887 O  O   . HOH E 3 .   ? -34.989 -20.927 -39.356 1.00 25.83  ? 471  HOH B O   1 
HETATM 5888 O  O   . HOH E 3 .   ? -41.235 -41.157 -35.318 1.00 55.49  ? 472  HOH B O   1 
HETATM 5889 O  O   . HOH E 3 .   ? -47.670 -5.284  -66.460 1.00 35.98  ? 473  HOH B O   1 
HETATM 5890 O  O   . HOH E 3 .   ? -34.756 -33.251 -32.372 1.00 26.40  ? 474  HOH B O   1 
HETATM 5891 O  O   . HOH E 3 .   ? -25.141 -41.374 -33.631 1.00 22.45  ? 475  HOH B O   1 
HETATM 5892 O  O   . HOH E 3 .   ? -9.290  -30.809 -38.503 1.00 65.05  ? 476  HOH B O   1 
HETATM 5893 O  O   . HOH E 3 .   ? -45.028 22.424  -46.586 1.00 43.92  ? 477  HOH B O   1 
HETATM 5894 O  O   . HOH E 3 .   ? -39.204 24.077  -58.366 1.00 41.86  ? 478  HOH B O   1 
HETATM 5895 O  O   . HOH E 3 .   ? -15.879 -34.897 -40.660 1.00 56.47  ? 479  HOH B O   1 
HETATM 5896 O  O   . HOH E 3 .   ? -34.504 -40.806 -49.317 1.00 23.19  ? 480  HOH B O   1 
HETATM 5897 O  O   . HOH E 3 .   ? -40.299 -31.169 -65.978 1.00 45.92  ? 481  HOH B O   1 
HETATM 5898 O  O   . HOH E 3 .   ? -54.254 5.444   -66.857 1.00 42.73  ? 482  HOH B O   1 
HETATM 5899 O  O   . HOH E 3 .   ? -35.082 6.070   -61.229 1.00 29.35  ? 483  HOH B O   1 
HETATM 5900 O  O   . HOH E 3 .   ? -37.419 -44.773 -37.499 1.00 33.58  ? 484  HOH B O   1 
HETATM 5901 O  O   . HOH E 3 .   ? -20.966 -36.705 -37.200 1.00 31.86  ? 485  HOH B O   1 
HETATM 5902 O  O   . HOH E 3 .   ? -35.751 12.319  -67.365 1.00 38.85  ? 486  HOH B O   1 
HETATM 5903 O  O   . HOH E 3 .   ? -45.145 -16.916 -47.718 1.00 33.44  ? 487  HOH B O   1 
HETATM 5904 O  O   . HOH E 3 .   ? -43.128 23.404  -59.271 1.00 40.37  ? 488  HOH B O   1 
HETATM 5905 O  O   . HOH E 3 .   ? -26.795 -43.788 -28.241 1.00 39.29  ? 489  HOH B O   1 
HETATM 5906 O  O   . HOH E 3 .   ? -35.954 -18.995 -48.018 1.00 26.20  ? 490  HOH B O   1 
HETATM 5907 O  O   . HOH E 3 .   ? -37.181 -11.705 -51.964 1.00 37.84  ? 491  HOH B O   1 
HETATM 5908 O  O   . HOH E 3 .   ? -13.463 -30.301 -42.829 1.00 41.14  ? 492  HOH B O   1 
HETATM 5909 O  O   . HOH E 3 .   ? -35.206 -16.931 -52.059 1.00 38.90  ? 493  HOH B O   1 
HETATM 5910 O  O   . HOH E 3 .   ? -31.956 -18.565 -55.263 1.00 36.88  ? 494  HOH B O   1 
HETATM 5911 O  O   . HOH E 3 .   ? -37.824 -34.803 -31.181 1.00 47.64  ? 495  HOH B O   1 
HETATM 5912 O  O   . HOH E 3 .   ? -42.221 -26.428 -46.183 1.00 23.88  ? 496  HOH B O   1 
HETATM 5913 O  O   . HOH E 3 .   ? -22.217 -21.134 -39.159 1.00 36.93  ? 497  HOH B O   1 
HETATM 5914 O  O   . HOH E 3 .   ? -36.499 17.662  -69.258 1.00 36.66  ? 498  HOH B O   1 
HETATM 5915 O  O   . HOH E 3 .   ? -39.726 14.310  -44.213 1.00 51.94  ? 499  HOH B O   1 
HETATM 5916 O  O   . HOH E 3 .   ? -41.121 -13.115 -50.506 1.00 22.24  ? 500  HOH B O   1 
HETATM 5917 O  O   . HOH E 3 .   ? -41.088 -26.441 -68.490 1.00 34.20  ? 501  HOH B O   1 
HETATM 5918 O  O   . HOH E 3 .   ? -16.052 -29.232 -45.554 1.00 45.07  ? 502  HOH B O   1 
HETATM 5919 O  O   . HOH E 3 .   ? -30.494 -31.860 -62.731 1.00 49.09  ? 503  HOH B O   1 
HETATM 5920 O  O   . HOH E 3 .   ? -58.855 -15.194 -62.799 1.00 50.90  ? 504  HOH B O   1 
HETATM 5921 O  O   . HOH E 3 .   ? -35.213 -40.934 -29.488 1.00 48.24  ? 505  HOH B O   1 
HETATM 5922 O  O   . HOH E 3 .   ? -29.956 -39.734 -54.628 1.00 32.14  ? 506  HOH B O   1 
HETATM 5923 O  O   . HOH E 3 .   ? -39.649 -41.862 -49.694 1.00 39.18  ? 507  HOH B O   1 
HETATM 5924 O  O   . HOH E 3 .   ? -35.333 0.061   -65.139 1.00 41.90  ? 508  HOH B O   1 
HETATM 5925 O  O   . HOH E 3 .   ? -22.828 -44.981 -43.651 1.00 31.57  ? 509  HOH B O   1 
HETATM 5926 O  O   . HOH E 3 .   ? -24.289 -45.723 -46.102 1.00 32.94  ? 510  HOH B O   1 
HETATM 5927 O  O   . HOH E 3 .   ? -56.705 15.025  -60.177 1.00 48.02  ? 511  HOH B O   1 
HETATM 5928 O  O   . HOH E 3 .   ? -37.361 -39.270 -29.185 1.00 60.64  ? 512  HOH B O   1 
HETATM 5929 O  O   . HOH E 3 .   ? -33.519 -13.371 -63.363 1.00 32.27  ? 513  HOH B O   1 
HETATM 5930 O  O   . HOH E 3 .   ? -38.429 -15.848 -47.989 1.00 47.42  ? 514  HOH B O   1 
HETATM 5931 O  O   . HOH E 3 .   ? -44.287 -36.630 -35.914 1.00 60.78  ? 515  HOH B O   1 
HETATM 5932 O  O   . HOH E 3 .   ? -47.633 -14.035 -73.816 1.00 61.79  ? 516  HOH B O   1 
HETATM 5933 O  O   . HOH E 3 .   ? -46.453 6.051   -45.975 1.00 61.68  ? 517  HOH B O   1 
HETATM 5934 O  O   . HOH E 3 .   ? -42.269 -32.865 -65.324 1.00 71.56  ? 518  HOH B O   1 
HETATM 5935 O  O   . HOH E 3 .   ? -49.281 -13.261 -70.973 1.00 58.99  ? 519  HOH B O   1 
HETATM 5936 O  O   . HOH E 3 .   ? -55.966 11.206  -53.474 1.00 43.97  ? 520  HOH B O   1 
HETATM 5937 O  O   . HOH E 3 .   ? -37.567 10.492  -49.311 1.00 31.95  ? 521  HOH B O   1 
HETATM 5938 O  O   . HOH E 3 .   ? -59.478 -18.730 -54.978 1.00 50.14  ? 522  HOH B O   1 
HETATM 5939 O  O   . HOH E 3 .   ? -41.294 -7.179  -70.267 1.00 53.07  ? 523  HOH B O   1 
HETATM 5940 O  O   . HOH E 3 .   ? -51.327 -5.496  -48.975 1.00 62.43  ? 524  HOH B O   1 
HETATM 5941 O  O   . HOH E 3 .   ? -27.145 -47.362 -31.007 1.00 39.97  ? 525  HOH B O   1 
HETATM 5942 O  O   . HOH E 3 .   ? -49.538 25.252  -52.763 1.00 58.65  ? 526  HOH B O   1 
HETATM 5943 O  O   . HOH E 3 .   ? -23.589 -43.660 -36.936 1.00 34.02  ? 527  HOH B O   1 
HETATM 5944 O  O   . HOH E 3 .   ? -46.167 4.368   -74.583 1.00 66.76  ? 528  HOH B O   1 
HETATM 5945 O  O   . HOH E 3 .   ? -36.965 -11.116 -64.043 1.00 36.26  ? 529  HOH B O   1 
HETATM 5946 O  O   . HOH E 3 .   ? -54.774 -14.225 -49.346 1.00 44.27  ? 530  HOH B O   1 
HETATM 5947 O  O   . HOH E 3 .   ? -49.245 -3.942  -69.989 1.00 57.19  ? 531  HOH B O   1 
HETATM 5948 O  O   . HOH E 3 .   ? -44.004 -37.505 -32.659 1.00 69.05  ? 532  HOH B O   1 
HETATM 5949 O  O   . HOH E 3 .   ? -41.377 27.306  -52.492 1.00 47.90  ? 533  HOH B O   1 
HETATM 5950 O  O   . HOH E 3 .   ? -20.897 -38.750 -51.191 1.00 47.10  ? 534  HOH B O   1 
HETATM 5951 O  O   . HOH E 3 .   ? -25.815 -24.351 -54.988 1.00 31.40  ? 535  HOH B O   1 
HETATM 5952 O  O   . HOH E 3 .   ? -37.908 -17.755 -46.104 1.00 52.25  ? 536  HOH B O   1 
HETATM 5953 O  O   . HOH E 3 .   ? -49.374 23.096  -69.389 1.00 62.61  ? 537  HOH B O   1 
HETATM 5954 O  O   . HOH E 3 .   ? -41.421 -3.388  -56.293 1.00 38.37  ? 538  HOH B O   1 
HETATM 5955 O  O   . HOH E 3 .   ? -58.381 -31.272 -63.865 1.00 43.94  ? 539  HOH B O   1 
HETATM 5956 O  O   . HOH E 3 .   ? -41.319 -24.010 -69.805 1.00 38.17  ? 540  HOH B O   1 
HETATM 5957 O  O   . HOH E 3 .   ? -47.243 -37.997 -44.575 1.00 54.07  ? 541  HOH B O   1 
HETATM 5958 O  O   . HOH E 3 .   ? -15.199 -39.224 -34.257 1.00 62.12  ? 542  HOH B O   1 
HETATM 5959 O  O   . HOH E 3 .   ? -36.837 -41.685 -50.728 1.00 24.36  ? 543  HOH B O   1 
HETATM 5960 O  O   . HOH E 3 .   ? -21.690 -44.129 -38.803 1.00 47.39  ? 544  HOH B O   1 
HETATM 5961 O  O   . HOH E 3 .   ? -21.588 -27.934 -51.621 1.00 40.28  ? 545  HOH B O   1 
HETATM 5962 O  O   . HOH E 3 .   ? -50.770 20.975  -50.969 1.00 28.46  ? 546  HOH B O   1 
HETATM 5963 O  O   . HOH E 3 .   ? -48.749 0.767   -68.955 1.00 35.41  ? 547  HOH B O   1 
HETATM 5964 O  O   . HOH E 3 .   ? -49.262 14.239  -73.016 1.00 43.67  ? 548  HOH B O   1 
HETATM 5965 O  O   . HOH E 3 .   ? -40.382 14.770  -72.274 1.00 37.46  ? 549  HOH B O   1 
HETATM 5966 O  O   . HOH E 3 .   ? -36.210 -9.487  -57.592 1.00 35.51  ? 550  HOH B O   1 
HETATM 5967 O  O   . HOH E 3 .   ? -27.566 -36.975 -26.516 1.00 45.12  ? 551  HOH B O   1 
HETATM 5968 O  O   . HOH E 3 .   ? -28.898 -22.073 -55.322 1.00 28.31  ? 552  HOH B O   1 
HETATM 5969 O  O   . HOH E 3 .   ? -24.922 -47.718 -33.104 1.00 47.26  ? 553  HOH B O   1 
HETATM 5970 O  O   . HOH E 3 .   ? -23.679 -45.364 -32.225 1.00 42.84  ? 554  HOH B O   1 
HETATM 5971 O  O   . HOH E 3 .   ? -19.704 -37.296 -34.907 1.00 35.43  ? 555  HOH B O   1 
HETATM 5972 O  O   . HOH E 3 .   ? -32.752 13.228  -63.580 1.00 49.58  ? 556  HOH B O   1 
HETATM 5973 O  O   . HOH E 3 .   ? -37.596 -6.377  -59.582 1.00 47.17  ? 557  HOH B O   1 
HETATM 5974 O  O   . HOH E 3 .   ? -46.125 0.356   -51.813 1.00 50.82  ? 558  HOH B O   1 
HETATM 5975 O  O   . HOH E 3 .   ? -45.322 34.139  -47.166 1.00 61.01  ? 559  HOH B O   1 
HETATM 5976 O  O   . HOH E 3 .   ? -33.261 -15.639 -64.857 1.00 36.74  ? 560  HOH B O   1 
HETATM 5977 O  O   . HOH E 3 .   ? -17.024 -21.824 -41.655 1.00 32.61  ? 561  HOH B O   1 
HETATM 5978 O  O   . HOH E 3 .   ? -31.683 -21.828 -36.931 1.00 32.09  ? 562  HOH B O   1 
HETATM 5979 O  O   . HOH E 3 .   ? -27.353 -22.104 -50.103 1.00 42.72  ? 563  HOH B O   1 
HETATM 5980 O  O   . HOH E 3 .   ? -30.560 -20.486 -44.637 1.00 34.09  ? 564  HOH B O   1 
HETATM 5981 O  O   . HOH E 3 .   ? -34.550 -43.151 -56.305 1.00 44.64  ? 565  HOH B O   1 
HETATM 5982 O  O   . HOH E 3 .   ? -37.974 -40.649 -58.692 1.00 41.28  ? 566  HOH B O   1 
HETATM 5983 O  O   . HOH E 3 .   ? -25.136 -20.426 -35.455 1.00 31.61  ? 567  HOH B O   1 
HETATM 5984 O  O   . HOH E 3 .   ? -29.487 -20.657 -36.031 1.00 37.86  ? 568  HOH B O   1 
HETATM 5985 O  O   . HOH E 3 .   ? -11.743 -22.780 -42.728 1.00 47.53  ? 569  HOH B O   1 
HETATM 5986 O  O   . HOH E 3 .   ? -30.851 -45.104 -52.412 1.00 45.21  ? 570  HOH B O   1 
HETATM 5987 O  O   . HOH E 3 .   ? -31.752 -37.543 -55.743 1.00 40.20  ? 571  HOH B O   1 
HETATM 5988 O  O   . HOH E 3 .   ? -40.346 -38.935 -53.689 1.00 53.13  ? 572  HOH B O   1 
HETATM 5989 O  O   . HOH E 3 .   ? -42.009 -39.142 -49.388 1.00 43.15  ? 573  HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . HIS A 1   ? 0.9067 0.7441 1.4618 -0.0345 -0.3953 0.0593  9985 HIS A N   
2    C CA  . HIS A 1   ? 0.9053 0.7342 1.4127 -0.0322 -0.3852 0.0549  9985 HIS A CA  
3    C C   . HIS A 1   ? 0.9268 0.7750 1.4271 -0.0312 -0.3594 0.0520  9985 HIS A C   
4    O O   . HIS A 1   ? 0.9291 0.7690 1.3938 -0.0310 -0.3549 0.0494  9985 HIS A O   
5    C CB  . HIS A 1   ? 0.9424 0.7420 1.4069 -0.0327 -0.4025 0.0539  9985 HIS A CB  
6    N N   . HIS A 2   ? 0.8503 0.7235 1.3836 -0.0302 -0.3425 0.0524  9986 HIS A N   
7    C CA  . HIS A 2   ? 0.8255 0.7152 1.3497 -0.0290 -0.3190 0.0495  9986 HIS A CA  
8    C C   . HIS A 2   ? 0.8504 0.7463 1.3550 -0.0260 -0.3024 0.0457  9986 HIS A C   
9    O O   . HIS A 2   ? 0.8371 0.7362 1.3539 -0.0244 -0.3022 0.0457  9986 HIS A O   
10   C CB  . HIS A 2   ? 0.8193 0.7300 1.3781 -0.0300 -0.3080 0.0517  9986 HIS A CB  
11   C CG  . HIS A 2   ? 0.8521 0.7791 1.4614 -0.0299 -0.3077 0.0555  9986 HIS A CG  
12   N ND1 . HIS A 2   ? 0.8715 0.8038 1.4965 -0.0275 -0.3061 0.0553  9986 HIS A ND1 
13   C CD2 . HIS A 2   ? 0.8652 0.8059 1.5120 -0.0314 -0.3060 0.0597  9986 HIS A CD2 
14   C CE1 . HIS A 2   ? 0.8548 0.8026 1.5262 -0.0275 -0.3047 0.0593  9986 HIS A CE1 
15   N NE2 . HIS A 2   ? 0.8550 0.8089 1.5413 -0.0299 -0.3040 0.0623  9986 HIS A NE2 
16   N N   . HIS A 3   ? 0.7987 0.6948 1.2716 -0.0255 -0.2897 0.0424  9987 HIS A N   
17   C CA  . HIS A 3   ? 0.7890 0.6894 1.2379 -0.0230 -0.2737 0.0387  9987 HIS A CA  
18   C C   . HIS A 3   ? 0.8166 0.7386 1.2748 -0.0219 -0.2516 0.0366  9987 HIS A C   
19   O O   . HIS A 3   ? 0.7934 0.7231 1.2636 -0.0233 -0.2482 0.0378  9987 HIS A O   
20   C CB  . HIS A 3   ? 0.8138 0.6943 1.2152 -0.0230 -0.2780 0.0369  9987 HIS A CB  
21   N N   . HIS A 4   ? 0.7794 0.7099 1.2304 -0.0193 -0.2372 0.0336  9988 HIS A N   
22   C CA  . HIS A 4   ? 0.7629 0.7120 1.2177 -0.0173 -0.2158 0.0308  9988 HIS A CA  
23   C C   . HIS A 4   ? 0.7974 0.7465 1.2277 -0.0183 -0.2074 0.0292  9988 HIS A C   
24   O O   . HIS A 4   ? 0.8047 0.7377 1.2090 -0.0199 -0.2171 0.0294  9988 HIS A O   
25   C CB  . HIS A 4   ? 0.7743 0.7252 1.2171 -0.0146 -0.2071 0.0277  9988 HIS A CB  
26   C CG  . HIS A 4   ? 0.8328 0.7735 1.2801 -0.0142 -0.2198 0.0290  9988 HIS A CG  
27   N ND1 . HIS A 4   ? 0.8550 0.8012 1.3062 -0.0116 -0.2128 0.0269  9988 HIS A ND1 
28   C CD2 . HIS A 4   ? 0.8749 0.7995 1.3215 -0.0160 -0.2394 0.0320  9988 HIS A CD2 
29   C CE1 . HIS A 4   ? 0.8625 0.7967 1.3167 -0.0121 -0.2277 0.0290  9988 HIS A CE1 
30   N NE2 . HIS A 4   ? 0.8799 0.8006 1.3310 -0.0146 -0.2441 0.0322  9988 HIS A NE2 
31   N N   . HIS A 5   ? 0.7352 0.7016 1.1735 -0.0170 -0.1894 0.0274  9989 HIS A N   
32   C CA  . HIS A 5   ? 0.7282 0.6982 1.1471 -0.0174 -0.1784 0.0256  9989 HIS A CA  
33   C C   . HIS A 5   ? 0.7804 0.7546 1.2129 -0.0197 -0.1800 0.0283  9989 HIS A C   
34   O O   . HIS A 5   ? 0.7901 0.7576 1.2380 -0.0218 -0.1948 0.0318  9989 HIS A O   
35   C CB  . HIS A 5   ? 0.7452 0.7008 1.1224 -0.0175 -0.1794 0.0231  9989 HIS A CB  
36   N N   . HIS A 6   ? 0.7267 0.7118 1.1542 -0.0192 -0.1651 0.0269  9990 HIS A N   
37   C CA  . HIS A 6   ? 0.7234 0.7137 1.1614 -0.0213 -0.1637 0.0293  9990 HIS A CA  
38   C C   . HIS A 6   ? 0.7662 0.7619 1.1825 -0.0207 -0.1490 0.0265  9990 HIS A C   
39   O O   . HIS A 6   ? 0.7609 0.7660 1.1892 -0.0216 -0.1424 0.0284  9990 HIS A O   
40   C CB  . HIS A 6   ? 0.7244 0.7305 1.2045 -0.0211 -0.1598 0.0332  9990 HIS A CB  
41   N N   . SER A 7   ? 0.7145 0.7039 1.0996 -0.0192 -0.1443 0.0225  9991 SER A N   
42   C CA  . SER A 7   ? 0.6979 0.6895 1.0571 -0.0183 -0.1318 0.0191  9991 SER A CA  
43   C C   . SER A 7   ? 0.7074 0.6979 1.0522 -0.0158 -0.1263 0.0158  9991 SER A C   
44   O O   . SER A 7   ? 0.7100 0.7084 1.0454 -0.0140 -0.1127 0.0128  9991 SER A O   
45   C CB  . SER A 7   ? 0.7376 0.7460 1.1111 -0.0175 -0.1167 0.0192  9991 SER A CB  
46   N N   . SER A 8   ? 0.6245 0.6047 0.9689 -0.0159 -0.1380 0.0165  9992 SER A N   
47   C CA  . SER A 8   ? 0.5982 0.5755 0.9341 -0.0140 -0.1368 0.0146  9992 SER A CA  
48   C C   . SER A 8   ? 0.5755 0.5676 0.9363 -0.0115 -0.1274 0.0135  9992 SER A C   
49   O O   . SER A 8   ? 0.5846 0.5748 0.9585 -0.0107 -0.1337 0.0142  9992 SER A O   
50   C CB  . SER A 8   ? 0.6489 0.6201 0.9515 -0.0133 -0.1306 0.0118  9992 SER A CB  
51   O OG  . SER A 8   ? 0.7813 0.7346 1.0612 -0.0145 -0.1427 0.0131  9992 SER A OG  
52   N N   . GLY A 9   ? 0.4539 0.4599 0.8212 -0.0100 -0.1128 0.0118  9993 GLY A N   
53   C CA  . GLY A 9   ? 0.4102 0.4300 0.7990 -0.0068 -0.1023 0.0103  9993 GLY A CA  
54   C C   . GLY A 9   ? 0.3649 0.3984 0.7579 -0.0051 -0.0866 0.0089  9993 GLY A C   
55   O O   . GLY A 9   ? 0.3204 0.3538 0.7014 -0.0067 -0.0835 0.0093  9993 GLY A O   
56   N N   . LEU A 10  ? 0.2598 0.3046 0.6698 -0.0014 -0.0767 0.0072  9994 LEU A N   
57   C CA  . LEU A 10  ? 0.2276 0.2849 0.6406 0.0012  -0.0608 0.0056  9994 LEU A CA  
58   C C   . LEU A 10  ? 0.2683 0.3235 0.6540 0.0028  -0.0526 0.0006  9994 LEU A C   
59   O O   . LEU A 10  ? 0.2766 0.3383 0.6550 0.0042  -0.0413 -0.0011 9994 LEU A O   
60   C CB  . LEU A 10  ? 0.2076 0.2766 0.6496 0.0053  -0.0536 0.0058  9994 LEU A CB  
61   C CG  . LEU A 10  ? 0.2445 0.3180 0.7181 0.0040  -0.0598 0.0113  9994 LEU A CG  
62   C CD1 . LEU A 10  ? 0.2269 0.3104 0.7284 0.0085  -0.0537 0.0113  9994 LEU A CD1 
63   C CD2 . LEU A 10  ? 0.2453 0.3247 0.7250 0.0019  -0.0556 0.0150  9994 LEU A CD2 
64   N N   . VAL A 11  ? 0.2296 0.2757 0.6012 0.0026  -0.0587 -0.0014 9995 VAL A N   
65   C CA  . VAL A 11  ? 0.2271 0.2703 0.5751 0.0037  -0.0528 -0.0055 9995 VAL A CA  
66   C C   . VAL A 11  ? 0.3058 0.3358 0.6316 0.0004  -0.0627 -0.0044 9995 VAL A C   
67   O O   . VAL A 11  ? 0.3121 0.3340 0.6413 -0.0009 -0.0739 -0.0023 9995 VAL A O   
68   C CB  . VAL A 11  ? 0.2459 0.2922 0.6005 0.0077  -0.0485 -0.0091 9995 VAL A CB  
69   C CG1 . VAL A 11  ? 0.2378 0.2804 0.5693 0.0085  -0.0438 -0.0131 9995 VAL A CG1 
70   C CG2 . VAL A 11  ? 0.2433 0.3020 0.6192 0.0118  -0.0382 -0.0103 9995 VAL A CG2 
71   N N   . PRO A 12  ? 0.2752 0.3022 0.5776 -0.0005 -0.0584 -0.0058 9996 PRO A N   
72   C CA  . PRO A 12  ? 0.2833 0.2976 0.5636 -0.0030 -0.0664 -0.0045 9996 PRO A CA  
73   C C   . PRO A 12  ? 0.3170 0.3251 0.5902 -0.0023 -0.0694 -0.0055 9996 PRO A C   
74   O O   . PRO A 12  ? 0.2927 0.3066 0.5738 0.0002  -0.0639 -0.0082 9996 PRO A O   
75   C CB  . PRO A 12  ? 0.3074 0.3228 0.5680 -0.0035 -0.0585 -0.0061 9996 PRO A CB  
76   C CG  . PRO A 12  ? 0.3418 0.3688 0.6101 -0.0007 -0.0464 -0.0093 9996 PRO A CG  
77   C CD  . PRO A 12  ? 0.2770 0.3118 0.5721 0.0008  -0.0463 -0.0082 9996 PRO A CD  
78   N N   . ARG A 13  ? 0.3100 0.3057 0.5672 -0.0043 -0.0782 -0.0032 9997 ARG A N   
79   C CA  . ARG A 13  ? 0.3317 0.3205 0.5795 -0.0040 -0.0809 -0.0032 9997 ARG A CA  
80   C C   . ARG A 13  ? 0.3491 0.3415 0.5830 -0.0030 -0.0706 -0.0060 9997 ARG A C   
81   O O   . ARG A 13  ? 0.3261 0.3217 0.5499 -0.0033 -0.0643 -0.0070 9997 ARG A O   
82   C CB  . ARG A 13  ? 0.3989 0.3728 0.6294 -0.0061 -0.0915 0.0004  9997 ARG A CB  
83   N N   . GLY A 14  ? 0.2980 0.2897 0.5323 -0.0019 -0.0697 -0.0071 9998 GLY A N   
84   C CA  . GLY A 14  ? 0.2828 0.2764 0.5052 -0.0012 -0.0618 -0.0093 9998 GLY A CA  
85   C C   . GLY A 14  ? 0.3248 0.3104 0.5243 -0.0032 -0.0625 -0.0067 9998 GLY A C   
86   O O   . GLY A 14  ? 0.3263 0.3022 0.5176 -0.0046 -0.0704 -0.0032 9998 GLY A O   
87   N N   . SER A 15  ? 0.2616 0.2506 0.4504 -0.0029 -0.0544 -0.0084 9999 SER A N   
88   C CA  . SER A 15  ? 0.2593 0.2418 0.4273 -0.0042 -0.0534 -0.0061 9999 SER A CA  
89   C C   . SER A 15  ? 0.3122 0.2899 0.4728 -0.0044 -0.0532 -0.0043 9999 SER A C   
90   O O   . SER A 15  ? 0.2983 0.2809 0.4674 -0.0034 -0.0500 -0.0066 9999 SER A O   
91   C CB  . SER A 15  ? 0.2874 0.2764 0.4490 -0.0039 -0.0449 -0.0084 9999 SER A CB  
92   O OG  . SER A 15  ? 0.3002 0.2834 0.4427 -0.0048 -0.0434 -0.0062 9999 SER A OG  
93   N N   . HIS A 16  ? 0.3014 0.2690 0.4459 -0.0055 -0.0566 -0.0001 0    HIS A N   
94   C CA  . HIS A 16  ? 0.3290 0.2917 0.4654 -0.0059 -0.0557 0.0029  0    HIS A CA  
95   C C   . HIS A 16  ? 0.3356 0.2962 0.4538 -0.0061 -0.0496 0.0046  0    HIS A C   
96   O O   . HIS A 16  ? 0.3338 0.2882 0.4413 -0.0064 -0.0489 0.0087  0    HIS A O   
97   C CB  . HIS A 16  ? 0.3775 0.3292 0.5108 -0.0065 -0.0646 0.0072  0    HIS A CB  
98   C CG  . HIS A 16  ? 0.4388 0.3927 0.5914 -0.0061 -0.0704 0.0056  0    HIS A CG  
99   N ND1 . HIS A 16  ? 0.4761 0.4277 0.6362 -0.0062 -0.0778 0.0055  0    HIS A ND1 
100  C CD2 . HIS A 16  ? 0.4649 0.4230 0.6312 -0.0055 -0.0698 0.0040  0    HIS A CD2 
101  C CE1 . HIS A 16  ? 0.4654 0.4203 0.6437 -0.0055 -0.0810 0.0041  0    HIS A CE1 
102  N NE2 . HIS A 16  ? 0.4645 0.4232 0.6466 -0.0049 -0.0764 0.0029  0    HIS A NE2 
103  N N   . MET A 17  ? 0.2559 0.2218 0.3711 -0.0058 -0.0450 0.0019  1    MET A N   
104  C CA  . MET A 17  ? 0.2432 0.2079 0.3426 -0.0057 -0.0390 0.0030  1    MET A CA  
105  C C   . MET A 17  ? 0.2901 0.2572 0.3888 -0.0057 -0.0334 0.0043  1    MET A C   
106  O O   . MET A 17  ? 0.2723 0.2467 0.3840 -0.0056 -0.0312 0.0015  1    MET A O   
107  C CB  . MET A 17  ? 0.2556 0.2282 0.3571 -0.0053 -0.0344 -0.0008 1    MET A CB  
108  C CG  . MET A 17  ? 0.2895 0.2599 0.3745 -0.0051 -0.0294 0.0003  1    MET A CG  
109  S SD  . MET A 17  ? 0.3063 0.2871 0.3952 -0.0047 -0.0228 -0.0042 1    MET A SD  
110  C CE  . MET A 17  ? 0.2483 0.2377 0.3482 -0.0044 -0.0172 -0.0065 1    MET A CE  
111  N N   . HIS A 18  ? 0.2732 0.2337 0.3568 -0.0057 -0.0311 0.0087  2    HIS A N   
112  C CA  . HIS A 18  ? 0.2876 0.2499 0.3708 -0.0059 -0.0256 0.0112  2    HIS A CA  
113  C C   . HIS A 18  ? 0.3234 0.2811 0.3893 -0.0052 -0.0204 0.0149  2    HIS A C   
114  O O   . HIS A 18  ? 0.3338 0.2815 0.3851 -0.0045 -0.0229 0.0185  2    HIS A O   
115  C CB  . HIS A 18  ? 0.3156 0.2740 0.4054 -0.0067 -0.0295 0.0146  2    HIS A CB  
116  C CG  . HIS A 18  ? 0.3704 0.3303 0.4616 -0.0072 -0.0245 0.0181  2    HIS A CG  
117  N ND1 . HIS A 18  ? 0.4203 0.3735 0.5097 -0.0079 -0.0264 0.0239  2    HIS A ND1 
118  C CD2 . HIS A 18  ? 0.3836 0.3508 0.4791 -0.0073 -0.0182 0.0168  2    HIS A CD2 
119  C CE1 . HIS A 18  ? 0.4101 0.3672 0.5034 -0.0085 -0.0209 0.0262  2    HIS A CE1 
120  N NE2 . HIS A 18  ? 0.3935 0.3588 0.4907 -0.0081 -0.0161 0.0220  2    HIS A NE2 
121  N N   . PHE A 19  ? 0.2589 0.2233 0.3261 -0.0051 -0.0133 0.0141  3    PHE A N   
122  C CA  . PHE A 19  ? 0.2545 0.2157 0.3075 -0.0041 -0.0072 0.0178  3    PHE A CA  
123  C C   . PHE A 19  ? 0.2941 0.2625 0.3554 -0.0046 -0.0008 0.0187  3    PHE A C   
124  O O   . PHE A 19  ? 0.2717 0.2478 0.3479 -0.0055 -0.0014 0.0150  3    PHE A O   
125  C CB  . PHE A 19  ? 0.2684 0.2289 0.3105 -0.0029 -0.0059 0.0150  3    PHE A CB  
126  C CG  . PHE A 19  ? 0.2609 0.2315 0.3127 -0.0033 -0.0037 0.0094  3    PHE A CG  
127  C CD1 . PHE A 19  ? 0.2722 0.2462 0.3331 -0.0038 -0.0083 0.0050  3    PHE A CD1 
128  C CD2 . PHE A 19  ? 0.2747 0.2508 0.3261 -0.0028 0.0030  0.0089  3    PHE A CD2 
129  C CE1 . PHE A 19  ? 0.2593 0.2418 0.3274 -0.0038 -0.0057 0.0003  3    PHE A CE1 
130  C CE2 . PHE A 19  ? 0.2929 0.2772 0.3516 -0.0031 0.0046  0.0038  3    PHE A CE2 
131  C CZ  . PHE A 19  ? 0.2498 0.2370 0.3158 -0.0035 0.0005  -0.0003 3    PHE A CZ  
132  N N   . THR A 20  ? 0.2577 0.2233 0.3094 -0.0037 0.0051  0.0238  4    THR A N   
133  C CA  . THR A 20  ? 0.2661 0.2382 0.3250 -0.0040 0.0116  0.0255  4    THR A CA  
134  C C   . THR A 20  ? 0.3125 0.2848 0.3597 -0.0022 0.0175  0.0253  4    THR A C   
135  O O   . THR A 20  ? 0.3119 0.2763 0.3423 -0.0004 0.0177  0.0268  4    THR A O   
136  C CB  . THR A 20  ? 0.3424 0.3120 0.4047 -0.0046 0.0141  0.0328  4    THR A CB  
137  O OG1 . THR A 20  ? 0.4085 0.3686 0.4529 -0.0028 0.0168  0.0384  4    THR A OG1 
138  C CG2 . THR A 20  ? 0.3427 0.3120 0.4177 -0.0064 0.0079  0.0328  4    THR A CG2 
139  N N   . ILE A 21  ? 0.2501 0.2307 0.3058 -0.0024 0.0215  0.0232  5    ILE A N   
140  C CA  . ILE A 21  ? 0.2470 0.2288 0.2938 -0.0008 0.0269  0.0224  5    ILE A CA  
141  C C   . ILE A 21  ? 0.2902 0.2802 0.3490 -0.0013 0.0317  0.0230  5    ILE A C   
142  O O   . ILE A 21  ? 0.2683 0.2640 0.3422 -0.0031 0.0289  0.0206  5    ILE A O   
143  C CB  . ILE A 21  ? 0.2635 0.2460 0.3058 -0.0005 0.0232  0.0160  5    ILE A CB  
144  C CG1 . ILE A 21  ? 0.2756 0.2571 0.3058 0.0015  0.0277  0.0153  5    ILE A CG1 
145  C CG2 . ILE A 21  ? 0.2387 0.2293 0.2961 -0.0021 0.0198  0.0103  5    ILE A CG2 
146  C CD1 . ILE A 21  ? 0.3217 0.3017 0.3454 0.0018  0.0235  0.0102  5    ILE A CD1 
147  N N   . GLN A 22  ? 0.2604 0.2504 0.3125 0.0005  0.0386  0.0261  6    GLN A N   
148  C CA  . GLN A 22  ? 0.2596 0.2571 0.3231 0.0002  0.0431  0.0269  6    GLN A CA  
149  C C   . GLN A 22  ? 0.2862 0.2894 0.3543 -0.0004 0.0401  0.0195  6    GLN A C   
150  O O   . GLN A 22  ? 0.2737 0.2746 0.3315 0.0004  0.0383  0.0156  6    GLN A O   
151  C CB  . GLN A 22  ? 0.2842 0.2799 0.3383 0.0028  0.0514  0.0316  6    GLN A CB  
152  C CG  . GLN A 22  ? 0.4694 0.4610 0.5214 0.0037  0.0566  0.0400  6    GLN A CG  
153  C CD  . GLN A 22  ? 0.6767 0.6747 0.7492 0.0015  0.0578  0.0441  6    GLN A CD  
154  O OE1 . GLN A 22  ? 0.5519 0.5491 0.6326 -0.0007 0.0534  0.0455  6    GLN A OE1 
155  N NE2 . GLN A 22  ? 0.6217 0.6260 0.7038 0.0019  0.0632  0.0462  6    GLN A NE2 
156  N N   . ARG A 23  ? 0.2450 0.2549 0.3282 -0.0018 0.0394  0.0180  7    ARG A N   
157  C CA  . ARG A 23  ? 0.2426 0.2574 0.3299 -0.0022 0.0368  0.0115  7    ARG A CA  
158  C C   . ARG A 23  ? 0.2901 0.3044 0.3653 -0.0005 0.0397  0.0093  7    ARG A C   
159  O O   . ARG A 23  ? 0.2763 0.2906 0.3467 -0.0004 0.0367  0.0043  7    ARG A O   
160  C CB  . ARG A 23  ? 0.2419 0.2623 0.3450 -0.0033 0.0364  0.0116  7    ARG A CB  
161  C CG  . ARG A 23  ? 0.2594 0.2838 0.3647 -0.0032 0.0341  0.0053  7    ARG A CG  
162  C CD  . ARG A 23  ? 0.3023 0.3309 0.4215 -0.0040 0.0338  0.0063  7    ARG A CD  
163  N NE  . ARG A 23  ? 0.2701 0.3012 0.3894 -0.0036 0.0315  0.0006  7    ARG A NE  
164  C CZ  . ARG A 23  ? 0.3423 0.3750 0.4567 -0.0026 0.0346  0.0002  7    ARG A CZ  
165  N NH1 . ARG A 23  ? 0.2783 0.3106 0.3872 -0.0015 0.0406  0.0048  7    ARG A NH1 
166  N NH2 . ARG A 23  ? 0.2459 0.2802 0.3600 -0.0023 0.0318  -0.0049 7    ARG A NH2 
167  N N   . GLU A 24  ? 0.2459 0.2600 0.3171 0.0011  0.0458  0.0134  8    GLU A N   
168  C CA  . GLU A 24  ? 0.2472 0.2607 0.3081 0.0030  0.0490  0.0118  8    GLU A CA  
169  C C   . GLU A 24  ? 0.2884 0.2948 0.3324 0.0044  0.0477  0.0105  8    GLU A C   
170  O O   . GLU A 24  ? 0.2804 0.2866 0.3180 0.0050  0.0465  0.0066  8    GLU A O   
171  C CB  . GLU A 24  ? 0.2769 0.2918 0.3392 0.0048  0.0563  0.0170  8    GLU A CB  
172  C CG  . GLU A 24  ? 0.3544 0.3766 0.4351 0.0034  0.0568  0.0181  8    GLU A CG  
173  C CD  . GLU A 24  ? 0.4112 0.4352 0.5063 0.0012  0.0544  0.0210  8    GLU A CD  
174  O OE1 . GLU A 24  ? 0.3228 0.3426 0.4142 0.0012  0.0554  0.0250  8    GLU A OE1 
175  O OE2 . GLU A 24  ? 0.3827 0.4115 0.4922 -0.0005 0.0509  0.0192  8    GLU A OE2 
176  N N   . ALA A 25  ? 0.2658 0.2659 0.3030 0.0048  0.0472  0.0140  9    ALA A N   
177  C CA  . ALA A 25  ? 0.2812 0.2729 0.3024 0.0061  0.0445  0.0131  9    ALA A CA  
178  C C   . ALA A 25  ? 0.3075 0.3007 0.3321 0.0042  0.0375  0.0075  9    ALA A C   
179  O O   . ALA A 25  ? 0.3003 0.2898 0.3155 0.0049  0.0351  0.0049  9    ALA A O   
180  C CB  . ALA A 25  ? 0.3000 0.2843 0.3145 0.0067  0.0446  0.0182  9    ALA A CB  
181  N N   . LEU A 26  ? 0.2569 0.2554 0.2955 0.0020  0.0345  0.0058  10   LEU A N   
182  C CA  . LEU A 26  ? 0.2389 0.2397 0.2823 0.0006  0.0291  0.0008  10   LEU A CA  
183  C C   . LEU A 26  ? 0.2812 0.2875 0.3270 0.0006  0.0300  -0.0035 10   LEU A C   
184  O O   . LEU A 26  ? 0.2535 0.2595 0.2963 0.0004  0.0274  -0.0066 10   LEU A O   
185  C CB  . LEU A 26  ? 0.2194 0.2231 0.2759 -0.0010 0.0258  0.0002  10   LEU A CB  
186  C CG  . LEU A 26  ? 0.2677 0.2744 0.3308 -0.0018 0.0214  -0.0049 10   LEU A CG  
187  C CD1 . LEU A 26  ? 0.2571 0.2589 0.3129 -0.0016 0.0177  -0.0053 10   LEU A CD1 
188  C CD2 . LEU A 26  ? 0.2583 0.2671 0.3336 -0.0027 0.0186  -0.0054 10   LEU A CD2 
189  N N   . LEU A 27  ? 0.2712 0.2825 0.3235 0.0006  0.0332  -0.0034 11   LEU A N   
190  C CA  . LEU A 27  ? 0.2694 0.2857 0.3247 0.0005  0.0336  -0.0072 11   LEU A CA  
191  C C   . LEU A 27  ? 0.3077 0.3221 0.3523 0.0016  0.0349  -0.0084 11   LEU A C   
192  O O   . LEU A 27  ? 0.2820 0.2991 0.3273 0.0012  0.0335  -0.0120 11   LEU A O   
193  C CB  . LEU A 27  ? 0.2820 0.3027 0.3466 0.0004  0.0359  -0.0062 11   LEU A CB  
194  C CG  . LEU A 27  ? 0.3693 0.3946 0.4387 0.0002  0.0349  -0.0104 11   LEU A CG  
195  C CD1 . LEU A 27  ? 0.3811 0.4079 0.4555 -0.0005 0.0307  -0.0148 11   LEU A CD1 
196  C CD2 . LEU A 27  ? 0.4117 0.4401 0.4905 0.0001  0.0364  -0.0084 11   LEU A CD2 
197  N N   . LYS A 28  ? 0.2929 0.3022 0.3273 0.0032  0.0377  -0.0051 12   LYS A N   
198  C CA  . LYS A 28  ? 0.3051 0.3112 0.3283 0.0047  0.0387  -0.0061 12   LYS A CA  
199  C C   . LYS A 28  ? 0.3448 0.3486 0.3642 0.0038  0.0338  -0.0091 12   LYS A C   
200  O O   . LYS A 28  ? 0.3285 0.3359 0.3501 0.0032  0.0331  -0.0120 12   LYS A O   
201  C CB  . LYS A 28  ? 0.3419 0.3414 0.3536 0.0072  0.0426  -0.0021 12   LYS A CB  
202  C CG  . LYS A 28  ? 0.5619 0.5578 0.5623 0.0093  0.0439  -0.0033 12   LYS A CG  
203  C CD  . LYS A 28  ? 0.7136 0.7010 0.6999 0.0126  0.0474  0.0002  12   LYS A CD  
204  C CE  . LYS A 28  ? 0.8563 0.8387 0.8304 0.0150  0.0478  -0.0016 12   LYS A CE  
205  N NZ  . LYS A 28  ? 0.9679 0.9401 0.9255 0.0189  0.0508  0.0013  12   LYS A NZ  
206  N N   . PRO A 29  ? 0.3019 0.3002 0.3173 0.0035  0.0300  -0.0082 13   PRO A N   
207  C CA  . PRO A 29  ? 0.2922 0.2895 0.3077 0.0024  0.0250  -0.0107 13   PRO A CA  
208  C C   . PRO A 29  ? 0.3066 0.3116 0.3351 0.0007  0.0239  -0.0136 13   PRO A C   
209  O O   . PRO A 29  ? 0.2927 0.2999 0.3227 0.0001  0.0226  -0.0158 13   PRO A O   
210  C CB  . PRO A 29  ? 0.3235 0.3131 0.3335 0.0026  0.0208  -0.0086 13   PRO A CB  
211  C CG  . PRO A 29  ? 0.3746 0.3642 0.3870 0.0029  0.0235  -0.0056 13   PRO A CG  
212  C CD  . PRO A 29  ? 0.3204 0.3130 0.3317 0.0042  0.0297  -0.0045 13   PRO A CD  
213  N N   . LEU A 30  ? 0.2384 0.2471 0.2760 0.0001  0.0245  -0.0135 14   LEU A N   
214  C CA  . LEU A 30  ? 0.2146 0.2293 0.2630 -0.0007 0.0235  -0.0165 14   LEU A CA  
215  C C   . LEU A 30  ? 0.2594 0.2791 0.3092 -0.0006 0.0258  -0.0193 14   LEU A C   
216  O O   . LEU A 30  ? 0.2546 0.2770 0.3080 -0.0009 0.0250  -0.0216 14   LEU A O   
217  C CB  . LEU A 30  ? 0.2114 0.2277 0.2681 -0.0010 0.0233  -0.0160 14   LEU A CB  
218  C CG  . LEU A 30  ? 0.2430 0.2641 0.3100 -0.0012 0.0221  -0.0195 14   LEU A CG  
219  C CD1 . LEU A 30  ? 0.2447 0.2660 0.3145 -0.0014 0.0195  -0.0209 14   LEU A CD1 
220  C CD2 . LEU A 30  ? 0.2589 0.2800 0.3334 -0.0014 0.0209  -0.0187 14   LEU A CD2 
221  N N   . GLN A 31  ? 0.2449 0.2654 0.2919 0.0000  0.0288  -0.0188 15   GLN A N   
222  C CA  . GLN A 31  ? 0.2463 0.2706 0.2937 0.0002  0.0303  -0.0213 15   GLN A CA  
223  C C   . GLN A 31  ? 0.2913 0.3147 0.3330 0.0001  0.0299  -0.0221 15   GLN A C   
224  O O   . GLN A 31  ? 0.2729 0.2994 0.3168 -0.0001 0.0300  -0.0243 15   GLN A O   
225  C CB  . GLN A 31  ? 0.2621 0.2870 0.3086 0.0009  0.0329  -0.0201 15   GLN A CB  
226  C CG  . GLN A 31  ? 0.4128 0.4405 0.4683 0.0007  0.0327  -0.0205 15   GLN A CG  
227  C CD  . GLN A 31  ? 0.6103 0.6392 0.6677 0.0012  0.0350  -0.0187 15   GLN A CD  
228  O OE1 . GLN A 31  ? 0.5108 0.5376 0.5644 0.0020  0.0377  -0.0154 15   GLN A OE1 
229  N NE2 . GLN A 31  ? 0.5442 0.5758 0.6076 0.0011  0.0337  -0.0208 15   GLN A NE2 
230  N N   . LEU A 32  ? 0.2883 0.3066 0.3223 0.0004  0.0291  -0.0201 16   LEU A N   
231  C CA  . LEU A 32  ? 0.3127 0.3291 0.3418 0.0001  0.0277  -0.0205 16   LEU A CA  
232  C C   . LEU A 32  ? 0.3182 0.3357 0.3530 -0.0011 0.0248  -0.0211 16   LEU A C   
233  O O   . LEU A 32  ? 0.3097 0.3303 0.3472 -0.0017 0.0251  -0.0222 16   LEU A O   
234  C CB  . LEU A 32  ? 0.3375 0.3468 0.3558 0.0012  0.0270  -0.0185 16   LEU A CB  
235  C CG  . LEU A 32  ? 0.4251 0.4340 0.4383 0.0028  0.0308  -0.0179 16   LEU A CG  
236  C CD1 . LEU A 32  ? 0.4511 0.4522 0.4530 0.0048  0.0311  -0.0158 16   LEU A CD1 
237  C CD2 . LEU A 32  ? 0.4714 0.4834 0.4846 0.0026  0.0317  -0.0197 16   LEU A CD2 
238  N N   . VAL A 33  ? 0.2488 0.2644 0.2868 -0.0014 0.0223  -0.0201 17   VAL A N   
239  C CA  . VAL A 33  ? 0.2493 0.2663 0.2951 -0.0024 0.0195  -0.0204 17   VAL A CA  
240  C C   . VAL A 33  ? 0.2919 0.3161 0.3468 -0.0023 0.0222  -0.0228 17   VAL A C   
241  O O   . VAL A 33  ? 0.2826 0.3096 0.3420 -0.0027 0.0224  -0.0231 17   VAL A O   
242  C CB  . VAL A 33  ? 0.2976 0.3101 0.3447 -0.0025 0.0157  -0.0188 17   VAL A CB  
243  C CG1 . VAL A 33  ? 0.3011 0.3162 0.3591 -0.0033 0.0130  -0.0192 17   VAL A CG1 
244  C CG2 . VAL A 33  ? 0.2994 0.3031 0.3352 -0.0022 0.0124  -0.0166 17   VAL A CG2 
245  N N   . ALA A 34  ? 0.2622 0.2889 0.3195 -0.0015 0.0243  -0.0242 18   ALA A N   
246  C CA  . ALA A 34  ? 0.2745 0.3063 0.3379 -0.0007 0.0266  -0.0270 18   ALA A CA  
247  C C   . ALA A 34  ? 0.3312 0.3654 0.3909 -0.0004 0.0294  -0.0281 18   ALA A C   
248  O O   . ALA A 34  ? 0.3332 0.3707 0.3965 0.0004  0.0314  -0.0298 18   ALA A O   
249  C CB  . ALA A 34  ? 0.2890 0.3212 0.3548 0.0001  0.0269  -0.0283 18   ALA A CB  
250  N N   . GLY A 35  ? 0.3028 0.3349 0.3551 -0.0008 0.0296  -0.0271 19   GLY A N   
251  C CA  . GLY A 35  ? 0.3150 0.3483 0.3629 -0.0007 0.0316  -0.0277 19   GLY A CA  
252  C C   . GLY A 35  ? 0.3813 0.4162 0.4314 -0.0013 0.0320  -0.0269 19   GLY A C   
253  O O   . GLY A 35  ? 0.3882 0.4253 0.4368 -0.0009 0.0345  -0.0276 19   GLY A O   
254  N N   . VAL A 36  ? 0.3180 0.3515 0.3721 -0.0024 0.0293  -0.0250 20   VAL A N   
255  C CA  . VAL A 36  ? 0.3133 0.3485 0.3725 -0.0033 0.0291  -0.0235 20   VAL A CA  
256  C C   . VAL A 36  ? 0.3815 0.4217 0.4510 -0.0026 0.0314  -0.0240 20   VAL A C   
257  O O   . VAL A 36  ? 0.3746 0.4177 0.4504 -0.0030 0.0327  -0.0225 20   VAL A O   
258  C CB  . VAL A 36  ? 0.3582 0.3884 0.4168 -0.0048 0.0240  -0.0210 20   VAL A CB  
259  C CG1 . VAL A 36  ? 0.3539 0.3784 0.4010 -0.0047 0.0224  -0.0208 20   VAL A CG1 
260  C CG2 . VAL A 36  ? 0.3514 0.3797 0.4157 -0.0051 0.0204  -0.0203 20   VAL A CG2 
261  N N   . VAL A 37  ? 0.3484 0.3892 0.4202 -0.0013 0.0317  -0.0260 21   VAL A N   
262  C CA  . VAL A 37  ? 0.3671 0.4117 0.4479 0.0000  0.0338  -0.0272 21   VAL A CA  
263  C C   . VAL A 37  ? 0.4619 0.5096 0.5400 0.0021  0.0391  -0.0293 21   VAL A C   
264  O O   . VAL A 37  ? 0.4720 0.5182 0.5428 0.0031  0.0397  -0.0316 21   VAL A O   
265  C CB  . VAL A 37  ? 0.4057 0.4487 0.4896 0.0006  0.0313  -0.0285 21   VAL A CB  
266  C CG1 . VAL A 37  ? 0.4091 0.4556 0.5015 0.0027  0.0337  -0.0304 21   VAL A CG1 
267  C CG2 . VAL A 37  ? 0.3985 0.4376 0.4842 -0.0011 0.0261  -0.0260 21   VAL A CG2 
268  N N   . GLU A 38  ? 0.4313 0.4829 0.5154 0.0029  0.0429  -0.0283 22   GLU A N   
269  C CA  . GLU A 38  ? 0.7844 0.8381 0.8646 0.0055  0.0486  -0.0300 22   GLU A CA  
270  C C   . GLU A 38  ? 1.0814 1.1362 1.1651 0.0087  0.0509  -0.0332 22   GLU A C   
271  O O   . GLU A 38  ? 0.5953 0.6512 0.6886 0.0088  0.0492  -0.0330 22   GLU A O   
272  C CB  . GLU A 38  ? 0.8015 0.8587 0.8856 0.0051  0.0526  -0.0267 22   GLU A CB  
273  N N   . THR A 42  ? 0.6498 0.7308 0.7953 0.0233  0.0819  -0.0270 26   THR A N   
274  C CA  . THR A 42  ? 0.6530 0.7396 0.8141 0.0267  0.0879  -0.0256 26   THR A CA  
275  C C   . THR A 42  ? 0.6710 0.7591 0.8490 0.0243  0.0807  -0.0245 26   THR A C   
276  O O   . THR A 42  ? 0.6720 0.7619 0.8597 0.0276  0.0826  -0.0262 26   THR A O   
277  C CB  . THR A 42  ? 0.7919 0.8846 0.9604 0.0272  0.0965  -0.0199 26   THR A CB  
278  O OG1 . THR A 42  ? 0.8160 0.9059 0.9663 0.0292  0.1020  -0.0210 26   THR A OG1 
279  C CG2 . THR A 42  ? 0.7774 0.8763 0.9619 0.0316  0.1047  -0.0183 26   THR A CG2 
280  N N   . LEU A 43  ? 0.5802 0.6667 0.7608 0.0189  0.0724  -0.0218 27   LEU A N   
281  C CA  . LEU A 43  ? 0.5530 0.6388 0.7463 0.0162  0.0640  -0.0207 27   LEU A CA  
282  C C   . LEU A 43  ? 0.5234 0.6022 0.7035 0.0156  0.0575  -0.0253 27   LEU A C   
283  O O   . LEU A 43  ? 0.5137 0.5882 0.6809 0.0129  0.0537  -0.0255 27   LEU A O   
284  C CB  . LEU A 43  ? 0.5561 0.6424 0.7567 0.0111  0.0584  -0.0154 27   LEU A CB  
285  C CG  . LEU A 43  ? 0.6249 0.7101 0.8401 0.0083  0.0494  -0.0130 27   LEU A CG  
286  C CD1 . LEU A 43  ? 0.6355 0.7269 0.8721 0.0108  0.0526  -0.0114 27   LEU A CD1 
287  C CD2 . LEU A 43  ? 0.6611 0.7449 0.8799 0.0038  0.0436  -0.0084 27   LEU A CD2 
288  N N   . PRO A 44  ? 0.4256 0.5031 0.6084 0.0185  0.0568  -0.0289 28   PRO A N   
289  C CA  . PRO A 44  ? 0.3986 0.4697 0.5699 0.0180  0.0513  -0.0328 28   PRO A CA  
290  C C   . PRO A 44  ? 0.3669 0.4337 0.5350 0.0133  0.0425  -0.0308 28   PRO A C   
291  O O   . PRO A 44  ? 0.3399 0.4021 0.4946 0.0123  0.0402  -0.0327 28   PRO A O   
292  C CB  . PRO A 44  ? 0.4262 0.4975 0.6061 0.0216  0.0513  -0.0358 28   PRO A CB  
293  C CG  . PRO A 44  ? 0.4966 0.5739 0.6861 0.0256  0.0600  -0.0352 28   PRO A CG  
294  C CD  . PRO A 44  ? 0.4460 0.5278 0.6432 0.0225  0.0613  -0.0295 28   PRO A CD  
295  N N   . VAL A 45  ? 0.3053 0.3728 0.4852 0.0107  0.0377  -0.0269 29   VAL A N   
296  C CA  . VAL A 45  ? 0.2967 0.3588 0.4725 0.0067  0.0292  -0.0248 29   VAL A CA  
297  C C   . VAL A 45  ? 0.3376 0.3968 0.4985 0.0045  0.0291  -0.0241 29   VAL A C   
298  O O   . VAL A 45  ? 0.3022 0.3558 0.4535 0.0026  0.0240  -0.0241 29   VAL A O   
299  C CB  . VAL A 45  ? 0.3291 0.3914 0.5201 0.0046  0.0233  -0.0209 29   VAL A CB  
300  C CG1 . VAL A 45  ? 0.3261 0.3920 0.5236 0.0029  0.0248  -0.0171 29   VAL A CG1 
301  C CG2 . VAL A 45  ? 0.3239 0.3784 0.5091 0.0019  0.0139  -0.0199 29   VAL A CG2 
302  N N   . LEU A 46  ? 0.3211 0.3841 0.4801 0.0051  0.0351  -0.0234 30   LEU A N   
303  C CA  . LEU A 46  ? 0.3289 0.3898 0.4753 0.0032  0.0353  -0.0226 30   LEU A CA  
304  C C   . LEU A 46  ? 0.3253 0.3826 0.4563 0.0041  0.0360  -0.0261 30   LEU A C   
305  O O   . LEU A 46  ? 0.2967 0.3508 0.4175 0.0023  0.0341  -0.0255 30   LEU A O   
306  C CB  . LEU A 46  ? 0.3434 0.4092 0.4929 0.0036  0.0414  -0.0204 30   LEU A CB  
307  C CG  . LEU A 46  ? 0.4249 0.4936 0.5895 0.0014  0.0392  -0.0156 30   LEU A CG  
308  C CD1 . LEU A 46  ? 0.4339 0.5078 0.6014 0.0019  0.0463  -0.0129 30   LEU A CD1 
309  C CD2 . LEU A 46  ? 0.4689 0.5313 0.6299 -0.0023 0.0302  -0.0135 30   LEU A CD2 
310  N N   . SER A 47  ? 0.2707 0.3284 0.4011 0.0069  0.0382  -0.0297 31   SER A N   
311  C CA  . SER A 47  ? 0.2648 0.3190 0.3833 0.0078  0.0381  -0.0330 31   SER A CA  
312  C C   . SER A 47  ? 0.2701 0.3197 0.3874 0.0060  0.0318  -0.0327 31   SER A C   
313  O O   . SER A 47  ? 0.2414 0.2881 0.3509 0.0061  0.0308  -0.0344 31   SER A O   
314  C CB  . SER A 47  ? 0.3161 0.3715 0.4345 0.0118  0.0424  -0.0369 31   SER A CB  
315  O OG  . SER A 47  ? 0.4564 0.5144 0.5710 0.0136  0.0487  -0.0371 31   SER A OG  
316  N N   . ASN A 48  ? 0.2232 0.2720 0.3488 0.0045  0.0275  -0.0302 32   ASN A N   
317  C CA  . ASN A 48  ? 0.2086 0.2524 0.3329 0.0031  0.0218  -0.0293 32   ASN A CA  
318  C C   . ASN A 48  ? 0.2171 0.2563 0.3335 0.0004  0.0178  -0.0263 32   ASN A C   
319  O O   . ASN A 48  ? 0.2055 0.2450 0.3216 -0.0008 0.0175  -0.0244 32   ASN A O   
320  C CB  . ASN A 48  ? 0.1905 0.2347 0.3276 0.0035  0.0186  -0.0288 32   ASN A CB  
321  C CG  . ASN A 48  ? 0.2523 0.2989 0.3956 0.0066  0.0213  -0.0323 32   ASN A CG  
322  O OD1 . ASN A 48  ? 0.1780 0.2263 0.3164 0.0088  0.0260  -0.0353 32   ASN A OD1 
323  N ND2 . ASN A 48  ? 0.1952 0.2413 0.3489 0.0071  0.0179  -0.0320 32   ASN A ND2 
324  N N   . VAL A 49  ? 0.1585 0.1927 0.2686 -0.0003 0.0148  -0.0258 33   VAL A N   
325  C CA  . VAL A 49  ? 0.1501 0.1783 0.2515 -0.0020 0.0110  -0.0229 33   VAL A CA  
326  C C   . VAL A 49  ? 0.1878 0.2119 0.2945 -0.0027 0.0051  -0.0209 33   VAL A C   
327  O O   . VAL A 49  ? 0.1929 0.2175 0.3062 -0.0020 0.0042  -0.0217 33   VAL A O   
328  C CB  . VAL A 49  ? 0.1852 0.2103 0.2755 -0.0020 0.0124  -0.0228 33   VAL A CB  
329  C CG1 . VAL A 49  ? 0.1699 0.1949 0.2637 -0.0013 0.0122  -0.0236 33   VAL A CG1 
330  C CG2 . VAL A 49  ? 0.1961 0.2142 0.2762 -0.0030 0.0093  -0.0198 33   VAL A CG2 
331  N N   . LEU A 50  ? 0.1691 0.1884 0.2730 -0.0040 0.0005  -0.0185 34   LEU A N   
332  C CA  . LEU A 50  ? 0.1709 0.1846 0.2782 -0.0047 -0.0063 -0.0164 34   LEU A CA  
333  C C   . LEU A 50  ? 0.2209 0.2265 0.3143 -0.0048 -0.0084 -0.0146 34   LEU A C   
334  O O   . LEU A 50  ? 0.2147 0.2163 0.2953 -0.0048 -0.0076 -0.0138 34   LEU A O   
335  C CB  . LEU A 50  ? 0.1656 0.1769 0.2765 -0.0059 -0.0114 -0.0145 34   LEU A CB  
336  C CG  . LEU A 50  ? 0.2016 0.2037 0.3108 -0.0067 -0.0205 -0.0120 34   LEU A CG  
337  C CD1 . LEU A 50  ? 0.1915 0.1954 0.3150 -0.0065 -0.0235 -0.0118 34   LEU A CD1 
338  C CD2 . LEU A 50  ? 0.2036 0.2013 0.3123 -0.0080 -0.0262 -0.0103 34   LEU A CD2 
339  N N   . LEU A 51  ? 0.1583 0.1614 0.2542 -0.0045 -0.0108 -0.0138 35   LEU A N   
340  C CA  . LEU A 51  ? 0.1681 0.1632 0.2516 -0.0045 -0.0123 -0.0113 35   LEU A CA  
341  C C   . LEU A 51  ? 0.2262 0.2127 0.3081 -0.0050 -0.0203 -0.0087 35   LEU A C   
342  O O   . LEU A 51  ? 0.2010 0.1889 0.2953 -0.0053 -0.0242 -0.0089 35   LEU A O   
343  C CB  . LEU A 51  ? 0.1750 0.1727 0.2619 -0.0040 -0.0091 -0.0115 35   LEU A CB  
344  C CG  . LEU A 51  ? 0.2367 0.2420 0.3261 -0.0034 -0.0025 -0.0143 35   LEU A CG  
345  C CD1 . LEU A 51  ? 0.2509 0.2583 0.3472 -0.0030 -0.0015 -0.0149 35   LEU A CD1 
346  C CD2 . LEU A 51  ? 0.2509 0.2548 0.3278 -0.0032 0.0014  -0.0135 35   LEU A CD2 
347  N N   . VAL A 52  ? 0.1831 0.1600 0.2493 -0.0047 -0.0231 -0.0064 36   VAL A N   
348  C CA  . VAL A 52  ? 0.1942 0.1606 0.2557 -0.0049 -0.0317 -0.0040 36   VAL A CA  
349  C C   . VAL A 52  ? 0.2599 0.2165 0.3034 -0.0038 -0.0313 -0.0010 36   VAL A C   
350  O O   . VAL A 52  ? 0.2672 0.2209 0.2967 -0.0026 -0.0272 -0.0006 36   VAL A O   
351  C CB  . VAL A 52  ? 0.2463 0.2082 0.3055 -0.0054 -0.0376 -0.0042 36   VAL A CB  
352  C CG1 . VAL A 52  ? 0.2625 0.2112 0.3141 -0.0053 -0.0477 -0.0017 36   VAL A CG1 
353  C CG2 . VAL A 52  ? 0.2297 0.2016 0.3081 -0.0066 -0.0373 -0.0062 36   VAL A CG2 
354  N N   . VAL A 53  ? 0.2167 0.1676 0.2602 -0.0038 -0.0356 0.0015  37   VAL A N   
355  C CA  . VAL A 53  ? 0.2372 0.1776 0.2630 -0.0025 -0.0354 0.0052  37   VAL A CA  
356  C C   . VAL A 53  ? 0.3092 0.2361 0.3256 -0.0021 -0.0456 0.0070  37   VAL A C   
357  O O   . VAL A 53  ? 0.2902 0.2163 0.3178 -0.0032 -0.0525 0.0073  37   VAL A O   
358  C CB  . VAL A 53  ? 0.2867 0.2297 0.3172 -0.0027 -0.0317 0.0074  37   VAL A CB  
359  C CG1 . VAL A 53  ? 0.3078 0.2386 0.3201 -0.0013 -0.0321 0.0123  37   VAL A CG1 
360  C CG2 . VAL A 53  ? 0.2715 0.2259 0.3093 -0.0028 -0.0225 0.0057  37   VAL A CG2 
361  N N   . GLU A 54  ? 0.3031 0.2190 0.2991 -0.0004 -0.0471 0.0080  38   GLU A N   
362  C CA  . GLU A 54  ? 0.3301 0.2303 0.3126 0.0006  -0.0574 0.0097  38   GLU A CA  
363  C C   . GLU A 54  ? 0.4024 0.2912 0.3598 0.0035  -0.0534 0.0129  38   GLU A C   
364  O O   . GLU A 54  ? 0.3865 0.2761 0.3335 0.0052  -0.0464 0.0122  38   GLU A O   
365  C CB  . GLU A 54  ? 0.3462 0.2431 0.3280 0.0003  -0.0638 0.0072  38   GLU A CB  
366  C CG  . GLU A 54  ? 0.4139 0.3205 0.4207 -0.0024 -0.0685 0.0051  38   GLU A CG  
367  C CD  . GLU A 54  ? 0.5877 0.4925 0.5975 -0.0031 -0.0746 0.0033  38   GLU A CD  
368  O OE1 . GLU A 54  ? 0.5111 0.4084 0.5038 -0.0016 -0.0745 0.0027  38   GLU A OE1 
369  O OE2 . GLU A 54  ? 0.4711 0.3820 0.5013 -0.0052 -0.0795 0.0026  38   GLU A OE2 
370  N N   . GLY A 55  ? 0.4075 0.2862 0.3561 0.0043  -0.0572 0.0166  39   GLY A N   
371  C CA  . GLY A 55  ? 0.4272 0.2950 0.3523 0.0074  -0.0524 0.0206  39   GLY A CA  
372  C C   . GLY A 55  ? 0.4503 0.3299 0.3807 0.0075  -0.0393 0.0218  39   GLY A C   
373  O O   . GLY A 55  ? 0.4158 0.3072 0.3656 0.0051  -0.0363 0.0218  39   GLY A O   
374  N N   . GLN A 56  ? 0.4148 0.2915 0.3293 0.0103  -0.0318 0.0224  40   GLN A N   
375  C CA  . GLN A 56  ? 0.3939 0.2810 0.3131 0.0106  -0.0195 0.0239  40   GLN A CA  
376  C C   . GLN A 56  ? 0.4422 0.3402 0.3701 0.0100  -0.0156 0.0192  40   GLN A C   
377  O O   . GLN A 56  ? 0.4297 0.3335 0.3566 0.0111  -0.0062 0.0198  40   GLN A O   
378  C CB  . GLN A 56  ? 0.4258 0.3023 0.3219 0.0146  -0.0127 0.0288  40   GLN A CB  
379  C CG  . GLN A 56  ? 0.4509 0.3181 0.3395 0.0151  -0.0146 0.0345  40   GLN A CG  
380  C CD  . GLN A 56  ? 0.5827 0.4620 0.4946 0.0116  -0.0129 0.0361  40   GLN A CD  
381  O OE1 . GLN A 56  ? 0.5314 0.4224 0.4555 0.0107  -0.0042 0.0370  40   GLN A OE1 
382  N NE2 . GLN A 56  ? 0.4607 0.3372 0.3804 0.0095  -0.0221 0.0360  40   GLN A NE2 
383  N N   . GLN A 57  ? 0.3998 0.2999 0.3363 0.0082  -0.0229 0.0149  41   GLN A N   
384  C CA  . GLN A 57  ? 0.3775 0.2869 0.3217 0.0075  -0.0200 0.0108  41   GLN A CA  
385  C C   . GLN A 57  ? 0.3723 0.2963 0.3413 0.0042  -0.0200 0.0080  41   GLN A C   
386  O O   . GLN A 57  ? 0.3606 0.2851 0.3405 0.0024  -0.0273 0.0071  41   GLN A O   
387  C CB  . GLN A 57  ? 0.4040 0.3042 0.3376 0.0085  -0.0275 0.0083  41   GLN A CB  
388  C CG  . GLN A 57  ? 0.6096 0.5178 0.5479 0.0082  -0.0236 0.0048  41   GLN A CG  
389  C CD  . GLN A 57  ? 0.8124 0.7134 0.7462 0.0081  -0.0323 0.0023  41   GLN A CD  
390  O OE1 . GLN A 57  ? 0.7275 0.6189 0.6437 0.0108  -0.0327 0.0018  41   GLN A OE1 
391  N NE2 . GLN A 57  ? 0.7122 0.6175 0.6625 0.0052  -0.0394 0.0009  41   GLN A NE2 
392  N N   . LEU A 58  ? 0.2998 0.2353 0.2773 0.0037  -0.0120 0.0066  42   LEU A N   
393  C CA  . LEU A 58  ? 0.2564 0.2051 0.2545 0.0013  -0.0110 0.0034  42   LEU A CA  
394  C C   . LEU A 58  ? 0.2808 0.2333 0.2796 0.0012  -0.0105 0.0000  42   LEU A C   
395  O O   . LEU A 58  ? 0.2823 0.2339 0.2712 0.0027  -0.0057 -0.0001 42   LEU A O   
396  C CB  . LEU A 58  ? 0.2493 0.2073 0.2568 0.0009  -0.0035 0.0040  42   LEU A CB  
397  C CG  . LEU A 58  ? 0.2736 0.2442 0.2985 -0.0007 -0.0015 0.0000  42   LEU A CG  
398  C CD1 . LEU A 58  ? 0.2754 0.2488 0.3146 -0.0022 -0.0072 -0.0016 42   LEU A CD1 
399  C CD2 . LEU A 58  ? 0.2969 0.2747 0.3283 -0.0008 0.0051  0.0005  42   LEU A CD2 
400  N N   . SER A 59  ? 0.2154 0.1720 0.2264 -0.0005 -0.0153 -0.0024 43   SER A N   
401  C CA  . SER A 59  ? 0.2185 0.1801 0.2332 -0.0011 -0.0146 -0.0052 43   SER A CA  
402  C C   . SER A 59  ? 0.2416 0.2163 0.2744 -0.0025 -0.0108 -0.0076 43   SER A C   
403  O O   . SER A 59  ? 0.2393 0.2173 0.2836 -0.0033 -0.0124 -0.0076 43   SER A O   
404  C CB  . SER A 59  ? 0.2477 0.2025 0.2615 -0.0017 -0.0233 -0.0054 43   SER A CB  
405  O OG  . SER A 59  ? 0.3596 0.3007 0.3540 0.0002  -0.0272 -0.0038 43   SER A OG  
406  N N   . LEU A 60  ? 0.1920 0.1732 0.2261 -0.0025 -0.0057 -0.0096 44   LEU A N   
407  C CA  . LEU A 60  ? 0.1766 0.1689 0.2245 -0.0033 -0.0017 -0.0121 44   LEU A CA  
408  C C   . LEU A 60  ? 0.2242 0.2191 0.2745 -0.0039 -0.0023 -0.0135 44   LEU A C   
409  O O   . LEU A 60  ? 0.2150 0.2065 0.2550 -0.0034 -0.0015 -0.0133 44   LEU A O   
410  C CB  . LEU A 60  ? 0.1851 0.1824 0.2314 -0.0025 0.0051  -0.0129 44   LEU A CB  
411  C CG  . LEU A 60  ? 0.2567 0.2517 0.3006 -0.0020 0.0067  -0.0107 44   LEU A CG  
412  C CD1 . LEU A 60  ? 0.2801 0.2669 0.3082 -0.0006 0.0080  -0.0078 44   LEU A CD1 
413  C CD2 . LEU A 60  ? 0.2751 0.2776 0.3264 -0.0019 0.0117  -0.0122 44   LEU A CD2 
414  N N   . THR A 61  ? 0.1913 0.1922 0.2556 -0.0048 -0.0033 -0.0145 45   THR A N   
415  C CA  . THR A 61  ? 0.1927 0.1965 0.2615 -0.0057 -0.0037 -0.0149 45   THR A CA  
416  C C   . THR A 61  ? 0.2329 0.2470 0.3122 -0.0055 0.0023  -0.0169 45   THR A C   
417  O O   . THR A 61  ? 0.2013 0.2200 0.2906 -0.0050 0.0036  -0.0179 45   THR A O   
418  C CB  . THR A 61  ? 0.2300 0.2297 0.3057 -0.0069 -0.0114 -0.0132 45   THR A CB  
419  O OG1 . THR A 61  ? 0.2140 0.2024 0.2775 -0.0065 -0.0175 -0.0116 45   THR A OG1 
420  C CG2 . THR A 61  ? 0.2068 0.2094 0.2891 -0.0080 -0.0123 -0.0127 45   THR A CG2 
421  N N   . GLY A 62  ? 0.1944 0.2111 0.2706 -0.0056 0.0055  -0.0175 46   GLY A N   
422  C CA  . GLY A 62  ? 0.1969 0.2220 0.2801 -0.0052 0.0112  -0.0191 46   GLY A CA  
423  C C   . GLY A 62  ? 0.2361 0.2628 0.3232 -0.0063 0.0109  -0.0177 46   GLY A C   
424  O O   . GLY A 62  ? 0.2135 0.2345 0.2942 -0.0073 0.0068  -0.0163 46   GLY A O   
425  N N   . THR A 63  ? 0.2108 0.2447 0.3087 -0.0060 0.0148  -0.0178 47   THR A N   
426  C CA  . THR A 63  ? 0.2073 0.2439 0.3115 -0.0072 0.0152  -0.0157 47   THR A CA  
427  C C   . THR A 63  ? 0.2537 0.2982 0.3632 -0.0059 0.0229  -0.0163 47   THR A C   
428  O O   . THR A 63  ? 0.2372 0.2852 0.3498 -0.0039 0.0268  -0.0184 47   THR A O   
429  C CB  . THR A 63  ? 0.2765 0.3118 0.3935 -0.0087 0.0092  -0.0128 47   THR A CB  
430  O OG1 . THR A 63  ? 0.2928 0.3296 0.4155 -0.0102 0.0086  -0.0102 47   THR A OG1 
431  C CG2 . THR A 63  ? 0.2537 0.2948 0.3855 -0.0076 0.0111  -0.0130 47   THR A CG2 
432  N N   . ASP A 64  ? 0.2399 0.2862 0.3499 -0.0068 0.0249  -0.0144 48   ASP A N   
433  C CA  . ASP A 64  ? 0.2439 0.2969 0.3585 -0.0055 0.0324  -0.0140 48   ASP A CA  
434  C C   . ASP A 64  ? 0.2926 0.3490 0.4217 -0.0072 0.0318  -0.0096 48   ASP A C   
435  O O   . ASP A 64  ? 0.2928 0.3543 0.4263 -0.0066 0.0380  -0.0078 48   ASP A O   
436  C CB  . ASP A 64  ? 0.2590 0.3111 0.3603 -0.0050 0.0360  -0.0153 48   ASP A CB  
437  C CG  . ASP A 64  ? 0.2820 0.3303 0.3781 -0.0072 0.0324  -0.0131 48   ASP A CG  
438  O OD1 . ASP A 64  ? 0.2680 0.3130 0.3692 -0.0092 0.0263  -0.0109 48   ASP A OD1 
439  O OD2 . ASP A 64  ? 0.2956 0.3434 0.3824 -0.0069 0.0351  -0.0138 48   ASP A OD2 
440  N N   . LEU A 65  ? 0.2518 0.3046 0.3883 -0.0092 0.0241  -0.0076 49   LEU A N   
441  C CA  . LEU A 65  ? 0.2606 0.3148 0.4124 -0.0115 0.0206  -0.0030 49   LEU A CA  
442  C C   . LEU A 65  ? 0.3109 0.3610 0.4577 -0.0138 0.0170  -0.0008 49   LEU A C   
443  O O   . LEU A 65  ? 0.3078 0.3560 0.4655 -0.0161 0.0108  0.0027  49   LEU A O   
444  C CB  . LEU A 65  ? 0.2607 0.3241 0.4306 -0.0105 0.0273  -0.0003 49   LEU A CB  
445  C CG  . LEU A 65  ? 0.3209 0.3880 0.4986 -0.0080 0.0299  -0.0024 49   LEU A CG  
446  C CD1 . LEU A 65  ? 0.3366 0.4129 0.5318 -0.0064 0.0378  0.0006  49   LEU A CD1 
447  C CD2 . LEU A 65  ? 0.3168 0.3789 0.5004 -0.0093 0.0203  -0.0023 49   LEU A CD2 
448  N N   . GLU A 66  ? 0.2566 0.3046 0.3877 -0.0132 0.0199  -0.0027 50   GLU A N   
449  C CA  . GLU A 66  ? 0.2605 0.3039 0.3845 -0.0150 0.0167  -0.0013 50   GLU A CA  
450  C C   . GLU A 66  ? 0.2743 0.3077 0.3851 -0.0151 0.0089  -0.0037 50   GLU A C   
451  O O   . GLU A 66  ? 0.2572 0.2840 0.3679 -0.0168 0.0013  -0.0021 50   GLU A O   
452  C CB  . GLU A 66  ? 0.2829 0.3290 0.3967 -0.0138 0.0240  -0.0022 50   GLU A CB  
453  C CG  . GLU A 66  ? 0.4937 0.5347 0.5996 -0.0154 0.0207  -0.0010 50   GLU A CG  
454  C CD  . GLU A 66  ? 0.7169 0.7581 0.8097 -0.0142 0.0257  -0.0027 50   GLU A CD  
455  O OE1 . GLU A 66  ? 0.3541 0.3895 0.4336 -0.0136 0.0229  -0.0055 50   GLU A OE1 
456  O OE2 . GLU A 66  ? 0.5471 0.5937 0.6430 -0.0139 0.0321  -0.0008 50   GLU A OE2 
457  N N   . VAL A 67  ? 0.2289 0.2609 0.3283 -0.0131 0.0111  -0.0073 51   VAL A N   
458  C CA  . VAL A 67  ? 0.2262 0.2495 0.3120 -0.0125 0.0060  -0.0094 51   VAL A CA  
459  C C   . VAL A 67  ? 0.2534 0.2757 0.3408 -0.0115 0.0044  -0.0107 51   VAL A C   
460  O O   . VAL A 67  ? 0.2357 0.2646 0.3308 -0.0106 0.0091  -0.0115 51   VAL A O   
461  C CB  . VAL A 67  ? 0.2848 0.3061 0.3551 -0.0111 0.0096  -0.0118 51   VAL A CB  
462  C CG1 . VAL A 67  ? 0.2790 0.3005 0.3474 -0.0120 0.0105  -0.0105 51   VAL A CG1 
463  C CG2 . VAL A 67  ? 0.2873 0.3144 0.3559 -0.0093 0.0164  -0.0143 51   VAL A CG2 
464  N N   . GLU A 68  ? 0.2166 0.2300 0.2959 -0.0114 -0.0021 -0.0110 52   GLU A N   
465  C CA  . GLU A 68  ? 0.1998 0.2106 0.2779 -0.0105 -0.0041 -0.0119 52   GLU A CA  
466  C C   . GLU A 68  ? 0.2560 0.2590 0.3161 -0.0090 -0.0047 -0.0134 52   GLU A C   
467  O O   . GLU A 68  ? 0.2708 0.2663 0.3212 -0.0089 -0.0087 -0.0131 52   GLU A O   
468  C CB  . GLU A 68  ? 0.2205 0.2266 0.3070 -0.0118 -0.0125 -0.0099 52   GLU A CB  
469  C CG  . GLU A 68  ? 0.2854 0.2886 0.3709 -0.0108 -0.0148 -0.0105 52   GLU A CG  
470  C CD  . GLU A 68  ? 0.4063 0.4009 0.4942 -0.0118 -0.0250 -0.0088 52   GLU A CD  
471  O OE1 . GLU A 68  ? 0.3693 0.3672 0.4718 -0.0125 -0.0273 -0.0076 52   GLU A OE1 
472  O OE2 . GLU A 68  ? 0.3374 0.3215 0.4127 -0.0116 -0.0311 -0.0086 52   GLU A OE2 
473  N N   . LEU A 69  ? 0.1992 0.2042 0.2554 -0.0076 -0.0005 -0.0149 53   LEU A N   
474  C CA  . LEU A 69  ? 0.2037 0.2025 0.2449 -0.0059 0.0001  -0.0156 53   LEU A CA  
475  C C   . LEU A 69  ? 0.2362 0.2312 0.2761 -0.0053 -0.0021 -0.0151 53   LEU A C   
476  O O   . LEU A 69  ? 0.2280 0.2289 0.2769 -0.0054 0.0003  -0.0156 53   LEU A O   
477  C CB  . LEU A 69  ? 0.2058 0.2100 0.2434 -0.0049 0.0074  -0.0172 53   LEU A CB  
478  C CG  . LEU A 69  ? 0.2771 0.2761 0.3013 -0.0030 0.0092  -0.0173 53   LEU A CG  
479  C CD1 . LEU A 69  ? 0.2946 0.2837 0.3063 -0.0021 0.0051  -0.0166 53   LEU A CD1 
480  C CD2 . LEU A 69  ? 0.3055 0.3104 0.3293 -0.0023 0.0154  -0.0187 53   LEU A CD2 
481  N N   . VAL A 70  ? 0.2045 0.1890 0.2324 -0.0043 -0.0068 -0.0141 54   VAL A N   
482  C CA  . VAL A 70  ? 0.2021 0.1810 0.2255 -0.0035 -0.0092 -0.0130 54   VAL A CA  
483  C C   . VAL A 70  ? 0.2681 0.2429 0.2769 -0.0012 -0.0046 -0.0128 54   VAL A C   
484  O O   . VAL A 70  ? 0.2760 0.2447 0.2726 0.0002  -0.0048 -0.0129 54   VAL A O   
485  C CB  . VAL A 70  ? 0.2475 0.2159 0.2676 -0.0038 -0.0187 -0.0116 54   VAL A CB  
486  C CG1 . VAL A 70  ? 0.2419 0.2043 0.2568 -0.0028 -0.0209 -0.0102 54   VAL A CG1 
487  C CG2 . VAL A 70  ? 0.2405 0.2133 0.2774 -0.0061 -0.0233 -0.0112 54   VAL A CG2 
488  N N   . GLY A 71  ? 0.2092 0.1874 0.2200 -0.0007 -0.0004 -0.0122 55   GLY A N   
489  C CA  . GLY A 71  ? 0.2117 0.1868 0.2115 0.0013  0.0043  -0.0110 55   GLY A CA  
490  C C   . GLY A 71  ? 0.2882 0.2557 0.2820 0.0022  0.0016  -0.0085 55   GLY A C   
491  O O   . GLY A 71  ? 0.2931 0.2621 0.2961 0.0008  -0.0017 -0.0081 55   GLY A O   
492  N N   . ARG A 72  ? 0.2511 0.2098 0.2290 0.0047  0.0030  -0.0067 56   ARG A N   
493  C CA  . ARG A 72  ? 0.2793 0.2288 0.2481 0.0059  0.0007  -0.0037 56   ARG A CA  
494  C C   . ARG A 72  ? 0.3332 0.2834 0.2971 0.0077  0.0083  -0.0009 56   ARG A C   
495  O O   . ARG A 72  ? 0.3180 0.2702 0.2775 0.0094  0.0144  -0.0010 56   ARG A O   
496  C CB  . ARG A 72  ? 0.3064 0.2416 0.2576 0.0080  -0.0054 -0.0034 56   ARG A CB  
497  C CG  . ARG A 72  ? 0.3441 0.2763 0.3013 0.0060  -0.0151 -0.0047 56   ARG A CG  
498  C CD  . ARG A 72  ? 0.4148 0.3315 0.3537 0.0082  -0.0221 -0.0048 56   ARG A CD  
499  N NE  . ARG A 72  ? 0.4216 0.3376 0.3542 0.0094  -0.0203 -0.0068 56   ARG A NE  
500  C CZ  . ARG A 72  ? 0.5716 0.4921 0.5142 0.0072  -0.0238 -0.0089 56   ARG A CZ  
501  N NH1 . ARG A 72  ? 0.3712 0.2977 0.3311 0.0040  -0.0286 -0.0091 56   ARG A NH1 
502  N NH2 . ARG A 72  ? 0.3672 0.2861 0.3031 0.0085  -0.0222 -0.0105 56   ARG A NH2 
503  N N   . VAL A 73  ? 0.2985 0.2467 0.2639 0.0075  0.0079  0.0019  57   VAL A N   
504  C CA  . VAL A 73  ? 0.3125 0.2605 0.2740 0.0090  0.0149  0.0058  57   VAL A CA  
505  C C   . VAL A 73  ? 0.3577 0.2954 0.3098 0.0100  0.0117  0.0095  57   VAL A C   
506  O O   . VAL A 73  ? 0.3355 0.2723 0.2944 0.0080  0.0051  0.0092  57   VAL A O   
507  C CB  . VAL A 73  ? 0.3547 0.3155 0.3337 0.0072  0.0203  0.0057  57   VAL A CB  
508  C CG1 . VAL A 73  ? 0.3405 0.3073 0.3356 0.0043  0.0157  0.0040  57   VAL A CG1 
509  C CG2 . VAL A 73  ? 0.3588 0.3193 0.3356 0.0087  0.0273  0.0105  57   VAL A CG2 
510  N N   . VAL A 74  ? 0.3477 0.2770 0.2831 0.0133  0.0164  0.0132  58   VAL A N   
511  C CA  . VAL A 74  ? 0.3811 0.2992 0.3043 0.0149  0.0146  0.0175  58   VAL A CA  
512  C C   . VAL A 74  ? 0.4063 0.3318 0.3431 0.0131  0.0190  0.0213  58   VAL A C   
513  O O   . VAL A 74  ? 0.4237 0.3576 0.3682 0.0132  0.0271  0.0229  58   VAL A O   
514  C CB  . VAL A 74  ? 0.4687 0.3738 0.3668 0.0198  0.0186  0.0202  58   VAL A CB  
515  C CG1 . VAL A 74  ? 0.4858 0.3787 0.3698 0.0217  0.0174  0.0252  58   VAL A CG1 
516  C CG2 . VAL A 74  ? 0.4778 0.3745 0.3627 0.0216  0.0129  0.0160  58   VAL A CG2 
517  N N   . LEU A 75  ? 0.3326 0.2554 0.2741 0.0113  0.0129  0.0226  59   LEU A N   
518  C CA  . LEU A 75  ? 0.3243 0.2522 0.2784 0.0094  0.0151  0.0262  59   LEU A CA  
519  C C   . LEU A 75  ? 0.4320 0.3499 0.3706 0.0121  0.0196  0.0330  59   LEU A C   
520  O O   . LEU A 75  ? 0.4347 0.3393 0.3557 0.0140  0.0149  0.0346  59   LEU A O   
521  C CB  . LEU A 75  ? 0.3117 0.2407 0.2781 0.0065  0.0060  0.0243  59   LEU A CB  
522  C CG  . LEU A 75  ? 0.3282 0.2676 0.3114 0.0041  0.0025  0.0181  59   LEU A CG  
523  C CD1 . LEU A 75  ? 0.3344 0.2726 0.3269 0.0022  -0.0064 0.0166  59   LEU A CD1 
524  C CD2 . LEU A 75  ? 0.3178 0.2707 0.3181 0.0026  0.0087  0.0168  59   LEU A CD2 
525  N N   . GLU A 76  ? 0.4172 0.3414 0.3624 0.0124  0.0286  0.0372  60   GLU A N   
526  C CA  . GLU A 76  ? 0.4541 0.3710 0.3874 0.0150  0.0353  0.0448  60   GLU A CA  
527  C C   . GLU A 76  ? 0.5148 0.4281 0.4527 0.0130  0.0310  0.0490  60   GLU A C   
528  O O   . GLU A 76  ? 0.5263 0.4278 0.4474 0.0154  0.0320  0.0544  60   GLU A O   
529  C CB  . GLU A 76  ? 0.4724 0.3989 0.4149 0.0157  0.0465  0.0480  60   GLU A CB  
530  C CG  . GLU A 76  ? 0.7070 0.6323 0.6502 0.0166  0.0542  0.0567  60   GLU A CG  
531  C CD  . GLU A 76  ? 1.0587 0.9974 1.0232 0.0149  0.0616  0.0592  60   GLU A CD  
532  O OE1 . GLU A 76  ? 1.0209 0.9654 0.9875 0.0163  0.0667  0.0570  60   GLU A OE1 
533  O OE2 . GLU A 76  ? 0.9809 0.9239 0.9605 0.0123  0.0617  0.0635  60   GLU A OE2 
534  N N   . ASP A 77  ? 0.4628 0.3855 0.4226 0.0090  0.0261  0.0465  61   ASP A N   
535  C CA  . ASP A 77  ? 0.4707 0.3913 0.4384 0.0069  0.0216  0.0500  61   ASP A CA  
536  C C   . ASP A 77  ? 0.5177 0.4319 0.4830 0.0058  0.0100  0.0462  61   ASP A C   
537  O O   . ASP A 77  ? 0.4900 0.4056 0.4555 0.0056  0.0053  0.0401  61   ASP A O   
538  C CB  . ASP A 77  ? 0.4836 0.4175 0.4772 0.0035  0.0230  0.0496  61   ASP A CB  
539  C CG  . ASP A 77  ? 0.6403 0.5830 0.6419 0.0039  0.0327  0.0519  61   ASP A CG  
540  O OD1 . ASP A 77  ? 0.6578 0.5964 0.6494 0.0062  0.0406  0.0584  61   ASP A OD1 
541  O OD2 . ASP A 77  ? 0.6875 0.6411 0.7058 0.0020  0.0324  0.0473  61   ASP A OD2 
542  N N   . ALA A 78  ? 0.4863 0.3937 0.4511 0.0050  0.0053  0.0503  62   ALA A N   
543  C CA  . ALA A 78  ? 0.4935 0.3947 0.4587 0.0039  -0.0061 0.0477  62   ALA A CA  
544  C C   . ALA A 78  ? 0.5122 0.4252 0.4991 0.0012  -0.0107 0.0406  62   ALA A C   
545  O O   . ALA A 78  ? 0.5051 0.4298 0.5096 -0.0005 -0.0068 0.0392  62   ALA A O   
546  C CB  . ALA A 78  ? 0.5167 0.4116 0.4830 0.0029  -0.0093 0.0536  62   ALA A CB  
547  N N   . ALA A 79  ? 0.4489 0.3586 0.4336 0.0011  -0.0187 0.0360  63   ALA A N   
548  C CA  . ALA A 79  ? 0.4132 0.3332 0.4166 -0.0008 -0.0226 0.0296  63   ALA A CA  
549  C C   . ALA A 79  ? 0.4569 0.3714 0.4643 -0.0016 -0.0335 0.0280  63   ALA A C   
550  O O   . ALA A 79  ? 0.4797 0.3815 0.4713 -0.0004 -0.0392 0.0300  63   ALA A O   
551  C CB  . ALA A 79  ? 0.4091 0.3335 0.4088 0.0001  -0.0194 0.0252  63   ALA A CB  
552  N N   . GLU A 80  ? 0.3750 0.2986 0.4035 -0.0035 -0.0365 0.0244  64   GLU A N   
553  C CA  . GLU A 80  ? 0.3644 0.2854 0.4017 -0.0043 -0.0463 0.0225  64   GLU A CA  
554  C C   . GLU A 80  ? 0.3774 0.3033 0.4187 -0.0042 -0.0477 0.0174  64   GLU A C   
555  O O   . GLU A 80  ? 0.3278 0.2651 0.3789 -0.0045 -0.0417 0.0138  64   GLU A O   
556  C CB  . GLU A 80  ? 0.3760 0.3047 0.4346 -0.0057 -0.0479 0.0213  64   GLU A CB  
557  C CG  . GLU A 80  ? 0.5923 0.5122 0.6498 -0.0061 -0.0537 0.0259  64   GLU A CG  
558  C CD  . GLU A 80  ? 0.8827 0.7949 0.9417 -0.0062 -0.0647 0.0257  64   GLU A CD  
559  O OE1 . GLU A 80  ? 0.8449 0.7638 0.9231 -0.0069 -0.0687 0.0220  64   GLU A OE1 
560  O OE2 . GLU A 80  ? 0.7772 0.6763 0.8183 -0.0054 -0.0695 0.0292  64   GLU A OE2 
561  N N   . PRO A 81  ? 0.3536 0.2708 0.3878 -0.0039 -0.0558 0.0172  65   PRO A N   
562  C CA  . PRO A 81  ? 0.3337 0.2558 0.3731 -0.0041 -0.0569 0.0131  65   PRO A CA  
563  C C   . PRO A 81  ? 0.3323 0.2664 0.3963 -0.0054 -0.0578 0.0093  65   PRO A C   
564  O O   . PRO A 81  ? 0.2990 0.2350 0.3759 -0.0059 -0.0609 0.0097  65   PRO A O   
565  C CB  . PRO A 81  ? 0.3775 0.2855 0.4036 -0.0035 -0.0668 0.0145  65   PRO A CB  
566  C CG  . PRO A 81  ? 0.4418 0.3402 0.4646 -0.0035 -0.0731 0.0184  65   PRO A CG  
567  C CD  . PRO A 81  ? 0.3884 0.2903 0.4093 -0.0033 -0.0646 0.0210  65   PRO A CD  
568  N N   . GLY A 82  ? 0.2822 0.2242 0.3520 -0.0055 -0.0546 0.0059  66   GLY A N   
569  C CA  . GLY A 82  ? 0.2653 0.2188 0.3569 -0.0062 -0.0539 0.0025  66   GLY A CA  
570  C C   . GLY A 82  ? 0.2888 0.2511 0.3826 -0.0061 -0.0473 -0.0007 66   GLY A C   
571  O O   . GLY A 82  ? 0.2804 0.2406 0.3599 -0.0056 -0.0432 -0.0004 66   GLY A O   
572  N N   . GLU A 83  ? 0.2367 0.2087 0.3485 -0.0062 -0.0462 -0.0034 67   GLU A N   
573  C CA  . GLU A 83  ? 0.2484 0.2291 0.3638 -0.0061 -0.0400 -0.0061 67   GLU A CA  
574  C C   . GLU A 83  ? 0.2683 0.2602 0.4001 -0.0053 -0.0347 -0.0092 67   GLU A C   
575  O O   . GLU A 83  ? 0.2656 0.2586 0.4098 -0.0049 -0.0376 -0.0094 67   GLU A O   
576  C CB  . GLU A 83  ? 0.2802 0.2587 0.3972 -0.0069 -0.0449 -0.0056 67   GLU A CB  
577  C CG  . GLU A 83  ? 0.4702 0.4455 0.6001 -0.0076 -0.0540 -0.0042 67   GLU A CG  
578  C CD  . GLU A 83  ? 0.7259 0.6994 0.8601 -0.0086 -0.0595 -0.0034 67   GLU A CD  
579  O OE1 . GLU A 83  ? 0.4300 0.3998 0.5508 -0.0089 -0.0588 -0.0033 67   GLU A OE1 
580  O OE2 . GLU A 83  ? 0.5965 0.5728 0.7490 -0.0092 -0.0645 -0.0027 67   GLU A OE2 
581  N N   . ILE A 84  ? 0.2051 0.2042 0.3358 -0.0047 -0.0269 -0.0117 68   ILE A N   
582  C CA  . ILE A 84  ? 0.1902 0.1988 0.3329 -0.0032 -0.0210 -0.0151 68   ILE A CA  
583  C C   . ILE A 84  ? 0.2186 0.2330 0.3569 -0.0028 -0.0141 -0.0171 68   ILE A C   
584  O O   . ILE A 84  ? 0.2063 0.2174 0.3316 -0.0036 -0.0132 -0.0160 68   ILE A O   
585  C CB  . ILE A 84  ? 0.2368 0.2448 0.3789 -0.0025 -0.0197 -0.0159 68   ILE A CB  
586  C CG1 . ILE A 84  ? 0.2515 0.2665 0.4079 -0.0005 -0.0167 -0.0195 68   ILE A CG1 
587  C CG2 . ILE A 84  ? 0.2312 0.2381 0.3598 -0.0027 -0.0152 -0.0157 68   ILE A CG2 
588  C CD1 . ILE A 84  ? 0.2843 0.3002 0.4560 0.0002  -0.0211 -0.0194 68   ILE A CD1 
589  N N   . THR A 85  ? 0.1688 0.1912 0.3169 -0.0012 -0.0089 -0.0201 69   THR A N   
590  C CA  . THR A 85  ? 0.1582 0.1856 0.3011 -0.0005 -0.0021 -0.0222 69   THR A CA  
591  C C   . THR A 85  ? 0.2026 0.2331 0.3465 0.0015  0.0023  -0.0257 69   THR A C   
592  O O   . THR A 85  ? 0.1761 0.2079 0.3298 0.0031  0.0015  -0.0272 69   THR A O   
593  C CB  . THR A 85  ? 0.1978 0.2307 0.3481 -0.0003 0.0005  -0.0221 69   THR A CB  
594  O OG1 . THR A 85  ? 0.2208 0.2601 0.3836 0.0021  0.0045  -0.0244 69   THR A OG1 
595  C CG2 . THR A 85  ? 0.1755 0.2047 0.3292 -0.0024 -0.0059 -0.0186 69   THR A CG2 
596  N N   . VAL A 86  ? 0.1790 0.2102 0.3130 0.0017  0.0064  -0.0270 70   VAL A N   
597  C CA  . VAL A 86  ? 0.1886 0.2213 0.3216 0.0034  0.0094  -0.0303 70   VAL A CA  
598  C C   . VAL A 86  ? 0.2126 0.2486 0.3385 0.0043  0.0148  -0.0323 70   VAL A C   
599  O O   . VAL A 86  ? 0.1876 0.2230 0.3062 0.0028  0.0155  -0.0304 70   VAL A O   
600  C CB  . VAL A 86  ? 0.2483 0.2760 0.3765 0.0022  0.0062  -0.0286 70   VAL A CB  
601  C CG1 . VAL A 86  ? 0.2402 0.2651 0.3563 0.0005  0.0070  -0.0260 70   VAL A CG1 
602  C CG2 . VAL A 86  ? 0.2536 0.2818 0.3847 0.0038  0.0070  -0.0317 70   VAL A CG2 
603  N N   . PRO A 87  ? 0.2004 0.2387 0.3270 0.0068  0.0182  -0.0363 71   PRO A N   
604  C CA  . PRO A 87  ? 0.1952 0.2352 0.3134 0.0076  0.0226  -0.0380 71   PRO A CA  
605  C C   . PRO A 87  ? 0.2238 0.2614 0.3323 0.0054  0.0218  -0.0361 71   PRO A C   
606  O O   . PRO A 87  ? 0.2014 0.2361 0.3085 0.0047  0.0194  -0.0355 71   PRO A O   
607  C CB  . PRO A 87  ? 0.2224 0.2622 0.3411 0.0107  0.0240  -0.0426 71   PRO A CB  
608  C CG  . PRO A 87  ? 0.2913 0.3316 0.4210 0.0124  0.0226  -0.0435 71   PRO A CG  
609  C CD  . PRO A 87  ? 0.2275 0.2658 0.3613 0.0094  0.0177  -0.0395 71   PRO A CD  
610  N N   . ALA A 88  ? 0.2031 0.2418 0.3061 0.0044  0.0237  -0.0345 72   ALA A N   
611  C CA  . ALA A 88  ? 0.1992 0.2355 0.2933 0.0026  0.0232  -0.0324 72   ALA A CA  
612  C C   . ALA A 88  ? 0.2293 0.2652 0.3184 0.0033  0.0245  -0.0344 72   ALA A C   
613  O O   . ALA A 88  ? 0.2063 0.2398 0.2934 0.0023  0.0229  -0.0327 72   ALA A O   
614  C CB  . ALA A 88  ? 0.2113 0.2486 0.3012 0.0017  0.0247  -0.0308 72   ALA A CB  
615  N N   . ARG A 89  ? 0.2100 0.2479 0.2972 0.0052  0.0273  -0.0375 73   ARG A N   
616  C CA  . ARG A 89  ? 0.2127 0.2495 0.2951 0.0059  0.0274  -0.0396 73   ARG A CA  
617  C C   . ARG A 89  ? 0.2477 0.2822 0.3350 0.0063  0.0242  -0.0407 73   ARG A C   
618  O O   . ARG A 89  ? 0.2464 0.2794 0.3325 0.0052  0.0227  -0.0396 73   ARG A O   
619  C CB  . ARG A 89  ? 0.2471 0.2850 0.3249 0.0082  0.0305  -0.0428 73   ARG A CB  
620  C CG  . ARG A 89  ? 0.4520 0.4876 0.5242 0.0092  0.0295  -0.0452 73   ARG A CG  
621  C CD  . ARG A 89  ? 0.7102 0.7457 0.7767 0.0073  0.0297  -0.0430 73   ARG A CD  
622  N NE  . ARG A 89  ? 0.9048 0.9379 0.9681 0.0081  0.0278  -0.0450 73   ARG A NE  
623  C CZ  . ARG A 89  ? 1.1041 1.1370 1.1625 0.0073  0.0279  -0.0440 73   ARG A CZ  
624  N NH1 . ARG A 89  ? 0.9562 0.9908 1.0115 0.0059  0.0302  -0.0412 73   ARG A NH1 
625  N NH2 . ARG A 89  ? 0.9170 0.9474 0.9741 0.0081  0.0252  -0.0459 73   ARG A NH2 
626  N N   . LYS A 90  ? 0.2033 0.2376 0.2971 0.0077  0.0230  -0.0425 74   LYS A N   
627  C CA  . LYS A 90  ? 0.2039 0.2356 0.3038 0.0080  0.0192  -0.0436 74   LYS A CA  
628  C C   . LYS A 90  ? 0.2387 0.2691 0.3410 0.0052  0.0170  -0.0389 74   LYS A C   
629  O O   . LYS A 90  ? 0.2022 0.2309 0.3060 0.0044  0.0151  -0.0380 74   LYS A O   
630  C CB  . LYS A 90  ? 0.2382 0.2698 0.3447 0.0102  0.0186  -0.0461 74   LYS A CB  
631  C CG  . LYS A 90  ? 0.2747 0.3057 0.3784 0.0139  0.0203  -0.0513 74   LYS A CG  
632  C CD  . LYS A 90  ? 0.3297 0.3617 0.4399 0.0164  0.0215  -0.0531 74   LYS A CD  
633  C CE  . LYS A 90  ? 0.3868 0.4179 0.4924 0.0209  0.0247  -0.0581 74   LYS A CE  
634  N NZ  . LYS A 90  ? 0.3217 0.3550 0.4347 0.0236  0.0273  -0.0591 74   LYS A NZ  
635  N N   . LEU A 91  ? 0.2089 0.2395 0.3109 0.0038  0.0173  -0.0356 75   LEU A N   
636  C CA  . LEU A 91  ? 0.2005 0.2287 0.3022 0.0017  0.0157  -0.0310 75   LEU A CA  
637  C C   . LEU A 91  ? 0.2351 0.2631 0.3307 0.0008  0.0177  -0.0289 75   LEU A C   
638  O O   . LEU A 91  ? 0.2208 0.2473 0.3187 -0.0001 0.0170  -0.0263 75   LEU A O   
639  C CB  . LEU A 91  ? 0.1997 0.2264 0.2999 0.0007  0.0149  -0.0280 75   LEU A CB  
640  C CG  . LEU A 91  ? 0.2462 0.2686 0.3440 -0.0008 0.0132  -0.0232 75   LEU A CG  
641  C CD1 . LEU A 91  ? 0.2394 0.2601 0.3452 -0.0010 0.0103  -0.0225 75   LEU A CD1 
642  C CD2 . LEU A 91  ? 0.2652 0.2846 0.3589 -0.0015 0.0114  -0.0208 75   LEU A CD2 
643  N N   . MET A 92  ? 0.2153 0.2450 0.3043 0.0011  0.0203  -0.0299 76   MET A N   
644  C CA  . MET A 92  ? 0.2163 0.2460 0.3000 0.0005  0.0223  -0.0283 76   MET A CA  
645  C C   . MET A 92  ? 0.2303 0.2604 0.3185 0.0009  0.0212  -0.0297 76   MET A C   
646  O O   . MET A 92  ? 0.2194 0.2489 0.3095 0.0000  0.0215  -0.0265 76   MET A O   
647  C CB  . MET A 92  ? 0.2441 0.2753 0.3207 0.0009  0.0247  -0.0294 76   MET A CB  
648  C CG  . MET A 92  ? 0.2989 0.3298 0.3704 0.0005  0.0265  -0.0276 76   MET A CG  
649  S SD  . MET A 92  ? 0.3674 0.3999 0.4317 0.0010  0.0285  -0.0295 76   MET A SD  
650  N N   . ASP A 93  ? 0.2017 0.2323 0.2918 0.0024  0.0199  -0.0342 77   ASP A N   
651  C CA  . ASP A 93  ? 0.2118 0.2413 0.3056 0.0030  0.0173  -0.0363 77   ASP A CA  
652  C C   . ASP A 93  ? 0.2355 0.2635 0.3385 0.0020  0.0143  -0.0341 77   ASP A C   
653  O O   . ASP A 93  ? 0.2253 0.2531 0.3327 0.0011  0.0130  -0.0324 77   ASP A O   
654  C CB  . ASP A 93  ? 0.2390 0.2676 0.3305 0.0055  0.0163  -0.0419 77   ASP A CB  
655  C CG  . ASP A 93  ? 0.3236 0.3532 0.4060 0.0065  0.0192  -0.0437 77   ASP A CG  
656  O OD1 . ASP A 93  ? 0.3071 0.3382 0.3858 0.0051  0.0212  -0.0409 77   ASP A OD1 
657  O OD2 . ASP A 93  ? 0.3286 0.3572 0.4071 0.0089  0.0197  -0.0476 77   ASP A OD2 
658  N N   . ILE A 94  ? 0.1971 0.2243 0.3040 0.0018  0.0132  -0.0334 78   ILE A N   
659  C CA  . ILE A 94  ? 0.2016 0.2270 0.3172 0.0006  0.0103  -0.0305 78   ILE A CA  
660  C C   . ILE A 94  ? 0.2274 0.2532 0.3430 -0.0013 0.0128  -0.0242 78   ILE A C   
661  O O   . ILE A 94  ? 0.2334 0.2591 0.3560 -0.0023 0.0116  -0.0218 78   ILE A O   
662  C CB  . ILE A 94  ? 0.2335 0.2575 0.3523 0.0010  0.0087  -0.0309 78   ILE A CB  
663  C CG1 . ILE A 94  ? 0.2391 0.2623 0.3604 0.0035  0.0063  -0.0370 78   ILE A CG1 
664  C CG2 . ILE A 94  ? 0.2601 0.2820 0.3863 -0.0008 0.0064  -0.0262 78   ILE A CG2 
665  C CD1 . ILE A 94  ? 0.2694 0.2925 0.3930 0.0045  0.0060  -0.0381 78   ILE A CD1 
666  N N   . CYS A 95  ? 0.2038 0.2296 0.3116 -0.0017 0.0161  -0.0216 79   CYS A N   
667  C CA  A CYS A 95  ? 0.1967 0.2218 0.3011 -0.0026 0.0193  -0.0159 79   CYS A CA  
668  C CA  B CYS A 95  ? 0.2214 0.2466 0.3268 -0.0026 0.0191  -0.0159 79   CYS A CA  
669  C C   . CYS A 95  ? 0.2515 0.2789 0.3578 -0.0027 0.0214  -0.0148 79   CYS A C   
670  O O   . CYS A 95  ? 0.2416 0.2690 0.3535 -0.0034 0.0227  -0.0102 79   CYS A O   
671  C CB  A CYS A 95  ? 0.1884 0.2121 0.2819 -0.0023 0.0216  -0.0150 79   CYS A CB  
672  C CB  B CYS A 95  ? 0.2384 0.2616 0.3335 -0.0025 0.0212  -0.0141 79   CYS A CB  
673  S SG  A CYS A 95  ? 0.2351 0.2557 0.3211 -0.0023 0.0258  -0.0084 79   CYS A SG  
674  S SG  B CYS A 95  ? 0.2963 0.3164 0.3929 -0.0027 0.0176  -0.0141 79   CYS A SG  
675  N N   . LYS A 96  ? 0.2251 0.2541 0.3271 -0.0018 0.0217  -0.0187 80   LYS A N   
676  C CA  . LYS A 96  ? 0.2433 0.2742 0.3465 -0.0017 0.0230  -0.0183 80   LYS A CA  
677  C C   . LYS A 96  ? 0.2869 0.3181 0.4027 -0.0024 0.0194  -0.0180 80   LYS A C   
678  O O   . LYS A 96  ? 0.2667 0.2994 0.3889 -0.0030 0.0207  -0.0141 80   LYS A O   
679  C CB  . LYS A 96  ? 0.2663 0.2981 0.3624 -0.0006 0.0228  -0.0232 80   LYS A CB  
680  C CG  . LYS A 96  ? 0.6053 0.6385 0.7004 -0.0004 0.0242  -0.0227 80   LYS A CG  
681  C CD  . LYS A 96  ? 0.7892 0.8226 0.8751 0.0006  0.0247  -0.0265 80   LYS A CD  
682  C CE  . LYS A 96  ? 0.9937 1.0280 1.0789 0.0009  0.0252  -0.0262 80   LYS A CE  
683  N NZ  . LYS A 96  ? 1.1268 1.1605 1.2183 0.0011  0.0207  -0.0287 80   LYS A NZ  
684  N N   . SER A 97  ? 0.2491 0.2787 0.3691 -0.0021 0.0147  -0.0218 81   SER A N   
685  C CA  . SER A 97  ? 0.2439 0.2723 0.3753 -0.0025 0.0096  -0.0224 81   SER A CA  
686  C C   . SER A 97  ? 0.2956 0.3239 0.4382 -0.0043 0.0093  -0.0165 81   SER A C   
687  O O   . SER A 97  ? 0.2900 0.3180 0.4443 -0.0052 0.0055  -0.0154 81   SER A O   
688  C CB  . SER A 97  ? 0.2702 0.2956 0.4007 -0.0010 0.0048  -0.0287 81   SER A CB  
689  O OG  . SER A 97  ? 0.3063 0.3306 0.4387 -0.0012 0.0044  -0.0280 81   SER A OG  
690  N N   . LEU A 98  ? 0.2413 0.2693 0.3805 -0.0048 0.0127  -0.0127 82   LEU A N   
691  C CA  . LEU A 98  ? 0.2430 0.2704 0.3915 -0.0063 0.0129  -0.0065 82   LEU A CA  
692  C C   . LEU A 98  ? 0.2850 0.3150 0.4400 -0.0072 0.0169  -0.0002 82   LEU A C   
693  O O   . LEU A 98  ? 0.2667 0.2987 0.4153 -0.0063 0.0208  -0.0003 82   LEU A O   
694  C CB  . LEU A 98  ? 0.2364 0.2615 0.3786 -0.0064 0.0147  -0.0041 82   LEU A CB  
695  C CG  . LEU A 98  ? 0.2876 0.3102 0.4292 -0.0059 0.0101  -0.0088 82   LEU A CG  
696  C CD1 . LEU A 98  ? 0.2821 0.3027 0.4152 -0.0057 0.0120  -0.0070 82   LEU A CD1 
697  C CD2 . LEU A 98  ? 0.3259 0.3467 0.4808 -0.0068 0.0046  -0.0086 82   LEU A CD2 
698  N N   . PRO A 99  ? 0.2649 0.2951 0.4336 -0.0088 0.0160  0.0053  83   PRO A N   
699  C CA  . PRO A 99  ? 0.2751 0.3086 0.4520 -0.0093 0.0206  0.0118  83   PRO A CA  
700  C C   . PRO A 99  ? 0.3377 0.3716 0.5030 -0.0081 0.0292  0.0164  83   PRO A C   
701  O O   . PRO A 99  ? 0.3227 0.3534 0.4774 -0.0076 0.0309  0.0172  83   PRO A O   
702  C CB  . PRO A 99  ? 0.3024 0.3356 0.4961 -0.0114 0.0181  0.0174  83   PRO A CB  
703  C CG  . PRO A 99  ? 0.3519 0.3814 0.5471 -0.0118 0.0105  0.0124  83   PRO A CG  
704  C CD  . PRO A 99  ? 0.2871 0.3147 0.4654 -0.0101 0.0110  0.0063  83   PRO A CD  
705  N N   . ASN A 100 ? 0.3043 0.3414 0.4712 -0.0073 0.0341  0.0192  84   ASN A N   
706  C CA  . ASN A 100 ? 0.2991 0.3359 0.4544 -0.0055 0.0426  0.0234  84   ASN A CA  
707  C C   . ASN A 100 ? 0.3092 0.3432 0.4624 -0.0054 0.0471  0.0304  84   ASN A C   
708  O O   . ASN A 100 ? 0.2807 0.3153 0.4475 -0.0072 0.0455  0.0348  84   ASN A O   
709  C CB  . ASN A 100 ? 0.3591 0.4003 0.5213 -0.0046 0.0471  0.0262  84   ASN A CB  
710  C CG  . ASN A 100 ? 0.6742 0.7172 0.8359 -0.0043 0.0429  0.0195  84   ASN A CG  
711  O OD1 . ASN A 100 ? 0.6060 0.6470 0.7537 -0.0034 0.0413  0.0136  84   ASN A OD1 
712  N ND2 . ASN A 100 ? 0.5872 0.6338 0.7646 -0.0051 0.0407  0.0208  84   ASN A ND2 
713  N N   . ASP A 101 ? 0.2923 0.3223 0.4276 -0.0034 0.0517  0.0311  85   ASP A N   
714  C CA  . ASP A 101 ? 0.3156 0.3408 0.4431 -0.0026 0.0562  0.0374  85   ASP A CA  
715  C C   . ASP A 101 ? 0.3624 0.3839 0.4917 -0.0044 0.0508  0.0377  85   ASP A C   
716  O O   . ASP A 101 ? 0.3812 0.3982 0.5043 -0.0039 0.0541  0.0435  85   ASP A O   
717  C CB  . ASP A 101 ? 0.3576 0.3852 0.4931 -0.0017 0.0646  0.0465  85   ASP A CB  
718  C CG  . ASP A 101 ? 0.5339 0.5656 0.6707 0.0002  0.0699  0.0466  85   ASP A CG  
719  O OD1 . ASP A 101 ? 0.5400 0.5693 0.6606 0.0026  0.0719  0.0429  85   ASP A OD1 
720  O OD2 . ASP A 101 ? 0.6930 0.7305 0.8482 -0.0007 0.0716  0.0506  85   ASP A OD2 
721  N N   . VAL A 102 ? 0.2910 0.3136 0.4278 -0.0062 0.0426  0.0316  86   VAL A N   
722  C CA  . VAL A 102 ? 0.2760 0.2953 0.4161 -0.0078 0.0371  0.0315  86   VAL A CA  
723  C C   . VAL A 102 ? 0.3160 0.3291 0.4390 -0.0066 0.0365  0.0302  86   VAL A C   
724  O O   . VAL A 102 ? 0.3038 0.3159 0.4142 -0.0051 0.0371  0.0260  86   VAL A O   
725  C CB  . VAL A 102 ? 0.3088 0.3303 0.4613 -0.0093 0.0289  0.0252  86   VAL A CB  
726  C CG1 . VAL A 102 ? 0.2881 0.3090 0.4307 -0.0083 0.0252  0.0166  86   VAL A CG1 
727  C CG2 . VAL A 102 ? 0.3087 0.3278 0.4719 -0.0111 0.0241  0.0276  86   VAL A CG2 
728  N N   . LEU A 103 ? 0.2970 0.3057 0.4204 -0.0074 0.0349  0.0343  87   LEU A N   
729  C CA  . LEU A 103 ? 0.3055 0.3076 0.4151 -0.0067 0.0326  0.0334  87   LEU A CA  
730  C C   . LEU A 103 ? 0.3392 0.3421 0.4542 -0.0076 0.0246  0.0261  87   LEU A C   
731  O O   . LEU A 103 ? 0.3389 0.3437 0.4681 -0.0092 0.0203  0.0253  87   LEU A O   
732  C CB  . LEU A 103 ? 0.3215 0.3180 0.4292 -0.0070 0.0341  0.0414  87   LEU A CB  
733  C CG  . LEU A 103 ? 0.3992 0.3871 0.4908 -0.0060 0.0313  0.0415  87   LEU A CG  
734  C CD1 . LEU A 103 ? 0.4116 0.3955 0.4835 -0.0033 0.0353  0.0406  87   LEU A CD1 
735  C CD2 . LEU A 103 ? 0.4595 0.4414 0.5499 -0.0064 0.0325  0.0497  87   LEU A CD2 
736  N N   . ILE A 104 ? 0.2827 0.2843 0.3872 -0.0065 0.0228  0.0209  88   ILE A N   
737  C CA  . ILE A 104 ? 0.2561 0.2589 0.3653 -0.0069 0.0165  0.0142  88   ILE A CA  
738  C C   . ILE A 104 ? 0.2927 0.2895 0.3965 -0.0069 0.0125  0.0150  88   ILE A C   
739  O O   . ILE A 104 ? 0.2878 0.2796 0.3779 -0.0059 0.0137  0.0170  88   ILE A O   
740  C CB  . ILE A 104 ? 0.2699 0.2764 0.3746 -0.0059 0.0171  0.0078  88   ILE A CB  
741  C CG1 . ILE A 104 ? 0.2631 0.2749 0.3724 -0.0058 0.0206  0.0071  88   ILE A CG1 
742  C CG2 . ILE A 104 ? 0.2401 0.2481 0.3504 -0.0058 0.0118  0.0013  88   ILE A CG2 
743  C CD1 . ILE A 104 ? 0.2635 0.2782 0.3661 -0.0047 0.0217  0.0015  88   ILE A CD1 
744  N N   . ASP A 105 ? 0.2380 0.2346 0.3523 -0.0078 0.0071  0.0133  89   ASP A N   
745  C CA  . ASP A 105 ? 0.2417 0.2330 0.3536 -0.0078 0.0021  0.0136  89   ASP A CA  
746  C C   . ASP A 105 ? 0.2858 0.2799 0.4008 -0.0070 -0.0014 0.0064  89   ASP A C   
747  O O   . ASP A 105 ? 0.2657 0.2644 0.3910 -0.0068 -0.0029 0.0016  89   ASP A O   
748  C CB  . ASP A 105 ? 0.2611 0.2497 0.3830 -0.0091 -0.0014 0.0173  89   ASP A CB  
749  C CG  . ASP A 105 ? 0.3187 0.3007 0.4369 -0.0091 -0.0065 0.0187  89   ASP A CG  
750  O OD1 . ASP A 105 ? 0.3394 0.3224 0.4633 -0.0087 -0.0113 0.0136  89   ASP A OD1 
751  O OD2 . ASP A 105 ? 0.3743 0.3499 0.4839 -0.0093 -0.0057 0.0251  89   ASP A OD2 
752  N N   . ILE A 106 ? 0.2326 0.2236 0.3384 -0.0064 -0.0028 0.0057  90   ILE A N   
753  C CA  . ILE A 106 ? 0.2119 0.2059 0.3213 -0.0056 -0.0055 -0.0002 90   ILE A CA  
754  C C   . ILE A 106 ? 0.2568 0.2459 0.3672 -0.0057 -0.0113 0.0006  90   ILE A C   
755  O O   . ILE A 106 ? 0.2405 0.2230 0.3403 -0.0058 -0.0128 0.0044  90   ILE A O   
756  C CB  . ILE A 106 ? 0.2432 0.2398 0.3437 -0.0049 -0.0019 -0.0025 90   ILE A CB  
757  C CG1 . ILE A 106 ? 0.2541 0.2564 0.3568 -0.0047 0.0029  -0.0044 90   ILE A CG1 
758  C CG2 . ILE A 106 ? 0.2429 0.2418 0.3470 -0.0042 -0.0045 -0.0070 90   ILE A CG2 
759  C CD1 . ILE A 106 ? 0.2852 0.2892 0.3785 -0.0041 0.0069  -0.0054 90   ILE A CD1 
760  N N   . ARG A 107 ? 0.2281 0.2198 0.3511 -0.0053 -0.0149 -0.0030 91   ARG A N   
761  C CA  . ARG A 107 ? 0.2485 0.2361 0.3750 -0.0053 -0.0209 -0.0024 91   ARG A CA  
762  C C   . ARG A 107 ? 0.2789 0.2716 0.4172 -0.0040 -0.0225 -0.0079 91   ARG A C   
763  O O   . ARG A 107 ? 0.2602 0.2584 0.4061 -0.0029 -0.0201 -0.0121 91   ARG A O   
764  C CB  . ARG A 107 ? 0.3002 0.2821 0.4301 -0.0062 -0.0248 0.0020  91   ARG A CB  
765  C CG  . ARG A 107 ? 0.5067 0.4917 0.6507 -0.0060 -0.0260 -0.0003 91   ARG A CG  
766  C CD  . ARG A 107 ? 0.7075 0.6865 0.8538 -0.0073 -0.0295 0.0051  91   ARG A CD  
767  N NE  . ARG A 107 ? 0.8427 0.8206 0.9829 -0.0085 -0.0250 0.0101  91   ARG A NE  
768  C CZ  . ARG A 107 ? 1.0351 1.0076 1.1746 -0.0098 -0.0261 0.0166  91   ARG A CZ  
769  N NH1 . ARG A 107 ? 0.9552 0.9222 1.0986 -0.0102 -0.0322 0.0186  91   ARG A NH1 
770  N NH2 . ARG A 107 ? 0.8314 0.8039 0.9667 -0.0106 -0.0209 0.0215  91   ARG A NH2 
771  N N   . VAL A 108 ? 0.2345 0.2251 0.3746 -0.0039 -0.0268 -0.0078 92   VAL A N   
772  C CA  . VAL A 108 ? 0.2308 0.2263 0.3843 -0.0024 -0.0282 -0.0121 92   VAL A CA  
773  C C   . VAL A 108 ? 0.3080 0.3007 0.4720 -0.0021 -0.0333 -0.0116 92   VAL A C   
774  O O   . VAL A 108 ? 0.3086 0.2942 0.4693 -0.0034 -0.0383 -0.0072 92   VAL A O   
775  C CB  . VAL A 108 ? 0.2780 0.2737 0.4321 -0.0024 -0.0304 -0.0122 92   VAL A CB  
776  C CG1 . VAL A 108 ? 0.2823 0.2845 0.4523 -0.0004 -0.0301 -0.0163 92   VAL A CG1 
777  C CG2 . VAL A 108 ? 0.2653 0.2625 0.4080 -0.0028 -0.0260 -0.0122 92   VAL A CG2 
778  N N   . GLU A 109 ? 0.2833 0.2807 0.4588 -0.0002 -0.0321 -0.0161 93   GLU A N   
779  C CA  . GLU A 109 ? 0.3072 0.3025 0.4944 0.0006  -0.0369 -0.0167 93   GLU A CA  
780  C C   . GLU A 109 ? 0.3542 0.3551 0.5536 0.0036  -0.0359 -0.0218 93   GLU A C   
781  O O   . GLU A 109 ? 0.3275 0.3334 0.5287 0.0058  -0.0310 -0.0266 93   GLU A O   
782  C CB  . GLU A 109 ? 0.3318 0.3261 0.5202 0.0006  -0.0362 -0.0172 93   GLU A CB  
783  C CG  . GLU A 109 ? 0.5434 0.5323 0.7224 -0.0022 -0.0369 -0.0110 93   GLU A CG  
784  C CD  . GLU A 109 ? 0.9198 0.9031 1.1046 -0.0032 -0.0420 -0.0076 93   GLU A CD  
785  O OE1 . GLU A 109 ? 0.8758 0.8598 1.0728 -0.0017 -0.0450 -0.0110 93   GLU A OE1 
786  O OE2 . GLU A 109 ? 0.8275 0.8056 1.0043 -0.0054 -0.0426 -0.0013 93   GLU A OE2 
787  N N   . GLU A 110 ? 0.3376 0.3376 0.5448 0.0037  -0.0403 -0.0207 94   GLU A N   
788  C CA  . GLU A 110 ? 0.3366 0.3424 0.5574 0.0066  -0.0388 -0.0245 94   GLU A CA  
789  C C   . GLU A 110 ? 0.3482 0.3602 0.5645 0.0071  -0.0323 -0.0261 94   GLU A C   
790  O O   . GLU A 110 ? 0.3488 0.3593 0.5581 0.0049  -0.0334 -0.0229 94   GLU A O   
791  N N   . GLN A 111 ? 0.2700 0.2878 0.4888 0.0101  -0.0258 -0.0310 95   GLN A N   
792  C CA  . GLN A 111 ? 0.2425 0.2660 0.4568 0.0108  -0.0191 -0.0325 95   GLN A CA  
793  C C   . GLN A 111 ? 0.2691 0.2928 0.4702 0.0106  -0.0144 -0.0343 95   GLN A C   
794  O O   . GLN A 111 ? 0.2502 0.2785 0.4478 0.0121  -0.0084 -0.0367 95   GLN A O   
795  C CB  . GLN A 111 ? 0.2479 0.2778 0.4748 0.0148  -0.0146 -0.0361 95   GLN A CB  
796  C CG  . GLN A 111 ? 0.2542 0.2851 0.4967 0.0150  -0.0188 -0.0340 95   GLN A CG  
797  C CD  . GLN A 111 ? 0.3634 0.4011 0.6188 0.0195  -0.0128 -0.0375 95   GLN A CD  
798  O OE1 . GLN A 111 ? 0.3069 0.3447 0.5656 0.0233  -0.0105 -0.0417 95   GLN A OE1 
799  N NE2 . GLN A 111 ? 0.2450 0.2882 0.5077 0.0195  -0.0098 -0.0356 95   GLN A NE2 
800  N N   . LYS A 112 ? 0.2240 0.2429 0.4189 0.0090  -0.0173 -0.0330 96   LYS A N   
801  C CA  . LYS A 112 ? 0.2268 0.2457 0.4112 0.0086  -0.0137 -0.0343 96   LYS A CA  
802  C C   . LYS A 112 ? 0.2557 0.2712 0.4290 0.0051  -0.0148 -0.0294 96   LYS A C   
803  O O   . LYS A 112 ? 0.2452 0.2561 0.4181 0.0031  -0.0194 -0.0251 96   LYS A O   
804  C CB  . LYS A 112 ? 0.2590 0.2754 0.4467 0.0102  -0.0154 -0.0372 96   LYS A CB  
805  C CG  . LYS A 112 ? 0.4435 0.4619 0.6405 0.0146  -0.0143 -0.0429 96   LYS A CG  
806  C CD  . LYS A 112 ? 0.5779 0.6008 0.7701 0.0176  -0.0073 -0.0473 96   LYS A CD  
807  C CE  . LYS A 112 ? 0.7450 0.7690 0.9448 0.0228  -0.0053 -0.0527 96   LYS A CE  
808  N NZ  . LYS A 112 ? 0.8593 0.8783 1.0591 0.0249  -0.0084 -0.0567 96   LYS A NZ  
809  N N   . LEU A 113 ? 0.2131 0.2303 0.3771 0.0047  -0.0105 -0.0300 97   LEU A N   
810  C CA  . LEU A 113 ? 0.2050 0.2190 0.3586 0.0020  -0.0105 -0.0256 97   LEU A CA  
811  C C   . LEU A 113 ? 0.2485 0.2611 0.4022 0.0017  -0.0106 -0.0257 97   LEU A C   
812  O O   . LEU A 113 ? 0.2497 0.2648 0.4035 0.0032  -0.0081 -0.0296 97   LEU A O   
813  C CB  . LEU A 113 ? 0.1995 0.2160 0.3433 0.0015  -0.0061 -0.0254 97   LEU A CB  
814  C CG  . LEU A 113 ? 0.2588 0.2713 0.3917 -0.0007 -0.0061 -0.0206 97   LEU A CG  
815  C CD1 . LEU A 113 ? 0.2533 0.2608 0.3829 -0.0019 -0.0101 -0.0168 97   LEU A CD1 
816  C CD2 . LEU A 113 ? 0.3079 0.3230 0.4319 -0.0008 -0.0012 -0.0213 97   LEU A CD2 
817  N N   . LEU A 114 ? 0.2110 0.2188 0.3652 0.0000  -0.0140 -0.0214 98   LEU A N   
818  C CA  . LEU A 114 ? 0.2338 0.2398 0.3902 -0.0008 -0.0148 -0.0200 98   LEU A CA  
819  C C   . LEU A 114 ? 0.2682 0.2738 0.4153 -0.0026 -0.0113 -0.0159 98   LEU A C   
820  O O   . LEU A 114 ? 0.2479 0.2503 0.3878 -0.0039 -0.0111 -0.0110 98   LEU A O   
821  C CB  . LEU A 114 ? 0.2621 0.2633 0.4254 -0.0018 -0.0201 -0.0167 98   LEU A CB  
822  C CG  . LEU A 114 ? 0.3704 0.3711 0.5459 -0.0001 -0.0240 -0.0207 98   LEU A CG  
823  C CD1 . LEU A 114 ? 0.3777 0.3810 0.5582 0.0026  -0.0243 -0.0256 98   LEU A CD1 
824  C CD2 . LEU A 114 ? 0.4370 0.4323 0.6181 -0.0017 -0.0292 -0.0161 98   LEU A CD2 
825  N N   . VAL A 115 ? 0.2265 0.2349 0.3733 -0.0023 -0.0087 -0.0179 99   VAL A N   
826  C CA  . VAL A 115 ? 0.2298 0.2388 0.3701 -0.0036 -0.0049 -0.0143 99   VAL A CA  
827  C C   . VAL A 115 ? 0.2912 0.2989 0.4398 -0.0048 -0.0067 -0.0119 99   VAL A C   
828  O O   . VAL A 115 ? 0.2956 0.3040 0.4520 -0.0038 -0.0094 -0.0161 99   VAL A O   
829  C CB  . VAL A 115 ? 0.2711 0.2843 0.4057 -0.0026 -0.0010 -0.0182 99   VAL A CB  
830  C CG1 . VAL A 115 ? 0.2643 0.2782 0.3936 -0.0037 0.0027  -0.0146 99   VAL A CG1 
831  C CG2 . VAL A 115 ? 0.2685 0.2831 0.3972 -0.0017 0.0003  -0.0202 99   VAL A CG2 
832  N N   . LYS A 116 ? 0.2434 0.2486 0.3904 -0.0066 -0.0054 -0.0050 100  LYS A N   
833  C CA  . LYS A 116 ? 0.2380 0.2424 0.3945 -0.0080 -0.0067 -0.0011 100  LYS A CA  
834  C C   . LYS A 116 ? 0.2871 0.2927 0.4393 -0.0091 -0.0013 0.0046  100  LYS A C   
835  O O   . LYS A 116 ? 0.2602 0.2640 0.4015 -0.0090 0.0025  0.0083  100  LYS A O   
836  C CB  . LYS A 116 ? 0.2646 0.2642 0.4262 -0.0091 -0.0106 0.0032  100  LYS A CB  
837  C CG  . LYS A 116 ? 0.5550 0.5532 0.7247 -0.0080 -0.0166 -0.0020 100  LYS A CG  
838  C CD  . LYS A 116 ? 0.7778 0.7713 0.9553 -0.0094 -0.0211 0.0026  100  LYS A CD  
839  C CE  . LYS A 116 ? 0.9824 0.9716 1.1525 -0.0098 -0.0217 0.0067  100  LYS A CE  
840  N NZ  . LYS A 116 ? 1.0954 1.0820 1.2567 -0.0113 -0.0173 0.0148  100  LYS A NZ  
841  N N   . ALA A 117 ? 0.2533 0.2615 0.4142 -0.0097 -0.0010 0.0050  101  ALA A N   
842  C CA  . ALA A 117 ? 0.2553 0.2655 0.4158 -0.0106 0.0043  0.0107  101  ALA A CA  
843  C C   . ALA A 117 ? 0.3163 0.3274 0.4931 -0.0121 0.0013  0.0129  101  ALA A C   
844  O O   . ALA A 117 ? 0.2979 0.3104 0.4816 -0.0117 -0.0029 0.0073  101  ALA A O   
845  C CB  . ALA A 117 ? 0.2551 0.2689 0.4079 -0.0093 0.0080  0.0070  101  ALA A CB  
846  N N   . GLY A 118 ? 0.2979 0.3076 0.4808 -0.0138 0.0029  0.0209  102  GLY A N   
847  C CA  . GLY A 118 ? 0.3093 0.3195 0.5098 -0.0157 -0.0005 0.0243  102  GLY A CA  
848  C C   . GLY A 118 ? 0.3576 0.3648 0.5662 -0.0157 -0.0092 0.0187  102  GLY A C   
849  O O   . GLY A 118 ? 0.3618 0.3655 0.5664 -0.0153 -0.0115 0.0179  102  GLY A O   
850  N N   . ARG A 119 ? 0.3279 0.3360 0.5468 -0.0157 -0.0144 0.0142  103  ARG A N   
851  C CA  . ARG A 119 ? 0.3270 0.3313 0.5531 -0.0150 -0.0230 0.0080  103  ARG A CA  
852  C C   . ARG A 119 ? 0.3544 0.3587 0.5707 -0.0119 -0.0246 -0.0022 103  ARG A C   
853  O O   . ARG A 119 ? 0.3482 0.3494 0.5692 -0.0105 -0.0313 -0.0086 103  ARG A O   
854  C CB  . ARG A 119 ? 0.3621 0.3652 0.6063 -0.0169 -0.0291 0.0102  103  ARG A CB  
855  C CG  . ARG A 119 ? 0.4901 0.4922 0.7461 -0.0198 -0.0287 0.0202  103  ARG A CG  
856  N N   . SER A 120 ? 0.2763 0.2836 0.4787 -0.0107 -0.0184 -0.0035 104  SER A N   
857  C CA  . SER A 120 ? 0.2752 0.2831 0.4676 -0.0079 -0.0184 -0.0118 104  SER A CA  
858  C C   . SER A 120 ? 0.3020 0.3088 0.4873 -0.0068 -0.0174 -0.0132 104  SER A C   
859  O O   . SER A 120 ? 0.2874 0.2940 0.4687 -0.0081 -0.0142 -0.0076 104  SER A O   
860  C CB  . SER A 120 ? 0.3180 0.3299 0.5012 -0.0075 -0.0127 -0.0121 104  SER A CB  
861  O OG  . SER A 120 ? 0.4740 0.4874 0.6651 -0.0089 -0.0131 -0.0092 104  SER A OG  
862  N N   . ARG A 121 ? 0.2540 0.2594 0.4380 -0.0042 -0.0204 -0.0205 105  ARG A N   
863  C CA  . ARG A 121 ? 0.2451 0.2500 0.4249 -0.0028 -0.0200 -0.0224 105  ARG A CA  
864  C C   . ARG A 121 ? 0.2755 0.2823 0.4480 0.0003  -0.0181 -0.0296 105  ARG A C   
865  O O   . ARG A 121 ? 0.2760 0.2815 0.4494 0.0024  -0.0204 -0.0352 105  ARG A O   
866  C CB  . ARG A 121 ? 0.2555 0.2562 0.4451 -0.0026 -0.0259 -0.0229 105  ARG A CB  
867  C CG  . ARG A 121 ? 0.4418 0.4403 0.6366 -0.0056 -0.0269 -0.0147 105  ARG A CG  
868  N N   . PHE A 122 ? 0.2150 0.2241 0.3797 0.0006  -0.0140 -0.0292 106  PHE A N   
869  C CA  . PHE A 122 ? 0.2132 0.2248 0.3718 0.0034  -0.0112 -0.0350 106  PHE A CA  
870  C C   . PHE A 122 ? 0.2606 0.2726 0.4201 0.0044  -0.0110 -0.0353 106  PHE A C   
871  O O   . PHE A 122 ? 0.2546 0.2661 0.4133 0.0023  -0.0110 -0.0303 106  PHE A O   
872  C CB  . PHE A 122 ? 0.2277 0.2427 0.3765 0.0029  -0.0062 -0.0342 106  PHE A CB  
873  C CG  . PHE A 122 ? 0.2534 0.2683 0.4022 0.0018  -0.0063 -0.0332 106  PHE A CG  
874  C CD1 . PHE A 122 ? 0.2769 0.2918 0.4281 -0.0010 -0.0057 -0.0267 106  PHE A CD1 
875  C CD2 . PHE A 122 ? 0.2885 0.3032 0.4351 0.0038  -0.0071 -0.0384 106  PHE A CD2 
876  C CE1 . PHE A 122 ? 0.2926 0.3080 0.4464 -0.0020 -0.0059 -0.0253 106  PHE A CE1 
877  C CE2 . PHE A 122 ? 0.3186 0.3329 0.4666 0.0027  -0.0082 -0.0373 106  PHE A CE2 
878  C CZ  . PHE A 122 ? 0.2793 0.2945 0.4322 -0.0003 -0.0077 -0.0307 106  PHE A CZ  
879  N N   . THR A 123 ? 0.2246 0.2372 0.3857 0.0077  -0.0108 -0.0410 107  THR A N   
880  C CA  . THR A 123 ? 0.2288 0.2427 0.3932 0.0089  -0.0104 -0.0416 107  THR A CA  
881  C C   . THR A 123 ? 0.2496 0.2677 0.4080 0.0110  -0.0051 -0.0446 107  THR A C   
882  O O   . THR A 123 ? 0.2211 0.2394 0.3772 0.0140  -0.0033 -0.0497 107  THR A O   
883  C CB  . THR A 123 ? 0.3227 0.3338 0.4965 0.0115  -0.0144 -0.0452 107  THR A CB  
884  O OG1 . THR A 123 ? 0.2928 0.3000 0.4727 0.0091  -0.0196 -0.0413 107  THR A OG1 
885  C CG2 . THR A 123 ? 0.3341 0.3474 0.5132 0.0136  -0.0134 -0.0465 107  THR A CG2 
886  N N   . LEU A 124 ? 0.2060 0.2267 0.3611 0.0093  -0.0027 -0.0413 108  LEU A N   
887  C CA  . LEU A 124 ? 0.2021 0.2269 0.3527 0.0107  0.0023  -0.0432 108  LEU A CA  
888  C C   . LEU A 124 ? 0.2265 0.2535 0.3847 0.0119  0.0026  -0.0431 108  LEU A C   
889  O O   . LEU A 124 ? 0.2160 0.2412 0.3798 0.0103  -0.0013 -0.0399 108  LEU A O   
890  C CB  . LEU A 124 ? 0.2083 0.2342 0.3498 0.0080  0.0046  -0.0395 108  LEU A CB  
891  C CG  . LEU A 124 ? 0.2779 0.3030 0.4121 0.0070  0.0056  -0.0394 108  LEU A CG  
892  C CD1 . LEU A 124 ? 0.2830 0.3084 0.4097 0.0044  0.0072  -0.0349 108  LEU A CD1 
893  C CD2 . LEU A 124 ? 0.3098 0.3367 0.4395 0.0096  0.0089  -0.0441 108  LEU A CD2 
894  N N   . SER A 125 ? 0.1909 0.2219 0.3495 0.0147  0.0074  -0.0461 109  SER A N   
895  C CA  . SER A 125 ? 0.1840 0.2184 0.3518 0.0161  0.0088  -0.0457 109  SER A CA  
896  C C   . SER A 125 ? 0.2456 0.2812 0.4119 0.0126  0.0079  -0.0407 109  SER A C   
897  O O   . SER A 125 ? 0.2180 0.2525 0.3743 0.0102  0.0084  -0.0388 109  SER A O   
898  C CB  . SER A 125 ? 0.2239 0.2623 0.3909 0.0200  0.0156  -0.0494 109  SER A CB  
899  O OG  . SER A 125 ? 0.3264 0.3669 0.4837 0.0188  0.0195  -0.0484 109  SER A OG  
900  N N   . THR A 126 ? 0.2095 0.2464 0.3860 0.0123  0.0060  -0.0387 110  THR A N   
901  C CA  . THR A 126 ? 0.2039 0.2406 0.3795 0.0093  0.0037  -0.0342 110  THR A CA  
902  C C   . THR A 126 ? 0.2386 0.2802 0.4253 0.0103  0.0057  -0.0335 110  THR A C   
903  O O   . THR A 126 ? 0.2016 0.2469 0.3989 0.0135  0.0085  -0.0359 110  THR A O   
904  C CB  . THR A 126 ? 0.2480 0.2787 0.4247 0.0067  -0.0039 -0.0307 110  THR A CB  
905  O OG1 . THR A 126 ? 0.2398 0.2709 0.4306 0.0081  -0.0072 -0.0309 110  THR A OG1 
906  C CG2 . THR A 126 ? 0.2450 0.2707 0.4126 0.0054  -0.0059 -0.0300 110  THR A CG2 
907  N N   . LEU A 127 ? 0.1984 0.2399 0.3834 0.0077  0.0040  -0.0300 111  LEU A N   
908  C CA  . LEU A 127 ? 0.1946 0.2400 0.3925 0.0076  0.0038  -0.0278 111  LEU A CA  
909  C C   . LEU A 127 ? 0.2573 0.2970 0.4541 0.0042  -0.0046 -0.0237 111  LEU A C   
910  O O   . LEU A 127 ? 0.2334 0.2677 0.4156 0.0021  -0.0067 -0.0224 111  LEU A O   
911  C CB  . LEU A 127 ? 0.1851 0.2364 0.3824 0.0084  0.0108  -0.0279 111  LEU A CB  
912  C CG  . LEU A 127 ? 0.2302 0.2869 0.4295 0.0126  0.0194  -0.0318 111  LEU A CG  
913  C CD1 . LEU A 127 ? 0.2381 0.2991 0.4333 0.0129  0.0260  -0.0310 111  LEU A CD1 
914  C CD2 . LEU A 127 ? 0.2461 0.3066 0.4627 0.0159  0.0208  -0.0327 111  LEU A CD2 
915  N N   . PRO A 128 ? 0.2236 0.2631 0.4348 0.0038  -0.0098 -0.0215 112  PRO A N   
916  C CA  . PRO A 128 ? 0.2188 0.2509 0.4272 0.0008  -0.0190 -0.0177 112  PRO A CA  
917  C C   . PRO A 128 ? 0.2329 0.2631 0.4315 -0.0014 -0.0194 -0.0157 112  PRO A C   
918  O O   . PRO A 128 ? 0.2084 0.2449 0.4102 -0.0010 -0.0137 -0.0161 112  PRO A O   
919  C CB  . PRO A 128 ? 0.2513 0.2855 0.4803 0.0011  -0.0236 -0.0160 112  PRO A CB  
920  C CG  . PRO A 128 ? 0.3110 0.3523 0.5518 0.0047  -0.0172 -0.0192 112  PRO A CG  
921  C CD  . PRO A 128 ? 0.2503 0.2962 0.4812 0.0064  -0.0077 -0.0222 112  PRO A CD  
922  N N   . ALA A 129 ? 0.2161 0.2371 0.4022 -0.0035 -0.0263 -0.0135 113  ALA A N   
923  C CA  . ALA A 129 ? 0.2288 0.2454 0.4041 -0.0054 -0.0286 -0.0117 113  ALA A CA  
924  C C   . ALA A 129 ? 0.2796 0.2993 0.4702 -0.0064 -0.0317 -0.0096 113  ALA A C   
925  O O   . ALA A 129 ? 0.2497 0.2706 0.4374 -0.0074 -0.0301 -0.0088 113  ALA A O   
926  C CB  . ALA A 129 ? 0.2535 0.2581 0.4144 -0.0066 -0.0365 -0.0096 113  ALA A CB  
927  N N   . ASN A 130 ? 0.2384 0.2595 0.4469 -0.0061 -0.0362 -0.0084 114  ASN A N   
928  C CA  . ASN A 130 ? 0.2457 0.2705 0.4735 -0.0070 -0.0397 -0.0058 114  ASN A CA  
929  C C   . ASN A 130 ? 0.2931 0.3293 0.5302 -0.0060 -0.0295 -0.0063 114  ASN A C   
930  O O   . ASN A 130 ? 0.3098 0.3484 0.5570 -0.0074 -0.0309 -0.0036 114  ASN A O   
931  C CB  . ASN A 130 ? 0.2983 0.3237 0.5447 -0.0063 -0.0451 -0.0048 114  ASN A CB  
932  C CG  . ASN A 130 ? 0.8508 0.8808 1.1206 -0.0072 -0.0486 -0.0017 114  ASN A CG  
933  O OD1 . ASN A 130 ? 0.8559 0.8965 1.1447 -0.0053 -0.0418 -0.0018 114  ASN A OD1 
934  N ND2 . ASN A 130 ? 0.7892 0.8112 1.0583 -0.0099 -0.0592 0.0013  114  ASN A ND2 
935  N N   . ASP A 131 ? 0.2389 0.2811 0.4717 -0.0035 -0.0196 -0.0096 115  ASP A N   
936  C CA  . ASP A 131 ? 0.2444 0.2961 0.4826 -0.0019 -0.0092 -0.0103 115  ASP A CA  
937  C C   . ASP A 131 ? 0.3035 0.3539 0.5256 -0.0033 -0.0061 -0.0102 115  ASP A C   
938  O O   . ASP A 131 ? 0.2893 0.3466 0.5154 -0.0025 0.0014  -0.0099 115  ASP A O   
939  C CB  . ASP A 131 ? 0.2706 0.3275 0.5090 0.0019  -0.0007 -0.0142 115  ASP A CB  
940  C CG  . ASP A 131 ? 0.3515 0.4126 0.6090 0.0044  -0.0005 -0.0146 115  ASP A CG  
941  O OD1 . ASP A 131 ? 0.3341 0.3954 0.6080 0.0031  -0.0066 -0.0113 115  ASP A OD1 
942  O OD2 . ASP A 131 ? 0.3358 0.3992 0.5918 0.0077  0.0051  -0.0183 115  ASP A OD2 
943  N N   . PHE A 132 ? 0.2608 0.3024 0.4648 -0.0050 -0.0113 -0.0105 116  PHE A N   
944  C CA  . PHE A 132 ? 0.2443 0.2841 0.4324 -0.0060 -0.0086 -0.0108 116  PHE A CA  
945  C C   . PHE A 132 ? 0.3251 0.3640 0.5179 -0.0083 -0.0123 -0.0075 116  PHE A C   
946  O O   . PHE A 132 ? 0.3221 0.3555 0.5209 -0.0100 -0.0215 -0.0051 116  PHE A O   
947  C CB  . PHE A 132 ? 0.2531 0.2839 0.4211 -0.0065 -0.0121 -0.0121 116  PHE A CB  
948  C CG  . PHE A 132 ? 0.2543 0.2846 0.4064 -0.0065 -0.0072 -0.0133 116  PHE A CG  
949  C CD1 . PHE A 132 ? 0.2781 0.3132 0.4251 -0.0047 0.0007  -0.0163 116  PHE A CD1 
950  C CD2 . PHE A 132 ? 0.2741 0.2981 0.4157 -0.0081 -0.0113 -0.0118 116  PHE A CD2 
951  C CE1 . PHE A 132 ? 0.2908 0.3252 0.4240 -0.0047 0.0044  -0.0173 116  PHE A CE1 
952  C CE2 . PHE A 132 ? 0.3059 0.3295 0.4336 -0.0079 -0.0068 -0.0130 116  PHE A CE2 
953  C CZ  . PHE A 132 ? 0.2752 0.3043 0.3994 -0.0063 0.0010  -0.0156 116  PHE A CZ  
954  N N   . PRO A 133 ? 0.3095 0.3528 0.4992 -0.0084 -0.0061 -0.0073 117  PRO A N   
955  C CA  . PRO A 133 ? 0.3259 0.3681 0.5211 -0.0108 -0.0100 -0.0038 117  PRO A CA  
956  C C   . PRO A 133 ? 0.4411 0.4716 0.6231 -0.0128 -0.0201 -0.0032 117  PRO A C   
957  O O   . PRO A 133 ? 0.4231 0.4471 0.5865 -0.0122 -0.0207 -0.0054 117  PRO A O   
958  C CB  . PRO A 133 ? 0.3436 0.3916 0.5336 -0.0103 -0.0009 -0.0042 117  PRO A CB  
959  C CG  . PRO A 133 ? 0.3955 0.4490 0.5826 -0.0073 0.0079  -0.0075 117  PRO A CG  
960  C CD  . PRO A 133 ? 0.3310 0.3796 0.5124 -0.0064 0.0039  -0.0100 117  PRO A CD  
961  N N   . THR A 134 ? 0.4479 0.4752 0.6401 -0.0150 -0.0280 0.0001  118  THR A N   
962  C CA  . THR A 134 ? 0.4719 0.4865 0.6514 -0.0165 -0.0386 0.0007  118  THR A CA  
963  C C   . THR A 134 ? 0.5349 0.5488 0.7138 -0.0182 -0.0395 0.0025  118  THR A C   
964  O O   . THR A 134 ? 0.5206 0.5433 0.7167 -0.0191 -0.0354 0.0051  118  THR A O   
965  C CB  . THR A 134 ? 0.6488 0.6569 0.8389 -0.0176 -0.0502 0.0027  118  THR A CB  
966  O OG1 . THR A 134 ? 0.6873 0.7028 0.9030 -0.0190 -0.0513 0.0062  118  THR A OG1 
967  C CG2 . THR A 134 ? 0.6399 0.6469 0.8286 -0.0159 -0.0505 0.0010  118  THR A CG2 
968  N N   . VAL A 135 ? 0.5213 0.5245 0.6807 -0.0183 -0.0444 0.0013  119  VAL A N   
969  C CA  . VAL A 135 ? 0.5315 0.5320 0.6889 -0.0199 -0.0469 0.0028  119  VAL A CA  
970  C C   . VAL A 135 ? 0.6288 0.6192 0.7923 -0.0218 -0.0609 0.0052  119  VAL A C   
971  O O   . VAL A 135 ? 0.6260 0.6042 0.7763 -0.0210 -0.0693 0.0039  119  VAL A O   
972  C CB  . VAL A 135 ? 0.5767 0.5720 0.7103 -0.0186 -0.0435 0.0000  119  VAL A CB  
973  C CG1 . VAL A 135 ? 0.5740 0.5657 0.7066 -0.0202 -0.0471 0.0016  119  VAL A CG1 
974  C CG2 . VAL A 135 ? 0.5633 0.5685 0.6930 -0.0169 -0.0308 -0.0021 119  VAL A CG2 
975  N N   . GLU A 136 ? 0.6280 0.6233 0.8122 -0.0241 -0.0633 0.0090  120  GLU A N   
976  C CA  . GLU A 136 ? 0.6535 0.6399 0.8474 -0.0264 -0.0773 0.0118  120  GLU A CA  
977  C C   . GLU A 136 ? 0.7487 0.7295 0.9355 -0.0277 -0.0807 0.0125  120  GLU A C   
978  O O   . GLU A 136 ? 0.7517 0.7386 0.9570 -0.0301 -0.0806 0.0164  120  GLU A O   
979  C CB  . GLU A 136 ? 0.6664 0.6627 0.8922 -0.0282 -0.0781 0.0162  120  GLU A CB  
980  N N   . GLU A 137 ? 0.7251 0.6947 0.8848 -0.0259 -0.0826 0.0089  121  GLU A N   
981  C CA  . GLU A 137 ? 0.7318 0.6942 0.8805 -0.0264 -0.0860 0.0085  121  GLU A CA  
982  C C   . GLU A 137 ? 0.7992 0.7476 0.9505 -0.0280 -0.1025 0.0100  121  GLU A C   
983  O O   . GLU A 137 ? 0.8098 0.7463 0.9517 -0.0268 -0.1119 0.0086  121  GLU A O   
984  C CB  . GLU A 137 ? 0.7514 0.7070 0.8707 -0.0232 -0.0814 0.0040  121  GLU A CB  
985  N N   . GLY A 138 ? 0.7532 0.7024 0.9170 -0.0305 -0.1064 0.0131  122  GLY A N   
986  C CA  . GLY A 138 ? 0.7594 0.6950 0.9276 -0.0324 -0.1229 0.0147  122  GLY A CA  
987  C C   . GLY A 138 ? 0.8006 0.7168 0.9386 -0.0297 -0.1317 0.0104  122  GLY A C   
988  O O   . GLY A 138 ? 0.7928 0.7072 0.9074 -0.0265 -0.1238 0.0064  122  GLY A O   
989  N N   . PRO A 139 ? 0.7608 0.6616 0.8982 -0.0307 -0.1481 0.0110  123  PRO A N   
990  C CA  . PRO A 139 ? 0.7733 0.6538 0.8795 -0.0273 -0.1565 0.0064  123  PRO A CA  
991  C C   . PRO A 139 ? 0.8023 0.6828 0.8919 -0.0256 -0.1486 0.0040  123  PRO A C   
992  O O   . PRO A 139 ? 0.7798 0.6721 0.8847 -0.0281 -0.1423 0.0066  123  PRO A O   
993  C CB  . PRO A 139 ? 0.8125 0.6781 0.9268 -0.0293 -0.1761 0.0081  123  PRO A CB  
994  C CG  . PRO A 139 ? 0.8614 0.7386 1.0095 -0.0332 -0.1785 0.0133  123  PRO A CG  
995  C CD  . PRO A 139 ? 0.7834 0.6835 0.9484 -0.0346 -0.1604 0.0158  123  PRO A CD  
996  N N   . GLY A 140 ? 0.7498 0.6173 0.8085 -0.0211 -0.1487 -0.0007 124  GLY A N   
997  C CA  . GLY A 140 ? 0.7324 0.5979 0.7729 -0.0187 -0.1418 -0.0036 124  GLY A CA  
998  C C   . GLY A 140 ? 0.7657 0.6166 0.8008 -0.0188 -0.1542 -0.0042 124  GLY A C   
999  O O   . GLY A 140 ? 0.7863 0.6178 0.8061 -0.0166 -0.1677 -0.0064 124  GLY A O   
1000 N N   . SER A 141 ? 0.6821 0.5415 0.7288 -0.0211 -0.1500 -0.0023 125  SER A N   
1001 C CA  . SER A 141 ? 0.6754 0.5228 0.7193 -0.0216 -0.1606 -0.0026 125  SER A CA  
1002 C C   . SER A 141 ? 0.6855 0.5162 0.6956 -0.0159 -0.1620 -0.0083 125  SER A C   
1003 O O   . SER A 141 ? 0.6983 0.5113 0.6987 -0.0147 -0.1754 -0.0101 125  SER A O   
1004 C CB  . SER A 141 ? 0.7149 0.5771 0.7783 -0.0252 -0.1530 0.0012  125  SER A CB  
1005 O OG  . SER A 141 ? 0.8464 0.7214 0.9420 -0.0303 -0.1537 0.0072  125  SER A OG  
1006 N N   . LEU A 142 ? 0.5692 0.4052 0.5621 -0.0122 -0.1482 -0.0112 126  LEU A N   
1007 C CA  . LEU A 142 ? 0.5536 0.3762 0.5156 -0.0063 -0.1465 -0.0162 126  LEU A CA  
1008 C C   . LEU A 142 ? 0.5630 0.3911 0.5098 -0.0026 -0.1332 -0.0183 126  LEU A C   
1009 O O   . LEU A 142 ? 0.5293 0.3759 0.4886 -0.0045 -0.1203 -0.0165 126  LEU A O   
1010 C CB  . LEU A 142 ? 0.5490 0.3740 0.5110 -0.0064 -0.1430 -0.0167 126  LEU A CB  
1011 C CG  . LEU A 142 ? 0.6234 0.4387 0.5572 -0.0003 -0.1381 -0.0216 126  LEU A CG  
1012 C CD1 . LEU A 142 ? 0.6490 0.4387 0.5588 0.0043  -0.1520 -0.0255 126  LEU A CD1 
1013 C CD2 . LEU A 142 ? 0.6577 0.4807 0.5978 -0.0015 -0.1323 -0.0210 126  LEU A CD2 
1014 N N   . ASN A 143 ? 0.5053 0.3168 0.4245 0.0029  -0.1362 -0.0219 127  ASN A N   
1015 C CA  . ASN A 143 ? 0.4915 0.3068 0.3952 0.0068  -0.1235 -0.0234 127  ASN A CA  
1016 C C   . ASN A 143 ? 0.5206 0.3235 0.3965 0.0132  -0.1201 -0.0274 127  ASN A C   
1017 O O   . ASN A 143 ? 0.5237 0.3075 0.3833 0.0163  -0.1311 -0.0300 127  ASN A O   
1018 C CB  . ASN A 143 ? 0.5615 0.3735 0.4616 0.0074  -0.1257 -0.0226 127  ASN A CB  
1019 C CG  . ASN A 143 ? 1.0143 0.8058 0.9043 0.0086  -0.1425 -0.0235 127  ASN A CG  
1020 O OD1 . ASN A 143 ? 1.0501 0.8222 0.9130 0.0139  -0.1478 -0.0268 127  ASN A OD1 
1021 N ND2 . ASN A 143 ? 0.9372 0.7321 0.8486 0.0039  -0.1513 -0.0206 127  ASN A ND2 
1022 N N   . PHE A 144 ? 0.4338 0.2479 0.3057 0.0152  -0.1052 -0.0278 128  PHE A N   
1023 C CA  . PHE A 144 ? 0.4343 0.2398 0.2825 0.0214  -0.0991 -0.0310 128  PHE A CA  
1024 C C   . PHE A 144 ? 0.4938 0.3110 0.3387 0.0234  -0.0835 -0.0304 128  PHE A C   
1025 O O   . PHE A 144 ? 0.4842 0.3182 0.3474 0.0194  -0.0769 -0.0279 128  PHE A O   
1026 C CB  . PHE A 144 ? 0.4332 0.2400 0.2852 0.0210  -0.0993 -0.0322 128  PHE A CB  
1027 C CG  . PHE A 144 ? 0.4092 0.2378 0.2839 0.0164  -0.0895 -0.0297 128  PHE A CG  
1028 C CD1 . PHE A 144 ? 0.4220 0.2603 0.2932 0.0187  -0.0760 -0.0303 128  PHE A CD1 
1029 C CD2 . PHE A 144 ? 0.4205 0.2588 0.3197 0.0101  -0.0940 -0.0267 128  PHE A CD2 
1030 C CE1 . PHE A 144 ? 0.4114 0.2681 0.3017 0.0147  -0.0678 -0.0283 128  PHE A CE1 
1031 C CE2 . PHE A 144 ? 0.4213 0.2781 0.3387 0.0064  -0.0846 -0.0244 128  PHE A CE2 
1032 C CZ  . PHE A 144 ? 0.3946 0.2600 0.3066 0.0088  -0.0721 -0.0254 128  PHE A CZ  
1033 N N   . SER A 145 ? 0.4849 0.2933 0.3073 0.0298  -0.0776 -0.0327 129  SER A N   
1034 C CA  . SER A 145 ? 0.4814 0.3005 0.3013 0.0320  -0.0627 -0.0318 129  SER A CA  
1035 C C   . SER A 145 ? 0.5013 0.3246 0.3190 0.0345  -0.0549 -0.0333 129  SER A C   
1036 O O   . SER A 145 ? 0.4910 0.3023 0.2978 0.0373  -0.0606 -0.0359 129  SER A O   
1037 C CB  . SER A 145 ? 0.5666 0.3728 0.3632 0.0377  -0.0606 -0.0320 129  SER A CB  
1038 O OG  . SER A 145 ? 0.8280 0.6162 0.5996 0.0444  -0.0630 -0.0351 129  SER A OG  
1039 N N   . ILE A 146 ? 0.4379 0.2779 0.2667 0.0333  -0.0427 -0.0317 130  ILE A N   
1040 C CA  . ILE A 146 ? 0.4358 0.2814 0.2650 0.0353  -0.0349 -0.0328 130  ILE A CA  
1041 C C   . ILE A 146 ? 0.4540 0.3114 0.2859 0.0368  -0.0213 -0.0311 130  ILE A C   
1042 O O   . ILE A 146 ? 0.4201 0.2857 0.2605 0.0342  -0.0182 -0.0288 130  ILE A O   
1043 C CB  . ILE A 146 ? 0.4572 0.3131 0.3062 0.0298  -0.0380 -0.0324 130  ILE A CB  
1044 C CG1 . ILE A 146 ? 0.4733 0.3295 0.3190 0.0325  -0.0339 -0.0341 130  ILE A CG1 
1045 C CG2 . ILE A 146 ? 0.4268 0.3015 0.2986 0.0238  -0.0335 -0.0295 130  ILE A CG2 
1046 C CD1 . ILE A 146 ? 0.5894 0.4517 0.4504 0.0279  -0.0385 -0.0337 130  ILE A CD1 
1047 N N   . ALA A 147 ? 0.4124 0.2704 0.2379 0.0410  -0.0135 -0.0321 131  ALA A N   
1048 C CA  . ALA A 147 ? 0.3946 0.2644 0.2255 0.0422  -0.0009 -0.0301 131  ALA A CA  
1049 C C   . ALA A 147 ? 0.4126 0.3009 0.2675 0.0358  0.0017  -0.0284 131  ALA A C   
1050 O O   . ALA A 147 ? 0.3883 0.2807 0.2533 0.0324  -0.0027 -0.0292 131  ALA A O   
1051 C CB  . ALA A 147 ? 0.4175 0.2847 0.2397 0.0478  0.0061  -0.0314 131  ALA A CB  
1052 N N   . GLN A 148 ? 0.3540 0.2523 0.2173 0.0343  0.0081  -0.0261 132  GLN A N   
1053 C CA  . GLN A 148 ? 0.3372 0.2519 0.2213 0.0290  0.0110  -0.0247 132  GLN A CA  
1054 C C   . GLN A 148 ? 0.3944 0.3168 0.2860 0.0289  0.0152  -0.0254 132  GLN A C   
1055 O O   . GLN A 148 ? 0.3673 0.2975 0.2715 0.0247  0.0127  -0.0256 132  GLN A O   
1056 C CB  . GLN A 148 ? 0.3433 0.2657 0.2329 0.0286  0.0178  -0.0223 132  GLN A CB  
1057 C CG  . GLN A 148 ? 0.3889 0.3069 0.2765 0.0270  0.0128  -0.0213 132  GLN A CG  
1058 C CD  . GLN A 148 ? 0.4300 0.3556 0.3241 0.0264  0.0190  -0.0187 132  GLN A CD  
1059 O OE1 . GLN A 148 ? 0.3969 0.3350 0.3050 0.0243  0.0243  -0.0179 132  GLN A OE1 
1060 N NE2 . GLN A 148 ? 0.4104 0.3276 0.2942 0.0281  0.0176  -0.0174 132  GLN A NE2 
1061 N N   . SER A 149 ? 0.3780 0.2975 0.2613 0.0339  0.0214  -0.0258 133  SER A N   
1062 C CA  . SER A 149 ? 0.3705 0.2962 0.2601 0.0346  0.0254  -0.0264 133  SER A CA  
1063 C C   . SER A 149 ? 0.3917 0.3133 0.2811 0.0332  0.0181  -0.0284 133  SER A C   
1064 O O   . SER A 149 ? 0.3796 0.3098 0.2804 0.0305  0.0189  -0.0284 133  SER A O   
1065 C CB  . SER A 149 ? 0.4140 0.3353 0.2937 0.0410  0.0330  -0.0262 133  SER A CB  
1066 O OG  . SER A 149 ? 0.5374 0.4434 0.3988 0.0457  0.0292  -0.0284 133  SER A OG  
1067 N N   . LYS A 150 ? 0.3686 0.2764 0.2450 0.0348  0.0107  -0.0301 134  LYS A N   
1068 C CA  . LYS A 150 ? 0.3574 0.2594 0.2333 0.0335  0.0025  -0.0317 134  LYS A CA  
1069 C C   . LYS A 150 ? 0.3840 0.2946 0.2759 0.0266  -0.0024 -0.0303 134  LYS A C   
1070 O O   . LYS A 150 ? 0.3418 0.2575 0.2424 0.0241  -0.0036 -0.0301 134  LYS A O   
1071 C CB  . LYS A 150 ? 0.4025 0.2864 0.2601 0.0373  -0.0051 -0.0339 134  LYS A CB  
1072 C CG  . LYS A 150 ? 0.5717 0.4453 0.4117 0.0449  -0.0003 -0.0358 134  LYS A CG  
1073 N N   . LEU A 151 ? 0.3397 0.2523 0.2358 0.0239  -0.0046 -0.0289 135  LEU A N   
1074 C CA  . LEU A 151 ? 0.3282 0.2493 0.2401 0.0179  -0.0081 -0.0273 135  LEU A CA  
1075 C C   . LEU A 151 ? 0.3085 0.2447 0.2339 0.0154  -0.0008 -0.0261 135  LEU A C   
1076 O O   . LEU A 151 ? 0.2838 0.2260 0.2195 0.0119  -0.0024 -0.0252 135  LEU A O   
1077 C CB  . LEU A 151 ? 0.3329 0.2526 0.2468 0.0160  -0.0119 -0.0262 135  LEU A CB  
1078 C CG  . LEU A 151 ? 0.3705 0.2997 0.3020 0.0103  -0.0144 -0.0241 135  LEU A CG  
1079 C CD1 . LEU A 151 ? 0.3748 0.3014 0.3122 0.0077  -0.0215 -0.0236 135  LEU A CD1 
1080 C CD2 . LEU A 151 ? 0.3735 0.3010 0.3070 0.0091  -0.0177 -0.0231 135  LEU A CD2 
1081 N N   . ARG A 152 ? 0.2737 0.2150 0.1983 0.0176  0.0070  -0.0260 136  ARG A N   
1082 C CA  . ARG A 152 ? 0.2736 0.2278 0.2102 0.0156  0.0129  -0.0252 136  ARG A CA  
1083 C C   . ARG A 152 ? 0.2983 0.2536 0.2362 0.0159  0.0130  -0.0258 136  ARG A C   
1084 O O   . ARG A 152 ? 0.2644 0.2278 0.2122 0.0127  0.0136  -0.0251 136  ARG A O   
1085 C CB  . ARG A 152 ? 0.2980 0.2567 0.2347 0.0178  0.0202  -0.0246 136  ARG A CB  
1086 C CG  . ARG A 152 ? 0.3267 0.2978 0.2766 0.0152  0.0242  -0.0240 136  ARG A CG  
1087 C CD  . ARG A 152 ? 0.3579 0.3346 0.3115 0.0166  0.0306  -0.0231 136  ARG A CD  
1088 N NE  . ARG A 152 ? 0.3720 0.3588 0.3377 0.0137  0.0321  -0.0230 136  ARG A NE  
1089 C CZ  . ARG A 152 ? 0.5405 0.5337 0.5137 0.0127  0.0350  -0.0222 136  ARG A CZ  
1090 N NH1 . ARG A 152 ? 0.3594 0.3508 0.3304 0.0141  0.0372  -0.0210 136  ARG A NH1 
1091 N NH2 . ARG A 152 ? 0.3833 0.3838 0.3655 0.0104  0.0353  -0.0226 136  ARG A NH2 
1092 N N   . ARG A 153 ? 0.2803 0.2267 0.2074 0.0199  0.0124  -0.0272 137  ARG A N   
1093 C CA  . ARG A 153 ? 0.2862 0.2321 0.2135 0.0208  0.0120  -0.0280 137  ARG A CA  
1094 C C   . ARG A 153 ? 0.3184 0.2644 0.2517 0.0165  0.0055  -0.0273 137  ARG A C   
1095 O O   . ARG A 153 ? 0.2947 0.2476 0.2358 0.0144  0.0067  -0.0265 137  ARG A O   
1096 C CB  . ARG A 153 ? 0.2982 0.2325 0.2115 0.0264  0.0117  -0.0299 137  ARG A CB  
1097 C CG  . ARG A 153 ? 0.4338 0.3668 0.3474 0.0278  0.0110  -0.0309 137  ARG A CG  
1098 C CD  . ARG A 153 ? 0.6988 0.6403 0.6188 0.0295  0.0185  -0.0304 137  ARG A CD  
1099 N NE  . ARG A 153 ? 0.8190 0.7561 0.7306 0.0354  0.0243  -0.0311 137  ARG A NE  
1100 C CZ  . ARG A 153 ? 0.9123 0.8421 0.8161 0.0404  0.0253  -0.0327 137  ARG A CZ  
1101 N NH1 . ARG A 153 ? 0.6388 0.5647 0.5423 0.0399  0.0199  -0.0340 137  ARG A NH1 
1102 N NH2 . ARG A 153 ? 0.7857 0.7122 0.6824 0.0461  0.0319  -0.0328 137  ARG A NH2 
1103 N N   . LEU A 154 ? 0.2856 0.2242 0.2159 0.0152  -0.0014 -0.0272 138  LEU A N   
1104 C CA  . LEU A 154 ? 0.2711 0.2098 0.2088 0.0111  -0.0077 -0.0257 138  LEU A CA  
1105 C C   . LEU A 154 ? 0.2920 0.2436 0.2436 0.0067  -0.0042 -0.0233 138  LEU A C   
1106 O O   . LEU A 154 ? 0.2784 0.2335 0.2364 0.0042  -0.0051 -0.0218 138  LEU A O   
1107 C CB  . LEU A 154 ? 0.2766 0.2065 0.2117 0.0101  -0.0157 -0.0255 138  LEU A CB  
1108 C CG  . LEU A 154 ? 0.3548 0.2690 0.2746 0.0144  -0.0215 -0.0280 138  LEU A CG  
1109 C CD1 . LEU A 154 ? 0.3780 0.2836 0.2965 0.0130  -0.0304 -0.0276 138  LEU A CD1 
1110 C CD2 . LEU A 154 ? 0.3732 0.2825 0.2910 0.0152  -0.0248 -0.0288 138  LEU A CD2 
1111 N N   . ILE A 155 ? 0.2264 0.1843 0.1818 0.0061  -0.0002 -0.0230 139  ILE A N   
1112 C CA  . ILE A 155 ? 0.1982 0.1673 0.1652 0.0026  0.0033  -0.0212 139  ILE A CA  
1113 C C   . ILE A 155 ? 0.2387 0.2144 0.2076 0.0031  0.0086  -0.0215 139  ILE A C   
1114 O O   . ILE A 155 ? 0.2131 0.1938 0.1881 0.0007  0.0091  -0.0201 139  ILE A O   
1115 C CB  . ILE A 155 ? 0.2214 0.1945 0.1923 0.0019  0.0053  -0.0210 139  ILE A CB  
1116 C CG1 . ILE A 155 ? 0.2199 0.1859 0.1898 0.0011  -0.0012 -0.0204 139  ILE A CG1 
1117 C CG2 . ILE A 155 ? 0.2189 0.2030 0.2008 -0.0009 0.0093  -0.0196 139  ILE A CG2 
1118 C CD1 . ILE A 155 ? 0.2363 0.2032 0.2065 0.0015  -0.0001 -0.0206 139  ILE A CD1 
1119 N N   . ASP A 156 ? 0.2283 0.2041 0.1926 0.0063  0.0126  -0.0231 140  ASP A N   
1120 C CA  . ASP A 156 ? 0.2356 0.2173 0.2028 0.0070  0.0169  -0.0235 140  ASP A CA  
1121 C C   . ASP A 156 ? 0.2438 0.2231 0.2095 0.0072  0.0148  -0.0234 140  ASP A C   
1122 O O   . ASP A 156 ? 0.2336 0.2181 0.2035 0.0061  0.0165  -0.0229 140  ASP A O   
1123 C CB  . ASP A 156 ? 0.2625 0.2445 0.2269 0.0104  0.0213  -0.0246 140  ASP A CB  
1124 C CG  . ASP A 156 ? 0.2864 0.2735 0.2551 0.0097  0.0243  -0.0242 140  ASP A CG  
1125 O OD1 . ASP A 156 ? 0.2682 0.2595 0.2425 0.0067  0.0234  -0.0235 140  ASP A OD1 
1126 O OD2 . ASP A 156 ? 0.3138 0.3005 0.2805 0.0123  0.0278  -0.0243 140  ASP A OD2 
1127 N N   . ARG A 157 ? 0.2351 0.2057 0.1945 0.0086  0.0106  -0.0239 141  ARG A N   
1128 C CA  . ARG A 157 ? 0.2454 0.2127 0.2035 0.0088  0.0079  -0.0238 141  ARG A CA  
1129 C C   . ARG A 157 ? 0.2575 0.2270 0.2215 0.0046  0.0047  -0.0213 141  ARG A C   
1130 O O   . ARG A 157 ? 0.2343 0.2022 0.1984 0.0041  0.0028  -0.0206 141  ARG A O   
1131 C CB  . ARG A 157 ? 0.2757 0.2317 0.2244 0.0121  0.0038  -0.0255 141  ARG A CB  
1132 C CG  . ARG A 157 ? 0.4238 0.3764 0.3653 0.0174  0.0078  -0.0276 141  ARG A CG  
1133 C CD  . ARG A 157 ? 0.5917 0.5492 0.5370 0.0189  0.0118  -0.0278 141  ARG A CD  
1134 N NE  . ARG A 157 ? 0.7474 0.7048 0.6896 0.0235  0.0174  -0.0289 141  ARG A NE  
1135 C CZ  . ARG A 157 ? 0.8665 0.8177 0.8025 0.0283  0.0186  -0.0303 141  ARG A CZ  
1136 N NH1 . ARG A 157 ? 0.6883 0.6322 0.6199 0.0292  0.0137  -0.0314 141  ARG A NH1 
1137 N NH2 . ARG A 157 ? 0.7279 0.6801 0.6626 0.0325  0.0249  -0.0305 141  ARG A NH2 
1138 N N   . THR A 158 ? 0.2074 0.1804 0.1768 0.0015  0.0043  -0.0196 142  THR A N   
1139 C CA  . THR A 158 ? 0.2060 0.1811 0.1822 -0.0024 0.0020  -0.0164 142  THR A CA  
1140 C C   . THR A 158 ? 0.2349 0.2193 0.2188 -0.0050 0.0062  -0.0144 142  THR A C   
1141 O O   . THR A 158 ? 0.2202 0.2072 0.2093 -0.0077 0.0062  -0.0113 142  THR A O   
1142 C CB  . THR A 158 ? 0.2808 0.2489 0.2578 -0.0036 -0.0045 -0.0154 142  THR A CB  
1143 O OG1 . THR A 158 ? 0.2227 0.1918 0.2011 -0.0037 -0.0041 -0.0159 142  THR A OG1 
1144 C CG2 . THR A 158 ? 0.2602 0.2172 0.2285 -0.0009 -0.0099 -0.0174 142  THR A CG2 
1145 N N   . SER A 159 ? 0.1712 0.1599 0.1560 -0.0042 0.0100  -0.0159 143  SER A N   
1146 C CA  . SER A 159 ? 0.1696 0.1659 0.1612 -0.0061 0.0136  -0.0145 143  SER A CA  
1147 C C   . SER A 159 ? 0.2138 0.2152 0.2069 -0.0071 0.0171  -0.0131 143  SER A C   
1148 O O   . SER A 159 ? 0.2056 0.2116 0.2043 -0.0089 0.0194  -0.0109 143  SER A O   
1149 C CB  . SER A 159 ? 0.2223 0.2212 0.2138 -0.0046 0.0164  -0.0167 143  SER A CB  
1150 O OG  . SER A 159 ? 0.2322 0.2330 0.2203 -0.0025 0.0194  -0.0188 143  SER A OG  
1151 N N   . PHE A 160 ? 0.2005 0.2008 0.1886 -0.0056 0.0175  -0.0143 144  PHE A N   
1152 C CA  . PHE A 160 ? 0.1932 0.1967 0.1805 -0.0062 0.0200  -0.0132 144  PHE A CA  
1153 C C   . PHE A 160 ? 0.2162 0.2193 0.2061 -0.0087 0.0193  -0.0090 144  PHE A C   
1154 O O   . PHE A 160 ? 0.2146 0.2206 0.2039 -0.0093 0.0223  -0.0072 144  PHE A O   
1155 C CB  . PHE A 160 ? 0.1955 0.1966 0.1778 -0.0041 0.0191  -0.0150 144  PHE A CB  
1156 C CG  . PHE A 160 ? 0.2019 0.1970 0.1817 -0.0040 0.0149  -0.0143 144  PHE A CG  
1157 C CD1 . PHE A 160 ? 0.2104 0.2039 0.1898 -0.0057 0.0133  -0.0114 144  PHE A CD1 
1158 C CD2 . PHE A 160 ? 0.2226 0.2129 0.2001 -0.0019 0.0126  -0.0163 144  PHE A CD2 
1159 C CE1 . PHE A 160 ? 0.2403 0.2276 0.2178 -0.0056 0.0088  -0.0107 144  PHE A CE1 
1160 C CE2 . PHE A 160 ? 0.2515 0.2353 0.2261 -0.0013 0.0085  -0.0160 144  PHE A CE2 
1161 C CZ  . PHE A 160 ? 0.2300 0.2124 0.2052 -0.0032 0.0063  -0.0134 144  PHE A CZ  
1162 N N   . ALA A 161 ? 0.1644 0.1631 0.1565 -0.0100 0.0149  -0.0074 145  ALA A N   
1163 C CA  . ALA A 161 ? 0.1582 0.1561 0.1543 -0.0126 0.0135  -0.0028 145  ALA A CA  
1164 C C   . ALA A 161 ? 0.1928 0.1952 0.1983 -0.0150 0.0156  0.0007  145  ALA A C   
1165 O O   . ALA A 161 ? 0.1773 0.1803 0.1881 -0.0173 0.0155  0.0053  145  ALA A O   
1166 C CB  . ALA A 161 ? 0.1706 0.1609 0.1657 -0.0129 0.0070  -0.0025 145  ALA A CB  
1167 N N   . MET A 162 ? 0.1696 0.1752 0.1784 -0.0144 0.0174  -0.0011 146  MET A N   
1168 C CA  . MET A 162 ? 0.1688 0.1790 0.1881 -0.0165 0.0193  0.0023  146  MET A CA  
1169 C C   . MET A 162 ? 0.2335 0.2496 0.2541 -0.0167 0.0262  0.0052  146  MET A C   
1170 O O   . MET A 162 ? 0.2189 0.2359 0.2311 -0.0148 0.0296  0.0029  146  MET A O   
1171 C CB  . MET A 162 ? 0.1789 0.1914 0.2008 -0.0154 0.0200  -0.0005 146  MET A CB  
1172 C CG  . MET A 162 ? 0.2049 0.2109 0.2236 -0.0146 0.0139  -0.0034 146  MET A CG  
1173 S SD  . MET A 162 ? 0.2262 0.2347 0.2488 -0.0138 0.0145  -0.0055 146  MET A SD  
1174 C CE  . MET A 162 ? 0.2048 0.2177 0.2203 -0.0111 0.0209  -0.0092 146  MET A CE  
1175 N N   . ALA A 163 ? 0.2017 0.2212 0.2326 -0.0190 0.0281  0.0104  147  ALA A N   
1176 C CA  . ALA A 163 ? 0.1910 0.2162 0.2230 -0.0186 0.0360  0.0134  147  ALA A CA  
1177 C C   . ALA A 163 ? 0.2388 0.2685 0.2709 -0.0164 0.0406  0.0101  147  ALA A C   
1178 O O   . ALA A 163 ? 0.2062 0.2356 0.2412 -0.0161 0.0375  0.0071  147  ALA A O   
1179 C CB  . ALA A 163 ? 0.1967 0.2249 0.2419 -0.0214 0.0376  0.0203  147  ALA A CB  
1180 N N   . GLN A 164 ? 0.2565 0.2896 0.2845 -0.0146 0.0477  0.0107  148  GLN A N   
1181 C CA  . GLN A 164 ? 0.2761 0.3134 0.3043 -0.0122 0.0526  0.0080  148  GLN A CA  
1182 C C   . GLN A 164 ? 0.3147 0.3568 0.3478 -0.0117 0.0606  0.0128  148  GLN A C   
1183 O O   . GLN A 164 ? 0.3209 0.3617 0.3463 -0.0110 0.0645  0.0153  148  GLN A O   
1184 C CB  . GLN A 164 ? 0.3018 0.3365 0.3164 -0.0093 0.0529  0.0026  148  GLN A CB  
1185 C CG  . GLN A 164 ? 0.5247 0.5626 0.5395 -0.0068 0.0569  -0.0007 148  GLN A CG  
1186 C CD  . GLN A 164 ? 0.8563 0.8911 0.8607 -0.0045 0.0550  -0.0063 148  GLN A CD  
1187 O OE1 . GLN A 164 ? 0.8283 0.8598 0.8220 -0.0031 0.0552  -0.0073 148  GLN A OE1 
1188 N NE2 . GLN A 164 ? 0.7671 0.8028 0.7751 -0.0041 0.0527  -0.0098 148  GLN A NE2 
1189 N N   . GLN A 165 ? 0.2987 0.3458 0.3446 -0.0121 0.0631  0.0145  149  GLN A N   
1190 C CA  . GLN A 165 ? 0.3023 0.3551 0.3558 -0.0112 0.0717  0.0195  149  GLN A CA  
1191 C C   . GLN A 165 ? 0.3182 0.3716 0.3766 -0.0135 0.0742  0.0270  149  GLN A C   
1192 O O   . GLN A 165 ? 0.3178 0.3740 0.3751 -0.0118 0.0828  0.0309  149  GLN A O   
1193 C CB  . GLN A 165 ? 0.3258 0.3791 0.3677 -0.0067 0.0790  0.0162  149  GLN A CB  
1194 C CG  . GLN A 165 ? 0.5366 0.5908 0.5789 -0.0048 0.0776  0.0102  149  GLN A CG  
1195 C CD  . GLN A 165 ? 0.8695 0.9216 0.8975 -0.0004 0.0820  0.0057  149  GLN A CD  
1196 O OE1 . GLN A 165 ? 0.7953 0.8424 0.8086 0.0009  0.0815  0.0041  149  GLN A OE1 
1197 N NE2 . GLN A 165 ? 0.8167 0.8719 0.8489 0.0021  0.0856  0.0034  149  GLN A NE2 
1198 N N   . ASP A 166 ? 0.2540 0.3043 0.3175 -0.0170 0.0666  0.0291  150  ASP A N   
1199 C CA  . ASP A 166 ? 0.2460 0.2968 0.3166 -0.0197 0.0679  0.0367  150  ASP A CA  
1200 C C   . ASP A 166 ? 0.2956 0.3535 0.3874 -0.0213 0.0713  0.0424  150  ASP A C   
1201 O O   . ASP A 166 ? 0.2628 0.3221 0.3647 -0.0220 0.0669  0.0402  150  ASP A O   
1202 C CB  . ASP A 166 ? 0.2578 0.3024 0.3283 -0.0228 0.0577  0.0366  150  ASP A CB  
1203 C CG  . ASP A 166 ? 0.2918 0.3350 0.3656 -0.0254 0.0579  0.0436  150  ASP A CG  
1204 O OD1 . ASP A 166 ? 0.3043 0.3523 0.3942 -0.0275 0.0611  0.0508  150  ASP A OD1 
1205 O OD2 . ASP A 166 ? 0.3015 0.3389 0.3629 -0.0253 0.0548  0.0423  150  ASP A OD2 
1206 N N   . VAL A 167 ? 0.2879 0.3499 0.3870 -0.0217 0.0789  0.0501  151  VAL A N   
1207 C CA  . VAL A 167 ? 0.3065 0.3759 0.4288 -0.0235 0.0825  0.0569  151  VAL A CA  
1208 C C   . VAL A 167 ? 0.3228 0.3898 0.4606 -0.0282 0.0707  0.0587  151  VAL A C   
1209 O O   . VAL A 167 ? 0.3188 0.3902 0.4754 -0.0297 0.0691  0.0610  151  VAL A O   
1210 C CB  . VAL A 167 ? 0.3888 0.4630 0.5162 -0.0230 0.0937  0.0658  151  VAL A CB  
1211 C CG1 . VAL A 167 ? 0.3993 0.4824 0.5523 -0.0241 0.0987  0.0725  151  VAL A CG1 
1212 C CG2 . VAL A 167 ? 0.3977 0.4712 0.5050 -0.0177 0.1039  0.0631  151  VAL A CG2 
1213 N N   . ARG A 168 ? 0.2699 0.3291 0.3986 -0.0302 0.0616  0.0566  152  ARG A N   
1214 C CA  . ARG A 168 ? 0.2537 0.3082 0.3927 -0.0338 0.0494  0.0566  152  ARG A CA  
1215 C C   . ARG A 168 ? 0.2910 0.3421 0.4221 -0.0320 0.0437  0.0480  152  ARG A C   
1216 O O   . ARG A 168 ? 0.2537 0.2979 0.3690 -0.0310 0.0383  0.0421  152  ARG A O   
1217 C CB  . ARG A 168 ? 0.2421 0.2889 0.3735 -0.0359 0.0428  0.0577  152  ARG A CB  
1218 C CG  . ARG A 168 ? 0.2935 0.3430 0.4316 -0.0379 0.0483  0.0667  152  ARG A CG  
1219 C CD  . ARG A 168 ? 0.3017 0.3431 0.4272 -0.0389 0.0427  0.0661  152  ARG A CD  
1220 N NE  . ARG A 168 ? 0.2502 0.2885 0.3525 -0.0352 0.0458  0.0597  152  ARG A NE  
1221 C CZ  . ARG A 168 ? 0.3216 0.3537 0.4106 -0.0351 0.0432  0.0588  152  ARG A CZ  
1222 N NH1 . ARG A 168 ? 0.2437 0.2718 0.3392 -0.0384 0.0375  0.0639  152  ARG A NH1 
1223 N NH2 . ARG A 168 ? 0.2993 0.3289 0.3692 -0.0317 0.0456  0.0531  152  ARG A NH2 
1224 N N   . TYR A 169 ? 0.2699 0.3263 0.4124 -0.0313 0.0457  0.0477  153  TYR A N   
1225 C CA  . TYR A 169 ? 0.2655 0.3202 0.4028 -0.0294 0.0421  0.0406  153  TYR A CA  
1226 C C   . TYR A 169 ? 0.2697 0.3151 0.4010 -0.0306 0.0298  0.0362  153  TYR A C   
1227 O O   . TYR A 169 ? 0.2564 0.2982 0.3748 -0.0284 0.0276  0.0296  153  TYR A O   
1228 C CB  . TYR A 169 ? 0.3023 0.3643 0.4577 -0.0292 0.0453  0.0428  153  TYR A CB  
1229 C CG  . TYR A 169 ? 0.3708 0.4329 0.5481 -0.0331 0.0379  0.0484  153  TYR A CG  
1230 C CD1 . TYR A 169 ? 0.4082 0.4753 0.6023 -0.0355 0.0416  0.0571  153  TYR A CD1 
1231 C CD2 . TYR A 169 ? 0.3916 0.4478 0.5721 -0.0344 0.0266  0.0452  153  TYR A CD2 
1232 C CE1 . TYR A 169 ? 0.4365 0.5031 0.6520 -0.0395 0.0334  0.0624  153  TYR A CE1 
1233 C CE2 . TYR A 169 ? 0.4120 0.4666 0.6119 -0.0380 0.0180  0.0501  153  TYR A CE2 
1234 C CZ  . TYR A 169 ? 0.5465 0.6065 0.7649 -0.0407 0.0211  0.0587  153  TYR A CZ  
1235 O OH  . TYR A 169 ? 0.5959 0.6541 0.8352 -0.0445 0.0117  0.0637  153  TYR A OH  
1236 N N   . TYR A 170 ? 0.2165 0.2573 0.3564 -0.0340 0.0218  0.0402  154  TYR A N   
1237 C CA  . TYR A 170 ? 0.2081 0.2385 0.3414 -0.0348 0.0098  0.0364  154  TYR A CA  
1238 C C   . TYR A 170 ? 0.2243 0.2483 0.3361 -0.0328 0.0088  0.0312  154  TYR A C   
1239 O O   . TYR A 170 ? 0.2206 0.2358 0.3239 -0.0323 0.0004  0.0271  154  TYR A O   
1240 C CB  . TYR A 170 ? 0.2375 0.2640 0.3865 -0.0388 0.0009  0.0420  154  TYR A CB  
1241 C CG  . TYR A 170 ? 0.2664 0.2965 0.4228 -0.0410 0.0054  0.0492  154  TYR A CG  
1242 C CD1 . TYR A 170 ? 0.2924 0.3324 0.4668 -0.0423 0.0135  0.0565  154  TYR A CD1 
1243 C CD2 . TYR A 170 ? 0.2866 0.3102 0.4317 -0.0414 0.0023  0.0488  154  TYR A CD2 
1244 C CE1 . TYR A 170 ? 0.3234 0.3667 0.5037 -0.0441 0.0187  0.0636  154  TYR A CE1 
1245 C CE2 . TYR A 170 ? 0.3014 0.3279 0.4529 -0.0435 0.0064  0.0558  154  TYR A CE2 
1246 C CZ  . TYR A 170 ? 0.4055 0.4417 0.5744 -0.0449 0.0146  0.0634  154  TYR A CZ  
1247 O OH  . TYR A 170 ? 0.4635 0.5025 0.6382 -0.0468 0.0195  0.0709  154  TYR A OH  
1248 N N   . LEU A 171 ? 0.1632 0.1909 0.2660 -0.0313 0.0173  0.0315  155  LEU A N   
1249 C CA  . LEU A 171 ? 0.1645 0.1871 0.2485 -0.0291 0.0170  0.0268  155  LEU A CA  
1250 C C   . LEU A 171 ? 0.2035 0.2280 0.2759 -0.0256 0.0214  0.0205  155  LEU A C   
1251 O O   . LEU A 171 ? 0.1926 0.2128 0.2509 -0.0237 0.0202  0.0160  155  LEU A O   
1252 C CB  . LEU A 171 ? 0.1659 0.1903 0.2462 -0.0295 0.0224  0.0307  155  LEU A CB  
1253 C CG  . LEU A 171 ? 0.2341 0.2563 0.3248 -0.0330 0.0185  0.0374  155  LEU A CG  
1254 C CD1 . LEU A 171 ? 0.2682 0.2914 0.3520 -0.0329 0.0243  0.0408  155  LEU A CD1 
1255 C CD2 . LEU A 171 ? 0.2348 0.2473 0.3240 -0.0342 0.0066  0.0351  155  LEU A CD2 
1256 N N   . ASN A 172 ? 0.2065 0.2376 0.2858 -0.0248 0.0266  0.0205  156  ASN A N   
1257 C CA  . ASN A 172 ? 0.1992 0.2323 0.2694 -0.0217 0.0307  0.0151  156  ASN A CA  
1258 C C   . ASN A 172 ? 0.2232 0.2518 0.2909 -0.0210 0.0242  0.0105  156  ASN A C   
1259 O O   . ASN A 172 ? 0.1995 0.2309 0.2708 -0.0200 0.0256  0.0087  156  ASN A O   
1260 C CB  . ASN A 172 ? 0.2212 0.2625 0.2992 -0.0206 0.0391  0.0170  156  ASN A CB  
1261 C CG  . ASN A 172 ? 0.2696 0.3148 0.3477 -0.0204 0.0468  0.0216  156  ASN A CG  
1262 O OD1 . ASN A 172 ? 0.2322 0.2744 0.2989 -0.0199 0.0477  0.0214  156  ASN A OD1 
1263 N ND2 . ASN A 172 ? 0.2267 0.2786 0.3180 -0.0207 0.0528  0.0261  156  ASN A ND2 
1264 N N   . GLY A 173 ? 0.1680 0.1888 0.2286 -0.0213 0.0173  0.0088  157  GLY A N   
1265 C CA  . GLY A 173 ? 0.1786 0.1933 0.2350 -0.0204 0.0109  0.0051  157  GLY A CA  
1266 C C   . GLY A 173 ? 0.2129 0.2184 0.2606 -0.0202 0.0041  0.0038  157  GLY A C   
1267 O O   . GLY A 173 ? 0.2003 0.2046 0.2442 -0.0205 0.0048  0.0049  157  GLY A O   
1268 N N   . MET A 174 ? 0.1732 0.1715 0.2167 -0.0193 -0.0023 0.0011  158  MET A N   
1269 C CA  . MET A 174 ? 0.1766 0.1648 0.2096 -0.0181 -0.0086 -0.0010 158  MET A CA  
1270 C C   . MET A 174 ? 0.2120 0.1917 0.2486 -0.0193 -0.0182 -0.0001 158  MET A C   
1271 O O   . MET A 174 ? 0.2038 0.1819 0.2429 -0.0192 -0.0211 -0.0008 158  MET A O   
1272 C CB  . MET A 174 ? 0.1948 0.1802 0.2141 -0.0145 -0.0066 -0.0060 158  MET A CB  
1273 C CG  . MET A 174 ? 0.2237 0.1985 0.2307 -0.0121 -0.0116 -0.0086 158  MET A CG  
1274 S SD  . MET A 174 ? 0.2535 0.2266 0.2464 -0.0076 -0.0072 -0.0134 158  MET A SD  
1275 C CE  . MET A 174 ? 0.2065 0.1904 0.2022 -0.0079 0.0014  -0.0130 158  MET A CE  
1276 N N   . LEU A 175 ? 0.1684 0.1412 0.2038 -0.0202 -0.0241 0.0011  159  LEU A N   
1277 C CA  . LEU A 175 ? 0.1722 0.1345 0.2088 -0.0209 -0.0349 0.0013  159  LEU A CA  
1278 C C   . LEU A 175 ? 0.2298 0.1815 0.2489 -0.0168 -0.0384 -0.0041 159  LEU A C   
1279 O O   . LEU A 175 ? 0.2434 0.1928 0.2500 -0.0139 -0.0353 -0.0071 159  LEU A O   
1280 C CB  . LEU A 175 ? 0.1619 0.1191 0.2020 -0.0229 -0.0406 0.0041  159  LEU A CB  
1281 C CG  . LEU A 175 ? 0.2204 0.1638 0.2593 -0.0231 -0.0536 0.0035  159  LEU A CG  
1282 C CD1 . LEU A 175 ? 0.2312 0.1757 0.2865 -0.0263 -0.0592 0.0071  159  LEU A CD1 
1283 C CD2 . LEU A 175 ? 0.2166 0.1535 0.2556 -0.0242 -0.0591 0.0052  159  LEU A CD2 
1284 N N   . LEU A 176 ? 0.2272 0.1722 0.2457 -0.0164 -0.0451 -0.0050 160  LEU A N   
1285 C CA  . LEU A 176 ? 0.2492 0.1811 0.2501 -0.0124 -0.0503 -0.0095 160  LEU A CA  
1286 C C   . LEU A 176 ? 0.3201 0.2398 0.3234 -0.0137 -0.0632 -0.0085 160  LEU A C   
1287 O O   . LEU A 176 ? 0.2970 0.2182 0.3149 -0.0171 -0.0684 -0.0052 160  LEU A O   
1288 C CB  . LEU A 176 ? 0.2461 0.1784 0.2409 -0.0103 -0.0475 -0.0117 160  LEU A CB  
1289 C CG  . LEU A 176 ? 0.2963 0.2397 0.2890 -0.0088 -0.0357 -0.0129 160  LEU A CG  
1290 C CD1 . LEU A 176 ? 0.3121 0.2550 0.3001 -0.0071 -0.0342 -0.0145 160  LEU A CD1 
1291 C CD2 . LEU A 176 ? 0.3132 0.2546 0.2928 -0.0055 -0.0311 -0.0156 160  LEU A CD2 
1292 N N   . GLU A 177 ? 0.2987 0.2064 0.2888 -0.0111 -0.0684 -0.0112 161  GLU A N   
1293 C CA  . GLU A 177 ? 0.3167 0.2114 0.3078 -0.0120 -0.0814 -0.0106 161  GLU A CA  
1294 C C   . GLU A 177 ? 0.3941 0.2712 0.3635 -0.0068 -0.0885 -0.0158 161  GLU A C   
1295 O O   . GLU A 177 ? 0.3757 0.2491 0.3286 -0.0022 -0.0834 -0.0195 161  GLU A O   
1296 C CB  . GLU A 177 ? 0.3283 0.2249 0.3267 -0.0143 -0.0821 -0.0081 161  GLU A CB  
1297 C CG  . GLU A 177 ? 0.4119 0.2956 0.4141 -0.0159 -0.0960 -0.0069 161  GLU A CG  
1298 C CD  . GLU A 177 ? 0.5168 0.4017 0.5242 -0.0176 -0.0962 -0.0046 161  GLU A CD  
1299 O OE1 . GLU A 177 ? 0.5066 0.4017 0.5335 -0.0226 -0.0944 0.0013  161  GLU A OE1 
1300 O OE2 . GLU A 177 ? 0.5341 0.4103 0.5261 -0.0138 -0.0971 -0.0085 161  GLU A OE2 
1301 N N   . VAL A 178 ? 0.3816 0.2470 0.3513 -0.0074 -0.1006 -0.0158 162  VAL A N   
1302 C CA  . VAL A 178 ? 0.4043 0.2499 0.3525 -0.0024 -0.1096 -0.0205 162  VAL A CA  
1303 C C   . VAL A 178 ? 0.4650 0.2997 0.4172 -0.0039 -0.1218 -0.0198 162  VAL A C   
1304 O O   . VAL A 178 ? 0.4576 0.2947 0.4294 -0.0091 -0.1292 -0.0155 162  VAL A O   
1305 C CB  . VAL A 178 ? 0.4687 0.3066 0.4120 -0.0015 -0.1159 -0.0214 162  VAL A CB  
1306 C CG1 . VAL A 178 ? 0.4935 0.3085 0.4118 0.0043  -0.1259 -0.0264 162  VAL A CG1 
1307 C CG2 . VAL A 178 ? 0.4573 0.3066 0.3985 -0.0004 -0.1038 -0.0216 162  VAL A CG2 
1308 N N   . ASN A 179 ? 0.4644 0.2879 0.3996 0.0006  -0.1235 -0.0237 163  ASN A N   
1309 C CA  . ASN A 179 ? 0.4956 0.3065 0.4315 0.0000  -0.1356 -0.0239 163  ASN A CA  
1310 C C   . ASN A 179 ? 0.5964 0.3880 0.5040 0.0076  -0.1395 -0.0305 163  ASN A C   
1311 O O   . ASN A 179 ? 0.5639 0.3577 0.4588 0.0121  -0.1296 -0.0333 163  ASN A O   
1312 C CB  . ASN A 179 ? 0.5183 0.3409 0.4692 -0.0037 -0.1305 -0.0203 163  ASN A CB  
1313 C CG  . ASN A 179 ? 0.8913 0.7080 0.8576 -0.0082 -0.1431 -0.0167 163  ASN A CG  
1314 O OD1 . ASN A 179 ? 0.8173 0.6197 0.7830 -0.0085 -0.1573 -0.0173 163  ASN A OD1 
1315 N ND2 . ASN A 179 ? 0.7955 0.6229 0.7763 -0.0120 -0.1386 -0.0124 163  ASN A ND2 
1316 N N   . GLY A 180 ? 0.6360 0.4087 0.5338 0.0095  -0.1537 -0.0328 164  GLY A N   
1317 C CA  . GLY A 180 ? 0.6749 0.4267 0.5430 0.0176  -0.1583 -0.0393 164  GLY A CA  
1318 C C   . GLY A 180 ? 0.7480 0.5024 0.6020 0.0215  -0.1488 -0.0411 164  GLY A C   
1319 O O   . GLY A 180 ? 0.7511 0.5120 0.6151 0.0180  -0.1492 -0.0383 164  GLY A O   
1320 N N   . GLY A 181 ? 0.6953 0.4461 0.5285 0.0283  -0.1394 -0.0451 165  GLY A N   
1321 C CA  . GLY A 181 ? 0.6711 0.4255 0.4917 0.0321  -0.1287 -0.0461 165  GLY A CA  
1322 C C   . GLY A 181 ? 0.6549 0.4322 0.4885 0.0299  -0.1121 -0.0434 165  GLY A C   
1323 O O   . GLY A 181 ? 0.6616 0.4458 0.4904 0.0316  -0.1022 -0.0432 165  GLY A O   
1324 N N   . THR A 182 ? 0.5535 0.3419 0.4035 0.0260  -0.1096 -0.0413 166  THR A N   
1325 C CA  . THR A 182 ? 0.5065 0.3147 0.3687 0.0239  -0.0958 -0.0390 166  THR A CA  
1326 C C   . THR A 182 ? 0.4721 0.2986 0.3549 0.0176  -0.0905 -0.0344 166  THR A C   
1327 O O   . THR A 182 ? 0.4617 0.2895 0.3587 0.0126  -0.0983 -0.0314 166  THR A O   
1328 C CB  . THR A 182 ? 0.5963 0.4068 0.4670 0.0222  -0.0973 -0.0383 166  THR A CB  
1329 O OG1 . THR A 182 ? 0.6651 0.4578 0.5166 0.0284  -0.1028 -0.0429 166  THR A OG1 
1330 C CG2 . THR A 182 ? 0.5715 0.4003 0.4522 0.0207  -0.0839 -0.0364 166  THR A CG2 
1331 N N   . LEU A 183 ? 0.3880 0.2287 0.2733 0.0181  -0.0772 -0.0337 167  LEU A N   
1332 C CA  . LEU A 183 ? 0.3461 0.2048 0.2500 0.0128  -0.0706 -0.0299 167  LEU A CA  
1333 C C   . LEU A 183 ? 0.3863 0.2582 0.3005 0.0108  -0.0625 -0.0283 167  LEU A C   
1334 O O   . LEU A 183 ? 0.3857 0.2582 0.2909 0.0148  -0.0557 -0.0304 167  LEU A O   
1335 C CB  . LEU A 183 ? 0.3349 0.1983 0.2335 0.0147  -0.0629 -0.0303 167  LEU A CB  
1336 C CG  . LEU A 183 ? 0.3660 0.2468 0.2835 0.0095  -0.0570 -0.0267 167  LEU A CG  
1337 C CD1 . LEU A 183 ? 0.3498 0.2313 0.2831 0.0042  -0.0659 -0.0236 167  LEU A CD1 
1338 C CD2 . LEU A 183 ? 0.4065 0.2903 0.3177 0.0117  -0.0502 -0.0273 167  LEU A CD2 
1339 N N   . ARG A 184 ? 0.3430 0.2250 0.2762 0.0050  -0.0635 -0.0242 168  ARG A N   
1340 C CA  . ARG A 184 ? 0.3055 0.1990 0.2482 0.0028  -0.0568 -0.0222 168  ARG A CA  
1341 C C   . ARG A 184 ? 0.3268 0.2366 0.2853 -0.0016 -0.0498 -0.0186 168  ARG A C   
1342 O O   . ARG A 184 ? 0.3286 0.2410 0.2979 -0.0050 -0.0532 -0.0160 168  ARG A O   
1343 C CB  . ARG A 184 ? 0.3116 0.1993 0.2599 0.0005  -0.0651 -0.0206 168  ARG A CB  
1344 C CG  . ARG A 184 ? 0.3982 0.2969 0.3574 -0.0025 -0.0598 -0.0175 168  ARG A CG  
1345 C CD  . ARG A 184 ? 0.4046 0.2963 0.3700 -0.0051 -0.0690 -0.0152 168  ARG A CD  
1346 N NE  . ARG A 184 ? 0.5042 0.3823 0.4549 -0.0004 -0.0739 -0.0194 168  ARG A NE  
1347 C CZ  . ARG A 184 ? 0.7271 0.5958 0.6793 -0.0013 -0.0830 -0.0187 168  ARG A CZ  
1348 N NH1 . ARG A 184 ? 0.5264 0.3981 0.4954 -0.0071 -0.0883 -0.0135 168  ARG A NH1 
1349 N NH2 . ARG A 184 ? 0.6095 0.4657 0.5471 0.0036  -0.0867 -0.0230 168  ARG A NH2 
1350 N N   . SER A 185 ? 0.2599 0.1801 0.2202 -0.0013 -0.0405 -0.0184 169  SER A N   
1351 C CA  . SER A 185 ? 0.2358 0.1707 0.2093 -0.0049 -0.0334 -0.0153 169  SER A CA  
1352 C C   . SER A 185 ? 0.2603 0.1998 0.2413 -0.0075 -0.0325 -0.0125 169  SER A C   
1353 O O   . SER A 185 ? 0.2614 0.1962 0.2353 -0.0054 -0.0332 -0.0140 169  SER A O   
1354 C CB  . SER A 185 ? 0.2513 0.1936 0.2201 -0.0025 -0.0241 -0.0173 169  SER A CB  
1355 O OG  . SER A 185 ? 0.2818 0.2216 0.2413 0.0010  -0.0211 -0.0197 169  SER A OG  
1356 N N   . VAL A 186 ? 0.2134 0.1618 0.2086 -0.0117 -0.0307 -0.0082 170  VAL A N   
1357 C CA  . VAL A 186 ? 0.1935 0.1469 0.1960 -0.0144 -0.0288 -0.0046 170  VAL A CA  
1358 C C   . VAL A 186 ? 0.2178 0.1841 0.2295 -0.0165 -0.0205 -0.0019 170  VAL A C   
1359 O O   . VAL A 186 ? 0.2010 0.1717 0.2212 -0.0181 -0.0198 -0.0003 170  VAL A O   
1360 C CB  . VAL A 186 ? 0.2322 0.1801 0.2435 -0.0176 -0.0371 -0.0008 170  VAL A CB  
1361 C CG1 . VAL A 186 ? 0.2231 0.1755 0.2392 -0.0197 -0.0343 0.0029  170  VAL A CG1 
1362 C CG2 . VAL A 186 ? 0.2439 0.1769 0.2456 -0.0153 -0.0471 -0.0039 170  VAL A CG2 
1363 N N   . ALA A 187 ? 0.1846 0.1564 0.1945 -0.0163 -0.0147 -0.0012 171  ALA A N   
1364 C CA  . ALA A 187 ? 0.1747 0.1572 0.1910 -0.0178 -0.0068 0.0012  171  ALA A CA  
1365 C C   . ALA A 187 ? 0.2087 0.1931 0.2261 -0.0193 -0.0049 0.0046  171  ALA A C   
1366 O O   . ALA A 187 ? 0.1922 0.1717 0.2019 -0.0179 -0.0069 0.0031  171  ALA A O   
1367 C CB  . ALA A 187 ? 0.1772 0.1639 0.1863 -0.0150 -0.0008 -0.0027 171  ALA A CB  
1368 N N   . THR A 188 ? 0.1693 0.1607 0.1963 -0.0219 -0.0006 0.0095  172  THR A N   
1369 C CA  . THR A 188 ? 0.1711 0.1647 0.1990 -0.0233 0.0024  0.0137  172  THR A CA  
1370 C C   . THR A 188 ? 0.2255 0.2282 0.2593 -0.0242 0.0107  0.0172  172  THR A C   
1371 O O   . THR A 188 ? 0.2104 0.2176 0.2528 -0.0249 0.0127  0.0182  172  THR A O   
1372 C CB  . THR A 188 ? 0.2163 0.2045 0.2508 -0.0261 -0.0042 0.0180  172  THR A CB  
1373 O OG1 . THR A 188 ? 0.2481 0.2380 0.2814 -0.0272 -0.0009 0.0219  172  THR A OG1 
1374 C CG2 . THR A 188 ? 0.2026 0.1929 0.2529 -0.0293 -0.0067 0.0226  172  THR A CG2 
1375 N N   . ASP A 189 ? 0.1837 0.1882 0.2118 -0.0238 0.0155  0.0189  173  ASP A N   
1376 C CA  . ASP A 189 ? 0.1992 0.2109 0.2297 -0.0238 0.0240  0.0222  173  ASP A CA  
1377 C C   . ASP A 189 ? 0.2754 0.2875 0.3113 -0.0264 0.0256  0.0296  173  ASP A C   
1378 O O   . ASP A 189 ? 0.2686 0.2850 0.3031 -0.0260 0.0331  0.0330  173  ASP A O   
1379 C CB  . ASP A 189 ? 0.2111 0.2239 0.2287 -0.0206 0.0286  0.0179  173  ASP A CB  
1380 C CG  . ASP A 189 ? 0.2485 0.2560 0.2549 -0.0196 0.0262  0.0166  173  ASP A CG  
1381 O OD1 . ASP A 189 ? 0.2380 0.2410 0.2460 -0.0214 0.0213  0.0192  173  ASP A OD1 
1382 O OD2 . ASP A 189 ? 0.2576 0.2652 0.2544 -0.0171 0.0285  0.0130  173  ASP A OD2 
1383 N N   . GLY A 190 ? 0.2698 0.2765 0.3102 -0.0287 0.0184  0.0318  174  GLY A N   
1384 C CA  . GLY A 190 ? 0.2915 0.2975 0.3379 -0.0315 0.0185  0.0391  174  GLY A CA  
1385 C C   . GLY A 190 ? 0.3496 0.3507 0.3839 -0.0307 0.0176  0.0390  174  GLY A C   
1386 O O   . GLY A 190 ? 0.3753 0.3740 0.4135 -0.0331 0.0158  0.0447  174  GLY A O   
1387 N N   . HIS A 191 ? 0.2986 0.2980 0.3191 -0.0274 0.0182  0.0328  175  HIS A N   
1388 C CA  . HIS A 191 ? 0.3022 0.2968 0.3109 -0.0262 0.0168  0.0319  175  HIS A CA  
1389 C C   . HIS A 191 ? 0.3224 0.3106 0.3256 -0.0245 0.0093  0.0258  175  HIS A C   
1390 O O   . HIS A 191 ? 0.3361 0.3187 0.3351 -0.0246 0.0050  0.0263  175  HIS A O   
1391 C CB  . HIS A 191 ? 0.3261 0.3236 0.3238 -0.0235 0.0238  0.0302  175  HIS A CB  
1392 C CG  . HIS A 191 ? 0.3793 0.3828 0.3805 -0.0240 0.0324  0.0352  175  HIS A CG  
1393 N ND1 . HIS A 191 ? 0.4128 0.4166 0.4173 -0.0261 0.0356  0.0430  175  HIS A ND1 
1394 C CD2 . HIS A 191 ? 0.4000 0.4091 0.4025 -0.0224 0.0385  0.0336  175  HIS A CD2 
1395 C CE1 . HIS A 191 ? 0.4055 0.4153 0.4129 -0.0254 0.0441  0.0459  175  HIS A CE1 
1396 N NE2 . HIS A 191 ? 0.4057 0.4188 0.4120 -0.0232 0.0459  0.0402  175  HIS A NE2 
1397 N N   . ARG A 192 ? 0.2442 0.2331 0.2470 -0.0227 0.0083  0.0203  176  ARG A N   
1398 C CA  . ARG A 192 ? 0.2241 0.2073 0.2216 -0.0204 0.0026  0.0146  176  ARG A CA  
1399 C C   . ARG A 192 ? 0.2482 0.2308 0.2507 -0.0202 -0.0001 0.0121  176  ARG A C   
1400 O O   . ARG A 192 ? 0.2189 0.2067 0.2280 -0.0214 0.0032  0.0136  176  ARG A O   
1401 C CB  . ARG A 192 ? 0.2087 0.1924 0.1963 -0.0171 0.0049  0.0098  176  ARG A CB  
1402 C CG  . ARG A 192 ? 0.2466 0.2370 0.2323 -0.0161 0.0118  0.0089  176  ARG A CG  
1403 C CD  . ARG A 192 ? 0.2123 0.2057 0.2009 -0.0150 0.0129  0.0051  176  ARG A CD  
1404 N NE  . ARG A 192 ? 0.2397 0.2387 0.2264 -0.0138 0.0188  0.0038  176  ARG A NE  
1405 C CZ  . ARG A 192 ? 0.3016 0.3010 0.2819 -0.0114 0.0200  -0.0001 176  ARG A CZ  
1406 N NH1 . ARG A 192 ? 0.2155 0.2110 0.1918 -0.0097 0.0163  -0.0029 176  ARG A NH1 
1407 N NH2 . ARG A 192 ? 0.2073 0.2111 0.1863 -0.0103 0.0246  -0.0014 176  ARG A NH2 
1408 N N   . LEU A 193 ? 0.1935 0.1690 0.1924 -0.0186 -0.0062 0.0084  177  LEU A N   
1409 C CA  . LEU A 193 ? 0.1847 0.1573 0.1861 -0.0180 -0.0099 0.0060  177  LEU A CA  
1410 C C   . LEU A 193 ? 0.2141 0.1818 0.2059 -0.0139 -0.0115 -0.0001 177  LEU A C   
1411 O O   . LEU A 193 ? 0.2004 0.1646 0.1860 -0.0119 -0.0125 -0.0018 177  LEU A O   
1412 C CB  . LEU A 193 ? 0.1821 0.1484 0.1907 -0.0208 -0.0175 0.0095  177  LEU A CB  
1413 C CG  . LEU A 193 ? 0.2299 0.1900 0.2400 -0.0203 -0.0240 0.0071  177  LEU A CG  
1414 C CD1 . LEU A 193 ? 0.2322 0.1906 0.2551 -0.0243 -0.0295 0.0125  177  LEU A CD1 
1415 C CD2 . LEU A 193 ? 0.2516 0.2010 0.2508 -0.0166 -0.0299 0.0021  177  LEU A CD2 
1416 N N   . ALA A 194 ? 0.1849 0.1523 0.1758 -0.0126 -0.0115 -0.0029 178  ALA A N   
1417 C CA  . ALA A 194 ? 0.1830 0.1454 0.1651 -0.0085 -0.0124 -0.0081 178  ALA A CA  
1418 C C   . ALA A 194 ? 0.2358 0.1914 0.2176 -0.0082 -0.0180 -0.0090 178  ALA A C   
1419 O O   . ALA A 194 ? 0.2230 0.1817 0.2122 -0.0108 -0.0184 -0.0069 178  ALA A O   
1420 C CB  . ALA A 194 ? 0.1741 0.1434 0.1541 -0.0066 -0.0057 -0.0105 178  ALA A CB  
1421 N N   . MET A 195 ? 0.1985 0.1447 0.1714 -0.0048 -0.0221 -0.0125 179  MET A N   
1422 C CA  . MET A 195 ? 0.2257 0.1632 0.1947 -0.0036 -0.0279 -0.0142 179  MET A CA  
1423 C C   . MET A 195 ? 0.2815 0.2124 0.2376 0.0019  -0.0269 -0.0190 179  MET A C   
1424 O O   . MET A 195 ? 0.2531 0.1832 0.2045 0.0046  -0.0246 -0.0206 179  MET A O   
1425 C CB  . MET A 195 ? 0.2658 0.1948 0.2386 -0.0059 -0.0373 -0.0121 179  MET A CB  
1426 C CG  . MET A 195 ? 0.3338 0.2560 0.3021 -0.0044 -0.0409 -0.0127 179  MET A CG  
1427 S SD  . MET A 195 ? 0.4227 0.3347 0.3972 -0.0076 -0.0528 -0.0098 179  MET A SD  
1428 C CE  . MET A 195 ? 0.3745 0.2741 0.3397 -0.0044 -0.0599 -0.0139 179  MET A CE  
1429 N N   . CYS A 196 ? 0.2814 0.2070 0.2318 0.0038  -0.0287 -0.0210 180  CYS A N   
1430 C CA  . CYS A 196 ? 0.3008 0.2189 0.2376 0.0095  -0.0273 -0.0251 180  CYS A CA  
1431 C C   . CYS A 196 ? 0.3390 0.2449 0.2684 0.0108  -0.0350 -0.0265 180  CYS A C   
1432 O O   . CYS A 196 ? 0.3081 0.2159 0.2443 0.0074  -0.0380 -0.0245 180  CYS A O   
1433 C CB  . CYS A 196 ? 0.3052 0.2322 0.2418 0.0110  -0.0183 -0.0258 180  CYS A CB  
1434 S SG  . CYS A 196 ? 0.3634 0.2836 0.2853 0.0183  -0.0138 -0.0297 180  CYS A SG  
1435 N N   . SER A 197 ? 0.3366 0.2295 0.2522 0.0158  -0.0386 -0.0299 181  SER A N   
1436 C CA  . SER A 197 ? 0.3647 0.2429 0.2700 0.0178  -0.0473 -0.0318 181  SER A CA  
1437 C C   . SER A 197 ? 0.4519 0.3215 0.3392 0.0248  -0.0437 -0.0357 181  SER A C   
1438 O O   . SER A 197 ? 0.4424 0.3119 0.3234 0.0291  -0.0379 -0.0375 181  SER A O   
1439 C CB  . SER A 197 ? 0.4191 0.2861 0.3234 0.0174  -0.0575 -0.0322 181  SER A CB  
1440 O OG  . SER A 197 ? 0.4553 0.3302 0.3766 0.0111  -0.0602 -0.0279 181  SER A OG  
1441 N N   . LEU A 198 ? 0.4425 0.3043 0.3215 0.0262  -0.0471 -0.0366 182  LEU A N   
1442 C CA  . LEU A 198 ? 0.4875 0.3398 0.3477 0.0331  -0.0436 -0.0398 182  LEU A CA  
1443 C C   . LEU A 198 ? 0.5680 0.4017 0.4138 0.0356  -0.0545 -0.0420 182  LEU A C   
1444 O O   . LEU A 198 ? 0.5398 0.3723 0.3931 0.0311  -0.0626 -0.0403 182  LEU A O   
1445 C CB  . LEU A 198 ? 0.4907 0.3539 0.3534 0.0331  -0.0336 -0.0383 182  LEU A CB  
1446 C CG  . LEU A 198 ? 0.5667 0.4454 0.4393 0.0326  -0.0224 -0.0370 182  LEU A CG  
1447 C CD1 . LEU A 198 ? 0.5583 0.4473 0.4355 0.0317  -0.0146 -0.0352 182  LEU A CD1 
1448 C CD2 . LEU A 198 ? 0.6436 0.5178 0.5065 0.0388  -0.0174 -0.0393 182  LEU A CD2 
1449 N N   . ASP A 199 ? 0.5855 0.4039 0.4109 0.0429  -0.0555 -0.0459 183  ASP A N   
1450 C CA  . ASP A 199 ? 0.6304 0.4290 0.4395 0.0458  -0.0667 -0.0485 183  ASP A CA  
1451 C C   . ASP A 199 ? 0.7116 0.5080 0.5110 0.0478  -0.0636 -0.0482 183  ASP A C   
1452 O O   . ASP A 199 ? 0.7589 0.5511 0.5425 0.0542  -0.0554 -0.0498 183  ASP A O   
1453 C CB  . ASP A 199 ? 0.6910 0.4716 0.4812 0.0529  -0.0713 -0.0530 183  ASP A CB  
1454 C CG  . ASP A 199 ? 0.9197 0.6977 0.6941 0.0611  -0.0598 -0.0555 183  ASP A CG  
1455 O OD1 . ASP A 199 ? 0.9346 0.7289 0.7191 0.0603  -0.0475 -0.0533 183  ASP A OD1 
1456 O OD2 . ASP A 199 ? 1.0212 0.7805 0.7734 0.0685  -0.0633 -0.0595 183  ASP A OD2 
1457 N N   . ALA A 200 ? 0.6361 0.4372 0.4473 0.0419  -0.0689 -0.0455 184  ALA A N   
1458 C CA  . ALA A 200 ? 0.6415 0.4425 0.4482 0.0420  -0.0672 -0.0444 184  ALA A CA  
1459 C C   . ALA A 200 ? 0.7304 0.5101 0.5181 0.0454  -0.0788 -0.0467 184  ALA A C   
1460 O O   . ALA A 200 ? 0.7225 0.4996 0.5023 0.0468  -0.0771 -0.0460 184  ALA A O   
1461 C CB  . ALA A 200 ? 0.6267 0.4449 0.4575 0.0341  -0.0664 -0.0402 184  ALA A CB  
1462 N N   . GLN A 201 ? 0.7082 0.4724 0.4892 0.0465  -0.0913 -0.0492 185  GLN A N   
1463 C CA  . GLN A 201 ? 0.7456 0.4871 0.5082 0.0497  -0.1050 -0.0519 185  GLN A CA  
1464 C C   . GLN A 201 ? 0.7796 0.5233 0.5511 0.0450  -0.1110 -0.0490 185  GLN A C   
1465 O O   . GLN A 201 ? 0.7921 0.5277 0.5477 0.0486  -0.1100 -0.0496 185  GLN A O   
1466 C CB  . GLN A 201 ? 0.7918 0.5159 0.5225 0.0598  -0.1010 -0.0560 185  GLN A CB  
1467 N N   . ILE A 202 ? 0.6844 0.4406 0.4828 0.0369  -0.1158 -0.0455 186  ILE A N   
1468 C CA  . ILE A 202 ? 0.6457 0.4072 0.4591 0.0313  -0.1213 -0.0422 186  ILE A CA  
1469 C C   . ILE A 202 ? 0.6791 0.4205 0.4870 0.0311  -0.1404 -0.0435 186  ILE A C   
1470 O O   . ILE A 202 ? 0.6581 0.3912 0.4674 0.0307  -0.1493 -0.0447 186  ILE A O   
1471 C CB  . ILE A 202 ? 0.6409 0.4261 0.4860 0.0234  -0.1156 -0.0376 186  ILE A CB  
1472 C CG1 . ILE A 202 ? 0.6219 0.4251 0.4703 0.0240  -0.0979 -0.0366 186  ILE A CG1 
1473 C CG2 . ILE A 202 ? 0.6247 0.4156 0.4898 0.0172  -0.1229 -0.0338 186  ILE A CG2 
1474 C CD1 . ILE A 202 ? 0.6365 0.4598 0.5091 0.0183  -0.0911 -0.0333 186  ILE A CD1 
1475 N N   . PRO A 203 ? 0.6543 0.3875 0.4571 0.0311  -0.1476 -0.0430 187  PRO A N   
1476 C CA  . PRO A 203 ? 0.6664 0.3789 0.4636 0.0310  -0.1670 -0.0444 187  PRO A CA  
1477 C C   . PRO A 203 ? 0.6731 0.3933 0.5012 0.0229  -0.1775 -0.0404 187  PRO A C   
1478 O O   . PRO A 203 ? 0.6524 0.3709 0.4922 0.0191  -0.1872 -0.0380 187  PRO A O   
1479 C CB  . PRO A 203 ? 0.7060 0.4090 0.4883 0.0337  -0.1697 -0.0447 187  PRO A CB  
1480 C CG  . PRO A 203 ? 0.7357 0.4619 0.5334 0.0304  -0.1544 -0.0411 187  PRO A CG  
1481 C CD  . PRO A 203 ? 0.6664 0.4067 0.4667 0.0315  -0.1392 -0.0414 187  PRO A CD  
1482 N N   . SER A 204 ? 0.6036 0.3309 0.4446 0.0203  -0.1762 -0.0396 188  SER A N   
1483 C CA  . SER A 204 ? 0.5906 0.3256 0.4613 0.0128  -0.1846 -0.0352 188  SER A CA  
1484 C C   . SER A 204 ? 0.6332 0.3608 0.5033 0.0132  -0.1904 -0.0365 188  SER A C   
1485 O O   . SER A 204 ? 0.6122 0.3393 0.4677 0.0176  -0.1817 -0.0396 188  SER A O   
1486 C CB  . SER A 204 ? 0.6306 0.3931 0.5285 0.0068  -0.1710 -0.0299 188  SER A CB  
1487 O OG  . SER A 204 ? 0.7665 0.5363 0.6936 -0.0003 -0.1788 -0.0248 188  SER A OG  
1488 N N   . GLN A 205 ? 0.6278 0.3493 0.5145 0.0086  -0.2056 -0.0341 189  GLN A N   
1489 C CA  . GLN A 205 ? 0.6465 0.3612 0.5359 0.0082  -0.2124 -0.0347 189  GLN A CA  
1490 C C   . GLN A 205 ? 0.7185 0.4533 0.6418 0.0002  -0.2087 -0.0280 189  GLN A C   
1491 O O   . GLN A 205 ? 0.7339 0.4705 0.6606 -0.0004 -0.2071 -0.0277 189  GLN A O   
1492 C CB  . GLN A 205 ? 0.6861 0.3741 0.5643 0.0102  -0.2338 -0.0377 189  GLN A CB  
1493 C CG  . GLN A 205 ? 0.8332 0.4993 0.6737 0.0198  -0.2355 -0.0454 189  GLN A CG  
1494 C CD  . GLN A 205 ? 0.9584 0.5958 0.7813 0.0233  -0.2561 -0.0494 189  GLN A CD  
1495 O OE1 . GLN A 205 ? 0.8570 0.4899 0.6976 0.0182  -0.2713 -0.0463 189  GLN A OE1 
1496 N NE2 . GLN A 205 ? 0.9180 0.5350 0.7057 0.0324  -0.2572 -0.0562 189  GLN A NE2 
1497 N N   . ASP A 206 ? 0.6585 0.4081 0.6066 -0.0058 -0.2070 -0.0224 190  ASP A N   
1498 C CA  . ASP A 206 ? 0.6323 0.4014 0.6131 -0.0132 -0.2027 -0.0153 190  ASP A CA  
1499 C C   . ASP A 206 ? 0.6203 0.4115 0.6056 -0.0138 -0.1822 -0.0137 190  ASP A C   
1500 O O   . ASP A 206 ? 0.6115 0.4066 0.5818 -0.0100 -0.1719 -0.0167 190  ASP A O   
1501 C CB  . ASP A 206 ? 0.6551 0.4293 0.6616 -0.0189 -0.2106 -0.0099 190  ASP A CB  
1502 C CG  . ASP A 206 ? 0.8236 0.5759 0.8282 -0.0189 -0.2323 -0.0111 190  ASP A CG  
1503 O OD1 . ASP A 206 ? 0.8548 0.5882 0.8432 -0.0156 -0.2430 -0.0151 190  ASP A OD1 
1504 O OD2 . ASP A 206 ? 0.9045 0.6581 0.9243 -0.0219 -0.2392 -0.0081 190  ASP A OD2 
1505 N N   . ARG A 207 ? 0.5327 0.3379 0.5387 -0.0185 -0.1769 -0.0086 191  ARG A N   
1506 C CA  . ARG A 207 ? 0.4997 0.3255 0.5116 -0.0195 -0.1587 -0.0066 191  ARG A CA  
1507 C C   . ARG A 207 ? 0.5152 0.3560 0.5437 -0.0227 -0.1522 -0.0029 191  ARG A C   
1508 O O   . ARG A 207 ? 0.5022 0.3453 0.5524 -0.0273 -0.1598 0.0019  191  ARG A O   
1509 C CB  . ARG A 207 ? 0.4991 0.3340 0.5273 -0.0235 -0.1557 -0.0019 191  ARG A CB  
1510 C CG  . ARG A 207 ? 0.6191 0.4714 0.6466 -0.0231 -0.1377 -0.0012 191  ARG A CG  
1511 C CD  . ARG A 207 ? 0.7258 0.5896 0.7731 -0.0280 -0.1337 0.0051  191  ARG A CD  
1512 N NE  . ARG A 207 ? 0.9248 0.7772 0.9655 -0.0271 -0.1410 0.0039  191  ARG A NE  
1513 C CZ  . ARG A 207 ? 1.1172 0.9759 1.1577 -0.0274 -0.1338 0.0052  191  ARG A CZ  
1514 N NH1 . ARG A 207 ? 0.9790 0.8547 1.0245 -0.0285 -0.1191 0.0076  191  ARG A NH1 
1515 N NH2 . ARG A 207 ? 0.9061 0.7532 0.9409 -0.0265 -0.1416 0.0040  191  ARG A NH2 
1516 N N   . HIS A 208 ? 0.4539 0.3040 0.4722 -0.0199 -0.1389 -0.0052 192  HIS A N   
1517 C CA  . HIS A 208 ? 0.4458 0.3107 0.4771 -0.0220 -0.1307 -0.0025 192  HIS A CA  
1518 C C   . HIS A 208 ? 0.4478 0.3307 0.4831 -0.0225 -0.1141 -0.0011 192  HIS A C   
1519 O O   . HIS A 208 ? 0.4333 0.3146 0.4512 -0.0188 -0.1077 -0.0049 192  HIS A O   
1520 C CB  . HIS A 208 ? 0.4780 0.3359 0.4911 -0.0177 -0.1306 -0.0070 192  HIS A CB  
1521 C CG  . HIS A 208 ? 0.5542 0.3969 0.5662 -0.0177 -0.1461 -0.0076 192  HIS A CG  
1522 N ND1 . HIS A 208 ? 0.6063 0.4277 0.6003 -0.0145 -0.1590 -0.0114 192  HIS A ND1 
1523 C CD2 . HIS A 208 ? 0.5895 0.4347 0.6155 -0.0203 -0.1508 -0.0050 192  HIS A CD2 
1524 C CE1 . HIS A 208 ? 0.6174 0.4287 0.6149 -0.0154 -0.1718 -0.0109 192  HIS A CE1 
1525 N NE2 . HIS A 208 ? 0.6119 0.4372 0.6290 -0.0190 -0.1674 -0.0070 192  HIS A NE2 
1526 N N   . GLN A 209 ? 0.3462 0.2453 0.4037 -0.0267 -0.1073 0.0041  193  GLN A N   
1527 C CA  . GLN A 209 ? 0.2975 0.2129 0.3589 -0.0272 -0.0922 0.0056  193  GLN A CA  
1528 C C   . GLN A 209 ? 0.3285 0.2570 0.4014 -0.0284 -0.0842 0.0075  193  GLN A C   
1529 O O   . GLN A 209 ? 0.3175 0.2485 0.4082 -0.0313 -0.0891 0.0112  193  GLN A O   
1530 C CB  . GLN A 209 ? 0.2908 0.2132 0.3685 -0.0312 -0.0906 0.0112  193  GLN A CB  
1531 C CG  . GLN A 209 ? 0.2960 0.2077 0.3640 -0.0303 -0.0966 0.0098  193  GLN A CG  
1532 C CD  . GLN A 209 ? 0.3971 0.3186 0.4793 -0.0338 -0.0913 0.0155  193  GLN A CD  
1533 O OE1 . GLN A 209 ? 0.3803 0.3136 0.4831 -0.0377 -0.0869 0.0215  193  GLN A OE1 
1534 N NE2 . GLN A 209 ? 0.3050 0.2216 0.3763 -0.0324 -0.0912 0.0138  193  GLN A NE2 
1535 N N   . VAL A 210 ? 0.2597 0.1966 0.3235 -0.0260 -0.0724 0.0050  194  VAL A N   
1536 C CA  . VAL A 210 ? 0.2463 0.1963 0.3194 -0.0266 -0.0632 0.0063  194  VAL A CA  
1537 C C   . VAL A 210 ? 0.2661 0.2276 0.3368 -0.0260 -0.0502 0.0064  194  VAL A C   
1538 O O   . VAL A 210 ? 0.2641 0.2219 0.3195 -0.0235 -0.0478 0.0033  194  VAL A O   
1539 C CB  . VAL A 210 ? 0.3010 0.2472 0.3638 -0.0238 -0.0638 0.0024  194  VAL A CB  
1540 C CG1 . VAL A 210 ? 0.3049 0.2381 0.3680 -0.0241 -0.0775 0.0022  194  VAL A CG1 
1541 C CG2 . VAL A 210 ? 0.3057 0.2481 0.3458 -0.0193 -0.0583 -0.0028 194  VAL A CG2 
1542 N N   . ILE A 211 ? 0.2201 0.1950 0.3055 -0.0278 -0.0419 0.0098  195  ILE A N   
1543 C CA  . ILE A 211 ? 0.1926 0.1776 0.2749 -0.0269 -0.0300 0.0097  195  ILE A CA  
1544 C C   . ILE A 211 ? 0.2349 0.2261 0.3148 -0.0249 -0.0233 0.0071  195  ILE A C   
1545 O O   . ILE A 211 ? 0.2209 0.2183 0.3148 -0.0262 -0.0220 0.0094  195  ILE A O   
1546 C CB  . ILE A 211 ? 0.2042 0.1986 0.3024 -0.0298 -0.0247 0.0157  195  ILE A CB  
1547 C CG1 . ILE A 211 ? 0.2135 0.2016 0.3180 -0.0326 -0.0328 0.0194  195  ILE A CG1 
1548 C CG2 . ILE A 211 ? 0.1895 0.1916 0.2800 -0.0283 -0.0134 0.0149  195  ILE A CG2 
1549 C CD1 . ILE A 211 ? 0.2880 0.2854 0.4120 -0.0360 -0.0282 0.0270  195  ILE A CD1 
1550 N N   . VAL A 212 ? 0.1944 0.1841 0.2580 -0.0218 -0.0192 0.0025  196  VAL A N   
1551 C CA  . VAL A 212 ? 0.1771 0.1722 0.2382 -0.0199 -0.0133 0.0000  196  VAL A CA  
1552 C C   . VAL A 212 ? 0.2178 0.2237 0.2822 -0.0198 -0.0029 0.0010  196  VAL A C   
1553 O O   . VAL A 212 ? 0.2154 0.2211 0.2720 -0.0192 -0.0001 0.0004  196  VAL A O   
1554 C CB  . VAL A 212 ? 0.2127 0.2004 0.2560 -0.0166 -0.0143 -0.0048 196  VAL A CB  
1555 C CG1 . VAL A 212 ? 0.1990 0.1919 0.2413 -0.0150 -0.0090 -0.0068 196  VAL A CG1 
1556 C CG2 . VAL A 212 ? 0.2196 0.1945 0.2562 -0.0160 -0.0245 -0.0058 196  VAL A CG2 
1557 N N   . PRO A 213 ? 0.1861 0.2007 0.2610 -0.0201 0.0025  0.0022  197  PRO A N   
1558 C CA  . PRO A 213 ? 0.1826 0.2058 0.2579 -0.0192 0.0122  0.0026  197  PRO A CA  
1559 C C   . PRO A 213 ? 0.2129 0.2347 0.2726 -0.0166 0.0155  -0.0018 197  PRO A C   
1560 O O   . PRO A 213 ? 0.1980 0.2148 0.2491 -0.0151 0.0126  -0.0051 197  PRO A O   
1561 C CB  . PRO A 213 ? 0.2056 0.2358 0.2921 -0.0189 0.0160  0.0033  197  PRO A CB  
1562 C CG  . PRO A 213 ? 0.2559 0.2830 0.3541 -0.0209 0.0084  0.0056  197  PRO A CG  
1563 C CD  . PRO A 213 ? 0.2031 0.2193 0.2891 -0.0207 0.0000  0.0031  197  PRO A CD  
1564 N N   . ARG A 214 ? 0.1736 0.1993 0.2299 -0.0161 0.0213  -0.0013 198  ARG A N   
1565 C CA  . ARG A 214 ? 0.1859 0.2101 0.2291 -0.0139 0.0238  -0.0048 198  ARG A CA  
1566 C C   . ARG A 214 ? 0.2186 0.2440 0.2578 -0.0118 0.0257  -0.0087 198  ARG A C   
1567 O O   . ARG A 214 ? 0.2047 0.2260 0.2349 -0.0104 0.0240  -0.0115 198  ARG A O   
1568 C CB  . ARG A 214 ? 0.1929 0.2205 0.2333 -0.0137 0.0292  -0.0034 198  ARG A CB  
1569 C CG  . ARG A 214 ? 0.2826 0.3173 0.3284 -0.0131 0.0362  -0.0021 198  ARG A CG  
1570 C CD  . ARG A 214 ? 0.3025 0.3382 0.3404 -0.0120 0.0411  -0.0017 198  ARG A CD  
1571 N NE  . ARG A 214 ? 0.3098 0.3429 0.3363 -0.0099 0.0406  -0.0062 198  ARG A NE  
1572 C CZ  . ARG A 214 ? 0.4489 0.4777 0.4673 -0.0098 0.0379  -0.0071 198  ARG A CZ  
1573 N NH1 . ARG A 214 ? 0.2904 0.3167 0.3094 -0.0115 0.0355  -0.0040 198  ARG A NH1 
1574 N NH2 . ARG A 214 ? 0.3019 0.3290 0.3126 -0.0079 0.0375  -0.0110 198  ARG A NH2 
1575 N N   . LYS A 215 ? 0.1992 0.2301 0.2458 -0.0115 0.0292  -0.0085 199  LYS A N   
1576 C CA  . LYS A 215 ? 0.2092 0.2411 0.2533 -0.0097 0.0306  -0.0119 199  LYS A CA  
1577 C C   . LYS A 215 ? 0.2612 0.2876 0.3031 -0.0097 0.0251  -0.0132 199  LYS A C   
1578 O O   . LYS A 215 ? 0.2624 0.2865 0.2968 -0.0081 0.0251  -0.0158 199  LYS A O   
1579 C CB  . LYS A 215 ? 0.2394 0.2776 0.2922 -0.0091 0.0352  -0.0115 199  LYS A CB  
1580 C CG  . LYS A 215 ? 0.3028 0.3421 0.3522 -0.0070 0.0372  -0.0152 199  LYS A CG  
1581 C CD  . LYS A 215 ? 0.4528 0.4975 0.5103 -0.0058 0.0416  -0.0153 199  LYS A CD  
1582 C CE  . LYS A 215 ? 0.6139 0.6588 0.6676 -0.0037 0.0429  -0.0192 199  LYS A CE  
1583 N NZ  . LYS A 215 ? 0.7850 0.8343 0.8440 -0.0018 0.0478  -0.0199 199  LYS A NZ  
1584 N N   . GLY A 216 ? 0.1944 0.2180 0.2423 -0.0113 0.0201  -0.0109 200  GLY A N   
1585 C CA  . GLY A 216 ? 0.2026 0.2193 0.2470 -0.0111 0.0141  -0.0118 200  GLY A CA  
1586 C C   . GLY A 216 ? 0.2442 0.2534 0.2756 -0.0098 0.0114  -0.0134 200  GLY A C   
1587 O O   . GLY A 216 ? 0.2236 0.2284 0.2473 -0.0081 0.0103  -0.0153 200  GLY A O   
1588 N N   . ILE A 217 ? 0.1866 0.1939 0.2157 -0.0105 0.0104  -0.0123 201  ILE A N   
1589 C CA  . ILE A 217 ? 0.1699 0.1698 0.1870 -0.0089 0.0079  -0.0139 201  ILE A CA  
1590 C C   . ILE A 217 ? 0.2197 0.2216 0.2291 -0.0065 0.0131  -0.0165 201  ILE A C   
1591 O O   . ILE A 217 ? 0.2204 0.2168 0.2210 -0.0044 0.0121  -0.0181 201  ILE A O   
1592 C CB  . ILE A 217 ? 0.1935 0.1900 0.2103 -0.0101 0.0047  -0.0122 201  ILE A CB  
1593 C CG1 . ILE A 217 ? 0.2090 0.1952 0.2138 -0.0081 -0.0001 -0.0140 201  ILE A CG1 
1594 C CG2 . ILE A 217 ? 0.1866 0.1897 0.2055 -0.0107 0.0101  -0.0113 201  ILE A CG2 
1595 C CD1 . ILE A 217 ? 0.2698 0.2466 0.2723 -0.0080 -0.0079 -0.0140 201  ILE A CD1 
1596 N N   . LEU A 218 ? 0.2172 0.2265 0.2304 -0.0067 0.0183  -0.0166 202  LEU A N   
1597 C CA  . LEU A 218 ? 0.2198 0.2312 0.2282 -0.0048 0.0223  -0.0188 202  LEU A CA  
1598 C C   . LEU A 218 ? 0.2782 0.2894 0.2861 -0.0036 0.0229  -0.0201 202  LEU A C   
1599 O O   . LEU A 218 ? 0.2686 0.2774 0.2706 -0.0017 0.0238  -0.0212 202  LEU A O   
1600 C CB  . LEU A 218 ? 0.2083 0.2261 0.2199 -0.0052 0.0265  -0.0189 202  LEU A CB  
1601 C CG  . LEU A 218 ? 0.2552 0.2728 0.2654 -0.0061 0.0265  -0.0173 202  LEU A CG  
1602 C CD1 . LEU A 218 ? 0.2487 0.2715 0.2606 -0.0062 0.0308  -0.0171 202  LEU A CD1 
1603 C CD2 . LEU A 218 ? 0.2886 0.3016 0.2911 -0.0048 0.0249  -0.0183 202  LEU A CD2 
1604 N N   . GLU A 219 ? 0.2491 0.2623 0.2636 -0.0046 0.0221  -0.0195 203  GLU A N   
1605 C CA  . GLU A 219 ? 0.2524 0.2649 0.2672 -0.0038 0.0221  -0.0202 203  GLU A CA  
1606 C C   . GLU A 219 ? 0.3034 0.3076 0.3097 -0.0025 0.0186  -0.0201 203  GLU A C   
1607 O O   . GLU A 219 ? 0.2849 0.2875 0.2862 -0.0006 0.0205  -0.0207 203  GLU A O   
1608 C CB  . GLU A 219 ? 0.2601 0.2760 0.2846 -0.0052 0.0213  -0.0193 203  GLU A CB  
1609 C CG  . GLU A 219 ? 0.3890 0.4040 0.4146 -0.0045 0.0207  -0.0199 203  GLU A CG  
1610 C CD  . GLU A 219 ? 0.5966 0.6142 0.6205 -0.0030 0.0244  -0.0214 203  GLU A CD  
1611 O OE1 . GLU A 219 ? 0.4294 0.4515 0.4545 -0.0027 0.0278  -0.0226 203  GLU A OE1 
1612 O OE2 . GLU A 219 ? 0.4457 0.4602 0.4671 -0.0022 0.0236  -0.0213 203  GLU A OE2 
1613 N N   . LEU A 220 ? 0.2558 0.2542 0.2601 -0.0032 0.0136  -0.0190 204  LEU A N   
1614 C CA  . LEU A 220 ? 0.2400 0.2285 0.2338 -0.0015 0.0096  -0.0193 204  LEU A CA  
1615 C C   . LEU A 220 ? 0.2958 0.2815 0.2795 0.0014  0.0129  -0.0205 204  LEU A C   
1616 O O   . LEU A 220 ? 0.2867 0.2674 0.2625 0.0038  0.0137  -0.0207 204  LEU A O   
1617 C CB  . LEU A 220 ? 0.2287 0.2106 0.2220 -0.0027 0.0028  -0.0183 204  LEU A CB  
1618 C CG  . LEU A 220 ? 0.2814 0.2507 0.2618 -0.0004 -0.0026 -0.0189 204  LEU A CG  
1619 C CD1 . LEU A 220 ? 0.2706 0.2361 0.2467 0.0009  -0.0035 -0.0190 204  LEU A CD1 
1620 C CD2 . LEU A 220 ? 0.3285 0.2914 0.3107 -0.0020 -0.0107 -0.0180 204  LEU A CD2 
1621 N N   . ALA A 221 ? 0.2820 0.2708 0.2663 0.0013  0.0151  -0.0209 205  ALA A N   
1622 C CA  . ALA A 221 ? 0.2839 0.2709 0.2611 0.0039  0.0181  -0.0218 205  ALA A CA  
1623 C C   . ALA A 221 ? 0.3535 0.3445 0.3316 0.0055  0.0233  -0.0220 205  ALA A C   
1624 O O   . ALA A 221 ? 0.3378 0.3247 0.3088 0.0084  0.0254  -0.0221 205  ALA A O   
1625 C CB  . ALA A 221 ? 0.2835 0.2742 0.2635 0.0030  0.0190  -0.0220 205  ALA A CB  
1626 N N   . ARG A 222 ? 0.3341 0.3327 0.3212 0.0037  0.0253  -0.0220 206  ARG A N   
1627 C CA  . ARG A 222 ? 0.3412 0.3442 0.3318 0.0046  0.0293  -0.0221 206  ARG A CA  
1628 C C   . ARG A 222 ? 0.4033 0.4021 0.3901 0.0059  0.0295  -0.0211 206  ARG A C   
1629 O O   . ARG A 222 ? 0.4068 0.4068 0.3939 0.0074  0.0331  -0.0203 206  ARG A O   
1630 C CB  . ARG A 222 ? 0.3475 0.3579 0.3474 0.0026  0.0304  -0.0227 206  ARG A CB  
1631 C CG  . ARG A 222 ? 0.4893 0.5036 0.4915 0.0020  0.0313  -0.0236 206  ARG A CG  
1632 C CD  . ARG A 222 ? 0.5589 0.5789 0.5679 0.0008  0.0324  -0.0245 206  ARG A CD  
1633 N NE  . ARG A 222 ? 0.7229 0.7449 0.7321 -0.0001 0.0325  -0.0248 206  ARG A NE  
1634 C CZ  . ARG A 222 ? 0.7397 0.7637 0.7521 -0.0014 0.0324  -0.0242 206  ARG A CZ  
1635 N NH1 . ARG A 222 ? 0.4399 0.4644 0.4567 -0.0022 0.0316  -0.0237 206  ARG A NH1 
1636 N NH2 . ARG A 222 ? 0.6073 0.6328 0.6189 -0.0019 0.0333  -0.0240 206  ARG A NH2 
1637 N N   . LEU A 223 ? 0.3508 0.3442 0.3342 0.0053  0.0253  -0.0206 207  LEU A N   
1638 C CA  . LEU A 223 ? 0.3543 0.3419 0.3323 0.0065  0.0242  -0.0195 207  LEU A CA  
1639 C C   . LEU A 223 ? 0.3969 0.3749 0.3609 0.0100  0.0245  -0.0191 207  LEU A C   
1640 O O   . LEU A 223 ? 0.3817 0.3549 0.3394 0.0118  0.0254  -0.0178 207  LEU A O   
1641 C CB  . LEU A 223 ? 0.3584 0.3435 0.3391 0.0045  0.0185  -0.0193 207  LEU A CB  
1642 C CG  . LEU A 223 ? 0.4115 0.4049 0.4054 0.0017  0.0185  -0.0194 207  LEU A CG  
1643 C CD1 . LEU A 223 ? 0.4176 0.4081 0.4152 0.0000  0.0126  -0.0188 207  LEU A CD1 
1644 C CD2 . LEU A 223 ? 0.4315 0.4288 0.4299 0.0020  0.0216  -0.0191 207  LEU A CD2 
1645 N N   . LEU A 224 ? 0.3356 0.3100 0.2940 0.0111  0.0233  -0.0201 208  LEU A N   
1646 C CA  . LEU A 224 ? 0.3485 0.3125 0.2924 0.0150  0.0231  -0.0203 208  LEU A CA  
1647 C C   . LEU A 224 ? 0.4684 0.4346 0.4102 0.0182  0.0306  -0.0196 208  LEU A C   
1648 O O   . LEU A 224 ? 0.4840 0.4484 0.4219 0.0203  0.0321  -0.0204 208  LEU A O   
1649 C CB  . LEU A 224 ? 0.3398 0.2983 0.2793 0.0148  0.0179  -0.0218 208  LEU A CB  
1650 C CG  . LEU A 224 ? 0.3590 0.3146 0.3017 0.0118  0.0102  -0.0218 208  LEU A CG  
1651 C CD1 . LEU A 224 ? 0.3429 0.2961 0.2860 0.0108  0.0059  -0.0227 208  LEU A CD1 
1652 C CD2 . LEU A 224 ? 0.3901 0.3344 0.3219 0.0135  0.0053  -0.0216 208  LEU A CD2 
1653 N N   . THR A 225 ? 0.4736 0.4434 0.4189 0.0186  0.0350  -0.0177 209  THR A N   
1654 C CA  . THR A 225 ? 0.4995 0.4733 0.4473 0.0209  0.0424  -0.0160 209  THR A CA  
1655 C C   . THR A 225 ? 0.6204 0.5858 0.5550 0.0259  0.0467  -0.0143 209  THR A C   
1656 O O   . THR A 225 ? 0.6276 0.5954 0.5637 0.0286  0.0529  -0.0131 209  THR A O   
1657 C CB  . THR A 225 ? 0.5353 0.5185 0.4968 0.0183  0.0446  -0.0146 209  THR A CB  
1658 O OG1 . THR A 225 ? 0.4821 0.4621 0.4414 0.0173  0.0423  -0.0135 209  THR A OG1 
1659 C CG2 . THR A 225 ? 0.4845 0.4763 0.4583 0.0147  0.0423  -0.0165 209  THR A CG2 
1660 N N   . GLU A 226 ? 0.6120 0.5672 0.5336 0.0274  0.0437  -0.0139 210  GLU A N   
1661 C CA  . GLU A 226 ? 0.6380 0.5829 0.5434 0.0328  0.0477  -0.0123 210  GLU A CA  
1662 C C   . GLU A 226 ? 0.7164 0.6547 0.6112 0.0368  0.0485  -0.0143 210  GLU A C   
1663 O O   . GLU A 226 ? 0.7157 0.6445 0.5999 0.0374  0.0417  -0.0169 210  GLU A O   
1664 C CB  . GLU A 226 ? 0.6655 0.5996 0.5582 0.0332  0.0425  -0.0119 210  GLU A CB  
1665 C CG  . GLU A 226 ? 0.7871 0.7266 0.6895 0.0297  0.0415  -0.0098 210  GLU A CG  
1666 C CD  . GLU A 226 ? 1.1102 1.0409 1.0052 0.0285  0.0332  -0.0103 210  GLU A CD  
1667 O OE1 . GLU A 226 ? 1.0540 0.9708 0.9304 0.0321  0.0304  -0.0107 210  GLU A OE1 
1668 O OE2 . GLU A 226 ? 1.0928 1.0299 1.0004 0.0241  0.0293  -0.0105 210  GLU A OE2 
1669 N N   . GLN A 227 ? 0.6848 0.6282 0.5840 0.0395  0.0563  -0.0131 211  GLN A N   
1670 C CA  . GLN A 227 ? 0.6869 0.6261 0.5793 0.0438  0.0587  -0.0147 211  GLN A CA  
1671 C C   . GLN A 227 ? 0.7416 0.6643 0.6110 0.0491  0.0566  -0.0163 211  GLN A C   
1672 O O   . GLN A 227 ? 0.7498 0.6671 0.6132 0.0509  0.0533  -0.0192 211  GLN A O   
1673 C CB  . GLN A 227 ? 0.7023 0.6493 0.6039 0.0464  0.0686  -0.0119 211  GLN A CB  
1674 N N   . ASP A 228 ? 0.6831 0.5972 0.5392 0.0518  0.0581  -0.0144 212  ASP A N   
1675 C CA  . ASP A 228 ? 0.6968 0.5933 0.5285 0.0574  0.0556  -0.0160 212  ASP A CA  
1676 C C   . ASP A 228 ? 0.7131 0.6008 0.5366 0.0548  0.0457  -0.0168 212  ASP A C   
1677 O O   . ASP A 228 ? 0.7423 0.6140 0.5444 0.0591  0.0424  -0.0178 212  ASP A O   
1678 C CB  . ASP A 228 ? 0.7396 0.6308 0.5590 0.0643  0.0665  -0.0128 212  ASP A CB  
1679 N N   . GLY A 229 ? 0.6026 0.5003 0.4429 0.0481  0.0409  -0.0166 213  GLY A N   
1680 C CA  . GLY A 229 ? 0.5798 0.4720 0.4176 0.0449  0.0316  -0.0170 213  GLY A CA  
1681 C C   . GLY A 229 ? 0.5839 0.4685 0.4182 0.0432  0.0203  -0.0206 213  GLY A C   
1682 O O   . GLY A 229 ? 0.5575 0.4453 0.3974 0.0423  0.0189  -0.0227 213  GLY A O   
1683 N N   . GLU A 230 ? 0.5231 0.3973 0.3489 0.0425  0.0116  -0.0209 214  GLU A N   
1684 C CA  . GLU A 230 ? 0.5064 0.3726 0.3306 0.0404  -0.0006 -0.0235 214  GLU A CA  
1685 C C   . GLU A 230 ? 0.4776 0.3546 0.3223 0.0334  -0.0057 -0.0226 214  GLU A C   
1686 O O   . GLU A 230 ? 0.4456 0.3315 0.2998 0.0312  -0.0015 -0.0203 214  GLU A O   
1687 C CB  . GLU A 230 ? 0.5515 0.3974 0.3525 0.0445  -0.0080 -0.0244 214  GLU A CB  
1688 C CG  . GLU A 230 ? 0.7385 0.5700 0.5160 0.0520  -0.0053 -0.0263 214  GLU A CG  
1689 C CD  . GLU A 230 ? 0.8876 0.7176 0.6663 0.0526  -0.0084 -0.0295 214  GLU A CD  
1690 O OE1 . GLU A 230 ? 0.7648 0.6015 0.5459 0.0550  0.0008  -0.0296 214  GLU A OE1 
1691 O OE2 . GLU A 230 ? 0.7321 0.5553 0.5118 0.0502  -0.0203 -0.0316 214  GLU A OE2 
1692 N N   . VAL A 231 ? 0.4069 0.2829 0.2586 0.0302  -0.0146 -0.0242 215  VAL A N   
1693 C CA  . VAL A 231 ? 0.3778 0.2624 0.2484 0.0241  -0.0201 -0.0232 215  VAL A CA  
1694 C C   . VAL A 231 ? 0.4109 0.2832 0.2778 0.0231  -0.0333 -0.0243 215  VAL A C   
1695 O O   . VAL A 231 ? 0.3989 0.2625 0.2579 0.0248  -0.0379 -0.0263 215  VAL A O   
1696 C CB  . VAL A 231 ? 0.3870 0.2892 0.2786 0.0199  -0.0150 -0.0228 215  VAL A CB  
1697 C CG1 . VAL A 231 ? 0.3770 0.2784 0.2680 0.0203  -0.0158 -0.0245 215  VAL A CG1 
1698 C CG2 . VAL A 231 ? 0.3730 0.2838 0.2831 0.0144  -0.0192 -0.0215 215  VAL A CG2 
1699 N N   . GLY A 232 ? 0.3876 0.2587 0.2604 0.0204  -0.0395 -0.0230 216  GLY A N   
1700 C CA  . GLY A 232 ? 0.3886 0.2496 0.2625 0.0186  -0.0529 -0.0234 216  GLY A CA  
1701 C C   . GLY A 232 ? 0.4030 0.2772 0.3016 0.0128  -0.0549 -0.0222 216  GLY A C   
1702 O O   . GLY A 232 ? 0.3747 0.2641 0.2897 0.0097  -0.0484 -0.0205 216  GLY A O   
1703 N N   . ILE A 233 ? 0.3594 0.2278 0.2605 0.0115  -0.0632 -0.0229 217  ILE A N   
1704 C CA  . ILE A 233 ? 0.3207 0.2006 0.2448 0.0063  -0.0650 -0.0211 217  ILE A CA  
1705 C C   . ILE A 233 ? 0.3761 0.2483 0.3084 0.0035  -0.0785 -0.0199 217  ILE A C   
1706 O O   . ILE A 233 ? 0.3810 0.2362 0.2993 0.0058  -0.0887 -0.0214 217  ILE A O   
1707 C CB  . ILE A 233 ? 0.3559 0.2391 0.2808 0.0064  -0.0617 -0.0220 217  ILE A CB  
1708 C CG1 . ILE A 233 ? 0.3529 0.2439 0.2711 0.0091  -0.0487 -0.0231 217  ILE A CG1 
1709 C CG2 . ILE A 233 ? 0.3600 0.2545 0.3082 0.0009  -0.0633 -0.0194 217  ILE A CG2 
1710 C CD1 . ILE A 233 ? 0.3758 0.2848 0.3094 0.0065  -0.0387 -0.0214 217  ILE A CD1 
1711 N N   . VAL A 234 ? 0.3281 0.2126 0.2838 -0.0012 -0.0787 -0.0170 218  VAL A N   
1712 C CA  . VAL A 234 ? 0.3478 0.2280 0.3173 -0.0046 -0.0908 -0.0149 218  VAL A CA  
1713 C C   . VAL A 234 ? 0.4100 0.3037 0.4023 -0.0090 -0.0882 -0.0121 218  VAL A C   
1714 O O   . VAL A 234 ? 0.3716 0.2813 0.3771 -0.0108 -0.0780 -0.0106 218  VAL A O   
1715 C CB  . VAL A 234 ? 0.4003 0.2808 0.3773 -0.0058 -0.0948 -0.0134 218  VAL A CB  
1716 C CG1 . VAL A 234 ? 0.4018 0.2779 0.3954 -0.0093 -0.1081 -0.0109 218  VAL A CG1 
1717 C CG2 . VAL A 234 ? 0.4147 0.2815 0.3677 -0.0013 -0.0966 -0.0156 218  VAL A CG2 
1718 N N   . LEU A 235 ? 0.3958 0.2822 0.3916 -0.0104 -0.0972 -0.0114 219  LEU A N   
1719 C CA  . LEU A 235 ? 0.3872 0.2853 0.4052 -0.0147 -0.0955 -0.0079 219  LEU A CA  
1720 C C   . LEU A 235 ? 0.4662 0.3646 0.5055 -0.0186 -0.1052 -0.0041 219  LEU A C   
1721 O O   . LEU A 235 ? 0.4869 0.3709 0.5233 -0.0187 -0.1190 -0.0043 219  LEU A O   
1722 C CB  . LEU A 235 ? 0.3885 0.2803 0.4007 -0.0144 -0.0986 -0.0086 219  LEU A CB  
1723 C CG  . LEU A 235 ? 0.4360 0.3262 0.4282 -0.0104 -0.0904 -0.0122 219  LEU A CG  
1724 C CD1 . LEU A 235 ? 0.4330 0.3158 0.4217 -0.0104 -0.0956 -0.0126 219  LEU A CD1 
1725 C CD2 . LEU A 235 ? 0.4249 0.3328 0.4233 -0.0109 -0.0752 -0.0114 219  LEU A CD2 
1726 N N   . GLY A 236 ? 0.4170 0.3314 0.4774 -0.0215 -0.0981 -0.0008 220  GLY A N   
1727 C CA  . GLY A 236 ? 0.4290 0.3470 0.5139 -0.0253 -0.1052 0.0035  220  GLY A CA  
1728 C C   . GLY A 236 ? 0.4652 0.3932 0.5712 -0.0290 -0.1028 0.0081  220  GLY A C   
1729 O O   . GLY A 236 ? 0.4461 0.3781 0.5462 -0.0286 -0.0956 0.0076  220  GLY A O   
1730 N N   . GLN A 237 ? 0.4363 0.3686 0.5676 -0.0327 -0.1085 0.0129  221  GLN A N   
1731 C CA  . GLN A 237 ? 0.4256 0.3684 0.5801 -0.0365 -0.1056 0.0186  221  GLN A CA  
1732 C C   . GLN A 237 ? 0.4238 0.3853 0.5870 -0.0365 -0.0885 0.0203  221  GLN A C   
1733 O O   . GLN A 237 ? 0.4123 0.3815 0.5825 -0.0380 -0.0819 0.0233  221  GLN A O   
1734 C CB  . GLN A 237 ? 0.4557 0.3976 0.6368 -0.0403 -0.1170 0.0239  221  GLN A CB  
1735 C CG  . GLN A 237 ? 0.7875 0.7319 0.9788 -0.0401 -0.1192 0.0242  221  GLN A CG  
1736 C CD  . GLN A 237 ? 1.0815 1.0194 1.2938 -0.0432 -0.1346 0.0282  221  GLN A CD  
1737 O OE1 . GLN A 237 ? 1.0352 0.9608 1.2477 -0.0447 -0.1477 0.0290  221  GLN A OE1 
1738 N NE2 . GLN A 237 ? 0.9475 0.8927 1.1781 -0.0441 -0.1343 0.0305  221  GLN A NE2 
1739 N N   . HIS A 238 ? 0.3605 0.3281 0.5216 -0.0346 -0.0819 0.0183  222  HIS A N   
1740 C CA  . HIS A 238 ? 0.3414 0.3250 0.5089 -0.0340 -0.0666 0.0191  222  HIS A CA  
1741 C C   . HIS A 238 ? 0.3331 0.3172 0.4790 -0.0302 -0.0584 0.0136  222  HIS A C   
1742 O O   . HIS A 238 ? 0.3024 0.2984 0.4518 -0.0293 -0.0465 0.0136  222  HIS A O   
1743 C CB  . HIS A 238 ? 0.3584 0.3521 0.5518 -0.0357 -0.0650 0.0233  222  HIS A CB  
1744 C CG  . HIS A 238 ? 0.4106 0.4070 0.6293 -0.0395 -0.0706 0.0299  222  HIS A CG  
1745 N ND1 . HIS A 238 ? 0.4335 0.4383 0.6621 -0.0412 -0.0632 0.0342  222  HIS A ND1 
1746 C CD2 . HIS A 238 ? 0.4392 0.4305 0.6753 -0.0419 -0.0830 0.0330  222  HIS A CD2 
1747 C CE1 . HIS A 238 ? 0.4280 0.4331 0.6804 -0.0446 -0.0709 0.0402  222  HIS A CE1 
1748 N NE2 . HIS A 238 ? 0.4379 0.4349 0.6960 -0.0452 -0.0833 0.0395  222  HIS A NE2 
1749 N N   . HIS A 239 ? 0.2955 0.2665 0.4196 -0.0279 -0.0647 0.0091  223  HIS A N   
1750 C CA  A HIS A 239 ? 0.2944 0.2651 0.3991 -0.0245 -0.0576 0.0045  223  HIS A CA  
1751 C CA  B HIS A 239 ? 0.2900 0.2606 0.3947 -0.0245 -0.0577 0.0045  223  HIS A CA  
1752 C C   . HIS A 239 ? 0.3439 0.3020 0.4241 -0.0219 -0.0611 0.0007  223  HIS A C   
1753 O O   . HIS A 239 ? 0.3710 0.3175 0.4467 -0.0223 -0.0712 0.0008  223  HIS A O   
1754 C CB  A HIS A 239 ? 0.3049 0.2744 0.4105 -0.0234 -0.0598 0.0034  223  HIS A CB  
1755 C CB  B HIS A 239 ? 0.2963 0.2655 0.4022 -0.0235 -0.0603 0.0034  223  HIS A CB  
1756 C CG  A HIS A 239 ? 0.3384 0.3216 0.4637 -0.0245 -0.0528 0.0057  223  HIS A CG  
1757 C CG  B HIS A 239 ? 0.3503 0.3029 0.4425 -0.0223 -0.0726 0.0016  223  HIS A CG  
1758 N ND1 A HIS A 239 ? 0.3612 0.3477 0.5094 -0.0270 -0.0581 0.0097  223  HIS A ND1 
1759 N ND1 B HIS A 239 ? 0.3810 0.3256 0.4836 -0.0244 -0.0855 0.0039  223  HIS A ND1 
1760 C CD2 A HIS A 239 ? 0.3537 0.3470 0.4786 -0.0229 -0.0417 0.0042  223  HIS A CD2 
1761 C CD2 B HIS A 239 ? 0.3751 0.3174 0.4439 -0.0190 -0.0737 -0.0022 223  HIS A CD2 
1762 C CE1 A HIS A 239 ? 0.3471 0.3460 0.5076 -0.0266 -0.0491 0.0106  223  HIS A CE1 
1763 C CE1 B HIS A 239 ? 0.3835 0.3123 0.4668 -0.0221 -0.0943 0.0011  223  HIS A CE1 
1764 N NE2 A HIS A 239 ? 0.3460 0.3488 0.4924 -0.0242 -0.0394 0.0071  223  HIS A NE2 
1765 N NE2 B HIS A 239 ? 0.3860 0.3130 0.4483 -0.0186 -0.0870 -0.0025 223  HIS A NE2 
1766 N N   . ILE A 240 ? 0.2731 0.2330 0.3380 -0.0190 -0.0528 -0.0026 224  ILE A N   
1767 C CA  . ILE A 240 ? 0.2743 0.2240 0.3158 -0.0157 -0.0533 -0.0063 224  ILE A CA  
1768 C C   . ILE A 240 ? 0.3216 0.2714 0.3543 -0.0132 -0.0494 -0.0085 224  ILE A C   
1769 O O   . ILE A 240 ? 0.3137 0.2750 0.3551 -0.0137 -0.0414 -0.0081 224  ILE A O   
1770 C CB  . ILE A 240 ? 0.2956 0.2487 0.3293 -0.0147 -0.0461 -0.0075 224  ILE A CB  
1771 C CG1 . ILE A 240 ? 0.3101 0.2522 0.3202 -0.0105 -0.0464 -0.0113 224  ILE A CG1 
1772 C CG2 . ILE A 240 ? 0.2763 0.2444 0.3175 -0.0151 -0.0341 -0.0071 224  ILE A CG2 
1773 C CD1 . ILE A 240 ? 0.3567 0.2980 0.3579 -0.0092 -0.0427 -0.0126 224  ILE A CD1 
1774 N N   . ARG A 241 ? 0.2853 0.2216 0.3008 -0.0105 -0.0552 -0.0105 225  ARG A N   
1775 C CA  . ARG A 241 ? 0.2830 0.2184 0.2888 -0.0081 -0.0514 -0.0120 225  ARG A CA  
1776 C C   . ARG A 241 ? 0.3434 0.2704 0.3266 -0.0041 -0.0484 -0.0146 225  ARG A C   
1777 O O   . ARG A 241 ? 0.3667 0.2814 0.3377 -0.0025 -0.0548 -0.0157 225  ARG A O   
1778 C CB  . ARG A 241 ? 0.2730 0.2003 0.2799 -0.0084 -0.0604 -0.0112 225  ARG A CB  
1779 C CG  . ARG A 241 ? 0.3456 0.2728 0.3443 -0.0062 -0.0561 -0.0120 225  ARG A CG  
1780 C CD  . ARG A 241 ? 0.4377 0.3564 0.4379 -0.0066 -0.0658 -0.0109 225  ARG A CD  
1781 N NE  . ARG A 241 ? 0.7092 0.6094 0.6909 -0.0044 -0.0760 -0.0120 225  ARG A NE  
1782 C CZ  . ARG A 241 ? 1.0073 0.8964 0.9888 -0.0048 -0.0880 -0.0112 225  ARG A CZ  
1783 N NH1 . ARG A 241 ? 0.9133 0.8088 0.9141 -0.0076 -0.0912 -0.0090 225  ARG A NH1 
1784 N NH2 . ARG A 241 ? 0.8930 0.7639 0.8550 -0.0021 -0.0973 -0.0126 225  ARG A NH2 
1785 N N   . ALA A 242 ? 0.2714 0.2049 0.2499 -0.0024 -0.0387 -0.0155 226  ALA A N   
1786 C CA  . ALA A 242 ? 0.2773 0.2047 0.2368 0.0017  -0.0341 -0.0174 226  ALA A CA  
1787 C C   . ALA A 242 ? 0.3368 0.2627 0.2894 0.0036  -0.0309 -0.0171 226  ALA A C   
1788 O O   . ALA A 242 ? 0.3067 0.2434 0.2706 0.0021  -0.0256 -0.0163 226  ALA A O   
1789 C CB  . ALA A 242 ? 0.2743 0.2119 0.2369 0.0017  -0.0249 -0.0180 226  ALA A CB  
1790 N N   . THR A 243 ? 0.3451 0.2569 0.2787 0.0072  -0.0344 -0.0178 227  THR A N   
1791 C CA  . THR A 243 ? 0.3512 0.2593 0.2761 0.0093  -0.0320 -0.0169 227  THR A CA  
1792 C C   . THR A 243 ? 0.4311 0.3337 0.3375 0.0141  -0.0249 -0.0174 227  THR A C   
1793 O O   . THR A 243 ? 0.4161 0.3073 0.3070 0.0173  -0.0275 -0.0189 227  THR A O   
1794 C CB  . THR A 243 ? 0.3899 0.2846 0.3084 0.0095  -0.0432 -0.0163 227  THR A CB  
1795 O OG1 . THR A 243 ? 0.3435 0.2438 0.2813 0.0051  -0.0498 -0.0155 227  THR A OG1 
1796 C CG2 . THR A 243 ? 0.4371 0.3280 0.3481 0.0111  -0.0417 -0.0148 227  THR A CG2 
1797 N N   . THR A 244 ? 0.4174 0.3274 0.3258 0.0147  -0.0161 -0.0161 228  THR A N   
1798 C CA  . THR A 244 ? 0.4572 0.3640 0.3514 0.0192  -0.0079 -0.0156 228  THR A CA  
1799 C C   . THR A 244 ? 0.5746 0.4761 0.4593 0.0215  -0.0051 -0.0131 228  THR A C   
1800 O O   . THR A 244 ? 0.6183 0.5179 0.4927 0.0252  0.0027  -0.0119 228  THR A O   
1801 C CB  . THR A 244 ? 0.5367 0.4576 0.4422 0.0184  0.0016  -0.0156 228  THR A CB  
1802 O OG1 . THR A 244 ? 0.4877 0.4204 0.4096 0.0150  0.0042  -0.0144 228  THR A OG1 
1803 C CG2 . THR A 244 ? 0.4617 0.3865 0.3727 0.0171  0.0004  -0.0177 228  THR A CG2 
1804 N N   . GLY A 245 ? 0.5255 0.4254 0.4147 0.0193  -0.0108 -0.0119 229  GLY A N   
1805 C CA  . GLY A 245 ? 0.5356 0.4309 0.4165 0.0213  -0.0078 -0.0091 229  GLY A CA  
1806 C C   . GLY A 245 ? 0.5220 0.4322 0.4211 0.0183  -0.0016 -0.0074 229  GLY A C   
1807 O O   . GLY A 245 ? 0.5168 0.4270 0.4208 0.0167  -0.0044 -0.0058 229  GLY A O   
1808 N N   . GLU A 246 ? 0.4397 0.3624 0.3499 0.0174  0.0059  -0.0081 230  GLU A N   
1809 C CA  . GLU A 246 ? 0.4110 0.3475 0.3392 0.0145  0.0107  -0.0072 230  GLU A CA  
1810 C C   . GLU A 246 ? 0.3905 0.3355 0.3358 0.0104  0.0059  -0.0094 230  GLU A C   
1811 O O   . GLU A 246 ? 0.3534 0.3064 0.3123 0.0080  0.0066  -0.0090 230  GLU A O   
1812 C CB  . GLU A 246 ? 0.4253 0.3700 0.3572 0.0157  0.0201  -0.0068 230  GLU A CB  
1813 N N   . PHE A 247 ? 0.3396 0.2829 0.2846 0.0097  0.0016  -0.0115 231  PHE A N   
1814 C CA  . PHE A 247 ? 0.3272 0.2787 0.2886 0.0061  -0.0018 -0.0128 231  PHE A CA  
1815 C C   . PHE A 247 ? 0.3388 0.2835 0.2989 0.0051  -0.0104 -0.0136 231  PHE A C   
1816 O O   . PHE A 247 ? 0.3233 0.2576 0.2692 0.0074  -0.0134 -0.0142 231  PHE A O   
1817 C CB  . PHE A 247 ? 0.3524 0.3163 0.3248 0.0048  0.0046  -0.0141 231  PHE A CB  
1818 C CG  . PHE A 247 ? 0.4007 0.3632 0.3672 0.0058  0.0056  -0.0154 231  PHE A CG  
1819 C CD1 . PHE A 247 ? 0.4546 0.4171 0.4256 0.0040  0.0008  -0.0164 231  PHE A CD1 
1820 C CD2 . PHE A 247 ? 0.4516 0.4134 0.4097 0.0085  0.0115  -0.0154 231  PHE A CD2 
1821 C CE1 . PHE A 247 ? 0.4755 0.4360 0.4410 0.0049  0.0012  -0.0175 231  PHE A CE1 
1822 C CE2 . PHE A 247 ? 0.4950 0.4551 0.4479 0.0097  0.0121  -0.0167 231  PHE A CE2 
1823 C CZ  . PHE A 247 ? 0.4709 0.4301 0.4271 0.0078  0.0067  -0.0178 231  PHE A CZ  
1824 N N   . THR A 248 ? 0.2871 0.2376 0.2627 0.0020  -0.0144 -0.0136 232  THR A N   
1825 C CA  . THR A 248 ? 0.2848 0.2318 0.2652 0.0003  -0.0222 -0.0138 232  THR A CA  
1826 C C   . THR A 248 ? 0.3226 0.2827 0.3204 -0.0024 -0.0186 -0.0141 232  THR A C   
1827 O O   . THR A 248 ? 0.2851 0.2544 0.2961 -0.0039 -0.0157 -0.0138 232  THR A O   
1828 C CB  . THR A 248 ? 0.3539 0.2933 0.3361 -0.0006 -0.0315 -0.0126 232  THR A CB  
1829 O OG1 . THR A 248 ? 0.3428 0.2695 0.3064 0.0024  -0.0337 -0.0121 232  THR A OG1 
1830 C CG2 . THR A 248 ? 0.3692 0.3037 0.3567 -0.0023 -0.0406 -0.0124 232  THR A CG2 
1831 N N   . PHE A 249 ? 0.2714 0.2319 0.2680 -0.0027 -0.0184 -0.0147 233  PHE A N   
1832 C CA  . PHE A 249 ? 0.2768 0.2483 0.2871 -0.0049 -0.0147 -0.0147 233  PHE A CA  
1833 C C   . PHE A 249 ? 0.2904 0.2597 0.3098 -0.0072 -0.0220 -0.0132 233  PHE A C   
1834 O O   . PHE A 249 ? 0.2755 0.2347 0.2862 -0.0067 -0.0284 -0.0133 233  PHE A O   
1835 C CB  . PHE A 249 ? 0.3045 0.2781 0.3075 -0.0036 -0.0089 -0.0159 233  PHE A CB  
1836 C CG  . PHE A 249 ? 0.3192 0.3007 0.3318 -0.0055 -0.0064 -0.0156 233  PHE A CG  
1837 C CD1 . PHE A 249 ? 0.3706 0.3478 0.3837 -0.0067 -0.0115 -0.0148 233  PHE A CD1 
1838 C CD2 . PHE A 249 ? 0.3517 0.3438 0.3718 -0.0060 0.0008  -0.0161 233  PHE A CD2 
1839 C CE1 . PHE A 249 ? 0.3887 0.3730 0.4105 -0.0084 -0.0088 -0.0138 233  PHE A CE1 
1840 C CE2 . PHE A 249 ? 0.3807 0.3791 0.4077 -0.0074 0.0034  -0.0155 233  PHE A CE2 
1841 C CZ  . PHE A 249 ? 0.3609 0.3557 0.3890 -0.0087 -0.0011 -0.0141 233  PHE A CZ  
1842 N N   . THR A 250 ? 0.2486 0.2272 0.2858 -0.0095 -0.0209 -0.0118 234  THR A N   
1843 C CA  . THR A 250 ? 0.2518 0.2304 0.3017 -0.0120 -0.0269 -0.0096 234  THR A CA  
1844 C C   . THR A 250 ? 0.2828 0.2733 0.3453 -0.0135 -0.0199 -0.0084 234  THR A C   
1845 O O   . THR A 250 ? 0.2555 0.2554 0.3247 -0.0132 -0.0128 -0.0089 234  THR A O   
1846 C CB  . THR A 250 ? 0.3136 0.2906 0.3748 -0.0133 -0.0335 -0.0079 234  THR A CB  
1847 O OG1 . THR A 250 ? 0.2839 0.2489 0.3310 -0.0115 -0.0397 -0.0089 234  THR A OG1 
1848 C CG2 . THR A 250 ? 0.3021 0.2787 0.3784 -0.0160 -0.0406 -0.0050 234  THR A CG2 
1849 N N   . SER A 251 ? 0.2313 0.2208 0.2969 -0.0150 -0.0224 -0.0068 235  SER A N   
1850 C CA  . SER A 251 ? 0.2049 0.2046 0.2819 -0.0165 -0.0161 -0.0049 235  SER A CA  
1851 C C   . SER A 251 ? 0.2316 0.2316 0.3241 -0.0193 -0.0216 -0.0011 235  SER A C   
1852 O O   . SER A 251 ? 0.2153 0.2056 0.3046 -0.0201 -0.0307 -0.0004 235  SER A O   
1853 C CB  . SER A 251 ? 0.2266 0.2262 0.2921 -0.0155 -0.0116 -0.0063 235  SER A CB  
1854 O OG  . SER A 251 ? 0.2211 0.2298 0.2958 -0.0167 -0.0053 -0.0043 235  SER A OG  
1855 N N   . LYS A 252 ? 0.1936 0.2044 0.3026 -0.0205 -0.0159 0.0017  236  LYS A N   
1856 C CA  . LYS A 252 ? 0.1967 0.2102 0.3230 -0.0233 -0.0188 0.0065  236  LYS A CA  
1857 C C   . LYS A 252 ? 0.2431 0.2536 0.3614 -0.0240 -0.0187 0.0071  236  LYS A C   
1858 O O   . LYS A 252 ? 0.2158 0.2260 0.3190 -0.0221 -0.0135 0.0041  236  LYS A O   
1859 C CB  . LYS A 252 ? 0.2335 0.2600 0.3766 -0.0236 -0.0095 0.0093  236  LYS A CB  
1860 C CG  . LYS A 252 ? 0.4215 0.4517 0.5779 -0.0233 -0.0104 0.0097  236  LYS A CG  
1861 C CD  . LYS A 252 ? 0.5809 0.6236 0.7502 -0.0223 0.0006  0.0115  236  LYS A CD  
1862 C CE  . LYS A 252 ? 0.7746 0.8240 0.9673 -0.0244 0.0013  0.0176  236  LYS A CE  
1863 N NZ  . LYS A 252 ? 0.9485 0.9980 1.1586 -0.0253 -0.0051 0.0194  236  LYS A NZ  
1864 N N   . LEU A 253 ? 0.2101 0.2182 0.3391 -0.0266 -0.0248 0.0109  237  LEU A N   
1865 C CA  . LEU A 253 ? 0.2053 0.2104 0.3286 -0.0275 -0.0253 0.0120  237  LEU A CA  
1866 C C   . LEU A 253 ? 0.2691 0.2853 0.4078 -0.0293 -0.0175 0.0170  237  LEU A C   
1867 O O   . LEU A 253 ? 0.2637 0.2880 0.4201 -0.0302 -0.0143 0.0203  237  LEU A O   
1868 C CB  . LEU A 253 ? 0.2161 0.2094 0.3397 -0.0292 -0.0384 0.0130  237  LEU A CB  
1869 C CG  . LEU A 253 ? 0.2664 0.2460 0.3726 -0.0270 -0.0472 0.0084  237  LEU A CG  
1870 C CD1 . LEU A 253 ? 0.2785 0.2461 0.3873 -0.0287 -0.0608 0.0098  237  LEU A CD1 
1871 C CD2 . LEU A 253 ? 0.3100 0.2858 0.3933 -0.0237 -0.0424 0.0036  237  LEU A CD2 
1872 N N   . VAL A 254 ? 0.2212 0.2373 0.3534 -0.0296 -0.0145 0.0178  238  VAL A N   
1873 C CA  . VAL A 254 ? 0.2222 0.2472 0.3676 -0.0313 -0.0075 0.0233  238  VAL A CA  
1874 C C   . VAL A 254 ? 0.2700 0.2924 0.4338 -0.0349 -0.0163 0.0288  238  VAL A C   
1875 O O   . VAL A 254 ? 0.2664 0.2782 0.4246 -0.0360 -0.0266 0.0280  238  VAL A O   
1876 C CB  . VAL A 254 ? 0.2693 0.2946 0.4017 -0.0305 -0.0019 0.0228  238  VAL A CB  
1877 C CG1 . VAL A 254 ? 0.2743 0.3079 0.4202 -0.0323 0.0051  0.0294  238  VAL A CG1 
1878 C CG2 . VAL A 254 ? 0.2584 0.2857 0.3743 -0.0270 0.0054  0.0174  238  VAL A CG2 
1879 N N   . ASP A 255 ? 0.2529 0.2844 0.4387 -0.0365 -0.0125 0.0343  239  ASP A N   
1880 C CA  . ASP A 255 ? 0.2761 0.3071 0.4843 -0.0402 -0.0200 0.0406  239  ASP A CA  
1881 C C   . ASP A 255 ? 0.3317 0.3647 0.5454 -0.0425 -0.0175 0.0461  239  ASP A C   
1882 O O   . ASP A 255 ? 0.3461 0.3895 0.5748 -0.0434 -0.0084 0.0521  239  ASP A O   
1883 C CB  . ASP A 255 ? 0.3032 0.3442 0.5344 -0.0407 -0.0160 0.0446  239  ASP A CB  
1884 C CG  . ASP A 255 ? 0.4852 0.5271 0.7437 -0.0446 -0.0236 0.0517  239  ASP A CG  
1885 O OD1 . ASP A 255 ? 0.5135 0.5451 0.7720 -0.0469 -0.0363 0.0522  239  ASP A OD1 
1886 O OD2 . ASP A 255 ? 0.6010 0.6538 0.8812 -0.0451 -0.0169 0.0570  239  ASP A OD2 
1887 N N   . GLY A 256 ? 0.2836 0.3063 0.4844 -0.0431 -0.0254 0.0441  240  GLY A N   
1888 C CA  . GLY A 256 ? 0.2738 0.2960 0.4771 -0.0453 -0.0248 0.0486  240  GLY A CA  
1889 C C   . GLY A 256 ? 0.3122 0.3204 0.5022 -0.0457 -0.0367 0.0454  240  GLY A C   
1890 O O   . GLY A 256 ? 0.3183 0.3167 0.4959 -0.0441 -0.0451 0.0396  240  GLY A O   
1891 N N   . LYS A 257 ? 0.2588 0.2656 0.4510 -0.0478 -0.0373 0.0494  241  LYS A N   
1892 C CA  . LYS A 257 ? 0.2633 0.2570 0.4444 -0.0482 -0.0483 0.0470  241  LYS A CA  
1893 C C   . LYS A 257 ? 0.2946 0.2875 0.4558 -0.0459 -0.0417 0.0440  241  LYS A C   
1894 O O   . LYS A 257 ? 0.2842 0.2851 0.4497 -0.0469 -0.0326 0.0486  241  LYS A O   
1895 C CB  . LYS A 257 ? 0.2986 0.2896 0.5007 -0.0528 -0.0568 0.0544  241  LYS A CB  
1896 N N   . PHE A 258 ? 0.2509 0.2341 0.3905 -0.0427 -0.0460 0.0366  242  PHE A N   
1897 C CA  . PHE A 258 ? 0.2281 0.2101 0.3495 -0.0404 -0.0407 0.0333  242  PHE A CA  
1898 C C   . PHE A 258 ? 0.3066 0.2845 0.4322 -0.0428 -0.0448 0.0377  242  PHE A C   
1899 O O   . PHE A 258 ? 0.3154 0.2853 0.4498 -0.0452 -0.0560 0.0398  242  PHE A O   
1900 C CB  . PHE A 258 ? 0.2409 0.2130 0.3402 -0.0362 -0.0447 0.0249  242  PHE A CB  
1901 C CG  . PHE A 258 ? 0.2262 0.2011 0.3091 -0.0332 -0.0361 0.0212  242  PHE A CG  
1902 C CD1 . PHE A 258 ? 0.2448 0.2296 0.3250 -0.0316 -0.0254 0.0200  242  PHE A CD1 
1903 C CD2 . PHE A 258 ? 0.2493 0.2167 0.3203 -0.0319 -0.0391 0.0192  242  PHE A CD2 
1904 C CE1 . PHE A 258 ? 0.2522 0.2390 0.3183 -0.0289 -0.0186 0.0167  242  PHE A CE1 
1905 C CE2 . PHE A 258 ? 0.2666 0.2366 0.3240 -0.0292 -0.0318 0.0161  242  PHE A CE2 
1906 C CZ  . PHE A 258 ? 0.2363 0.2159 0.2916 -0.0278 -0.0219 0.0149  242  PHE A CZ  
1907 N N   . PRO A 259 ? 0.2550 0.2376 0.3749 -0.0425 -0.0367 0.0393  243  PRO A N   
1908 C CA  . PRO A 259 ? 0.2606 0.2388 0.3841 -0.0449 -0.0410 0.0437  243  PRO A CA  
1909 C C   . PRO A 259 ? 0.3119 0.2753 0.4261 -0.0440 -0.0539 0.0393  243  PRO A C   
1910 O O   . PRO A 259 ? 0.2756 0.2323 0.3731 -0.0402 -0.0564 0.0318  243  PRO A O   
1911 C CB  . PRO A 259 ? 0.2829 0.2653 0.3931 -0.0430 -0.0313 0.0428  243  PRO A CB  
1912 C CG  . PRO A 259 ? 0.3288 0.3212 0.4367 -0.0411 -0.0204 0.0413  243  PRO A CG  
1913 C CD  . PRO A 259 ? 0.2689 0.2599 0.3783 -0.0399 -0.0243 0.0373  243  PRO A CD  
1914 N N   . ASP A 260 ? 0.3165 0.2744 0.4411 -0.0472 -0.0619 0.0441  244  ASP A N   
1915 C CA  . ASP A 260 ? 0.3346 0.2775 0.4505 -0.0463 -0.0744 0.0405  244  ASP A CA  
1916 C C   . ASP A 260 ? 0.4051 0.3464 0.5025 -0.0432 -0.0692 0.0368  244  ASP A C   
1917 O O   . ASP A 260 ? 0.4109 0.3517 0.5108 -0.0449 -0.0692 0.0407  244  ASP A O   
1918 C CB  . ASP A 260 ? 0.3620 0.3009 0.4971 -0.0511 -0.0837 0.0478  244  ASP A CB  
1919 C CG  . ASP A 260 ? 0.4673 0.3889 0.5950 -0.0503 -0.0987 0.0441  244  ASP A CG  
1920 O OD1 . ASP A 260 ? 0.4769 0.3894 0.5832 -0.0454 -0.1012 0.0357  244  ASP A OD1 
1921 O OD2 . ASP A 260 ? 0.4734 0.3905 0.6167 -0.0542 -0.1076 0.0497  244  ASP A OD2 
1922 N N   . TYR A 261 ? 0.3516 0.2929 0.4318 -0.0387 -0.0644 0.0297  245  TYR A N   
1923 C CA  . TYR A 261 ? 0.3485 0.2897 0.4120 -0.0353 -0.0587 0.0255  245  TYR A CA  
1924 C C   . TYR A 261 ? 0.4319 0.3602 0.4862 -0.0337 -0.0675 0.0229  245  TYR A C   
1925 O O   . TYR A 261 ? 0.4286 0.3573 0.4754 -0.0325 -0.0639 0.0223  245  TYR A O   
1926 C CB  . TYR A 261 ? 0.3405 0.2843 0.3904 -0.0310 -0.0525 0.0189  245  TYR A CB  
1927 C CG  . TYR A 261 ? 0.3461 0.2785 0.3857 -0.0278 -0.0605 0.0128  245  TYR A CG  
1928 C CD1 . TYR A 261 ? 0.3697 0.2916 0.3932 -0.0237 -0.0643 0.0074  245  TYR A CD1 
1929 C CD2 . TYR A 261 ? 0.3336 0.2649 0.3793 -0.0286 -0.0645 0.0128  245  TYR A CD2 
1930 C CE1 . TYR A 261 ? 0.3810 0.2908 0.3937 -0.0203 -0.0718 0.0022  245  TYR A CE1 
1931 C CE2 . TYR A 261 ? 0.3467 0.2656 0.3815 -0.0255 -0.0728 0.0076  245  TYR A CE2 
1932 C CZ  . TYR A 261 ? 0.4304 0.3384 0.4478 -0.0212 -0.0760 0.0022  245  TYR A CZ  
1933 O OH  . TYR A 261 ? 0.4323 0.3271 0.4369 -0.0175 -0.0835 -0.0028 245  TYR A OH  
1934 N N   . GLU A 262 ? 0.3954 0.3115 0.4497 -0.0334 -0.0795 0.0209  246  GLU A N   
1935 C CA  . GLU A 262 ? 0.4170 0.3189 0.4621 -0.0314 -0.0891 0.0178  246  GLU A CA  
1936 C C   . GLU A 262 ? 0.4476 0.3507 0.5006 -0.0345 -0.0896 0.0234  246  GLU A C   
1937 O O   . GLU A 262 ? 0.4473 0.3439 0.4894 -0.0319 -0.0912 0.0204  246  GLU A O   
1938 C CB  . GLU A 262 ? 0.4526 0.3412 0.5002 -0.0317 -0.1030 0.0164  246  GLU A CB  
1939 C CG  . GLU A 262 ? 0.6681 0.5406 0.6957 -0.0260 -0.1104 0.0086  246  GLU A CG  
1940 C CD  . GLU A 262 ? 0.9272 0.7974 0.9383 -0.0208 -0.1066 0.0018  246  GLU A CD  
1941 O OE1 . GLU A 262 ? 0.9184 0.7872 0.9324 -0.0214 -0.1101 0.0015  246  GLU A OE1 
1942 O OE2 . GLU A 262 ? 0.8842 0.7536 0.8798 -0.0160 -0.1007 -0.0031 246  GLU A OE2 
1943 N N   . ARG A 263 ? 0.4106 0.3224 0.4828 -0.0399 -0.0875 0.0318  247  ARG A N   
1944 C CA  . ARG A 263 ? 0.4263 0.3404 0.5087 -0.0437 -0.0872 0.0390  247  ARG A CA  
1945 C C   . ARG A 263 ? 0.4858 0.4070 0.5588 -0.0423 -0.0765 0.0392  247  ARG A C   
1946 O O   . ARG A 263 ? 0.4793 0.3991 0.5554 -0.0442 -0.0776 0.0436  247  ARG A O   
1947 C CB  . ARG A 263 ? 0.4592 0.3819 0.5651 -0.0494 -0.0858 0.0484  247  ARG A CB  
1948 C CG  . ARG A 263 ? 0.6532 0.5683 0.7725 -0.0519 -0.0983 0.0498  247  ARG A CG  
1949 C CD  . ARG A 263 ? 0.8528 0.7769 0.9983 -0.0578 -0.0968 0.0604  247  ARG A CD  
1950 N NE  . ARG A 263 ? 1.0306 0.9504 1.1874 -0.0616 -0.1029 0.0671  247  ARG A NE  
1951 C CZ  . ARG A 263 ? 1.2215 1.1361 1.3979 -0.0659 -0.1140 0.0727  247  ARG A CZ  
1952 N NH1 . ARG A 263 ? 0.9979 0.9110 1.1851 -0.0669 -0.1206 0.0723  247  ARG A NH1 
1953 N NH2 . ARG A 263 ? 1.0963 1.0071 1.2825 -0.0693 -0.1191 0.0790  247  ARG A NH2 
1954 N N   . VAL A 264 ? 0.4328 0.3614 0.4952 -0.0390 -0.0668 0.0348  248  VAL A N   
1955 C CA  . VAL A 264 ? 0.4260 0.3611 0.4795 -0.0375 -0.0572 0.0347  248  VAL A CA  
1956 C C   . VAL A 264 ? 0.4296 0.3589 0.4649 -0.0322 -0.0573 0.0267  248  VAL A C   
1957 O O   . VAL A 264 ? 0.4095 0.3432 0.4376 -0.0308 -0.0508 0.0262  248  VAL A O   
1958 C CB  . VAL A 264 ? 0.4776 0.4264 0.5355 -0.0386 -0.0451 0.0380  248  VAL A CB  
1959 C CG1 . VAL A 264 ? 0.4833 0.4381 0.5602 -0.0436 -0.0436 0.0472  248  VAL A CG1 
1960 C CG2 . VAL A 264 ? 0.4666 0.4188 0.5192 -0.0358 -0.0417 0.0322  248  VAL A CG2 
1961 N N   . LEU A 265 ? 0.3670 0.2861 0.3951 -0.0291 -0.0649 0.0207  249  LEU A N   
1962 C CA  . LEU A 265 ? 0.3574 0.2703 0.3696 -0.0237 -0.0652 0.0135  249  LEU A CA  
1963 C C   . LEU A 265 ? 0.4160 0.3213 0.4266 -0.0238 -0.0708 0.0147  249  LEU A C   
1964 O O   . LEU A 265 ? 0.3947 0.2915 0.4114 -0.0258 -0.0803 0.0169  249  LEU A O   
1965 C CB  . LEU A 265 ? 0.3697 0.2727 0.3739 -0.0201 -0.0715 0.0073  249  LEU A CB  
1966 C CG  . LEU A 265 ? 0.4261 0.3342 0.4311 -0.0198 -0.0679 0.0057  249  LEU A CG  
1967 C CD1 . LEU A 265 ? 0.4369 0.3328 0.4311 -0.0157 -0.0748 -0.0003 249  LEU A CD1 
1968 C CD2 . LEU A 265 ? 0.4103 0.3298 0.4104 -0.0180 -0.0561 0.0040  249  LEU A CD2 
1969 N N   . PRO A 266 ? 0.3819 0.2902 0.3862 -0.0221 -0.0657 0.0141  250  PRO A N   
1970 C CA  . PRO A 266 ? 0.3842 0.2852 0.3880 -0.0224 -0.0715 0.0157  250  PRO A CA  
1971 C C   . PRO A 266 ? 0.4395 0.3266 0.4352 -0.0182 -0.0805 0.0097  250  PRO A C   
1972 O O   . PRO A 266 ? 0.4251 0.3095 0.4100 -0.0131 -0.0787 0.0030  250  PRO A O   
1973 C CB  . PRO A 266 ? 0.4049 0.3124 0.4029 -0.0210 -0.0639 0.0156  250  PRO A CB  
1974 C CG  . PRO A 266 ? 0.4408 0.3558 0.4332 -0.0183 -0.0559 0.0114  250  PRO A CG  
1975 C CD  . PRO A 266 ? 0.3841 0.3017 0.3819 -0.0199 -0.0557 0.0118  250  PRO A CD  
1976 N N   . ARG A 267 ? 0.4367 0.3143 0.4376 -0.0202 -0.0903 0.0123  251  ARG A N   
1977 C CA  . ARG A 267 ? 0.4625 0.3250 0.4554 -0.0161 -0.1001 0.0067  251  ARG A CA  
1978 C C   . ARG A 267 ? 0.5251 0.3808 0.5139 -0.0140 -0.1037 0.0059  251  ARG A C   
1979 O O   . ARG A 267 ? 0.5412 0.3871 0.5188 -0.0082 -0.1070 -0.0007 251  ARG A O   
1980 C CB  . ARG A 267 ? 0.4988 0.3527 0.5000 -0.0191 -0.1109 0.0089  251  ARG A CB  
1981 N N   . GLY A 268 ? 0.4775 0.3383 0.4748 -0.0184 -0.1024 0.0126  252  GLY A N   
1982 C CA  . GLY A 268 ? 0.5135 0.3681 0.5084 -0.0171 -0.1063 0.0127  252  GLY A CA  
1983 C C   . GLY A 268 ? 0.5734 0.4342 0.5613 -0.0142 -0.0985 0.0108  252  GLY A C   
1984 O O   . GLY A 268 ? 0.6101 0.4730 0.6016 -0.0167 -0.0980 0.0156  252  GLY A O   
1985 N N   . GLY A 269 ? 0.4480 0.3108 0.4263 -0.0088 -0.0929 0.0041  253  GLY A N   
1986 C CA  . GLY A 269 ? 0.4131 0.2813 0.3861 -0.0057 -0.0863 0.0019  253  GLY A CA  
1987 C C   . GLY A 269 ? 0.4028 0.2608 0.3695 -0.0002 -0.0913 -0.0031 253  GLY A C   
1988 O O   . GLY A 269 ? 0.4069 0.2570 0.3664 0.0050  -0.0936 -0.0092 253  GLY A O   
1989 N N   . ASP A 270 ? 0.3339 0.1917 0.3026 -0.0008 -0.0925 -0.0006 254  ASP A N   
1990 C CA  . ASP A 270 ? 0.3402 0.1885 0.3048 0.0041  -0.0976 -0.0046 254  ASP A CA  
1991 C C   . ASP A 270 ? 0.3873 0.2416 0.3489 0.0081  -0.0910 -0.0073 254  ASP A C   
1992 O O   . ASP A 270 ? 0.3693 0.2172 0.3285 0.0128  -0.0939 -0.0108 254  ASP A O   
1993 C CB  . ASP A 270 ? 0.3656 0.2073 0.3362 0.0002  -0.1060 0.0008  254  ASP A CB  
1994 C CG  . ASP A 270 ? 0.4272 0.2778 0.4033 -0.0052 -0.1022 0.0083  254  ASP A CG  
1995 O OD1 . ASP A 270 ? 0.4146 0.2747 0.3935 -0.0091 -0.0961 0.0121  254  ASP A OD1 
1996 O OD2 . ASP A 270 ? 0.4682 0.3157 0.4449 -0.0050 -0.1053 0.0101  254  ASP A OD2 
1997 N N   . LYS A 271 ? 0.3391 0.2055 0.3019 0.0062  -0.0826 -0.0056 255  LYS A N   
1998 C CA  . LYS A 271 ? 0.3306 0.2032 0.2926 0.0090  -0.0773 -0.0073 255  LYS A CA  
1999 C C   . LYS A 271 ? 0.3981 0.2774 0.3571 0.0123  -0.0695 -0.0117 255  LYS A C   
2000 O O   . LYS A 271 ? 0.4054 0.2918 0.3650 0.0092  -0.0649 -0.0099 255  LYS A O   
2001 C CB  . LYS A 271 ? 0.3400 0.2193 0.3053 0.0040  -0.0756 -0.0011 255  LYS A CB  
2002 C CG  . LYS A 271 ? 0.3952 0.2675 0.3633 0.0010  -0.0832 0.0038  255  LYS A CG  
2003 C CD  . LYS A 271 ? 0.4161 0.2943 0.3854 -0.0040 -0.0809 0.0106  255  LYS A CD  
2004 C CE  . LYS A 271 ? 0.4716 0.3430 0.4438 -0.0078 -0.0878 0.0168  255  LYS A CE  
2005 N NZ  . LYS A 271 ? 0.3938 0.2611 0.3707 -0.0113 -0.0918 0.0199  255  LYS A NZ  
2006 N N   . LEU A 272 ? 0.3381 0.2146 0.2941 0.0188  -0.0679 -0.0172 256  LEU A N   
2007 C CA  . LEU A 272 ? 0.3234 0.2058 0.2770 0.0224  -0.0601 -0.0210 256  LEU A CA  
2008 C C   . LEU A 272 ? 0.3558 0.2465 0.3136 0.0240  -0.0549 -0.0212 256  LEU A C   
2009 O O   . LEU A 272 ? 0.3368 0.2246 0.2971 0.0268  -0.0573 -0.0220 256  LEU A O   
2010 C CB  . LEU A 272 ? 0.3331 0.2068 0.2802 0.0290  -0.0605 -0.0267 256  LEU A CB  
2011 C CG  . LEU A 272 ? 0.3784 0.2572 0.3227 0.0340  -0.0518 -0.0306 256  LEU A CG  
2012 C CD1 . LEU A 272 ? 0.3662 0.2512 0.3089 0.0307  -0.0477 -0.0295 256  LEU A CD1 
2013 C CD2 . LEU A 272 ? 0.4126 0.2810 0.3492 0.0417  -0.0523 -0.0360 256  LEU A CD2 
2014 N N   . VAL A 273 ? 0.3012 0.2018 0.2604 0.0223  -0.0484 -0.0205 257  VAL A N   
2015 C CA  . VAL A 273 ? 0.2948 0.2033 0.2586 0.0236  -0.0439 -0.0208 257  VAL A CA  
2016 C C   . VAL A 273 ? 0.3313 0.2436 0.2944 0.0279  -0.0369 -0.0246 257  VAL A C   
2017 O O   . VAL A 273 ? 0.3126 0.2277 0.2727 0.0262  -0.0338 -0.0246 257  VAL A O   
2018 C CB  . VAL A 273 ? 0.3368 0.2532 0.3026 0.0183  -0.0423 -0.0167 257  VAL A CB  
2019 C CG1 . VAL A 273 ? 0.3225 0.2448 0.2934 0.0201  -0.0398 -0.0174 257  VAL A CG1 
2020 C CG2 . VAL A 273 ? 0.3511 0.2638 0.3160 0.0134  -0.0479 -0.0119 257  VAL A CG2 
2021 N N   . VAL A 274 ? 0.2872 0.1999 0.2537 0.0334  -0.0342 -0.0273 258  VAL A N   
2022 C CA  . VAL A 274 ? 0.2845 0.2020 0.2518 0.0375  -0.0265 -0.0299 258  VAL A CA  
2023 C C   . VAL A 274 ? 0.3007 0.2274 0.2777 0.0373  -0.0235 -0.0287 258  VAL A C   
2024 O O   . VAL A 274 ? 0.2975 0.2234 0.2806 0.0390  -0.0262 -0.0285 258  VAL A O   
2025 C CB  . VAL A 274 ? 0.3501 0.2606 0.3132 0.0448  -0.0242 -0.0339 258  VAL A CB  
2026 C CG1 . VAL A 274 ? 0.3282 0.2445 0.2921 0.0484  -0.0153 -0.0355 258  VAL A CG1 
2027 C CG2 . VAL A 274 ? 0.3691 0.2684 0.3217 0.0452  -0.0291 -0.0355 258  VAL A CG2 
2028 N N   . GLY A 275 ? 0.2669 0.2015 0.2457 0.0349  -0.0191 -0.0278 259  GLY A N   
2029 C CA  . GLY A 275 ? 0.2584 0.2010 0.2464 0.0342  -0.0173 -0.0267 259  GLY A CA  
2030 C C   . GLY A 275 ? 0.2740 0.2238 0.2657 0.0359  -0.0099 -0.0276 259  GLY A C   
2031 O O   . GLY A 275 ? 0.2686 0.2175 0.2543 0.0368  -0.0061 -0.0288 259  GLY A O   
2032 N N   . ASP A 276 ? 0.2401 0.1965 0.2421 0.0363  -0.0086 -0.0268 260  ASP A N   
2033 C CA  . ASP A 276 ? 0.2231 0.1867 0.2306 0.0374  -0.0020 -0.0270 260  ASP A CA  
2034 C C   . ASP A 276 ? 0.2378 0.2051 0.2408 0.0322  -0.0019 -0.0260 260  ASP A C   
2035 O O   . ASP A 276 ? 0.2200 0.1884 0.2233 0.0284  -0.0063 -0.0245 260  ASP A O   
2036 C CB  . ASP A 276 ? 0.2381 0.2073 0.2602 0.0394  -0.0015 -0.0263 260  ASP A CB  
2037 C CG  . ASP A 276 ? 0.2207 0.1971 0.2498 0.0408  0.0056  -0.0260 260  ASP A CG  
2038 O OD1 . ASP A 276 ? 0.2343 0.2105 0.2641 0.0456  0.0121  -0.0268 260  ASP A OD1 
2039 O OD2 . ASP A 276 ? 0.1989 0.1804 0.2313 0.0371  0.0048  -0.0249 260  ASP A OD2 
2040 N N   . ARG A 277 ? 0.2076 0.1758 0.2054 0.0323  0.0028  -0.0267 261  ARG A N   
2041 C CA  . ARG A 277 ? 0.2017 0.1733 0.1955 0.0279  0.0034  -0.0259 261  ARG A CA  
2042 C C   . ARG A 277 ? 0.2309 0.2092 0.2321 0.0256  0.0031  -0.0248 261  ARG A C   
2043 O O   . ARG A 277 ? 0.1944 0.1730 0.1920 0.0217  -0.0001 -0.0238 261  ARG A O   
2044 C CB  . ARG A 277 ? 0.1830 0.1549 0.1723 0.0293  0.0088  -0.0269 261  ARG A CB  
2045 C CG  . ARG A 277 ? 0.2214 0.1966 0.2073 0.0249  0.0094  -0.0261 261  ARG A CG  
2046 C CD  . ARG A 277 ? 0.2333 0.2118 0.2198 0.0265  0.0153  -0.0267 261  ARG A CD  
2047 N NE  . ARG A 277 ? 0.2530 0.2382 0.2498 0.0275  0.0185  -0.0261 261  ARG A NE  
2048 C CZ  . ARG A 277 ? 0.3093 0.3001 0.3110 0.0244  0.0178  -0.0254 261  ARG A CZ  
2049 N NH1 . ARG A 277 ? 0.2190 0.2096 0.2152 0.0204  0.0153  -0.0251 261  ARG A NH1 
2050 N NH2 . ARG A 277 ? 0.2009 0.1969 0.2131 0.0255  0.0198  -0.0248 261  ARG A NH2 
2051 N N   . GLN A 278 ? 0.2134 0.1964 0.2248 0.0283  0.0065  -0.0250 262  GLN A N   
2052 C CA  . GLN A 278 ? 0.2294 0.2182 0.2491 0.0265  0.0055  -0.0242 262  GLN A CA  
2053 C C   . GLN A 278 ? 0.2498 0.2366 0.2717 0.0249  -0.0015 -0.0235 262  GLN A C   
2054 O O   . GLN A 278 ? 0.2464 0.2340 0.2659 0.0217  -0.0046 -0.0231 262  GLN A O   
2055 C CB  . GLN A 278 ? 0.2426 0.2368 0.2746 0.0297  0.0106  -0.0239 262  GLN A CB  
2056 C CG  . GLN A 278 ? 0.3067 0.3064 0.3466 0.0273  0.0096  -0.0232 262  GLN A CG  
2057 C CD  . GLN A 278 ? 0.4851 0.4908 0.5374 0.0297  0.0153  -0.0221 262  GLN A CD  
2058 O OE1 . GLN A 278 ? 0.3226 0.3286 0.3749 0.0331  0.0218  -0.0219 262  GLN A OE1 
2059 N NE2 . GLN A 278 ? 0.4793 0.4892 0.5419 0.0280  0.0128  -0.0213 262  GLN A NE2 
2060 N N   . GLN A 279 ? 0.2100 0.1935 0.2353 0.0273  -0.0041 -0.0234 263  GLN A N   
2061 C CA  . GLN A 279 ? 0.2136 0.1942 0.2407 0.0261  -0.0114 -0.0226 263  GLN A CA  
2062 C C   . GLN A 279 ? 0.2446 0.2206 0.2582 0.0221  -0.0153 -0.0218 263  GLN A C   
2063 O O   . GLN A 279 ? 0.2137 0.1888 0.2252 0.0197  -0.0199 -0.0210 263  GLN A O   
2064 C CB  . GLN A 279 ? 0.2402 0.2176 0.2730 0.0298  -0.0131 -0.0227 263  GLN A CB  
2065 C CG  . GLN A 279 ? 0.3835 0.3577 0.4192 0.0286  -0.0213 -0.0217 263  GLN A CG  
2066 C CD  . GLN A 279 ? 0.5317 0.5030 0.5746 0.0323  -0.0233 -0.0218 263  GLN A CD  
2067 O OE1 . GLN A 279 ? 0.4302 0.3995 0.4714 0.0355  -0.0194 -0.0228 263  GLN A OE1 
2068 N NE2 . GLN A 279 ? 0.4233 0.3932 0.4731 0.0320  -0.0303 -0.0208 263  GLN A NE2 
2069 N N   . LEU A 280 ? 0.2073 0.1801 0.2119 0.0215  -0.0135 -0.0218 264  LEU A N   
2070 C CA  . LEU A 280 ? 0.2037 0.1729 0.1973 0.0176  -0.0161 -0.0203 264  LEU A CA  
2071 C C   . LEU A 280 ? 0.2438 0.2169 0.2337 0.0148  -0.0140 -0.0199 264  LEU A C   
2072 O O   . LEU A 280 ? 0.2201 0.1912 0.2041 0.0123  -0.0171 -0.0185 264  LEU A O   
2073 C CB  . LEU A 280 ? 0.1938 0.1590 0.1811 0.0175  -0.0150 -0.0201 264  LEU A CB  
2074 C CG  . LEU A 280 ? 0.2360 0.1950 0.2238 0.0198  -0.0187 -0.0202 264  LEU A CG  
2075 C CD1 . LEU A 280 ? 0.2445 0.1989 0.2261 0.0199  -0.0181 -0.0206 264  LEU A CD1 
2076 C CD2 . LEU A 280 ? 0.2851 0.2402 0.2710 0.0177  -0.0251 -0.0180 264  LEU A CD2 
2077 N N   . ARG A 281 ? 0.2158 0.1937 0.2085 0.0155  -0.0087 -0.0213 265  ARG A N   
2078 C CA  . ARG A 281 ? 0.2123 0.1938 0.2023 0.0131  -0.0066 -0.0213 265  ARG A CA  
2079 C C   . ARG A 281 ? 0.2381 0.2205 0.2308 0.0127  -0.0101 -0.0214 265  ARG A C   
2080 O O   . ARG A 281 ? 0.2082 0.1892 0.1934 0.0105  -0.0116 -0.0208 265  ARG A O   
2081 C CB  . ARG A 281 ? 0.2393 0.2253 0.2323 0.0141  -0.0007 -0.0225 265  ARG A CB  
2082 C CG  . ARG A 281 ? 0.2614 0.2494 0.2485 0.0112  0.0013  -0.0222 265  ARG A CG  
2083 C CD  . ARG A 281 ? 0.3163 0.3081 0.3054 0.0116  0.0064  -0.0231 265  ARG A CD  
2084 N NE  . ARG A 281 ? 0.3096 0.3033 0.2942 0.0090  0.0080  -0.0228 265  ARG A NE  
2085 C CZ  . ARG A 281 ? 0.5204 0.5168 0.5057 0.0081  0.0082  -0.0233 265  ARG A CZ  
2086 N NH1 . ARG A 281 ? 0.3623 0.3597 0.3532 0.0093  0.0060  -0.0242 265  ARG A NH1 
2087 N NH2 . ARG A 281 ? 0.5036 0.5014 0.4848 0.0063  0.0101  -0.0230 265  ARG A NH2 
2088 N N   . GLU A 282 ? 0.2216 0.2053 0.2246 0.0150  -0.0120 -0.0221 266  GLU A N   
2089 C CA  . GLU A 282 ? 0.2402 0.2237 0.2473 0.0148  -0.0169 -0.0223 266  GLU A CA  
2090 C C   . GLU A 282 ? 0.2736 0.2505 0.2726 0.0135  -0.0236 -0.0212 266  GLU A C   
2091 O O   . GLU A 282 ? 0.2571 0.2317 0.2508 0.0123  -0.0273 -0.0213 266  GLU A O   
2092 C CB  . GLU A 282 ? 0.2500 0.2372 0.2730 0.0175  -0.0172 -0.0227 266  GLU A CB  
2093 C CG  . GLU A 282 ? 0.2884 0.2821 0.3187 0.0183  -0.0108 -0.0233 266  GLU A CG  
2094 C CD  . GLU A 282 ? 0.4973 0.4954 0.5436 0.0214  -0.0082 -0.0228 266  GLU A CD  
2095 O OE1 . GLU A 282 ? 0.4503 0.4534 0.5023 0.0220  -0.0028 -0.0227 266  GLU A OE1 
2096 O OE2 . GLU A 282 ? 0.4667 0.4633 0.5200 0.0234  -0.0110 -0.0222 266  GLU A OE2 
2097 N N   . ALA A 283 ? 0.2352 0.2083 0.2320 0.0140  -0.0253 -0.0200 267  ALA A N   
2098 C CA  . ALA A 283 ? 0.2413 0.2076 0.2298 0.0128  -0.0315 -0.0183 267  ALA A CA  
2099 C C   . ALA A 283 ? 0.2418 0.2058 0.2161 0.0099  -0.0298 -0.0168 267  ALA A C   
2100 O O   . ALA A 283 ? 0.2278 0.1873 0.1936 0.0090  -0.0337 -0.0159 267  ALA A O   
2101 C CB  . ALA A 283 ? 0.2545 0.2174 0.2450 0.0139  -0.0334 -0.0173 267  ALA A CB  
2102 N N   . PHE A 284 ? 0.2068 0.1736 0.1785 0.0089  -0.0239 -0.0164 268  PHE A N   
2103 C CA  . PHE A 284 ? 0.2081 0.1740 0.1689 0.0064  -0.0211 -0.0145 268  PHE A CA  
2104 C C   . PHE A 284 ? 0.2499 0.2173 0.2067 0.0061  -0.0201 -0.0158 268  PHE A C   
2105 O O   . PHE A 284 ? 0.2665 0.2300 0.2124 0.0050  -0.0210 -0.0142 268  PHE A O   
2106 C CB  . PHE A 284 ? 0.2187 0.1877 0.1805 0.0055  -0.0157 -0.0141 268  PHE A CB  
2107 C CG  . PHE A 284 ? 0.2341 0.1997 0.1967 0.0054  -0.0171 -0.0127 268  PHE A CG  
2108 C CD1 . PHE A 284 ? 0.2890 0.2488 0.2484 0.0050  -0.0222 -0.0105 268  PHE A CD1 
2109 C CD2 . PHE A 284 ? 0.2401 0.2074 0.2060 0.0058  -0.0140 -0.0136 268  PHE A CD2 
2110 C CE1 . PHE A 284 ? 0.3103 0.2664 0.2708 0.0049  -0.0241 -0.0094 268  PHE A CE1 
2111 C CE2 . PHE A 284 ? 0.2787 0.2415 0.2445 0.0060  -0.0163 -0.0126 268  PHE A CE2 
2112 C CZ  . PHE A 284 ? 0.2621 0.2195 0.2258 0.0056  -0.0213 -0.0106 268  PHE A CZ  
2113 N N   . SER A 285 ? 0.2210 0.1935 0.1861 0.0073  -0.0182 -0.0185 269  SER A N   
2114 C CA  A SER A 285 ? 0.2250 0.1987 0.1880 0.0074  -0.0179 -0.0202 269  SER A CA  
2115 C CA  B SER A 285 ? 0.2249 0.1988 0.1884 0.0074  -0.0179 -0.0202 269  SER A CA  
2116 C C   . SER A 285 ? 0.2955 0.2631 0.2534 0.0080  -0.0250 -0.0205 269  SER A C   
2117 O O   . SER A 285 ? 0.2878 0.2520 0.2347 0.0077  -0.0254 -0.0206 269  SER A O   
2118 C CB  A SER A 285 ? 0.2396 0.2195 0.2144 0.0085  -0.0153 -0.0224 269  SER A CB  
2119 C CB  B SER A 285 ? 0.2405 0.2203 0.2167 0.0087  -0.0160 -0.0225 269  SER A CB  
2120 O OG  A SER A 285 ? 0.2727 0.2539 0.2451 0.0082  -0.0144 -0.0240 269  SER A OG  
2121 O OG  B SER A 285 ? 0.2967 0.2814 0.2752 0.0083  -0.0095 -0.0226 269  SER A OG  
2122 N N   . ARG A 286 ? 0.2705 0.2360 0.2358 0.0092  -0.0308 -0.0206 270  ARG A N   
2123 C CA  . ARG A 286 ? 0.2841 0.2428 0.2457 0.0099  -0.0392 -0.0209 270  ARG A CA  
2124 C C   . ARG A 286 ? 0.3102 0.2612 0.2549 0.0089  -0.0411 -0.0186 270  ARG A C   
2125 O O   . ARG A 286 ? 0.2940 0.2393 0.2272 0.0092  -0.0441 -0.0191 270  ARG A O   
2126 C CB  . ARG A 286 ? 0.3093 0.2677 0.2838 0.0112  -0.0446 -0.0207 270  ARG A CB  
2127 C CG  . ARG A 286 ? 0.4329 0.3965 0.4237 0.0126  -0.0454 -0.0226 270  ARG A CG  
2128 C CD  . ARG A 286 ? 0.4186 0.3807 0.4219 0.0141  -0.0523 -0.0222 270  ARG A CD  
2129 N NE  . ARG A 286 ? 0.4362 0.4008 0.4463 0.0151  -0.0490 -0.0210 270  ARG A NE  
2130 C CZ  . ARG A 286 ? 0.3982 0.3699 0.4214 0.0167  -0.0431 -0.0213 270  ARG A CZ  
2131 N NH1 . ARG A 286 ? 0.2446 0.2222 0.2774 0.0171  -0.0399 -0.0223 270  ARG A NH1 
2132 N NH2 . ARG A 286 ? 0.3600 0.3322 0.3867 0.0182  -0.0406 -0.0206 270  ARG A NH2 
2133 N N   . THR A 287 ? 0.3066 0.2568 0.2493 0.0080  -0.0395 -0.0159 271  THR A N   
2134 C CA  . THR A 287 ? 0.3224 0.2654 0.2501 0.0069  -0.0408 -0.0126 271  THR A CA  
2135 C C   . THR A 287 ? 0.3656 0.3088 0.2808 0.0060  -0.0347 -0.0116 271  THR A C   
2136 O O   . THR A 287 ? 0.4012 0.3373 0.3018 0.0062  -0.0365 -0.0100 271  THR A O   
2137 C CB  . THR A 287 ? 0.3869 0.3292 0.3175 0.0059  -0.0409 -0.0098 271  THR A CB  
2138 O OG1 . THR A 287 ? 0.4070 0.3556 0.3424 0.0049  -0.0337 -0.0095 271  THR A OG1 
2139 C CG2 . THR A 287 ? 0.3439 0.2851 0.2863 0.0075  -0.0472 -0.0108 271  THR A CG2 
2140 N N   . ALA A 288 ? 0.3106 0.2614 0.2314 0.0054  -0.0276 -0.0127 272  ALA A N   
2141 C CA  . ALA A 288 ? 0.3262 0.2788 0.2387 0.0047  -0.0209 -0.0119 272  ALA A CA  
2142 C C   . ALA A 288 ? 0.3847 0.3325 0.2862 0.0065  -0.0228 -0.0140 272  ALA A C   
2143 O O   . ALA A 288 ? 0.3943 0.3406 0.2846 0.0066  -0.0180 -0.0127 272  ALA A O   
2144 C CB  . ALA A 288 ? 0.3313 0.2925 0.2542 0.0042  -0.0149 -0.0135 272  ALA A CB  
2145 N N   . ILE A 289 ? 0.3282 0.2734 0.2335 0.0080  -0.0297 -0.0172 273  ILE A N   
2146 C CA  . ILE A 289 ? 0.3267 0.2659 0.2220 0.0099  -0.0334 -0.0198 273  ILE A CA  
2147 C C   . ILE A 289 ? 0.4060 0.3350 0.2811 0.0107  -0.0351 -0.0173 273  ILE A C   
2148 O O   . ILE A 289 ? 0.4050 0.3289 0.2660 0.0124  -0.0339 -0.0185 273  ILE A O   
2149 C CB  . ILE A 289 ? 0.3525 0.2900 0.2580 0.0111  -0.0422 -0.0230 273  ILE A CB  
2150 C CG1 . ILE A 289 ? 0.3183 0.2659 0.2430 0.0106  -0.0393 -0.0251 273  ILE A CG1 
2151 C CG2 . ILE A 289 ? 0.3883 0.3166 0.2813 0.0132  -0.0486 -0.0257 273  ILE A CG2 
2152 C CD1 . ILE A 289 ? 0.3209 0.2686 0.2608 0.0115  -0.0474 -0.0266 273  ILE A CD1 
2153 N N   . LEU A 290 ? 0.3670 0.2925 0.2401 0.0097  -0.0378 -0.0139 274  LEU A N   
2154 C CA  . LEU A 290 ? 0.3850 0.3005 0.2389 0.0103  -0.0393 -0.0106 274  LEU A CA  
2155 C C   . LEU A 290 ? 0.4525 0.3704 0.3017 0.0085  -0.0310 -0.0053 274  LEU A C   
2156 O O   . LEU A 290 ? 0.4729 0.3834 0.3091 0.0084  -0.0319 -0.0013 274  LEU A O   
2157 C CB  . LEU A 290 ? 0.3910 0.2978 0.2428 0.0109  -0.0502 -0.0104 274  LEU A CB  
2158 C CG  . LEU A 290 ? 0.4352 0.3383 0.2914 0.0128  -0.0594 -0.0152 274  LEU A CG  
2159 C CD1 . LEU A 290 ? 0.4503 0.3446 0.3051 0.0134  -0.0705 -0.0145 274  LEU A CD1 
2160 C CD2 . LEU A 290 ? 0.4434 0.3405 0.2843 0.0152  -0.0593 -0.0181 274  LEU A CD2 
2161 N N   . SER A 291 ? 0.3901 0.3180 0.2500 0.0069  -0.0231 -0.0050 275  SER A N   
2162 C CA  . SER A 291 ? 0.4005 0.3315 0.2587 0.0050  -0.0153 0.0000  275  SER A CA  
2163 C C   . SER A 291 ? 0.5247 0.4545 0.3695 0.0065  -0.0081 0.0009  275  SER A C   
2164 O O   . SER A 291 ? 0.5255 0.4532 0.3647 0.0090  -0.0091 -0.0033 275  SER A O   
2165 C CB  . SER A 291 ? 0.4237 0.3649 0.2994 0.0028  -0.0114 -0.0001 275  SER A CB  
2166 O OG  . SER A 291 ? 0.4557 0.4034 0.3365 0.0034  -0.0066 -0.0034 275  SER A OG  
2167 N N   . ASN A 292 ? 0.5166 0.4476 0.3573 0.0052  -0.0007 0.0065  276  ASN A N   
2168 C CA  . ASN A 292 ? 0.5290 0.4600 0.3589 0.0068  0.0080  0.0084  276  ASN A CA  
2169 C C   . ASN A 292 ? 0.5809 0.5208 0.4217 0.0071  0.0126  0.0043  276  ASN A C   
2170 O O   . ASN A 292 ? 0.5491 0.4974 0.4065 0.0046  0.0136  0.0041  276  ASN A O   
2171 C CB  . ASN A 292 ? 0.5297 0.4624 0.3592 0.0046  0.0149  0.0161  276  ASN A CB  
2172 C CG  . ASN A 292 ? 0.7632 0.6956 0.5816 0.0066  0.0249  0.0193  276  ASN A CG  
2173 O OD1 . ASN A 292 ? 0.6795 0.6190 0.5044 0.0071  0.0314  0.0178  276  ASN A OD1 
2174 N ND2 . ASN A 292 ? 0.6398 0.5640 0.4416 0.0078  0.0268  0.0243  276  ASN A ND2 
2175 N N   . GLU A 293 ? 0.5787 0.5159 0.4094 0.0103  0.0147  0.0009  277  GLU A N   
2176 C CA  . GLU A 293 ? 0.5802 0.5244 0.4195 0.0110  0.0183  -0.0033 277  GLU A CA  
2177 C C   . GLU A 293 ? 0.6373 0.5914 0.4879 0.0091  0.0276  0.0000  277  GLU A C   
2178 O O   . GLU A 293 ? 0.6335 0.5949 0.4968 0.0084  0.0286  -0.0030 277  GLU A O   
2179 C CB  . GLU A 293 ? 0.6157 0.5532 0.4398 0.0153  0.0182  -0.0074 277  GLU A CB  
2180 C CG  . GLU A 293 ? 0.7786 0.7081 0.5980 0.0169  0.0071  -0.0123 277  GLU A CG  
2181 C CD  . GLU A 293 ? 1.1152 1.0354 0.9178 0.0213  0.0047  -0.0166 277  GLU A CD  
2182 O OE1 . GLU A 293 ? 1.1249 1.0462 0.9216 0.0236  0.0122  -0.0173 277  GLU A OE1 
2183 O OE2 . GLU A 293 ? 1.0379 0.9491 0.8337 0.0226  -0.0052 -0.0195 277  GLU A OE2 
2184 N N   . LYS A 294 ? 0.5946 0.5488 0.4415 0.0081  0.0337  0.0065  278  LYS A N   
2185 C CA  . LYS A 294 ? 0.5798 0.5429 0.4385 0.0060  0.0420  0.0106  278  LYS A CA  
2186 C C   . LYS A 294 ? 0.6079 0.5755 0.4815 0.0017  0.0397  0.0142  278  LYS A C   
2187 O O   . LYS A 294 ? 0.6050 0.5801 0.4938 -0.0002 0.0405  0.0132  278  LYS A O   
2188 C CB  . LYS A 294 ? 0.6313 0.5923 0.4786 0.0079  0.0514  0.0161  278  LYS A CB  
2189 N N   . TYR A 295 ? 0.5384 0.5006 0.4070 0.0004  0.0364  0.0185  279  TYR A N   
2190 C CA  . TYR A 295 ? 0.5110 0.4756 0.3920 -0.0034 0.0335  0.0221  279  TYR A CA  
2191 C C   . TYR A 295 ? 0.4872 0.4521 0.3770 -0.0042 0.0249  0.0171  279  TYR A C   
2192 O O   . TYR A 295 ? 0.4725 0.4409 0.3748 -0.0068 0.0232  0.0184  279  TYR A O   
2193 C CB  . TYR A 295 ? 0.5440 0.5025 0.4167 -0.0044 0.0334  0.0288  279  TYR A CB  
2194 N N   . ARG A 296 ? 0.4075 0.3683 0.2909 -0.0018 0.0194  0.0117  280  ARG A N   
2195 C CA  . ARG A 296 ? 0.3929 0.3540 0.2844 -0.0018 0.0120  0.0070  280  ARG A CA  
2196 C C   . ARG A 296 ? 0.4224 0.3813 0.3196 -0.0039 0.0069  0.0095  280  ARG A C   
2197 O O   . ARG A 296 ? 0.4008 0.3623 0.3087 -0.0044 0.0035  0.0068  280  ARG A O   
2198 C CB  . ARG A 296 ? 0.3993 0.3680 0.3028 -0.0019 0.0140  0.0029  280  ARG A CB  
2199 C CG  . ARG A 296 ? 0.4671 0.4375 0.3658 0.0003  0.0180  -0.0002 280  ARG A CG  
2200 C CD  . ARG A 296 ? 0.5197 0.4869 0.4155 0.0026  0.0123  -0.0056 280  ARG A CD  
2201 N NE  . ARG A 296 ? 0.5820 0.5539 0.4913 0.0021  0.0094  -0.0090 280  ARG A NE  
2202 C CZ  . ARG A 296 ? 0.6954 0.6656 0.6076 0.0034  0.0036  -0.0126 280  ARG A CZ  
2203 N NH1 . ARG A 296 ? 0.4136 0.3770 0.3163 0.0051  -0.0013 -0.0138 280  ARG A NH1 
2204 N NH2 . ARG A 296 ? 0.5720 0.5470 0.4967 0.0031  0.0025  -0.0149 280  ARG A NH2 
2205 N N   . GLY A 297 ? 0.3713 0.3248 0.2605 -0.0048 0.0067  0.0148  281  GLY A N   
2206 C CA  . GLY A 297 ? 0.3581 0.3087 0.2520 -0.0067 0.0019  0.0177  281  GLY A CA  
2207 C C   . GLY A 297 ? 0.3995 0.3451 0.2927 -0.0054 -0.0066 0.0144  281  GLY A C   
2208 O O   . GLY A 297 ? 0.4045 0.3446 0.2874 -0.0034 -0.0098 0.0129  281  GLY A O   
2209 N N   . ILE A 298 ? 0.3565 0.3034 0.2610 -0.0062 -0.0106 0.0132  282  ILE A N   
2210 C CA  . ILE A 298 ? 0.3574 0.3001 0.2642 -0.0049 -0.0183 0.0107  282  ILE A CA  
2211 C C   . ILE A 298 ? 0.4014 0.3406 0.3122 -0.0067 -0.0218 0.0143  282  ILE A C   
2212 O O   . ILE A 298 ? 0.3990 0.3411 0.3164 -0.0086 -0.0193 0.0164  282  ILE A O   
2213 C CB  . ILE A 298 ? 0.3892 0.3359 0.3053 -0.0028 -0.0203 0.0045  282  ILE A CB  
2214 C CG1 . ILE A 298 ? 0.3862 0.3386 0.3136 -0.0034 -0.0174 0.0031  282  ILE A CG1 
2215 C CG2 . ILE A 298 ? 0.4014 0.3494 0.3128 -0.0010 -0.0189 0.0011  282  ILE A CG2 
2216 C CD1 . ILE A 298 ? 0.5068 0.4609 0.4434 -0.0011 -0.0202 -0.0015 282  ILE A CD1 
2217 N N   . ARG A 299 ? 0.3516 0.2842 0.2585 -0.0060 -0.0283 0.0152  283  ARG A N   
2218 C CA  . ARG A 299 ? 0.3564 0.2842 0.2659 -0.0075 -0.0327 0.0187  283  ARG A CA  
2219 C C   . ARG A 299 ? 0.3911 0.3190 0.3112 -0.0056 -0.0379 0.0142  283  ARG A C   
2220 O O   . ARG A 299 ? 0.3847 0.3119 0.3059 -0.0031 -0.0415 0.0105  283  ARG A O   
2221 C CB  . ARG A 299 ? 0.4102 0.3297 0.3076 -0.0075 -0.0368 0.0225  283  ARG A CB  
2222 C CG  . ARG A 299 ? 0.6336 0.5477 0.5303 -0.0099 -0.0395 0.0285  283  ARG A CG  
2223 C CD  . ARG A 299 ? 0.7596 0.6652 0.6422 -0.0097 -0.0428 0.0325  283  ARG A CD  
2224 N NE  . ARG A 299 ? 0.8376 0.7429 0.7075 -0.0102 -0.0359 0.0364  283  ARG A NE  
2225 C CZ  . ARG A 299 ? 0.9676 0.8709 0.8326 -0.0126 -0.0318 0.0439  283  ARG A CZ  
2226 N NH1 . ARG A 299 ? 0.7357 0.6370 0.6079 -0.0151 -0.0348 0.0483  283  ARG A NH1 
2227 N NH2 . ARG A 299 ? 0.7821 0.6853 0.6354 -0.0123 -0.0245 0.0472  283  ARG A NH2 
2228 N N   . LEU A 300 ? 0.3431 0.2716 0.2713 -0.0065 -0.0383 0.0146  284  LEU A N   
2229 C CA  . LEU A 300 ? 0.3291 0.2568 0.2663 -0.0041 -0.0424 0.0105  284  LEU A CA  
2230 C C   . LEU A 300 ? 0.3862 0.3064 0.3235 -0.0047 -0.0489 0.0136  284  LEU A C   
2231 O O   . LEU A 300 ? 0.3879 0.3056 0.3246 -0.0074 -0.0490 0.0180  284  LEU A O   
2232 C CB  . LEU A 300 ? 0.3220 0.2539 0.2664 -0.0038 -0.0390 0.0080  284  LEU A CB  
2233 C CG  . LEU A 300 ? 0.3789 0.3181 0.3262 -0.0022 -0.0336 0.0037  284  LEU A CG  
2234 C CD1 . LEU A 300 ? 0.4137 0.3569 0.3553 -0.0042 -0.0283 0.0056  284  LEU A CD1 
2235 C CD2 . LEU A 300 ? 0.3735 0.3145 0.3266 -0.0015 -0.0317 0.0014  284  LEU A CD2 
2236 N N   . GLN A 301 ? 0.3372 0.2538 0.2763 -0.0023 -0.0545 0.0115  285  GLN A N   
2237 C CA  . GLN A 301 ? 0.3445 0.2537 0.2847 -0.0024 -0.0613 0.0139  285  GLN A CA  
2238 C C   . GLN A 301 ? 0.3616 0.2706 0.3118 0.0010  -0.0637 0.0091  285  GLN A C   
2239 O O   . GLN A 301 ? 0.3379 0.2487 0.2930 0.0043  -0.0648 0.0052  285  GLN A O   
2240 C CB  . GLN A 301 ? 0.3799 0.2835 0.3134 -0.0023 -0.0667 0.0161  285  GLN A CB  
2241 C CG  . GLN A 301 ? 0.6817 0.5829 0.6027 -0.0054 -0.0645 0.0218  285  GLN A CG  
2242 C CD  . GLN A 301 ? 1.0225 0.9155 0.9355 -0.0053 -0.0712 0.0248  285  GLN A CD  
2243 O OE1 . GLN A 301 ? 0.9476 0.8391 0.8554 -0.0037 -0.0734 0.0230  285  GLN A OE1 
2244 N NE2 . GLN A 301 ? 0.9786 0.8652 0.8906 -0.0071 -0.0753 0.0296  285  GLN A NE2 
2245 N N   . LEU A 302 ? 0.3277 0.2346 0.2811 0.0006  -0.0641 0.0095  286  LEU A N   
2246 C CA  . LEU A 302 ? 0.3284 0.2338 0.2891 0.0044  -0.0659 0.0049  286  LEU A CA  
2247 C C   . LEU A 302 ? 0.3903 0.2875 0.3531 0.0055  -0.0735 0.0060  286  LEU A C   
2248 O O   . LEU A 302 ? 0.4047 0.2967 0.3640 0.0022  -0.0772 0.0109  286  LEU A O   
2249 C CB  . LEU A 302 ? 0.3303 0.2365 0.2923 0.0041  -0.0627 0.0035  286  LEU A CB  
2250 C CG  . LEU A 302 ? 0.3819 0.2961 0.3440 0.0047  -0.0554 0.0007  286  LEU A CG  
2251 C CD1 . LEU A 302 ? 0.3806 0.2952 0.3419 0.0022  -0.0531 0.0019  286  LEU A CD1 
2252 C CD2 . LEU A 302 ? 0.4040 0.3206 0.3713 0.0098  -0.0534 -0.0051 286  LEU A CD2 
2253 N N   . SER A 303 ? 0.3324 0.2288 0.3018 0.0102  -0.0754 0.0016  287  SER A N   
2254 C CA  . SER A 303 ? 0.3398 0.2286 0.3130 0.0123  -0.0826 0.0015  287  SER A CA  
2255 C C   . SER A 303 ? 0.3820 0.2716 0.3626 0.0183  -0.0807 -0.0045 287  SER A C   
2256 O O   . SER A 303 ? 0.3441 0.2402 0.3262 0.0201  -0.0741 -0.0076 287  SER A O   
2257 C CB  . SER A 303 ? 0.3737 0.2598 0.3462 0.0116  -0.0880 0.0042  287  SER A CB  
2258 O OG  . SER A 303 ? 0.3943 0.2857 0.3713 0.0142  -0.0864 0.0014  287  SER A OG  
2259 N N   . ASN A 304 ? 0.3670 0.2497 0.3519 0.0216  -0.0860 -0.0059 288  ASN A N   
2260 C CA  . ASN A 304 ? 0.3665 0.2491 0.3575 0.0281  -0.0836 -0.0114 288  ASN A CA  
2261 C C   . ASN A 304 ? 0.3674 0.2586 0.3653 0.0314  -0.0779 -0.0142 288  ASN A C   
2262 O O   . ASN A 304 ? 0.3643 0.2578 0.3674 0.0310  -0.0806 -0.0128 288  ASN A O   
2263 C CB  . ASN A 304 ? 0.4127 0.2865 0.4079 0.0316  -0.0905 -0.0123 288  ASN A CB  
2264 C CG  . ASN A 304 ? 0.8326 0.7034 0.8303 0.0383  -0.0879 -0.0178 288  ASN A CG  
2265 O OD1 . ASN A 304 ? 0.7588 0.6348 0.7625 0.0432  -0.0822 -0.0213 288  ASN A OD1 
2266 N ND2 . ASN A 304 ? 0.7934 0.6551 0.7863 0.0388  -0.0919 -0.0186 288  ASN A ND2 
2267 N N   . GLY A 305 ? 0.3171 0.2129 0.3149 0.0339  -0.0705 -0.0175 289  GLY A N   
2268 C CA  . GLY A 305 ? 0.2886 0.1928 0.2934 0.0371  -0.0638 -0.0199 289  GLY A CA  
2269 C C   . GLY A 305 ? 0.3220 0.2337 0.3275 0.0331  -0.0623 -0.0177 289  GLY A C   
2270 O O   . GLY A 305 ? 0.2880 0.2063 0.3018 0.0355  -0.0586 -0.0191 289  GLY A O   
2271 N N   . LEU A 306 ? 0.2904 0.2008 0.2876 0.0274  -0.0652 -0.0140 290  LEU A N   
2272 C CA  . LEU A 306 ? 0.3022 0.2175 0.2980 0.0241  -0.0648 -0.0120 290  LEU A CA  
2273 C C   . LEU A 306 ? 0.3279 0.2445 0.3134 0.0190  -0.0626 -0.0093 290  LEU A C   
2274 O O   . LEU A 306 ? 0.3127 0.2243 0.2916 0.0161  -0.0651 -0.0064 290  LEU A O   
2275 C CB  . LEU A 306 ? 0.3137 0.2246 0.3115 0.0234  -0.0729 -0.0096 290  LEU A CB  
2276 C CG  . LEU A 306 ? 0.3975 0.3114 0.3948 0.0214  -0.0747 -0.0082 290  LEU A CG  
2277 C CD1 . LEU A 306 ? 0.3983 0.3194 0.4081 0.0249  -0.0716 -0.0113 290  LEU A CD1 
2278 C CD2 . LEU A 306 ? 0.4506 0.3572 0.4457 0.0201  -0.0838 -0.0052 290  LEU A CD2 
2279 N N   . LEU A 307 ? 0.2814 0.2048 0.2665 0.0180  -0.0581 -0.0098 291  LEU A N   
2280 C CA  . LEU A 307 ? 0.2816 0.2068 0.2576 0.0137  -0.0555 -0.0074 291  LEU A CA  
2281 C C   . LEU A 307 ? 0.3331 0.2594 0.3067 0.0123  -0.0578 -0.0061 291  LEU A C   
2282 O O   . LEU A 307 ? 0.3264 0.2569 0.3068 0.0145  -0.0571 -0.0085 291  LEU A O   
2283 C CB  . LEU A 307 ? 0.2774 0.2087 0.2535 0.0139  -0.0480 -0.0096 291  LEU A CB  
2284 C CG  . LEU A 307 ? 0.3409 0.2760 0.3098 0.0101  -0.0443 -0.0076 291  LEU A CG  
2285 C CD1 . LEU A 307 ? 0.3434 0.2743 0.3047 0.0062  -0.0457 -0.0032 291  LEU A CD1 
2286 C CD2 . LEU A 307 ? 0.3625 0.3036 0.3333 0.0108  -0.0375 -0.0101 291  LEU A CD2 
2287 N N   . LYS A 308 ? 0.2888 0.2105 0.2527 0.0090  -0.0608 -0.0021 292  LYS A N   
2288 C CA  . LYS A 308 ? 0.2922 0.2130 0.2502 0.0080  -0.0632 -0.0009 292  LYS A CA  
2289 C C   . LYS A 308 ? 0.3478 0.2718 0.2966 0.0052  -0.0572 0.0006  292  LYS A C   
2290 O O   . LYS A 308 ? 0.3521 0.2747 0.2955 0.0027  -0.0549 0.0037  292  LYS A O   
2291 C CB  . LYS A 308 ? 0.3314 0.2435 0.2832 0.0068  -0.0708 0.0028  292  LYS A CB  
2292 C CG  . LYS A 308 ? 0.6315 0.5404 0.5777 0.0070  -0.0756 0.0032  292  LYS A CG  
2293 C CD  . LYS A 308 ? 0.8435 0.7426 0.7809 0.0057  -0.0831 0.0074  292  LYS A CD  
2294 C CE  . LYS A 308 ? 1.0503 0.9454 0.9977 0.0079  -0.0905 0.0068  292  LYS A CE  
2295 N NZ  . LYS A 308 ? 1.2097 1.0949 1.1481 0.0068  -0.0988 0.0107  292  LYS A NZ  
2296 N N   . ILE A 309 ? 0.2984 0.2266 0.2467 0.0058  -0.0547 -0.0017 293  ILE A N   
2297 C CA  . ILE A 309 ? 0.2965 0.2281 0.2369 0.0039  -0.0487 -0.0009 293  ILE A CA  
2298 C C   . ILE A 309 ? 0.3717 0.2981 0.3002 0.0033  -0.0519 0.0009  293  ILE A C   
2299 O O   . ILE A 309 ? 0.3661 0.2900 0.2964 0.0050  -0.0576 -0.0010 293  ILE A O   
2300 C CB  . ILE A 309 ? 0.3376 0.2772 0.2853 0.0052  -0.0433 -0.0049 293  ILE A CB  
2301 C CG1 . ILE A 309 ? 0.3363 0.2796 0.2939 0.0065  -0.0403 -0.0068 293  ILE A CG1 
2302 C CG2 . ILE A 309 ? 0.3657 0.3085 0.3056 0.0034  -0.0374 -0.0042 293  ILE A CG2 
2303 C CD1 . ILE A 309 ? 0.3562 0.3048 0.3243 0.0094  -0.0388 -0.0107 293  ILE A CD1 
2304 N N   . GLN A 310 ? 0.3243 0.2485 0.2409 0.0011  -0.0485 0.0046  294  GLN A N   
2305 C CA  . GLN A 310 ? 0.3429 0.2609 0.2450 0.0011  -0.0508 0.0065  294  GLN A CA  
2306 C C   . GLN A 310 ? 0.3749 0.2958 0.2680 0.0002  -0.0430 0.0074  294  GLN A C   
2307 O O   . GLN A 310 ? 0.3627 0.2876 0.2572 -0.0017 -0.0367 0.0100  294  GLN A O   
2308 C CB  . GLN A 310 ? 0.3685 0.2777 0.2623 -0.0001 -0.0556 0.0115  294  GLN A CB  
2309 C CG  . GLN A 310 ? 0.6308 0.5315 0.5070 0.0004  -0.0584 0.0137  294  GLN A CG  
2310 C CD  . GLN A 310 ? 1.0077 0.9000 0.8750 -0.0010 -0.0620 0.0196  294  GLN A CD  
2311 O OE1 . GLN A 310 ? 0.9762 0.8636 0.8476 -0.0006 -0.0698 0.0199  294  GLN A OE1 
2312 N NE2 . GLN A 310 ? 0.8897 0.7799 0.7447 -0.0026 -0.0561 0.0247  294  GLN A NE2 
2313 N N   . ALA A 311 ? 0.3575 0.2759 0.2418 0.0018  -0.0439 0.0054  295  ALA A N   
2314 C CA  . ALA A 311 ? 0.3584 0.2782 0.2326 0.0017  -0.0369 0.0060  295  ALA A CA  
2315 C C   . ALA A 311 ? 0.4220 0.3319 0.2776 0.0032  -0.0402 0.0073  295  ALA A C   
2316 O O   . ALA A 311 ? 0.4194 0.3229 0.2728 0.0047  -0.0488 0.0053  295  ALA A O   
2317 C CB  . ALA A 311 ? 0.3523 0.2795 0.2346 0.0028  -0.0338 0.0009  295  ALA A CB  
2318 N N   . ASN A 312 ? 0.4121 0.3201 0.2544 0.0030  -0.0335 0.0110  296  ASN A N   
2319 C CA  . ASN A 312 ? 0.4456 0.3434 0.2665 0.0049  -0.0343 0.0129  296  ASN A CA  
2320 C C   . ASN A 312 ? 0.5010 0.4019 0.3140 0.0060  -0.0247 0.0128  296  ASN A C   
2321 O O   . ASN A 312 ? 0.4862 0.3965 0.3094 0.0042  -0.0169 0.0141  296  ASN A O   
2322 C CB  . ASN A 312 ? 0.4745 0.3653 0.2854 0.0035  -0.0346 0.0200  296  ASN A CB  
2323 C CG  . ASN A 312 ? 0.7781 0.6636 0.5938 0.0029  -0.0447 0.0204  296  ASN A CG  
2324 O OD1 . ASN A 312 ? 0.7906 0.6661 0.5952 0.0047  -0.0528 0.0196  296  ASN A OD1 
2325 N ND2 . ASN A 312 ? 0.5730 0.4645 0.4049 0.0005  -0.0449 0.0216  296  ASN A ND2 
2326 N N   . ASN A 313 ? 0.4941 0.3868 0.2893 0.0091  -0.0258 0.0112  297  ASN A N   
2327 C CA  . ASN A 313 ? 0.5173 0.4114 0.3027 0.0110  -0.0167 0.0108  297  ASN A CA  
2328 C C   . ASN A 313 ? 0.6355 0.5179 0.3955 0.0135  -0.0142 0.0152  297  ASN A C   
2329 O O   . ASN A 313 ? 0.6402 0.5129 0.3904 0.0137  -0.0213 0.0175  297  ASN A O   
2330 C CB  . ASN A 313 ? 0.4720 0.3675 0.2603 0.0133  -0.0196 0.0034  297  ASN A CB  
2331 C CG  . ASN A 313 ? 0.6043 0.4885 0.3822 0.0160  -0.0308 -0.0007 297  ASN A CG  
2332 O OD1 . ASN A 313 ? 0.5620 0.4345 0.3232 0.0174  -0.0358 0.0016  297  ASN A OD1 
2333 N ND2 . ASN A 313 ? 0.5226 0.4095 0.3099 0.0169  -0.0353 -0.0068 297  ASN A ND2 
2334 N N   . PRO A 314 ? 0.6310 0.5133 0.3792 0.0158  -0.0043 0.0166  298  PRO A N   
2335 C CA  . PRO A 314 ? 0.6631 0.5337 0.3857 0.0187  -0.0009 0.0213  298  PRO A CA  
2336 C C   . PRO A 314 ? 0.7540 0.6086 0.4552 0.0224  -0.0113 0.0180  298  PRO A C   
2337 O O   . PRO A 314 ? 0.7931 0.6366 0.4740 0.0240  -0.0109 0.0228  298  PRO A O   
2338 C CB  . PRO A 314 ? 0.6870 0.5620 0.4042 0.0210  0.0119  0.0220  298  PRO A CB  
2339 C CG  . PRO A 314 ? 0.7166 0.6074 0.4599 0.0176  0.0164  0.0208  298  PRO A CG  
2340 C CD  . PRO A 314 ? 0.6385 0.5314 0.3960 0.0160  0.0051  0.0147  298  PRO A CD  
2341 N N   . GLU A 315 ? 0.6952 0.5480 0.4013 0.0235  -0.0209 0.0103  299  GLU A N   
2342 C CA  . GLU A 315 ? 0.7040 0.5414 0.3927 0.0269  -0.0330 0.0063  299  GLU A CA  
2343 C C   . GLU A 315 ? 0.7256 0.5581 0.4198 0.0247  -0.0450 0.0077  299  GLU A C   
2344 O O   . GLU A 315 ? 0.7206 0.5416 0.4060 0.0267  -0.0570 0.0041  299  GLU A O   
2345 C CB  . GLU A 315 ? 0.7200 0.5577 0.4134 0.0290  -0.0384 -0.0021 299  GLU A CB  
2346 C CG  . GLU A 315 ? 0.8713 0.7144 0.5621 0.0313  -0.0277 -0.0043 299  GLU A CG  
2347 C CD  . GLU A 315 ? 1.1227 0.9834 0.8412 0.0278  -0.0222 -0.0056 299  GLU A CD  
2348 O OE1 . GLU A 315 ? 1.0418 0.9124 0.7691 0.0252  -0.0121 -0.0005 299  GLU A OE1 
2349 O OE2 . GLU A 315 ? 1.0292 0.8937 0.7613 0.0274  -0.0285 -0.0114 299  GLU A OE2 
2350 N N   . GLN A 316 ? 0.6697 0.5107 0.3794 0.0205  -0.0421 0.0127  300  GLN A N   
2351 C CA  . GLN A 316 ? 0.6562 0.4944 0.3740 0.0181  -0.0517 0.0147  300  GLN A CA  
2352 C C   . GLN A 316 ? 0.6356 0.4779 0.3736 0.0172  -0.0622 0.0087  300  GLN A C   
2353 O O   . GLN A 316 ? 0.6298 0.4677 0.3730 0.0163  -0.0721 0.0092  300  GLN A O   
2354 C CB  . GLN A 316 ? 0.7058 0.5275 0.3992 0.0199  -0.0573 0.0190  300  GLN A CB  
2355 N N   . GLU A 317 ? 0.5316 0.3832 0.2828 0.0175  -0.0596 0.0034  301  GLU A N   
2356 C CA  . GLU A 317 ? 0.4859 0.3433 0.2589 0.0166  -0.0674 -0.0014 301  GLU A CA  
2357 C C   . GLU A 317 ? 0.4931 0.3621 0.2874 0.0130  -0.0638 0.0012  301  GLU A C   
2358 O O   . GLU A 317 ? 0.4936 0.3684 0.2882 0.0113  -0.0542 0.0052  301  GLU A O   
2359 C CB  . GLU A 317 ? 0.4794 0.3423 0.2589 0.0179  -0.0655 -0.0072 301  GLU A CB  
2360 C CG  . GLU A 317 ? 0.5043 0.3542 0.2631 0.0218  -0.0711 -0.0107 301  GLU A CG  
2361 C CD  . GLU A 317 ? 0.5428 0.3969 0.3055 0.0234  -0.0686 -0.0161 301  GLU A CD  
2362 O OE1 . GLU A 317 ? 0.5887 0.4546 0.3609 0.0221  -0.0579 -0.0158 301  GLU A OE1 
2363 O OE2 . GLU A 317 ? 0.5383 0.3831 0.2941 0.0260  -0.0780 -0.0205 301  GLU A OE2 
2364 N N   . GLU A 318 ? 0.4188 0.2904 0.2304 0.0122  -0.0717 -0.0008 302  GLU A N   
2365 C CA  . GLU A 318 ? 0.3840 0.2647 0.2142 0.0097  -0.0692 0.0011  302  GLU A CA  
2366 C C   . GLU A 318 ? 0.4154 0.3039 0.2685 0.0098  -0.0732 -0.0033 302  GLU A C   
2367 O O   . GLU A 318 ? 0.4147 0.2989 0.2710 0.0113  -0.0821 -0.0064 302  GLU A O   
2368 C CB  . GLU A 318 ? 0.4044 0.2775 0.2294 0.0087  -0.0745 0.0058  302  GLU A CB  
2369 C CG  . GLU A 318 ? 0.5400 0.4209 0.3812 0.0063  -0.0716 0.0082  302  GLU A CG  
2370 C CD  . GLU A 318 ? 0.7881 0.6611 0.6250 0.0054  -0.0775 0.0128  302  GLU A CD  
2371 O OE1 . GLU A 318 ? 0.7045 0.5731 0.5476 0.0063  -0.0874 0.0112  302  GLU A OE1 
2372 O OE2 . GLU A 318 ? 0.7144 0.5854 0.5422 0.0037  -0.0725 0.0182  302  GLU A OE2 
2373 N N   . ALA A 319 ? 0.3815 0.2811 0.2502 0.0082  -0.0664 -0.0033 303  ALA A N   
2374 C CA  . ALA A 319 ? 0.3620 0.2695 0.2520 0.0085  -0.0680 -0.0067 303  ALA A CA  
2375 C C   . ALA A 319 ? 0.3944 0.3052 0.2945 0.0073  -0.0669 -0.0043 303  ALA A C   
2376 O O   . ALA A 319 ? 0.3836 0.2954 0.2786 0.0056  -0.0612 -0.0009 303  ALA A O   
2377 C CB  . ALA A 319 ? 0.3554 0.2724 0.2528 0.0085  -0.0605 -0.0096 303  ALA A CB  
2378 N N   . GLU A 320 ? 0.3476 0.2594 0.2623 0.0084  -0.0727 -0.0058 304  GLU A N   
2379 C CA  . GLU A 320 ? 0.3505 0.2644 0.2750 0.0080  -0.0724 -0.0042 304  GLU A CA  
2380 C C   . GLU A 320 ? 0.3881 0.3093 0.3328 0.0098  -0.0724 -0.0075 304  GLU A C   
2381 O O   . GLU A 320 ? 0.3681 0.2901 0.3207 0.0113  -0.0766 -0.0099 304  GLU A O   
2382 C CB  . GLU A 320 ? 0.3833 0.2873 0.3013 0.0079  -0.0809 -0.0011 304  GLU A CB  
2383 C CG  . GLU A 320 ? 0.6074 0.5111 0.5303 0.0071  -0.0805 0.0015  304  GLU A CG  
2384 C CD  . GLU A 320 ? 0.9924 0.8857 0.9068 0.0066  -0.0885 0.0051  304  GLU A CD  
2385 O OE1 . GLU A 320 ? 0.8517 0.7422 0.7593 0.0047  -0.0865 0.0092  304  GLU A OE1 
2386 O OE2 . GLU A 320 ? 0.9423 0.8300 0.8574 0.0080  -0.0972 0.0042  304  GLU A OE2 
2387 N N   . GLU A 321 ? 0.3209 0.2471 0.2739 0.0098  -0.0674 -0.0074 305  GLU A N   
2388 C CA  . GLU A 321 ? 0.3048 0.2374 0.2756 0.0122  -0.0661 -0.0101 305  GLU A CA  
2389 C C   . GLU A 321 ? 0.3246 0.2572 0.3004 0.0129  -0.0648 -0.0092 305  GLU A C   
2390 O O   . GLU A 321 ? 0.3318 0.2636 0.2999 0.0111  -0.0609 -0.0076 305  GLU A O   
2391 C CB  . GLU A 321 ? 0.3116 0.2527 0.2878 0.0125  -0.0587 -0.0126 305  GLU A CB  
2392 C CG  . GLU A 321 ? 0.4378 0.3848 0.4323 0.0153  -0.0581 -0.0149 305  GLU A CG  
2393 C CD  . GLU A 321 ? 0.4623 0.4170 0.4633 0.0157  -0.0521 -0.0170 305  GLU A CD  
2394 O OE1 . GLU A 321 ? 0.4113 0.3660 0.4038 0.0141  -0.0511 -0.0174 305  GLU A OE1 
2395 O OE2 . GLU A 321 ? 0.4365 0.3969 0.4511 0.0180  -0.0484 -0.0181 305  GLU A OE2 
2396 N N   . GLU A 322 ? 0.2812 0.2142 0.2702 0.0156  -0.0681 -0.0104 306  GLU A N   
2397 C CA  . GLU A 322 ? 0.2799 0.2123 0.2744 0.0172  -0.0670 -0.0104 306  GLU A CA  
2398 C C   . GLU A 322 ? 0.3209 0.2608 0.3272 0.0202  -0.0600 -0.0133 306  GLU A C   
2399 O O   . GLU A 322 ? 0.3128 0.2575 0.3304 0.0220  -0.0595 -0.0148 306  GLU A O   
2400 C CB  . GLU A 322 ? 0.3126 0.2392 0.3131 0.0189  -0.0753 -0.0095 306  GLU A CB  
2401 C CG  . GLU A 322 ? 0.4631 0.3808 0.4504 0.0162  -0.0823 -0.0061 306  GLU A CG  
2402 C CD  . GLU A 322 ? 0.7610 0.6723 0.7537 0.0176  -0.0911 -0.0050 306  GLU A CD  
2403 O OE1 . GLU A 322 ? 0.5895 0.5037 0.5980 0.0210  -0.0920 -0.0070 306  GLU A OE1 
2404 O OE2 . GLU A 322 ? 0.7311 0.6343 0.7125 0.0155  -0.0970 -0.0018 306  GLU A OE2 
2405 N N   . VAL A 323 ? 0.2748 0.2153 0.2781 0.0205  -0.0547 -0.0138 307  VAL A N   
2406 C CA  . VAL A 323 ? 0.2522 0.1983 0.2636 0.0236  -0.0477 -0.0164 307  VAL A CA  
2407 C C   . VAL A 323 ? 0.2986 0.2404 0.3115 0.0265  -0.0479 -0.0171 307  VAL A C   
2408 O O   . VAL A 323 ? 0.2857 0.2219 0.2896 0.0245  -0.0502 -0.0157 307  VAL A O   
2409 C CB  . VAL A 323 ? 0.2955 0.2460 0.3002 0.0217  -0.0407 -0.0169 307  VAL A CB  
2410 C CG1 . VAL A 323 ? 0.2815 0.2363 0.2925 0.0252  -0.0337 -0.0194 307  VAL A CG1 
2411 C CG2 . VAL A 323 ? 0.2909 0.2450 0.2941 0.0194  -0.0407 -0.0166 307  VAL A CG2 
2412 N N   . GLN A 324 ? 0.2463 0.1903 0.2709 0.0313  -0.0457 -0.0190 308  GLN A N   
2413 C CA  . GLN A 324 ? 0.2488 0.1881 0.2741 0.0350  -0.0453 -0.0204 308  GLN A CA  
2414 C C   . GLN A 324 ? 0.2725 0.2117 0.2894 0.0353  -0.0390 -0.0219 308  GLN A C   
2415 O O   . GLN A 324 ? 0.2602 0.2054 0.2780 0.0355  -0.0327 -0.0228 308  GLN A O   
2416 C CB  . GLN A 324 ? 0.2686 0.2108 0.3089 0.0408  -0.0431 -0.0220 308  GLN A CB  
2417 C CG  . GLN A 324 ? 0.4407 0.3810 0.4908 0.0412  -0.0509 -0.0206 308  GLN A CG  
2418 C CD  . GLN A 324 ? 0.7000 0.6427 0.7659 0.0474  -0.0484 -0.0219 308  GLN A CD  
2419 O OE1 . GLN A 324 ? 0.5509 0.4996 0.6313 0.0487  -0.0479 -0.0213 308  GLN A OE1 
2420 N NE2 . GLN A 324 ? 0.6504 0.5880 0.7144 0.0515  -0.0469 -0.0237 308  GLN A NE2 
2421 N N   . VAL A 325 ? 0.2480 0.1799 0.2567 0.0349  -0.0416 -0.0219 309  VAL A N   
2422 C CA  . VAL A 325 ? 0.2393 0.1688 0.2395 0.0353  -0.0378 -0.0234 309  VAL A CA  
2423 C C   . VAL A 325 ? 0.3131 0.2341 0.3116 0.0395  -0.0403 -0.0254 309  VAL A C   
2424 O O   . VAL A 325 ? 0.3098 0.2263 0.3119 0.0404  -0.0460 -0.0247 309  VAL A O   
2425 C CB  . VAL A 325 ? 0.2710 0.1995 0.2614 0.0293  -0.0395 -0.0209 309  VAL A CB  
2426 C CG1 . VAL A 325 ? 0.2642 0.2006 0.2546 0.0261  -0.0355 -0.0199 309  VAL A CG1 
2427 C CG2 . VAL A 325 ? 0.2725 0.1950 0.2596 0.0258  -0.0471 -0.0177 309  VAL A CG2 
2428 N N   . GLU A 326 ? 0.2835 0.2012 0.2756 0.0420  -0.0368 -0.0278 310  GLU A N   
2429 C CA  . GLU A 326 ? 0.3054 0.2130 0.2929 0.0458  -0.0399 -0.0300 310  GLU A CA  
2430 C C   . GLU A 326 ? 0.3538 0.2558 0.3336 0.0401  -0.0463 -0.0276 310  GLU A C   
2431 O O   . GLU A 326 ? 0.3231 0.2258 0.2968 0.0371  -0.0446 -0.0271 310  GLU A O   
2432 C CB  . GLU A 326 ? 0.3292 0.2345 0.3113 0.0512  -0.0337 -0.0337 310  GLU A CB  
2433 C CG  . GLU A 326 ? 0.4767 0.3878 0.4666 0.0571  -0.0258 -0.0355 310  GLU A CG  
2434 C CD  . GLU A 326 ? 0.7710 0.6811 0.7539 0.0616  -0.0182 -0.0381 310  GLU A CD  
2435 O OE1 . GLU A 326 ? 0.6579 0.5589 0.6290 0.0628  -0.0202 -0.0402 310  GLU A OE1 
2436 O OE2 . GLU A 326 ? 0.7002 0.6182 0.6896 0.0639  -0.0105 -0.0379 310  GLU A OE2 
2437 N N   . TYR A 327 ? 0.3395 0.2365 0.3209 0.0382  -0.0537 -0.0254 311  TYR A N   
2438 C CA  . TYR A 327 ? 0.3405 0.2325 0.3168 0.0326  -0.0598 -0.0219 311  TYR A CA  
2439 C C   . TYR A 327 ? 0.3999 0.2836 0.3781 0.0333  -0.0678 -0.0209 311  TYR A C   
2440 O O   . TYR A 327 ? 0.3601 0.2453 0.3444 0.0344  -0.0697 -0.0202 311  TYR A O   
2441 C CB  . TYR A 327 ? 0.3583 0.2574 0.3345 0.0263  -0.0590 -0.0175 311  TYR A CB  
2442 C CG  . TYR A 327 ? 0.3945 0.2895 0.3666 0.0205  -0.0641 -0.0128 311  TYR A CG  
2443 C CD1 . TYR A 327 ? 0.4308 0.3243 0.3987 0.0178  -0.0636 -0.0118 311  TYR A CD1 
2444 C CD2 . TYR A 327 ? 0.4047 0.2973 0.3777 0.0177  -0.0695 -0.0087 311  TYR A CD2 
2445 C CE1 . TYR A 327 ? 0.4463 0.3369 0.4127 0.0123  -0.0677 -0.0067 311  TYR A CE1 
2446 C CE2 . TYR A 327 ? 0.4250 0.3139 0.3946 0.0124  -0.0733 -0.0036 311  TYR A CE2 
2447 C CZ  . TYR A 327 ? 0.4996 0.3882 0.4669 0.0097  -0.0720 -0.0024 311  TYR A CZ  
2448 O OH  . TYR A 327 ? 0.4908 0.3766 0.4569 0.0044  -0.0752 0.0034  311  TYR A OH  
2449 N N   . ASN A 328 ? 0.3917 0.2664 0.3651 0.0324  -0.0731 -0.0206 312  ASN A N   
2450 C CA  . ASN A 328 ? 0.4250 0.2907 0.3999 0.0325  -0.0815 -0.0193 312  ASN A CA  
2451 C C   . ASN A 328 ? 0.5230 0.3837 0.4948 0.0262  -0.0876 -0.0144 312  ASN A C   
2452 O O   . ASN A 328 ? 0.5281 0.3799 0.5006 0.0260  -0.0951 -0.0132 312  ASN A O   
2453 C CB  . ASN A 328 ? 0.4488 0.3063 0.4236 0.0400  -0.0829 -0.0246 312  ASN A CB  
2454 C CG  . ASN A 328 ? 0.6842 0.5356 0.6513 0.0427  -0.0818 -0.0284 312  ASN A CG  
2455 O OD1 . ASN A 328 ? 0.5648 0.4158 0.5275 0.0382  -0.0827 -0.0265 312  ASN A OD1 
2456 N ND2 . ASN A 328 ? 0.6206 0.4664 0.5859 0.0506  -0.0802 -0.0337 312  ASN A ND2 
2457 N N   . GLY A 329 ? 0.5111 0.3778 0.4807 0.0209  -0.0842 -0.0112 313  GLY A N   
2458 C CA  . GLY A 329 ? 0.5398 0.4035 0.5085 0.0146  -0.0886 -0.0054 313  GLY A CA  
2459 C C   . GLY A 329 ? 0.6269 0.4898 0.5976 0.0115  -0.0927 -0.0002 313  GLY A C   
2460 O O   . GLY A 329 ? 0.6521 0.5147 0.6251 0.0146  -0.0940 -0.0018 313  GLY A O   
2461 N N   . GLY A 330 ? 0.5684 0.4309 0.5386 0.0055  -0.0947 0.0062  314  GLY A N   
2462 C CA  . GLY A 330 ? 0.5627 0.4238 0.5328 0.0029  -0.0982 0.0113  314  GLY A CA  
2463 C C   . GLY A 330 ? 0.5653 0.4350 0.5324 0.0014  -0.0923 0.0131  314  GLY A C   
2464 O O   . GLY A 330 ? 0.5661 0.4434 0.5325 0.0028  -0.0856 0.0097  314  GLY A O   
2465 N N   . ASN A 331 ? 0.4673 0.3354 0.4319 -0.0015 -0.0949 0.0184  315  ASN A N   
2466 C CA  . ASN A 331 ? 0.4504 0.3248 0.4099 -0.0032 -0.0902 0.0207  315  ASN A CA  
2467 C C   . ASN A 331 ? 0.4699 0.3493 0.4269 -0.0074 -0.0842 0.0244  315  ASN A C   
2468 O O   . ASN A 331 ? 0.4432 0.3192 0.4017 -0.0109 -0.0862 0.0292  315  ASN A O   
2469 C CB  . ASN A 331 ? 0.4566 0.3259 0.4119 -0.0051 -0.0951 0.0259  315  ASN A CB  
2470 C CG  . ASN A 331 ? 0.5660 0.4316 0.5244 -0.0010 -0.1007 0.0225  315  ASN A CG  
2471 O OD1 . ASN A 331 ? 0.4956 0.3644 0.4592 0.0035  -0.0993 0.0162  315  ASN A OD1 
2472 N ND2 . ASN A 331 ? 0.4688 0.3274 0.4246 -0.0024 -0.1072 0.0269  315  ASN A ND2 
2473 N N   . LEU A 332 ? 0.4063 0.2938 0.3615 -0.0067 -0.0771 0.0217  316  LEU A N   
2474 C CA  . LEU A 332 ? 0.3876 0.2803 0.3415 -0.0103 -0.0712 0.0249  316  LEU A CA  
2475 C C   . LEU A 332 ? 0.3993 0.2985 0.3472 -0.0106 -0.0650 0.0252  316  LEU A C   
2476 O O   . LEU A 332 ? 0.3852 0.2880 0.3331 -0.0073 -0.0633 0.0200  316  LEU A O   
2477 C CB  . LEU A 332 ? 0.3737 0.2686 0.3327 -0.0091 -0.0692 0.0208  316  LEU A CB  
2478 C CG  . LEU A 332 ? 0.4145 0.3159 0.3740 -0.0122 -0.0629 0.0230  316  LEU A CG  
2479 C CD1 . LEU A 332 ? 0.4074 0.3071 0.3684 -0.0173 -0.0635 0.0312  316  LEU A CD1 
2480 C CD2 . LEU A 332 ? 0.4512 0.3534 0.4146 -0.0102 -0.0622 0.0180  316  LEU A CD2 
2481 N N   . GLU A 333 ? 0.3601 0.2604 0.3030 -0.0143 -0.0618 0.0316  317  GLU A N   
2482 C CA  . GLU A 333 ? 0.3636 0.2691 0.2992 -0.0145 -0.0555 0.0322  317  GLU A CA  
2483 C C   . GLU A 333 ? 0.3814 0.2935 0.3197 -0.0166 -0.0485 0.0335  317  GLU A C   
2484 O O   . GLU A 333 ? 0.3795 0.2909 0.3213 -0.0199 -0.0479 0.0390  317  GLU A O   
2485 C CB  . GLU A 333 ? 0.3966 0.2974 0.3225 -0.0163 -0.0564 0.0386  317  GLU A CB  
2486 C CG  . GLU A 333 ? 0.4976 0.4015 0.4136 -0.0153 -0.0513 0.0380  317  GLU A CG  
2487 C CD  . GLU A 333 ? 0.8505 0.7481 0.7538 -0.0162 -0.0524 0.0437  317  GLU A CD  
2488 O OE1 . GLU A 333 ? 0.6934 0.5874 0.5953 -0.0192 -0.0523 0.0509  317  GLU A OE1 
2489 O OE2 . GLU A 333 ? 0.8744 0.7702 0.7689 -0.0140 -0.0534 0.0412  317  GLU A OE2 
2490 N N   . ILE A 334 ? 0.3221 0.2407 0.2602 -0.0147 -0.0436 0.0288  318  ILE A N   
2491 C CA  . ILE A 334 ? 0.3117 0.2369 0.2531 -0.0163 -0.0371 0.0293  318  ILE A CA  
2492 C C   . ILE A 334 ? 0.3562 0.2871 0.2919 -0.0148 -0.0311 0.0268  318  ILE A C   
2493 O O   . ILE A 334 ? 0.3493 0.2805 0.2829 -0.0119 -0.0325 0.0218  318  ILE A O   
2494 C CB  . ILE A 334 ? 0.3313 0.2571 0.2818 -0.0156 -0.0390 0.0255  318  ILE A CB  
2495 C CG1 . ILE A 334 ? 0.3183 0.2495 0.2737 -0.0181 -0.0339 0.0276  318  ILE A CG1 
2496 C CG2 . ILE A 334 ? 0.3267 0.2537 0.2783 -0.0113 -0.0399 0.0178  318  ILE A CG2 
2497 C CD1 . ILE A 334 ? 0.3511 0.2804 0.3145 -0.0180 -0.0375 0.0251  318  ILE A CD1 
2498 N N   . GLY A 335 ? 0.3063 0.2414 0.2402 -0.0168 -0.0246 0.0305  319  GLY A N   
2499 C CA  . GLY A 335 ? 0.2998 0.2397 0.2277 -0.0154 -0.0187 0.0284  319  GLY A CA  
2500 C C   . GLY A 335 ? 0.3351 0.2822 0.2699 -0.0154 -0.0139 0.0256  319  GLY A C   
2501 O O   . GLY A 335 ? 0.3274 0.2761 0.2702 -0.0176 -0.0132 0.0280  319  GLY A O   
2502 N N   . PHE A 336 ? 0.3037 0.2546 0.2363 -0.0130 -0.0113 0.0205  320  PHE A N   
2503 C CA  . PHE A 336 ? 0.2883 0.2459 0.2268 -0.0128 -0.0068 0.0177  320  PHE A CA  
2504 C C   . PHE A 336 ? 0.3488 0.3099 0.2813 -0.0112 -0.0021 0.0153  320  PHE A C   
2505 O O   . PHE A 336 ? 0.3351 0.2933 0.2603 -0.0092 -0.0042 0.0132  320  PHE A O   
2506 C CB  . PHE A 336 ? 0.2964 0.2546 0.2416 -0.0110 -0.0101 0.0120  320  PHE A CB  
2507 C CG  . PHE A 336 ? 0.2977 0.2521 0.2490 -0.0120 -0.0146 0.0130  320  PHE A CG  
2508 C CD1 . PHE A 336 ? 0.3173 0.2733 0.2749 -0.0143 -0.0135 0.0153  320  PHE A CD1 
2509 C CD2 . PHE A 336 ? 0.3234 0.2723 0.2748 -0.0104 -0.0206 0.0113  320  PHE A CD2 
2510 C CE1 . PHE A 336 ? 0.3413 0.2924 0.3038 -0.0150 -0.0188 0.0159  320  PHE A CE1 
2511 C CE2 . PHE A 336 ? 0.3670 0.3113 0.3230 -0.0108 -0.0252 0.0118  320  PHE A CE2 
2512 C CZ  . PHE A 336 ? 0.3545 0.2994 0.3155 -0.0132 -0.0246 0.0140  320  PHE A CZ  
2513 N N   . ASN A 337 ? 0.3059 0.2729 0.2424 -0.0118 0.0034  0.0152  321  ASN A N   
2514 C CA  . ASN A 337 ? 0.3031 0.2740 0.2361 -0.0100 0.0078  0.0121  321  ASN A CA  
2515 C C   . ASN A 337 ? 0.3089 0.2808 0.2459 -0.0078 0.0043  0.0057  321  ASN A C   
2516 O O   . ASN A 337 ? 0.2547 0.2284 0.1997 -0.0080 0.0033  0.0038  321  ASN A O   
2517 C CB  . ASN A 337 ? 0.3145 0.2914 0.2532 -0.0113 0.0140  0.0139  321  ASN A CB  
2518 C CG  . ASN A 337 ? 0.3998 0.3809 0.3365 -0.0094 0.0184  0.0102  321  ASN A CG  
2519 O OD1 . ASN A 337 ? 0.3643 0.3459 0.3009 -0.0074 0.0162  0.0050  321  ASN A OD1 
2520 N ND2 . ASN A 337 ? 0.3251 0.3098 0.2618 -0.0099 0.0248  0.0132  321  ASN A ND2 
2521 N N   . VAL A 338 ? 0.2734 0.2432 0.2046 -0.0056 0.0023  0.0027  322  VAL A N   
2522 C CA  . VAL A 338 ? 0.2634 0.2343 0.1996 -0.0035 -0.0008 -0.0024 322  VAL A CA  
2523 C C   . VAL A 338 ? 0.2744 0.2513 0.2170 -0.0030 0.0029  -0.0055 322  VAL A C   
2524 O O   . VAL A 338 ? 0.2432 0.2215 0.1926 -0.0019 0.0015  -0.0082 322  VAL A O   
2525 C CB  . VAL A 338 ? 0.3268 0.2938 0.2575 -0.0015 -0.0050 -0.0044 322  VAL A CB  
2526 C CG1 . VAL A 338 ? 0.3401 0.3077 0.2635 -0.0006 -0.0022 -0.0056 322  VAL A CG1 
2527 C CG2 . VAL A 338 ? 0.3109 0.2790 0.2500 0.0004  -0.0087 -0.0084 322  VAL A CG2 
2528 N N   . SER A 339 ? 0.2509 0.2312 0.1915 -0.0036 0.0080  -0.0048 323  SER A N   
2529 C CA  . SER A 339 ? 0.2465 0.2323 0.1932 -0.0032 0.0112  -0.0075 323  SER A CA  
2530 C C   . SER A 339 ? 0.2492 0.2365 0.2036 -0.0044 0.0112  -0.0069 323  SER A C   
2531 O O   . SER A 339 ? 0.2265 0.2159 0.1858 -0.0033 0.0112  -0.0098 323  SER A O   
2532 C CB  . SER A 339 ? 0.3273 0.3160 0.2705 -0.0033 0.0165  -0.0069 323  SER A CB  
2533 O OG  . SER A 339 ? 0.4808 0.4714 0.4263 -0.0054 0.0201  -0.0028 323  SER A OG  
2534 N N   . TYR A 340 ? 0.2114 0.1966 0.1662 -0.0065 0.0106  -0.0028 324  TYR A N   
2535 C CA  . TYR A 340 ? 0.2045 0.1891 0.1656 -0.0076 0.0090  -0.0022 324  TYR A CA  
2536 C C   . TYR A 340 ? 0.2304 0.2116 0.1928 -0.0056 0.0047  -0.0054 324  TYR A C   
2537 O O   . TYR A 340 ? 0.2099 0.1914 0.1759 -0.0047 0.0044  -0.0075 324  TYR A O   
2538 C CB  . TYR A 340 ? 0.2148 0.1972 0.1770 -0.0104 0.0081  0.0032  324  TYR A CB  
2539 C CG  . TYR A 340 ? 0.2490 0.2351 0.2122 -0.0123 0.0133  0.0073  324  TYR A CG  
2540 C CD1 . TYR A 340 ? 0.2669 0.2584 0.2313 -0.0116 0.0182  0.0056  324  TYR A CD1 
2541 C CD2 . TYR A 340 ? 0.2627 0.2474 0.2273 -0.0148 0.0136  0.0132  324  TYR A CD2 
2542 C CE1 . TYR A 340 ? 0.2734 0.2686 0.2396 -0.0128 0.0236  0.0094  324  TYR A CE1 
2543 C CE2 . TYR A 340 ? 0.2777 0.2664 0.2444 -0.0162 0.0195  0.0176  324  TYR A CE2 
2544 C CZ  . TYR A 340 ? 0.3210 0.3150 0.2885 -0.0150 0.0246  0.0155  324  TYR A CZ  
2545 O OH  . TYR A 340 ? 0.3262 0.3244 0.2968 -0.0160 0.0309  0.0199  324  TYR A OH  
2546 N N   . LEU A 341 ? 0.2080 0.1858 0.1672 -0.0045 0.0015  -0.0056 325  LEU A N   
2547 C CA  . LEU A 341 ? 0.2040 0.1787 0.1650 -0.0020 -0.0020 -0.0085 325  LEU A CA  
2548 C C   . LEU A 341 ? 0.2424 0.2210 0.2064 0.0005  0.0002  -0.0125 325  LEU A C   
2549 O O   . LEU A 341 ? 0.2171 0.1951 0.1841 0.0025  0.0002  -0.0147 325  LEU A O   
2550 C CB  . LEU A 341 ? 0.2069 0.1773 0.1649 -0.0015 -0.0061 -0.0074 325  LEU A CB  
2551 C CG  . LEU A 341 ? 0.2694 0.2352 0.2252 -0.0038 -0.0089 -0.0031 325  LEU A CG  
2552 C CD1 . LEU A 341 ? 0.2830 0.2441 0.2356 -0.0030 -0.0135 -0.0023 325  LEU A CD1 
2553 C CD2 . LEU A 341 ? 0.2741 0.2370 0.2337 -0.0041 -0.0110 -0.0030 325  LEU A CD2 
2554 N N   . LEU A 342 ? 0.1893 0.1712 0.1520 0.0006  0.0021  -0.0132 326  LEU A N   
2555 C CA  . LEU A 342 ? 0.1835 0.1692 0.1504 0.0025  0.0040  -0.0164 326  LEU A CA  
2556 C C   . LEU A 342 ? 0.2058 0.1945 0.1757 0.0025  0.0075  -0.0174 326  LEU A C   
2557 O O   . LEU A 342 ? 0.1843 0.1741 0.1580 0.0046  0.0085  -0.0195 326  LEU A O   
2558 C CB  . LEU A 342 ? 0.1936 0.1811 0.1579 0.0024  0.0044  -0.0170 326  LEU A CB  
2559 C CG  . LEU A 342 ? 0.2488 0.2323 0.2096 0.0030  -0.0001 -0.0167 326  LEU A CG  
2560 C CD1 . LEU A 342 ? 0.2719 0.2554 0.2280 0.0032  -0.0002 -0.0177 326  LEU A CD1 
2561 C CD2 . LEU A 342 ? 0.2786 0.2613 0.2464 0.0053  -0.0033 -0.0183 326  LEU A CD2 
2562 N N   . ASP A 343 ? 0.1879 0.1776 0.1562 0.0003  0.0094  -0.0155 327  ASP A N   
2563 C CA  . ASP A 343 ? 0.1873 0.1792 0.1584 0.0000  0.0118  -0.0162 327  ASP A CA  
2564 C C   . ASP A 343 ? 0.2064 0.1943 0.1781 0.0014  0.0098  -0.0170 327  ASP A C   
2565 O O   . ASP A 343 ? 0.1864 0.1750 0.1595 0.0031  0.0114  -0.0190 327  ASP A O   
2566 C CB  . ASP A 343 ? 0.2029 0.1963 0.1740 -0.0028 0.0134  -0.0133 327  ASP A CB  
2567 C CG  . ASP A 343 ? 0.2505 0.2480 0.2203 -0.0034 0.0169  -0.0129 327  ASP A CG  
2568 O OD1 . ASP A 343 ? 0.2401 0.2391 0.2091 -0.0018 0.0175  -0.0154 327  ASP A OD1 
2569 O OD2 . ASP A 343 ? 0.2353 0.2340 0.2052 -0.0053 0.0189  -0.0101 327  ASP A OD2 
2570 N N   . VAL A 344 ? 0.1738 0.1567 0.1437 0.0010  0.0062  -0.0156 328  VAL A N   
2571 C CA  . VAL A 344 ? 0.1619 0.1393 0.1308 0.0028  0.0037  -0.0168 328  VAL A CA  
2572 C C   . VAL A 344 ? 0.1990 0.1759 0.1684 0.0068  0.0047  -0.0196 328  VAL A C   
2573 O O   . VAL A 344 ? 0.1893 0.1647 0.1579 0.0092  0.0062  -0.0215 328  VAL A O   
2574 C CB  . VAL A 344 ? 0.2029 0.1745 0.1703 0.0015  -0.0010 -0.0145 328  VAL A CB  
2575 C CG1 . VAL A 344 ? 0.2098 0.1743 0.1749 0.0044  -0.0042 -0.0165 328  VAL A CG1 
2576 C CG2 . VAL A 344 ? 0.2093 0.1816 0.1783 -0.0023 -0.0016 -0.0109 328  VAL A CG2 
2577 N N   . LEU A 345 ? 0.1569 0.1351 0.1280 0.0075  0.0041  -0.0197 329  LEU A N   
2578 C CA  . LEU A 345 ? 0.1881 0.1665 0.1623 0.0113  0.0051  -0.0218 329  LEU A CA  
2579 C C   . LEU A 345 ? 0.2239 0.2073 0.2015 0.0126  0.0097  -0.0232 329  LEU A C   
2580 O O   . LEU A 345 ? 0.1970 0.1799 0.1765 0.0160  0.0120  -0.0245 329  LEU A O   
2581 C CB  . LEU A 345 ? 0.2017 0.1804 0.1784 0.0115  0.0026  -0.0213 329  LEU A CB  
2582 C CG  . LEU A 345 ? 0.2794 0.2525 0.2533 0.0107  -0.0023 -0.0198 329  LEU A CG  
2583 C CD1 . LEU A 345 ? 0.3066 0.2800 0.2822 0.0105  -0.0051 -0.0191 329  LEU A CD1 
2584 C CD2 . LEU A 345 ? 0.2959 0.2635 0.2691 0.0137  -0.0036 -0.0211 329  LEU A CD2 
2585 N N   . GLY A 346 ? 0.2006 0.1883 0.1787 0.0101  0.0113  -0.0227 330  GLY A N   
2586 C CA  . GLY A 346 ? 0.2026 0.1948 0.1839 0.0107  0.0152  -0.0237 330  GLY A CA  
2587 C C   . GLY A 346 ? 0.2511 0.2414 0.2301 0.0122  0.0175  -0.0243 330  GLY A C   
2588 O O   . GLY A 346 ? 0.2579 0.2508 0.2396 0.0138  0.0210  -0.0250 330  GLY A O   
2589 N N   . VAL A 347 ? 0.1986 0.1834 0.1722 0.0118  0.0151  -0.0240 331  VAL A N   
2590 C CA  . VAL A 347 ? 0.2074 0.1879 0.1764 0.0135  0.0159  -0.0249 331  VAL A CA  
2591 C C   . VAL A 347 ? 0.2661 0.2392 0.2302 0.0174  0.0147  -0.0262 331  VAL A C   
2592 O O   . VAL A 347 ? 0.2787 0.2463 0.2367 0.0197  0.0149  -0.0272 331  VAL A O   
2593 C CB  . VAL A 347 ? 0.2430 0.2222 0.2100 0.0104  0.0137  -0.0238 331  VAL A CB  
2594 C CG1 . VAL A 347 ? 0.2393 0.2256 0.2109 0.0077  0.0161  -0.0230 331  VAL A CG1 
2595 C CG2 . VAL A 347 ? 0.2299 0.2051 0.1957 0.0082  0.0089  -0.0223 331  VAL A CG2 
2596 N N   . ILE A 348 ? 0.2025 0.1746 0.1684 0.0185  0.0131  -0.0262 332  ILE A N   
2597 C CA  . ILE A 348 ? 0.2136 0.1791 0.1757 0.0228  0.0125  -0.0276 332  ILE A CA  
2598 C C   . ILE A 348 ? 0.2516 0.2196 0.2160 0.0272  0.0186  -0.0285 332  ILE A C   
2599 O O   . ILE A 348 ? 0.2480 0.2229 0.2207 0.0270  0.0212  -0.0278 332  ILE A O   
2600 C CB  . ILE A 348 ? 0.2326 0.1963 0.1969 0.0225  0.0086  -0.0271 332  ILE A CB  
2601 C CG1 . ILE A 348 ? 0.2351 0.1956 0.1970 0.0183  0.0030  -0.0255 332  ILE A CG1 
2602 C CG2 . ILE A 348 ? 0.2236 0.1816 0.1859 0.0278  0.0089  -0.0289 332  ILE A CG2 
2603 C CD1 . ILE A 348 ? 0.2792 0.2306 0.2338 0.0189  -0.0010 -0.0262 332  ILE A CD1 
2604 N N   . GLY A 349 ? 0.2307 0.1928 0.1877 0.0312  0.0208  -0.0298 333  GLY A N   
2605 C CA  . GLY A 349 ? 0.2414 0.2053 0.1998 0.0357  0.0277  -0.0300 333  GLY A CA  
2606 C C   . GLY A 349 ? 0.2902 0.2514 0.2498 0.0411  0.0301  -0.0307 333  GLY A C   
2607 O O   . GLY A 349 ? 0.2639 0.2285 0.2280 0.0447  0.0367  -0.0300 333  GLY A O   
2608 N N   . THR A 350 ? 0.2322 0.1873 0.1886 0.0417  0.0251  -0.0319 334  THR A N   
2609 C CA  . THR A 350 ? 0.2367 0.1885 0.1943 0.0469  0.0265  -0.0329 334  THR A CA  
2610 C C   . THR A 350 ? 0.2645 0.2238 0.2356 0.0449  0.0253  -0.0315 334  THR A C   
2611 O O   . THR A 350 ? 0.2468 0.2101 0.2216 0.0395  0.0210  -0.0303 334  THR A O   
2612 C CB  . THR A 350 ? 0.3111 0.2512 0.2579 0.0488  0.0209  -0.0352 334  THR A CB  
2613 O OG1 . THR A 350 ? 0.2656 0.2054 0.2132 0.0429  0.0133  -0.0343 334  THR A OG1 
2614 C CG2 . THR A 350 ? 0.2921 0.2224 0.2241 0.0525  0.0219  -0.0371 334  THR A CG2 
2615 N N   . GLU A 351 ? 0.2375 0.1980 0.2155 0.0495  0.0287  -0.0315 335  GLU A N   
2616 C CA  . GLU A 351 ? 0.2102 0.1770 0.2018 0.0480  0.0266  -0.0301 335  GLU A CA  
2617 C C   . GLU A 351 ? 0.2516 0.2136 0.2409 0.0457  0.0186  -0.0307 335  GLU A C   
2618 O O   . GLU A 351 ? 0.2634 0.2294 0.2606 0.0426  0.0147  -0.0293 335  GLU A O   
2619 C CB  . GLU A 351 ? 0.2150 0.1852 0.2172 0.0536  0.0327  -0.0295 335  GLU A CB  
2620 C CG  . GLU A 351 ? 0.2560 0.2186 0.2544 0.0595  0.0329  -0.0313 335  GLU A CG  
2621 C CD  . GLU A 351 ? 0.2684 0.2337 0.2740 0.0662  0.0421  -0.0305 335  GLU A CD  
2622 O OE1 . GLU A 351 ? 0.2860 0.2549 0.2916 0.0673  0.0490  -0.0291 335  GLU A OE1 
2623 O OE2 . GLU A 351 ? 0.3128 0.2768 0.3250 0.0704  0.0425  -0.0308 335  GLU A OE2 
2624 N N   . GLN A 352 ? 0.2145 0.1670 0.1928 0.0476  0.0158  -0.0325 336  GLN A N   
2625 C CA  . GLN A 352 ? 0.2254 0.1725 0.2011 0.0452  0.0079  -0.0326 336  GLN A CA  
2626 C C   . GLN A 352 ? 0.2801 0.2241 0.2472 0.0402  0.0036  -0.0321 336  GLN A C   
2627 O O   . GLN A 352 ? 0.2731 0.2158 0.2338 0.0403  0.0062  -0.0328 336  GLN A O   
2628 C CB  . GLN A 352 ? 0.2431 0.1811 0.2145 0.0507  0.0065  -0.0348 336  GLN A CB  
2629 C CG  . GLN A 352 ? 0.2813 0.2228 0.2640 0.0551  0.0094  -0.0347 336  GLN A CG  
2630 C CD  . GLN A 352 ? 0.5346 0.4668 0.5134 0.0606  0.0074  -0.0370 336  GLN A CD  
2631 O OE1 . GLN A 352 ? 0.5063 0.4299 0.4737 0.0648  0.0087  -0.0394 336  GLN A OE1 
2632 N NE2 . GLN A 352 ? 0.4316 0.3645 0.4193 0.0610  0.0037  -0.0364 336  GLN A NE2 
2633 N N   . VAL A 353 ? 0.2164 0.1593 0.1841 0.0357  -0.0027 -0.0305 337  VAL A N   
2634 C CA  . VAL A 353 ? 0.1961 0.1369 0.1584 0.0308  -0.0066 -0.0292 337  VAL A CA  
2635 C C   . VAL A 353 ? 0.2570 0.1895 0.2161 0.0300  -0.0138 -0.0288 337  VAL A C   
2636 O O   . VAL A 353 ? 0.2536 0.1851 0.2167 0.0310  -0.0163 -0.0284 337  VAL A O   
2637 C CB  . VAL A 353 ? 0.2291 0.1783 0.1959 0.0254  -0.0060 -0.0266 337  VAL A CB  
2638 C CG1 . VAL A 353 ? 0.2233 0.1751 0.1957 0.0237  -0.0089 -0.0249 337  VAL A CG1 
2639 C CG2 . VAL A 353 ? 0.2225 0.1703 0.1849 0.0208  -0.0085 -0.0249 337  VAL A CG2 
2640 N N   . ARG A 354 ? 0.2184 0.1449 0.1714 0.0281  -0.0175 -0.0286 338  ARG A N   
2641 C CA  . ARG A 354 ? 0.2268 0.1450 0.1776 0.0268  -0.0249 -0.0277 338  ARG A CA  
2642 C C   . ARG A 354 ? 0.2728 0.1938 0.2261 0.0200  -0.0281 -0.0235 338  ARG A C   
2643 O O   . ARG A 354 ? 0.2590 0.1828 0.2116 0.0172  -0.0266 -0.0225 338  ARG A O   
2644 C CB  . ARG A 354 ? 0.2755 0.1827 0.2178 0.0301  -0.0280 -0.0306 338  ARG A CB  
2645 C CG  . ARG A 354 ? 0.3467 0.2478 0.2843 0.0377  -0.0258 -0.0347 338  ARG A CG  
2646 C CD  . ARG A 354 ? 0.3952 0.2831 0.3219 0.0407  -0.0305 -0.0375 338  ARG A CD  
2647 N NE  . ARG A 354 ? 0.3797 0.2676 0.3005 0.0405  -0.0280 -0.0383 338  ARG A NE  
2648 C CZ  . ARG A 354 ? 0.5868 0.4650 0.4999 0.0402  -0.0338 -0.0393 338  ARG A CZ  
2649 N NH1 . ARG A 354 ? 0.4880 0.3560 0.3989 0.0396  -0.0426 -0.0396 338  ARG A NH1 
2650 N NH2 . ARG A 354 ? 0.3725 0.2508 0.2804 0.0402  -0.0314 -0.0399 338  ARG A NH2 
2651 N N   . PHE A 355 ? 0.2248 0.1450 0.1812 0.0176  -0.0321 -0.0208 339  PHE A N   
2652 C CA  . PHE A 355 ? 0.2218 0.1432 0.1800 0.0117  -0.0350 -0.0161 339  PHE A CA  
2653 C C   . PHE A 355 ? 0.3135 0.2248 0.2705 0.0113  -0.0426 -0.0153 339  PHE A C   
2654 O O   . PHE A 355 ? 0.3382 0.2444 0.2950 0.0142  -0.0458 -0.0166 339  PHE A O   
2655 C CB  . PHE A 355 ? 0.2404 0.1674 0.2016 0.0091  -0.0341 -0.0130 339  PHE A CB  
2656 C CG  . PHE A 355 ? 0.2585 0.1948 0.2210 0.0084  -0.0279 -0.0131 339  PHE A CG  
2657 C CD1 . PHE A 355 ? 0.2920 0.2318 0.2562 0.0122  -0.0242 -0.0165 339  PHE A CD1 
2658 C CD2 . PHE A 355 ? 0.2953 0.2366 0.2580 0.0040  -0.0258 -0.0097 339  PHE A CD2 
2659 C CE1 . PHE A 355 ? 0.3026 0.2505 0.2688 0.0114  -0.0194 -0.0165 339  PHE A CE1 
2660 C CE2 . PHE A 355 ? 0.3250 0.2739 0.2883 0.0037  -0.0206 -0.0102 339  PHE A CE2 
2661 C CZ  . PHE A 355 ? 0.3016 0.2534 0.2665 0.0073  -0.0179 -0.0137 339  PHE A CZ  
2662 N N   . ILE A 356 ? 0.2622 0.1708 0.2198 0.0078  -0.0459 -0.0128 340  ILE A N   
2663 C CA  . ILE A 356 ? 0.2817 0.1806 0.2397 0.0066  -0.0541 -0.0112 340  ILE A CA  
2664 C C   . ILE A 356 ? 0.3163 0.2190 0.2801 0.0002  -0.0551 -0.0044 340  ILE A C   
2665 O O   . ILE A 356 ? 0.2703 0.1789 0.2372 -0.0034 -0.0521 -0.0017 340  ILE A O   
2666 C CB  . ILE A 356 ? 0.3303 0.2209 0.2847 0.0082  -0.0582 -0.0140 340  ILE A CB  
2667 C CG1 . ILE A 356 ? 0.3417 0.2277 0.2882 0.0154  -0.0559 -0.0206 340  ILE A CG1 
2668 C CG2 . ILE A 356 ? 0.3428 0.2230 0.2991 0.0062  -0.0679 -0.0118 340  ILE A CG2 
2669 C CD1 . ILE A 356 ? 0.4663 0.3462 0.4067 0.0173  -0.0574 -0.0236 340  ILE A CD1 
2670 N N   . LEU A 357 ? 0.2972 0.1969 0.2624 -0.0009 -0.0589 -0.0016 341  LEU A N   
2671 C CA  . LEU A 357 ? 0.2839 0.1866 0.2533 -0.0063 -0.0592 0.0053  341  LEU A CA  
2672 C C   . LEU A 357 ? 0.3430 0.2366 0.3156 -0.0085 -0.0677 0.0087  341  LEU A C   
2673 O O   . LEU A 357 ? 0.3347 0.2193 0.3054 -0.0051 -0.0735 0.0050  341  LEU A O   
2674 C CB  . LEU A 357 ? 0.2775 0.1848 0.2446 -0.0058 -0.0558 0.0062  341  LEU A CB  
2675 C CG  . LEU A 357 ? 0.3249 0.2399 0.2895 -0.0030 -0.0490 0.0023  341  LEU A CG  
2676 C CD1 . LEU A 357 ? 0.3271 0.2436 0.2900 -0.0019 -0.0486 0.0025  341  LEU A CD1 
2677 C CD2 . LEU A 357 ? 0.3281 0.2512 0.2935 -0.0060 -0.0429 0.0044  341  LEU A CD2 
2678 N N   . SER A 358 ? 0.2973 0.1930 0.2747 -0.0138 -0.0679 0.0161  342  SER A N   
2679 C CA  . SER A 358 ? 0.3280 0.2159 0.3101 -0.0166 -0.0756 0.0207  342  SER A CA  
2680 C C   . SER A 358 ? 0.4060 0.2965 0.3879 -0.0194 -0.0739 0.0269  342  SER A C   
2681 O O   . SER A 358 ? 0.4491 0.3354 0.4273 -0.0170 -0.0768 0.0253  342  SER A O   
2682 C CB  . SER A 358 ? 0.3570 0.2433 0.3470 -0.0205 -0.0789 0.0244  342  SER A CB  
2683 O OG  . SER A 358 ? 0.3796 0.2758 0.3737 -0.0240 -0.0717 0.0286  342  SER A OG  
2684 N N   . ASP A 359 ? 0.3329 0.2303 0.3176 -0.0237 -0.0685 0.0334  343  ASP A N   
2685 C CA  . ASP A 359 ? 0.3315 0.2305 0.3135 -0.0260 -0.0661 0.0395  343  ASP A CA  
2686 C C   . ASP A 359 ? 0.3726 0.2814 0.3499 -0.0263 -0.0563 0.0405  343  ASP A C   
2687 O O   . ASP A 359 ? 0.3528 0.2673 0.3303 -0.0249 -0.0517 0.0365  343  ASP A O   
2688 C CB  . ASP A 359 ? 0.3505 0.2459 0.3402 -0.0311 -0.0698 0.0484  343  ASP A CB  
2689 C CG  . ASP A 359 ? 0.4511 0.3510 0.4505 -0.0348 -0.0675 0.0526  343  ASP A CG  
2690 O OD1 . ASP A 359 ? 0.4312 0.3399 0.4299 -0.0353 -0.0591 0.0534  343  ASP A OD1 
2691 O OD2 . ASP A 359 ? 0.5985 0.4926 0.6069 -0.0372 -0.0745 0.0553  343  ASP A OD2 
2692 N N   . SER A 360 ? 0.3504 0.2601 0.3226 -0.0278 -0.0535 0.0458  344  SER A N   
2693 C CA  . SER A 360 ? 0.3615 0.2781 0.3267 -0.0275 -0.0450 0.0467  344  SER A CA  
2694 C C   . SER A 360 ? 0.4136 0.3379 0.3838 -0.0299 -0.0376 0.0501  344  SER A C   
2695 O O   . SER A 360 ? 0.4165 0.3469 0.3816 -0.0286 -0.0308 0.0482  344  SER A O   
2696 C CB  . SER A 360 ? 0.4248 0.3382 0.3820 -0.0284 -0.0447 0.0521  344  SER A CB  
2697 O OG  . SER A 360 ? 0.5885 0.4995 0.5505 -0.0325 -0.0454 0.0610  344  SER A OG  
2698 N N   . ASN A 361 ? 0.3915 0.3152 0.3724 -0.0335 -0.0395 0.0553  345  ASN A N   
2699 C CA  . ASN A 361 ? 0.3891 0.3201 0.3776 -0.0362 -0.0330 0.0597  345  ASN A CA  
2700 C C   . ASN A 361 ? 0.4330 0.3659 0.4304 -0.0361 -0.0350 0.0556  345  ASN A C   
2701 O O   . ASN A 361 ? 0.4449 0.3834 0.4511 -0.0386 -0.0310 0.0595  345  ASN A O   
2702 C CB  . ASN A 361 ? 0.3976 0.3279 0.3930 -0.0407 -0.0320 0.0705  345  ASN A CB  
2703 C CG  . ASN A 361 ? 0.6940 0.6218 0.6787 -0.0406 -0.0293 0.0752  345  ASN A CG  
2704 O OD1 . ASN A 361 ? 0.6725 0.5937 0.6581 -0.0424 -0.0347 0.0799  345  ASN A OD1 
2705 N ND2 . ASN A 361 ? 0.5117 0.4435 0.4849 -0.0382 -0.0218 0.0736  345  ASN A ND2 
2706 N N   . SER A 362 ? 0.3498 0.2779 0.3450 -0.0331 -0.0412 0.0479  346  SER A N   
2707 C CA  . SER A 362 ? 0.3166 0.2445 0.3175 -0.0324 -0.0439 0.0435  346  SER A CA  
2708 C C   . SER A 362 ? 0.3200 0.2517 0.3135 -0.0282 -0.0401 0.0354  346  SER A C   
2709 O O   . SER A 362 ? 0.2733 0.2050 0.2580 -0.0251 -0.0384 0.0317  346  SER A O   
2710 C CB  . SER A 362 ? 0.3624 0.2801 0.3670 -0.0322 -0.0545 0.0418  346  SER A CB  
2711 O OG  . SER A 362 ? 0.4284 0.3424 0.4409 -0.0364 -0.0587 0.0497  346  SER A OG  
2712 N N   . SER A 363 ? 0.2862 0.2209 0.2842 -0.0281 -0.0389 0.0331  347  SER A N   
2713 C CA  . SER A 363 ? 0.2670 0.2056 0.2597 -0.0246 -0.0350 0.0263  347  SER A CA  
2714 C C   . SER A 363 ? 0.3335 0.2663 0.3187 -0.0200 -0.0389 0.0191  347  SER A C   
2715 O O   . SER A 363 ? 0.3383 0.2625 0.3238 -0.0192 -0.0462 0.0180  347  SER A O   
2716 C CB  . SER A 363 ? 0.3021 0.2429 0.3016 -0.0256 -0.0350 0.0256  347  SER A CB  
2717 O OG  . SER A 363 ? 0.3897 0.3375 0.3975 -0.0293 -0.0300 0.0320  347  SER A OG  
2718 N N   . ALA A 364 ? 0.2798 0.2170 0.2589 -0.0168 -0.0338 0.0144  348  ALA A N   
2719 C CA  . ALA A 364 ? 0.2685 0.2021 0.2422 -0.0120 -0.0355 0.0078  348  ALA A CA  
2720 C C   . ALA A 364 ? 0.2943 0.2271 0.2684 -0.0105 -0.0357 0.0040  348  ALA A C   
2721 O O   . ALA A 364 ? 0.2767 0.2155 0.2540 -0.0123 -0.0317 0.0051  348  ALA A O   
2722 C CB  . ALA A 364 ? 0.2780 0.2174 0.2471 -0.0098 -0.0300 0.0054  348  ALA A CB  
2723 N N   . LEU A 365 ? 0.2476 0.1727 0.2181 -0.0068 -0.0402 -0.0006 349  LEU A N   
2724 C CA  . LEU A 365 ? 0.2331 0.1555 0.2006 -0.0041 -0.0405 -0.0050 349  LEU A CA  
2725 C C   . LEU A 365 ? 0.2783 0.2018 0.2398 0.0012  -0.0364 -0.0102 349  LEU A C   
2726 O O   . LEU A 365 ? 0.2934 0.2130 0.2526 0.0040  -0.0381 -0.0118 349  LEU A O   
2727 C CB  . LEU A 365 ? 0.2351 0.1460 0.2016 -0.0033 -0.0490 -0.0060 349  LEU A CB  
2728 C CG  . LEU A 365 ? 0.2773 0.1823 0.2380 0.0002  -0.0506 -0.0108 349  LEU A CG  
2729 C CD1 . LEU A 365 ? 0.2700 0.1811 0.2349 -0.0026 -0.0479 -0.0092 349  LEU A CD1 
2730 C CD2 . LEU A 365 ? 0.3215 0.2132 0.2795 0.0014  -0.0603 -0.0121 349  LEU A CD2 
2731 N N   . VAL A 366 ? 0.2240 0.1531 0.1844 0.0025  -0.0309 -0.0124 350  VAL A N   
2732 C CA  . VAL A 366 ? 0.2237 0.1552 0.1806 0.0070  -0.0261 -0.0165 350  VAL A CA  
2733 C C   . VAL A 366 ? 0.2730 0.2005 0.2245 0.0107  -0.0251 -0.0203 350  VAL A C   
2734 O O   . VAL A 366 ? 0.2594 0.1879 0.2114 0.0088  -0.0251 -0.0197 350  VAL A O   
2735 C CB  . VAL A 366 ? 0.2615 0.2037 0.2217 0.0055  -0.0197 -0.0153 350  VAL A CB  
2736 C CG1 . VAL A 366 ? 0.2547 0.1993 0.2140 0.0098  -0.0159 -0.0186 350  VAL A CG1 
2737 C CG2 . VAL A 366 ? 0.2614 0.2067 0.2247 0.0016  -0.0205 -0.0110 350  VAL A CG2 
2738 N N   . HIS A 367 ? 0.2401 0.1632 0.1868 0.0162  -0.0241 -0.0240 351  HIS A N   
2739 C CA  . HIS A 367 ? 0.2398 0.1586 0.1795 0.0207  -0.0219 -0.0276 351  HIS A CA  
2740 C C   . HIS A 367 ? 0.2865 0.2101 0.2263 0.0252  -0.0148 -0.0298 351  HIS A C   
2741 O O   . HIS A 367 ? 0.2558 0.1829 0.2004 0.0258  -0.0137 -0.0292 351  HIS A O   
2742 C CB  . HIS A 367 ? 0.2674 0.1726 0.1990 0.0244  -0.0281 -0.0303 351  HIS A CB  
2743 C CG  . HIS A 367 ? 0.3209 0.2194 0.2529 0.0206  -0.0364 -0.0284 351  HIS A CG  
2744 N ND1 . HIS A 367 ? 0.3451 0.2431 0.2769 0.0180  -0.0381 -0.0275 351  HIS A ND1 
2745 C CD2 . HIS A 367 ? 0.3452 0.2360 0.2779 0.0196  -0.0439 -0.0275 351  HIS A CD2 
2746 C CE1 . HIS A 367 ? 0.3464 0.2375 0.2804 0.0150  -0.0464 -0.0257 351  HIS A CE1 
2747 N NE2 . HIS A 367 ? 0.3482 0.2346 0.2826 0.0158  -0.0502 -0.0256 351  HIS A NE2 
2748 N N   . GLU A 368 ? 0.2682 0.1903 0.2025 0.0289  -0.0107 -0.0320 352  GLU A N   
2749 C CA  . GLU A 368 ? 0.2715 0.1961 0.2055 0.0342  -0.0039 -0.0339 352  GLU A CA  
2750 C C   . GLU A 368 ? 0.3193 0.2346 0.2483 0.0396  -0.0061 -0.0363 352  GLU A C   
2751 O O   . GLU A 368 ? 0.3270 0.2331 0.2513 0.0391  -0.0132 -0.0369 352  GLU A O   
2752 C CB  . GLU A 368 ? 0.2837 0.2077 0.2116 0.0368  0.0010  -0.0351 352  GLU A CB  
2753 C CG  . GLU A 368 ? 0.2728 0.2059 0.2061 0.0322  0.0035  -0.0330 352  GLU A CG  
2754 C CD  . GLU A 368 ? 0.3455 0.2792 0.2744 0.0352  0.0094  -0.0338 352  GLU A CD  
2755 O OE1 . GLU A 368 ? 0.3699 0.2939 0.2877 0.0393  0.0087  -0.0358 352  GLU A OE1 
2756 O OE2 . GLU A 368 ? 0.3156 0.2590 0.2519 0.0338  0.0145  -0.0324 352  GLU A OE2 
2757 N N   . ALA A 369 ? 0.2888 0.2064 0.2201 0.0446  -0.0003 -0.0374 353  ALA A N   
2758 C CA  . ALA A 369 ? 0.3031 0.2133 0.2317 0.0500  -0.0015 -0.0396 353  ALA A CA  
2759 C C   . ALA A 369 ? 0.3646 0.2607 0.2789 0.0554  -0.0039 -0.0430 353  ALA A C   
2760 O O   . ALA A 369 ? 0.3648 0.2520 0.2756 0.0574  -0.0094 -0.0446 353  ALA A O   
2761 C CB  . ALA A 369 ? 0.3073 0.2243 0.2436 0.0544  0.0063  -0.0396 353  ALA A CB  
2762 N N   . ASP A 370 ? 0.3609 0.2542 0.2664 0.0579  0.0000  -0.0441 354  ASP A N   
2763 C CA  . ASP A 370 ? 0.3876 0.2669 0.2770 0.0645  -0.0006 -0.0476 354  ASP A CA  
2764 C C   . ASP A 370 ? 0.4331 0.3023 0.3112 0.0625  -0.0078 -0.0487 354  ASP A C   
2765 O O   . ASP A 370 ? 0.4480 0.3038 0.3108 0.0683  -0.0091 -0.0520 354  ASP A O   
2766 C CB  . ASP A 370 ? 0.4132 0.2949 0.2992 0.0709  0.0105  -0.0481 354  ASP A CB  
2767 C CG  . ASP A 370 ? 0.4942 0.3841 0.3821 0.0680  0.0158  -0.0459 354  ASP A CG  
2768 O OD1 . ASP A 370 ? 0.4918 0.3883 0.3866 0.0607  0.0119  -0.0438 354  ASP A OD1 
2769 O OD2 . ASP A 370 ? 0.6180 0.5078 0.5009 0.0732  0.0241  -0.0460 354  ASP A OD2 
2770 N N   . ASN A 371 ? 0.3808 0.2559 0.2660 0.0548  -0.0122 -0.0460 355  ASN A N   
2771 C CA  . ASN A 371 ? 0.3835 0.2502 0.2610 0.0524  -0.0194 -0.0464 355  ASN A CA  
2772 C C   . ASN A 371 ? 0.4195 0.2919 0.3084 0.0439  -0.0260 -0.0429 355  ASN A C   
2773 O O   . ASN A 371 ? 0.3759 0.2606 0.2773 0.0396  -0.0230 -0.0400 355  ASN A O   
2774 C CB  . ASN A 371 ? 0.3967 0.2656 0.2686 0.0536  -0.0136 -0.0463 355  ASN A CB  
2775 C CG  . ASN A 371 ? 0.5070 0.3918 0.3924 0.0477  -0.0089 -0.0427 355  ASN A CG  
2776 O OD1 . ASN A 371 ? 0.4023 0.2900 0.2926 0.0418  -0.0133 -0.0407 355  ASN A OD1 
2777 N ND2 . ASN A 371 ? 0.3944 0.2897 0.2874 0.0489  -0.0003 -0.0416 355  ASN A ND2 
2778 N N   . ASP A 372 ? 0.3873 0.2502 0.2715 0.0418  -0.0349 -0.0432 356  ASP A N   
2779 C CA  . ASP A 372 ? 0.3811 0.2485 0.2764 0.0340  -0.0410 -0.0394 356  ASP A CA  
2780 C C   . ASP A 372 ? 0.4188 0.2901 0.3158 0.0305  -0.0407 -0.0378 356  ASP A C   
2781 O O   . ASP A 372 ? 0.4295 0.3019 0.3343 0.0250  -0.0465 -0.0349 356  ASP A O   
2782 C CB  . ASP A 372 ? 0.4069 0.2620 0.3005 0.0332  -0.0522 -0.0398 356  ASP A CB  
2783 C CG  . ASP A 372 ? 0.5692 0.4208 0.4632 0.0356  -0.0537 -0.0407 356  ASP A CG  
2784 O OD1 . ASP A 372 ? 0.5662 0.4286 0.4680 0.0348  -0.0474 -0.0391 356  ASP A OD1 
2785 O OD2 . ASP A 372 ? 0.6376 0.4753 0.5246 0.0382  -0.0620 -0.0431 356  ASP A OD2 
2786 N N   . ASP A 373 ? 0.3661 0.2399 0.2571 0.0338  -0.0337 -0.0392 357  ASP A N   
2787 C CA  . ASP A 373 ? 0.3664 0.2438 0.2588 0.0309  -0.0330 -0.0378 357  ASP A CA  
2788 C C   . ASP A 373 ? 0.3830 0.2751 0.2914 0.0240  -0.0306 -0.0336 357  ASP A C   
2789 O O   . ASP A 373 ? 0.3771 0.2705 0.2905 0.0199  -0.0342 -0.0316 357  ASP A O   
2790 C CB  . ASP A 373 ? 0.3939 0.2716 0.2772 0.0359  -0.0251 -0.0397 357  ASP A CB  
2791 C CG  . ASP A 373 ? 0.5351 0.3974 0.4002 0.0436  -0.0263 -0.0437 357  ASP A CG  
2792 O OD1 . ASP A 373 ? 0.5293 0.3781 0.3868 0.0446  -0.0356 -0.0456 357  ASP A OD1 
2793 O OD2 . ASP A 373 ? 0.6486 0.5120 0.5072 0.0488  -0.0177 -0.0449 357  ASP A OD2 
2794 N N   . SER A 374 ? 0.3186 0.2211 0.2348 0.0230  -0.0248 -0.0323 358  SER A N   
2795 C CA  . SER A 374 ? 0.2980 0.2133 0.2271 0.0172  -0.0220 -0.0286 358  SER A CA  
2796 C C   . SER A 374 ? 0.3212 0.2365 0.2563 0.0144  -0.0263 -0.0264 358  SER A C   
2797 O O   . SER A 374 ? 0.3424 0.2514 0.2731 0.0175  -0.0283 -0.0281 358  SER A O   
2798 C CB  . SER A 374 ? 0.3242 0.2502 0.2566 0.0184  -0.0130 -0.0287 358  SER A CB  
2799 O OG  . SER A 374 ? 0.4329 0.3598 0.3613 0.0204  -0.0090 -0.0298 358  SER A OG  
2800 N N   . ALA A 375 ? 0.2551 0.1766 0.2001 0.0087  -0.0276 -0.0224 359  ALA A N   
2801 C CA  . ALA A 375 ? 0.2448 0.1669 0.1959 0.0055  -0.0309 -0.0193 359  ALA A CA  
2802 C C   . ALA A 375 ? 0.2692 0.2031 0.2299 0.0008  -0.0264 -0.0152 359  ALA A C   
2803 O O   . ALA A 375 ? 0.2580 0.1967 0.2231 -0.0016 -0.0247 -0.0138 359  ALA A O   
2804 C CB  . ALA A 375 ? 0.2608 0.1730 0.2128 0.0038  -0.0404 -0.0181 359  ALA A CB  
2805 N N   . TYR A 376 ? 0.2185 0.1564 0.1816 -0.0001 -0.0244 -0.0135 360  TYR A N   
2806 C CA  . TYR A 376 ? 0.2022 0.1499 0.1715 -0.0037 -0.0197 -0.0099 360  TYR A CA  
2807 C C   . TYR A 376 ? 0.2561 0.2024 0.2293 -0.0068 -0.0230 -0.0057 360  TYR A C   
2808 O O   . TYR A 376 ? 0.2591 0.1996 0.2293 -0.0052 -0.0266 -0.0064 360  TYR A O   
2809 C CB  . TYR A 376 ? 0.2007 0.1546 0.1676 -0.0013 -0.0136 -0.0121 360  TYR A CB  
2810 C CG  . TYR A 376 ? 0.2053 0.1605 0.1692 0.0017  -0.0102 -0.0157 360  TYR A CG  
2811 C CD1 . TYR A 376 ? 0.2137 0.1748 0.1806 0.0002  -0.0067 -0.0152 360  TYR A CD1 
2812 C CD2 . TYR A 376 ? 0.2156 0.1651 0.1735 0.0064  -0.0106 -0.0194 360  TYR A CD2 
2813 C CE1 . TYR A 376 ? 0.2182 0.1796 0.1822 0.0027  -0.0042 -0.0181 360  TYR A CE1 
2814 C CE2 . TYR A 376 ? 0.2134 0.1634 0.1680 0.0093  -0.0071 -0.0220 360  TYR A CE2 
2815 C CZ  . TYR A 376 ? 0.2144 0.1701 0.1720 0.0072  -0.0043 -0.0212 360  TYR A CZ  
2816 O OH  . TYR A 376 ? 0.2394 0.1951 0.1937 0.0098  -0.0012 -0.0234 360  TYR A OH  
2817 N N   . VAL A 377 ? 0.2188 0.1703 0.1989 -0.0109 -0.0214 -0.0010 361  VAL A N   
2818 C CA  . VAL A 377 ? 0.2171 0.1676 0.2016 -0.0142 -0.0238 0.0043  361  VAL A CA  
2819 C C   . VAL A 377 ? 0.2370 0.1959 0.2219 -0.0156 -0.0170 0.0071  361  VAL A C   
2820 O O   . VAL A 377 ? 0.2127 0.1783 0.1997 -0.0162 -0.0117 0.0073  361  VAL A O   
2821 C CB  . VAL A 377 ? 0.2632 0.2114 0.2566 -0.0178 -0.0284 0.0084  361  VAL A CB  
2822 C CG1 . VAL A 377 ? 0.2600 0.2079 0.2594 -0.0216 -0.0301 0.0149  361  VAL A CG1 
2823 C CG2 . VAL A 377 ? 0.2621 0.2003 0.2531 -0.0159 -0.0362 0.0049  361  VAL A CG2 
2824 N N   . VAL A 378 ? 0.2087 0.1662 0.1907 -0.0158 -0.0174 0.0091  362  VAL A N   
2825 C CA  . VAL A 378 ? 0.2179 0.1812 0.1978 -0.0168 -0.0116 0.0119  362  VAL A CA  
2826 C C   . VAL A 378 ? 0.2927 0.2534 0.2746 -0.0198 -0.0135 0.0181  362  VAL A C   
2827 O O   . VAL A 378 ? 0.2665 0.2207 0.2465 -0.0194 -0.0190 0.0182  362  VAL A O   
2828 C CB  . VAL A 378 ? 0.2479 0.2124 0.2203 -0.0135 -0.0095 0.0077  362  VAL A CB  
2829 C CG1 . VAL A 378 ? 0.2403 0.2090 0.2089 -0.0143 -0.0045 0.0104  362  VAL A CG1 
2830 C CG2 . VAL A 378 ? 0.2309 0.1978 0.2025 -0.0107 -0.0076 0.0021  362  VAL A CG2 
2831 N N   . MET A 379 ? 0.2874 0.2530 0.2736 -0.0226 -0.0089 0.0236  363  MET A N   
2832 C CA  . MET A 379 ? 0.3215 0.2855 0.3098 -0.0255 -0.0091 0.0307  363  MET A CA  
2833 C C   . MET A 379 ? 0.3443 0.3071 0.3220 -0.0239 -0.0071 0.0308  363  MET A C   
2834 O O   . MET A 379 ? 0.3189 0.2857 0.2903 -0.0219 -0.0021 0.0281  363  MET A O   
2835 C CB  . MET A 379 ? 0.3722 0.3425 0.3681 -0.0283 -0.0030 0.0369  363  MET A CB  
2836 C CG  . MET A 379 ? 0.4519 0.4225 0.4604 -0.0307 -0.0063 0.0385  363  MET A CG  
2837 S SD  . MET A 379 ? 0.5510 0.5258 0.5718 -0.0351 -0.0022 0.0492  363  MET A SD  
2838 C CE  . MET A 379 ? 0.5175 0.4833 0.5461 -0.0381 -0.0132 0.0525  363  MET A CE  
2839 N N   . PRO A 380 ? 0.3287 0.2857 0.3044 -0.0249 -0.0114 0.0340  364  PRO A N   
2840 C CA  . PRO A 380 ? 0.3391 0.2941 0.3043 -0.0235 -0.0103 0.0344  364  PRO A CA  
2841 C C   . PRO A 380 ? 0.3929 0.3511 0.3542 -0.0249 -0.0032 0.0407  364  PRO A C   
2842 O O   . PRO A 380 ? 0.3671 0.3288 0.3359 -0.0276 0.0006  0.0461  364  PRO A O   
2843 C CB  . PRO A 380 ? 0.3680 0.3151 0.3334 -0.0241 -0.0180 0.0359  364  PRO A CB  
2844 C CG  . PRO A 380 ? 0.4321 0.3780 0.4083 -0.0273 -0.0209 0.0401  364  PRO A CG  
2845 C CD  . PRO A 380 ? 0.3651 0.3163 0.3478 -0.0273 -0.0182 0.0373  364  PRO A CD  
2846 N N   . MET A 381 ? 0.3640 0.3202 0.3134 -0.0230 -0.0017 0.0400  365  MET A N   
2847 C CA  . MET A 381 ? 0.3838 0.3406 0.3254 -0.0234 0.0048  0.0456  365  MET A CA  
2848 C C   . MET A 381 ? 0.4473 0.3979 0.3869 -0.0255 0.0016  0.0525  365  MET A C   
2849 O O   . MET A 381 ? 0.4708 0.4164 0.4139 -0.0261 -0.0061 0.0514  365  MET A O   
2850 C CB  . MET A 381 ? 0.4122 0.3682 0.3405 -0.0198 0.0067  0.0411  365  MET A CB  
2851 C CG  . MET A 381 ? 0.4585 0.4210 0.3888 -0.0181 0.0113  0.0359  365  MET A CG  
2852 S SD  . MET A 381 ? 0.5143 0.4745 0.4308 -0.0140 0.0109  0.0298  365  MET A SD  
2853 C CE  . MET A 381 ? 0.4805 0.4398 0.3845 -0.0132 0.0192  0.0351  365  MET A CE  
2854 N N   . ARG A 382 ? 0.3967 0.3473 0.3308 -0.0265 0.0080  0.0598  366  ARG A N   
2855 C CA  . ARG A 382 ? 0.5064 0.4516 0.4374 -0.0287 0.0073  0.0682  366  ARG A CA  
2856 C C   . ARG A 382 ? 1.0303 0.9777 0.9767 -0.0329 0.0077  0.0757  366  ARG A C   
2857 O O   . ARG A 382 ? 0.6050 0.5575 0.5557 -0.0342 0.0160  0.0818  366  ARG A O   
2858 C CB  . ARG A 382 ? 0.4838 0.4201 0.4060 -0.0277 -0.0010 0.0665  366  ARG A CB  
2859 C CG  . ARG A 382 ? 0.5034 0.4365 0.4095 -0.0238 -0.0010 0.0616  366  ARG A CG  
2860 C CD  . ARG A 382 ? 0.6702 0.5941 0.5676 -0.0230 -0.0090 0.0614  366  ARG A CD  
2861 N NE  . ARG A 382 ? 0.7959 0.7168 0.7039 -0.0246 -0.0175 0.0607  366  ARG A NE  
2862 C CZ  . ARG A 382 ? 0.9687 0.8882 0.8800 -0.0226 -0.0244 0.0534  366  ARG A CZ  
2863 N NH1 . ARG A 382 ? 0.7947 0.7161 0.7012 -0.0194 -0.0241 0.0465  366  ARG A NH1 
2864 N NH2 . ARG A 382 ? 0.7917 0.7077 0.7117 -0.0237 -0.0315 0.0531  366  ARG A NH2 
2865 N N   . HIS B 16  ? 1.4380 0.5200 0.6090 -0.0393 -0.3568 -0.0187 0    HIS B N   
2866 C CA  . HIS B 16  ? 1.4048 0.5032 0.6237 -0.0335 -0.3883 -0.0229 0    HIS B CA  
2867 C C   . HIS B 16  ? 1.3100 0.4765 0.6045 -0.0297 -0.3783 -0.0226 0    HIS B C   
2868 O O   . HIS B 16  ? 1.2542 0.4566 0.6024 -0.0257 -0.3897 -0.0249 0    HIS B O   
2869 C CB  . HIS B 16  ? 1.4723 0.5133 0.6582 -0.0315 -0.4228 -0.0262 0    HIS B CB  
2870 C CG  . HIS B 16  ? 1.5906 0.5611 0.7057 -0.0341 -0.4405 -0.0274 0    HIS B CG  
2871 N ND1 . HIS B 16  ? 1.6214 0.5816 0.7408 -0.0325 -0.4632 -0.0304 0    HIS B ND1 
2872 C CD2 . HIS B 16  ? 1.6785 0.5840 0.7173 -0.0378 -0.4398 -0.0264 0    HIS B CD2 
2873 C CE1 . HIS B 16  ? 1.6830 0.5726 0.7278 -0.0356 -0.4753 -0.0307 0    HIS B CE1 
2874 N NE2 . HIS B 16  ? 1.7233 0.5771 0.7165 -0.0389 -0.4613 -0.0283 0    HIS B NE2 
2875 N N   . MET B 17  ? 1.2183 0.4003 0.5155 -0.0310 -0.3572 -0.0200 1    MET B N   
2876 C CA  . MET B 17  ? 1.1378 0.3793 0.4995 -0.0281 -0.3458 -0.0193 1    MET B CA  
2877 C C   . MET B 17  ? 1.0645 0.3643 0.4807 -0.0264 -0.3325 -0.0188 1    MET B C   
2878 O O   . MET B 17  ? 1.0225 0.3305 0.4243 -0.0294 -0.3121 -0.0164 1    MET B O   
2879 C CB  . MET B 17  ? 1.1685 0.4165 0.5154 -0.0310 -0.3185 -0.0159 1    MET B CB  
2880 C CG  . MET B 17  ? 1.1762 0.4671 0.5771 -0.0278 -0.3157 -0.0159 1    MET B CG  
2881 S SD  . MET B 17  ? 1.2171 0.5272 0.6104 -0.0310 -0.2801 -0.0119 1    MET B SD  
2882 C CE  . MET B 17  ? 1.1080 0.4816 0.5474 -0.0314 -0.2517 -0.0094 1    MET B CE  
2883 N N   . HIS B 18  ? 0.9635 0.2998 0.4405 -0.0215 -0.3455 -0.0212 2    HIS B N   
2884 C CA  . HIS B 18  ? 0.9026 0.2927 0.4335 -0.0189 -0.3349 -0.0211 2    HIS B CA  
2885 C C   . HIS B 18  ? 0.8953 0.3275 0.4917 -0.0144 -0.3396 -0.0227 2    HIS B C   
2886 O O   . HIS B 18  ? 0.9076 0.3234 0.5170 -0.0117 -0.3651 -0.0259 2    HIS B O   
2887 C CB  . HIS B 18  ? 0.9280 0.3052 0.4546 -0.0177 -0.3515 -0.0237 2    HIS B CB  
2888 C CG  . HIS B 18  ? 0.9301 0.3590 0.5151 -0.0139 -0.3458 -0.0246 2    HIS B CG  
2889 N ND1 . HIS B 18  ? 0.9482 0.3858 0.5747 -0.0089 -0.3698 -0.0291 2    HIS B ND1 
2890 C CD2 . HIS B 18  ? 0.9084 0.3801 0.5157 -0.0143 -0.3189 -0.0218 2    HIS B CD2 
2891 C CE1 . HIS B 18  ? 0.8971 0.3817 0.5674 -0.0064 -0.3554 -0.0287 2    HIS B CE1 
2892 N NE2 . HIS B 18  ? 0.8750 0.3805 0.5342 -0.0094 -0.3255 -0.0243 2    HIS B NE2 
2893 N N   . PHE B 19  ? 0.7874 0.2720 0.4246 -0.0136 -0.3151 -0.0204 3    PHE B N   
2894 C CA  . PHE B 19  ? 0.7288 0.2558 0.4283 -0.0096 -0.3145 -0.0214 3    PHE B CA  
2895 C C   . PHE B 19  ? 0.7491 0.3276 0.4867 -0.0083 -0.2903 -0.0195 3    PHE B C   
2896 O O   . PHE B 19  ? 0.7368 0.3208 0.4519 -0.0110 -0.2705 -0.0167 3    PHE B O   
2897 C CB  . PHE B 19  ? 0.7358 0.2621 0.4370 -0.0105 -0.3110 -0.0200 3    PHE B CB  
2898 C CG  . PHE B 19  ? 0.7227 0.2605 0.4035 -0.0141 -0.2816 -0.0157 3    PHE B CG  
2899 C CD1 . PHE B 19  ? 0.7836 0.2824 0.4052 -0.0184 -0.2761 -0.0140 3    PHE B CD1 
2900 C CD2 . PHE B 19  ? 0.6847 0.2705 0.4054 -0.0133 -0.2593 -0.0135 3    PHE B CD2 
2901 C CE1 . PHE B 19  ? 0.7839 0.2939 0.3907 -0.0215 -0.2490 -0.0105 3    PHE B CE1 
2902 C CE2 . PHE B 19  ? 0.7089 0.3047 0.4127 -0.0164 -0.2339 -0.0099 3    PHE B CE2 
2903 C CZ  . PHE B 19  ? 0.7230 0.2819 0.3720 -0.0205 -0.2289 -0.0086 3    PHE B CZ  
2904 N N   . THR B 20  ? 0.6836 0.2981 0.4788 -0.0041 -0.2921 -0.0212 4    THR B N   
2905 C CA  . THR B 20  ? 0.6352 0.2973 0.4688 -0.0022 -0.2699 -0.0196 4    THR B CA  
2906 C C   . THR B 20  ? 0.6524 0.3428 0.5201 -0.0015 -0.2583 -0.0182 4    THR B C   
2907 O O   . THR B 20  ? 0.6548 0.3363 0.5387 -0.0004 -0.2742 -0.0200 4    THR B O   
2908 C CB  . THR B 20  ? 0.7431 0.4212 0.6115 0.0022  -0.2793 -0.0229 4    THR B CB  
2909 O OG1 . THR B 20  ? 0.8247 0.5045 0.7329 0.0057  -0.2994 -0.0268 4    THR B OG1 
2910 C CG2 . THR B 20  ? 0.7270 0.3769 0.5601 0.0013  -0.2906 -0.0242 4    THR B CG2 
2911 N N   . ILE B 21  ? 0.5599 0.2818 0.4367 -0.0022 -0.2317 -0.0148 5    ILE B N   
2912 C CA  . ILE B 21  ? 0.5326 0.2812 0.4372 -0.0020 -0.2179 -0.0129 5    ILE B CA  
2913 C C   . ILE B 21  ? 0.5689 0.3565 0.4959 -0.0008 -0.1929 -0.0105 5    ILE B C   
2914 O O   . ILE B 21  ? 0.5606 0.3487 0.4647 -0.0022 -0.1814 -0.0088 5    ILE B O   
2915 C CB  . ILE B 21  ? 0.5853 0.3120 0.4533 -0.0061 -0.2140 -0.0106 5    ILE B CB  
2916 C CG1 . ILE B 21  ? 0.5646 0.3135 0.4607 -0.0059 -0.2049 -0.0091 5    ILE B CG1 
2917 C CG2 . ILE B 21  ? 0.5988 0.3149 0.4224 -0.0099 -0.1969 -0.0077 5    ILE B CG2 
2918 C CD1 . ILE B 21  ? 0.5919 0.3153 0.4562 -0.0090 -0.2073 -0.0079 5    ILE B CD1 
2919 N N   . GLN B 22  ? 0.5079 0.3259 0.4781 0.0015  -0.1846 -0.0103 6    GLN B N   
2920 C CA  . GLN B 22  ? 0.4773 0.3285 0.4653 0.0027  -0.1610 -0.0079 6    GLN B CA  
2921 C C   . GLN B 22  ? 0.5031 0.3551 0.4637 -0.0009 -0.1436 -0.0042 6    GLN B C   
2922 O O   . GLN B 22  ? 0.4893 0.3277 0.4364 -0.0034 -0.1468 -0.0034 6    GLN B O   
2923 C CB  . GLN B 22  ? 0.4765 0.3557 0.5144 0.0058  -0.1559 -0.0086 6    GLN B CB  
2924 C CG  . GLN B 22  ? 0.6526 0.5404 0.7264 0.0102  -0.1658 -0.0123 6    GLN B CG  
2925 C CD  . GLN B 22  ? 0.8850 0.7884 0.9615 0.0129  -0.1536 -0.0122 6    GLN B CD  
2926 O OE1 . GLN B 22  ? 0.8273 0.7185 0.8916 0.0140  -0.1640 -0.0142 6    GLN B OE1 
2927 N NE2 . GLN B 22  ? 0.7475 0.6767 0.8399 0.0141  -0.1324 -0.0099 6    GLN B NE2 
2928 N N   . ARG B 23  ? 0.4497 0.3168 0.4029 -0.0011 -0.1259 -0.0020 7    ARG B N   
2929 C CA  . ARG B 23  ? 0.4439 0.3146 0.3761 -0.0042 -0.1086 0.0012  7    ARG B CA  
2930 C C   . ARG B 23  ? 0.4886 0.3663 0.4313 -0.0053 -0.1033 0.0025  7    ARG B C   
2931 O O   . ARG B 23  ? 0.4782 0.3392 0.3953 -0.0086 -0.1028 0.0035  7    ARG B O   
2932 C CB  . ARG B 23  ? 0.4068 0.3004 0.3463 -0.0026 -0.0915 0.0030  7    ARG B CB  
2933 C CG  . ARG B 23  ? 0.4312 0.3302 0.3548 -0.0054 -0.0745 0.0059  7    ARG B CG  
2934 C CD  . ARG B 23  ? 0.4479 0.3707 0.3856 -0.0031 -0.0596 0.0074  7    ARG B CD  
2935 N NE  . ARG B 23  ? 0.4590 0.3871 0.3855 -0.0055 -0.0451 0.0099  7    ARG B NE  
2936 C CZ  . ARG B 23  ? 0.5356 0.4774 0.4757 -0.0054 -0.0362 0.0111  7    ARG B CZ  
2937 N NH1 . ARG B 23  ? 0.4582 0.4099 0.4234 -0.0034 -0.0392 0.0105  7    ARG B NH1 
2938 N NH2 . ARG B 23  ? 0.4077 0.3529 0.3375 -0.0075 -0.0244 0.0129  7    ARG B NH2 
2939 N N   . GLU B 24  ? 0.4376 0.3388 0.4176 -0.0026 -0.0991 0.0024  8    GLU B N   
2940 C CA  . GLU B 24  ? 0.4339 0.3459 0.4299 -0.0034 -0.0930 0.0038  8    GLU B CA  
2941 C C   . GLU B 24  ? 0.4987 0.3895 0.4883 -0.0051 -0.1091 0.0026  8    GLU B C   
2942 O O   . GLU B 24  ? 0.4933 0.3800 0.4710 -0.0075 -0.1042 0.0042  8    GLU B O   
2943 C CB  . GLU B 24  ? 0.4326 0.3716 0.4702 0.0000  -0.0854 0.0037  8    GLU B CB  
2944 C CG  . GLU B 24  ? 0.5204 0.4787 0.5603 0.0016  -0.0673 0.0054  8    GLU B CG  
2945 C CD  . GLU B 24  ? 0.7285 0.6840 0.7587 0.0035  -0.0690 0.0043  8    GLU B CD  
2946 O OE1 . GLU B 24  ? 0.5947 0.5408 0.6313 0.0050  -0.0837 0.0016  8    GLU B OE1 
2947 O OE2 . GLU B 24  ? 0.5898 0.5511 0.6053 0.0034  -0.0570 0.0061  8    GLU B OE2 
2948 N N   . ALA B 25  ? 0.4717 0.3468 0.4673 -0.0037 -0.1293 -0.0004 9    ALA B N   
2949 C CA  . ALA B 25  ? 0.4959 0.3461 0.4840 -0.0048 -0.1484 -0.0019 9    ALA B CA  
2950 C C   . ALA B 25  ? 0.5560 0.3766 0.4938 -0.0084 -0.1495 -0.0009 9    ALA B C   
2951 O O   . ALA B 25  ? 0.5612 0.3672 0.4872 -0.0101 -0.1544 -0.0005 9    ALA B O   
2952 C CB  . ALA B 25  ? 0.5232 0.3606 0.5257 -0.0024 -0.1705 -0.0056 9    ALA B CB  
2953 N N   . LEU B 26  ? 0.4910 0.3023 0.3995 -0.0096 -0.1438 -0.0005 10   LEU B N   
2954 C CA  . LEU B 26  ? 0.4978 0.2811 0.3590 -0.0133 -0.1411 0.0005  10   LEU B CA  
2955 C C   . LEU B 26  ? 0.5123 0.3094 0.3668 -0.0154 -0.1197 0.0034  10   LEU B C   
2956 O O   . LEU B 26  ? 0.5014 0.2783 0.3286 -0.0180 -0.1185 0.0039  10   LEU B O   
2957 C CB  . LEU B 26  ? 0.5002 0.2686 0.3346 -0.0141 -0.1419 0.0000  10   LEU B CB  
2958 C CG  . LEU B 26  ? 0.5665 0.3060 0.3516 -0.0183 -0.1353 0.0012  10   LEU B CG  
2959 C CD1 . LEU B 26  ? 0.5831 0.2846 0.3382 -0.0199 -0.1501 0.0001  10   LEU B CD1 
2960 C CD2 . LEU B 26  ? 0.5813 0.3097 0.3457 -0.0192 -0.1351 0.0010  10   LEU B CD2 
2961 N N   . LEU B 27  ? 0.4598 0.2892 0.3378 -0.0142 -0.1032 0.0049  11   LEU B N   
2962 C CA  . LEU B 27  ? 0.4548 0.2984 0.3290 -0.0159 -0.0836 0.0073  11   LEU B CA  
2963 C C   . LEU B 27  ? 0.4964 0.3412 0.3760 -0.0168 -0.0822 0.0080  11   LEU B C   
2964 O O   . LEU B 27  ? 0.4919 0.3284 0.3494 -0.0193 -0.0726 0.0090  11   LEU B O   
2965 C CB  . LEU B 27  ? 0.4257 0.3008 0.3246 -0.0138 -0.0695 0.0086  11   LEU B CB  
2966 C CG  . LEU B 27  ? 0.4843 0.3715 0.3761 -0.0154 -0.0505 0.0107  11   LEU B CG  
2967 C CD1 . LEU B 27  ? 0.5023 0.3699 0.3596 -0.0185 -0.0458 0.0109  11   LEU B CD1 
2968 C CD2 . LEU B 27  ? 0.4797 0.3939 0.3953 -0.0127 -0.0405 0.0117  11   LEU B CD2 
2969 N N   . LYS B 28  ? 0.4648 0.3196 0.3746 -0.0148 -0.0912 0.0074  12   LYS B N   
2970 C CA  . LYS B 28  ? 0.4720 0.3297 0.3911 -0.0155 -0.0910 0.0081  12   LYS B CA  
2971 C C   . LYS B 28  ? 0.5471 0.3729 0.4306 -0.0180 -0.0981 0.0077  12   LYS B C   
2972 O O   . LYS B 28  ? 0.5355 0.3622 0.4055 -0.0198 -0.0855 0.0091  12   LYS B O   
2973 C CB  . LYS B 28  ? 0.4954 0.3671 0.4548 -0.0131 -0.1005 0.0074  12   LYS B CB  
2974 N N   . PRO B 29  ? 0.5473 0.3422 0.4115 -0.0181 -0.1172 0.0057  13   PRO B N   
2975 C CA  . PRO B 29  ? 0.5742 0.3349 0.3990 -0.0203 -0.1225 0.0054  13   PRO B CA  
2976 C C   . PRO B 29  ? 0.6080 0.3536 0.3936 -0.0231 -0.1083 0.0061  13   PRO B C   
2977 O O   . PRO B 29  ? 0.6161 0.3459 0.3762 -0.0250 -0.1015 0.0066  13   PRO B O   
2978 C CB  . PRO B 29  ? 0.6275 0.3588 0.4443 -0.0192 -0.1483 0.0029  13   PRO B CB  
2979 C CG  . PRO B 29  ? 0.6729 0.4171 0.5101 -0.0173 -0.1529 0.0018  13   PRO B CG  
2980 C CD  . PRO B 29  ? 0.5791 0.3666 0.4559 -0.0159 -0.1357 0.0035  13   PRO B CD  
2981 N N   . LEU B 30  ? 0.5475 0.2981 0.3295 -0.0231 -0.1031 0.0061  14   LEU B N   
2982 C CA  . LEU B 30  ? 0.5469 0.2852 0.2964 -0.0259 -0.0887 0.0068  14   LEU B CA  
2983 C C   . LEU B 30  ? 0.5747 0.3324 0.3292 -0.0273 -0.0672 0.0085  14   LEU B C   
2984 O O   . LEU B 30  ? 0.5902 0.3286 0.3151 -0.0299 -0.0579 0.0087  14   LEU B O   
2985 C CB  . LEU B 30  ? 0.5439 0.2893 0.2963 -0.0255 -0.0875 0.0067  14   LEU B CB  
2986 C CG  . LEU B 30  ? 0.6141 0.3396 0.3306 -0.0286 -0.0772 0.0072  14   LEU B CG  
2987 C CD1 . LEU B 30  ? 0.6576 0.3371 0.3281 -0.0311 -0.0852 0.0061  14   LEU B CD1 
2988 C CD2 . LEU B 30  ? 0.5910 0.3222 0.3128 -0.0277 -0.0807 0.0069  14   LEU B CD2 
2989 N N   . GLN B 31  ? 0.5062 0.3001 0.2978 -0.0254 -0.0595 0.0096  15   GLN B N   
2990 C CA  . GLN B 31  ? 0.4942 0.3077 0.2944 -0.0262 -0.0412 0.0110  15   GLN B CA  
2991 C C   . GLN B 31  ? 0.5569 0.3578 0.3456 -0.0274 -0.0409 0.0109  15   GLN B C   
2992 O O   . GLN B 31  ? 0.5424 0.3387 0.3156 -0.0294 -0.0273 0.0111  15   GLN B O   
2993 C CB  . GLN B 31  ? 0.4752 0.3249 0.3147 -0.0237 -0.0361 0.0121  15   GLN B CB  
2994 C CG  . GLN B 31  ? 0.5982 0.4632 0.4470 -0.0226 -0.0301 0.0126  15   GLN B CG  
2995 C CD  . GLN B 31  ? 0.7032 0.5997 0.5848 -0.0202 -0.0228 0.0137  15   GLN B CD  
2996 O OE1 . GLN B 31  ? 0.6653 0.5755 0.5507 -0.0200 -0.0109 0.0147  15   GLN B OE1 
2997 N NE2 . GLN B 31  ? 0.5639 0.4707 0.4694 -0.0182 -0.0298 0.0137  15   GLN B NE2 
2998 N N   . LEU B 32  ? 0.5434 0.3379 0.3406 -0.0261 -0.0564 0.0103  16   LEU B N   
2999 C CA  . LEU B 32  ? 0.5621 0.3429 0.3489 -0.0268 -0.0593 0.0101  16   LEU B CA  
3000 C C   . LEU B 32  ? 0.6090 0.3515 0.3502 -0.0290 -0.0594 0.0091  16   LEU B C   
3001 O O   . LEU B 32  ? 0.5940 0.3304 0.3201 -0.0304 -0.0476 0.0092  16   LEU B O   
3002 C CB  . LEU B 32  ? 0.5761 0.3560 0.3830 -0.0249 -0.0783 0.0096  16   LEU B CB  
3003 C CG  . LEU B 32  ? 0.6253 0.4413 0.4788 -0.0229 -0.0769 0.0107  16   LEU B CG  
3004 C CD1 . LEU B 32  ? 0.6374 0.4485 0.5095 -0.0216 -0.0949 0.0101  16   LEU B CD1 
3005 C CD2 . LEU B 32  ? 0.6588 0.4988 0.5246 -0.0235 -0.0587 0.0124  16   LEU B CD2 
3006 N N   . VAL B 33  ? 0.5795 0.2953 0.2977 -0.0293 -0.0716 0.0080  17   VAL B N   
3007 C CA  . VAL B 33  ? 0.6166 0.2898 0.2863 -0.0314 -0.0728 0.0070  17   VAL B CA  
3008 C C   . VAL B 33  ? 0.6865 0.3587 0.3372 -0.0341 -0.0498 0.0075  17   VAL B C   
3009 O O   . VAL B 33  ? 0.6812 0.3323 0.3044 -0.0359 -0.0405 0.0071  17   VAL B O   
3010 C CB  . VAL B 33  ? 0.6942 0.3385 0.3458 -0.0308 -0.0939 0.0056  17   VAL B CB  
3011 C CG1 . VAL B 33  ? 0.7488 0.3492 0.3470 -0.0335 -0.0914 0.0049  17   VAL B CG1 
3012 C CG2 . VAL B 33  ? 0.6955 0.3298 0.3580 -0.0285 -0.1172 0.0045  17   VAL B CG2 
3013 N N   . ALA B 34  ? 0.6751 0.3709 0.3432 -0.0344 -0.0401 0.0083  18   ALA B N   
3014 C CA  . ALA B 34  ? 0.6947 0.3926 0.3516 -0.0370 -0.0189 0.0088  18   ALA B CA  
3015 C C   . ALA B 34  ? 0.7357 0.4493 0.4032 -0.0375 -0.0021 0.0091  18   ALA B C   
3016 O O   . ALA B 34  ? 0.7630 0.4649 0.4117 -0.0401 0.0141  0.0088  18   ALA B O   
3017 C CB  . ALA B 34  ? 0.6873 0.4105 0.3666 -0.0365 -0.0147 0.0097  18   ALA B CB  
3018 N N   . GLY B 35  ? 0.6665 0.4039 0.3633 -0.0353 -0.0064 0.0095  19   GLY B N   
3019 C CA  . GLY B 35  ? 0.6610 0.4139 0.3704 -0.0354 0.0060  0.0097  19   GLY B CA  
3020 C C   . GLY B 35  ? 0.7616 0.4847 0.4392 -0.0369 0.0107  0.0085  19   GLY B C   
3021 O O   . GLY B 35  ? 0.7690 0.4996 0.4498 -0.0377 0.0262  0.0081  19   GLY B O   
3022 N N   . VAL B 36  ? 0.7340 0.4212 0.3798 -0.0370 -0.0031 0.0077  20   VAL B N   
3023 C CA  . VAL B 36  ? 0.7606 0.4136 0.3702 -0.0382 0.0006  0.0065  20   VAL B CA  
3024 C C   . VAL B 36  ? 0.8459 0.4675 0.4163 -0.0411 0.0136  0.0057  20   VAL B C   
3025 O O   . VAL B 36  ? 0.8637 0.4573 0.4030 -0.0424 0.0229  0.0046  20   VAL B O   
3026 C CB  . VAL B 36  ? 0.8293 0.4573 0.4238 -0.0365 -0.0208 0.0059  20   VAL B CB  
3027 C CG1 . VAL B 36  ? 0.7993 0.4588 0.4346 -0.0341 -0.0304 0.0068  20   VAL B CG1 
3028 C CG2 . VAL B 36  ? 0.8507 0.4497 0.4225 -0.0363 -0.0396 0.0055  20   VAL B CG2 
3029 N N   . VAL B 37  ? 0.8073 0.4327 0.3790 -0.0423 0.0150  0.0063  21   VAL B N   
3030 C CA  . VAL B 37  ? 0.8481 0.4454 0.3855 -0.0455 0.0272  0.0059  21   VAL B CA  
3031 C C   . VAL B 37  ? 0.9086 0.5249 0.4601 -0.0475 0.0533  0.0058  21   VAL B C   
3032 O O   . VAL B 37  ? 0.8838 0.5386 0.4742 -0.0467 0.0583  0.0067  21   VAL B O   
3033 C CB  . VAL B 37  ? 0.8955 0.4885 0.4293 -0.0459 0.0160  0.0066  21   VAL B CB  
3034 C CG1 . VAL B 37  ? 0.9262 0.4930 0.4275 -0.0496 0.0305  0.0065  21   VAL B CG1 
3035 C CG2 . VAL B 37  ? 0.9098 0.4789 0.4279 -0.0439 -0.0105 0.0060  21   VAL B CG2 
3036 N N   . GLU B 38  ? 0.8925 0.4799 0.4126 -0.0499 0.0694  0.0046  22   GLU B N   
3037 C CA  . GLU B 38  ? 1.3463 0.9452 0.8773 -0.0520 0.0951  0.0039  22   GLU B CA  
3038 C C   . GLU B 38  ? 1.8751 1.4320 1.3620 -0.0558 0.1109  0.0031  22   GLU B C   
3039 O O   . GLU B 38  ? 1.4566 0.9717 0.8999 -0.0561 0.1062  0.0024  22   GLU B O   
3040 C CB  . GLU B 38  ? 1.3498 0.9638 0.8984 -0.0503 0.1018  0.0028  22   GLU B CB  
3041 N N   . THR B 42  ? 1.3183 0.6524 0.5790 -0.0743 0.2062  -0.0010 26   THR B N   
3042 C CA  . THR B 42  ? 1.3735 0.6545 0.5803 -0.0787 0.2253  -0.0013 26   THR B CA  
3043 C C   . THR B 42  ? 1.4432 0.6833 0.6017 -0.0795 0.2039  0.0003  26   THR B C   
3044 O O   . THR B 42  ? 1.4591 0.6832 0.6013 -0.0836 0.2120  0.0015  26   THR B O   
3045 C CB  . THR B 42  ? 1.5261 0.7724 0.6997 -0.0785 0.2436  -0.0037 26   THR B CB  
3046 N N   . LEU B 43  ? 1.3859 0.6085 0.5227 -0.0757 0.1757  0.0001  27   LEU B N   
3047 C CA  . LEU B 43  ? 1.3967 0.5809 0.4911 -0.0755 0.1500  0.0010  27   LEU B CA  
3048 C C   . LEU B 43  ? 1.3391 0.5679 0.4791 -0.0745 0.1313  0.0026  27   LEU B C   
3049 O O   . LEU B 43  ? 1.2792 0.5559 0.4696 -0.0709 0.1191  0.0027  27   LEU B O   
3050 C CB  . LEU B 43  ? 1.4201 0.5771 0.4869 -0.0712 0.1260  -0.0002 27   LEU B CB  
3051 C CG  . LEU B 43  ? 1.5183 0.6310 0.5405 -0.0700 0.0951  0.0001  27   LEU B CG  
3052 C CD1 . LEU B 43  ? 1.5976 0.6391 0.5444 -0.0737 0.1058  -0.0002 27   LEU B CD1 
3053 C CD2 . LEU B 43  ? 1.5471 0.6528 0.5663 -0.0651 0.0689  -0.0010 27   LEU B CD2 
3054 N N   . PRO B 44  ? 1.2628 0.4780 0.3875 -0.0778 0.1312  0.0040  28   PRO B N   
3055 C CA  . PRO B 44  ? 1.1942 0.4528 0.3636 -0.0767 0.1158  0.0054  28   PRO B CA  
3056 C C   . PRO B 44  ? 1.1635 0.4385 0.3515 -0.0717 0.0814  0.0052  28   PRO B C   
3057 O O   . PRO B 44  ? 1.1043 0.4321 0.3474 -0.0692 0.0746  0.0058  28   PRO B O   
3058 C CB  . PRO B 44  ? 1.2513 0.4787 0.3872 -0.0813 0.1210  0.0066  28   PRO B CB  
3059 C CG  . PRO B 44  ? 1.3661 0.5495 0.4570 -0.0856 0.1497  0.0061  28   PRO B CG  
3060 C CD  . PRO B 44  ? 1.3395 0.4992 0.4060 -0.0827 0.1465  0.0043  28   PRO B CD  
3061 N N   . VAL B 45  ? 1.1272 0.3567 0.2706 -0.0700 0.0601  0.0043  29   VAL B N   
3062 C CA  . VAL B 45  ? 1.1009 0.3403 0.2605 -0.0654 0.0263  0.0038  29   VAL B CA  
3063 C C   . VAL B 45  ? 1.1010 0.3893 0.3136 -0.0613 0.0220  0.0035  29   VAL B C   
3064 O O   . VAL B 45  ? 1.0471 0.3658 0.2963 -0.0580 0.0007  0.0036  29   VAL B O   
3065 C CB  . VAL B 45  ? 1.2037 0.3803 0.3038 -0.0646 0.0030  0.0026  29   VAL B CB  
3066 C CG1 . VAL B 45  ? 1.2372 0.3809 0.3043 -0.0634 0.0065  0.0014  29   VAL B CG1 
3067 C CG2 . VAL B 45  ? 1.1815 0.3688 0.3026 -0.0607 -0.0326 0.0021  29   VAL B CG2 
3068 N N   . LEU B 46  ? 1.0561 0.3523 0.2738 -0.0618 0.0436  0.0030  30   LEU B N   
3069 C CA  . LEU B 46  ? 1.0133 0.3521 0.2767 -0.0585 0.0429  0.0027  30   LEU B CA  
3070 C C   . LEU B 46  ? 0.9916 0.3929 0.3190 -0.0574 0.0439  0.0039  30   LEU B C   
3071 O O   . LEU B 46  ? 0.9403 0.3755 0.3058 -0.0540 0.0330  0.0039  30   LEU B O   
3072 C CB  . LEU B 46  ? 1.0310 0.3626 0.2843 -0.0596 0.0684  0.0017  30   LEU B CB  
3073 N N   . SER B 47  ? 0.9352 0.3487 0.2717 -0.0602 0.0566  0.0049  31   SER B N   
3074 C CA  . SER B 47  ? 0.8802 0.3465 0.2704 -0.0593 0.0583  0.0060  31   SER B CA  
3075 C C   . SER B 47  ? 0.8859 0.3603 0.2873 -0.0571 0.0330  0.0066  31   SER B C   
3076 O O   . SER B 47  ? 0.8316 0.3459 0.2736 -0.0560 0.0322  0.0076  31   SER B O   
3077 C CB  . SER B 47  ? 0.9289 0.4016 0.3228 -0.0633 0.0834  0.0067  31   SER B CB  
3078 O OG  . SER B 47  ? 1.0507 0.5284 0.4505 -0.0646 0.1072  0.0058  31   SER B OG  
3079 N N   . ASN B 48  ? 0.8618 0.2975 0.2279 -0.0562 0.0118  0.0059  32   ASN B N   
3080 C CA  . ASN B 48  ? 0.8447 0.2828 0.2194 -0.0541 -0.0135 0.0058  32   ASN B CA  
3081 C C   . ASN B 48  ? 0.8450 0.2933 0.2407 -0.0497 -0.0377 0.0049  32   ASN B C   
3082 O O   . ASN B 48  ? 0.8456 0.2842 0.2341 -0.0486 -0.0392 0.0043  32   ASN B O   
3083 C CB  . ASN B 48  ? 0.9043 0.2897 0.2255 -0.0566 -0.0220 0.0054  32   ASN B CB  
3084 C CG  . ASN B 48  ? 1.0307 0.4127 0.3409 -0.0607 -0.0041 0.0066  32   ASN B CG  
3085 O OD1 . ASN B 48  ? 0.9190 0.3341 0.2581 -0.0621 0.0173  0.0076  32   ASN B OD1 
3086 N ND2 . ASN B 48  ? 0.9709 0.3104 0.2383 -0.0627 -0.0134 0.0064  32   ASN B ND2 
3087 N N   . VAL B 49  ? 0.7549 0.2244 0.1797 -0.0472 -0.0559 0.0048  33   VAL B N   
3088 C CA  . VAL B 49  ? 0.7276 0.2060 0.1759 -0.0432 -0.0803 0.0038  33   VAL B CA  
3089 C C   . VAL B 49  ? 0.8074 0.2398 0.2197 -0.0427 -0.1056 0.0022  33   VAL B C   
3090 O O   . VAL B 49  ? 0.8138 0.2341 0.2123 -0.0440 -0.1093 0.0021  33   VAL B O   
3091 C CB  . VAL B 49  ? 0.7045 0.2372 0.2128 -0.0402 -0.0834 0.0044  33   VAL B CB  
3092 C CG1 . VAL B 49  ? 0.6855 0.2292 0.2024 -0.0406 -0.0837 0.0048  33   VAL B CG1 
3093 C CG2 . VAL B 49  ? 0.6904 0.2300 0.2239 -0.0364 -0.1071 0.0033  33   VAL B CG2 
3094 N N   . LEU B 50  ? 0.8062 0.2124 0.2037 -0.0409 -0.1239 0.0009  34   LEU B N   
3095 C CA  . LEU B 50  ? 0.8485 0.2086 0.2131 -0.0400 -0.1515 -0.0010 34   LEU B CA  
3096 C C   . LEU B 50  ? 0.8654 0.2542 0.2779 -0.0363 -0.1740 -0.0021 34   LEU B C   
3097 O O   . LEU B 50  ? 0.8200 0.2421 0.2762 -0.0336 -0.1783 -0.0021 34   LEU B O   
3098 C CB  . LEU B 50  ? 0.8875 0.2036 0.2141 -0.0394 -0.1628 -0.0020 34   LEU B CB  
3099 C CG  . LEU B 50  ? 0.9799 0.2489 0.2783 -0.0375 -0.1968 -0.0043 34   LEU B CG  
3100 C CD1 . LEU B 50  ? 1.0248 0.2438 0.2660 -0.0403 -0.1988 -0.0048 34   LEU B CD1 
3101 C CD2 . LEU B 50  ? 1.0411 0.2777 0.3166 -0.0359 -0.2101 -0.0053 34   LEU B CD2 
3102 N N   . LEU B 51  ? 0.8255 0.2030 0.2314 -0.0362 -0.1864 -0.0030 35   LEU B N   
3103 C CA  . LEU B 51  ? 0.8028 0.2032 0.2513 -0.0327 -0.2075 -0.0046 35   LEU B CA  
3104 C C   . LEU B 51  ? 0.9189 0.2698 0.3379 -0.0313 -0.2397 -0.0074 35   LEU B C   
3105 O O   . LEU B 51  ? 0.9547 0.2587 0.3209 -0.0335 -0.2444 -0.0079 35   LEU B O   
3106 C CB  . LEU B 51  ? 0.7859 0.2076 0.2468 -0.0336 -0.1983 -0.0040 35   LEU B CB  
3107 C CG  . LEU B 51  ? 0.7908 0.2736 0.3082 -0.0321 -0.1821 -0.0026 35   LEU B CG  
3108 C CD1 . LEU B 51  ? 0.7734 0.2822 0.3026 -0.0334 -0.1572 -0.0003 35   LEU B CD1 
3109 C CD2 . LEU B 51  ? 0.7985 0.2917 0.3164 -0.0333 -0.1741 -0.0020 35   LEU B CD2 
3110 N N   . VAL B 52  ? 0.8793 0.2381 0.3314 -0.0277 -0.2619 -0.0091 36   VAL B N   
3111 C CA  . VAL B 52  ? 0.9294 0.2431 0.3613 -0.0257 -0.2964 -0.0122 36   VAL B CA  
3112 C C   . VAL B 52  ? 0.9427 0.2872 0.4340 -0.0217 -0.3168 -0.0145 36   VAL B C   
3113 O O   . VAL B 52  ? 0.8899 0.2792 0.4354 -0.0198 -0.3117 -0.0140 36   VAL B O   
3114 C CB  . VAL B 52  ? 1.0100 0.2887 0.4149 -0.0252 -0.3075 -0.0126 36   VAL B CB  
3115 C CG1 . VAL B 52  ? 1.0551 0.2849 0.4398 -0.0228 -0.3460 -0.0160 36   VAL B CG1 
3116 C CG2 . VAL B 52  ? 1.0397 0.2863 0.3851 -0.0289 -0.2854 -0.0107 36   VAL B CG2 
3117 N N   . VAL B 53  ? 0.9334 0.2530 0.4141 -0.0207 -0.3389 -0.0171 37   VAL B N   
3118 C CA  . VAL B 53  ? 0.9216 0.2620 0.4544 -0.0167 -0.3614 -0.0201 37   VAL B CA  
3119 C C   . VAL B 53  ? 1.0278 0.3171 0.5401 -0.0147 -0.3988 -0.0236 37   VAL B C   
3120 O O   . VAL B 53  ? 1.0592 0.2941 0.5129 -0.0162 -0.4115 -0.0246 37   VAL B O   
3121 C CB  . VAL B 53  ? 0.9642 0.3201 0.5074 -0.0166 -0.3581 -0.0208 37   VAL B CB  
3122 C CG1 . VAL B 53  ? 0.9533 0.3239 0.5474 -0.0121 -0.3838 -0.0247 37   VAL B CG1 
3123 C CG2 . VAL B 53  ? 0.9075 0.3137 0.4736 -0.0181 -0.3231 -0.0174 37   VAL B CG2 
3124 N N   . GLU B 54  ? 0.9979 0.3027 0.5563 -0.0115 -0.4154 -0.0253 38   GLU B N   
3125 C CA  . GLU B 54  ? 1.0494 0.3117 0.6009 -0.0090 -0.4530 -0.0288 38   GLU B CA  
3126 C C   . GLU B 54  ? 1.0793 0.3812 0.7094 -0.0050 -0.4685 -0.0315 38   GLU B C   
3127 O O   . GLU B 54  ? 1.0161 0.3649 0.6960 -0.0044 -0.4531 -0.0299 38   GLU B O   
3128 C CB  . GLU B 54  ? 1.0962 0.3301 0.6159 -0.0099 -0.4546 -0.0274 38   GLU B CB  
3129 N N   . GLY B 55  ? 1.0799 0.3640 0.7213 -0.0025 -0.4966 -0.0357 39   GLY B N   
3130 C CA  . GLY B 55  ? 1.0516 0.3701 0.7683 0.0015  -0.5121 -0.0390 39   GLY B CA  
3131 C C   . GLY B 55  ? 1.0435 0.4251 0.8086 0.0016  -0.4820 -0.0373 39   GLY B C   
3132 O O   . GLY B 55  ? 1.0302 0.4162 0.7755 0.0005  -0.4687 -0.0365 39   GLY B O   
3133 N N   . GLN B 56  ? 0.9517 0.3804 0.7765 0.0029  -0.4698 -0.0363 40   GLN B N   
3134 C CA  . GLN B 56  ? 0.8916 0.3790 0.7608 0.0031  -0.4398 -0.0343 40   GLN B CA  
3135 C C   . GLN B 56  ? 0.9061 0.4193 0.7691 0.0003  -0.4084 -0.0293 40   GLN B C   
3136 O O   . GLN B 56  ? 0.8553 0.4170 0.7657 0.0009  -0.3876 -0.0277 40   GLN B O   
3137 C CB  . GLN B 56  ? 0.8766 0.3991 0.8241 0.0071  -0.4497 -0.0376 40   GLN B CB  
3138 C CG  . GLN B 56  ? 1.0011 0.5068 0.9621 0.0102  -0.4765 -0.0428 40   GLN B CG  
3139 C CD  . GLN B 56  ? 1.1598 0.6694 1.0959 0.0096  -0.4632 -0.0424 40   GLN B CD  
3140 O OE1 . GLN B 56  ? 1.0464 0.6000 1.0137 0.0103  -0.4388 -0.0410 40   GLN B OE1 
3141 N NE2 . GLN B 56  ? 1.0385 0.5000 0.9156 0.0083  -0.4791 -0.0433 40   GLN B NE2 
3142 N N   . GLN B 57  ? 0.8790 0.3572 0.6821 -0.0027 -0.4051 -0.0271 41   GLN B N   
3143 C CA  . GLN B 57  ? 0.8461 0.3429 0.6385 -0.0053 -0.3775 -0.0229 41   GLN B CA  
3144 C C   . GLN B 57  ? 0.8724 0.3542 0.6065 -0.0089 -0.3557 -0.0200 41   GLN B C   
3145 O O   . GLN B 57  ? 0.9234 0.3567 0.6009 -0.0104 -0.3666 -0.0207 41   GLN B O   
3146 C CB  . GLN B 57  ? 0.8842 0.3613 0.6720 -0.0053 -0.3904 -0.0227 41   GLN B CB  
3147 C CG  . GLN B 57  ? 1.0091 0.5114 0.7956 -0.0076 -0.3619 -0.0186 41   GLN B CG  
3148 C CD  . GLN B 57  ? 1.1418 0.6301 0.9318 -0.0073 -0.3746 -0.0185 41   GLN B CD  
3149 O OE1 . GLN B 57  ? 1.1598 0.6013 0.8992 -0.0081 -0.3872 -0.0188 41   GLN B OE1 
3150 N NE2 . GLN B 57  ? 0.9100 0.4374 0.7587 -0.0061 -0.3708 -0.0180 41   GLN B NE2 
3151 N N   . LEU B 58  ? 0.7576 0.2800 0.5063 -0.0103 -0.3245 -0.0168 42   LEU B N   
3152 C CA  . LEU B 58  ? 0.7364 0.2522 0.4399 -0.0138 -0.3002 -0.0139 42   LEU B CA  
3153 C C   . LEU B 58  ? 0.7579 0.2765 0.4505 -0.0155 -0.2855 -0.0114 42   LEU B C   
3154 O O   . LEU B 58  ? 0.7125 0.2670 0.4485 -0.0144 -0.2778 -0.0104 42   LEU B O   
3155 C CB  . LEU B 58  ? 0.6831 0.2416 0.4110 -0.0139 -0.2765 -0.0123 42   LEU B CB  
3156 C CG  . LEU B 58  ? 0.7141 0.2749 0.4069 -0.0175 -0.2483 -0.0091 42   LEU B CG  
3157 C CD1 . LEU B 58  ? 0.7449 0.2584 0.3773 -0.0201 -0.2534 -0.0096 42   LEU B CD1 
3158 C CD2 . LEU B 58  ? 0.6925 0.3002 0.4192 -0.0169 -0.2265 -0.0075 42   LEU B CD2 
3159 N N   . SER B 59  ? 0.7417 0.2216 0.3761 -0.0183 -0.2808 -0.0105 43   SER B N   
3160 C CA  . SER B 59  ? 0.7379 0.2183 0.3573 -0.0201 -0.2646 -0.0082 43   SER B CA  
3161 C C   . SER B 59  ? 0.7757 0.2616 0.3667 -0.0233 -0.2352 -0.0058 43   SER B C   
3162 O O   . SER B 59  ? 0.7845 0.2456 0.3392 -0.0251 -0.2336 -0.0061 43   SER B O   
3163 C CB  . SER B 59  ? 0.8187 0.2470 0.3954 -0.0202 -0.2839 -0.0095 43   SER B CB  
3164 O OG  . SER B 59  ? 0.9101 0.3426 0.5239 -0.0172 -0.3079 -0.0112 43   SER B OG  
3165 N N   . LEU B 60  ? 0.6927 0.2110 0.3020 -0.0242 -0.2124 -0.0036 44   LEU B N   
3166 C CA  . LEU B 60  ? 0.6848 0.2131 0.2756 -0.0271 -0.1836 -0.0014 44   LEU B CA  
3167 C C   . LEU B 60  ? 0.7415 0.2570 0.3100 -0.0285 -0.1730 -0.0005 44   LEU B C   
3168 O O   . LEU B 60  ? 0.7068 0.2446 0.3054 -0.0271 -0.1731 0.0000  44   LEU B O   
3169 C CB  . LEU B 60  ? 0.6314 0.2146 0.2701 -0.0264 -0.1656 0.0002  44   LEU B CB  
3170 C CG  . LEU B 60  ? 0.6829 0.2823 0.3464 -0.0246 -0.1736 -0.0008 44   LEU B CG  
3171 C CD1 . LEU B 60  ? 0.6662 0.2891 0.3794 -0.0211 -0.1896 -0.0021 44   LEU B CD1 
3172 C CD2 . LEU B 60  ? 0.6937 0.3263 0.3716 -0.0255 -0.1504 0.0010  44   LEU B CD2 
3173 N N   . THR B 61  ? 0.7433 0.2207 0.2583 -0.0312 -0.1639 -0.0004 45   THR B N   
3174 C CA  . THR B 61  ? 0.7669 0.2277 0.2566 -0.0324 -0.1530 0.0002  45   THR B CA  
3175 C C   . THR B 61  ? 0.8242 0.2928 0.2982 -0.0355 -0.1219 0.0016  45   THR B C   
3176 O O   . THR B 61  ? 0.8276 0.2827 0.2779 -0.0378 -0.1131 0.0018  45   THR B O   
3177 C CB  . THR B 61  ? 0.8883 0.2896 0.3275 -0.0321 -0.1734 -0.0015 45   THR B CB  
3178 O OG1 . THR B 61  ? 0.8415 0.2392 0.3031 -0.0291 -0.2037 -0.0031 45   THR B OG1 
3179 C CG2 . THR B 61  ? 0.9069 0.2896 0.3210 -0.0326 -0.1646 -0.0013 45   THR B CG2 
3180 N N   . GLY B 62  ? 0.7734 0.2641 0.2633 -0.0356 -0.1063 0.0025  46   GLY B N   
3181 C CA  . GLY B 62  ? 0.7638 0.2640 0.2453 -0.0382 -0.0774 0.0034  46   GLY B CA  
3182 C C   . GLY B 62  ? 0.8171 0.2976 0.2762 -0.0383 -0.0710 0.0029  46   GLY B C   
3183 O O   . GLY B 62  ? 0.8095 0.2941 0.2833 -0.0360 -0.0845 0.0027  46   GLY B O   
3184 N N   . THR B 63  ? 0.7960 0.2542 0.2201 -0.0410 -0.0500 0.0027  47   THR B N   
3185 C CA  . THR B 63  ? 0.8363 0.2731 0.2357 -0.0411 -0.0411 0.0019  47   THR B CA  
3186 C C   . THR B 63  ? 0.9056 0.3477 0.2975 -0.0439 -0.0095 0.0019  47   THR B C   
3187 O O   . THR B 63  ? 0.8852 0.3298 0.2733 -0.0464 0.0036  0.0024  47   THR B O   
3188 C CB  . THR B 63  ? 0.9458 0.3219 0.2899 -0.0406 -0.0589 0.0006  47   THR B CB  
3189 O OG1 . THR B 63  ? 0.9612 0.3203 0.2872 -0.0398 -0.0539 -0.0001 47   THR B OG1 
3190 C CG2 . THR B 63  ? 0.9754 0.3065 0.2673 -0.0435 -0.0529 0.0002  47   THR B CG2 
3191 N N   . ASP B 64  ? 0.8738 0.3186 0.2664 -0.0434 0.0021  0.0013  48   ASP B N   
3192 C CA  . ASP B 64  ? 0.8764 0.3223 0.2618 -0.0457 0.0316  0.0006  48   ASP B CA  
3193 C C   . ASP B 64  ? 0.9813 0.3786 0.3167 -0.0456 0.0358  -0.0010 48   ASP B C   
3194 O O   . ASP B 64  ? 0.9914 0.3861 0.3201 -0.0468 0.0593  -0.0021 48   ASP B O   
3195 C CB  . ASP B 64  ? 0.8322 0.3317 0.2713 -0.0447 0.0435  0.0010  48   ASP B CB  
3196 C CG  . ASP B 64  ? 0.8761 0.3862 0.3304 -0.0420 0.0352  0.0006  48   ASP B CG  
3197 O OD1 . ASP B 64  ? 0.9085 0.3894 0.3386 -0.0403 0.0163  0.0003  48   ASP B OD1 
3198 O OD2 . ASP B 64  ? 0.8451 0.3921 0.3360 -0.0414 0.0465  0.0006  48   ASP B OD2 
3199 N N   . LEU B 65  ? 0.9672 0.3256 0.2690 -0.0440 0.0117  -0.0013 49   LEU B N   
3200 C CA  . LEU B 65  ? 1.0266 0.3322 0.2763 -0.0431 0.0068  -0.0028 49   LEU B CA  
3201 C C   . LEU B 65  ? 1.0615 0.3795 0.3290 -0.0400 -0.0013 -0.0032 49   LEU B C   
3202 O O   . LEU B 65  ? 1.1037 0.3804 0.3345 -0.0382 -0.0167 -0.0041 49   LEU B O   
3203 C CB  . LEU B 65  ? 1.0817 0.3452 0.2806 -0.0459 0.0324  -0.0040 49   LEU B CB  
3204 C CG  . LEU B 65  ? 1.1757 0.4129 0.3439 -0.0492 0.0383  -0.0035 49   LEU B CG  
3205 C CD1 . LEU B 65  ? 1.2258 0.4317 0.3557 -0.0524 0.0698  -0.0046 49   LEU B CD1 
3206 C CD2 . LEU B 65  ? 1.2382 0.4292 0.3653 -0.0482 0.0089  -0.0035 49   LEU B CD2 
3207 N N   . GLU B 66  ? 0.9488 0.3209 0.2704 -0.0393 0.0080  -0.0026 50   GLU B N   
3208 C CA  . GLU B 66  ? 0.9255 0.3147 0.2694 -0.0367 0.0007  -0.0028 50   GLU B CA  
3209 C C   . GLU B 66  ? 0.9186 0.3323 0.2988 -0.0346 -0.0270 -0.0014 50   GLU B C   
3210 O O   . GLU B 66  ? 0.9112 0.3100 0.2860 -0.0323 -0.0467 -0.0015 50   GLU B O   
3211 C CB  . GLU B 66  ? 0.9091 0.3401 0.2901 -0.0371 0.0247  -0.0032 50   GLU B CB  
3212 C CG  . GLU B 66  ? 1.1011 0.5396 0.4938 -0.0346 0.0193  -0.0037 50   GLU B CG  
3213 C CD  . GLU B 66  ? 1.2930 0.7506 0.7006 -0.0347 0.0432  -0.0052 50   GLU B CD  
3214 O OE1 . GLU B 66  ? 1.0207 0.5243 0.4737 -0.0353 0.0538  -0.0046 50   GLU B OE1 
3215 O OE2 . GLU B 66  ? 1.1234 0.5495 0.4985 -0.0338 0.0492  -0.0070 50   GLU B OE2 
3216 N N   . VAL B 67  ? 0.8397 0.2895 0.2568 -0.0353 -0.0280 0.0000  51   VAL B N   
3217 C CA  . VAL B 67  ? 0.8079 0.2824 0.2621 -0.0336 -0.0511 0.0012  51   VAL B CA  
3218 C C   . VAL B 67  ? 0.8747 0.3347 0.3180 -0.0342 -0.0636 0.0014  51   VAL B C   
3219 O O   . VAL B 67  ? 0.8682 0.3188 0.2922 -0.0365 -0.0495 0.0013  51   VAL B O   
3220 C CB  . VAL B 67  ? 0.8037 0.3375 0.3177 -0.0331 -0.0437 0.0026  51   VAL B CB  
3221 C CG1 . VAL B 67  ? 0.7858 0.3325 0.3119 -0.0322 -0.0359 0.0024  51   VAL B CG1 
3222 C CG2 . VAL B 67  ? 0.7795 0.3408 0.3108 -0.0350 -0.0236 0.0032  51   VAL B CG2 
3223 N N   . GLU B 68  ? 0.8305 0.2908 0.2898 -0.0323 -0.0900 0.0016  52   GLU B N   
3224 C CA  . GLU B 68  ? 0.8331 0.2841 0.2904 -0.0322 -0.1057 0.0014  52   GLU B CA  
3225 C C   . GLU B 68  ? 0.8260 0.3197 0.3406 -0.0304 -0.1191 0.0023  52   GLU B C   
3226 O O   . GLU B 68  ? 0.8241 0.3273 0.3615 -0.0285 -0.1319 0.0025  52   GLU B O   
3227 C CB  . GLU B 68  ? 0.9081 0.3002 0.3160 -0.0314 -0.1283 -0.0001 52   GLU B CB  
3228 C CG  . GLU B 68  ? 1.0087 0.3850 0.4068 -0.0318 -0.1428 -0.0006 52   GLU B CG  
3229 C CD  . GLU B 68  ? 1.2449 0.5729 0.6126 -0.0300 -0.1742 -0.0022 52   GLU B CD  
3230 O OE1 . GLU B 68  ? 1.1543 0.4342 0.4691 -0.0312 -0.1776 -0.0032 52   GLU B OE1 
3231 O OE2 . GLU B 68  ? 1.0537 0.3908 0.4508 -0.0274 -0.1960 -0.0026 52   GLU B OE2 
3232 N N   . LEU B 69  ? 0.7396 0.2595 0.2781 -0.0309 -0.1148 0.0029  53   LEU B N   
3233 C CA  . LEU B 69  ? 0.6966 0.2549 0.2876 -0.0290 -0.1256 0.0036  53   LEU B CA  
3234 C C   . LEU B 69  ? 0.7478 0.2917 0.3355 -0.0283 -0.1437 0.0025  53   LEU B C   
3235 O O   . LEU B 69  ? 0.7488 0.2804 0.3130 -0.0299 -0.1363 0.0024  53   LEU B O   
3236 C CB  . LEU B 69  ? 0.6488 0.2582 0.2807 -0.0295 -0.1044 0.0052  53   LEU B CB  
3237 C CG  . LEU B 69  ? 0.6841 0.3327 0.3702 -0.0274 -0.1128 0.0060  53   LEU B CG  
3238 C CD1 . LEU B 69  ? 0.6816 0.3338 0.3873 -0.0260 -0.1250 0.0062  53   LEU B CD1 
3239 C CD2 . LEU B 69  ? 0.6832 0.3749 0.4006 -0.0278 -0.0922 0.0075  53   LEU B CD2 
3240 N N   . VAL B 70  ? 0.7154 0.2594 0.3271 -0.0260 -0.1680 0.0017  54   VAL B N   
3241 C CA  . VAL B 70  ? 0.7289 0.2604 0.3445 -0.0248 -0.1890 0.0002  54   VAL B CA  
3242 C C   . VAL B 70  ? 0.7526 0.3310 0.4303 -0.0229 -0.1919 0.0006  54   VAL B C   
3243 O O   . VAL B 70  ? 0.7400 0.3377 0.4515 -0.0216 -0.1969 0.0011  54   VAL B O   
3244 C CB  . VAL B 70  ? 0.8224 0.3042 0.4083 -0.0235 -0.2185 -0.0019 54   VAL B CB  
3245 C CG1 . VAL B 70  ? 0.8335 0.2990 0.4196 -0.0223 -0.2400 -0.0039 54   VAL B CG1 
3246 C CG2 . VAL B 70  ? 0.8678 0.3010 0.3900 -0.0251 -0.2138 -0.0022 54   VAL B CG2 
3247 N N   . GLY B 71  ? 0.6923 0.2876 0.3832 -0.0227 -0.1872 0.0005  55   GLY B N   
3248 C CA  . GLY B 71  ? 0.6476 0.2826 0.3927 -0.0207 -0.1893 0.0005  55   GLY B CA  
3249 C C   . GLY B 71  ? 0.7204 0.3363 0.4686 -0.0189 -0.2140 -0.0020 55   GLY B C   
3250 O O   . GLY B 71  ? 0.7371 0.3189 0.4448 -0.0198 -0.2209 -0.0032 55   GLY B O   
3251 N N   . ARG B 72  ? 0.6712 0.3067 0.4670 -0.0164 -0.2279 -0.0031 56   ARG B N   
3252 C CA  . ARG B 72  ? 0.6913 0.3105 0.4972 -0.0143 -0.2532 -0.0061 56   ARG B CA  
3253 C C   . ARG B 72  ? 0.7121 0.3717 0.5717 -0.0121 -0.2494 -0.0066 56   ARG B C   
3254 O O   . ARG B 72  ? 0.6758 0.3728 0.5761 -0.0116 -0.2363 -0.0051 56   ARG B O   
3255 C CB  . ARG B 72  ? 0.7338 0.3244 0.5414 -0.0130 -0.2811 -0.0080 56   ARG B CB  
3256 C CG  . ARG B 72  ? 0.8801 0.4188 0.6250 -0.0145 -0.2899 -0.0083 56   ARG B CG  
3257 C CD  . ARG B 72  ? 1.0552 0.5688 0.8010 -0.0133 -0.3135 -0.0094 56   ARG B CD  
3258 N NE  . ARG B 72  ? 1.1144 0.6467 0.8699 -0.0143 -0.2985 -0.0070 56   ARG B NE  
3259 C CZ  . ARG B 72  ? 1.2916 0.8556 1.0995 -0.0132 -0.3002 -0.0064 56   ARG B CZ  
3260 N NH1 . ARG B 72  ? 1.1657 0.7463 1.0228 -0.0111 -0.3156 -0.0082 56   ARG B NH1 
3261 N NH2 . ARG B 72  ? 1.0728 0.6512 0.8846 -0.0143 -0.2864 -0.0041 56   ARG B NH2 
3262 N N   . VAL B 73  ? 0.6890 0.3399 0.5461 -0.0109 -0.2595 -0.0088 57   VAL B N   
3263 C CA  . VAL B 73  ? 0.6710 0.3548 0.5748 -0.0084 -0.2575 -0.0099 57   VAL B CA  
3264 C C   . VAL B 73  ? 0.7524 0.4141 0.6674 -0.0060 -0.2872 -0.0140 57   VAL B C   
3265 O O   . VAL B 73  ? 0.7863 0.4067 0.6584 -0.0066 -0.3035 -0.0155 57   VAL B O   
3266 C CB  . VAL B 73  ? 0.7128 0.4147 0.6067 -0.0090 -0.2366 -0.0086 57   VAL B CB  
3267 C CG1 . VAL B 73  ? 0.6698 0.4166 0.6166 -0.0066 -0.2240 -0.0083 57   VAL B CG1 
3268 C CG2 . VAL B 73  ? 0.7124 0.4124 0.5682 -0.0123 -0.2140 -0.0054 57   VAL B CG2 
3269 N N   . VAL B 74  ? 0.6949 0.3831 0.6674 -0.0031 -0.2936 -0.0158 58   VAL B N   
3270 C CA  . VAL B 74  ? 0.7142 0.3866 0.7076 -0.0002 -0.3216 -0.0202 58   VAL B CA  
3271 C C   . VAL B 74  ? 0.7630 0.4479 0.7607 0.0012  -0.3153 -0.0214 58   VAL B C   
3272 O O   . VAL B 74  ? 0.7259 0.4499 0.7545 0.0021  -0.2937 -0.0201 58   VAL B O   
3273 C CB  . VAL B 74  ? 0.7459 0.4373 0.8021 0.0021  -0.3334 -0.0221 58   VAL B CB  
3274 C CG1 . VAL B 74  ? 0.7632 0.4340 0.8401 0.0051  -0.3652 -0.0272 58   VAL B CG1 
3275 C CG2 . VAL B 74  ? 0.7506 0.4325 0.8027 0.0005  -0.3374 -0.0204 58   VAL B CG2 
3276 N N   . LEU B 75  ? 0.7573 0.4067 0.7203 0.0013  -0.3338 -0.0238 59   LEU B N   
3277 C CA  . LEU B 75  ? 0.7514 0.4072 0.7132 0.0026  -0.3307 -0.0251 59   LEU B CA  
3278 C C   . LEU B 75  ? 0.8343 0.5021 0.8499 0.0068  -0.3488 -0.0296 59   LEU B C   
3279 O O   . LEU B 75  ? 0.8572 0.4990 0.8808 0.0083  -0.3776 -0.0331 59   LEU B O   
3280 C CB  . LEU B 75  ? 0.7826 0.3944 0.6797 0.0004  -0.3399 -0.0253 59   LEU B CB  
3281 C CG  . LEU B 75  ? 0.8319 0.4315 0.6759 -0.0039 -0.3192 -0.0211 59   LEU B CG  
3282 C CD1 . LEU B 75  ? 0.8732 0.4178 0.6538 -0.0062 -0.3348 -0.0219 59   LEU B CD1 
3283 C CD2 . LEU B 75  ? 0.8138 0.4466 0.6594 -0.0050 -0.2894 -0.0182 59   LEU B CD2 
3284 N N   . GLU B 76  ? 0.7811 0.4878 0.8349 0.0090  -0.3316 -0.0297 60   GLU B N   
3285 C CA  . GLU B 76  ? 0.7770 0.5008 0.8869 0.0133  -0.3431 -0.0340 60   GLU B CA  
3286 C C   . GLU B 76  ? 0.8606 0.5586 0.9552 0.0151  -0.3649 -0.0380 60   GLU B C   
3287 O O   . GLU B 76  ? 0.8743 0.5628 1.0012 0.0181  -0.3899 -0.0428 60   GLU B O   
3288 C CB  . GLU B 76  ? 0.7544 0.5261 0.9055 0.0150  -0.3146 -0.0325 60   GLU B CB  
3289 N N   . ASP B 77  ? 0.8192 0.5063 0.8671 0.0134  -0.3558 -0.0362 61   ASP B N   
3290 C CA  . ASP B 77  ? 0.8341 0.4959 0.8613 0.0146  -0.3742 -0.0395 61   ASP B CA  
3291 C C   . ASP B 77  ? 0.9105 0.5178 0.8799 0.0120  -0.3975 -0.0401 61   ASP B C   
3292 O O   . ASP B 77  ? 0.9139 0.5051 0.8524 0.0088  -0.3936 -0.0372 61   ASP B O   
3293 C CB  . ASP B 77  ? 0.8408 0.5201 0.8508 0.0142  -0.3517 -0.0372 61   ASP B CB  
3294 N N   . ALA B 78  ? 0.8896 0.4668 0.8423 0.0133  -0.4213 -0.0438 62   ALA B N   
3295 C CA  . ALA B 78  ? 0.9425 0.4623 0.8370 0.0111  -0.4458 -0.0449 62   ALA B CA  
3296 C C   . ALA B 78  ? 1.0031 0.5025 0.8307 0.0059  -0.4267 -0.0399 62   ALA B C   
3297 O O   . ALA B 78  ? 0.9785 0.4998 0.7957 0.0042  -0.4009 -0.0368 62   ALA B O   
3298 C CB  . ALA B 78  ? 0.9753 0.4724 0.8642 0.0134  -0.4693 -0.0494 62   ALA B CB  
3299 N N   . ALA B 79  ? 0.9818 0.4388 0.7657 0.0034  -0.4392 -0.0393 63   ALA B N   
3300 C CA  . ALA B 79  ? 0.9892 0.4223 0.7095 -0.0015 -0.4217 -0.0349 63   ALA B CA  
3301 C C   . ALA B 79  ? 1.0713 0.4378 0.7272 -0.0035 -0.4456 -0.0363 63   ALA B C   
3302 O O   . ALA B 79  ? 1.0954 0.4338 0.7543 -0.0015 -0.4739 -0.0394 63   ALA B O   
3303 C CB  . ALA B 79  ? 0.9766 0.4329 0.7078 -0.0030 -0.4009 -0.0314 63   ALA B CB  
3304 N N   . GLU B 80  ? 1.0214 0.3607 0.6182 -0.0074 -0.4343 -0.0340 64   GLU B N   
3305 C CA  . GLU B 80  ? 1.0706 0.3425 0.5968 -0.0099 -0.4523 -0.0347 64   GLU B CA  
3306 C C   . GLU B 80  ? 1.1101 0.3677 0.6000 -0.0133 -0.4348 -0.0310 64   GLU B C   
3307 O O   . GLU B 80  ? 1.0737 0.3660 0.5702 -0.0155 -0.4019 -0.0271 64   GLU B O   
3308 C CB  . GLU B 80  ? 1.1077 0.3544 0.5880 -0.0127 -0.4487 -0.0341 64   GLU B CB  
3309 C CG  . GLU B 80  ? 1.2419 0.4861 0.7455 -0.0092 -0.4740 -0.0385 64   GLU B CG  
3310 C CD  . GLU B 80  ? 1.4320 0.7382 0.9977 -0.0065 -0.4585 -0.0386 64   GLU B CD  
3311 O OE1 . GLU B 80  ? 1.3303 0.6492 0.8813 -0.0088 -0.4380 -0.0361 64   GLU B OE1 
3312 O OE2 . GLU B 80  ? 1.3000 0.6414 0.9286 -0.0022 -0.4655 -0.0410 64   GLU B OE2 
3313 N N   . PRO B 81  ? 1.0869 0.2958 0.5425 -0.0132 -0.4566 -0.0324 65   PRO B N   
3314 C CA  . PRO B 81  ? 1.0867 0.2836 0.5114 -0.0158 -0.4400 -0.0293 65   PRO B CA  
3315 C C   . PRO B 81  ? 1.1453 0.3120 0.5021 -0.0210 -0.4165 -0.0259 65   PRO B C   
3316 O O   . PRO B 81  ? 1.1664 0.3072 0.4877 -0.0229 -0.4182 -0.0262 65   PRO B O   
3317 C CB  . PRO B 81  ? 1.1509 0.2998 0.5580 -0.0136 -0.4748 -0.0324 65   PRO B CB  
3318 C CG  . PRO B 81  ? 1.2396 0.3505 0.6305 -0.0120 -0.5062 -0.0363 65   PRO B CG  
3319 C CD  . PRO B 81  ? 1.1429 0.3050 0.5880 -0.0103 -0.4984 -0.0372 65   PRO B CD  
3320 N N   . GLY B 82  ? 1.0977 0.2654 0.4366 -0.0232 -0.3953 -0.0230 66   GLY B N   
3321 C CA  . GLY B 82  ? 1.1235 0.2625 0.4010 -0.0281 -0.3706 -0.0200 66   GLY B CA  
3322 C C   . GLY B 82  ? 1.1330 0.3004 0.4182 -0.0299 -0.3397 -0.0167 66   GLY B C   
3323 O O   . GLY B 82  ? 1.0860 0.2981 0.4247 -0.0275 -0.3362 -0.0165 66   GLY B O   
3324 N N   . GLU B 83  ? 1.1195 0.2585 0.3503 -0.0342 -0.3173 -0.0144 67   GLU B N   
3325 C CA  . GLU B 83  ? 1.0958 0.2551 0.3266 -0.0363 -0.2866 -0.0115 67   GLU B CA  
3326 C C   . GLU B 83  ? 1.1292 0.2869 0.3301 -0.0412 -0.2546 -0.0088 67   GLU B C   
3327 O O   . GLU B 83  ? 1.1632 0.2759 0.3126 -0.0440 -0.2569 -0.0090 67   GLU B O   
3328 C CB  . GLU B 83  ? 1.1502 0.2721 0.3487 -0.0357 -0.2945 -0.0121 67   GLU B CB  
3329 C CG  . GLU B 83  ? 1.3886 0.4336 0.5195 -0.0359 -0.3195 -0.0141 67   GLU B CG  
3330 C CD  . GLU B 83  ? 1.8404 0.8496 0.9398 -0.0350 -0.3259 -0.0145 67   GLU B CD  
3331 O OE1 . GLU B 83  ? 1.7677 0.7939 0.9057 -0.0312 -0.3450 -0.0158 67   GLU B OE1 
3332 O OE2 . GLU B 83  ? 1.8701 0.8333 0.9060 -0.0380 -0.3113 -0.0134 67   GLU B OE2 
3333 N N   . ILE B 84  ? 1.0150 0.2240 0.2526 -0.0422 -0.2258 -0.0065 68   ILE B N   
3334 C CA  . ILE B 84  ? 1.0006 0.2200 0.2253 -0.0465 -0.1938 -0.0039 68   ILE B CA  
3335 C C   . ILE B 84  ? 0.9943 0.2589 0.2532 -0.0468 -0.1668 -0.0020 68   ILE B C   
3336 O O   . ILE B 84  ? 0.9688 0.2690 0.2731 -0.0434 -0.1730 -0.0024 68   ILE B O   
3337 C CB  . ILE B 84  ? 1.0144 0.2599 0.2646 -0.0466 -0.1949 -0.0038 68   ILE B CB  
3338 C CG1 . ILE B 84  ? 1.0544 0.2816 0.2672 -0.0518 -0.1721 -0.0018 68   ILE B CG1 
3339 C CG2 . ILE B 84  ? 0.9517 0.2667 0.2750 -0.0434 -0.1893 -0.0032 68   ILE B CG2 
3340 N N   . THR B 85  ? 0.9359 0.1977 0.1736 -0.0509 -0.1370 0.0000  69   THR B N   
3341 C CA  . THR B 85  ? 0.8971 0.2023 0.1687 -0.0513 -0.1111 0.0015  69   THR B CA  
3342 C C   . THR B 85  ? 0.9236 0.2635 0.2198 -0.0535 -0.0913 0.0033  69   THR B C   
3343 O O   . THR B 85  ? 0.9303 0.2459 0.1970 -0.0565 -0.0883 0.0037  69   THR B O   
3344 C CB  . THR B 85  ? 0.9549 0.2320 0.1901 -0.0535 -0.0932 0.0019  69   THR B CB  
3345 O OG1 . THR B 85  ? 0.9841 0.2401 0.1849 -0.0584 -0.0684 0.0031  69   THR B OG1 
3346 C CG2 . THR B 85  ? 1.0255 0.2517 0.2191 -0.0518 -0.1148 0.0001  69   THR B CG2 
3347 N N   . VAL B 86  ? 0.8487 0.2442 0.1991 -0.0517 -0.0805 0.0042  70   VAL B N   
3348 C CA  . VAL B 86  ? 0.8233 0.2557 0.2028 -0.0530 -0.0633 0.0058  70   VAL B CA  
3349 C C   . VAL B 86  ? 0.8214 0.2924 0.2331 -0.0532 -0.0393 0.0070  70   VAL B C   
3350 O O   . VAL B 86  ? 0.7687 0.2534 0.1985 -0.0507 -0.0430 0.0065  70   VAL B O   
3351 C CB  . VAL B 86  ? 0.8651 0.3281 0.2830 -0.0496 -0.0803 0.0054  70   VAL B CB  
3352 C CG1 . VAL B 86  ? 0.9113 0.3361 0.2973 -0.0499 -0.1018 0.0040  70   VAL B CG1 
3353 C CG2 . VAL B 86  ? 0.8235 0.3209 0.2870 -0.0448 -0.0930 0.0045  70   VAL B CG2 
3354 N N   . PRO B 87  ? 0.7937 0.2824 0.2148 -0.0561 -0.0163 0.0085  71   PRO B N   
3355 C CA  . PRO B 87  ? 0.7567 0.2825 0.2117 -0.0560 0.0039  0.0092  71   PRO B CA  
3356 C C   . PRO B 87  ? 0.7416 0.3110 0.2457 -0.0512 -0.0070 0.0091  71   PRO B C   
3357 O O   . PRO B 87  ? 0.6912 0.2835 0.2213 -0.0489 -0.0174 0.0093  71   PRO B O   
3358 C CB  . PRO B 87  ? 0.7693 0.3098 0.2341 -0.0590 0.0221  0.0106  71   PRO B CB  
3359 C CG  . PRO B 87  ? 0.8779 0.3762 0.2984 -0.0623 0.0189  0.0107  71   PRO B CG  
3360 C CD  . PRO B 87  ? 0.8355 0.3116 0.2393 -0.0595 -0.0091 0.0094  71   PRO B CD  
3361 N N   . ALA B 88  ? 0.7006 0.2768 0.2136 -0.0497 -0.0057 0.0086  72   ALA B N   
3362 C CA  . ALA B 88  ? 0.6615 0.2731 0.2162 -0.0456 -0.0152 0.0086  72   ALA B CA  
3363 C C   . ALA B 88  ? 0.6379 0.2958 0.2363 -0.0444 -0.0039 0.0097  72   ALA B C   
3364 O O   . ALA B 88  ? 0.5861 0.2695 0.2150 -0.0412 -0.0150 0.0099  72   ALA B O   
3365 C CB  . ALA B 88  ? 0.6765 0.2813 0.2262 -0.0451 -0.0134 0.0080  72   ALA B CB  
3366 N N   . ARG B 89  ? 0.5975 0.2650 0.1993 -0.0468 0.0178  0.0104  73   ARG B N   
3367 C CA  . ARG B 89  ? 0.5704 0.2786 0.2116 -0.0456 0.0281  0.0114  73   ARG B CA  
3368 C C   . ARG B 89  ? 0.5766 0.2952 0.2277 -0.0450 0.0226  0.0121  73   ARG B C   
3369 O O   . ARG B 89  ? 0.5127 0.2623 0.1967 -0.0418 0.0177  0.0126  73   ARG B O   
3370 C CB  . ARG B 89  ? 0.6066 0.3189 0.2493 -0.0484 0.0511  0.0114  73   ARG B CB  
3371 C CG  . ARG B 89  ? 0.7186 0.4696 0.4008 -0.0472 0.0606  0.0122  73   ARG B CG  
3372 C CD  . ARG B 89  ? 0.8974 0.6793 0.6128 -0.0431 0.0527  0.0124  73   ARG B CD  
3373 N NE  . ARG B 89  ? 1.0933 0.8998 0.8347 -0.0427 0.0659  0.0124  73   ARG B NE  
3374 C CZ  . ARG B 89  ? 1.3011 1.1119 1.0484 -0.0424 0.0713  0.0117  73   ARG B CZ  
3375 N NH1 . ARG B 89  ? 1.1421 0.9345 0.8709 -0.0423 0.0648  0.0110  73   ARG B NH1 
3376 N NH2 . ARG B 89  ? 1.1468 0.9790 0.9184 -0.0420 0.0819  0.0115  73   ARG B NH2 
3377 N N   . LYS B 90  ? 0.5611 0.2517 0.1818 -0.0480 0.0230  0.0121  74   LYS B N   
3378 C CA  . LYS B 90  ? 0.5518 0.2484 0.1780 -0.0476 0.0168  0.0128  74   LYS B CA  
3379 C C   . LYS B 90  ? 0.5581 0.2620 0.1971 -0.0435 -0.0050 0.0120  74   LYS B C   
3380 O O   . LYS B 90  ? 0.5118 0.2429 0.1790 -0.0408 -0.0080 0.0125  74   LYS B O   
3381 C CB  . LYS B 90  ? 0.6227 0.2838 0.2102 -0.0520 0.0213  0.0130  74   LYS B CB  
3382 C CG  . LYS B 90  ? 0.7112 0.3750 0.2991 -0.0559 0.0445  0.0139  74   LYS B CG  
3383 C CD  . LYS B 90  ? 0.7909 0.4165 0.3385 -0.0608 0.0508  0.0143  74   LYS B CD  
3384 C CE  . LYS B 90  ? 0.7936 0.4245 0.3479 -0.0647 0.0750  0.0151  74   LYS B CE  
3385 N NZ  . LYS B 90  ? 0.8865 0.4753 0.3977 -0.0702 0.0860  0.0154  74   LYS B NZ  
3386 N N   . LEU B 91  ? 0.5614 0.2413 0.1819 -0.0427 -0.0201 0.0107  75   LEU B N   
3387 C CA  . LEU B 91  ? 0.5434 0.2300 0.1804 -0.0388 -0.0414 0.0096  75   LEU B CA  
3388 C C   . LEU B 91  ? 0.5277 0.2542 0.2090 -0.0349 -0.0408 0.0099  75   LEU B C   
3389 O O   . LEU B 91  ? 0.4767 0.2233 0.1837 -0.0317 -0.0492 0.0096  75   LEU B O   
3390 C CB  . LEU B 91  ? 0.5693 0.2198 0.1784 -0.0388 -0.0593 0.0080  75   LEU B CB  
3391 C CG  . LEU B 91  ? 0.6123 0.2647 0.2380 -0.0350 -0.0832 0.0063  75   LEU B CG  
3392 C CD1 . LEU B 91  ? 0.6333 0.2788 0.2520 -0.0350 -0.0906 0.0059  75   LEU B CD1 
3393 C CD2 . LEU B 91  ? 0.6779 0.2973 0.2819 -0.0346 -0.1013 0.0046  75   LEU B CD2 
3394 N N   . MET B 92  ? 0.4985 0.2350 0.1875 -0.0353 -0.0302 0.0104  76   MET B N   
3395 C CA  . MET B 92  ? 0.4567 0.2289 0.1849 -0.0321 -0.0280 0.0109  76   MET B CA  
3396 C C   . MET B 92  ? 0.4613 0.2622 0.2129 -0.0309 -0.0181 0.0121  76   MET B C   
3397 O O   . MET B 92  ? 0.4315 0.2552 0.2109 -0.0274 -0.0235 0.0121  76   MET B O   
3398 C CB  . MET B 92  ? 0.4775 0.2530 0.2068 -0.0331 -0.0180 0.0113  76   MET B CB  
3399 C CG  . MET B 92  ? 0.4979 0.3084 0.2653 -0.0302 -0.0149 0.0120  76   MET B CG  
3400 S SD  . MET B 92  ? 0.5562 0.3701 0.3236 -0.0316 -0.0024 0.0123  76   MET B SD  
3401 N N   . ASP B 93  ? 0.4348 0.2333 0.1755 -0.0338 -0.0035 0.0129  77   ASP B N   
3402 C CA  . ASP B 93  ? 0.4078 0.2306 0.1691 -0.0327 0.0049  0.0140  77   ASP B CA  
3403 C C   . ASP B 93  ? 0.4368 0.2625 0.2030 -0.0305 -0.0060 0.0138  77   ASP B C   
3404 O O   . ASP B 93  ? 0.3961 0.2461 0.1870 -0.0274 -0.0054 0.0143  77   ASP B O   
3405 C CB  . ASP B 93  ? 0.4454 0.2622 0.1953 -0.0365 0.0211  0.0147  77   ASP B CB  
3406 C CG  . ASP B 93  ? 0.4924 0.3139 0.2466 -0.0380 0.0344  0.0146  77   ASP B CG  
3407 O OD1 . ASP B 93  ? 0.4805 0.3143 0.2492 -0.0358 0.0316  0.0144  77   ASP B OD1 
3408 O OD2 . ASP B 93  ? 0.5494 0.3619 0.2934 -0.0414 0.0480  0.0147  77   ASP B OD2 
3409 N N   . ILE B 94  ? 0.4204 0.2196 0.1617 -0.0319 -0.0165 0.0130  78   ILE B N   
3410 C CA  . ILE B 94  ? 0.4124 0.2113 0.1566 -0.0298 -0.0285 0.0124  78   ILE B CA  
3411 C C   . ILE B 94  ? 0.4288 0.2461 0.2013 -0.0250 -0.0402 0.0113  78   ILE B C   
3412 O O   . ILE B 94  ? 0.3909 0.2292 0.1855 -0.0217 -0.0406 0.0115  78   ILE B O   
3413 C CB  . ILE B 94  ? 0.4686 0.2309 0.1767 -0.0327 -0.0380 0.0115  78   ILE B CB  
3414 C CG1 . ILE B 94  ? 0.4843 0.2326 0.1694 -0.0374 -0.0236 0.0128  78   ILE B CG1 
3415 C CG2 . ILE B 94  ? 0.4697 0.2313 0.1840 -0.0297 -0.0548 0.0102  78   ILE B CG2 
3416 C CD1 . ILE B 94  ? 0.5586 0.2653 0.2010 -0.0413 -0.0284 0.0123  78   ILE B CD1 
3417 N N   . CYS B 95  ? 0.4326 0.2417 0.2051 -0.0246 -0.0485 0.0103  79   CYS B N   
3418 C CA  . CYS B 95  ? 0.4378 0.2624 0.2390 -0.0205 -0.0589 0.0092  79   CYS B CA  
3419 C C   . CYS B 95  ? 0.4230 0.2819 0.2562 -0.0179 -0.0471 0.0105  79   CYS B C   
3420 O O   . CYS B 95  ? 0.3871 0.2633 0.2440 -0.0142 -0.0504 0.0100  79   CYS B O   
3421 C CB  . CYS B 95  ? 0.4795 0.2883 0.2745 -0.0212 -0.0682 0.0082  79   CYS B CB  
3422 S SG  . CYS B 95  ? 0.5316 0.3551 0.3634 -0.0168 -0.0833 0.0065  79   CYS B SG  
3423 N N   . LYS B 96  ? 0.3882 0.2545 0.2201 -0.0197 -0.0331 0.0119  80   LYS B N   
3424 C CA  . LYS B 96  ? 0.3619 0.2561 0.2187 -0.0176 -0.0219 0.0132  80   LYS B CA  
3425 C C   . LYS B 96  ? 0.3811 0.2890 0.2468 -0.0155 -0.0178 0.0138  80   LYS B C   
3426 O O   . LYS B 96  ? 0.3470 0.2748 0.2354 -0.0119 -0.0157 0.0141  80   LYS B O   
3427 C CB  . LYS B 96  ? 0.4083 0.3026 0.2570 -0.0205 -0.0088 0.0143  80   LYS B CB  
3428 C CG  . LYS B 96  ? 0.6185 0.5360 0.4904 -0.0187 -0.0005 0.0153  80   LYS B CG  
3429 C CD  . LYS B 96  ? 0.8328 0.7450 0.7011 -0.0205 0.0015  0.0152  80   LYS B CD  
3430 C CE  . LYS B 96  ? 0.9430 0.8442 0.7929 -0.0241 0.0118  0.0153  80   LYS B CE  
3431 N NZ  . LYS B 96  ? 0.9261 0.8239 0.7744 -0.0252 0.0138  0.0151  80   LYS B NZ  
3432 N N   . SER B 97  ? 0.3603 0.2560 0.2070 -0.0177 -0.0160 0.0141  81   SER B N   
3433 C CA  . SER B 97  ? 0.3523 0.2578 0.2041 -0.0161 -0.0127 0.0147  81   SER B CA  
3434 C C   . SER B 97  ? 0.4098 0.3181 0.2705 -0.0124 -0.0238 0.0136  81   SER B C   
3435 O O   . SER B 97  ? 0.3886 0.3081 0.2577 -0.0098 -0.0214 0.0140  81   SER B O   
3436 C CB  . SER B 97  ? 0.3949 0.2851 0.2245 -0.0201 -0.0074 0.0154  81   SER B CB  
3437 O OG  . SER B 97  ? 0.4631 0.3297 0.2707 -0.0220 -0.0172 0.0144  81   SER B OG  
3438 N N   . LEU B 98  ? 0.3639 0.2597 0.2216 -0.0120 -0.0367 0.0118  82   LEU B N   
3439 C CA  . LEU B 98  ? 0.3777 0.2746 0.2452 -0.0085 -0.0482 0.0101  82   LEU B CA  
3440 C C   . LEU B 98  ? 0.4305 0.3514 0.3294 -0.0036 -0.0456 0.0098  82   LEU B C   
3441 O O   . LEU B 98  ? 0.4024 0.3344 0.3145 -0.0033 -0.0393 0.0105  82   LEU B O   
3442 C CB  . LEU B 98  ? 0.3943 0.2689 0.2508 -0.0094 -0.0646 0.0080  82   LEU B CB  
3443 C CG  . LEU B 98  ? 0.4796 0.3251 0.3005 -0.0137 -0.0692 0.0079  82   LEU B CG  
3444 C CD1 . LEU B 98  ? 0.5153 0.3353 0.3220 -0.0148 -0.0851 0.0060  82   LEU B CD1 
3445 C CD2 . LEU B 98  ? 0.5285 0.3712 0.3424 -0.0130 -0.0720 0.0078  82   LEU B CD2 
3446 N N   . PRO B 99  ? 0.4392 0.3670 0.3491 0.0003  -0.0496 0.0088  83   PRO B N   
3447 C CA  . PRO B 99  ? 0.4314 0.3796 0.3698 0.0051  -0.0453 0.0083  83   PRO B CA  
3448 C C   . PRO B 99  ? 0.4956 0.4469 0.4545 0.0060  -0.0506 0.0068  83   PRO B C   
3449 O O   . PRO B 99  ? 0.4940 0.4302 0.4478 0.0044  -0.0635 0.0052  83   PRO B O   
3450 C CB  . PRO B 99  ? 0.4501 0.3986 0.3926 0.0087  -0.0515 0.0067  83   PRO B CB  
3451 C CG  . PRO B 99  ? 0.5195 0.4524 0.4350 0.0057  -0.0551 0.0073  83   PRO B CG  
3452 C CD  . PRO B 99  ? 0.4692 0.3851 0.3656 0.0005  -0.0580 0.0078  83   PRO B CD  
3453 N N   . ASN B 100 ? 0.4461 0.4154 0.4276 0.0085  -0.0410 0.0075  84   ASN B N   
3454 C CA  . ASN B 100 ? 0.4462 0.4216 0.4522 0.0094  -0.0436 0.0064  84   ASN B CA  
3455 C C   . ASN B 100 ? 0.4819 0.4535 0.5053 0.0120  -0.0573 0.0031  84   ASN B C   
3456 O O   . ASN B 100 ? 0.4628 0.4352 0.4876 0.0149  -0.0596 0.0018  84   ASN B O   
3457 C CB  . ASN B 100 ? 0.4784 0.4730 0.5044 0.0120  -0.0288 0.0078  84   ASN B CB  
3458 C CG  . ASN B 100 ? 0.7839 0.7826 0.7959 0.0100  -0.0163 0.0107  84   ASN B CG  
3459 O OD1 . ASN B 100 ? 0.6912 0.6807 0.6828 0.0062  -0.0172 0.0117  84   ASN B OD1 
3460 N ND2 . ASN B 100 ? 0.6854 0.6968 0.7084 0.0126  -0.0041 0.0119  84   ASN B ND2 
3461 N N   . ASP B 101 ? 0.4619 0.4277 0.4981 0.0110  -0.0677 0.0016  85   ASP B N   
3462 C CA  . ASP B 101 ? 0.4777 0.4390 0.5357 0.0133  -0.0831 -0.0019 85   ASP B CA  
3463 C C   . ASP B 101 ? 0.5471 0.4896 0.5864 0.0134  -0.0986 -0.0041 85   ASP B C   
3464 O O   . ASP B 101 ? 0.5804 0.5215 0.6402 0.0163  -0.1104 -0.0074 85   ASP B O   
3465 C CB  . ASP B 101 ? 0.4896 0.4713 0.5856 0.0180  -0.0751 -0.0033 85   ASP B CB  
3466 C CG  . ASP B 101 ? 0.6282 0.6271 0.7392 0.0181  -0.0576 -0.0008 85   ASP B CG  
3467 O OD1 . ASP B 101 ? 0.6441 0.6422 0.7609 0.0155  -0.0589 0.0000  85   ASP B OD1 
3468 O OD2 . ASP B 101 ? 0.7138 0.7251 0.8290 0.0208  -0.0429 0.0002  85   ASP B OD2 
3469 N N   . VAL B 102 ? 0.4723 0.3999 0.4746 0.0101  -0.0985 -0.0024 86   VAL B N   
3470 C CA  . VAL B 102 ? 0.4663 0.3734 0.4473 0.0096  -0.1126 -0.0042 86   VAL B CA  
3471 C C   . VAL B 102 ? 0.5020 0.3837 0.4714 0.0072  -0.1316 -0.0061 86   VAL B C   
3472 O O   . VAL B 102 ? 0.4915 0.3663 0.4522 0.0043  -0.1306 -0.0048 86   VAL B O   
3473 C CB  . VAL B 102 ? 0.5097 0.4103 0.4577 0.0071  -0.1043 -0.0018 86   VAL B CB  
3474 C CG1 . VAL B 102 ? 0.5127 0.3961 0.4293 0.0017  -0.1017 0.0004  86   VAL B CG1 
3475 C CG2 . VAL B 102 ? 0.5194 0.4071 0.4556 0.0082  -0.1158 -0.0036 86   VAL B CG2 
3476 N N   . LEU B 103 ? 0.4712 0.3373 0.4394 0.0087  -0.1495 -0.0092 87   LEU B N   
3477 C CA  . LEU B 103 ? 0.4970 0.3335 0.4497 0.0068  -0.1705 -0.0114 87   LEU B CA  
3478 C C   . LEU B 103 ? 0.5538 0.3632 0.4562 0.0020  -0.1704 -0.0094 87   LEU B C   
3479 O O   . LEU B 103 ? 0.5644 0.3725 0.4501 0.0016  -0.1653 -0.0086 87   LEU B O   
3480 C CB  . LEU B 103 ? 0.5131 0.3430 0.4859 0.0105  -0.1906 -0.0159 87   LEU B CB  
3481 C CG  . LEU B 103 ? 0.6221 0.4209 0.5863 0.0097  -0.2165 -0.0189 87   LEU B CG  
3482 C CD1 . LEU B 103 ? 0.6339 0.4374 0.6224 0.0096  -0.2200 -0.0192 87   LEU B CD1 
3483 C CD2 . LEU B 103 ? 0.6676 0.4610 0.6518 0.0136  -0.2356 -0.0236 87   LEU B CD2 
3484 N N   . ILE B 104 ? 0.4977 0.2859 0.3763 -0.0016 -0.1741 -0.0085 88   ILE B N   
3485 C CA  . ILE B 104 ? 0.5035 0.2632 0.3337 -0.0064 -0.1721 -0.0068 88   ILE B CA  
3486 C C   . ILE B 104 ? 0.5875 0.3078 0.3924 -0.0073 -0.1962 -0.0095 88   ILE B C   
3487 O O   . ILE B 104 ? 0.6156 0.3250 0.4288 -0.0066 -0.2103 -0.0113 88   ILE B O   
3488 C CB  . ILE B 104 ? 0.5212 0.2820 0.3364 -0.0099 -0.1559 -0.0037 88   ILE B CB  
3489 C CG1 . ILE B 104 ? 0.4791 0.2768 0.3185 -0.0089 -0.1335 -0.0012 88   ILE B CG1 
3490 C CG2 . ILE B 104 ? 0.5380 0.2668 0.3033 -0.0150 -0.1524 -0.0022 88   ILE B CG2 
3491 C CD1 . ILE B 104 ? 0.4762 0.2787 0.3122 -0.0113 -0.1210 0.0010  88   ILE B CD1 
3492 N N   . ASP B 105 ? 0.5493 0.2463 0.3215 -0.0092 -0.2012 -0.0097 89   ASP B N   
3493 C CA  . ASP B 105 ? 0.5843 0.2383 0.3240 -0.0106 -0.2239 -0.0121 89   ASP B CA  
3494 C C   . ASP B 105 ? 0.6664 0.2884 0.3537 -0.0162 -0.2155 -0.0095 89   ASP B C   
3495 O O   . ASP B 105 ? 0.6803 0.3061 0.3497 -0.0191 -0.1976 -0.0068 89   ASP B O   
3496 C CB  . ASP B 105 ? 0.6081 0.2557 0.3460 -0.0088 -0.2353 -0.0141 89   ASP B CB  
3497 C CG  . ASP B 105 ? 0.7450 0.3465 0.4498 -0.0098 -0.2611 -0.0169 89   ASP B CG  
3498 O OD1 . ASP B 105 ? 0.7668 0.3341 0.4213 -0.0145 -0.2590 -0.0153 89   ASP B OD1 
3499 O OD2 . ASP B 105 ? 0.7759 0.3739 0.5049 -0.0060 -0.2831 -0.0209 89   ASP B OD2 
3500 N N   . ILE B 106 ? 0.6389 0.2297 0.3035 -0.0177 -0.2275 -0.0104 90   ILE B N   
3501 C CA  . ILE B 106 ? 0.6671 0.2241 0.2805 -0.0228 -0.2190 -0.0083 90   ILE B CA  
3502 C C   . ILE B 106 ? 0.7738 0.2773 0.3438 -0.0241 -0.2425 -0.0106 90   ILE B C   
3503 O O   . ILE B 106 ? 0.7658 0.2560 0.3468 -0.0212 -0.2667 -0.0137 90   ILE B O   
3504 C CB  . ILE B 106 ? 0.6915 0.2590 0.3107 -0.0238 -0.2059 -0.0065 90   ILE B CB  
3505 C CG1 . ILE B 106 ? 0.6430 0.2584 0.2964 -0.0232 -0.1806 -0.0039 90   ILE B CG1 
3506 C CG2 . ILE B 106 ? 0.7370 0.2626 0.3018 -0.0284 -0.2009 -0.0052 90   ILE B CG2 
3507 C CD1 . ILE B 106 ? 0.6426 0.2775 0.3185 -0.0224 -0.1730 -0.0030 90   ILE B CD1 
3508 N N   . ARG B 107 ? 0.7849 0.2563 0.3057 -0.0286 -0.2357 -0.0091 91   ARG B N   
3509 C CA  . ARG B 107 ? 0.8396 0.2539 0.3092 -0.0305 -0.2556 -0.0108 91   ARG B CA  
3510 C C   . ARG B 107 ? 0.9188 0.2980 0.3314 -0.0365 -0.2381 -0.0080 91   ARG B C   
3511 O O   . ARG B 107 ? 0.8895 0.2897 0.3037 -0.0393 -0.2116 -0.0050 91   ARG B O   
3512 C CB  . ARG B 107 ? 0.8690 0.2735 0.3401 -0.0287 -0.2755 -0.0133 91   ARG B CB  
3513 C CG  . ARG B 107 ? 1.0552 0.4644 0.5117 -0.0316 -0.2600 -0.0112 91   ARG B CG  
3514 C CD  . ARG B 107 ? 1.2407 0.6418 0.7018 -0.0291 -0.2812 -0.0140 91   ARG B CD  
3515 N NE  . ARG B 107 ? 1.3200 0.7720 0.8414 -0.0240 -0.2808 -0.0153 91   ARG B NE  
3516 C CZ  . ARG B 107 ? 1.4887 0.9482 1.0437 -0.0188 -0.3039 -0.0194 91   ARG B CZ  
3517 N NH1 . ARG B 107 ? 1.4191 0.8385 0.9550 -0.0180 -0.3320 -0.0228 91   ARG B NH1 
3518 N NH2 . ARG B 107 ? 1.1967 0.7020 0.8046 -0.0143 -0.2994 -0.0203 91   ARG B NH2 
3519 N N   . VAL B 108 ? 0.9386 0.2620 0.3003 -0.0383 -0.2532 -0.0092 92   VAL B N   
3520 C CA  . VAL B 108 ? 0.9878 0.2694 0.2894 -0.0440 -0.2375 -0.0070 92   VAL B CA  
3521 C C   . VAL B 108 ? 1.1074 0.3490 0.3683 -0.0463 -0.2492 -0.0077 92   VAL B C   
3522 O O   . VAL B 108 ? 1.1339 0.3474 0.3850 -0.0438 -0.2792 -0.0109 92   VAL B O   
3523 C CB  . VAL B 108 ? 1.0662 0.3080 0.3321 -0.0447 -0.2437 -0.0076 92   VAL B CB  
3524 C CG1 . VAL B 108 ? 1.1070 0.2980 0.3048 -0.0505 -0.2279 -0.0056 92   VAL B CG1 
3525 C CG2 . VAL B 108 ? 1.0243 0.3060 0.3301 -0.0427 -0.2311 -0.0067 92   VAL B CG2 
3526 N N   . GLU B 109 ? 1.0931 0.3313 0.3313 -0.0511 -0.2263 -0.0049 93   GLU B N   
3527 C CA  . GLU B 109 ? 1.1513 0.3518 0.3482 -0.0543 -0.2329 -0.0049 93   GLU B CA  
3528 C C   . GLU B 109 ? 1.2461 0.4158 0.3925 -0.0611 -0.2056 -0.0016 93   GLU B C   
3529 O O   . GLU B 109 ? 1.2146 0.4186 0.3821 -0.0634 -0.1772 0.0012  93   GLU B O   
3530 C CB  . GLU B 109 ? 1.1365 0.3780 0.3746 -0.0524 -0.2332 -0.0048 93   GLU B CB  
3531 C CG  . GLU B 109 ? 1.3347 0.5631 0.5791 -0.0484 -0.2667 -0.0086 93   GLU B CG  
3532 C CD  . GLU B 109 ? 1.6496 0.9162 0.9321 -0.0463 -0.2663 -0.0087 93   GLU B CD  
3533 O OE1 . GLU B 109 ? 1.6124 0.8712 0.8726 -0.0504 -0.2530 -0.0064 93   GLU B OE1 
3534 O OE2 . GLU B 109 ? 1.5823 0.8861 0.9170 -0.0405 -0.2789 -0.0112 93   GLU B OE2 
3535 N N   . GLU B 110 ? 1.2765 0.3798 0.3567 -0.0643 -0.2144 -0.0022 94   GLU B N   
3536 C CA  . GLU B 110 ? 1.3138 0.3755 0.3365 -0.0710 -0.1900 0.0005  94   GLU B CA  
3537 C C   . GLU B 110 ? 1.3066 0.3951 0.3445 -0.0730 -0.1571 0.0029  94   GLU B C   
3538 O O   . GLU B 110 ? 1.2734 0.3853 0.3232 -0.0767 -0.1296 0.0056  94   GLU B O   
3539 N N   . GLN B 111 ? 1.2506 0.3373 0.2916 -0.0703 -0.1614 0.0017  95   GLN B N   
3540 C CA  . GLN B 111 ? 1.2245 0.3344 0.2803 -0.0713 -0.1342 0.0033  95   GLN B CA  
3541 C C   . GLN B 111 ? 1.1673 0.3500 0.2913 -0.0699 -0.1152 0.0049  95   GLN B C   
3542 O O   . GLN B 111 ? 1.1330 0.3348 0.2679 -0.0719 -0.0883 0.0066  95   GLN B O   
3543 C CB  . GLN B 111 ? 1.2974 0.3592 0.2931 -0.0775 -0.1089 0.0051  95   GLN B CB  
3544 N N   . LYS B 112 ? 1.0817 0.3029 0.2507 -0.0663 -0.1296 0.0042  96   LYS B N   
3545 C CA  . LYS B 112 ? 1.0140 0.3003 0.2450 -0.0644 -0.1152 0.0055  96   LYS B CA  
3546 C C   . LYS B 112 ? 0.9962 0.3197 0.2774 -0.0578 -0.1361 0.0034  96   LYS B C   
3547 O O   . LYS B 112 ? 1.0146 0.3202 0.2912 -0.0549 -0.1640 0.0008  96   LYS B O   
3548 C CB  . LYS B 112 ? 1.0564 0.3573 0.2957 -0.0668 -0.1063 0.0071  96   LYS B CB  
3549 C CG  . LYS B 112 ? 1.2785 0.5476 0.4750 -0.0738 -0.0824 0.0095  96   LYS B CG  
3550 C CD  . LYS B 112 ? 1.4081 0.7039 0.6240 -0.0763 -0.0501 0.0116  96   LYS B CD  
3551 C CE  . LYS B 112 ? 1.6226 0.8803 0.7933 -0.0834 -0.0258 0.0135  96   LYS B CE  
3552 N NZ  . LYS B 112 ? 1.7901 1.0536 0.9641 -0.0869 -0.0174 0.0153  96   LYS B NZ  
3553 N N   . LEU B 113 ? 0.8695 0.2434 0.1992 -0.0556 -0.1228 0.0042  97   LEU B N   
3554 C CA  . LEU B 113 ? 0.8214 0.2330 0.2013 -0.0497 -0.1388 0.0025  97   LEU B CA  
3555 C C   . LEU B 113 ? 0.8031 0.2572 0.2234 -0.0479 -0.1344 0.0032  97   LEU B C   
3556 O O   . LEU B 113 ? 0.7801 0.2601 0.2150 -0.0498 -0.1116 0.0055  97   LEU B O   
3557 C CB  . LEU B 113 ? 0.7951 0.2329 0.2018 -0.0479 -0.1293 0.0029  97   LEU B CB  
3558 C CG  . LEU B 113 ? 0.8309 0.2959 0.2814 -0.0422 -0.1486 0.0009  97   LEU B CG  
3559 C CD1 . LEU B 113 ? 0.8780 0.3045 0.3039 -0.0411 -0.1708 -0.0013 97   LEU B CD1 
3560 C CD2 . LEU B 113 ? 0.8368 0.3499 0.3321 -0.0404 -0.1323 0.0022  97   LEU B CD2 
3561 N N   . LEU B 114 ? 0.7602 0.2179 0.1964 -0.0442 -0.1569 0.0011  98   LEU B N   
3562 C CA  . LEU B 114 ? 0.7434 0.2361 0.2150 -0.0417 -0.1571 0.0011  98   LEU B CA  
3563 C C   . LEU B 114 ? 0.7526 0.2889 0.2791 -0.0359 -0.1626 -0.0002 98   LEU B C   
3564 O O   . LEU B 114 ? 0.7444 0.2740 0.2813 -0.0327 -0.1826 -0.0028 98   LEU B O   
3565 C CB  . LEU B 114 ? 0.7859 0.2495 0.2355 -0.0415 -0.1780 -0.0008 98   LEU B CB  
3566 C CG  . LEU B 114 ? 0.9067 0.3394 0.3122 -0.0471 -0.1683 0.0012  98   LEU B CG  
3567 C CD1 . LEU B 114 ? 0.9649 0.3521 0.3176 -0.0524 -0.1595 0.0023  98   LEU B CD1 
3568 C CD2 . LEU B 114 ? 0.9959 0.4044 0.3856 -0.0462 -0.1912 -0.0010 98   LEU B CD2 
3569 N N   . VAL B 115 ? 0.6835 0.2626 0.2446 -0.0349 -0.1443 0.0017  99   VAL B N   
3570 C CA  . VAL B 115 ? 0.6484 0.2701 0.2600 -0.0299 -0.1440 0.0011  99   VAL B CA  
3571 C C   . VAL B 115 ? 0.6796 0.3297 0.3196 -0.0268 -0.1438 0.0009  99   VAL B C   
3572 O O   . VAL B 115 ? 0.6522 0.3111 0.2875 -0.0289 -0.1290 0.0031  99   VAL B O   
3573 C CB  . VAL B 115 ? 0.6777 0.3217 0.3017 -0.0312 -0.1224 0.0034  99   VAL B CB  
3574 C CG1 . VAL B 115 ? 0.6275 0.3152 0.3016 -0.0265 -0.1195 0.0032  99   VAL B CG1 
3575 C CG2 . VAL B 115 ? 0.7063 0.3216 0.3024 -0.0337 -0.1234 0.0033  99   VAL B CG2 
3576 N N   . LYS B 116 ? 0.6217 0.2846 0.2914 -0.0218 -0.1604 -0.0018 100  LYS B N   
3577 C CA  . LYS B 116 ? 0.5926 0.2820 0.2910 -0.0179 -0.1610 -0.0024 100  LYS B CA  
3578 C C   . LYS B 116 ? 0.5816 0.3083 0.3280 -0.0128 -0.1583 -0.0033 100  LYS B C   
3579 O O   . LYS B 116 ? 0.5915 0.3165 0.3525 -0.0110 -0.1690 -0.0052 100  LYS B O   
3580 C CB  . LYS B 116 ? 0.6523 0.3197 0.3411 -0.0163 -0.1832 -0.0055 100  LYS B CB  
3581 C CG  . LYS B 116 ? 0.9047 0.5330 0.5441 -0.0213 -0.1862 -0.0046 100  LYS B CG  
3582 C CD  . LYS B 116 ? 1.0252 0.6328 0.6567 -0.0194 -0.2092 -0.0077 100  LYS B CD  
3583 N N   . ALA B 117 ? 0.4786 0.2372 0.2481 -0.0108 -0.1434 -0.0017 101  ALA B N   
3584 C CA  . ALA B 117 ? 0.4443 0.2371 0.2565 -0.0060 -0.1381 -0.0022 101  ALA B CA  
3585 C C   . ALA B 117 ? 0.4948 0.3100 0.3220 -0.0031 -0.1293 -0.0015 101  ALA B C   
3586 O O   . ALA B 117 ? 0.4787 0.2986 0.2933 -0.0053 -0.1154 0.0013  101  ALA B O   
3587 C CB  . ALA B 117 ? 0.4385 0.2443 0.2573 -0.0076 -0.1234 0.0000  101  ALA B CB  
3588 N N   . GLY B 118 ? 0.4426 0.2691 0.2958 0.0020  -0.1384 -0.0042 102  GLY B N   
3589 C CA  . GLY B 118 ? 0.4278 0.2722 0.2938 0.0056  -0.1324 -0.0040 102  GLY B CA  
3590 C C   . GLY B 118 ? 0.4821 0.3087 0.3171 0.0027  -0.1346 -0.0029 102  GLY B C   
3591 O O   . GLY B 118 ? 0.4966 0.2970 0.3106 0.0008  -0.1494 -0.0045 102  GLY B O   
3592 N N   . ARG B 119 ? 0.4491 0.2873 0.2791 0.0019  -0.1197 0.0000  103  ARG B N   
3593 C CA  . ARG B 119 ? 0.4735 0.2970 0.2767 -0.0013 -0.1193 0.0015  103  ARG B CA  
3594 C C   . ARG B 119 ? 0.5251 0.3323 0.2997 -0.0081 -0.1096 0.0044  103  ARG B C   
3595 O O   . ARG B 119 ? 0.5199 0.3188 0.2760 -0.0114 -0.1041 0.0064  103  ARG B O   
3596 C CB  . ARG B 119 ? 0.4884 0.3329 0.3050 0.0021  -0.1102 0.0028  103  ARG B CB  
3597 C CG  . ARG B 119 ? 0.6125 0.4660 0.4489 0.0085  -0.1199 -0.0001 103  ARG B CG  
3598 C CD  . ARG B 119 ? 0.7847 0.6246 0.6035 0.0081  -0.1283 -0.0004 103  ARG B CD  
3599 N NE  . ARG B 119 ? 0.7716 0.6281 0.6086 0.0142  -0.1276 -0.0014 103  ARG B NE  
3600 C CZ  . ARG B 119 ? 0.9096 0.7601 0.7356 0.0149  -0.1321 -0.0012 103  ARG B CZ  
3601 N NH1 . ARG B 119 ? 0.6095 0.4381 0.4070 0.0095  -0.1370 0.0002  103  ARG B NH1 
3602 N NH2 . ARG B 119 ? 0.8747 0.7397 0.7170 0.0210  -0.1311 -0.0022 103  ARG B NH2 
3603 N N   . SER B 120 ? 0.4744 0.2782 0.2476 -0.0102 -0.1063 0.0046  104  SER B N   
3604 C CA  . SER B 120 ? 0.4805 0.2698 0.2293 -0.0161 -0.0955 0.0069  104  SER B CA  
3605 C C   . SER B 120 ? 0.5491 0.3028 0.2663 -0.0199 -0.1069 0.0057  104  SER B C   
3606 O O   . SER B 120 ? 0.5401 0.2851 0.2618 -0.0176 -0.1227 0.0031  104  SER B O   
3607 C CB  . SER B 120 ? 0.4794 0.2871 0.2452 -0.0159 -0.0833 0.0080  104  SER B CB  
3608 O OG  . SER B 120 ? 0.5644 0.4016 0.3562 -0.0125 -0.0729 0.0091  104  SER B OG  
3609 N N   . ARG B 121 ? 0.5201 0.2514 0.2052 -0.0257 -0.0987 0.0076  105  ARG B N   
3610 C CA  . ARG B 121 ? 0.5679 0.2598 0.2147 -0.0300 -0.1061 0.0070  105  ARG B CA  
3611 C C   . ARG B 121 ? 0.6088 0.2902 0.2356 -0.0354 -0.0878 0.0093  105  ARG B C   
3612 O O   . ARG B 121 ? 0.5953 0.2899 0.2271 -0.0375 -0.0710 0.0116  105  ARG B O   
3613 C CB  . ARG B 121 ? 0.6115 0.2777 0.2318 -0.0319 -0.1162 0.0066  105  ARG B CB  
3614 C CG  . ARG B 121 ? 0.8252 0.4914 0.4582 -0.0270 -0.1383 0.0034  105  ARG B CG  
3615 C CD  . ARG B 121 ? 1.0784 0.7244 0.6891 -0.0285 -0.1466 0.0033  105  ARG B CD  
3616 N NE  . ARG B 121 ? 1.3397 0.9402 0.9034 -0.0339 -0.1526 0.0033  105  ARG B NE  
3617 C CZ  . ARG B 121 ? 1.5862 1.1563 1.1303 -0.0332 -0.1747 0.0005  105  ARG B CZ  
3618 N NH1 . ARG B 121 ? 1.3742 0.9567 0.9458 -0.0273 -0.1931 -0.0029 105  ARG B NH1 
3619 N NH2 . ARG B 121 ? 1.5160 1.0413 1.0127 -0.0384 -0.1786 0.0009  105  ARG B NH2 
3620 N N   . PHE B 122 ? 0.5762 0.2329 0.1811 -0.0374 -0.0915 0.0086  106  PHE B N   
3621 C CA  . PHE B 122 ? 0.5748 0.2175 0.1581 -0.0423 -0.0744 0.0103  106  PHE B CA  
3622 C C   . PHE B 122 ? 0.6742 0.2686 0.2107 -0.0459 -0.0830 0.0094  106  PHE B C   
3623 O O   . PHE B 122 ? 0.6851 0.2635 0.2153 -0.0435 -0.1034 0.0071  106  PHE B O   
3624 C CB  . PHE B 122 ? 0.5561 0.2221 0.1641 -0.0403 -0.0668 0.0103  106  PHE B CB  
3625 C CG  . PHE B 122 ? 0.5188 0.2290 0.1705 -0.0363 -0.0598 0.0110  106  PHE B CG  
3626 C CD1 . PHE B 122 ? 0.5298 0.2610 0.2110 -0.0308 -0.0726 0.0095  106  PHE B CD1 
3627 C CD2 . PHE B 122 ? 0.5211 0.2499 0.1842 -0.0380 -0.0404 0.0131  106  PHE B CD2 
3628 C CE1 . PHE B 122 ? 0.5009 0.2687 0.2178 -0.0271 -0.0652 0.0102  106  PHE B CE1 
3629 C CE2 . PHE B 122 ? 0.5138 0.2790 0.2131 -0.0342 -0.0354 0.0137  106  PHE B CE2 
3630 C CZ  . PHE B 122 ? 0.4720 0.2554 0.1958 -0.0288 -0.0474 0.0123  106  PHE B CZ  
3631 N N   . THR B 123 ? 0.6533 0.2232 0.1573 -0.0516 -0.0676 0.0111  107  THR B N   
3632 C CA  . THR B 123 ? 0.6911 0.2106 0.1442 -0.0556 -0.0712 0.0106  107  THR B CA  
3633 C C   . THR B 123 ? 0.7526 0.2670 0.1955 -0.0588 -0.0506 0.0117  107  THR B C   
3634 O O   . THR B 123 ? 0.7381 0.2659 0.1888 -0.0618 -0.0287 0.0136  107  THR B O   
3635 C CB  . THR B 123 ? 0.7978 0.2875 0.2171 -0.0600 -0.0705 0.0116  107  THR B CB  
3636 O OG1 . THR B 123 ? 0.7968 0.2966 0.2313 -0.0564 -0.0894 0.0103  107  THR B OG1 
3637 C CG2 . THR B 123 ? 0.8598 0.2921 0.2213 -0.0640 -0.0753 0.0110  107  THR B CG2 
3638 N N   . LEU B 124 ? 0.7334 0.2305 0.1629 -0.0577 -0.0582 0.0103  108  LEU B N   
3639 C CA  . LEU B 124 ? 0.7327 0.2230 0.1515 -0.0599 -0.0408 0.0109  108  LEU B CA  
3640 C C   . LEU B 124 ? 0.8287 0.2620 0.1885 -0.0641 -0.0401 0.0106  108  LEU B C   
3641 O O   . LEU B 124 ? 0.8176 0.2166 0.1480 -0.0635 -0.0613 0.0092  108  LEU B O   
3642 C CB  . LEU B 124 ? 0.7147 0.2291 0.1633 -0.0554 -0.0480 0.0098  108  LEU B CB  
3643 C CG  . LEU B 124 ? 0.7212 0.2905 0.2262 -0.0514 -0.0452 0.0102  108  LEU B CG  
3644 C CD1 . LEU B 124 ? 0.7231 0.3089 0.2512 -0.0476 -0.0528 0.0092  108  LEU B CD1 
3645 C CD2 . LEU B 124 ? 0.7548 0.3479 0.2764 -0.0537 -0.0202 0.0122  108  LEU B CD2 
3646 N N   . SER B 125 ? 0.8425 0.2639 0.1846 -0.0682 -0.0158 0.0117  109  SER B N   
3647 C CA  . SER B 125 ? 0.9111 0.2760 0.1943 -0.0722 -0.0113 0.0115  109  SER B CA  
3648 C C   . SER B 125 ? 0.9556 0.3061 0.2291 -0.0688 -0.0263 0.0096  109  SER B C   
3649 O O   . SER B 125 ? 0.8948 0.2833 0.2099 -0.0649 -0.0295 0.0091  109  SER B O   
3650 C CB  . SER B 125 ? 0.9910 0.3502 0.2632 -0.0773 0.0211  0.0130  109  SER B CB  
3651 O OG  . SER B 125 ? 1.1468 0.5280 0.4413 -0.0759 0.0339  0.0126  109  SER B OG  
3652 N N   . THR B 126 ? 0.9591 0.2535 0.1779 -0.0702 -0.0377 0.0086  110  THR B N   
3653 C CA  . THR B 126 ? 0.9591 0.2347 0.1656 -0.0670 -0.0548 0.0067  110  THR B CA  
3654 C C   . THR B 126 ? 1.0537 0.2760 0.2022 -0.0704 -0.0425 0.0067  110  THR B C   
3655 O O   . THR B 126 ? 1.0777 0.2689 0.1882 -0.0755 -0.0249 0.0078  110  THR B O   
3656 C CB  . THR B 126 ? 1.0322 0.2888 0.2315 -0.0635 -0.0904 0.0047  110  THR B CB  
3657 O OG1 . THR B 126 ? 1.1375 0.3342 0.2758 -0.0667 -0.0984 0.0043  110  THR B OG1 
3658 C CG2 . THR B 126 ? 0.9670 0.2711 0.2200 -0.0599 -0.1030 0.0044  110  THR B CG2 
3659 N N   . LEU B 127 ? 1.0259 0.2356 0.1664 -0.0677 -0.0522 0.0053  111  LEU B N   
3660 C CA  . LEU B 127 ? 1.0886 0.2410 0.1689 -0.0698 -0.0463 0.0047  111  LEU B CA  
3661 C C   . LEU B 127 ? 1.1721 0.2926 0.2320 -0.0658 -0.0806 0.0026  111  LEU B C   
3662 O O   . LEU B 127 ? 1.1248 0.2820 0.2315 -0.0613 -0.0991 0.0017  111  LEU B O   
3663 C CB  . LEU B 127 ? 1.0814 0.2501 0.1723 -0.0706 -0.0189 0.0052  111  LEU B CB  
3664 C CG  . LEU B 127 ? 1.1164 0.3124 0.2269 -0.0748 0.0156  0.0070  111  LEU B CG  
3665 C CD1 . LEU B 127 ? 1.0950 0.3206 0.2338 -0.0740 0.0364  0.0068  111  LEU B CD1 
3666 C CD2 . LEU B 127 ? 1.1723 0.3168 0.2258 -0.0806 0.0331  0.0078  111  LEU B CD2 
3667 N N   . PRO B 128 ? 1.2124 0.2636 0.2039 -0.0673 -0.0906 0.0016  112  PRO B N   
3668 C CA  . PRO B 128 ? 1.2350 0.2531 0.2077 -0.0633 -0.1266 -0.0007 112  PRO B CA  
3669 C C   . PRO B 128 ? 1.2492 0.2881 0.2511 -0.0590 -0.1356 -0.0017 112  PRO B C   
3670 O O   . PRO B 128 ? 1.2318 0.2799 0.2347 -0.0598 -0.1129 -0.0009 112  PRO B O   
3671 C CB  . PRO B 128 ? 1.3404 0.2770 0.2278 -0.0664 -0.1277 -0.0011 112  PRO B CB  
3672 C CG  . PRO B 128 ? 1.4127 0.3436 0.2810 -0.0721 -0.1000 0.0009  112  PRO B CG  
3673 C CD  . PRO B 128 ? 1.2919 0.2894 0.2193 -0.0728 -0.0704 0.0026  112  PRO B CD  
3674 N N   . ALA B 129 ? 1.2011 0.2451 0.2261 -0.0545 -0.1694 -0.0036 113  ALA B N   
3675 C CA  . ALA B 129 ? 1.1903 0.2510 0.2441 -0.0502 -0.1834 -0.0046 113  ALA B CA  
3676 C C   . ALA B 129 ? 1.3189 0.3220 0.3145 -0.0503 -0.1855 -0.0054 113  ALA B C   
3677 O O   . ALA B 129 ? 1.2711 0.2897 0.2860 -0.0480 -0.1852 -0.0056 113  ALA B O   
3678 C CB  . ALA B 129 ? 1.1889 0.2600 0.2763 -0.0459 -0.2198 -0.0067 113  ALA B CB  
3679 N N   . ASN B 130 ? 1.3759 0.3111 0.2984 -0.0530 -0.1869 -0.0058 114  ASN B N   
3680 C CA  . ASN B 130 ? 1.4521 0.3242 0.3096 -0.0532 -0.1875 -0.0066 114  ASN B CA  
3681 C C   . ASN B 130 ? 1.5093 0.3934 0.3619 -0.0555 -0.1495 -0.0051 114  ASN B C   
3682 O O   . ASN B 130 ? 1.5404 0.3934 0.3627 -0.0541 -0.1501 -0.0059 114  ASN B O   
3683 C CB  . ASN B 130 ? 1.5827 0.3758 0.3603 -0.0556 -0.1986 -0.0073 114  ASN B CB  
3684 C CG  . ASN B 130 ? 2.0418 0.8350 0.8075 -0.0603 -0.1809 -0.0059 114  ASN B CG  
3685 O OD1 . ASN B 130 ? 2.0390 0.8208 0.7765 -0.0648 -0.1469 -0.0041 114  ASN B OD1 
3686 N ND2 . ASN B 130 ? 1.9519 0.7562 0.7388 -0.0593 -0.2038 -0.0066 114  ASN B ND2 
3687 N N   . ASP B 131 ? 1.4330 0.3628 0.3182 -0.0587 -0.1178 -0.0032 115  ASP B N   
3688 C CA  . ASP B 131 ? 1.4225 0.3717 0.3140 -0.0609 -0.0806 -0.0021 115  ASP B CA  
3689 C C   . ASP B 131 ? 1.4008 0.4060 0.3530 -0.0572 -0.0809 -0.0022 115  ASP B C   
3690 O O   . ASP B 131 ? 1.3992 0.4125 0.3523 -0.0578 -0.0571 -0.0020 115  ASP B O   
3691 C CB  . ASP B 131 ? 1.4208 0.4043 0.3358 -0.0653 -0.0512 -0.0002 115  ASP B CB  
3692 C CG  . ASP B 131 ? 1.6146 0.5528 0.4786 -0.0698 -0.0450 0.0004  115  ASP B CG  
3693 O OD1 . ASP B 131 ? 1.6899 0.5639 0.4932 -0.0698 -0.0641 -0.0006 115  ASP B OD1 
3694 O OD2 . ASP B 131 ? 1.6242 0.5899 0.5086 -0.0735 -0.0215 0.0020  115  ASP B OD2 
3695 N N   . PHE B 132 ? 1.2903 0.3343 0.2940 -0.0536 -0.1066 -0.0026 116  PHE B N   
3696 C CA  . PHE B 132 ? 1.2261 0.3255 0.2909 -0.0503 -0.1084 -0.0025 116  PHE B CA  
3697 C C   . PHE B 132 ? 1.3320 0.4039 0.3781 -0.0471 -0.1242 -0.0038 116  PHE B C   
3698 O O   . PHE B 132 ? 1.3775 0.4057 0.3926 -0.0452 -0.1536 -0.0052 116  PHE B O   
3699 C CB  . PHE B 132 ? 1.1789 0.3280 0.3048 -0.0478 -0.1272 -0.0024 116  PHE B CB  
3700 C CG  . PHE B 132 ? 1.1153 0.3320 0.3089 -0.0461 -0.1163 -0.0014 116  PHE B CG  
3701 C CD1 . PHE B 132 ? 1.1252 0.3577 0.3468 -0.0425 -0.1320 -0.0020 116  PHE B CD1 
3702 C CD2 . PHE B 132 ? 1.0806 0.3434 0.3091 -0.0481 -0.0911 0.0002  116  PHE B CD2 
3703 C CE1 . PHE B 132 ? 1.0708 0.3629 0.3518 -0.0412 -0.1214 -0.0010 116  PHE B CE1 
3704 C CE2 . PHE B 132 ? 1.0551 0.3764 0.3423 -0.0464 -0.0821 0.0010  116  PHE B CE2 
3705 C CZ  . PHE B 132 ? 1.0140 0.3491 0.3259 -0.0431 -0.0968 0.0005  116  PHE B CZ  
3706 N N   . PRO B 133 ? 1.2911 0.3865 0.3556 -0.0465 -0.1065 -0.0035 117  PRO B N   
3707 C CA  . PRO B 133 ? 1.3613 0.4287 0.4059 -0.0435 -0.1213 -0.0046 117  PRO B CA  
3708 C C   . PRO B 133 ? 1.6819 0.7684 0.7663 -0.0393 -0.1553 -0.0053 117  PRO B C   
3709 O O   . PRO B 133 ? 1.1869 0.3294 0.3332 -0.0383 -0.1587 -0.0046 117  PRO B O   
3710 C CB  . PRO B 133 ? 1.3535 0.4497 0.4160 -0.0441 -0.0916 -0.0041 117  PRO B CB  
3711 C CG  . PRO B 133 ? 1.3676 0.4962 0.4493 -0.0477 -0.0607 -0.0029 117  PRO B CG  
3712 C CD  . PRO B 133 ? 1.2791 0.4246 0.3816 -0.0484 -0.0734 -0.0022 117  PRO B CD  
3713 N N   . GLY B 138 ? 1.6328 0.6464 0.7923 -0.0108 -0.3365 -0.0101 122  GLY B N   
3714 C CA  . GLY B 138 ? 1.6730 0.6430 0.8098 -0.0075 -0.3659 -0.0111 122  GLY B CA  
3715 C C   . GLY B 138 ? 1.6826 0.6911 0.8886 -0.0059 -0.3890 -0.0105 122  GLY B C   
3716 O O   . GLY B 138 ? 1.6153 0.6871 0.8880 -0.0074 -0.3794 -0.0091 122  GLY B O   
3717 N N   . PRO B 139 ? 1.6715 0.6416 0.8631 -0.0028 -0.4195 -0.0114 123  PRO B N   
3718 C CA  . PRO B 139 ? 1.6299 0.6355 0.8900 -0.0015 -0.4419 -0.0108 123  PRO B CA  
3719 C C   . PRO B 139 ? 1.6114 0.6780 0.9215 -0.0029 -0.4171 -0.0083 123  PRO B C   
3720 O O   . PRO B 139 ? 1.6106 0.6738 0.8905 -0.0034 -0.3926 -0.0077 123  PRO B O   
3721 C CB  . PRO B 139 ? 1.7142 0.6559 0.9349 0.0020  -0.4779 -0.0124 123  PRO B CB  
3722 C CG  . PRO B 139 ? 1.8426 0.7128 0.9760 0.0027  -0.4799 -0.0143 123  PRO B CG  
3723 C CD  . PRO B 139 ? 1.7690 0.6599 0.8815 -0.0004 -0.4356 -0.0132 123  PRO B CD  
3724 N N   . GLY B 140 ? 1.5060 0.6267 0.8921 -0.0035 -0.4234 -0.0071 124  GLY B N   
3725 C CA  . GLY B 140 ? 1.4392 0.6196 0.8788 -0.0050 -0.4028 -0.0047 124  GLY B CA  
3726 C C   . GLY B 140 ? 1.4837 0.6544 0.9320 -0.0033 -0.4195 -0.0041 124  GLY B C   
3727 O O   . GLY B 140 ? 1.5005 0.6533 0.9673 -0.0014 -0.4532 -0.0049 124  GLY B O   
3728 N N   . SER B 141 ? 1.4097 0.5913 0.8453 -0.0038 -0.3967 -0.0030 125  SER B N   
3729 C CA  . SER B 141 ? 1.4046 0.5801 0.8463 -0.0023 -0.4078 -0.0022 125  SER B CA  
3730 C C   . SER B 141 ? 1.3588 0.5909 0.8817 -0.0036 -0.4129 -0.0001 125  SER B C   
3731 O O   . SER B 141 ? 1.3600 0.5829 0.9020 -0.0023 -0.4369 0.0003  125  SER B O   
3732 C CB  . SER B 141 ? 1.4588 0.6334 0.8658 -0.0026 -0.3787 -0.0019 125  SER B CB  
3733 O OG  . SER B 141 ? 1.6492 0.7674 0.9797 -0.0014 -0.3732 -0.0040 125  SER B OG  
3734 N N   . LEU B 142 ? 1.2280 0.5167 0.7976 -0.0063 -0.3899 0.0014  126  LEU B N   
3735 C CA  . LEU B 142 ? 1.1562 0.5005 0.8017 -0.0080 -0.3891 0.0036  126  LEU B CA  
3736 C C   . LEU B 142 ? 1.1293 0.5125 0.8150 -0.0097 -0.3786 0.0039  126  LEU B C   
3737 O O   . LEU B 142 ? 1.1158 0.5066 0.7798 -0.0108 -0.3558 0.0036  126  LEU B O   
3738 C CB  . LEU B 142 ? 1.1230 0.5016 0.7831 -0.0095 -0.3645 0.0058  126  LEU B CB  
3739 C CG  . LEU B 142 ? 1.1354 0.5653 0.8674 -0.0113 -0.3634 0.0084  126  LEU B CG  
3740 C CD1 . LEU B 142 ? 1.1578 0.5694 0.9041 -0.0101 -0.3912 0.0088  126  LEU B CD1 
3741 C CD2 . LEU B 142 ? 1.1245 0.5960 0.8693 -0.0134 -0.3305 0.0103  126  LEU B CD2 
3742 N N   . ASN B 143 ? 1.0324 0.4402 0.7784 -0.0100 -0.3951 0.0044  127  ASN B N   
3743 C CA  . ASN B 143 ? 0.9823 0.4276 0.7728 -0.0112 -0.3874 0.0045  127  ASN B CA  
3744 C C   . ASN B 143 ? 0.9555 0.4542 0.8185 -0.0130 -0.3801 0.0069  127  ASN B C   
3745 O O   . ASN B 143 ? 0.9510 0.4474 0.8443 -0.0127 -0.3998 0.0074  127  ASN B O   
3746 C CB  . ASN B 143 ? 1.0352 0.4500 0.8252 -0.0093 -0.4173 0.0018  127  ASN B CB  
3747 C CG  . ASN B 143 ? 1.4248 0.7751 1.1421 -0.0072 -0.4339 -0.0007 127  ASN B CG  
3748 O OD1 . ASN B 143 ? 1.4511 0.7599 1.1559 -0.0050 -0.4663 -0.0023 127  ASN B OD1 
3749 N ND2 . ASN B 143 ? 1.3426 0.6809 1.0099 -0.0079 -0.4123 -0.0010 127  ASN B ND2 
3750 N N   . PHE B 144 ? 0.8436 0.3881 0.7334 -0.0150 -0.3519 0.0084  128  PHE B N   
3751 C CA  . PHE B 144 ? 0.7816 0.3760 0.7363 -0.0170 -0.3409 0.0109  128  PHE B CA  
3752 C C   . PHE B 144 ? 0.8156 0.4484 0.7976 -0.0181 -0.3194 0.0113  128  PHE B C   
3753 O O   . PHE B 144 ? 0.8115 0.4369 0.7592 -0.0178 -0.3080 0.0102  128  PHE B O   
3754 C CB  . PHE B 144 ? 0.7723 0.3829 0.7266 -0.0185 -0.3249 0.0134  128  PHE B CB  
3755 C CG  . PHE B 144 ? 0.7604 0.3821 0.6805 -0.0194 -0.2947 0.0141  128  PHE B CG  
3756 C CD1 . PHE B 144 ? 0.8140 0.4002 0.6737 -0.0182 -0.2928 0.0127  128  PHE B CD1 
3757 C CD2 . PHE B 144 ? 0.7268 0.3935 0.6763 -0.0213 -0.2683 0.0159  128  PHE B CD2 
3758 C CE1 . PHE B 144 ? 0.8029 0.4004 0.6364 -0.0191 -0.2649 0.0131  128  PHE B CE1 
3759 C CE2 . PHE B 144 ? 0.7395 0.4159 0.6606 -0.0220 -0.2424 0.0163  128  PHE B CE2 
3760 C CZ  . PHE B 144 ? 0.7419 0.3850 0.6077 -0.0210 -0.2408 0.0148  128  PHE B CZ  
3761 N N   . SER B 145 ? 0.7525 0.4256 0.7955 -0.0195 -0.3128 0.0130  129  SER B N   
3762 C CA  . SER B 145 ? 0.7179 0.4287 0.7903 -0.0204 -0.2916 0.0136  129  SER B CA  
3763 C C   . SER B 145 ? 0.7087 0.4583 0.8045 -0.0228 -0.2653 0.0169  129  SER B C   
3764 O O   . SER B 145 ? 0.6886 0.4473 0.8117 -0.0240 -0.2689 0.0186  129  SER B O   
3765 C CB  . SER B 145 ? 0.7694 0.4901 0.8927 -0.0197 -0.3069 0.0123  129  SER B CB  
3766 O OG  . SER B 145 ? 0.8749 0.6294 1.0228 -0.0202 -0.2859 0.0127  129  SER B OG  
3767 N N   . ILE B 146 ? 0.6310 0.4014 0.7149 -0.0234 -0.2397 0.0176  130  ILE B N   
3768 C CA  . ILE B 146 ? 0.5855 0.3896 0.6857 -0.0254 -0.2145 0.0204  130  ILE B CA  
3769 C C   . ILE B 146 ? 0.6005 0.4350 0.7216 -0.0257 -0.1947 0.0208  130  ILE B C   
3770 O O   . ILE B 146 ? 0.5937 0.4208 0.6998 -0.0243 -0.1958 0.0189  130  ILE B O   
3771 C CB  . ILE B 146 ? 0.6333 0.4255 0.6871 -0.0258 -0.2033 0.0208  130  ILE B CB  
3772 C CG1 . ILE B 146 ? 0.6128 0.4349 0.6847 -0.0278 -0.1829 0.0236  130  ILE B CG1 
3773 C CG2 . ILE B 146 ? 0.6554 0.4337 0.6633 -0.0248 -0.1934 0.0190  130  ILE B CG2 
3774 C CD1 . ILE B 146 ? 0.6395 0.4487 0.6788 -0.0281 -0.1791 0.0240  130  ILE B CD1 
3775 N N   . ALA B 147 ? 0.5360 0.4029 0.6899 -0.0274 -0.1768 0.0234  131  ALA B N   
3776 C CA  . ALA B 147 ? 0.5083 0.4025 0.6774 -0.0275 -0.1561 0.0241  131  ALA B CA  
3777 C C   . ALA B 147 ? 0.5460 0.4357 0.6696 -0.0271 -0.1414 0.0237  131  ALA B C   
3778 O O   . ALA B 147 ? 0.5237 0.4040 0.6197 -0.0278 -0.1380 0.0242  131  ALA B O   
3779 C CB  . ALA B 147 ? 0.4924 0.4158 0.6983 -0.0295 -0.1401 0.0271  131  ALA B CB  
3780 N N   . GLN B 148 ? 0.5064 0.4001 0.6219 -0.0260 -0.1345 0.0224  132  GLN B N   
3781 C CA  . GLN B 148 ? 0.4981 0.3877 0.5746 -0.0257 -0.1211 0.0218  132  GLN B CA  
3782 C C   . GLN B 148 ? 0.5315 0.4401 0.6054 -0.0270 -0.1006 0.0239  132  GLN B C   
3783 O O   . GLN B 148 ? 0.5218 0.4206 0.5627 -0.0272 -0.0941 0.0234  132  GLN B O   
3784 C CB  . GLN B 148 ? 0.5041 0.4006 0.5824 -0.0244 -0.1162 0.0207  132  GLN B CB  
3785 C CG  . GLN B 148 ? 0.5620 0.4329 0.6279 -0.0230 -0.1363 0.0180  132  GLN B CG  
3786 C CD  . GLN B 148 ? 0.6684 0.5465 0.7370 -0.0217 -0.1317 0.0169  132  GLN B CD  
3787 O OE1 . GLN B 148 ? 0.5472 0.4390 0.6054 -0.0218 -0.1137 0.0176  132  GLN B OE1 
3788 N NE2 . GLN B 148 ? 0.5679 0.4351 0.6498 -0.0203 -0.1495 0.0149  132  GLN B NE2 
3789 N N   . SER B 149 ? 0.4738 0.4078 0.5831 -0.0278 -0.0905 0.0260  133  SER B N   
3790 C CA  . SER B 149 ? 0.4539 0.4065 0.5667 -0.0291 -0.0724 0.0282  133  SER B CA  
3791 C C   . SER B 149 ? 0.4756 0.4176 0.5715 -0.0302 -0.0755 0.0287  133  SER B C   
3792 O O   . SER B 149 ? 0.4527 0.3997 0.5318 -0.0307 -0.0626 0.0291  133  SER B O   
3793 C CB  . SER B 149 ? 0.5023 0.4766 0.6574 -0.0300 -0.0659 0.0304  133  SER B CB  
3794 O OG  . SER B 149 ? 0.6637 0.6542 0.8198 -0.0310 -0.0475 0.0325  133  SER B OG  
3795 N N   . LYS B 150 ? 0.4370 0.3638 0.5388 -0.0305 -0.0933 0.0285  134  LYS B N   
3796 C CA  . LYS B 150 ? 0.4433 0.3574 0.5312 -0.0313 -0.0996 0.0288  134  LYS B CA  
3797 C C   . LYS B 150 ? 0.4897 0.3801 0.5322 -0.0302 -0.1016 0.0266  134  LYS B C   
3798 O O   . LYS B 150 ? 0.4702 0.3594 0.4949 -0.0307 -0.0935 0.0267  134  LYS B O   
3799 C CB  . LYS B 150 ? 0.4822 0.3866 0.5933 -0.0318 -0.1195 0.0293  134  LYS B CB  
3800 C CG  . LYS B 150 ? 0.6390 0.5673 0.7963 -0.0337 -0.1143 0.0320  134  LYS B CG  
3801 C CD  . LYS B 150 ? 0.7676 0.6877 0.9551 -0.0340 -0.1348 0.0321  134  LYS B CD  
3802 C CE  . LYS B 150 ? 0.9214 0.8360 1.1131 -0.0357 -0.1418 0.0338  134  LYS B CE  
3803 N NZ  . LYS B 150 ? 1.0080 0.9142 1.2319 -0.0360 -0.1631 0.0339  134  LYS B NZ  
3804 N N   . LEU B 151 ? 0.4498 0.3198 0.4731 -0.0288 -0.1121 0.0244  135  LEU B N   
3805 C CA  . LEU B 151 ? 0.4605 0.3050 0.4384 -0.0279 -0.1122 0.0222  135  LEU B CA  
3806 C C   . LEU B 151 ? 0.4576 0.3156 0.4212 -0.0281 -0.0905 0.0219  135  LEU B C   
3807 O O   . LEU B 151 ? 0.4419 0.2904 0.3792 -0.0281 -0.0831 0.0209  135  LEU B O   
3808 C CB  . LEU B 151 ? 0.4859 0.3028 0.4444 -0.0266 -0.1283 0.0201  135  LEU B CB  
3809 C CG  . LEU B 151 ? 0.5742 0.3598 0.4820 -0.0258 -0.1275 0.0178  135  LEU B CG  
3810 C CD1 . LEU B 151 ? 0.5925 0.3567 0.4774 -0.0257 -0.1331 0.0174  135  LEU B CD1 
3811 C CD2 . LEU B 151 ? 0.6156 0.3745 0.5054 -0.0247 -0.1429 0.0160  135  LEU B CD2 
3812 N N   . ARG B 152 ? 0.4001 0.2803 0.3828 -0.0281 -0.0803 0.0226  136  ARG B N   
3813 C CA  . ARG B 152 ? 0.3804 0.2743 0.3536 -0.0282 -0.0612 0.0224  136  ARG B CA  
3814 C C   . ARG B 152 ? 0.4020 0.3096 0.3804 -0.0291 -0.0501 0.0236  136  ARG B C   
3815 O O   . ARG B 152 ? 0.3838 0.2906 0.3434 -0.0290 -0.0389 0.0225  136  ARG B O   
3816 C CB  . ARG B 152 ? 0.3558 0.2699 0.3497 -0.0278 -0.0539 0.0232  136  ARG B CB  
3817 C CG  . ARG B 152 ? 0.4670 0.3864 0.4436 -0.0275 -0.0388 0.0223  136  ARG B CG  
3818 C CD  . ARG B 152 ? 0.4257 0.3667 0.4223 -0.0269 -0.0296 0.0234  136  ARG B CD  
3819 N NE  . ARG B 152 ? 0.4389 0.3845 0.4198 -0.0267 -0.0160 0.0226  136  ARG B NE  
3820 C CZ  . ARG B 152 ? 0.6224 0.5694 0.5973 -0.0259 -0.0118 0.0219  136  ARG B CZ  
3821 N NH1 . ARG B 152 ? 0.5161 0.4603 0.4983 -0.0251 -0.0201 0.0217  136  ARG B NH1 
3822 N NH2 . ARG B 152 ? 0.4519 0.4026 0.4148 -0.0259 -0.0001 0.0212  136  ARG B NH2 
3823 N N   . ARG B 153 ? 0.3682 0.2875 0.3733 -0.0300 -0.0536 0.0257  137  ARG B N   
3824 C CA  . ARG B 153 ? 0.3509 0.2817 0.3620 -0.0311 -0.0452 0.0270  137  ARG B CA  
3825 C C   . ARG B 153 ? 0.3841 0.2956 0.3671 -0.0308 -0.0481 0.0253  137  ARG B C   
3826 O O   . ARG B 153 ? 0.3639 0.2802 0.3364 -0.0308 -0.0367 0.0245  137  ARG B O   
3827 C CB  . ARG B 153 ? 0.3658 0.3083 0.4097 -0.0325 -0.0502 0.0297  137  ARG B CB  
3828 C CG  . ARG B 153 ? 0.4910 0.4475 0.5429 -0.0338 -0.0395 0.0315  137  ARG B CG  
3829 C CD  . ARG B 153 ? 0.6853 0.6396 0.7532 -0.0354 -0.0489 0.0333  137  ARG B CD  
3830 N NE  . ARG B 153 ? 0.8315 0.7999 0.9096 -0.0369 -0.0383 0.0354  137  ARG B NE  
3831 C CZ  . ARG B 153 ? 1.0792 1.0452 1.1623 -0.0384 -0.0429 0.0366  137  ARG B CZ  
3832 N NH1 . ARG B 153 ? 0.9197 0.8697 0.9989 -0.0383 -0.0584 0.0361  137  ARG B NH1 
3833 N NH2 . ARG B 153 ? 0.9473 0.9250 1.0378 -0.0399 -0.0329 0.0385  137  ARG B NH2 
3834 N N   . LEU B 154 ? 0.3682 0.2564 0.3381 -0.0303 -0.0634 0.0243  138  LEU B N   
3835 C CA  . LEU B 154 ? 0.3738 0.2396 0.3141 -0.0297 -0.0667 0.0225  138  LEU B CA  
3836 C C   . LEU B 154 ? 0.3891 0.2471 0.3002 -0.0290 -0.0537 0.0199  138  LEU B C   
3837 O O   . LEU B 154 ? 0.3523 0.2075 0.2502 -0.0288 -0.0457 0.0187  138  LEU B O   
3838 C CB  . LEU B 154 ? 0.4000 0.2375 0.3271 -0.0290 -0.0866 0.0218  138  LEU B CB  
3839 C CG  . LEU B 154 ? 0.4668 0.3072 0.4217 -0.0297 -0.1018 0.0239  138  LEU B CG  
3840 C CD1 . LEU B 154 ? 0.4946 0.3046 0.4351 -0.0286 -0.1230 0.0227  138  LEU B CD1 
3841 C CD2 . LEU B 154 ? 0.4928 0.3395 0.4535 -0.0306 -0.0993 0.0251  138  LEU B CD2 
3842 N N   . ILE B 155 ? 0.3464 0.2017 0.2499 -0.0286 -0.0510 0.0191  139  ILE B N   
3843 C CA  . ILE B 155 ? 0.3430 0.1911 0.2218 -0.0282 -0.0382 0.0168  139  ILE B CA  
3844 C C   . ILE B 155 ? 0.3635 0.2375 0.2573 -0.0286 -0.0216 0.0171  139  ILE B C   
3845 O O   . ILE B 155 ? 0.3415 0.2125 0.2222 -0.0284 -0.0113 0.0152  139  ILE B O   
3846 C CB  . ILE B 155 ? 0.3820 0.2176 0.2472 -0.0279 -0.0412 0.0160  139  ILE B CB  
3847 C CG1 . ILE B 155 ? 0.4256 0.2315 0.2740 -0.0273 -0.0604 0.0155  139  ILE B CG1 
3848 C CG2 . ILE B 155 ? 0.3773 0.2046 0.2173 -0.0279 -0.0264 0.0137  139  ILE B CG2 
3849 C CD1 . ILE B 155 ? 0.4903 0.2895 0.3389 -0.0270 -0.0693 0.0154  139  ILE B CD1 
3850 N N   . ASP B 156 ? 0.3110 0.2085 0.2315 -0.0289 -0.0189 0.0191  140  ASP B N   
3851 C CA  . ASP B 156 ? 0.2925 0.2117 0.2254 -0.0290 -0.0049 0.0194  140  ASP B CA  
3852 C C   . ASP B 156 ? 0.3197 0.2467 0.2592 -0.0294 -0.0008 0.0197  140  ASP B C   
3853 O O   . ASP B 156 ? 0.3022 0.2379 0.2414 -0.0291 0.0100  0.0185  140  ASP B O   
3854 C CB  . ASP B 156 ? 0.2948 0.2337 0.2518 -0.0290 -0.0032 0.0217  140  ASP B CB  
3855 C CG  . ASP B 156 ? 0.3445 0.2803 0.2962 -0.0284 -0.0035 0.0211  140  ASP B CG  
3856 O OD1 . ASP B 156 ? 0.3559 0.2754 0.2838 -0.0282 -0.0023 0.0190  140  ASP B OD1 
3857 O OD2 . ASP B 156 ? 0.3599 0.3089 0.3305 -0.0281 -0.0037 0.0227  140  ASP B OD2 
3858 N N   . ARG B 157 ? 0.2914 0.2146 0.2374 -0.0299 -0.0102 0.0209  141  ARG B N   
3859 C CA  . ARG B 157 ? 0.2925 0.2220 0.2439 -0.0304 -0.0073 0.0212  141  ARG B CA  
3860 C C   . ARG B 157 ? 0.3494 0.2627 0.2772 -0.0295 -0.0045 0.0180  141  ARG B C   
3861 O O   . ARG B 157 ? 0.3198 0.2379 0.2506 -0.0296 -0.0011 0.0175  141  ARG B O   
3862 C CB  . ARG B 157 ? 0.3390 0.2701 0.3070 -0.0315 -0.0181 0.0238  141  ARG B CB  
3863 C CG  . ARG B 157 ? 0.4827 0.4326 0.4789 -0.0326 -0.0170 0.0270  141  ARG B CG  
3864 C CD  . ARG B 157 ? 0.6014 0.5689 0.6072 -0.0330 -0.0045 0.0279  141  ARG B CD  
3865 N NE  . ARG B 157 ? 0.7442 0.7260 0.7730 -0.0339 -0.0019 0.0308  141  ARG B NE  
3866 C CZ  . ARG B 157 ? 0.8691 0.8581 0.9167 -0.0356 -0.0026 0.0336  141  ARG B CZ  
3867 N NH1 . ARG B 157 ? 0.6750 0.6592 0.7215 -0.0366 -0.0073 0.0340  141  ARG B NH1 
3868 N NH2 . ARG B 157 ? 0.6440 0.6445 0.7117 -0.0363 0.0021  0.0360  141  ARG B NH2 
3869 N N   . THR B 158 ? 0.3148 0.2076 0.2184 -0.0287 -0.0056 0.0158  142  THR B N   
3870 C CA  . THR B 158 ? 0.3141 0.1879 0.1933 -0.0278 -0.0019 0.0127  142  THR B CA  
3871 C C   . THR B 158 ? 0.3627 0.2251 0.2210 -0.0273 0.0096  0.0097  142  THR B C   
3872 O O   . THR B 158 ? 0.3545 0.2054 0.1973 -0.0265 0.0173  0.0068  142  THR B O   
3873 C CB  . THR B 158 ? 0.3618 0.2106 0.2239 -0.0274 -0.0163 0.0128  142  THR B CB  
3874 O OG1 . THR B 158 ? 0.3611 0.1936 0.2099 -0.0273 -0.0240 0.0130  142  THR B OG1 
3875 C CG2 . THR B 158 ? 0.3461 0.2032 0.2286 -0.0282 -0.0280 0.0155  142  THR B CG2 
3876 N N   . SER B 159 ? 0.3326 0.1976 0.1911 -0.0276 0.0113  0.0103  143  SER B N   
3877 C CA  . SER B 159 ? 0.3317 0.1831 0.1693 -0.0276 0.0211  0.0079  143  SER B CA  
3878 C C   . SER B 159 ? 0.3785 0.2372 0.2180 -0.0274 0.0375  0.0051  143  SER B C   
3879 O O   . SER B 159 ? 0.3842 0.2248 0.2024 -0.0273 0.0464  0.0024  143  SER B O   
3880 C CB  . SER B 159 ? 0.3463 0.2002 0.1857 -0.0281 0.0188  0.0092  143  SER B CB  
3881 O OG  . SER B 159 ? 0.3506 0.2319 0.2160 -0.0283 0.0243  0.0106  143  SER B OG  
3882 N N   . PHE B 160 ? 0.3285 0.2114 0.1931 -0.0273 0.0413  0.0056  144  PHE B N   
3883 C CA  . PHE B 160 ? 0.3226 0.2136 0.1940 -0.0269 0.0547  0.0027  144  PHE B CA  
3884 C C   . PHE B 160 ? 0.3857 0.2607 0.2426 -0.0261 0.0599  -0.0006 144  PHE B C   
3885 O O   . PHE B 160 ? 0.3845 0.2599 0.2431 -0.0257 0.0724  -0.0038 144  PHE B O   
3886 C CB  . PHE B 160 ? 0.3115 0.2279 0.2103 -0.0267 0.0544  0.0040  144  PHE B CB  
3887 C CG  . PHE B 160 ? 0.3167 0.2363 0.2224 -0.0265 0.0466  0.0051  144  PHE B CG  
3888 C CD1 . PHE B 160 ? 0.3474 0.2643 0.2529 -0.0257 0.0505  0.0023  144  PHE B CD1 
3889 C CD2 . PHE B 160 ? 0.3286 0.2533 0.2421 -0.0272 0.0357  0.0088  144  PHE B CD2 
3890 C CE1 . PHE B 160 ? 0.3492 0.2690 0.2608 -0.0257 0.0429  0.0034  144  PHE B CE1 
3891 C CE2 . PHE B 160 ? 0.3406 0.2677 0.2611 -0.0275 0.0290  0.0100  144  PHE B CE2 
3892 C CZ  . PHE B 160 ? 0.3100 0.2343 0.2283 -0.0267 0.0322  0.0074  144  PHE B CZ  
3893 N N   . ALA B 161 ? 0.3536 0.2153 0.1990 -0.0257 0.0502  0.0000  145  ALA B N   
3894 C CA  . ALA B 161 ? 0.3642 0.2101 0.1954 -0.0245 0.0540  -0.0031 145  ALA B CA  
3895 C C   . ALA B 161 ? 0.4259 0.2401 0.2230 -0.0242 0.0593  -0.0054 145  ALA B C   
3896 O O   . ALA B 161 ? 0.4163 0.2148 0.1990 -0.0230 0.0647  -0.0083 145  ALA B O   
3897 C CB  . ALA B 161 ? 0.3721 0.2184 0.2074 -0.0242 0.0411  -0.0013 145  ALA B CB  
3898 N N   . MET B 162 ? 0.4020 0.2052 0.1848 -0.0251 0.0580  -0.0042 146  MET B N   
3899 C CA  . MET B 162 ? 0.4433 0.2128 0.1898 -0.0250 0.0631  -0.0061 146  MET B CA  
3900 C C   . MET B 162 ? 0.5165 0.2832 0.2601 -0.0250 0.0841  -0.0100 146  MET B C   
3901 O O   . MET B 162 ? 0.4686 0.2593 0.2379 -0.0257 0.0928  -0.0104 146  MET B O   
3902 C CB  . MET B 162 ? 0.4547 0.2155 0.1896 -0.0261 0.0572  -0.0040 146  MET B CB  
3903 C CG  . MET B 162 ? 0.4777 0.2380 0.2158 -0.0261 0.0364  -0.0006 146  MET B CG  
3904 S SD  . MET B 162 ? 0.5154 0.2580 0.2347 -0.0270 0.0283  0.0009  146  MET B SD  
3905 C CE  . MET B 162 ? 0.4528 0.2291 0.2020 -0.0283 0.0400  0.0017  146  MET B CE  
3906 N N   . ALA B 163 ? 0.5435 0.2796 0.2562 -0.0243 0.0922  -0.0128 147  ALA B N   
3907 C CA  . ALA B 163 ? 0.5636 0.2927 0.2719 -0.0245 0.1144  -0.0168 147  ALA B CA  
3908 C C   . ALA B 163 ? 0.6319 0.3543 0.3304 -0.0266 0.1219  -0.0160 147  ALA B C   
3909 O O   . ALA B 163 ? 0.6016 0.3168 0.2880 -0.0274 0.1092  -0.0130 147  ALA B O   
3910 C CB  . ALA B 163 ? 0.6108 0.3055 0.2853 -0.0231 0.1215  -0.0199 147  ALA B CB  
3911 N N   . GLN B 164 ? 0.6368 0.3628 0.3438 -0.0275 0.1421  -0.0189 148  GLN B N   
3912 C CA  . GLN B 164 ? 0.6709 0.3906 0.3704 -0.0297 0.1521  -0.0186 148  GLN B CA  
3913 C C   . GLN B 164 ? 0.8003 0.4954 0.4806 -0.0303 0.1753  -0.0226 148  GLN B C   
3914 O O   . GLN B 164 ? 0.8107 0.5198 0.5154 -0.0298 0.1893  -0.0260 148  GLN B O   
3915 C CB  . GLN B 164 ? 0.6557 0.4122 0.3960 -0.0306 0.1533  -0.0176 148  GLN B CB  
3916 C CG  . GLN B 164 ? 0.9108 0.6661 0.6449 -0.0326 0.1515  -0.0150 148  GLN B CG  
3917 C CD  . GLN B 164 ? 1.1223 0.9124 0.8942 -0.0330 0.1491  -0.0136 148  GLN B CD  
3918 O OE1 . GLN B 164 ? 1.0824 0.8748 0.8569 -0.0347 0.1553  -0.0130 148  GLN B OE1 
3919 N NE2 . GLN B 164 ? 0.9613 0.7774 0.7610 -0.0314 0.1394  -0.0127 148  GLN B NE2 
3920 N N   . GLN B 165 ? 0.8021 0.4583 0.4379 -0.0312 0.1788  -0.0225 149  GLN B N   
3921 C CA  . GLN B 165 ? 0.8313 0.4562 0.4401 -0.0320 0.2023  -0.0260 149  GLN B CA  
3922 C C   . GLN B 165 ? 0.8969 0.5117 0.5020 -0.0297 0.2123  -0.0300 149  GLN B C   
3923 O O   . GLN B 165 ? 0.9111 0.5146 0.5140 -0.0301 0.2360  -0.0338 149  GLN B O   
3924 C CB  . GLN B 165 ? 0.8383 0.4757 0.4675 -0.0347 0.2218  -0.0272 149  GLN B CB  
3925 C CG  . GLN B 165 ? 1.0884 0.7249 0.7094 -0.0371 0.2142  -0.0236 149  GLN B CG  
3926 C CD  . GLN B 165 ? 1.3734 1.0318 1.0252 -0.0395 0.2286  -0.0241 149  GLN B CD  
3927 O OE1 . GLN B 165 ? 1.2773 0.9703 0.9737 -0.0389 0.2312  -0.0253 149  GLN B OE1 
3928 N NE2 . GLN B 165 ? 1.3166 0.9542 0.9448 -0.0423 0.2365  -0.0231 149  GLN B NE2 
3929 N N   . ASP B 166 ? 0.8285 0.4465 0.4331 -0.0272 0.1946  -0.0291 150  ASP B N   
3930 C CA  . ASP B 166 ? 0.8279 0.4351 0.4267 -0.0246 0.2008  -0.0327 150  ASP B CA  
3931 C C   . ASP B 166 ? 0.9169 0.4719 0.4589 -0.0240 0.2083  -0.0340 150  ASP B C   
3932 O O   . ASP B 166 ? 0.9201 0.4493 0.4271 -0.0248 0.1958  -0.0311 150  ASP B O   
3933 C CB  . ASP B 166 ? 0.8207 0.4454 0.4343 -0.0224 0.1779  -0.0307 150  ASP B CB  
3934 C CG  . ASP B 166 ? 0.9407 0.5658 0.5614 -0.0197 0.1832  -0.0344 150  ASP B CG  
3935 O OD1 . ASP B 166 ? 0.9592 0.5484 0.5419 -0.0180 0.1859  -0.0362 150  ASP B OD1 
3936 O OD2 . ASP B 166 ? 1.0147 0.6744 0.6774 -0.0191 0.1826  -0.0355 150  ASP B OD2 
3937 N N   . VAL B 167 ? 0.8989 0.4365 0.4309 -0.0226 0.2281  -0.0386 151  VAL B N   
3938 C CA  . VAL B 167 ? 0.9583 0.4426 0.4335 -0.0216 0.2380  -0.0405 151  VAL B CA  
3939 C C   . VAL B 167 ? 1.0292 0.4877 0.4682 -0.0194 0.2118  -0.0379 151  VAL B C   
3940 O O   . VAL B 167 ? 1.0689 0.4822 0.4559 -0.0195 0.2092  -0.0371 151  VAL B O   
3941 C CB  . VAL B 167 ? 1.0250 0.4980 0.5009 -0.0202 0.2661  -0.0464 151  VAL B CB  
3942 C CG1 . VAL B 167 ? 1.0089 0.4941 0.5012 -0.0165 0.2586  -0.0486 151  VAL B CG1 
3943 C CG2 . VAL B 167 ? 1.0876 0.5037 0.5039 -0.0204 0.2842  -0.0482 151  VAL B CG2 
3944 N N   . ARG B 168 ? 0.9410 0.4287 0.4092 -0.0177 0.1910  -0.0363 152  ARG B N   
3945 C CA  . ARG B 168 ? 0.9434 0.4145 0.3888 -0.0159 0.1635  -0.0334 152  ARG B CA  
3946 C C   . ARG B 168 ? 0.9370 0.4176 0.3866 -0.0182 0.1457  -0.0287 152  ARG B C   
3947 O O   . ARG B 168 ? 0.8830 0.4040 0.3741 -0.0190 0.1328  -0.0261 152  ARG B O   
3948 C CB  . ARG B 168 ? 0.9128 0.4141 0.3923 -0.0138 0.1506  -0.0333 152  ARG B CB  
3949 C CG  . ARG B 168 ? 1.0469 0.5316 0.5146 -0.0108 0.1629  -0.0378 152  ARG B CG  
3950 C CD  . ARG B 168 ? 1.1381 0.6658 0.6573 -0.0101 0.1684  -0.0400 152  ARG B CD  
3951 N NE  . ARG B 168 ? 1.2262 0.7847 0.7752 -0.0099 0.1440  -0.0365 152  ARG B NE  
3952 C CZ  . ARG B 168 ? 1.4522 1.0041 0.9946 -0.0076 0.1288  -0.0361 152  ARG B CZ  
3953 N NH1 . ARG B 168 ? 1.4483 0.9630 0.9537 -0.0048 0.1339  -0.0391 152  ARG B NH1 
3954 N NH2 . ARG B 168 ? 1.1815 0.7625 0.7534 -0.0080 0.1087  -0.0327 152  ARG B NH2 
3955 N N   . TYR B 169 ? 0.9196 0.3615 0.3257 -0.0194 0.1470  -0.0280 153  TYR B N   
3956 C CA  . TYR B 169 ? 0.8949 0.3367 0.2968 -0.0216 0.1332  -0.0244 153  TYR B CA  
3957 C C   . TYR B 169 ? 0.8920 0.3503 0.3108 -0.0209 0.1021  -0.0205 153  TYR B C   
3958 O O   . TYR B 169 ? 0.8568 0.3397 0.2998 -0.0227 0.0933  -0.0178 153  TYR B O   
3959 C CB  . TYR B 169 ? 0.9546 0.3415 0.2968 -0.0224 0.1389  -0.0249 153  TYR B CB  
3960 C CG  . TYR B 169 ? 1.0050 0.3435 0.2972 -0.0198 0.1207  -0.0247 153  TYR B CG  
3961 C CD1 . TYR B 169 ? 1.0661 0.3704 0.3245 -0.0174 0.1317  -0.0280 153  TYR B CD1 
3962 C CD2 . TYR B 169 ? 1.0196 0.3444 0.2979 -0.0197 0.0920  -0.0215 153  TYR B CD2 
3963 C CE1 . TYR B 169 ? 1.1170 0.3736 0.3267 -0.0147 0.1137  -0.0278 153  TYR B CE1 
3964 C CE2 . TYR B 169 ? 1.0753 0.3541 0.3088 -0.0171 0.0728  -0.0215 153  TYR B CE2 
3965 C CZ  . TYR B 169 ? 1.1824 0.4262 0.3801 -0.0146 0.0834  -0.0245 153  TYR B CZ  
3966 O OH  . TYR B 169 ? 1.2492 0.4456 0.4013 -0.0118 0.0633  -0.0245 153  TYR B OH  
3967 N N   . TYR B 170 ? 0.8565 0.3005 0.2634 -0.0183 0.0860  -0.0205 154  TYR B N   
3968 C CA  . TYR B 170 ? 0.8310 0.2875 0.2545 -0.0175 0.0568  -0.0172 154  TYR B CA  
3969 C C   . TYR B 170 ? 0.7904 0.3043 0.2746 -0.0183 0.0532  -0.0153 154  TYR B C   
3970 O O   . TYR B 170 ? 0.7458 0.2746 0.2496 -0.0182 0.0315  -0.0123 154  TYR B O   
3971 C CB  . TYR B 170 ? 0.8757 0.2990 0.2692 -0.0145 0.0422  -0.0178 154  TYR B CB  
3972 C CG  . TYR B 170 ? 0.8974 0.3198 0.2897 -0.0125 0.0590  -0.0213 154  TYR B CG  
3973 C CD1 . TYR B 170 ? 0.8656 0.3297 0.3032 -0.0121 0.0587  -0.0213 154  TYR B CD1 
3974 C CD2 . TYR B 170 ? 0.9538 0.3324 0.2991 -0.0111 0.0759  -0.0248 154  TYR B CD2 
3975 C CE1 . TYR B 170 ? 0.8873 0.3511 0.3257 -0.0101 0.0736  -0.0249 154  TYR B CE1 
3976 C CE2 . TYR B 170 ? 0.9748 0.3526 0.3207 -0.0091 0.0920  -0.0285 154  TYR B CE2 
3977 C CZ  . TYR B 170 ? 1.0045 0.4259 0.3982 -0.0085 0.0902  -0.0286 154  TYR B CZ  
3978 O OH  . TYR B 170 ? 1.0089 0.4304 0.4055 -0.0064 0.1053  -0.0325 154  TYR B OH  
3979 N N   . LEU B 171 ? 0.7220 0.2655 0.2350 -0.0190 0.0742  -0.0172 155  LEU B N   
3980 C CA  . LEU B 171 ? 0.6638 0.2582 0.2305 -0.0198 0.0732  -0.0158 155  LEU B CA  
3981 C C   . LEU B 171 ? 0.6821 0.3012 0.2715 -0.0222 0.0777  -0.0141 155  LEU B C   
3982 O O   . LEU B 171 ? 0.6079 0.2653 0.2375 -0.0229 0.0728  -0.0122 155  LEU B O   
3983 C CB  . LEU B 171 ? 0.6495 0.2604 0.2355 -0.0188 0.0906  -0.0193 155  LEU B CB  
3984 C CG  . LEU B 171 ? 0.7159 0.3092 0.2868 -0.0161 0.0864  -0.0212 155  LEU B CG  
3985 C CD1 . LEU B 171 ? 0.7065 0.3226 0.3048 -0.0152 0.1021  -0.0246 155  LEU B CD1 
3986 C CD2 . LEU B 171 ? 0.7046 0.3034 0.2833 -0.0154 0.0604  -0.0177 155  LEU B CD2 
3987 N N   . ASN B 172 ? 0.6849 0.2802 0.2467 -0.0235 0.0873  -0.0148 156  ASN B N   
3988 C CA  . ASN B 172 ? 0.6664 0.2811 0.2457 -0.0258 0.0917  -0.0132 156  ASN B CA  
3989 C C   . ASN B 172 ? 0.6887 0.3033 0.2676 -0.0263 0.0690  -0.0095 156  ASN B C   
3990 O O   . ASN B 172 ? 0.6675 0.2672 0.2288 -0.0276 0.0683  -0.0087 156  ASN B O   
3991 C CB  . ASN B 172 ? 0.7272 0.3165 0.2785 -0.0274 0.1126  -0.0155 156  ASN B CB  
3992 C CG  . ASN B 172 ? 0.8951 0.4856 0.4516 -0.0270 0.1367  -0.0195 156  ASN B CG  
3993 O OD1 . ASN B 172 ? 0.7327 0.3570 0.3281 -0.0265 0.1418  -0.0205 156  ASN B OD1 
3994 N ND2 . ASN B 172 ? 0.8151 0.3674 0.3325 -0.0274 0.1526  -0.0220 156  ASN B ND2 
3995 N N   . GLY B 173 ? 0.6311 0.2622 0.2309 -0.0252 0.0510  -0.0075 157  GLY B N   
3996 C CA  . GLY B 173 ? 0.6067 0.2398 0.2128 -0.0253 0.0285  -0.0043 157  GLY B CA  
3997 C C   . GLY B 173 ? 0.5780 0.2306 0.2108 -0.0242 0.0132  -0.0025 157  GLY B C   
3998 O O   . GLY B 173 ? 0.5310 0.2013 0.1815 -0.0236 0.0206  -0.0034 157  GLY B O   
3999 N N   . MET B 174 ? 0.5240 0.1733 0.1615 -0.0240 -0.0082 0.0000  158  MET B N   
4000 C CA  . MET B 174 ? 0.5040 0.1733 0.1712 -0.0235 -0.0230 0.0022  158  MET B CA  
4001 C C   . MET B 174 ? 0.5605 0.1985 0.2068 -0.0222 -0.0445 0.0027  158  MET B C   
4002 O O   . MET B 174 ? 0.5973 0.2094 0.2221 -0.0221 -0.0568 0.0029  158  MET B O   
4003 C CB  . MET B 174 ? 0.4835 0.1870 0.1895 -0.0248 -0.0280 0.0050  158  MET B CB  
4004 C CG  . MET B 174 ? 0.4828 0.2095 0.2233 -0.0248 -0.0405 0.0076  158  MET B CG  
4005 S SD  . MET B 174 ? 0.4657 0.2308 0.2495 -0.0261 -0.0415 0.0105  158  MET B SD  
4006 C CE  . MET B 174 ? 0.3936 0.1840 0.1875 -0.0267 -0.0171 0.0093  158  MET B CE  
4007 N N   . LEU B 175 ? 0.5332 0.1740 0.1876 -0.0213 -0.0508 0.0029  159  LEU B N   
4008 C CA  . LEU B 175 ? 0.5524 0.1665 0.1929 -0.0200 -0.0732 0.0036  159  LEU B CA  
4009 C C   . LEU B 175 ? 0.5885 0.2247 0.2668 -0.0209 -0.0908 0.0068  159  LEU B C   
4010 O O   . LEU B 175 ? 0.5325 0.2075 0.2509 -0.0222 -0.0852 0.0087  159  LEU B O   
4011 C CB  . LEU B 175 ? 0.5525 0.1620 0.1891 -0.0186 -0.0734 0.0028  159  LEU B CB  
4012 C CG  . LEU B 175 ? 0.6221 0.2051 0.2476 -0.0172 -0.0983 0.0037  159  LEU B CG  
4013 C CD1 . LEU B 175 ? 0.6789 0.2085 0.2507 -0.0153 -0.1068 0.0016  159  LEU B CD1 
4014 C CD2 . LEU B 175 ? 0.6238 0.2159 0.2610 -0.0164 -0.0994 0.0038  159  LEU B CD2 
4015 N N   . LEU B 176 ? 0.5911 0.2009 0.2563 -0.0202 -0.1116 0.0073  160  LEU B N   
4016 C CA  . LEU B 176 ? 0.5987 0.2221 0.2985 -0.0208 -0.1314 0.0098  160  LEU B CA  
4017 C C   . LEU B 176 ? 0.7090 0.3008 0.3931 -0.0191 -0.1538 0.0097  160  LEU B C   
4018 O O   . LEU B 176 ? 0.7487 0.2968 0.3896 -0.0175 -0.1637 0.0078  160  LEU B O   
4019 C CB  . LEU B 176 ? 0.6020 0.2234 0.3058 -0.0212 -0.1384 0.0100  160  LEU B CB  
4020 C CG  . LEU B 176 ? 0.6218 0.2786 0.3502 -0.0228 -0.1205 0.0107  160  LEU B CG  
4021 C CD1 . LEU B 176 ? 0.5601 0.2621 0.3341 -0.0241 -0.1104 0.0129  160  LEU B CD1 
4022 C CD2 . LEU B 176 ? 0.7048 0.3503 0.4003 -0.0230 -0.1009 0.0086  160  LEU B CD2 
4023 N N   . GLU B 177 ? 0.6627 0.2746 0.3794 -0.0196 -0.1609 0.0116  161  GLU B N   
4024 C CA  . GLU B 177 ? 0.6945 0.2812 0.4020 -0.0182 -0.1813 0.0118  161  GLU B CA  
4025 C C   . GLU B 177 ? 0.7500 0.3523 0.5019 -0.0192 -0.2017 0.0145  161  GLU B C   
4026 O O   . GLU B 177 ? 0.6947 0.3377 0.4915 -0.0213 -0.1937 0.0167  161  GLU B O   
4027 C CB  . GLU B 177 ? 0.7079 0.3008 0.4095 -0.0179 -0.1691 0.0113  161  GLU B CB  
4028 C CG  . GLU B 177 ? 0.8437 0.4098 0.5317 -0.0162 -0.1879 0.0113  161  GLU B CG  
4029 C CD  . GLU B 177 ? 0.9847 0.5654 0.6765 -0.0161 -0.1749 0.0111  161  GLU B CD  
4030 O OE1 . GLU B 177 ? 0.8540 0.4162 0.5095 -0.0145 -0.1612 0.0083  161  GLU B OE1 
4031 O OE2 . GLU B 177 ? 0.9144 0.5258 0.6465 -0.0179 -0.1768 0.0136  161  GLU B OE2 
4032 N N   . VAL B 178 ? 0.7619 0.3297 0.5006 -0.0176 -0.2280 0.0141  162  VAL B N   
4033 C CA  . VAL B 178 ? 0.7627 0.3389 0.5427 -0.0183 -0.2503 0.0162  162  VAL B CA  
4034 C C   . VAL B 178 ? 0.8476 0.4051 0.6191 -0.0172 -0.2640 0.0165  162  VAL B C   
4035 O O   . VAL B 178 ? 0.8788 0.3940 0.6022 -0.0147 -0.2723 0.0144  162  VAL B O   
4036 C CB  . VAL B 178 ? 0.8326 0.3884 0.6161 -0.0174 -0.2732 0.0154  162  VAL B CB  
4037 C CG1 . VAL B 178 ? 0.8087 0.3840 0.6010 -0.0185 -0.2594 0.0150  162  VAL B CG1 
4038 C CG2 . VAL B 178 ? 0.8887 0.3865 0.6182 -0.0145 -0.2936 0.0130  162  VAL B CG2 
4039 N N   . ASN B 179 ? 0.8075 0.3959 0.6232 -0.0192 -0.2642 0.0192  163  ASN B N   
4040 C CA  . ASN B 179 ? 0.8268 0.4031 0.6424 -0.0186 -0.2772 0.0201  163  ASN B CA  
4041 C C   . ASN B 179 ? 0.8646 0.4713 0.7405 -0.0213 -0.2865 0.0234  163  ASN B C   
4042 O O   . ASN B 179 ? 0.8094 0.4575 0.7216 -0.0240 -0.2682 0.0254  163  ASN B O   
4043 C CB  . ASN B 179 ? 0.8632 0.4459 0.6575 -0.0184 -0.2568 0.0195  163  ASN B CB  
4044 C CG  . ASN B 179 ? 1.2253 0.7824 1.0022 -0.0167 -0.2717 0.0193  163  ASN B CG  
4045 O OD1 . ASN B 179 ? 1.1663 0.6782 0.9019 -0.0137 -0.2881 0.0173  163  ASN B OD1 
4046 N ND2 . ASN B 179 ? 1.1332 0.7166 0.9390 -0.0185 -0.2665 0.0215  163  ASN B ND2 
4047 N N   . GLY B 180 ? 0.8710 0.4551 0.7571 -0.0204 -0.3151 0.0237  164  GLY B N   
4048 C CA  . GLY B 180 ? 0.8553 0.4628 0.8010 -0.0229 -0.3273 0.0266  164  GLY B CA  
4049 C C   . GLY B 180 ? 0.9067 0.5329 0.8831 -0.0240 -0.3251 0.0265  164  GLY B C   
4050 O O   . GLY B 180 ? 0.9258 0.5260 0.8785 -0.0218 -0.3364 0.0241  164  GLY B O   
4051 N N   . GLY B 181 ? 0.8322 0.5020 0.8572 -0.0272 -0.3090 0.0290  165  GLY B N   
4052 C CA  . GLY B 181 ? 0.8049 0.4976 0.8615 -0.0282 -0.3021 0.0291  165  GLY B CA  
4053 C C   . GLY B 181 ? 0.8202 0.5421 0.8703 -0.0294 -0.2705 0.0295  165  GLY B C   
4054 O O   . GLY B 181 ? 0.8075 0.5580 0.8910 -0.0310 -0.2589 0.0304  165  GLY B O   
4055 N N   . THR B 182 ? 0.7404 0.4546 0.7483 -0.0285 -0.2566 0.0285  166  THR B N   
4056 C CA  . THR B 182 ? 0.6898 0.4281 0.6878 -0.0294 -0.2279 0.0285  166  THR B CA  
4057 C C   . THR B 182 ? 0.6860 0.4056 0.6397 -0.0272 -0.2209 0.0255  166  THR B C   
4058 O O   . THR B 182 ? 0.7189 0.4016 0.6308 -0.0248 -0.2321 0.0232  166  THR B O   
4059 C CB  . THR B 182 ? 0.7800 0.5257 0.7683 -0.0301 -0.2164 0.0295  166  THR B CB  
4060 O OG1 . THR B 182 ? 0.7920 0.5487 0.8168 -0.0322 -0.2258 0.0324  166  THR B OG1 
4061 C CG2 . THR B 182 ? 0.7553 0.5300 0.7442 -0.0314 -0.1885 0.0299  166  THR B CG2 
4062 N N   . LEU B 183 ? 0.5744 0.3181 0.5360 -0.0280 -0.2016 0.0255  167  LEU B N   
4063 C CA  . LEU B 183 ? 0.5579 0.2886 0.4808 -0.0265 -0.1910 0.0229  167  LEU B CA  
4064 C C   . LEU B 183 ? 0.5507 0.3019 0.4651 -0.0273 -0.1656 0.0230  167  LEU B C   
4065 O O   . LEU B 183 ? 0.4996 0.2842 0.4458 -0.0291 -0.1524 0.0250  167  LEU B O   
4066 C CB  . LEU B 183 ? 0.5470 0.2856 0.4831 -0.0265 -0.1908 0.0225  167  LEU B CB  
4067 C CG  . LEU B 183 ? 0.6006 0.3257 0.4978 -0.0253 -0.1798 0.0201  167  LEU B CG  
4068 C CD1 . LEU B 183 ? 0.6258 0.3048 0.4713 -0.0232 -0.1913 0.0175  167  LEU B CD1 
4069 C CD2 . LEU B 183 ? 0.6143 0.3493 0.5288 -0.0254 -0.1809 0.0199  167  LEU B CD2 
4070 N N   . ARG B 184 ? 0.5252 0.2540 0.3967 -0.0257 -0.1595 0.0206  168  ARG B N   
4071 C CA  . ARG B 184 ? 0.4930 0.2361 0.3546 -0.0260 -0.1378 0.0199  168  ARG B CA  
4072 C C   . ARG B 184 ? 0.5448 0.2769 0.3731 -0.0249 -0.1233 0.0171  168  ARG B C   
4073 O O   . ARG B 184 ? 0.5670 0.2651 0.3593 -0.0233 -0.1304 0.0150  168  ARG B O   
4074 C CB  . ARG B 184 ? 0.4912 0.2198 0.3374 -0.0251 -0.1420 0.0193  168  ARG B CB  
4075 C CG  . ARG B 184 ? 0.5412 0.2810 0.3761 -0.0250 -0.1212 0.0178  168  ARG B CG  
4076 C CD  . ARG B 184 ? 0.5881 0.3141 0.4101 -0.0240 -0.1262 0.0172  168  ARG B CD  
4077 N NE  . ARG B 184 ? 0.6309 0.3770 0.4886 -0.0259 -0.1339 0.0204  168  ARG B NE  
4078 C CZ  . ARG B 184 ? 0.8030 0.5410 0.6582 -0.0255 -0.1415 0.0207  168  ARG B CZ  
4079 N NH1 . ARG B 184 ? 0.6625 0.3724 0.4804 -0.0230 -0.1424 0.0178  168  ARG B NH1 
4080 N NH2 . ARG B 184 ? 0.6397 0.3969 0.5291 -0.0277 -0.1474 0.0239  168  ARG B NH2 
4081 N N   . SER B 185 ? 0.4684 0.2275 0.3078 -0.0258 -0.1028 0.0171  169  SER B N   
4082 C CA  . SER B 185 ? 0.4591 0.2139 0.2742 -0.0253 -0.0860 0.0146  169  SER B CA  
4083 C C   . SER B 185 ? 0.4779 0.2373 0.2846 -0.0249 -0.0719 0.0130  169  SER B C   
4084 O O   . SER B 185 ? 0.4336 0.2146 0.2649 -0.0257 -0.0700 0.0146  169  SER B O   
4085 C CB  . SER B 185 ? 0.4484 0.2306 0.2861 -0.0264 -0.0752 0.0157  169  SER B CB  
4086 O OG  . SER B 185 ? 0.3939 0.2092 0.2657 -0.0277 -0.0677 0.0178  169  SER B OG  
4087 N N   . VAL B 186 ? 0.4298 0.1663 0.2013 -0.0236 -0.0626 0.0099  170  VAL B N   
4088 C CA  . VAL B 186 ? 0.4163 0.1551 0.1797 -0.0228 -0.0482 0.0075  170  VAL B CA  
4089 C C   . VAL B 186 ? 0.4765 0.2100 0.2212 -0.0226 -0.0297 0.0047  170  VAL B C   
4090 O O   . VAL B 186 ? 0.4950 0.2019 0.2107 -0.0221 -0.0307 0.0035  170  VAL B O   
4091 C CB  . VAL B 186 ? 0.4717 0.1827 0.2104 -0.0211 -0.0562 0.0060  170  VAL B CB  
4092 C CG1 . VAL B 186 ? 0.4697 0.1906 0.2102 -0.0204 -0.0414 0.0037  170  VAL B CG1 
4093 C CG2 . VAL B 186 ? 0.4635 0.1738 0.2179 -0.0213 -0.0774 0.0089  170  VAL B CG2 
4094 N N   . ALA B 187 ? 0.4217 0.1785 0.1825 -0.0229 -0.0133 0.0035  171  ALA B N   
4095 C CA  . ALA B 187 ? 0.4149 0.1695 0.1640 -0.0228 0.0054  0.0006  171  ALA B CA  
4096 C C   . ALA B 187 ? 0.4544 0.2183 0.2103 -0.0220 0.0184  -0.0022 171  ALA B C   
4097 O O   . ALA B 187 ? 0.4159 0.2020 0.1972 -0.0222 0.0157  -0.0011 171  ALA B O   
4098 C CB  . ALA B 187 ? 0.3954 0.1745 0.1663 -0.0243 0.0110  0.0021  171  ALA B CB  
4099 N N   . THR B 188 ? 0.4459 0.1901 0.1780 -0.0210 0.0323  -0.0060 172  THR B N   
4100 C CA  . THR B 188 ? 0.4529 0.2031 0.1911 -0.0199 0.0461  -0.0096 172  THR B CA  
4101 C C   . THR B 188 ? 0.5291 0.2664 0.2518 -0.0197 0.0662  -0.0134 172  THR B C   
4102 O O   . THR B 188 ? 0.5407 0.2517 0.2338 -0.0200 0.0686  -0.0137 172  THR B O   
4103 C CB  . THR B 188 ? 0.4937 0.2300 0.2215 -0.0181 0.0380  -0.0105 172  THR B CB  
4104 O OG1 . THR B 188 ? 0.5023 0.2516 0.2450 -0.0171 0.0500  -0.0138 172  THR B OG1 
4105 C CG2 . THR B 188 ? 0.5337 0.2274 0.2177 -0.0166 0.0350  -0.0120 172  THR B CG2 
4106 N N   . ASP B 189 ? 0.4909 0.2467 0.2352 -0.0194 0.0804  -0.0163 173  ASP B N   
4107 C CA  . ASP B 189 ? 0.5018 0.2478 0.2381 -0.0192 0.1014  -0.0204 173  ASP B CA  
4108 C C   . ASP B 189 ? 0.5634 0.2997 0.2959 -0.0171 0.1116  -0.0251 173  ASP B C   
4109 O O   . ASP B 189 ? 0.5693 0.3021 0.3037 -0.0168 0.1305  -0.0291 173  ASP B O   
4110 C CB  . ASP B 189 ? 0.4828 0.2574 0.2504 -0.0207 0.1104  -0.0205 173  ASP B CB  
4111 C CG  . ASP B 189 ? 0.4976 0.3042 0.3031 -0.0202 0.1075  -0.0207 173  ASP B CG  
4112 O OD1 . ASP B 189 ? 0.4904 0.2984 0.2995 -0.0189 0.1004  -0.0212 173  ASP B OD1 
4113 O OD2 . ASP B 189 ? 0.4858 0.3141 0.3157 -0.0212 0.1117  -0.0204 173  ASP B OD2 
4114 N N   . GLY B 190 ? 0.5260 0.2596 0.2563 -0.0156 0.0989  -0.0245 174  GLY B N   
4115 C CA  . GLY B 190 ? 0.5434 0.2690 0.2712 -0.0132 0.1053  -0.0286 174  GLY B CA  
4116 C C   . GLY B 190 ? 0.5701 0.3274 0.3373 -0.0127 0.1065  -0.0303 174  GLY B C   
4117 O O   . GLY B 190 ? 0.5616 0.3155 0.3311 -0.0106 0.1089  -0.0336 174  GLY B O   
4118 N N   . HIS B 191 ? 0.5041 0.2906 0.3014 -0.0145 0.1042  -0.0281 175  HIS B N   
4119 C CA  . HIS B 191 ? 0.4816 0.2969 0.3154 -0.0142 0.1034  -0.0293 175  HIS B CA  
4120 C C   . HIS B 191 ? 0.4912 0.3246 0.3387 -0.0155 0.0851  -0.0242 175  HIS B C   
4121 O O   . HIS B 191 ? 0.4665 0.3152 0.3339 -0.0150 0.0793  -0.0245 175  HIS B O   
4122 C CB  . HIS B 191 ? 0.4873 0.3188 0.3437 -0.0151 0.1163  -0.0311 175  HIS B CB  
4123 C CG  . HIS B 191 ? 0.5631 0.3786 0.4107 -0.0144 0.1365  -0.0362 175  HIS B CG  
4124 N ND1 . HIS B 191 ? 0.6001 0.4133 0.4578 -0.0122 0.1466  -0.0417 175  HIS B ND1 
4125 C CD2 . HIS B 191 ? 0.6123 0.4115 0.4410 -0.0155 0.1483  -0.0364 175  HIS B CD2 
4126 C CE1 . HIS B 191 ? 0.6167 0.4129 0.4626 -0.0122 0.1657  -0.0451 175  HIS B CE1 
4127 N NE2 . HIS B 191 ? 0.6299 0.4168 0.4573 -0.0143 0.1675  -0.0419 175  HIS B NE2 
4128 N N   . ARG B 192 ? 0.4284 0.2597 0.2663 -0.0171 0.0769  -0.0197 176  ARG B N   
4129 C CA  . ARG B 192 ? 0.3915 0.2388 0.2428 -0.0186 0.0617  -0.0147 176  ARG B CA  
4130 C C   . ARG B 192 ? 0.4367 0.2683 0.2672 -0.0195 0.0515  -0.0111 176  ARG B C   
4131 O O   . ARG B 192 ? 0.4408 0.2524 0.2482 -0.0194 0.0570  -0.0121 176  ARG B O   
4132 C CB  . ARG B 192 ? 0.3528 0.2266 0.2316 -0.0198 0.0640  -0.0134 176  ARG B CB  
4133 C CG  . ARG B 192 ? 0.3667 0.2417 0.2463 -0.0202 0.0767  -0.0150 176  ARG B CG  
4134 C CD  . ARG B 192 ? 0.4204 0.2887 0.2863 -0.0216 0.0729  -0.0115 176  ARG B CD  
4135 N NE  . ARG B 192 ? 0.4242 0.2956 0.2930 -0.0222 0.0843  -0.0127 176  ARG B NE  
4136 C CZ  . ARG B 192 ? 0.4371 0.3289 0.3271 -0.0229 0.0852  -0.0115 176  ARG B CZ  
4137 N NH1 . ARG B 192 ? 0.2812 0.1913 0.1900 -0.0231 0.0762  -0.0090 176  ARG B NH1 
4138 N NH2 . ARG B 192 ? 0.4000 0.2923 0.2913 -0.0235 0.0954  -0.0127 176  ARG B NH2 
4139 N N   . LEU B 193 ? 0.3676 0.2061 0.2060 -0.0204 0.0365  -0.0070 177  LEU B N   
4140 C CA  . LEU B 193 ? 0.3633 0.1878 0.1874 -0.0212 0.0238  -0.0037 177  LEU B CA  
4141 C C   . LEU B 193 ? 0.3762 0.2224 0.2245 -0.0231 0.0144  0.0010  177  LEU B C   
4142 O O   . LEU B 193 ? 0.3247 0.1915 0.1956 -0.0238 0.0141  0.0021  177  LEU B O   
4143 C CB  . LEU B 193 ? 0.3803 0.1827 0.1857 -0.0199 0.0136  -0.0041 177  LEU B CB  
4144 C CG  . LEU B 193 ? 0.4394 0.2247 0.2317 -0.0203 -0.0035 -0.0009 177  LEU B CG  
4145 C CD1 . LEU B 193 ? 0.4757 0.2263 0.2342 -0.0182 -0.0084 -0.0031 177  LEU B CD1 
4146 C CD2 . LEU B 193 ? 0.4252 0.2292 0.2440 -0.0220 -0.0171 0.0034  177  LEU B CD2 
4147 N N   . ALA B 194 ? 0.3425 0.1820 0.1848 -0.0239 0.0069  0.0035  178  ALA B N   
4148 C CA  . ALA B 194 ? 0.3268 0.1832 0.1909 -0.0256 -0.0019 0.0077  178  ALA B CA  
4149 C C   . ALA B 194 ? 0.3935 0.2313 0.2466 -0.0257 -0.0175 0.0097  178  ALA B C   
4150 O O   . ALA B 194 ? 0.4149 0.2277 0.2414 -0.0248 -0.0196 0.0080  178  ALA B O   
4151 C CB  . ALA B 194 ? 0.3152 0.1850 0.1881 -0.0263 0.0060  0.0083  178  ALA B CB  
4152 N N   . MET B 195 ? 0.3379 0.1856 0.2110 -0.0270 -0.0286 0.0130  179  MET B N   
4153 C CA  . MET B 195 ? 0.3530 0.1856 0.2232 -0.0272 -0.0455 0.0150  179  MET B CA  
4154 C C   . MET B 195 ? 0.3942 0.2481 0.2971 -0.0292 -0.0514 0.0189  179  MET B C   
4155 O O   . MET B 195 ? 0.3442 0.2206 0.2687 -0.0305 -0.0447 0.0205  179  MET B O   
4156 C CB  . MET B 195 ? 0.3981 0.2094 0.2524 -0.0261 -0.0560 0.0142  179  MET B CB  
4157 C CG  . MET B 195 ? 0.4453 0.2721 0.3187 -0.0270 -0.0565 0.0155  179  MET B CG  
4158 S SD  . MET B 195 ? 0.5472 0.3472 0.3981 -0.0253 -0.0673 0.0139  179  MET B SD  
4159 C CE  . MET B 195 ? 0.5204 0.3030 0.3728 -0.0257 -0.0899 0.0167  179  MET B CE  
4160 N N   . CYS B 196 ? 0.3859 0.2315 0.2919 -0.0294 -0.0631 0.0203  180  CYS B N   
4161 C CA  . CYS B 196 ? 0.3866 0.2499 0.3250 -0.0312 -0.0688 0.0237  180  CYS B CA  
4162 C C   . CYS B 196 ? 0.4364 0.2808 0.3755 -0.0310 -0.0887 0.0246  180  CYS B C   
4163 O O   . CYS B 196 ? 0.4290 0.2479 0.3420 -0.0294 -0.0966 0.0225  180  CYS B O   
4164 C CB  . CYS B 196 ? 0.3969 0.2754 0.3450 -0.0314 -0.0594 0.0240  180  CYS B CB  
4165 S SG  . CYS B 196 ? 0.4376 0.3422 0.4283 -0.0335 -0.0600 0.0280  180  CYS B SG  
4166 N N   . SER B 197 ? 0.4087 0.2639 0.3772 -0.0327 -0.0969 0.0275  181  SER B N   
4167 C CA  . SER B 197 ? 0.4484 0.2886 0.4262 -0.0328 -0.1175 0.0286  181  SER B CA  
4168 C C   . SER B 197 ? 0.5331 0.3941 0.5528 -0.0347 -0.1199 0.0315  181  SER B C   
4169 O O   . SER B 197 ? 0.5089 0.3953 0.5514 -0.0366 -0.1064 0.0335  181  SER B O   
4170 C CB  . SER B 197 ? 0.5051 0.3359 0.4801 -0.0330 -0.1260 0.0292  181  SER B CB  
4171 O OG  . SER B 197 ? 0.5793 0.3871 0.5150 -0.0308 -0.1250 0.0262  181  SER B OG  
4172 N N   . LEU B 198 ? 0.5384 0.3868 0.5672 -0.0342 -0.1367 0.0314  182  LEU B N   
4173 C CA  . LEU B 198 ? 0.5488 0.4141 0.6199 -0.0358 -0.1406 0.0335  182  LEU B CA  
4174 C C   . LEU B 198 ? 0.6392 0.4843 0.7207 -0.0353 -0.1655 0.0334  182  LEU B C   
4175 O O   . LEU B 198 ? 0.6458 0.4616 0.6960 -0.0330 -0.1791 0.0310  182  LEU B O   
4176 C CB  . LEU B 198 ? 0.5529 0.4286 0.6278 -0.0351 -0.1317 0.0326  182  LEU B CB  
4177 C CG  . LEU B 198 ? 0.6128 0.5145 0.6929 -0.0360 -0.1081 0.0335  182  LEU B CG  
4178 C CD1 . LEU B 198 ? 0.6119 0.5157 0.6832 -0.0345 -0.1019 0.0319  182  LEU B CD1 
4179 C CD2 . LEU B 198 ? 0.6632 0.5900 0.7840 -0.0385 -0.1002 0.0369  182  LEU B CD2 
4180 N N   . ASP B 199 ? 0.6228 0.4814 0.7479 -0.0374 -0.1718 0.0359  183  ASP B N   
4181 C CA  . ASP B 199 ? 0.6607 0.5006 0.8013 -0.0368 -0.1973 0.0356  183  ASP B CA  
4182 C C   . ASP B 199 ? 0.7401 0.5759 0.8889 -0.0354 -0.2045 0.0337  183  ASP B C   
4183 O O   . ASP B 199 ? 0.7187 0.5783 0.8899 -0.0362 -0.1901 0.0344  183  ASP B O   
4184 C CB  . ASP B 199 ? 0.6829 0.5361 0.8690 -0.0397 -0.2031 0.0387  183  ASP B CB  
4185 C CG  . ASP B 199 ? 0.8504 0.7381 1.0781 -0.0426 -0.1836 0.0415  183  ASP B CG  
4186 O OD1 . ASP B 199 ? 0.8601 0.7587 1.1117 -0.0425 -0.1809 0.0410  183  ASP B OD1 
4187 O OD2 . ASP B 199 ? 0.9103 0.8121 1.1469 -0.0451 -0.1719 0.0441  183  ASP B OD2 
4188 N N   . ALA B 200 ? 0.7429 0.5461 0.8670 -0.0329 -0.2258 0.0312  184  ALA B N   
4189 C CA  . ALA B 200 ? 0.7661 0.5596 0.8922 -0.0312 -0.2359 0.0290  184  ALA B CA  
4190 C C   . ALA B 200 ? 0.8824 0.6544 1.0291 -0.0303 -0.2663 0.0281  184  ALA B C   
4191 O O   . ALA B 200 ? 0.8890 0.6571 1.0513 -0.0292 -0.2770 0.0264  184  ALA B O   
4192 C CB  . ALA B 200 ? 0.7921 0.5627 0.8633 -0.0289 -0.2324 0.0263  184  ALA B CB  
4193 N N   . GLN B 201 ? 0.8808 0.6390 1.0295 -0.0307 -0.2809 0.0291  185  GLN B N   
4194 C CA  . GLN B 201 ? 0.9212 0.6565 1.0890 -0.0298 -0.3119 0.0285  185  GLN B CA  
4195 C C   . GLN B 201 ? 1.0369 0.7302 1.1661 -0.0264 -0.3349 0.0249  185  GLN B C   
4196 O O   . GLN B 201 ? 1.0430 0.7283 1.1972 -0.0254 -0.3540 0.0234  185  GLN B O   
4197 C CB  . GLN B 201 ? 0.9185 0.6809 1.1563 -0.0320 -0.3151 0.0300  185  GLN B CB  
4198 N N   . ILE B 202 ? 1.0302 0.6956 1.0978 -0.0245 -0.3322 0.0235  186  ILE B N   
4199 C CA  . ILE B 202 ? 1.0700 0.6904 1.0893 -0.0213 -0.3506 0.0203  186  ILE B CA  
4200 C C   . ILE B 202 ? 1.1788 0.7581 1.1755 -0.0194 -0.3783 0.0196  186  ILE B C   
4201 O O   . ILE B 202 ? 1.1786 0.7535 1.1544 -0.0196 -0.3719 0.0207  186  ILE B O   
4202 C CB  . ILE B 202 ? 1.1134 0.7252 1.0772 -0.0205 -0.3292 0.0189  186  ILE B CB  
4203 C CG1 . ILE B 202 ? 1.0733 0.7275 1.0596 -0.0224 -0.3006 0.0199  186  ILE B CG1 
4204 C CG2 . ILE B 202 ? 1.1711 0.7357 1.0865 -0.0176 -0.3470 0.0157  186  ILE B CG2 
4205 C CD1 . ILE B 202 ? 1.1295 0.7864 1.0728 -0.0224 -0.2742 0.0194  186  ILE B CD1 
4206 N N   . PRO B 203 ? 1.1794 0.7262 1.1780 -0.0174 -0.4101 0.0176  187  PRO B N   
4207 C CA  . PRO B 203 ? 1.2254 0.7283 1.1971 -0.0151 -0.4380 0.0168  187  PRO B CA  
4208 C C   . PRO B 203 ? 1.3286 0.7877 1.2205 -0.0125 -0.4355 0.0146  187  PRO B C   
4209 O O   . PRO B 203 ? 1.3447 0.7757 1.2029 -0.0107 -0.4425 0.0121  187  PRO B O   
4210 C CB  . PRO B 203 ? 1.2645 0.7489 1.2676 -0.0138 -0.4720 0.0151  187  PRO B CB  
4211 C CG  . PRO B 203 ? 1.2811 0.8037 1.3307 -0.0155 -0.4592 0.0150  187  PRO B CG  
4212 C CD  . PRO B 203 ? 1.2003 0.7458 1.2229 -0.0166 -0.4236 0.0157  187  PRO B CD  
4213 N N   . SER B 204 ? 1.3011 0.7561 1.1633 -0.0124 -0.4227 0.0156  188  SER B N   
4214 C CA  . SER B 204 ? 1.3398 0.7561 1.1285 -0.0101 -0.4152 0.0135  188  SER B CA  
4215 C C   . SER B 204 ? 1.4472 0.8146 1.1969 -0.0072 -0.4388 0.0126  188  SER B C   
4216 O O   . SER B 204 ? 1.4941 0.8114 1.1822 -0.0043 -0.4473 0.0101  188  SER B O   
4217 C CB  . SER B 204 ? 1.3552 0.8032 1.1341 -0.0118 -0.3781 0.0145  188  SER B CB  
4218 O OG  . SER B 204 ? 1.4239 0.9000 1.2330 -0.0135 -0.3707 0.0170  188  SER B OG  
4219 N N   . GLN B 205 ? 1.3935 0.7734 1.1765 -0.0080 -0.4485 0.0147  189  GLN B N   
4220 C CA  . GLN B 205 ? 1.4332 0.7716 1.1860 -0.0054 -0.4707 0.0143  189  GLN B CA  
4221 C C   . GLN B 205 ? 1.4962 0.8162 1.1892 -0.0038 -0.4502 0.0133  189  GLN B C   
4222 O O   . GLN B 205 ? 1.4922 0.8128 1.1844 -0.0036 -0.4502 0.0144  189  GLN B O   
4223 C CB  . GLN B 205 ? 1.5033 0.7861 1.2320 -0.0020 -0.5093 0.0120  189  GLN B CB  
4224 N N   . ASP B 206 ? 1.4560 0.7606 1.1014 -0.0029 -0.4321 0.0111  190  ASP B N   
4225 C CA  . ASP B 206 ? 1.4616 0.7503 1.0518 -0.0015 -0.4082 0.0096  190  ASP B CA  
4226 C C   . ASP B 206 ? 1.4382 0.7690 1.0397 -0.0042 -0.3724 0.0098  190  ASP B C   
4227 O O   . ASP B 206 ? 1.4213 0.7675 1.0420 -0.0056 -0.3703 0.0098  190  ASP B O   
4228 C CB  . ASP B 206 ? 1.5525 0.7726 1.0680 0.0023  -0.4218 0.0065  190  ASP B CB  
4229 N N   . ARG B 207 ? 1.3442 0.6930 0.9352 -0.0047 -0.3455 0.0097  191  ARG B N   
4230 C CA  . ARG B 207 ? 1.2840 0.6717 0.8853 -0.0069 -0.3118 0.0098  191  ARG B CA  
4231 C C   . ARG B 207 ? 1.3157 0.6771 0.8707 -0.0060 -0.3006 0.0072  191  ARG B C   
4232 O O   . ARG B 207 ? 1.3611 0.6739 0.8572 -0.0033 -0.3026 0.0048  191  ARG B O   
4233 C CB  . ARG B 207 ? 1.2657 0.6716 0.8636 -0.0071 -0.2896 0.0097  191  ARG B CB  
4234 C CG  . ARG B 207 ? 1.3420 0.7928 0.9604 -0.0096 -0.2571 0.0099  191  ARG B CG  
4235 C CD  . ARG B 207 ? 1.4394 0.8956 1.0403 -0.0089 -0.2354 0.0085  191  ARG B CD  
4236 N NE  . ARG B 207 ? 1.5604 0.9735 1.1000 -0.0062 -0.2266 0.0050  191  ARG B NE  
4237 C CZ  . ARG B 207 ? 1.7329 1.1422 1.2495 -0.0050 -0.2068 0.0028  191  ARG B CZ  
4238 N NH1 . ARG B 207 ? 1.5541 1.0000 1.1030 -0.0061 -0.1953 0.0037  191  ARG B NH1 
4239 N NH2 . ARG B 207 ? 1.5776 0.9452 1.0387 -0.0026 -0.1979 -0.0004 191  ARG B NH2 
4240 N N   . HIS B 208 ? 1.1936 0.5859 0.7744 -0.0083 -0.2882 0.0078  192  HIS B N   
4241 C CA  . HIS B 208 ? 1.1856 0.5595 0.7289 -0.0081 -0.2753 0.0058  192  HIS B CA  
4242 C C   . HIS B 208 ? 1.1002 0.5156 0.6586 -0.0103 -0.2412 0.0060  192  HIS B C   
4243 O O   . HIS B 208 ? 1.0329 0.4974 0.6431 -0.0125 -0.2326 0.0081  192  HIS B O   
4244 C CB  . HIS B 208 ? 1.2118 0.5750 0.7631 -0.0083 -0.2944 0.0058  192  HIS B CB  
4245 C CG  . HIS B 208 ? 1.3020 0.6262 0.7986 -0.0074 -0.2893 0.0034  192  HIS B CG  
4246 N ND1 . HIS B 208 ? 1.3101 0.6532 0.8178 -0.0091 -0.2780 0.0034  192  HIS B ND1 
4247 C CD2 . HIS B 208 ? 1.3860 0.6526 0.8164 -0.0050 -0.2935 0.0011  192  HIS B CD2 
4248 C CE1 . HIS B 208 ? 1.3489 0.6463 0.7983 -0.0081 -0.2760 0.0012  192  HIS B CE1 
4249 N NE2 . HIS B 208 ? 1.4016 0.6513 0.8021 -0.0056 -0.2844 -0.0003 192  HIS B NE2 
4250 N N   . GLN B 209 ? 1.0212 0.4144 0.5334 -0.0096 -0.2220 0.0036  193  GLN B N   
4251 C CA  . GLN B 209 ? 0.9559 0.3807 0.4756 -0.0113 -0.1899 0.0031  193  GLN B CA  
4252 C C   . GLN B 209 ? 0.9657 0.3717 0.4538 -0.0118 -0.1793 0.0016  193  GLN B C   
4253 O O   . GLN B 209 ? 1.0091 0.3642 0.4453 -0.0102 -0.1871 -0.0003 193  GLN B O   
4254 C CB  . GLN B 209 ? 0.9769 0.3936 0.4727 -0.0101 -0.1727 0.0013  193  GLN B CB  
4255 C CG  . GLN B 209 ? 0.9307 0.3730 0.4596 -0.0100 -0.1767 0.0028  193  GLN B CG  
4256 C CD  . GLN B 209 ? 1.0852 0.5284 0.5974 -0.0091 -0.1548 0.0006  193  GLN B CD  
4257 O OE1 . GLN B 209 ? 1.0162 0.4252 0.4814 -0.0075 -0.1431 -0.0023 193  GLN B OE1 
4258 N NE2 . GLN B 209 ? 0.9474 0.4285 0.4977 -0.0101 -0.1485 0.0018  193  GLN B NE2 
4259 N N   . VAL B 210 ? 0.8375 0.2827 0.3552 -0.0141 -0.1614 0.0023  194  VAL B N   
4260 C CA  . VAL B 210 ? 0.8307 0.2652 0.3240 -0.0151 -0.1475 0.0011  194  VAL B CA  
4261 C C   . VAL B 210 ? 0.8376 0.3108 0.3512 -0.0168 -0.1170 0.0008  194  VAL B C   
4262 O O   . VAL B 210 ? 0.7829 0.3002 0.3426 -0.0178 -0.1122 0.0025  194  VAL B O   
4263 C CB  . VAL B 210 ? 0.8699 0.3042 0.3751 -0.0159 -0.1634 0.0021  194  VAL B CB  
4264 C CG1 . VAL B 210 ? 0.9038 0.2943 0.3860 -0.0139 -0.1953 0.0017  194  VAL B CG1 
4265 C CG2 . VAL B 210 ? 0.8103 0.2998 0.3786 -0.0176 -0.1624 0.0045  194  VAL B CG2 
4266 N N   . ILE B 211 ? 0.7832 0.2387 0.2630 -0.0173 -0.0969 -0.0012 195  ILE B N   
4267 C CA  . ILE B 211 ? 0.7310 0.2215 0.2315 -0.0190 -0.0692 -0.0017 195  ILE B CA  
4268 C C   . ILE B 211 ? 0.7510 0.2465 0.2518 -0.0208 -0.0634 -0.0013 195  ILE B C   
4269 O O   . ILE B 211 ? 0.7772 0.2332 0.2347 -0.0208 -0.0633 -0.0026 195  ILE B O   
4270 C CB  . ILE B 211 ? 0.7862 0.2618 0.2594 -0.0183 -0.0464 -0.0046 195  ILE B CB  
4271 C CG1 . ILE B 211 ? 0.8007 0.2649 0.2675 -0.0161 -0.0542 -0.0053 195  ILE B CG1 
4272 C CG2 . ILE B 211 ? 0.7602 0.2772 0.2653 -0.0200 -0.0210 -0.0051 195  ILE B CG2 
4273 C CD1 . ILE B 211 ? 0.8959 0.3311 0.3243 -0.0147 -0.0356 -0.0086 195  ILE B CD1 
4274 N N   . VAL B 212 ? 0.6691 0.2104 0.2162 -0.0223 -0.0591 0.0005  196  VAL B N   
4275 C CA  . VAL B 212 ? 0.6510 0.2011 0.2026 -0.0239 -0.0534 0.0010  196  VAL B CA  
4276 C C   . VAL B 212 ? 0.6956 0.2619 0.2487 -0.0253 -0.0248 -0.0004 196  VAL B C   
4277 O O   . VAL B 212 ? 0.6588 0.2573 0.2419 -0.0253 -0.0138 -0.0004 196  VAL B O   
4278 C CB  . VAL B 212 ? 0.6522 0.2377 0.2496 -0.0244 -0.0662 0.0035  196  VAL B CB  
4279 C CG1 . VAL B 212 ? 0.6460 0.2342 0.2423 -0.0257 -0.0629 0.0037  196  VAL B CG1 
4280 C CG2 . VAL B 212 ? 0.6570 0.2284 0.2592 -0.0231 -0.0939 0.0045  196  VAL B CG2 
4281 N N   . PRO B 213 ? 0.6858 0.2292 0.2079 -0.0265 -0.0127 -0.0017 197  PRO B N   
4282 C CA  . PRO B 213 ? 0.6658 0.2260 0.1948 -0.0280 0.0144  -0.0031 197  PRO B CA  
4283 C C   . PRO B 213 ? 0.6456 0.2571 0.2258 -0.0288 0.0194  -0.0015 197  PRO B C   
4284 O O   . PRO B 213 ? 0.6080 0.2362 0.2099 -0.0289 0.0053  0.0007  197  PRO B O   
4285 C CB  . PRO B 213 ? 0.7212 0.2492 0.2125 -0.0295 0.0216  -0.0039 197  PRO B CB  
4286 C CG  . PRO B 213 ? 0.8268 0.3096 0.2779 -0.0283 0.0009  -0.0039 197  PRO B CG  
4287 C CD  . PRO B 213 ? 0.7509 0.2529 0.2327 -0.0267 -0.0233 -0.0020 197  PRO B CD  
4288 N N   . ARG B 214 ? 0.6039 0.2391 0.2038 -0.0292 0.0388  -0.0027 198  ARG B N   
4289 C CA  . ARG B 214 ? 0.5589 0.2399 0.2049 -0.0297 0.0437  -0.0014 198  ARG B CA  
4290 C C   . ARG B 214 ? 0.5809 0.2752 0.2388 -0.0310 0.0415  0.0003  198  ARG B C   
4291 O O   . ARG B 214 ? 0.5149 0.2385 0.2055 -0.0306 0.0328  0.0024  198  ARG B O   
4292 C CB  . ARG B 214 ? 0.5743 0.2725 0.2355 -0.0299 0.0644  -0.0036 198  ARG B CB  
4293 C CG  . ARG B 214 ? 0.6504 0.3317 0.2913 -0.0313 0.0852  -0.0061 198  ARG B CG  
4294 C CD  . ARG B 214 ? 0.6961 0.4024 0.3646 -0.0315 0.1035  -0.0082 198  ARG B CD  
4295 N NE  . ARG B 214 ? 0.6964 0.4406 0.4039 -0.0319 0.1021  -0.0065 198  ARG B NE  
4296 C CZ  . ARG B 214 ? 0.8098 0.5839 0.5502 -0.0308 0.0973  -0.0058 198  ARG B CZ  
4297 N NH1 . ARG B 214 ? 0.6625 0.4355 0.4042 -0.0294 0.0936  -0.0067 198  ARG B NH1 
4298 N NH2 . ARG B 214 ? 0.6224 0.4258 0.3927 -0.0310 0.0961  -0.0042 198  ARG B NH2 
4299 N N   . LYS B 215 ? 0.5780 0.2488 0.2080 -0.0324 0.0492  -0.0006 199  LYS B N   
4300 C CA  . LYS B 215 ? 0.5604 0.2412 0.1990 -0.0335 0.0470  0.0008  199  LYS B CA  
4301 C C   . LYS B 215 ? 0.6011 0.2797 0.2436 -0.0325 0.0233  0.0029  199  LYS B C   
4302 O O   . LYS B 215 ? 0.5830 0.2904 0.2567 -0.0323 0.0181  0.0046  199  LYS B O   
4303 C CB  . LYS B 215 ? 0.6193 0.2719 0.2245 -0.0355 0.0602  -0.0005 199  LYS B CB  
4304 C CG  . LYS B 215 ? 0.7301 0.4017 0.3521 -0.0369 0.0645  0.0006  199  LYS B CG  
4305 C CD  . LYS B 215 ? 0.9327 0.5748 0.5210 -0.0393 0.0773  -0.0005 199  LYS B CD  
4306 C CE  . LYS B 215 ? 1.1213 0.7834 0.7281 -0.0407 0.0825  0.0006  199  LYS B CE  
4307 N NZ  . LYS B 215 ? 1.3112 0.9457 0.8874 -0.0435 0.0975  -0.0004 199  LYS B NZ  
4308 N N   . GLY B 216 ? 0.6030 0.2473 0.2155 -0.0317 0.0091  0.0025  200  GLY B N   
4309 C CA  . GLY B 216 ? 0.6037 0.2408 0.2194 -0.0306 -0.0152 0.0038  200  GLY B CA  
4310 C C   . GLY B 216 ? 0.5855 0.2562 0.2439 -0.0294 -0.0255 0.0056  200  GLY B C   
4311 O O   . GLY B 216 ? 0.5554 0.2432 0.2387 -0.0291 -0.0367 0.0071  200  GLY B O   
4312 N N   . ILE B 217 ? 0.5035 0.1842 0.1718 -0.0288 -0.0206 0.0054  201  ILE B N   
4313 C CA  . ILE B 217 ? 0.4731 0.1843 0.1808 -0.0281 -0.0291 0.0073  201  ILE B CA  
4314 C C   . ILE B 217 ? 0.4895 0.2418 0.2354 -0.0286 -0.0196 0.0087  201  ILE B C   
4315 O O   . ILE B 217 ? 0.4459 0.2185 0.2214 -0.0282 -0.0294 0.0106  201  ILE B O   
4316 C CB  . ILE B 217 ? 0.5109 0.2205 0.2184 -0.0274 -0.0283 0.0068  201  ILE B CB  
4317 C CG1 . ILE B 217 ? 0.5078 0.2350 0.2469 -0.0267 -0.0441 0.0089  201  ILE B CG1 
4318 C CG2 . ILE B 217 ? 0.4848 0.2131 0.2004 -0.0278 -0.0069 0.0056  201  ILE B CG2 
4319 C CD1 . ILE B 217 ? 0.5914 0.2937 0.3216 -0.0259 -0.0684 0.0094  201  ILE B CD1 
4320 N N   . LEU B 218 ? 0.4523 0.2150 0.1972 -0.0295 -0.0006 0.0077  202  LEU B N   
4321 C CA  . LEU B 218 ? 0.4411 0.2387 0.2182 -0.0297 0.0077  0.0090  202  LEU B CA  
4322 C C   . LEU B 218 ? 0.4965 0.2974 0.2798 -0.0297 -0.0001 0.0101  202  LEU B C   
4323 O O   . LEU B 218 ? 0.4629 0.2904 0.2763 -0.0292 -0.0020 0.0118  202  LEU B O   
4324 C CB  . LEU B 218 ? 0.4337 0.2395 0.2098 -0.0304 0.0276  0.0074  202  LEU B CB  
4325 C CG  . LEU B 218 ? 0.4699 0.2801 0.2495 -0.0301 0.0366  0.0059  202  LEU B CG  
4326 C CD1 . LEU B 218 ? 0.4733 0.2838 0.2481 -0.0309 0.0555  0.0036  202  LEU B CD1 
4327 C CD2 . LEU B 218 ? 0.4536 0.2933 0.2665 -0.0294 0.0333  0.0076  202  LEU B CD2 
4328 N N   . GLU B 219 ? 0.4987 0.2703 0.2519 -0.0302 -0.0052 0.0091  203  GLU B N   
4329 C CA  . GLU B 219 ? 0.5057 0.2749 0.2600 -0.0301 -0.0144 0.0098  203  GLU B CA  
4330 C C   . GLU B 219 ? 0.5570 0.3309 0.3315 -0.0288 -0.0338 0.0110  203  GLU B C   
4331 O O   . GLU B 219 ? 0.5134 0.3093 0.3154 -0.0282 -0.0371 0.0122  203  GLU B O   
4332 C CB  . GLU B 219 ? 0.5625 0.2941 0.2750 -0.0311 -0.0153 0.0083  203  GLU B CB  
4333 C CG  . GLU B 219 ? 0.7200 0.4421 0.4282 -0.0309 -0.0280 0.0085  203  GLU B CG  
4334 C CD  . GLU B 219 ? 0.9460 0.6955 0.6780 -0.0310 -0.0214 0.0095  203  GLU B CD  
4335 O OE1 . GLU B 219 ? 0.8433 0.6091 0.5816 -0.0319 -0.0038 0.0095  203  GLU B OE1 
4336 O OE2 . GLU B 219 ? 0.8364 0.5893 0.5801 -0.0301 -0.0345 0.0099  203  GLU B OE2 
4337 N N   . LEU B 220 ? 0.5502 0.3043 0.3135 -0.0283 -0.0458 0.0106  204  LEU B N   
4338 C CA  . LEU B 220 ? 0.5326 0.2900 0.3178 -0.0272 -0.0647 0.0116  204  LEU B CA  
4339 C C   . LEU B 220 ? 0.5369 0.3338 0.3667 -0.0269 -0.0602 0.0136  204  LEU B C   
4340 O O   . LEU B 220 ? 0.5123 0.3213 0.3676 -0.0263 -0.0695 0.0144  204  LEU B O   
4341 C CB  . LEU B 220 ? 0.5597 0.2899 0.3256 -0.0267 -0.0770 0.0110  204  LEU B CB  
4342 C CG  . LEU B 220 ? 0.6182 0.3449 0.4042 -0.0257 -0.0997 0.0116  204  LEU B CG  
4343 C CD1 . LEU B 220 ? 0.6223 0.3396 0.4114 -0.0251 -0.1145 0.0111  204  LEU B CD1 
4344 C CD2 . LEU B 220 ? 0.6562 0.3511 0.4169 -0.0251 -0.1120 0.0108  204  LEU B CD2 
4345 N N   . ALA B 221 ? 0.4628 0.2783 0.3014 -0.0274 -0.0455 0.0141  205  ALA B N   
4346 C CA  . ALA B 221 ? 0.4217 0.2711 0.2976 -0.0273 -0.0398 0.0161  205  ALA B CA  
4347 C C   . ALA B 221 ? 0.4869 0.3562 0.3807 -0.0269 -0.0342 0.0168  205  ALA B C   
4348 O O   . ALA B 221 ? 0.4517 0.3385 0.3747 -0.0264 -0.0385 0.0183  205  ALA B O   
4349 C CB  . ALA B 221 ? 0.4185 0.2794 0.2948 -0.0278 -0.0255 0.0160  205  ALA B CB  
4350 N N   . ARG B 222 ? 0.4620 0.3269 0.3379 -0.0272 -0.0246 0.0157  206  ARG B N   
4351 C CA  . ARG B 222 ? 0.4535 0.3341 0.3416 -0.0267 -0.0194 0.0162  206  ARG B CA  
4352 C C   . ARG B 222 ? 0.5112 0.3867 0.4077 -0.0258 -0.0338 0.0162  206  ARG B C   
4353 O O   . ARG B 222 ? 0.4849 0.3785 0.4018 -0.0249 -0.0315 0.0170  206  ARG B O   
4354 C CB  . ARG B 222 ? 0.4562 0.3294 0.3220 -0.0275 -0.0075 0.0149  206  ARG B CB  
4355 C CG  . ARG B 222 ? 0.5193 0.4059 0.3884 -0.0280 0.0082  0.0147  206  ARG B CG  
4356 C CD  . ARG B 222 ? 0.5612 0.4452 0.4172 -0.0287 0.0201  0.0136  206  ARG B CD  
4357 N NE  . ARG B 222 ? 0.6688 0.5232 0.4924 -0.0300 0.0192  0.0120  206  ARG B NE  
4358 C CZ  . ARG B 222 ? 0.8126 0.6501 0.6150 -0.0311 0.0273  0.0104  206  ARG B CZ  
4359 N NH1 . ARG B 222 ? 0.5813 0.4300 0.3937 -0.0310 0.0360  0.0099  206  ARG B NH1 
4360 N NH2 . ARG B 222 ? 0.6669 0.4746 0.4372 -0.0323 0.0272  0.0092  206  ARG B NH2 
4361 N N   . LEU B 223 ? 0.5016 0.3512 0.3822 -0.0258 -0.0491 0.0152  207  LEU B N   
4362 C CA  . LEU B 223 ? 0.5143 0.3551 0.4026 -0.0248 -0.0657 0.0147  207  LEU B CA  
4363 C C   . LEU B 223 ? 0.5694 0.4263 0.4954 -0.0239 -0.0752 0.0158  207  LEU B C   
4364 O O   . LEU B 223 ? 0.5544 0.4159 0.4999 -0.0228 -0.0842 0.0154  207  LEU B O   
4365 C CB  . LEU B 223 ? 0.5509 0.3531 0.4039 -0.0251 -0.0797 0.0129  207  LEU B CB  
4366 C CG  . LEU B 223 ? 0.6319 0.4137 0.4475 -0.0261 -0.0720 0.0117  207  LEU B CG  
4367 C CD1 . LEU B 223 ? 0.6667 0.4066 0.4418 -0.0266 -0.0828 0.0102  207  LEU B CD1 
4368 C CD2 . LEU B 223 ? 0.6695 0.4564 0.4907 -0.0256 -0.0739 0.0114  207  LEU B CD2 
4369 N N   . LEU B 224 ? 0.5313 0.3961 0.4686 -0.0245 -0.0731 0.0170  208  LEU B N   
4370 C CA  . LEU B 224 ? 0.5266 0.4059 0.5004 -0.0242 -0.0805 0.0182  208  LEU B CA  
4371 C C   . LEU B 224 ? 0.6096 0.5215 0.6151 -0.0239 -0.0664 0.0200  208  LEU B C   
4372 O O   . LEU B 224 ? 0.6022 0.5297 0.6174 -0.0247 -0.0553 0.0216  208  LEU B O   
4373 C CB  . LEU B 224 ? 0.5294 0.4010 0.4991 -0.0251 -0.0843 0.0189  208  LEU B CB  
4374 C CG  . LEU B 224 ? 0.6167 0.4525 0.5513 -0.0251 -0.0979 0.0171  208  LEU B CG  
4375 C CD1 . LEU B 224 ? 0.6232 0.4536 0.5445 -0.0259 -0.0935 0.0176  208  LEU B CD1 
4376 C CD2 . LEU B 224 ? 0.6529 0.4715 0.5974 -0.0242 -0.1214 0.0163  208  LEU B CD2 
4377 N N   . THR B 225 ? 0.5980 0.5177 0.6169 -0.0227 -0.0669 0.0195  209  THR B N   
4378 C CA  . THR B 225 ? 0.5921 0.5386 0.6363 -0.0219 -0.0534 0.0208  209  THR B CA  
4379 C C   . THR B 225 ? 0.6693 0.6296 0.7543 -0.0213 -0.0579 0.0215  209  THR B C   
4380 O O   . THR B 225 ? 0.6500 0.6310 0.7558 -0.0210 -0.0447 0.0231  209  THR B O   
4381 C CB  . THR B 225 ? 0.6687 0.6169 0.6993 -0.0208 -0.0464 0.0200  209  THR B CB  
4382 O OG1 . THR B 225 ? 0.6921 0.6225 0.7139 -0.0201 -0.0610 0.0180  209  THR B OG1 
4383 C CG2 . THR B 225 ? 0.6444 0.5886 0.6454 -0.0218 -0.0349 0.0199  209  THR B CG2 
4384 N N   . GLU B 226 ? 0.6632 0.6105 0.7594 -0.0210 -0.0762 0.0202  210  GLU B N   
4385 C CA  . GLU B 226 ? 0.6638 0.6225 0.8027 -0.0205 -0.0822 0.0204  210  GLU B CA  
4386 C C   . GLU B 226 ? 0.7155 0.6884 0.8759 -0.0221 -0.0741 0.0229  210  GLU B C   
4387 O O   . GLU B 226 ? 0.7175 0.6794 0.8738 -0.0234 -0.0836 0.0233  210  GLU B O   
4388 N N   . GLN B 227 ? 0.6674 0.6628 0.8478 -0.0220 -0.0562 0.0246  211  GLN B N   
4389 C CA  . GLN B 227 ? 0.6549 0.6646 0.8551 -0.0237 -0.0451 0.0273  211  GLN B CA  
4390 C C   . GLN B 227 ? 0.7128 0.7212 0.9453 -0.0250 -0.0572 0.0277  211  GLN B C   
4391 O O   . GLN B 227 ? 0.7146 0.7228 0.9479 -0.0270 -0.0565 0.0295  211  GLN B O   
4392 N N   . ASP B 228 ? 0.6729 0.6797 0.9328 -0.0237 -0.0693 0.0258  212  ASP B N   
4393 C CA  . ASP B 228 ? 0.6733 0.6780 0.9690 -0.0246 -0.0835 0.0256  212  ASP B CA  
4394 C C   . ASP B 228 ? 0.7214 0.7031 1.0107 -0.0234 -0.1099 0.0226  212  ASP B C   
4395 O O   . ASP B 228 ? 0.7252 0.7040 1.0489 -0.0233 -0.1250 0.0216  212  ASP B O   
4396 C CB  . ASP B 228 ? 0.6865 0.7115 1.0311 -0.0245 -0.0730 0.0262  212  ASP B CB  
4397 C CG  . ASP B 228 ? 0.8280 0.8690 1.1850 -0.0268 -0.0528 0.0297  212  ASP B CG  
4398 O OD1 . ASP B 228 ? 0.8341 0.8747 1.2091 -0.0291 -0.0577 0.0312  212  ASP B OD1 
4399 O OD2 . ASP B 228 ? 0.9078 0.9598 1.2545 -0.0263 -0.0327 0.0309  212  ASP B OD2 
4400 N N   . GLY B 229 ? 0.6642 0.6281 0.9093 -0.0224 -0.1151 0.0212  213  GLY B N   
4401 C CA  . GLY B 229 ? 0.6703 0.6068 0.8978 -0.0212 -0.1390 0.0184  213  GLY B CA  
4402 C C   . GLY B 229 ? 0.6942 0.6079 0.9016 -0.0223 -0.1545 0.0186  213  GLY B C   
4403 O O   . GLY B 229 ? 0.6901 0.6093 0.8917 -0.0240 -0.1456 0.0209  213  GLY B O   
4404 N N   . GLU B 230 ? 0.6372 0.5230 0.8323 -0.0211 -0.1786 0.0160  214  GLU B N   
4405 C CA  . GLU B 230 ? 0.6485 0.5055 0.8196 -0.0215 -0.1970 0.0156  214  GLU B CA  
4406 C C   . GLU B 230 ? 0.6972 0.5222 0.8114 -0.0206 -0.2040 0.0138  214  GLU B C   
4407 O O   . GLU B 230 ? 0.6945 0.5174 0.7947 -0.0195 -0.2006 0.0124  214  GLU B O   
4408 C CB  . GLU B 230 ? 0.6760 0.5226 0.8830 -0.0208 -0.2225 0.0142  214  GLU B CB  
4409 N N   . VAL B 231 ? 0.6441 0.4434 0.7249 -0.0210 -0.2127 0.0139  215  VAL B N   
4410 C CA  . VAL B 231 ? 0.6534 0.4175 0.6769 -0.0204 -0.2183 0.0123  215  VAL B CA  
4411 C C   . VAL B 231 ? 0.7046 0.4324 0.7080 -0.0198 -0.2421 0.0113  215  VAL B C   
4412 O O   . VAL B 231 ? 0.6911 0.4226 0.7055 -0.0206 -0.2435 0.0128  215  VAL B O   
4413 C CB  . VAL B 231 ? 0.6893 0.4604 0.6778 -0.0215 -0.1929 0.0134  215  VAL B CB  
4414 C CG1 . VAL B 231 ? 0.6690 0.4569 0.6639 -0.0230 -0.1791 0.0157  215  VAL B CG1 
4415 C CG2 . VAL B 231 ? 0.7186 0.4516 0.6495 -0.0211 -0.1973 0.0116  215  VAL B CG2 
4416 N N   . GLY B 232 ? 0.6761 0.3676 0.6500 -0.0183 -0.2616 0.0087  216  GLY B N   
4417 C CA  . GLY B 232 ? 0.7030 0.3520 0.6494 -0.0172 -0.2867 0.0074  216  GLY B CA  
4418 C C   . GLY B 232 ? 0.7609 0.3830 0.6466 -0.0176 -0.2769 0.0074  216  GLY B C   
4419 O O   . GLY B 232 ? 0.7677 0.3802 0.6184 -0.0178 -0.2652 0.0066  216  GLY B O   
4420 N N   . ILE B 233 ? 0.7110 0.3222 0.5857 -0.0178 -0.2799 0.0083  217  ILE B N   
4421 C CA  . ILE B 233 ? 0.7251 0.3101 0.5439 -0.0179 -0.2697 0.0081  217  ILE B CA  
4422 C C   . ILE B 233 ? 0.8407 0.3717 0.6181 -0.0161 -0.2955 0.0063  217  ILE B C   
4423 O O   . ILE B 233 ? 0.8595 0.3813 0.6575 -0.0152 -0.3180 0.0063  217  ILE B O   
4424 C CB  . ILE B 233 ? 0.7239 0.3366 0.5530 -0.0193 -0.2483 0.0104  217  ILE B CB  
4425 C CG1 . ILE B 233 ? 0.6771 0.3408 0.5450 -0.0210 -0.2234 0.0122  217  ILE B CG1 
4426 C CG2 . ILE B 233 ? 0.7398 0.3243 0.5125 -0.0192 -0.2374 0.0096  217  ILE B CG2 
4427 C CD1 . ILE B 233 ? 0.7121 0.3828 0.5597 -0.0215 -0.2037 0.0116  217  ILE B CD1 
4428 N N   . VAL B 234 ? 0.8377 0.3316 0.5558 -0.0157 -0.2917 0.0047  218  VAL B N   
4429 C CA  . VAL B 234 ? 0.8912 0.3268 0.5569 -0.0139 -0.3127 0.0029  218  VAL B CA  
4430 C C   . VAL B 234 ? 0.9634 0.3830 0.5807 -0.0143 -0.2914 0.0030  218  VAL B C   
4431 O O   . VAL B 234 ? 0.9434 0.3692 0.5393 -0.0156 -0.2675 0.0029  218  VAL B O   
4432 C CB  . VAL B 234 ? 0.9888 0.3853 0.6232 -0.0128 -0.3306 0.0005  218  VAL B CB  
4433 C CG1 . VAL B 234 ? 1.0439 0.3747 0.6140 -0.0109 -0.3495 -0.0013 218  VAL B CG1 
4434 C CG2 . VAL B 234 ? 0.9748 0.3862 0.6604 -0.0120 -0.3535 -0.0002 218  VAL B CG2 
4435 N N   . LEU B 235 ? 0.9570 0.3571 0.5600 -0.0132 -0.2999 0.0031  219  LEU B N   
4436 C CA  . LEU B 235 ? 0.9838 0.3657 0.5417 -0.0132 -0.2815 0.0028  219  LEU B CA  
4437 C C   . LEU B 235 ? 1.1361 0.4506 0.6273 -0.0111 -0.2980 0.0005  219  LEU B C   
4438 O O   . LEU B 235 ? 1.1672 0.4505 0.6511 -0.0091 -0.3262 0.0000  219  LEU B O   
4439 C CB  . LEU B 235 ? 0.9589 0.3621 0.5410 -0.0131 -0.2779 0.0043  219  LEU B CB  
4440 C CG  . LEU B 235 ? 0.9579 0.4241 0.6006 -0.0152 -0.2598 0.0067  219  LEU B CG  
4441 C CD1 . LEU B 235 ? 0.9512 0.4282 0.6088 -0.0150 -0.2600 0.0080  219  LEU B CD1 
4442 C CD2 . LEU B 235 ? 0.9426 0.4357 0.5817 -0.0169 -0.2276 0.0068  219  LEU B CD2 
4443 N N   . GLY B 236 ? 1.1331 0.4243 0.5770 -0.0118 -0.2813 -0.0007 220  GLY B N   
4444 C CA  . GLY B 236 ? 1.2028 0.4265 0.5755 -0.0102 -0.2918 -0.0028 220  GLY B CA  
4445 C C   . GLY B 236 ? 1.2895 0.4900 0.6183 -0.0096 -0.2740 -0.0035 220  GLY B C   
4446 O O   . GLY B 236 ? 1.2435 0.4811 0.6003 -0.0102 -0.2562 -0.0024 220  GLY B O   
4447 N N   . GLN B 237 ? 1.3195 0.4566 0.5780 -0.0082 -0.2781 -0.0054 221  GLN B N   
4448 C CA  . GLN B 237 ? 1.3526 0.4591 0.5621 -0.0073 -0.2608 -0.0065 221  GLN B CA  
4449 C C   . GLN B 237 ? 1.3663 0.4935 0.5674 -0.0098 -0.2209 -0.0068 221  GLN B C   
4450 O O   . GLN B 237 ? 1.3486 0.4909 0.5518 -0.0097 -0.1996 -0.0070 221  GLN B O   
4451 C CB  . GLN B 237 ? 1.4533 0.4799 0.5879 -0.0047 -0.2804 -0.0085 221  GLN B CB  
4452 N N   . HIS B 238 ? 1.3119 0.4398 0.5054 -0.0119 -0.2115 -0.0069 222  HIS B N   
4453 C CA  . HIS B 238 ? 1.2835 0.4299 0.4713 -0.0146 -0.1751 -0.0071 222  HIS B CA  
4454 C C   . HIS B 238 ? 1.2359 0.4367 0.4765 -0.0171 -0.1667 -0.0056 222  HIS B C   
4455 O O   . HIS B 238 ? 1.1940 0.4089 0.4316 -0.0195 -0.1399 -0.0057 222  HIS B O   
4456 C CB  . HIS B 238 ? 1.3618 0.4450 0.4743 -0.0149 -0.1660 -0.0090 222  HIS B CB  
4457 N N   . HIS B 239 ? 1.1516 0.3829 0.4418 -0.0166 -0.1892 -0.0042 223  HIS B N   
4458 C CA  . HIS B 239 ? 1.0943 0.3755 0.4359 -0.0185 -0.1846 -0.0028 223  HIS B CA  
4459 C C   . HIS B 239 ? 1.0353 0.3651 0.4432 -0.0179 -0.1972 -0.0010 223  HIS B C   
4460 O O   . HIS B 239 ? 1.0352 0.3542 0.4498 -0.0160 -0.2180 -0.0009 223  HIS B O   
4461 C CB  . HIS B 239 ? 1.1432 0.3959 0.4641 -0.0187 -0.2013 -0.0034 223  HIS B CB  
4462 C CG  . HIS B 239 ? 1.2295 0.4513 0.4999 -0.0206 -0.1823 -0.0044 223  HIS B CG  
4463 N ND1 . HIS B 239 ? 1.3202 0.4777 0.5212 -0.0199 -0.1845 -0.0061 223  HIS B ND1 
4464 C CD2 . HIS B 239 ? 1.2405 0.4861 0.5209 -0.0232 -0.1616 -0.0039 223  HIS B CD2 
4465 C CE1 . HIS B 239 ? 1.3327 0.4776 0.5045 -0.0223 -0.1636 -0.0064 223  HIS B CE1 
4466 N NE2 . HIS B 239 ? 1.2886 0.4858 0.5075 -0.0244 -0.1500 -0.0052 223  HIS B NE2 
4467 N N   . ILE B 240 ? 0.9130 0.2946 0.3691 -0.0195 -0.1846 0.0004  224  ILE B N   
4468 C CA  . ILE B 240 ? 0.8480 0.2757 0.3672 -0.0194 -0.1942 0.0021  224  ILE B CA  
4469 C C   . ILE B 240 ? 0.8863 0.3303 0.4291 -0.0200 -0.2002 0.0023  224  ILE B C   
4470 O O   . ILE B 240 ? 0.8754 0.3225 0.4044 -0.0215 -0.1834 0.0020  224  ILE B O   
4471 C CB  . ILE B 240 ? 0.8256 0.3026 0.3846 -0.0203 -0.1733 0.0037  224  ILE B CB  
4472 C CG1 . ILE B 240 ? 0.7848 0.3015 0.4047 -0.0201 -0.1859 0.0055  224  ILE B CG1 
4473 C CG2 . ILE B 240 ? 0.7748 0.2784 0.3367 -0.0223 -0.1430 0.0038  224  ILE B CG2 
4474 C CD1 . ILE B 240 ? 0.7971 0.3622 0.4587 -0.0211 -0.1678 0.0074  224  ILE B CD1 
4475 N N   . ARG B 241 ? 0.8408 0.2941 0.4197 -0.0189 -0.2240 0.0026  225  ARG B N   
4476 C CA  . ARG B 241 ? 0.8301 0.2996 0.4359 -0.0191 -0.2313 0.0025  225  ARG B CA  
4477 C C   . ARG B 241 ? 0.8434 0.3654 0.5171 -0.0192 -0.2311 0.0042  225  ARG B C   
4478 O O   . ARG B 241 ? 0.8410 0.3692 0.5410 -0.0184 -0.2443 0.0049  225  ARG B O   
4479 C CB  . ARG B 241 ? 0.8711 0.2937 0.4513 -0.0175 -0.2620 0.0005  225  ARG B CB  
4480 C CG  . ARG B 241 ? 1.0340 0.4655 0.6309 -0.0176 -0.2685 -0.0002 225  ARG B CG  
4481 C CD  . ARG B 241 ? 1.2318 0.6180 0.8091 -0.0157 -0.3020 -0.0025 225  ARG B CD  
4482 N NE  . ARG B 241 ? 1.4510 0.7820 0.9576 -0.0160 -0.3033 -0.0039 225  ARG B NE  
4483 C CZ  . ARG B 241 ? 1.7137 0.9910 1.1716 -0.0147 -0.3195 -0.0052 225  ARG B CZ  
4484 N NH1 . ARG B 241 ? 1.5772 0.8494 1.0509 -0.0129 -0.3375 -0.0051 225  ARG B NH1 
4485 N NH2 . ARG B 241 ? 1.5983 0.8248 0.9901 -0.0151 -0.3177 -0.0064 225  ARG B NH2 
4486 N N   . ALA B 242 ? 0.7567 0.3151 0.4574 -0.0203 -0.2148 0.0050  226  ALA B N   
4487 C CA  . ALA B 242 ? 0.7182 0.3248 0.4798 -0.0204 -0.2113 0.0066  226  ALA B CA  
4488 C C   . ALA B 242 ? 0.7920 0.4045 0.5719 -0.0198 -0.2202 0.0056  226  ALA B C   
4489 O O   . ALA B 242 ? 0.7890 0.3959 0.5456 -0.0204 -0.2102 0.0050  226  ALA B O   
4490 C CB  . ALA B 242 ? 0.6871 0.3321 0.4633 -0.0219 -0.1819 0.0084  226  ALA B CB  
4491 N N   . THR B 243 ? 0.7635 0.3858 0.5854 -0.0186 -0.2395 0.0053  227  THR B N   
4492 C CA  . THR B 243 ? 0.7618 0.3896 0.6074 -0.0175 -0.2511 0.0039  227  THR B CA  
4493 C C   . THR B 243 ? 0.7965 0.4718 0.7067 -0.0174 -0.2445 0.0051  227  THR B C   
4494 O O   . THR B 243 ? 0.7755 0.4640 0.7181 -0.0174 -0.2495 0.0062  227  THR B O   
4495 C CB  . THR B 243 ? 0.8478 0.4317 0.6772 -0.0158 -0.2842 0.0013  227  THR B CB  
4496 O OG1 . THR B 243 ? 0.8147 0.3518 0.5807 -0.0160 -0.2882 0.0005  227  THR B OG1 
4497 C CG2 . THR B 243 ? 0.8241 0.4048 0.6663 -0.0145 -0.2972 -0.0009 227  THR B CG2 
4498 N N   . THR B 244 ? 0.7559 0.4552 0.6834 -0.0172 -0.2328 0.0050  228  THR B N   
4499 C CA  . THR B 244 ? 0.7249 0.4669 0.7091 -0.0169 -0.2236 0.0060  228  THR B CA  
4500 C C   . THR B 244 ? 0.8053 0.5486 0.8151 -0.0150 -0.2377 0.0036  228  THR B C   
4501 O O   . THR B 244 ? 0.7820 0.5588 0.8340 -0.0145 -0.2274 0.0041  228  THR B O   
4502 C CB  . THR B 244 ? 0.7969 0.5707 0.7818 -0.0181 -0.1934 0.0082  228  THR B CB  
4503 O OG1 . THR B 244 ? 0.8017 0.5650 0.7536 -0.0181 -0.1865 0.0073  228  THR B OG1 
4504 C CG2 . THR B 244 ? 0.7453 0.5245 0.7163 -0.0197 -0.1790 0.0104  228  THR B CG2 
4505 N N   . GLY B 245 ? 0.7953 0.5007 0.7778 -0.0140 -0.2604 0.0010  229  GLY B N   
4506 C CA  . GLY B 245 ? 0.8077 0.5094 0.8102 -0.0120 -0.2763 -0.0017 229  GLY B CA  
4507 C C   . GLY B 245 ? 0.8819 0.5815 0.8562 -0.0121 -0.2652 -0.0022 229  GLY B C   
4508 O O   . GLY B 245 ? 0.9174 0.5876 0.8696 -0.0111 -0.2828 -0.0048 229  GLY B O   
4509 N N   . GLU B 246 ? 0.8071 0.5363 0.7816 -0.0133 -0.2369 0.0001  230  GLU B N   
4510 C CA  . GLU B 246 ? 0.8036 0.5331 0.7520 -0.0137 -0.2241 0.0000  230  GLU B CA  
4511 C C   . GLU B 246 ? 0.8424 0.5455 0.7325 -0.0158 -0.2151 0.0010  230  GLU B C   
4512 O O   . GLU B 246 ? 0.8566 0.5409 0.7135 -0.0162 -0.2146 0.0001  230  GLU B O   
4513 C CB  . GLU B 246 ? 0.7822 0.5552 0.7637 -0.0133 -0.2009 0.0016  230  GLU B CB  
4514 C CG  . GLU B 246 ? 0.9249 0.7270 0.9253 -0.0145 -0.1810 0.0045  230  GLU B CG  
4515 C CD  . GLU B 246 ? 1.2182 1.0597 1.2578 -0.0136 -0.1634 0.0057  230  GLU B CD  
4516 O OE1 . GLU B 246 ? 1.1166 0.9742 1.1452 -0.0145 -0.1420 0.0077  230  GLU B OE1 
4517 O OE2 . GLU B 246 ? 1.1875 1.0422 1.2689 -0.0118 -0.1709 0.0045  230  GLU B OE2 
4518 N N   . PHE B 247 ? 0.7614 0.4614 0.6391 -0.0171 -0.2082 0.0025  231  PHE B N   
4519 C CA  . PHE B 247 ? 0.7638 0.4386 0.5889 -0.0190 -0.1982 0.0031  231  PHE B CA  
4520 C C   . PHE B 247 ? 0.8113 0.4510 0.6081 -0.0191 -0.2122 0.0026  231  PHE B C   
4521 O O   . PHE B 247 ? 0.8005 0.4459 0.6244 -0.0183 -0.2237 0.0028  231  PHE B O   
4522 C CB  . PHE B 247 ? 0.7590 0.4640 0.5867 -0.0205 -0.1689 0.0054  231  PHE B CB  
4523 N N   . THR B 248 ? 0.7767 0.3784 0.5180 -0.0202 -0.2110 0.0019  232  THR B N   
4524 C CA  . THR B 248 ? 0.7980 0.3607 0.5013 -0.0204 -0.2209 0.0014  232  THR B CA  
4525 C C   . THR B 248 ? 0.8235 0.3819 0.4910 -0.0224 -0.1955 0.0025  232  THR B C   
4526 O O   . THR B 248 ? 0.8076 0.3507 0.4420 -0.0238 -0.1849 0.0021  232  THR B O   
4527 C CB  . THR B 248 ? 0.9473 0.4593 0.6169 -0.0192 -0.2491 -0.0011 232  THR B CB  
4528 O OG1 . THR B 248 ? 0.9285 0.4505 0.6419 -0.0171 -0.2723 -0.0023 232  THR B OG1 
4529 C CG2 . THR B 248 ? 0.9697 0.4367 0.5939 -0.0191 -0.2589 -0.0016 232  THR B CG2 
4530 N N   . PHE B 249 ? 0.7547 0.3293 0.4332 -0.0227 -0.1848 0.0038  233  PHE B N   
4531 C CA  . PHE B 249 ? 0.7534 0.3269 0.4053 -0.0243 -0.1609 0.0044  233  PHE B CA  
4532 C C   . PHE B 249 ? 0.8288 0.3584 0.4375 -0.0240 -0.1698 0.0034  233  PHE B C   
4533 O O   . PHE B 249 ? 0.8070 0.3320 0.4285 -0.0226 -0.1859 0.0035  233  PHE B O   
4534 C CB  . PHE B 249 ? 0.7406 0.3619 0.4338 -0.0247 -0.1428 0.0063  233  PHE B CB  
4535 C CG  . PHE B 249 ? 0.7775 0.3990 0.4501 -0.0260 -0.1211 0.0066  233  PHE B CG  
4536 C CD1 . PHE B 249 ? 0.8204 0.4535 0.4845 -0.0275 -0.0983 0.0068  233  PHE B CD1 
4537 C CD2 . PHE B 249 ? 0.8266 0.4354 0.4891 -0.0255 -0.1241 0.0065  233  PHE B CD2 
4538 C CE1 . PHE B 249 ? 0.8338 0.4678 0.4833 -0.0285 -0.0785 0.0066  233  PHE B CE1 
4539 C CE2 . PHE B 249 ? 0.8650 0.4738 0.5100 -0.0264 -0.1040 0.0063  233  PHE B CE2 
4540 C CZ  . PHE B 249 ? 0.8291 0.4511 0.4692 -0.0279 -0.0812 0.0062  233  PHE B CZ  
4541 N N   . THR B 250 ? 0.8170 0.3135 0.3748 -0.0252 -0.1586 0.0025  234  THR B N   
4542 C CA  . THR B 250 ? 0.8527 0.3031 0.3622 -0.0248 -0.1635 0.0014  234  THR B CA  
4543 C C   . THR B 250 ? 0.8712 0.3233 0.3591 -0.0264 -0.1344 0.0015  234  THR B C   
4544 O O   . THR B 250 ? 0.8511 0.3097 0.3303 -0.0283 -0.1153 0.0015  234  THR B O   
4545 C CB  . THR B 250 ? 0.9910 0.3860 0.4528 -0.0243 -0.1838 -0.0003 234  THR B CB  
4546 O OG1 . THR B 250 ? 0.9589 0.3586 0.4510 -0.0225 -0.2113 -0.0007 234  THR B OG1 
4547 C CG2 . THR B 250 ? 1.0522 0.3938 0.4600 -0.0234 -0.1911 -0.0015 234  THR B CG2 
4548 N N   . SER B 251 ? 0.8189 0.2669 0.3015 -0.0256 -0.1310 0.0014  235  SER B N   
4549 C CA  . SER B 251 ? 0.8094 0.2580 0.2738 -0.0268 -0.1041 0.0009  235  SER B CA  
4550 C C   . SER B 251 ? 0.8952 0.2952 0.3103 -0.0257 -0.1082 -0.0006 235  SER B C   
4551 O O   . SER B 251 ? 0.8982 0.2819 0.3117 -0.0237 -0.1305 -0.0006 235  SER B O   
4552 C CB  . SER B 251 ? 0.7842 0.2844 0.2974 -0.0269 -0.0907 0.0022  235  SER B CB  
4553 O OG  . SER B 251 ? 0.8325 0.3341 0.3316 -0.0278 -0.0654 0.0013  235  SER B OG  
4554 N N   . LYS B 252 ? 0.8746 0.2515 0.2506 -0.0270 -0.0858 -0.0018 236  LYS B N   
4555 C CA  . LYS B 252 ? 0.9243 0.2548 0.2511 -0.0259 -0.0845 -0.0035 236  LYS B CA  
4556 C C   . LYS B 252 ? 0.9331 0.2921 0.2887 -0.0246 -0.0779 -0.0033 236  LYS B C   
4557 O O   . LYS B 252 ? 0.8465 0.2572 0.2516 -0.0254 -0.0670 -0.0022 236  LYS B O   
4558 C CB  . LYS B 252 ? 1.0071 0.3085 0.2889 -0.0278 -0.0585 -0.0049 236  LYS B CB  
4559 N N   . LEU B 253 ? 0.9350 0.2592 0.2591 -0.0226 -0.0857 -0.0045 237  LEU B N   
4560 C CA  . LEU B 253 ? 0.9275 0.2743 0.2747 -0.0213 -0.0804 -0.0045 237  LEU B CA  
4561 C C   . LEU B 253 ? 1.0105 0.3401 0.3265 -0.0215 -0.0533 -0.0067 237  LEU B C   
4562 O O   . LEU B 253 ? 1.0769 0.3618 0.3414 -0.0220 -0.0448 -0.0082 237  LEU B O   
4563 C CB  . LEU B 253 ? 0.9458 0.2706 0.2870 -0.0186 -0.1090 -0.0042 237  LEU B CB  
4564 C CG  . LEU B 253 ? 0.9766 0.3193 0.3555 -0.0182 -0.1374 -0.0023 237  LEU B CG  
4565 C CD1 . LEU B 253 ? 0.9933 0.3096 0.3635 -0.0156 -0.1645 -0.0023 237  LEU B CD1 
4566 C CD2 . LEU B 253 ? 0.9446 0.3531 0.3907 -0.0196 -0.1296 -0.0003 237  LEU B CD2 
4567 N N   . VAL B 254 ? 0.9314 0.2956 0.2788 -0.0212 -0.0392 -0.0070 238  VAL B N   
4568 C CA  . VAL B 254 ? 0.9470 0.3000 0.2734 -0.0210 -0.0134 -0.0095 238  VAL B CA  
4569 C C   . VAL B 254 ? 1.0271 0.3323 0.3098 -0.0181 -0.0262 -0.0108 238  VAL B C   
4570 O O   . VAL B 254 ? 1.0086 0.3235 0.3103 -0.0163 -0.0453 -0.0098 238  VAL B O   
4571 C CB  . VAL B 254 ? 0.9480 0.3546 0.3258 -0.0213 0.0030  -0.0096 238  VAL B CB  
4572 C CG1 . VAL B 254 ? 0.9663 0.3595 0.3242 -0.0207 0.0282  -0.0128 238  VAL B CG1 
4573 C CG2 . VAL B 254 ? 0.9005 0.3522 0.3206 -0.0238 0.0128  -0.0082 238  VAL B CG2 
4574 N N   . ASP B 255 ? 1.0394 0.2910 0.2623 -0.0178 -0.0164 -0.0129 239  ASP B N   
4575 C CA  . ASP B 255 ? 1.0982 0.2959 0.2701 -0.0148 -0.0277 -0.0144 239  ASP B CA  
4576 C C   . ASP B 255 ? 1.1316 0.3349 0.3060 -0.0129 -0.0120 -0.0165 239  ASP B C   
4577 O O   . ASP B 255 ? 1.1506 0.3230 0.2866 -0.0125 0.0106  -0.0193 239  ASP B O   
4578 C CB  . ASP B 255 ? 1.1992 0.3319 0.3010 -0.0151 -0.0241 -0.0158 239  ASP B CB  
4579 C CG  . ASP B 255 ? 1.3845 0.4537 0.4283 -0.0117 -0.0445 -0.0168 239  ASP B CG  
4580 O OD1 . ASP B 255 ? 1.3921 0.4678 0.4514 -0.0091 -0.0636 -0.0164 239  ASP B OD1 
4581 O OD2 . ASP B 255 ? 1.4743 0.4856 0.4561 -0.0118 -0.0424 -0.0179 239  ASP B OD2 
4582 N N   . GLY B 256 ? 1.0574 0.2984 0.2764 -0.0118 -0.0244 -0.0153 240  GLY B N   
4583 C CA  . GLY B 256 ? 1.0527 0.3022 0.2793 -0.0098 -0.0146 -0.0171 240  GLY B CA  
4584 C C   . GLY B 256 ? 1.0682 0.3467 0.3344 -0.0085 -0.0376 -0.0150 240  GLY B C   
4585 O O   . GLY B 256 ? 1.0470 0.3457 0.3424 -0.0095 -0.0589 -0.0121 240  GLY B O   
4586 N N   . LYS B 257 ? 1.0183 0.2981 0.2858 -0.0064 -0.0329 -0.0166 241  LYS B N   
4587 C CA  . LYS B 257 ? 0.9880 0.2946 0.2922 -0.0053 -0.0519 -0.0147 241  LYS B CA  
4588 C C   . LYS B 257 ? 0.9798 0.3462 0.3405 -0.0071 -0.0352 -0.0145 241  LYS B C   
4589 O O   . LYS B 257 ? 0.9709 0.3453 0.3316 -0.0070 -0.0093 -0.0173 241  LYS B O   
4590 C CB  . LYS B 257 ? 1.0647 0.3330 0.3335 -0.0017 -0.0601 -0.0165 241  LYS B CB  
4591 N N   . PHE B 258 ? 0.8816 0.2889 0.2910 -0.0086 -0.0496 -0.0112 242  PHE B N   
4592 C CA  . PHE B 258 ? 0.8097 0.2709 0.2707 -0.0101 -0.0367 -0.0107 242  PHE B CA  
4593 C C   . PHE B 258 ? 0.8813 0.3451 0.3461 -0.0081 -0.0346 -0.0123 242  PHE B C   
4594 O O   . PHE B 258 ? 0.8977 0.3334 0.3413 -0.0060 -0.0529 -0.0119 242  PHE B O   
4595 C CB  . PHE B 258 ? 0.7752 0.2742 0.2828 -0.0122 -0.0528 -0.0067 242  PHE B CB  
4596 C CG  . PHE B 258 ? 0.7200 0.2701 0.2739 -0.0143 -0.0366 -0.0061 242  PHE B CG  
4597 C CD1 . PHE B 258 ? 0.7172 0.2795 0.2754 -0.0160 -0.0201 -0.0066 242  PHE B CD1 
4598 C CD2 . PHE B 258 ? 0.7020 0.2858 0.2935 -0.0145 -0.0385 -0.0049 242  PHE B CD2 
4599 C CE1 . PHE B 258 ? 0.6843 0.2910 0.2838 -0.0176 -0.0069 -0.0061 242  PHE B CE1 
4600 C CE2 . PHE B 258 ? 0.6802 0.3068 0.3106 -0.0162 -0.0247 -0.0044 242  PHE B CE2 
4601 C CZ  . PHE B 258 ? 0.6382 0.2757 0.2724 -0.0176 -0.0095 -0.0051 242  PHE B CZ  
4602 N N   . PRO B 259 ? 0.8300 0.3228 0.3184 -0.0083 -0.0135 -0.0143 243  PRO B N   
4603 C CA  . PRO B 259 ? 0.8376 0.3313 0.3289 -0.0061 -0.0125 -0.0161 243  PRO B CA  
4604 C C   . PRO B 259 ? 0.8669 0.3761 0.3836 -0.0062 -0.0365 -0.0128 243  PRO B C   
4605 O O   . PRO B 259 ? 0.8210 0.3541 0.3674 -0.0084 -0.0492 -0.0091 243  PRO B O   
4606 C CB  . PRO B 259 ? 0.8256 0.3573 0.3508 -0.0071 0.0105  -0.0183 243  PRO B CB  
4607 C CG  . PRO B 259 ? 0.8764 0.4113 0.3992 -0.0090 0.0265  -0.0189 243  PRO B CG  
4608 C CD  . PRO B 259 ? 0.8205 0.3457 0.3353 -0.0104 0.0085  -0.0152 243  PRO B CD  
4609 N N   . ASP B 260 ? 0.8555 0.3513 0.3618 -0.0038 -0.0419 -0.0141 244  ASP B N   
4610 C CA  . ASP B 260 ? 0.8413 0.3513 0.3724 -0.0040 -0.0631 -0.0111 244  ASP B CA  
4611 C C   . ASP B 260 ? 0.8413 0.4035 0.4235 -0.0063 -0.0535 -0.0101 244  ASP B C   
4612 O O   . ASP B 260 ? 0.8170 0.3901 0.4080 -0.0052 -0.0442 -0.0123 244  ASP B O   
4613 C CB  . ASP B 260 ? 0.9016 0.3793 0.4029 -0.0006 -0.0700 -0.0133 244  ASP B CB  
4614 C CG  . ASP B 260 ? 1.0208 0.5052 0.5414 -0.0006 -0.0941 -0.0102 244  ASP B CG  
4615 O OD1 . ASP B 260 ? 0.9825 0.4988 0.5432 -0.0035 -0.1047 -0.0062 244  ASP B OD1 
4616 O OD2 . ASP B 260 ? 1.1288 0.5859 0.6249 0.0023  -0.1018 -0.0117 244  ASP B OD2 
4617 N N   . TYR B 261 ? 0.7781 0.3700 0.3915 -0.0092 -0.0550 -0.0070 245  TYR B N   
4618 C CA  . TYR B 261 ? 0.7347 0.3731 0.3936 -0.0116 -0.0467 -0.0056 245  TYR B CA  
4619 C C   . TYR B 261 ? 0.8144 0.4715 0.5000 -0.0121 -0.0582 -0.0034 245  TYR B C   
4620 O O   . TYR B 261 ? 0.7858 0.4726 0.4987 -0.0131 -0.0487 -0.0037 245  TYR B O   
4621 C CB  . TYR B 261 ? 0.7141 0.3738 0.3949 -0.0143 -0.0476 -0.0026 245  TYR B CB  
4622 C CG  . TYR B 261 ? 0.7132 0.3692 0.4029 -0.0153 -0.0703 0.0014  245  TYR B CG  
4623 C CD1 . TYR B 261 ? 0.7022 0.3855 0.4292 -0.0172 -0.0805 0.0049  245  TYR B CD1 
4624 C CD2 . TYR B 261 ? 0.7448 0.3686 0.4062 -0.0145 -0.0818 0.0015  245  TYR B CD2 
4625 C CE1 . TYR B 261 ? 0.7024 0.3823 0.4416 -0.0182 -0.1009 0.0083  245  TYR B CE1 
4626 C CE2 . TYR B 261 ? 0.7546 0.3740 0.4273 -0.0153 -0.1043 0.0047  245  TYR B CE2 
4627 C CZ  . TYR B 261 ? 0.8223 0.4710 0.5360 -0.0171 -0.1133 0.0080  245  TYR B CZ  
4628 O OH  . TYR B 261 ? 0.8598 0.5052 0.5892 -0.0180 -0.1347 0.0109  245  TYR B OH  
4629 N N   . GLU B 262 ? 0.8157 0.4543 0.4936 -0.0116 -0.0795 -0.0012 246  GLU B N   
4630 C CA  . GLU B 262 ? 0.8165 0.4684 0.5175 -0.0124 -0.0924 0.0012  246  GLU B CA  
4631 C C   . GLU B 262 ? 0.8958 0.5502 0.5936 -0.0106 -0.0824 -0.0020 246  GLU B C   
4632 O O   . GLU B 262 ? 0.8719 0.5503 0.5976 -0.0120 -0.0849 -0.0003 246  GLU B O   
4633 C CB  . GLU B 262 ? 0.8590 0.4830 0.5465 -0.0115 -0.1172 0.0033  246  GLU B CB  
4634 C CG  . GLU B 262 ? 0.9984 0.6252 0.7005 -0.0135 -0.1309 0.0068  246  GLU B CG  
4635 C CD  . GLU B 262 ? 1.3915 0.9837 1.0576 -0.0119 -0.1352 0.0052  246  GLU B CD  
4636 O OE1 . GLU B 262 ? 1.3022 0.8822 0.9411 -0.0106 -0.1180 0.0019  246  GLU B OE1 
4637 O OE2 . GLU B 262 ? 1.3829 0.9596 1.0491 -0.0121 -0.1560 0.0073  246  GLU B OE2 
4638 N N   . ARG B 263 ? 0.8992 0.5283 0.5631 -0.0076 -0.0701 -0.0067 247  ARG B N   
4639 C CA  . ARG B 263 ? 0.9107 0.5391 0.5697 -0.0053 -0.0587 -0.0107 247  ARG B CA  
4640 C C   . ARG B 263 ? 0.9358 0.5959 0.6202 -0.0063 -0.0378 -0.0130 247  ARG B C   
4641 O O   . ARG B 263 ? 0.9380 0.6051 0.6289 -0.0049 -0.0296 -0.0162 247  ARG B O   
4642 C CB  . ARG B 263 ? 0.9733 0.5578 0.5846 -0.0015 -0.0540 -0.0149 247  ARG B CB  
4643 N N   . VAL B 264 ? 0.8674 0.5454 0.5663 -0.0086 -0.0304 -0.0116 248  VAL B N   
4644 C CA  . VAL B 264 ? 0.8302 0.5370 0.5538 -0.0095 -0.0126 -0.0134 248  VAL B CA  
4645 C C   . VAL B 264 ? 0.7892 0.5317 0.5522 -0.0123 -0.0192 -0.0098 248  VAL B C   
4646 O O   . VAL B 264 ? 0.7613 0.5269 0.5463 -0.0127 -0.0086 -0.0115 248  VAL B O   
4647 C CB  . VAL B 264 ? 0.8966 0.6006 0.6117 -0.0103 -0.0003 -0.0141 248  VAL B CB  
4648 C CG1 . VAL B 264 ? 0.8760 0.6073 0.6163 -0.0110 0.0175  -0.0164 248  VAL B CG1 
4649 C CG2 . VAL B 264 ? 0.9375 0.6018 0.6096 -0.0079 0.0062  -0.0174 248  VAL B CG2 
4650 N N   . LEU B 265 ? 0.6814 0.4262 0.4529 -0.0141 -0.0368 -0.0051 249  LEU B N   
4651 C CA  . LEU B 265 ? 0.6207 0.3952 0.4265 -0.0169 -0.0425 -0.0012 249  LEU B CA  
4652 C C   . LEU B 265 ? 0.6054 0.3882 0.4219 -0.0164 -0.0437 -0.0023 249  LEU B C   
4653 O O   . LEU B 265 ? 0.5773 0.3413 0.3788 -0.0148 -0.0527 -0.0031 249  LEU B O   
4654 C CB  . LEU B 265 ? 0.6228 0.3964 0.4368 -0.0191 -0.0595 0.0040  249  LEU B CB  
4655 C CG  . LEU B 265 ? 0.7009 0.4648 0.5051 -0.0195 -0.0615 0.0052  249  LEU B CG  
4656 C CD1 . LEU B 265 ? 0.7102 0.4740 0.5281 -0.0214 -0.0796 0.0098  249  LEU B CD1 
4657 C CD2 . LEU B 265 ? 0.6980 0.4831 0.5157 -0.0206 -0.0467 0.0049  249  LEU B CD2 
4658 N N   . PRO B 266 ? 0.5186 0.3265 0.3584 -0.0175 -0.0349 -0.0029 250  PRO B N   
4659 C CA  . PRO B 266 ? 0.5043 0.3188 0.3537 -0.0170 -0.0369 -0.0043 250  PRO B CA  
4660 C C   . PRO B 266 ? 0.5642 0.3812 0.4238 -0.0194 -0.0531 0.0006  250  PRO B C   
4661 O O   . PRO B 266 ? 0.5367 0.3657 0.4120 -0.0224 -0.0583 0.0054  250  PRO B O   
4662 C CB  . PRO B 266 ? 0.4975 0.3363 0.3689 -0.0179 -0.0258 -0.0055 250  PRO B CB  
4663 C CG  . PRO B 266 ? 0.5337 0.3835 0.4132 -0.0199 -0.0226 -0.0024 250  PRO B CG  
4664 C CD  . PRO B 266 ? 0.5048 0.3344 0.3623 -0.0191 -0.0245 -0.0023 250  PRO B CD  
4665 N N   . ARG B 267 ? 0.5649 0.3687 0.4151 -0.0178 -0.0609 -0.0007 251  ARG B N   
4666 C CA  . ARG B 267 ? 0.5791 0.3821 0.4375 -0.0199 -0.0768 0.0036  251  ARG B CA  
4667 C C   . ARG B 267 ? 0.6365 0.4518 0.5090 -0.0206 -0.0773 0.0031  251  ARG B C   
4668 O O   . ARG B 267 ? 0.6449 0.4664 0.5311 -0.0234 -0.0875 0.0073  251  ARG B O   
4669 C CB  . ARG B 267 ? 0.6131 0.3865 0.4465 -0.0175 -0.0890 0.0030  251  ARG B CB  
4670 N N   . GLY B 268 ? 0.6012 0.4192 0.4711 -0.0181 -0.0662 -0.0022 252  GLY B N   
4671 C CA  . GLY B 268 ? 0.6041 0.4313 0.4852 -0.0181 -0.0664 -0.0039 252  GLY B CA  
4672 C C   . GLY B 268 ? 0.6376 0.4868 0.5424 -0.0219 -0.0668 -0.0001 252  GLY B C   
4673 O O   . GLY B 268 ? 0.6625 0.5147 0.5750 -0.0235 -0.0745 0.0016  252  GLY B O   
4674 N N   . GLY B 269 ? 0.5221 0.3844 0.4362 -0.0233 -0.0584 0.0013  253  GLY B N   
4675 C CA  . GLY B 269 ? 0.4803 0.3612 0.4132 -0.0266 -0.0560 0.0046  253  GLY B CA  
4676 C C   . GLY B 269 ? 0.4833 0.3690 0.4265 -0.0296 -0.0642 0.0082  253  GLY B C   
4677 O O   . GLY B 269 ? 0.5170 0.4001 0.4637 -0.0322 -0.0729 0.0130  253  GLY B O   
4678 N N   . ASP B 270 ? 0.3842 0.2755 0.3328 -0.0292 -0.0619 0.0058  254  ASP B N   
4679 C CA  . ASP B 270 ? 0.3742 0.2676 0.3298 -0.0321 -0.0691 0.0088  254  ASP B CA  
4680 C C   . ASP B 270 ? 0.3936 0.2981 0.3588 -0.0345 -0.0639 0.0108  254  ASP B C   
4681 O O   . ASP B 270 ? 0.3755 0.2800 0.3443 -0.0373 -0.0684 0.0136  254  ASP B O   
4682 C CB  . ASP B 270 ? 0.4058 0.2905 0.3554 -0.0294 -0.0743 0.0039  254  ASP B CB  
4683 C CG  . ASP B 270 ? 0.5184 0.4047 0.4684 -0.0255 -0.0669 -0.0032 254  ASP B CG  
4684 O OD1 . ASP B 270 ? 0.5509 0.4447 0.5051 -0.0248 -0.0576 -0.0044 254  ASP B OD1 
4685 O OD2 . ASP B 270 ? 0.5411 0.4211 0.4889 -0.0230 -0.0706 -0.0077 254  ASP B OD2 
4686 N N   . LYS B 271 ? 0.3231 0.2348 0.2907 -0.0333 -0.0546 0.0093  255  LYS B N   
4687 C CA  . LYS B 271 ? 0.3115 0.2311 0.2854 -0.0350 -0.0498 0.0109  255  LYS B CA  
4688 C C   . LYS B 271 ? 0.3517 0.2790 0.3301 -0.0369 -0.0433 0.0151  255  LYS B C   
4689 O O   . LYS B 271 ? 0.3601 0.2894 0.3368 -0.0349 -0.0381 0.0131  255  LYS B O   
4690 C CB  . LYS B 271 ? 0.3261 0.2468 0.3007 -0.0314 -0.0456 0.0045  255  LYS B CB  
4691 C CG  . LYS B 271 ? 0.2895 0.2031 0.2627 -0.0294 -0.0522 -0.0001 255  LYS B CG  
4692 C CD  . LYS B 271 ? 0.3468 0.2615 0.3251 -0.0254 -0.0482 -0.0073 255  LYS B CD  
4693 C CE  . LYS B 271 ? 0.3500 0.2574 0.3287 -0.0230 -0.0549 -0.0124 255  LYS B CE  
4694 N NZ  . LYS B 271 ? 0.4034 0.3039 0.3748 -0.0210 -0.0551 -0.0146 255  LYS B NZ  
4695 N N   . LEU B 272 ? 0.3072 0.2376 0.2909 -0.0408 -0.0430 0.0207  256  LEU B N   
4696 C CA  . LEU B 272 ? 0.3061 0.2439 0.2961 -0.0428 -0.0363 0.0249  256  LEU B CA  
4697 C C   . LEU B 272 ? 0.3433 0.2842 0.3325 -0.0430 -0.0298 0.0251  256  LEU B C   
4698 O O   . LEU B 272 ? 0.3323 0.2687 0.3192 -0.0451 -0.0311 0.0271  256  LEU B O   
4699 C CB  . LEU B 272 ? 0.3180 0.2564 0.3168 -0.0470 -0.0391 0.0312  256  LEU B CB  
4700 C CG  . LEU B 272 ? 0.3774 0.3236 0.3859 -0.0494 -0.0313 0.0357  256  LEU B CG  
4701 C CD1 . LEU B 272 ? 0.3660 0.3170 0.3759 -0.0470 -0.0285 0.0341  256  LEU B CD1 
4702 C CD2 . LEU B 272 ? 0.3990 0.3453 0.4200 -0.0538 -0.0336 0.0415  256  LEU B CD2 
4703 N N   . VAL B 273 ? 0.2817 0.2282 0.2712 -0.0409 -0.0231 0.0231  257  VAL B N   
4704 C CA  . VAL B 273 ? 0.2824 0.2302 0.2700 -0.0405 -0.0177 0.0230  257  VAL B CA  
4705 C C   . VAL B 273 ? 0.3169 0.2713 0.3092 -0.0421 -0.0103 0.0272  257  VAL B C   
4706 O O   . VAL B 273 ? 0.2934 0.2531 0.2892 -0.0410 -0.0081 0.0266  257  VAL B O   
4707 C CB  . VAL B 273 ? 0.3341 0.2827 0.3202 -0.0364 -0.0164 0.0167  257  VAL B CB  
4708 C CG1 . VAL B 273 ? 0.3304 0.2785 0.3144 -0.0358 -0.0129 0.0165  257  VAL B CG1 
4709 C CG2 . VAL B 273 ? 0.3415 0.2840 0.3260 -0.0345 -0.0232 0.0119  257  VAL B CG2 
4710 N N   . VAL B 274 ? 0.2623 0.2147 0.2534 -0.0446 -0.0063 0.0312  258  VAL B N   
4711 C CA  . VAL B 274 ? 0.2675 0.2256 0.2637 -0.0459 0.0019  0.0350  258  VAL B CA  
4712 C C   . VAL B 274 ? 0.3087 0.2638 0.2963 -0.0442 0.0068  0.0338  258  VAL B C   
4713 O O   . VAL B 274 ? 0.3036 0.2486 0.2815 -0.0449 0.0056  0.0342  258  VAL B O   
4714 C CB  . VAL B 274 ? 0.3285 0.2861 0.3324 -0.0503 0.0047  0.0411  258  VAL B CB  
4715 C CG1 . VAL B 274 ? 0.3244 0.2890 0.3367 -0.0511 0.0138  0.0442  258  VAL B CG1 
4716 C CG2 . VAL B 274 ? 0.3293 0.2878 0.3420 -0.0518 -0.0028 0.0420  258  VAL B CG2 
4717 N N   . GLY B 275 ? 0.2677 0.2295 0.2575 -0.0420 0.0111  0.0323  259  GLY B N   
4718 C CA  . GLY B 275 ? 0.2622 0.2207 0.2445 -0.0400 0.0146  0.0309  259  GLY B CA  
4719 C C   . GLY B 275 ? 0.2858 0.2504 0.2711 -0.0399 0.0227  0.0332  259  GLY B C   
4720 O O   . GLY B 275 ? 0.2407 0.2136 0.2359 -0.0409 0.0251  0.0351  259  GLY B O   
4721 N N   . ASP B 276 ? 0.2430 0.2023 0.2196 -0.0383 0.0257  0.0328  260  ASP B N   
4722 C CA  . ASP B 276 ? 0.2354 0.1990 0.2129 -0.0376 0.0333  0.0345  260  ASP B CA  
4723 C C   . ASP B 276 ? 0.2584 0.2316 0.2422 -0.0349 0.0324  0.0308  260  ASP B C   
4724 O O   . ASP B 276 ? 0.2241 0.1953 0.2054 -0.0325 0.0283  0.0265  260  ASP B O   
4725 C CB  . ASP B 276 ? 0.2559 0.2072 0.2188 -0.0366 0.0360  0.0353  260  ASP B CB  
4726 C CG  . ASP B 276 ? 0.3156 0.2705 0.2791 -0.0360 0.0447  0.0376  260  ASP B CG  
4727 O OD1 . ASP B 276 ? 0.3248 0.2818 0.2934 -0.0385 0.0521  0.0418  260  ASP B OD1 
4728 O OD2 . ASP B 276 ? 0.2645 0.2216 0.2264 -0.0331 0.0442  0.0350  260  ASP B OD2 
4729 N N   . ARG B 277 ? 0.2133 0.1958 0.2063 -0.0355 0.0357  0.0322  261  ARG B N   
4730 C CA  . ARG B 277 ? 0.2043 0.1936 0.2009 -0.0334 0.0354  0.0290  261  ARG B CA  
4731 C C   . ARG B 277 ? 0.2343 0.2224 0.2258 -0.0306 0.0373  0.0265  261  ARG B C   
4732 O O   . ARG B 277 ? 0.2170 0.2056 0.2091 -0.0287 0.0348  0.0223  261  ARG B O   
4733 C CB  . ARG B 277 ? 0.2192 0.2157 0.2242 -0.0344 0.0381  0.0314  261  ARG B CB  
4734 C CG  . ARG B 277 ? 0.2846 0.2850 0.2903 -0.0327 0.0372  0.0284  261  ARG B CG  
4735 C CD  . ARG B 277 ? 0.2407 0.2464 0.2513 -0.0326 0.0409  0.0303  261  ARG B CD  
4736 N NE  . ARG B 277 ? 0.2611 0.2676 0.2682 -0.0311 0.0463  0.0306  261  ARG B NE  
4737 C CZ  . ARG B 277 ? 0.3755 0.3823 0.3779 -0.0288 0.0473  0.0277  261  ARG B CZ  
4738 N NH1 . ARG B 277 ? 0.2545 0.2613 0.2556 -0.0280 0.0451  0.0243  261  ARG B NH1 
4739 N NH2 . ARG B 277 ? 0.2382 0.2441 0.2368 -0.0274 0.0510  0.0283  261  ARG B NH2 
4740 N N   . GLN B 278 ? 0.2325 0.2182 0.2195 -0.0304 0.0419  0.0291  262  GLN B N   
4741 C CA  . GLN B 278 ? 0.2355 0.2185 0.2170 -0.0277 0.0428  0.0272  262  GLN B CA  
4742 C C   . GLN B 278 ? 0.2610 0.2349 0.2368 -0.0261 0.0366  0.0238  262  GLN B C   
4743 O O   . GLN B 278 ? 0.2521 0.2277 0.2312 -0.0239 0.0343  0.0201  262  GLN B O   
4744 C CB  . GLN B 278 ? 0.2418 0.2211 0.2172 -0.0277 0.0491  0.0308  262  GLN B CB  
4745 C CG  . GLN B 278 ? 0.3158 0.2934 0.2865 -0.0247 0.0495  0.0289  262  GLN B CG  
4746 C CD  . GLN B 278 ? 0.5188 0.4891 0.4797 -0.0241 0.0555  0.0321  262  GLN B CD  
4747 O OE1 . GLN B 278 ? 0.4325 0.4009 0.3925 -0.0261 0.0615  0.0359  262  GLN B OE1 
4748 N NE2 . GLN B 278 ? 0.5257 0.4902 0.4789 -0.0213 0.0543  0.0307  262  GLN B NE2 
4749 N N   . GLN B 279 ? 0.2495 0.2133 0.2177 -0.0273 0.0336  0.0251  263  GLN B N   
4750 C CA  . GLN B 279 ? 0.2661 0.2190 0.2288 -0.0257 0.0257  0.0218  263  GLN B CA  
4751 C C   . GLN B 279 ? 0.2860 0.2460 0.2609 -0.0246 0.0210  0.0167  263  GLN B C   
4752 O O   . GLN B 279 ? 0.2709 0.2285 0.2496 -0.0221 0.0166  0.0126  263  GLN B O   
4753 C CB  . GLN B 279 ? 0.2977 0.2380 0.2495 -0.0277 0.0232  0.0243  263  GLN B CB  
4754 C CG  . GLN B 279 ? 0.4555 0.3812 0.3993 -0.0259 0.0134  0.0209  263  GLN B CG  
4755 C CD  . GLN B 279 ? 0.6032 0.5136 0.5328 -0.0282 0.0111  0.0237  263  GLN B CD  
4756 O OE1 . GLN B 279 ? 0.4741 0.3878 0.4049 -0.0314 0.0158  0.0273  263  GLN B OE1 
4757 N NE2 . GLN B 279 ? 0.5077 0.3995 0.4238 -0.0266 0.0028  0.0219  263  GLN B NE2 
4758 N N   . LEU B 280 ? 0.2237 0.1913 0.2052 -0.0263 0.0223  0.0170  264  LEU B N   
4759 C CA  . LEU B 280 ? 0.2208 0.1929 0.2113 -0.0252 0.0198  0.0123  264  LEU B CA  
4760 C C   . LEU B 280 ? 0.2625 0.2417 0.2599 -0.0233 0.0239  0.0095  264  LEU B C   
4761 O O   . LEU B 280 ? 0.2285 0.2075 0.2335 -0.0214 0.0221  0.0047  264  LEU B O   
4762 C CB  . LEU B 280 ? 0.2105 0.1860 0.2027 -0.0272 0.0199  0.0137  264  LEU B CB  
4763 C CG  . LEU B 280 ? 0.2642 0.2323 0.2521 -0.0289 0.0144  0.0151  264  LEU B CG  
4764 C CD1 . LEU B 280 ? 0.2699 0.2411 0.2596 -0.0314 0.0145  0.0179  264  LEU B CD1 
4765 C CD2 . LEU B 280 ? 0.2829 0.2459 0.2734 -0.0270 0.0079  0.0099  264  LEU B CD2 
4766 N N   . ARG B 281 ? 0.2415 0.2266 0.2378 -0.0241 0.0297  0.0124  265  ARG B N   
4767 C CA  . ARG B 281 ? 0.2421 0.2328 0.2434 -0.0227 0.0339  0.0101  265  ARG B CA  
4768 C C   . ARG B 281 ? 0.2533 0.2414 0.2577 -0.0204 0.0322  0.0074  265  ARG B C   
4769 O O   . ARG B 281 ? 0.2345 0.2246 0.2477 -0.0190 0.0330  0.0031  265  ARG B O   
4770 C CB  . ARG B 281 ? 0.2623 0.2584 0.2613 -0.0238 0.0389  0.0135  265  ARG B CB  
4771 C CG  . ARG B 281 ? 0.3681 0.3677 0.3699 -0.0232 0.0428  0.0108  265  ARG B CG  
4772 C CD  . ARG B 281 ? 0.4557 0.4587 0.4546 -0.0241 0.0460  0.0135  265  ARG B CD  
4773 N NE  . ARG B 281 ? 0.4222 0.4250 0.4201 -0.0237 0.0497  0.0109  265  ARG B NE  
4774 C CZ  . ARG B 281 ? 0.6772 0.6817 0.6773 -0.0225 0.0533  0.0091  265  ARG B CZ  
4775 N NH1 . ARG B 281 ? 0.4811 0.4874 0.4847 -0.0212 0.0524  0.0094  265  ARG B NH1 
4776 N NH2 . ARG B 281 ? 0.6229 0.6254 0.6204 -0.0226 0.0576  0.0070  265  ARG B NH2 
4777 N N   . GLU B 282 ? 0.2335 0.2151 0.2304 -0.0199 0.0296  0.0098  266  GLU B N   
4778 C CA  . GLU B 282 ? 0.2512 0.2267 0.2484 -0.0175 0.0256  0.0078  266  GLU B CA  
4779 C C   . GLU B 282 ? 0.2839 0.2540 0.2892 -0.0160 0.0180  0.0028  266  GLU B C   
4780 O O   . GLU B 282 ? 0.2659 0.2367 0.2820 -0.0140 0.0159  -0.0010 266  GLU B O   
4781 C CB  . GLU B 282 ? 0.2780 0.2438 0.2605 -0.0174 0.0247  0.0118  266  GLU B CB  
4782 C CG  . GLU B 282 ? 0.3465 0.3185 0.3257 -0.0179 0.0324  0.0153  266  GLU B CG  
4783 C CD  . GLU B 282 ? 0.5007 0.4628 0.4651 -0.0177 0.0344  0.0193  266  GLU B CD  
4784 O OE1 . GLU B 282 ? 0.5095 0.4769 0.4728 -0.0179 0.0410  0.0220  266  GLU B OE1 
4785 O OE2 . GLU B 282 ? 0.4987 0.4464 0.4518 -0.0172 0.0296  0.0197  266  GLU B OE2 
4786 N N   . ALA B 283 ? 0.2393 0.2046 0.2416 -0.0170 0.0138  0.0028  267  ALA B N   
4787 C CA  . ALA B 283 ? 0.2356 0.1955 0.2465 -0.0155 0.0059  -0.0021 267  ALA B CA  
4788 C C   . ALA B 283 ? 0.2556 0.2254 0.2842 -0.0148 0.0100  -0.0070 267  ALA B C   
4789 O O   . ALA B 283 ? 0.2398 0.2083 0.2826 -0.0127 0.0061  -0.0120 267  ALA B O   
4790 C CB  . ALA B 283 ? 0.2476 0.2002 0.2499 -0.0171 0.0012  -0.0007 267  ALA B CB  
4791 N N   . PHE B 284 ? 0.2115 0.1892 0.2392 -0.0165 0.0178  -0.0058 268  PHE B N   
4792 C CA  . PHE B 284 ? 0.2137 0.1972 0.2531 -0.0159 0.0238  -0.0100 268  PHE B CA  
4793 C C   . PHE B 284 ? 0.2710 0.2586 0.3206 -0.0146 0.0283  -0.0122 268  PHE B C   
4794 O O   . PHE B 284 ? 0.2627 0.2514 0.3286 -0.0131 0.0294  -0.0175 268  PHE B O   
4795 C CB  . PHE B 284 ? 0.2376 0.2245 0.2684 -0.0179 0.0303  -0.0075 268  PHE B CB  
4796 C CG  . PHE B 284 ? 0.2619 0.2453 0.2857 -0.0192 0.0264  -0.0060 268  PHE B CG  
4797 C CD1 . PHE B 284 ? 0.3176 0.2956 0.3444 -0.0185 0.0188  -0.0081 268  PHE B CD1 
4798 C CD2 . PHE B 284 ? 0.2800 0.2643 0.2945 -0.0211 0.0290  -0.0025 268  PHE B CD2 
4799 C CE1 . PHE B 284 ? 0.3329 0.3073 0.3532 -0.0199 0.0149  -0.0066 268  PHE B CE1 
4800 C CE2 . PHE B 284 ? 0.3142 0.2949 0.3237 -0.0224 0.0246  -0.0011 268  PHE B CE2 
4801 C CZ  . PHE B 284 ? 0.3118 0.2879 0.3238 -0.0219 0.0180  -0.0029 268  PHE B CZ  
4802 N N   . SER B 285 ? 0.2408 0.2304 0.2825 -0.0152 0.0306  -0.0083 269  SER B N   
4803 C CA  . SER B 285 ? 0.2522 0.2453 0.3017 -0.0142 0.0345  -0.0096 269  SER B CA  
4804 C C   . SER B 285 ? 0.2954 0.2841 0.3582 -0.0118 0.0267  -0.0133 269  SER B C   
4805 O O   . SER B 285 ? 0.2873 0.2792 0.3677 -0.0108 0.0296  -0.0176 269  SER B O   
4806 C CB  . SER B 285 ? 0.2936 0.2889 0.3307 -0.0151 0.0375  -0.0046 269  SER B CB  
4807 O OG  . SER B 285 ? 0.4262 0.4258 0.4702 -0.0147 0.0431  -0.0060 269  SER B OG  
4808 N N   . ARG B 286 ? 0.2395 0.2191 0.2938 -0.0109 0.0168  -0.0117 270  ARG B N   
4809 C CA  . ARG B 286 ? 0.2426 0.2136 0.3060 -0.0084 0.0062  -0.0149 270  ARG B CA  
4810 C C   . ARG B 286 ? 0.2431 0.2149 0.3282 -0.0072 0.0029  -0.0213 270  ARG B C   
4811 O O   . ARG B 286 ? 0.2150 0.1875 0.3204 -0.0054 0.0003  -0.0257 270  ARG B O   
4812 C CB  . ARG B 286 ? 0.2945 0.2511 0.3395 -0.0079 -0.0038 -0.0121 270  ARG B CB  
4813 C CG  . ARG B 286 ? 0.4686 0.4191 0.4956 -0.0078 -0.0034 -0.0074 270  ARG B CG  
4814 C CD  . ARG B 286 ? 0.4165 0.3474 0.4272 -0.0064 -0.0148 -0.0064 270  ARG B CD  
4815 N NE  . ARG B 286 ? 0.5870 0.5126 0.5827 -0.0085 -0.0142 -0.0034 270  ARG B NE  
4816 C CZ  . ARG B 286 ? 0.6311 0.5575 0.6105 -0.0107 -0.0063 0.0021  270  ARG B CZ  
4817 N NH1 . ARG B 286 ? 0.4402 0.3720 0.4150 -0.0107 0.0013  0.0051  270  ARG B NH1 
4818 N NH2 . ARG B 286 ? 0.5559 0.4774 0.5248 -0.0128 -0.0060 0.0045  270  ARG B NH2 
4819 N N   . THR B 287 ? 0.2044 0.1757 0.2867 -0.0081 0.0028  -0.0219 271  THR B N   
4820 C CA  . THR B 287 ? 0.2139 0.1855 0.3167 -0.0067 -0.0001 -0.0282 271  THR B CA  
4821 C C   . THR B 287 ? 0.2545 0.2360 0.3782 -0.0065 0.0112  -0.0324 271  THR B C   
4822 O O   . THR B 287 ? 0.2519 0.2335 0.4002 -0.0046 0.0081  -0.0382 271  THR B O   
4823 C CB  . THR B 287 ? 0.3081 0.2761 0.4021 -0.0076 -0.0029 -0.0279 271  THR B CB  
4824 O OG1 . THR B 287 ? 0.3554 0.3305 0.4385 -0.0099 0.0081  -0.0248 271  THR B OG1 
4825 C CG2 . THR B 287 ? 0.2886 0.2440 0.3631 -0.0079 -0.0142 -0.0243 271  THR B CG2 
4826 N N   . ALA B 288 ? 0.2134 0.2018 0.3274 -0.0085 0.0238  -0.0294 272  ALA B N   
4827 C CA  . ALA B 288 ? 0.2315 0.2264 0.3584 -0.0089 0.0370  -0.0324 272  ALA B CA  
4828 C C   . ALA B 288 ? 0.2669 0.2645 0.4147 -0.0078 0.0377  -0.0352 272  ALA B C   
4829 O O   . ALA B 288 ? 0.2603 0.2619 0.4257 -0.0078 0.0481  -0.0392 272  ALA B O   
4830 C CB  . ALA B 288 ? 0.2505 0.2480 0.3571 -0.0113 0.0469  -0.0278 272  ALA B CB  
4831 N N   . ILE B 289 ? 0.2272 0.2212 0.3726 -0.0067 0.0272  -0.0332 273  ILE B N   
4832 C CA  . ILE B 289 ? 0.2150 0.2100 0.3801 -0.0054 0.0250  -0.0356 273  ILE B CA  
4833 C C   . ILE B 289 ? 0.2384 0.2340 0.4366 -0.0036 0.0229  -0.0430 273  ILE B C   
4834 O O   . ILE B 289 ? 0.2347 0.2354 0.4565 -0.0036 0.0299  -0.0463 273  ILE B O   
4835 C CB  . ILE B 289 ? 0.2488 0.2354 0.4019 -0.0039 0.0114  -0.0324 273  ILE B CB  
4836 C CG1 . ILE B 289 ? 0.2404 0.2273 0.3638 -0.0056 0.0157  -0.0253 273  ILE B CG1 
4837 C CG2 . ILE B 289 ? 0.2531 0.2382 0.4288 -0.0020 0.0054  -0.0355 273  ILE B CG2 
4838 C CD1 . ILE B 289 ? 0.2547 0.2303 0.3600 -0.0042 0.0040  -0.0217 273  ILE B CD1 
4839 N N   . LEU B 290 ? 0.2045 0.1950 0.4053 -0.0024 0.0142  -0.0455 274  LEU B N   
4840 C CA  . LEU B 290 ? 0.1958 0.1862 0.4287 -0.0004 0.0106  -0.0529 274  LEU B CA  
4841 C C   . LEU B 290 ? 0.2502 0.2455 0.4904 -0.0011 0.0235  -0.0563 274  LEU B C   
4842 O O   . LEU B 290 ? 0.2176 0.2124 0.4830 0.0007  0.0206  -0.0626 274  LEU B O   
4843 C CB  . LEU B 290 ? 0.1970 0.1758 0.4337 0.0021  -0.0102 -0.0549 274  LEU B CB  
4844 C CG  . LEU B 290 ? 0.2474 0.2174 0.4793 0.0035  -0.0237 -0.0527 274  LEU B CG  
4845 C CD1 . LEU B 290 ? 0.2608 0.2150 0.4929 0.0061  -0.0450 -0.0550 274  LEU B CD1 
4846 C CD2 . LEU B 290 ? 0.2506 0.2271 0.5112 0.0041  -0.0196 -0.0557 274  LEU B CD2 
4847 N N   . SER B 291 ? 0.2202 0.2190 0.4388 -0.0035 0.0377  -0.0526 275  SER B N   
4848 C CA  . SER B 291 ? 0.2271 0.2276 0.4485 -0.0041 0.0513  -0.0556 275  SER B CA  
4849 C C   . SER B 291 ? 0.2863 0.2915 0.5337 -0.0043 0.0668  -0.0602 275  SER B C   
4850 O O   . SER B 291 ? 0.2459 0.2543 0.5029 -0.0047 0.0678  -0.0593 275  SER B O   
4851 C CB  . SER B 291 ? 0.2565 0.2554 0.4436 -0.0064 0.0587  -0.0499 275  SER B CB  
4852 O OG  . SER B 291 ? 0.3129 0.3143 0.4896 -0.0083 0.0682  -0.0464 275  SER B OG  
4853 N N   . ASN B 292 ? 0.2843 0.2889 0.5417 -0.0040 0.0795  -0.0648 276  ASN B N   
4854 C CA  . ASN B 292 ? 0.3020 0.3088 0.5817 -0.0045 0.0979  -0.0694 276  ASN B CA  
4855 C C   . ASN B 292 ? 0.3700 0.3755 0.6246 -0.0074 0.1104  -0.0641 276  ASN B C   
4856 O O   . ASN B 292 ? 0.3560 0.3564 0.5769 -0.0087 0.1127  -0.0596 276  ASN B O   
4857 C CB  . ASN B 292 ? 0.3627 0.3657 0.6493 -0.0035 0.1093  -0.0747 276  ASN B CB  
4858 C CG  . ASN B 292 ? 0.5333 0.5369 0.8469 -0.0037 0.1296  -0.0804 276  ASN B CG  
4859 O OD1 . ASN B 292 ? 0.4450 0.4459 0.7467 -0.0061 0.1456  -0.0784 276  ASN B OD1 
4860 N ND2 . ASN B 292 ? 0.3900 0.3959 0.7401 -0.0013 0.1301  -0.0879 276  ASN B ND2 
4861 N N   . GLU B 293 ? 0.3616 0.3709 0.6329 -0.0084 0.1163  -0.0645 277  GLU B N   
4862 C CA  . GLU B 293 ? 0.3823 0.3898 0.6322 -0.0111 0.1269  -0.0599 277  GLU B CA  
4863 C C   . GLU B 293 ? 0.4665 0.4651 0.6956 -0.0129 0.1466  -0.0600 277  GLU B C   
4864 O O   . GLU B 293 ? 0.4737 0.4670 0.6716 -0.0149 0.1504  -0.0550 277  GLU B O   
4865 C CB  . GLU B 293 ? 0.3987 0.4115 0.6752 -0.0117 0.1297  -0.0612 277  GLU B CB  
4866 N N   . LYS B 294 ? 0.4493 0.4443 0.6941 -0.0119 0.1580  -0.0659 278  LYS B N   
4867 C CA  . LYS B 294 ? 0.4806 0.4632 0.7049 -0.0132 0.1775  -0.0669 278  LYS B CA  
4868 C C   . LYS B 294 ? 0.5544 0.5280 0.7441 -0.0126 0.1727  -0.0644 278  LYS B C   
4869 O O   . LYS B 294 ? 0.5865 0.5465 0.7467 -0.0139 0.1846  -0.0629 278  LYS B O   
4870 C CB  . LYS B 294 ? 0.5209 0.5020 0.7779 -0.0123 0.1946  -0.0746 278  LYS B CB  
4871 N N   . TYR B 295 ? 0.4749 0.4541 0.6673 -0.0107 0.1550  -0.0640 279  TYR B N   
4872 C CA  . TYR B 295 ? 0.4721 0.4434 0.6362 -0.0102 0.1496  -0.0620 279  TYR B CA  
4873 C C   . TYR B 295 ? 0.4677 0.4424 0.6102 -0.0108 0.1317  -0.0553 279  TYR B C   
4874 O O   . TYR B 295 ? 0.4654 0.4322 0.5788 -0.0114 0.1295  -0.0519 279  TYR B O   
4875 C CB  . TYR B 295 ? 0.5027 0.4733 0.6849 -0.0075 0.1486  -0.0680 279  TYR B CB  
4876 C CG  . TYR B 295 ? 0.5622 0.5302 0.7708 -0.0066 0.1674  -0.0752 279  TYR B CG  
4877 C CD1 . TYR B 295 ? 0.6173 0.5716 0.8079 -0.0078 0.1884  -0.0761 279  TYR B CD1 
4878 C CD2 . TYR B 295 ? 0.5704 0.5480 0.8223 -0.0046 0.1644  -0.0813 279  TYR B CD2 
4879 C CE1 . TYR B 295 ? 0.6563 0.6070 0.8714 -0.0072 0.2082  -0.0828 279  TYR B CE1 
4880 C CE2 . TYR B 295 ? 0.5968 0.5727 0.8775 -0.0038 0.1828  -0.0883 279  TYR B CE2 
4881 C CZ  . TYR B 295 ? 0.7512 0.7141 1.0135 -0.0052 0.2059  -0.0889 279  TYR B CZ  
4882 O OH  . TYR B 295 ? 0.8144 0.7744 1.1050 -0.0047 0.2266  -0.0958 279  TYR B OH  
4883 N N   . ARG B 296 ? 0.3610 0.3461 0.5180 -0.0106 0.1190  -0.0535 280  ARG B N   
4884 C CA  . ARG B 296 ? 0.3432 0.3314 0.4823 -0.0112 0.1038  -0.0473 280  ARG B CA  
4885 C C   . ARG B 296 ? 0.3840 0.3687 0.5083 -0.0107 0.0937  -0.0458 280  ARG B C   
4886 O O   . ARG B 296 ? 0.3939 0.3765 0.4939 -0.0120 0.0882  -0.0403 280  ARG B O   
4887 C CB  . ARG B 296 ? 0.3586 0.3447 0.4742 -0.0136 0.1084  -0.0418 280  ARG B CB  
4888 C CG  . ARG B 296 ? 0.4667 0.4566 0.5963 -0.0144 0.1163  -0.0426 280  ARG B CG  
4889 C CD  . ARG B 296 ? 0.4768 0.4753 0.6193 -0.0137 0.1037  -0.0407 280  ARG B CD  
4890 N NE  . ARG B 296 ? 0.5463 0.5454 0.6651 -0.0145 0.0939  -0.0343 280  ARG B NE  
4891 C CZ  . ARG B 296 ? 0.6401 0.6432 0.7616 -0.0136 0.0815  -0.0319 280  ARG B CZ  
4892 N NH1 . ARG B 296 ? 0.4049 0.4108 0.5504 -0.0119 0.0751  -0.0352 280  ARG B NH1 
4893 N NH2 . ARG B 296 ? 0.4138 0.4167 0.5142 -0.0144 0.0753  -0.0262 280  ARG B NH2 
4894 N N   . GLY B 297 ? 0.3238 0.3079 0.4650 -0.0087 0.0913  -0.0509 281  GLY B N   
4895 C CA  . GLY B 297 ? 0.3279 0.3083 0.4586 -0.0080 0.0818  -0.0504 281  GLY B CA  
4896 C C   . GLY B 297 ? 0.3476 0.3317 0.4835 -0.0074 0.0642  -0.0486 281  GLY B C   
4897 O O   . GLY B 297 ? 0.3371 0.3253 0.4944 -0.0062 0.0586  -0.0510 281  GLY B O   
4898 N N   . ILE B 298 ? 0.2933 0.2744 0.4087 -0.0083 0.0552  -0.0441 282  ILE B N   
4899 C CA  . ILE B 298 ? 0.2599 0.2406 0.3757 -0.0080 0.0394  -0.0424 282  ILE B CA  
4900 C C   . ILE B 298 ? 0.3165 0.2918 0.4266 -0.0075 0.0337  -0.0436 282  ILE B C   
4901 O O   . ILE B 298 ? 0.3150 0.2868 0.4125 -0.0080 0.0403  -0.0432 282  ILE B O   
4902 C CB  . ILE B 298 ? 0.2829 0.2645 0.3812 -0.0099 0.0332  -0.0353 282  ILE B CB  
4903 C CG1 . ILE B 298 ? 0.2802 0.2604 0.3542 -0.0122 0.0367  -0.0297 282  ILE B CG1 
4904 C CG2 . ILE B 298 ? 0.3059 0.2920 0.4126 -0.0097 0.0359  -0.0348 282  ILE B CG2 
4905 C CD1 . ILE B 298 ? 0.3285 0.3090 0.3875 -0.0141 0.0299  -0.0229 282  ILE B CD1 
4906 N N   . ARG B 299 ? 0.2582 0.2309 0.3769 -0.0063 0.0208  -0.0454 283  ARG B N   
4907 C CA  . ARG B 299 ? 0.2541 0.2212 0.3677 -0.0058 0.0134  -0.0465 283  ARG B CA  
4908 C C   . ARG B 299 ? 0.2951 0.2581 0.3887 -0.0080 0.0025  -0.0400 283  ARG B C   
4909 O O   . ARG B 299 ? 0.2889 0.2504 0.3819 -0.0082 -0.0048 -0.0379 283  ARG B O   
4910 C CB  . ARG B 299 ? 0.2516 0.2168 0.3903 -0.0029 0.0064  -0.0538 283  ARG B CB  
4911 C CG  . ARG B 299 ? 0.3734 0.3323 0.5089 -0.0020 -0.0013 -0.0559 283  ARG B CG  
4912 C CD  . ARG B 299 ? 0.4506 0.4066 0.6117 0.0010  -0.0112 -0.0631 283  ARG B CD  
4913 N NE  . ARG B 299 ? 0.6261 0.5773 0.7872 0.0009  -0.0260 -0.0614 283  ARG B NE  
4914 C CZ  . ARG B 299 ? 0.8354 0.7816 1.0170 0.0034  -0.0384 -0.0669 283  ARG B CZ  
4915 N NH1 . ARG B 299 ? 0.6288 0.5764 0.8365 0.0063  -0.0376 -0.0747 283  ARG B NH1 
4916 N NH2 . ARG B 299 ? 0.6033 0.5413 0.7790 0.0033  -0.0522 -0.0647 283  ARG B NH2 
4917 N N   . LEU B 300 ? 0.2524 0.2122 0.3293 -0.0095 0.0016  -0.0368 284  LEU B N   
4918 C CA  . LEU B 300 ? 0.2552 0.2106 0.3146 -0.0120 -0.0071 -0.0307 284  LEU B CA  
4919 C C   . LEU B 300 ? 0.2993 0.2474 0.3598 -0.0112 -0.0175 -0.0332 284  LEU B C   
4920 O O   . LEU B 300 ? 0.2914 0.2384 0.3553 -0.0100 -0.0153 -0.0368 284  LEU B O   
4921 C CB  . LEU B 300 ? 0.2661 0.2232 0.3078 -0.0146 -0.0013 -0.0248 284  LEU B CB  
4922 C CG  . LEU B 300 ? 0.3419 0.3046 0.3776 -0.0162 0.0056  -0.0203 284  LEU B CG  
4923 C CD1 . LEU B 300 ? 0.3719 0.3393 0.4183 -0.0145 0.0152  -0.0241 284  LEU B CD1 
4924 C CD2 . LEU B 300 ? 0.3547 0.3173 0.3756 -0.0186 0.0081  -0.0150 284  LEU B CD2 
4925 N N   . GLN B 301 ? 0.2544 0.1956 0.3102 -0.0118 -0.0287 -0.0315 285  GLN B N   
4926 C CA  . GLN B 301 ? 0.2585 0.1907 0.3115 -0.0117 -0.0398 -0.0329 285  GLN B CA  
4927 C C   . GLN B 301 ? 0.3066 0.2330 0.3385 -0.0153 -0.0438 -0.0254 285  GLN B C   
4928 O O   . GLN B 301 ? 0.2903 0.2113 0.3139 -0.0165 -0.0472 -0.0220 285  GLN B O   
4929 C CB  . GLN B 301 ? 0.2855 0.2107 0.3527 -0.0090 -0.0509 -0.0387 285  GLN B CB  
4930 C CG  . GLN B 301 ? 0.3888 0.3197 0.4821 -0.0053 -0.0470 -0.0471 285  GLN B CG  
4931 C CD  . GLN B 301 ? 0.6100 0.5341 0.7219 -0.0024 -0.0593 -0.0534 285  GLN B CD  
4932 O OE1 . GLN B 301 ? 0.5886 0.5144 0.7225 0.0005  -0.0598 -0.0606 285  GLN B OE1 
4933 N NE2 . GLN B 301 ? 0.4801 0.3952 0.5843 -0.0028 -0.0697 -0.0510 285  GLN B NE2 
4934 N N   . LEU B 302 ? 0.2732 0.2003 0.2964 -0.0172 -0.0421 -0.0225 286  LEU B N   
4935 C CA  . LEU B 302 ? 0.2805 0.2034 0.2873 -0.0210 -0.0442 -0.0153 286  LEU B CA  
4936 C C   . LEU B 302 ? 0.3271 0.2386 0.3281 -0.0218 -0.0557 -0.0157 286  LEU B C   
4937 O O   . LEU B 302 ? 0.3322 0.2420 0.3398 -0.0198 -0.0600 -0.0205 286  LEU B O   
4938 C CB  . LEU B 302 ? 0.2821 0.2115 0.2848 -0.0226 -0.0371 -0.0121 286  LEU B CB  
4939 C CG  . LEU B 302 ? 0.3360 0.2633 0.3270 -0.0267 -0.0381 -0.0047 286  LEU B CG  
4940 C CD1 . LEU B 302 ? 0.3278 0.2577 0.3141 -0.0289 -0.0327 0.0006  286  LEU B CD1 
4941 C CD2 . LEU B 302 ? 0.3829 0.3136 0.3724 -0.0274 -0.0352 -0.0033 286  LEU B CD2 
4942 N N   . SER B 303 ? 0.2766 0.1790 0.2640 -0.0246 -0.0598 -0.0107 287  SER B N   
4943 C CA  . SER B 303 ? 0.2991 0.1881 0.2766 -0.0263 -0.0702 -0.0096 287  SER B CA  
4944 C C   . SER B 303 ? 0.3764 0.2600 0.3375 -0.0310 -0.0668 -0.0012 287  SER B C   
4945 O O   . SER B 303 ? 0.3476 0.2383 0.3077 -0.0323 -0.0574 0.0027  287  SER B O   
4946 C CB  . SER B 303 ? 0.3404 0.2171 0.3194 -0.0237 -0.0813 -0.0148 287  SER B CB  
4947 O OG  . SER B 303 ? 0.3587 0.2294 0.3308 -0.0237 -0.0807 -0.0130 287  SER B OG  
4948 N N   . ASN B 304 ? 0.3533 0.2242 0.3026 -0.0338 -0.0737 0.0016  288  ASN B N   
4949 C CA  . ASN B 304 ? 0.3637 0.2281 0.2990 -0.0387 -0.0690 0.0094  288  ASN B CA  
4950 C C   . ASN B 304 ? 0.4089 0.2699 0.3361 -0.0391 -0.0620 0.0123  288  ASN B C   
4951 O O   . ASN B 304 ? 0.3964 0.2452 0.3162 -0.0370 -0.0677 0.0095  288  ASN B O   
4952 C CB  . ASN B 304 ? 0.4160 0.2618 0.3369 -0.0412 -0.0783 0.0110  288  ASN B CB  
4953 C CG  . ASN B 304 ? 0.7100 0.5584 0.6357 -0.0424 -0.0832 0.0109  288  ASN B CG  
4954 O OD1 . ASN B 304 ? 0.6165 0.4752 0.5480 -0.0447 -0.0772 0.0148  288  ASN B OD1 
4955 N ND2 . ASN B 304 ? 0.6639 0.5014 0.5869 -0.0408 -0.0954 0.0066  288  ASN B ND2 
4956 N N   . GLY B 305 ? 0.3586 0.2295 0.2878 -0.0414 -0.0505 0.0175  289  GLY B N   
4957 C CA  . GLY B 305 ? 0.3610 0.2297 0.2828 -0.0421 -0.0419 0.0209  289  GLY B CA  
4958 C C   . GLY B 305 ? 0.3668 0.2388 0.2928 -0.0378 -0.0421 0.0164  289  GLY B C   
4959 O O   . GLY B 305 ? 0.3741 0.2401 0.2907 -0.0378 -0.0373 0.0186  289  GLY B O   
4960 N N   . LEU B 306 ? 0.3023 0.1833 0.2430 -0.0342 -0.0469 0.0100  290  LEU B N   
4961 C CA  . LEU B 306 ? 0.3108 0.1941 0.2583 -0.0303 -0.0479 0.0053  290  LEU B CA  
4962 C C   . LEU B 306 ? 0.3260 0.2265 0.2933 -0.0275 -0.0444 0.0005  290  LEU B C   
4963 O O   . LEU B 306 ? 0.2986 0.2029 0.2747 -0.0265 -0.0477 -0.0031 290  LEU B O   
4964 C CB  . LEU B 306 ? 0.3365 0.2023 0.2785 -0.0281 -0.0612 0.0008  290  LEU B CB  
4965 C CG  . LEU B 306 ? 0.3954 0.2597 0.3463 -0.0238 -0.0660 -0.0047 290  LEU B CG  
4966 C CD1 . LEU B 306 ? 0.3977 0.2543 0.3349 -0.0241 -0.0619 -0.0011 290  LEU B CD1 
4967 C CD2 . LEU B 306 ? 0.4653 0.3138 0.4166 -0.0215 -0.0817 -0.0103 290  LEU B CD2 
4968 N N   . LEU B 307 ? 0.2839 0.1923 0.2568 -0.0259 -0.0378 0.0000  291  LEU B N   
4969 C CA  . LEU B 307 ? 0.2701 0.1917 0.2598 -0.0233 -0.0335 -0.0047 291  LEU B CA  
4970 C C   . LEU B 307 ? 0.3146 0.2335 0.3123 -0.0201 -0.0370 -0.0094 291  LEU B C   
4971 O O   . LEU B 307 ? 0.3094 0.2253 0.3003 -0.0201 -0.0351 -0.0068 291  LEU B O   
4972 C CB  . LEU B 307 ? 0.2663 0.2006 0.2573 -0.0247 -0.0222 -0.0011 291  LEU B CB  
4973 C CG  . LEU B 307 ? 0.3156 0.2607 0.3202 -0.0223 -0.0164 -0.0058 291  LEU B CG  
4974 C CD1 . LEU B 307 ? 0.3169 0.2632 0.3262 -0.0217 -0.0174 -0.0089 291  LEU B CD1 
4975 C CD2 . LEU B 307 ? 0.3412 0.2952 0.3442 -0.0234 -0.0068 -0.0022 291  LEU B CD2 
4976 N N   . LYS B 308 ? 0.2785 0.1977 0.2916 -0.0172 -0.0424 -0.0162 292  LYS B N   
4977 C CA  . LYS B 308 ? 0.2847 0.2026 0.3120 -0.0139 -0.0466 -0.0216 292  LYS B CA  
4978 C C   . LYS B 308 ? 0.3134 0.2468 0.3570 -0.0127 -0.0351 -0.0242 292  LYS B C   
4979 O O   . LYS B 308 ? 0.3034 0.2438 0.3522 -0.0128 -0.0292 -0.0257 292  LYS B O   
4980 C CB  . LYS B 308 ? 0.3155 0.2247 0.3541 -0.0114 -0.0590 -0.0280 292  LYS B CB  
4981 C CG  . LYS B 308 ? 0.4522 0.3422 0.4729 -0.0123 -0.0719 -0.0261 292  LYS B CG  
4982 C CD  . LYS B 308 ? 0.5993 0.4798 0.6339 -0.0092 -0.0862 -0.0334 292  LYS B CD  
4983 C CE  . LYS B 308 ? 0.7676 0.6266 0.7814 -0.0104 -0.0996 -0.0315 292  LYS B CE  
4984 N NZ  . LYS B 308 ? 0.9160 0.7655 0.9441 -0.0073 -0.1146 -0.0389 292  LYS B NZ  
4985 N N   . ILE B 309 ? 0.2631 0.1997 0.3113 -0.0118 -0.0317 -0.0241 293  ILE B N   
4986 C CA  . ILE B 309 ? 0.2644 0.2136 0.3258 -0.0110 -0.0204 -0.0260 293  ILE B CA  
4987 C C   . ILE B 309 ? 0.3109 0.2594 0.3942 -0.0079 -0.0248 -0.0323 293  ILE B C   
4988 O O   . ILE B 309 ? 0.2986 0.2386 0.3797 -0.0069 -0.0337 -0.0319 293  ILE B O   
4989 C CB  . ILE B 309 ? 0.3013 0.2556 0.3501 -0.0129 -0.0122 -0.0200 293  ILE B CB  
4990 C CG1 . ILE B 309 ? 0.3104 0.2647 0.3411 -0.0160 -0.0092 -0.0138 293  ILE B CG1 
4991 C CG2 . ILE B 309 ? 0.3105 0.2757 0.3710 -0.0123 -0.0010 -0.0220 293  ILE B CG2 
4992 C CD1 . ILE B 309 ? 0.3872 0.3407 0.4046 -0.0176 -0.0063 -0.0079 293  ILE B CD1 
4993 N N   . GLN B 310 ? 0.2702 0.2262 0.3744 -0.0064 -0.0185 -0.0380 294  GLN B N   
4994 C CA  . GLN B 310 ? 0.2649 0.2215 0.3963 -0.0035 -0.0219 -0.0447 294  GLN B CA  
4995 C C   . GLN B 310 ? 0.3135 0.2813 0.4617 -0.0032 -0.0069 -0.0475 294  GLN B C   
4996 O O   . GLN B 310 ? 0.3150 0.2876 0.4569 -0.0044 0.0048  -0.0468 294  GLN B O   
4997 C CB  . GLN B 310 ? 0.2822 0.2331 0.4277 -0.0014 -0.0313 -0.0507 294  GLN B CB  
4998 C CG  . GLN B 310 ? 0.4459 0.3955 0.6237 0.0019  -0.0385 -0.0584 294  GLN B CG  
4999 C CD  . GLN B 310 ? 0.6626 0.6230 0.8690 0.0032  -0.0252 -0.0646 294  GLN B CD  
5000 O OE1 . GLN B 310 ? 0.5526 0.5195 0.7523 0.0020  -0.0103 -0.0637 294  GLN B OE1 
5001 N NE2 . GLN B 310 ? 0.5097 0.4705 0.7485 0.0059  -0.0301 -0.0713 294  GLN B NE2 
5002 N N   . ALA B 311 ? 0.2737 0.2435 0.4433 -0.0015 -0.0079 -0.0510 295  ALA B N   
5003 C CA  . ALA B 311 ? 0.2491 0.2280 0.4392 -0.0012 0.0061  -0.0545 295  ALA B CA  
5004 C C   . ALA B 311 ? 0.2808 0.2595 0.5053 0.0015  -0.0006 -0.0612 295  ALA B C   
5005 O O   . ALA B 311 ? 0.2670 0.2379 0.4933 0.0029  -0.0165 -0.0612 295  ALA B O   
5006 C CB  . ALA B 311 ? 0.2467 0.2305 0.4223 -0.0032 0.0154  -0.0491 295  ALA B CB  
5007 N N   . ASN B 312 ? 0.2403 0.2257 0.4920 0.0024  0.0113  -0.0670 296  ASN B N   
5008 C CA  . ASN B 312 ? 0.2493 0.2365 0.5405 0.0047  0.0078  -0.0739 296  ASN B CA  
5009 C C   . ASN B 312 ? 0.3029 0.2990 0.6136 0.0039  0.0277  -0.0765 296  ASN B C   
5010 O O   . ASN B 312 ? 0.3014 0.3000 0.5950 0.0020  0.0441  -0.0742 296  ASN B O   
5011 C CB  . ASN B 312 ? 0.2851 0.2676 0.5987 0.0075  -0.0038 -0.0807 296  ASN B CB  
5012 C CG  . ASN B 312 ? 0.5112 0.4969 0.8308 0.0078  0.0090  -0.0846 296  ASN B CG  
5013 O OD1 . ASN B 312 ? 0.5917 0.5833 0.9387 0.0085  0.0232  -0.0901 296  ASN B OD1 
5014 N ND2 . ASN B 312 ? 0.4583 0.4388 0.7528 0.0074  0.0045  -0.0821 296  ASN B ND2 
5015 N N   . ASN B 313 ? 0.2523 0.2515 0.5964 0.0051  0.0257  -0.0806 297  ASN B N   
5016 C CA  . ASN B 313 ? 0.2576 0.2644 0.6223 0.0040  0.0448  -0.0828 297  ASN B CA  
5017 C C   . ASN B 313 ? 0.3102 0.3203 0.7252 0.0062  0.0472  -0.0920 297  ASN B C   
5018 O O   . ASN B 313 ? 0.2900 0.2962 0.7228 0.0089  0.0308  -0.0964 297  ASN B O   
5019 C CB  . ASN B 313 ? 0.2442 0.2526 0.6008 0.0025  0.0433  -0.0779 297  ASN B CB  
5020 C CG  . ASN B 313 ? 0.3069 0.3118 0.6840 0.0047  0.0235  -0.0795 297  ASN B CG  
5021 O OD1 . ASN B 313 ? 0.2291 0.2310 0.6354 0.0073  0.0110  -0.0855 297  ASN B OD1 
5022 N ND2 . ASN B 313 ? 0.2443 0.2479 0.6050 0.0037  0.0193  -0.0742 297  ASN B ND2 
5023 N N   . PRO B 314 ? 0.3021 0.3184 0.7420 0.0052  0.0669  -0.0953 298  PRO B N   
5024 C CA  . PRO B 314 ? 0.3174 0.3375 0.8099 0.0073  0.0700  -0.1045 298  PRO B CA  
5025 C C   . PRO B 314 ? 0.3748 0.3946 0.9028 0.0097  0.0484  -0.1079 298  PRO B C   
5026 O O   . PRO B 314 ? 0.3815 0.4029 0.9533 0.0121  0.0442  -0.1158 298  PRO B O   
5027 C CB  . PRO B 314 ? 0.3446 0.3696 0.8500 0.0050  0.0980  -0.1059 298  PRO B CB  
5028 C CG  . PRO B 314 ? 0.3943 0.4159 0.8488 0.0019  0.1093  -0.0980 298  PRO B CG  
5029 C CD  . PRO B 314 ? 0.3278 0.3467 0.7502 0.0020  0.0877  -0.0913 298  PRO B CD  
5030 N N   . GLU B 315 ? 0.3299 0.3462 0.8383 0.0092  0.0336  -0.1022 299  GLU B N   
5031 C CA  . GLU B 315 ? 0.3293 0.3410 0.8626 0.0115  0.0106  -0.1044 299  GLU B CA  
5032 C C   . GLU B 315 ? 0.3615 0.3612 0.8840 0.0145  -0.0155 -0.1053 299  GLU B C   
5033 O O   . GLU B 315 ? 0.3568 0.3473 0.8884 0.0166  -0.0380 -0.1062 299  GLU B O   
5034 C CB  . GLU B 315 ? 0.3467 0.3570 0.8595 0.0099  0.0070  -0.0977 299  GLU B CB  
5035 C CG  . GLU B 315 ? 0.5180 0.5381 1.0428 0.0071  0.0297  -0.0968 299  GLU B CG  
5036 C CD  . GLU B 315 ? 0.8077 0.8293 1.2857 0.0038  0.0454  -0.0892 299  GLU B CD  
5037 O OE1 . GLU B 315 ? 0.7369 0.7596 1.1974 0.0026  0.0600  -0.0889 299  GLU B OE1 
5038 O OE2 . GLU B 315 ? 0.6975 0.7182 1.1566 0.0025  0.0424  -0.0836 299  GLU B OE2 
5039 N N   . GLN B 316 ? 0.3121 0.3099 0.8132 0.0145  -0.0127 -0.1051 300  GLN B N   
5040 C CA  . GLN B 316 ? 0.3185 0.3041 0.8028 0.0165  -0.0342 -0.1053 300  GLN B CA  
5041 C C   . GLN B 316 ? 0.3441 0.3182 0.7837 0.0158  -0.0495 -0.0973 300  GLN B C   
5042 O O   . GLN B 316 ? 0.3604 0.3206 0.7863 0.0175  -0.0700 -0.0972 300  GLN B O   
5043 C CB  . GLN B 316 ? 0.3518 0.3323 0.8809 0.0203  -0.0521 -0.1143 300  GLN B CB  
5044 C CG  . GLN B 316 ? 0.6662 0.6516 1.2182 0.0217  -0.0433 -0.1211 300  GLN B CG  
5045 C CD  . GLN B 316 ? 0.9926 0.9924 1.5681 0.0201  -0.0139 -0.1240 300  GLN B CD  
5046 O OE1 . GLN B 316 ? 0.9548 0.9584 1.5031 0.0180  0.0053  -0.1208 300  GLN B OE1 
5047 N NE2 . GLN B 316 ? 0.9253 0.9315 1.5510 0.0211  -0.0099 -0.1301 300  GLN B NE2 
5048 N N   . GLU B 317 ? 0.2534 0.2319 0.6693 0.0132  -0.0386 -0.0906 301  GLU B N   
5049 C CA  . GLU B 317 ? 0.2393 0.2077 0.6117 0.0123  -0.0488 -0.0828 301  GLU B CA  
5050 C C   . GLU B 317 ? 0.2776 0.2449 0.6120 0.0105  -0.0432 -0.0780 301  GLU B C   
5051 O O   . GLU B 317 ? 0.2547 0.2316 0.5894 0.0090  -0.0259 -0.0787 301  GLU B O   
5052 C CB  . GLU B 317 ? 0.2383 0.2119 0.6019 0.0106  -0.0402 -0.0779 301  GLU B CB  
5053 C CG  . GLU B 317 ? 0.2679 0.2409 0.6690 0.0125  -0.0485 -0.0823 301  GLU B CG  
5054 C CD  . GLU B 317 ? 0.2892 0.2684 0.6866 0.0107  -0.0387 -0.0783 301  GLU B CD  
5055 O OE1 . GLU B 317 ? 0.2853 0.2747 0.6672 0.0077  -0.0182 -0.0747 301  GLU B OE1 
5056 O OE2 . GLU B 317 ? 0.2621 0.2343 0.6708 0.0123  -0.0525 -0.0788 301  GLU B OE2 
5057 N N   . GLU B 318 ? 0.2417 0.1953 0.5438 0.0106  -0.0580 -0.0736 302  GLU B N   
5058 C CA  . GLU B 318 ? 0.2342 0.1850 0.5032 0.0089  -0.0555 -0.0693 302  GLU B CA  
5059 C C   . GLU B 318 ? 0.2817 0.2230 0.5098 0.0074  -0.0605 -0.0612 302  GLU B C   
5060 O O   . GLU B 318 ? 0.2821 0.2098 0.5029 0.0088  -0.0752 -0.0602 302  GLU B O   
5061 C CB  . GLU B 318 ? 0.2505 0.1914 0.5281 0.0110  -0.0702 -0.0742 302  GLU B CB  
5062 C CG  . GLU B 318 ? 0.3909 0.3289 0.6387 0.0092  -0.0682 -0.0705 302  GLU B CG  
5063 C CD  . GLU B 318 ? 0.5044 0.4363 0.7669 0.0112  -0.0788 -0.0765 302  GLU B CD  
5064 O OE1 . GLU B 318 ? 0.4255 0.3432 0.6967 0.0136  -0.0987 -0.0800 302  GLU B OE1 
5065 O OE2 . GLU B 318 ? 0.4003 0.3406 0.6665 0.0106  -0.0675 -0.0782 302  GLU B OE2 
5066 N N   . ALA B 319 ? 0.2458 0.1929 0.4478 0.0046  -0.0481 -0.0557 303  ALA B N   
5067 C CA  . ALA B 319 ? 0.2532 0.1932 0.4178 0.0027  -0.0493 -0.0479 303  ALA B CA  
5068 C C   . ALA B 319 ? 0.2965 0.2324 0.4423 0.0012  -0.0505 -0.0459 303  ALA B C   
5069 O O   . ALA B 319 ? 0.2476 0.1921 0.4026 0.0007  -0.0425 -0.0484 303  ALA B O   
5070 C CB  . ALA B 319 ? 0.2524 0.2042 0.4066 0.0004  -0.0333 -0.0431 303  ALA B CB  
5071 N N   . GLU B 320 ? 0.2895 0.2106 0.4076 0.0006  -0.0601 -0.0414 304  GLU B N   
5072 C CA  . GLU B 320 ? 0.3066 0.2217 0.4041 -0.0013 -0.0619 -0.0385 304  GLU B CA  
5073 C C   . GLU B 320 ? 0.3641 0.2701 0.4283 -0.0035 -0.0610 -0.0307 304  GLU B C   
5074 O O   . GLU B 320 ? 0.3567 0.2495 0.4096 -0.0023 -0.0686 -0.0292 304  GLU B O   
5075 C CB  . GLU B 320 ? 0.3450 0.2457 0.4486 0.0007  -0.0786 -0.0433 304  GLU B CB  
5076 C CG  . GLU B 320 ? 0.5613 0.4717 0.6900 0.0017  -0.0761 -0.0494 304  GLU B CG  
5077 C CD  . GLU B 320 ? 0.8916 0.7882 1.0176 0.0026  -0.0907 -0.0523 304  GLU B CD  
5078 O OE1 . GLU B 320 ? 0.6421 0.5391 0.7528 0.0006  -0.0874 -0.0496 304  GLU B OE1 
5079 O OE2 . GLU B 320 ? 0.8462 0.7303 0.9849 0.0054  -0.1066 -0.0573 304  GLU B OE2 
5080 N N   . GLU B 321 ? 0.3115 0.2241 0.3611 -0.0064 -0.0513 -0.0260 305  GLU B N   
5081 C CA  . GLU B 321 ? 0.3191 0.2241 0.3404 -0.0089 -0.0485 -0.0187 305  GLU B CA  
5082 C C   . GLU B 321 ? 0.3592 0.2615 0.3677 -0.0115 -0.0480 -0.0159 305  GLU B C   
5083 O O   . GLU B 321 ? 0.3494 0.2630 0.3688 -0.0122 -0.0432 -0.0176 305  GLU B O   
5084 C CB  . GLU B 321 ? 0.3349 0.2520 0.3525 -0.0101 -0.0353 -0.0145 305  GLU B CB  
5085 C CG  . GLU B 321 ? 0.5038 0.4081 0.4963 -0.0110 -0.0357 -0.0087 305  GLU B CG  
5086 C CD  . GLU B 321 ? 0.6595 0.5736 0.6467 -0.0121 -0.0238 -0.0043 305  GLU B CD  
5087 O OE1 . GLU B 321 ? 0.5698 0.4800 0.5389 -0.0143 -0.0184 0.0013  305  GLU B OE1 
5088 O OE2 . GLU B 321 ? 0.5199 0.4447 0.5215 -0.0108 -0.0199 -0.0064 305  GLU B OE2 
5089 N N   . GLU B 322 ? 0.3189 0.2041 0.3036 -0.0129 -0.0531 -0.0117 306  GLU B N   
5090 C CA  . GLU B 322 ? 0.3293 0.2099 0.3008 -0.0158 -0.0528 -0.0084 306  GLU B CA  
5091 C C   . GLU B 322 ? 0.3771 0.2603 0.3323 -0.0190 -0.0412 -0.0010 306  GLU B C   
5092 O O   . GLU B 322 ? 0.3844 0.2579 0.3251 -0.0188 -0.0396 0.0021  306  GLU B O   
5093 C CB  . GLU B 322 ? 0.3763 0.2330 0.3330 -0.0154 -0.0670 -0.0094 306  GLU B CB  
5094 C CG  . GLU B 322 ? 0.5196 0.3738 0.4953 -0.0123 -0.0797 -0.0171 306  GLU B CG  
5095 C CD  . GLU B 322 ? 0.7767 0.6055 0.7373 -0.0118 -0.0958 -0.0185 306  GLU B CD  
5096 O OE1 . GLU B 322 ? 0.6330 0.4416 0.5655 -0.0132 -0.0981 -0.0139 306  GLU B OE1 
5097 O OE2 . GLU B 322 ? 0.7163 0.5437 0.6926 -0.0098 -0.1061 -0.0245 306  GLU B OE2 
5098 N N   . VAL B 323 ? 0.3034 0.1999 0.2630 -0.0215 -0.0330 0.0016  307  VAL B N   
5099 C CA  . VAL B 323 ? 0.2990 0.2001 0.2490 -0.0247 -0.0221 0.0082  307  VAL B CA  
5100 C C   . VAL B 323 ? 0.3491 0.2441 0.2900 -0.0281 -0.0229 0.0118  307  VAL B C   
5101 O O   . VAL B 323 ? 0.3170 0.2174 0.2668 -0.0284 -0.0264 0.0095  307  VAL B O   
5102 C CB  . VAL B 323 ? 0.3236 0.2453 0.2881 -0.0247 -0.0123 0.0084  307  VAL B CB  
5103 C CG1 . VAL B 323 ? 0.3135 0.2404 0.2722 -0.0280 -0.0028 0.0148  307  VAL B CG1 
5104 C CG2 . VAL B 323 ? 0.3207 0.2474 0.2930 -0.0219 -0.0107 0.0055  307  VAL B CG2 
5105 N N   . GLN B 324 ? 0.3326 0.2158 0.2559 -0.0307 -0.0189 0.0173  308  GLN B N   
5106 C CA  . GLN B 324 ? 0.3462 0.2240 0.2623 -0.0345 -0.0178 0.0214  308  GLN B CA  
5107 C C   . GLN B 324 ? 0.3464 0.2436 0.2774 -0.0366 -0.0095 0.0239  308  GLN B C   
5108 O O   . GLN B 324 ? 0.3316 0.2393 0.2681 -0.0366 -0.0010 0.0258  308  GLN B O   
5109 C CB  . GLN B 324 ? 0.3915 0.2508 0.2854 -0.0370 -0.0127 0.0268  308  GLN B CB  
5110 C CG  . GLN B 324 ? 0.7610 0.5943 0.6344 -0.0356 -0.0233 0.0248  308  GLN B CG  
5111 C CD  . GLN B 324 ? 1.0594 0.8707 0.9066 -0.0384 -0.0168 0.0304  308  GLN B CD  
5112 O OE1 . GLN B 324 ? 1.0170 0.8147 0.8484 -0.0368 -0.0144 0.0313  308  GLN B OE1 
5113 N NE2 . GLN B 324 ? 0.9250 0.7313 0.7669 -0.0426 -0.0131 0.0345  308  GLN B NE2 
5114 N N   . VAL B 325 ? 0.3042 0.2051 0.2414 -0.0382 -0.0133 0.0236  309  VAL B N   
5115 C CA  . VAL B 325 ? 0.2677 0.1832 0.2174 -0.0401 -0.0082 0.0260  309  VAL B CA  
5116 C C   . VAL B 325 ? 0.3471 0.2564 0.2933 -0.0441 -0.0094 0.0302  309  VAL B C   
5117 O O   . VAL B 325 ? 0.3542 0.2489 0.2890 -0.0450 -0.0154 0.0300  309  VAL B O   
5118 C CB  . VAL B 325 ? 0.2837 0.2111 0.2467 -0.0373 -0.0116 0.0208  309  VAL B CB  
5119 C CG1 . VAL B 325 ? 0.2769 0.2117 0.2453 -0.0341 -0.0078 0.0175  309  VAL B CG1 
5120 C CG2 . VAL B 325 ? 0.2871 0.2081 0.2502 -0.0359 -0.0215 0.0161  309  VAL B CG2 
5121 N N   . GLU B 326 ? 0.3173 0.2366 0.2741 -0.0467 -0.0047 0.0338  310  GLU B N   
5122 C CA  . GLU B 326 ? 0.3228 0.2380 0.2808 -0.0506 -0.0064 0.0377  310  GLU B CA  
5123 C C   . GLU B 326 ? 0.3585 0.2785 0.3235 -0.0491 -0.0155 0.0339  310  GLU B C   
5124 O O   . GLU B 326 ? 0.3354 0.2664 0.3108 -0.0478 -0.0151 0.0326  310  GLU B O   
5125 C CB  . GLU B 326 ? 0.3383 0.2609 0.3071 -0.0541 0.0025  0.0434  310  GLU B CB  
5126 C CG  . GLU B 326 ? 0.5114 0.4270 0.4724 -0.0559 0.0134  0.0475  310  GLU B CG  
5127 C CD  . GLU B 326 ? 0.8270 0.7529 0.8034 -0.0582 0.0234  0.0518  310  GLU B CD  
5128 O OE1 . GLU B 326 ? 0.5522 0.4844 0.5438 -0.0609 0.0220  0.0543  310  GLU B OE1 
5129 O OE2 . GLU B 326 ? 0.8711 0.7981 0.8452 -0.0572 0.0320  0.0527  310  GLU B OE2 
5130 N N   . TYR B 327 ? 0.3165 0.2261 0.2736 -0.0487 -0.0239 0.0314  311  TYR B N   
5131 C CA  . TYR B 327 ? 0.3094 0.2209 0.2713 -0.0468 -0.0327 0.0271  311  TYR B CA  
5132 C C   . TYR B 327 ? 0.3639 0.2620 0.3169 -0.0480 -0.0414 0.0266  311  TYR B C   
5133 O O   . TYR B 327 ? 0.3500 0.2367 0.2924 -0.0472 -0.0445 0.0249  311  TYR B O   
5134 C CB  . TYR B 327 ? 0.3157 0.2327 0.2816 -0.0418 -0.0339 0.0203  311  TYR B CB  
5135 C CG  . TYR B 327 ? 0.3404 0.2572 0.3101 -0.0394 -0.0413 0.0153  311  TYR B CG  
5136 C CD1 . TYR B 327 ? 0.3563 0.2776 0.3305 -0.0399 -0.0422 0.0160  311  TYR B CD1 
5137 C CD2 . TYR B 327 ? 0.3739 0.2837 0.3420 -0.0367 -0.0483 0.0098  311  TYR B CD2 
5138 C CE1 . TYR B 327 ? 0.3651 0.2837 0.3400 -0.0375 -0.0484 0.0114  311  TYR B CE1 
5139 C CE2 . TYR B 327 ? 0.3843 0.2930 0.3563 -0.0345 -0.0544 0.0050  311  TYR B CE2 
5140 C CZ  . TYR B 327 ? 0.4434 0.3563 0.4177 -0.0348 -0.0537 0.0059  311  TYR B CZ  
5141 O OH  . TYR B 327 ? 0.4485 0.3584 0.4244 -0.0322 -0.0589 0.0011  311  TYR B OH  
5142 N N   . ASN B 328 ? 0.3450 0.2430 0.3017 -0.0497 -0.0465 0.0278  312  ASN B N   
5143 C CA  . ASN B 328 ? 0.3685 0.2541 0.3174 -0.0508 -0.0559 0.0271  312  ASN B CA  
5144 C C   . ASN B 328 ? 0.4386 0.3288 0.3946 -0.0482 -0.0631 0.0228  312  ASN B C   
5145 O O   . ASN B 328 ? 0.4214 0.3173 0.3843 -0.0496 -0.0629 0.0253  312  ASN B O   
5146 C CB  . ASN B 328 ? 0.4362 0.3149 0.3816 -0.0565 -0.0538 0.0342  312  ASN B CB  
5147 N N   . GLY B 329 ? 0.4108 0.2983 0.3661 -0.0440 -0.0687 0.0160  313  GLY B N   
5148 C CA  . GLY B 329 ? 0.4072 0.2968 0.3676 -0.0406 -0.0743 0.0107  313  GLY B CA  
5149 C C   . GLY B 329 ? 0.4642 0.3498 0.4264 -0.0362 -0.0796 0.0030  313  GLY B C   
5150 O O   . GLY B 329 ? 0.4530 0.3316 0.4111 -0.0360 -0.0823 0.0019  313  GLY B O   
5151 N N   . GLY B 330 ? 0.4187 0.3073 0.3872 -0.0326 -0.0812 -0.0025 314  GLY B N   
5152 C CA  . GLY B 330 ? 0.4085 0.2948 0.3838 -0.0280 -0.0850 -0.0106 314  GLY B CA  
5153 C C   . GLY B 330 ? 0.4295 0.3235 0.4139 -0.0252 -0.0772 -0.0143 314  GLY B C   
5154 O O   . GLY B 330 ? 0.4197 0.3208 0.4031 -0.0266 -0.0687 -0.0105 314  GLY B O   
5155 N N   . ASN B 331 ? 0.3618 0.2543 0.3567 -0.0211 -0.0803 -0.0218 315  ASN B N   
5156 C CA  . ASN B 331 ? 0.3456 0.2451 0.3526 -0.0183 -0.0735 -0.0260 315  ASN B CA  
5157 C C   . ASN B 331 ? 0.3803 0.2883 0.3934 -0.0162 -0.0623 -0.0285 315  ASN B C   
5158 O O   . ASN B 331 ? 0.3714 0.2774 0.3822 -0.0151 -0.0620 -0.0302 315  ASN B O   
5159 C CB  . ASN B 331 ? 0.3394 0.2337 0.3593 -0.0148 -0.0815 -0.0334 315  ASN B CB  
5160 C CG  . ASN B 331 ? 0.4833 0.3655 0.4953 -0.0163 -0.0932 -0.0318 315  ASN B CG  
5161 O OD1 . ASN B 331 ? 0.4018 0.2788 0.3974 -0.0202 -0.0937 -0.0247 315  ASN B OD1 
5162 N ND2 . ASN B 331 ? 0.4306 0.3060 0.4539 -0.0131 -0.1031 -0.0385 315  ASN B ND2 
5163 N N   . LEU B 332 ? 0.3176 0.2332 0.3373 -0.0153 -0.0534 -0.0291 316  LEU B N   
5164 C CA  . LEU B 332 ? 0.2909 0.2126 0.3154 -0.0134 -0.0416 -0.0318 316  LEU B CA  
5165 C C   . LEU B 332 ? 0.3355 0.2634 0.3742 -0.0114 -0.0352 -0.0354 316  LEU B C   
5166 O O   . LEU B 332 ? 0.3149 0.2454 0.3520 -0.0130 -0.0357 -0.0319 316  LEU B O   
5167 C CB  . LEU B 332 ? 0.2779 0.2019 0.2885 -0.0161 -0.0358 -0.0254 316  LEU B CB  
5168 C CG  . LEU B 332 ? 0.3056 0.2328 0.3160 -0.0146 -0.0236 -0.0272 316  LEU B CG  
5169 C CD1 . LEU B 332 ? 0.2933 0.2138 0.3033 -0.0114 -0.0207 -0.0330 316  LEU B CD1 
5170 C CD2 . LEU B 332 ? 0.3364 0.2650 0.3341 -0.0175 -0.0210 -0.0204 316  LEU B CD2 
5171 N N   . GLU B 333 ? 0.2843 0.2139 0.3370 -0.0080 -0.0285 -0.0424 317  GLU B N   
5172 C CA  . GLU B 333 ? 0.2882 0.2241 0.3571 -0.0062 -0.0206 -0.0462 317  GLU B CA  
5173 C C   . GLU B 333 ? 0.3352 0.2736 0.3992 -0.0060 -0.0058 -0.0463 317  GLU B C   
5174 O O   . GLU B 333 ? 0.3454 0.2787 0.4062 -0.0044 -0.0010 -0.0495 317  GLU B O   
5175 C CB  . GLU B 333 ? 0.3098 0.2448 0.4027 -0.0026 -0.0243 -0.0546 317  GLU B CB  
5176 C CG  . GLU B 333 ? 0.4089 0.3506 0.5219 -0.0011 -0.0172 -0.0582 317  GLU B CG  
5177 C CD  . GLU B 333 ? 0.6314 0.5728 0.7732 0.0026  -0.0206 -0.0670 317  GLU B CD  
5178 O OE1 . GLU B 333 ? 0.6233 0.5651 0.7768 0.0049  -0.0113 -0.0727 317  GLU B OE1 
5179 O OE2 . GLU B 333 ? 0.4733 0.4124 0.6257 0.0032  -0.0330 -0.0683 317  GLU B OE2 
5180 N N   . ILE B 334 ? 0.2787 0.2226 0.3395 -0.0075 0.0012  -0.0429 318  ILE B N   
5181 C CA  . ILE B 334 ? 0.2673 0.2107 0.3195 -0.0076 0.0143  -0.0424 318  ILE B CA  
5182 C C   . ILE B 334 ? 0.3016 0.2520 0.3633 -0.0077 0.0228  -0.0427 318  ILE B C   
5183 O O   . ILE B 334 ? 0.2787 0.2341 0.3445 -0.0087 0.0172  -0.0400 318  ILE B O   
5184 C CB  . ILE B 334 ? 0.3008 0.2400 0.3293 -0.0103 0.0115  -0.0355 318  ILE B CB  
5185 C CG1 . ILE B 334 ? 0.3128 0.2460 0.3276 -0.0101 0.0223  -0.0354 318  ILE B CG1 
5186 C CG2 . ILE B 334 ? 0.2982 0.2428 0.3215 -0.0134 0.0055  -0.0286 318  ILE B CG2 
5187 C CD1 . ILE B 334 ? 0.3134 0.2394 0.3064 -0.0122 0.0166  -0.0296 318  ILE B CD1 
5188 N N   . GLY B 335 ? 0.2787 0.2277 0.3432 -0.0064 0.0363  -0.0463 319  GLY B N   
5189 C CA  . GLY B 335 ? 0.2763 0.2310 0.3499 -0.0066 0.0456  -0.0468 319  GLY B CA  
5190 C C   . GLY B 335 ? 0.3036 0.2556 0.3566 -0.0086 0.0532  -0.0421 319  GLY B C   
5191 O O   . GLY B 335 ? 0.3108 0.2535 0.3446 -0.0090 0.0552  -0.0408 319  GLY B O   
5192 N N   . PHE B 336 ? 0.2524 0.2108 0.3084 -0.0099 0.0562  -0.0397 320  PHE B N   
5193 C CA  . PHE B 336 ? 0.2401 0.1960 0.2785 -0.0117 0.0628  -0.0355 320  PHE B CA  
5194 C C   . PHE B 336 ? 0.3091 0.2703 0.3581 -0.0118 0.0717  -0.0366 320  PHE B C   
5195 O O   . PHE B 336 ? 0.2964 0.2658 0.3646 -0.0112 0.0682  -0.0381 320  PHE B O   
5196 C CB  . PHE B 336 ? 0.2505 0.2088 0.2748 -0.0140 0.0528  -0.0283 320  PHE B CB  
5197 C CG  . PHE B 336 ? 0.2600 0.2116 0.2700 -0.0147 0.0452  -0.0258 320  PHE B CG  
5198 C CD1 . PHE B 336 ? 0.2989 0.2395 0.2904 -0.0149 0.0486  -0.0250 320  PHE B CD1 
5199 C CD2 . PHE B 336 ? 0.2568 0.2111 0.2709 -0.0151 0.0340  -0.0242 320  PHE B CD2 
5200 C CE1 . PHE B 336 ? 0.3167 0.2504 0.2963 -0.0154 0.0401  -0.0227 320  PHE B CE1 
5201 C CE2 . PHE B 336 ? 0.3032 0.2514 0.3057 -0.0160 0.0269  -0.0217 320  PHE B CE2 
5202 C CZ  . PHE B 336 ? 0.2963 0.2349 0.2828 -0.0161 0.0296  -0.0210 320  PHE B CZ  
5203 N N   . ASN B 337 ? 0.2912 0.2461 0.3251 -0.0129 0.0814  -0.0353 321  ASN B N   
5204 C CA  . ASN B 337 ? 0.2875 0.2461 0.3260 -0.0137 0.0894  -0.0349 321  ASN B CA  
5205 C C   . ASN B 337 ? 0.2997 0.2666 0.3340 -0.0152 0.0788  -0.0288 321  ASN B C   
5206 O O   . ASN B 337 ? 0.2633 0.2271 0.2799 -0.0166 0.0728  -0.0241 321  ASN B O   
5207 C CB  . ASN B 337 ? 0.3716 0.3173 0.3895 -0.0145 0.1013  -0.0348 321  ASN B CB  
5208 C CG  . ASN B 337 ? 0.5531 0.5004 0.5692 -0.0160 0.1085  -0.0332 321  ASN B CG  
5209 O OD1 . ASN B 337 ? 0.3547 0.3112 0.3732 -0.0170 0.1016  -0.0292 321  ASN B OD1 
5210 N ND2 . ASN B 337 ? 0.4881 0.4243 0.4968 -0.0162 0.1231  -0.0359 321  ASN B ND2 
5211 N N   . VAL B 338 ? 0.2586 0.2348 0.3104 -0.0148 0.0756  -0.0292 322  VAL B N   
5212 C CA  . VAL B 338 ? 0.2528 0.2350 0.3003 -0.0159 0.0668  -0.0239 322  VAL B CA  
5213 C C   . VAL B 338 ? 0.2700 0.2510 0.3006 -0.0176 0.0702  -0.0193 322  VAL B C   
5214 O O   . VAL B 338 ? 0.2677 0.2503 0.2886 -0.0188 0.0633  -0.0145 322  VAL B O   
5215 C CB  . VAL B 338 ? 0.3065 0.2953 0.3726 -0.0147 0.0617  -0.0253 322  VAL B CB  
5216 C CG1 . VAL B 338 ? 0.3015 0.2935 0.3782 -0.0145 0.0701  -0.0271 322  VAL B CG1 
5217 C CG2 . VAL B 338 ? 0.3038 0.2947 0.3616 -0.0154 0.0514  -0.0200 322  VAL B CG2 
5218 N N   . SER B 339 ? 0.2367 0.2138 0.2640 -0.0180 0.0810  -0.0209 323  SER B N   
5219 C CA  . SER B 339 ? 0.2392 0.2134 0.2502 -0.0196 0.0832  -0.0170 323  SER B CA  
5220 C C   . SER B 339 ? 0.2826 0.2489 0.2736 -0.0206 0.0782  -0.0137 323  SER B C   
5221 O O   . SER B 339 ? 0.2611 0.2292 0.2441 -0.0217 0.0733  -0.0093 323  SER B O   
5222 C CB  . SER B 339 ? 0.3033 0.2720 0.3125 -0.0200 0.0957  -0.0195 323  SER B CB  
5223 O OG  . SER B 339 ? 0.4646 0.4191 0.4582 -0.0201 0.1028  -0.0215 323  SER B OG  
5224 N N   . TYR B 340 ? 0.2427 0.2004 0.2275 -0.0200 0.0785  -0.0159 324  TYR B N   
5225 C CA  . TYR B 340 ? 0.2535 0.2024 0.2209 -0.0207 0.0720  -0.0131 324  TYR B CA  
5226 C C   . TYR B 340 ? 0.2734 0.2312 0.2458 -0.0215 0.0604  -0.0087 324  TYR B C   
5227 O O   . TYR B 340 ? 0.2462 0.2014 0.2091 -0.0228 0.0546  -0.0047 324  TYR B O   
5228 C CB  . TYR B 340 ? 0.2689 0.2066 0.2302 -0.0195 0.0743  -0.0168 324  TYR B CB  
5229 C CG  . TYR B 340 ? 0.3059 0.2300 0.2572 -0.0187 0.0874  -0.0210 324  TYR B CG  
5230 C CD1 . TYR B 340 ? 0.3324 0.2519 0.2754 -0.0197 0.0951  -0.0204 324  TYR B CD1 
5231 C CD2 . TYR B 340 ? 0.3381 0.2518 0.2860 -0.0172 0.0927  -0.0254 324  TYR B CD2 
5232 C CE1 . TYR B 340 ? 0.3729 0.2766 0.3033 -0.0194 0.1084  -0.0239 324  TYR B CE1 
5233 C CE2 . TYR B 340 ? 0.3674 0.2662 0.3044 -0.0165 0.1068  -0.0292 324  TYR B CE2 
5234 C CZ  . TYR B 340 ? 0.4310 0.3242 0.3585 -0.0179 0.1150  -0.0283 324  TYR B CZ  
5235 O OH  . TYR B 340 ? 0.4666 0.3424 0.3807 -0.0176 0.1303  -0.0319 324  TYR B OH  
5236 N N   . LEU B 341 ? 0.2314 0.1982 0.2190 -0.0209 0.0571  -0.0096 325  LEU B N   
5237 C CA  . LEU B 341 ? 0.2280 0.2011 0.2191 -0.0219 0.0479  -0.0056 325  LEU B CA  
5238 C C   . LEU B 341 ? 0.2536 0.2335 0.2455 -0.0228 0.0477  -0.0016 325  LEU B C   
5239 O O   . LEU B 341 ? 0.2224 0.2035 0.2103 -0.0243 0.0429  0.0028  325  LEU B O   
5240 C CB  . LEU B 341 ? 0.2330 0.2098 0.2366 -0.0208 0.0442  -0.0080 325  LEU B CB  
5241 C CG  . LEU B 341 ? 0.2847 0.2552 0.2890 -0.0197 0.0428  -0.0118 325  LEU B CG  
5242 C CD1 . LEU B 341 ? 0.2755 0.2489 0.2920 -0.0187 0.0364  -0.0138 325  LEU B CD1 
5243 C CD2 . LEU B 341 ? 0.3169 0.2806 0.3079 -0.0209 0.0379  -0.0090 325  LEU B CD2 
5244 N N   . LEU B 342 ? 0.2376 0.2214 0.2355 -0.0220 0.0532  -0.0033 326  LEU B N   
5245 C CA  . LEU B 34