data_4TXQ
# 
_entry.id   4TXQ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.319 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4TXQ         
WWPDB D_1000202472 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB . 4TXP unspecified 
PDB . 4TXR unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4TXQ 
_pdbx_database_status.recvd_initial_deposition_date   2014-07-04 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Vild, C.J.' 1 ? 
'Xu, Z.'     2 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_id_ASTM           JBCHA3 
_citation.journal_id_CSD            0071 
_citation.journal_id_ISSN           1083-351X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            290 
_citation.language                  ? 
_citation.page_first                7291 
_citation.page_last                 7303 
_citation.title                     
;A Novel Mechanism of Regulating the ATPase VPS4 by Its Cofactor LIP5 and the Endosomal Sorting Complex Required for Transport (ESCRT)-III Protein CHMP5.
;
_citation.year                      2015 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1074/jbc.M114.616730 
_citation.pdbx_database_id_PubMed   25637630 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Vild, C.J.' 1 ? 
primary 'Li, Y.'     2 ? 
primary 'Guo, E.Z.'  3 ? 
primary 'Liu, Y.'    4 ? 
primary 'Xu, Z.'     5 ? 
# 
_cell.entry_id           4TXQ 
_cell.length_a           52.936 
_cell.length_b           55.536 
_cell.length_c           195.359 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4TXQ 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Vacuolar protein sorting-associated protein VTA1 homolog' 18792.727 2   ? ? 'UNP residues 1-162'   ? 
2 polymer man 'Charged multivesicular body protein 1b'                   2718.953  2   ? ? 'UNP residues 176-199' ? 
3 water   nat water                                                      18.015    198 ? ? ?                      ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Dopamine-responsive gene 1 protein,DRG-1,LYST-interacting protein 5,LIP5,SKD1-binding protein 1,SBP1'    
2 'CHMP1.5,Chromatin-modifying protein 1b,CHMP1b,Vacuolar protein sorting-associated protein 46-2,hVps46-2' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;SMAALAPLPPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEALKKQLGDNEA
ITQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIKSFYTASLLIDVITVFGELTDENVKHRKYARWKATYIHNCLKNG
ETP
;
;SMAALAPLPPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEALKKQLGDNEA
ITQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIKSFYTASLLIDVITVFGELTDENVKHRKYARWKATYIHNCLKNG
ETP
;
A,B ? 
2 'polypeptide(L)' no no SVGTSVASAEQDELSQRLARLRDQV SVGTSVASAEQDELSQRLARLRDQV C,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   MET n 
1 3   ALA n 
1 4   ALA n 
1 5   LEU n 
1 6   ALA n 
1 7   PRO n 
1 8   LEU n 
1 9   PRO n 
1 10  PRO n 
1 11  LEU n 
1 12  PRO n 
1 13  ALA n 
1 14  GLN n 
1 15  PHE n 
1 16  LYS n 
1 17  SER n 
1 18  ILE n 
1 19  GLN n 
1 20  HIS n 
1 21  HIS n 
1 22  LEU n 
1 23  ARG n 
1 24  THR n 
1 25  ALA n 
1 26  GLN n 
1 27  GLU n 
1 28  HIS n 
1 29  ASP n 
1 30  LYS n 
1 31  ARG n 
1 32  ASP n 
1 33  PRO n 
1 34  VAL n 
1 35  VAL n 
1 36  ALA n 
1 37  TYR n 
1 38  TYR n 
1 39  CYS n 
1 40  ARG n 
1 41  LEU n 
1 42  TYR n 
1 43  ALA n 
1 44  MET n 
1 45  GLN n 
1 46  THR n 
1 47  GLY n 
1 48  MET n 
1 49  LYS n 
1 50  ILE n 
1 51  ASP n 
1 52  SER n 
1 53  LYS n 
1 54  THR n 
1 55  PRO n 
1 56  GLU n 
1 57  CYS n 
1 58  ARG n 
1 59  LYS n 
1 60  PHE n 
1 61  LEU n 
1 62  SER n 
1 63  LYS n 
1 64  LEU n 
1 65  MET n 
1 66  ASP n 
1 67  GLN n 
1 68  LEU n 
1 69  GLU n 
1 70  ALA n 
1 71  LEU n 
1 72  LYS n 
1 73  LYS n 
1 74  GLN n 
1 75  LEU n 
1 76  GLY n 
1 77  ASP n 
1 78  ASN n 
1 79  GLU n 
1 80  ALA n 
1 81  ILE n 
1 82  THR n 
1 83  GLN n 
1 84  GLU n 
1 85  ILE n 
1 86  VAL n 
1 87  GLY n 
1 88  CYS n 
1 89  ALA n 
1 90  HIS n 
1 91  LEU n 
1 92  GLU n 
1 93  ASN n 
1 94  TYR n 
1 95  ALA n 
1 96  LEU n 
1 97  LYS n 
1 98  MET n 
1 99  PHE n 
1 100 LEU n 
1 101 TYR n 
1 102 ALA n 
1 103 ASP n 
1 104 ASN n 
1 105 GLU n 
1 106 ASP n 
1 107 ARG n 
1 108 ALA n 
1 109 GLY n 
1 110 ARG n 
1 111 PHE n 
1 112 HIS n 
1 113 LYS n 
1 114 ASN n 
1 115 MET n 
1 116 ILE n 
1 117 LYS n 
1 118 SER n 
1 119 PHE n 
1 120 TYR n 
1 121 THR n 
1 122 ALA n 
1 123 SER n 
1 124 LEU n 
1 125 LEU n 
1 126 ILE n 
1 127 ASP n 
1 128 VAL n 
1 129 ILE n 
1 130 THR n 
1 131 VAL n 
1 132 PHE n 
1 133 GLY n 
1 134 GLU n 
1 135 LEU n 
1 136 THR n 
1 137 ASP n 
1 138 GLU n 
1 139 ASN n 
1 140 VAL n 
1 141 LYS n 
1 142 HIS n 
1 143 ARG n 
1 144 LYS n 
1 145 TYR n 
1 146 ALA n 
1 147 ARG n 
1 148 TRP n 
1 149 LYS n 
1 150 ALA n 
1 151 THR n 
1 152 TYR n 
1 153 ILE n 
1 154 HIS n 
1 155 ASN n 
1 156 CYS n 
1 157 LEU n 
1 158 LYS n 
1 159 ASN n 
1 160 GLY n 
1 161 GLU n 
1 162 THR n 
1 163 PRO n 
2 1   SER n 
2 2   VAL n 
2 3   GLY n 
2 4   THR n 
2 5   SER n 
2 6   VAL n 
2 7   ALA n 
2 8   SER n 
2 9   ALA n 
2 10  GLU n 
2 11  GLN n 
2 12  ASP n 
2 13  GLU n 
2 14  LEU n 
2 15  SER n 
2 16  GLN n 
2 17  ARG n 
2 18  LEU n 
2 19  ALA n 
2 20  ARG n 
2 21  LEU n 
2 22  ARG n 
2 23  ASP n 
2 24  GLN n 
2 25  VAL n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 163 Human ? 'VTA1, C6orf55, HSPC228, My012' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? 'Rosetta (DE3)' ? ? ? ? ? ? ? plasmid ? 'modified pET28b; his6-sumo tag; kanR' ? pSMT3 ? ? 
2 1 sample 'Biological sequence' 1 25  Human ? 'CHMP1B, C18orf2'               ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? 'Rosetta (DE3)' ? ? ? ? ? ? ? plasmid ? 'modified pET28b; his6-sumo tag; kanR' ? pSMT3 ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP VTA1_HUMAN  Q9NP79 1 
;MAALAPLPPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEALKKQLGDNEAI
TQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIKSFYTASLLIDVITVFGELTDENVKHRKYARWKATYIHNCLKNGE
TP
;
1   ? 
2 UNP CHM1B_HUMAN Q7LBR1 2 VGTSVASAEQDELSQRLARLRDQV 176 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4TXQ A 2 ? 163 ? Q9NP79 1   ? 162 ? 1   162 
2 1 4TXQ B 2 ? 163 ? Q9NP79 1   ? 162 ? 1   162 
3 2 4TXQ C 2 ? 25  ? Q7LBR1 176 ? 199 ? 176 199 
4 2 4TXQ D 2 ? 25  ? Q7LBR1 176 ? 199 ? 176 199 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4TXQ SER A 1 ? UNP Q9NP79 ? ? 'expression tag' 0   1 
2 4TXQ SER B 1 ? UNP Q9NP79 ? ? 'expression tag' 0   2 
3 4TXQ SER C 1 ? UNP Q7LBR1 ? ? 'expression tag' 175 3 
4 4TXQ SER D 1 ? UNP Q7LBR1 ? ? 'expression tag' 175 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4TXQ 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.34 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         63.13 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              9 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277.15 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
;Protein mixture was added in 1:1 ratio with a solution of 16% MPD, 0.1 M Tris and equilibrated against a mother liquid of 8% MPD, 0.1 M Tris
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           193.15 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'MARMOSAIC 300 mm CCD' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2012-12-14 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'diamond laue monochromators with beryllium lenses' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97872 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 21-ID-D' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97872 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   21-ID-D 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         4TXQ 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.208 
_reflns.d_resolution_low                 41.076 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       29702 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.9 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  7.3 
_reflns.pdbx_Rmerge_I_obs                0.11 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            19.4 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.208 
_reflns_shell.d_res_low                   2.28 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         3.2 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        100 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.55 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             7.4 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 4TXQ 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.21 
_refine.ls_d_res_low                             41.076 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     29633 
_refine.ls_number_reflns_R_free                  1996 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.38 
_refine.ls_percent_reflns_R_free                 6.74 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1955 
_refine.ls_R_factor_R_free                       0.2266 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1932 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.36 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4TXP 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            'Random selection' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 22.80 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.20 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.009  ? 2866 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.224  ? 3870 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 10.426 ? 1072 ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.051  ? 429  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.006  ? 499  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
'X-RAY DIFFRACTION' 2.21   2.2634  . . 127 1766 92.00  . . . 0.2814 . 0.2476 . . . . . . . . 
'X-RAY DIFFRACTION' 2.2634 2.3246  . . 140 1972 100.00 . . . 0.2786 . 0.2271 . . . . . . . . 
'X-RAY DIFFRACTION' 2.3246 2.3930  . . 140 1960 100.00 . . . 0.2552 . 0.2219 . . . . . . . . 
'X-RAY DIFFRACTION' 2.3930 2.4702  . . 132 1936 100.00 . . . 0.3111 . 0.2084 . . . . . . . . 
'X-RAY DIFFRACTION' 2.4702 2.5585  . . 151 1965 100.00 . . . 0.2403 . 0.2142 . . . . . . . . 
'X-RAY DIFFRACTION' 2.5585 2.6609  . . 139 1974 100.00 . . . 0.2612 . 0.2060 . . . . . . . . 
'X-RAY DIFFRACTION' 2.6609 2.7820  . . 140 1974 100.00 . . . 0.2406 . 0.2021 . . . . . . . . 
'X-RAY DIFFRACTION' 2.7820 2.9286  . . 146 1966 100.00 . . . 0.2312 . 0.1899 . . . . . . . . 
'X-RAY DIFFRACTION' 2.9286 3.1120  . . 142 1956 100.00 . . . 0.2152 . 0.1952 . . . . . . . . 
'X-RAY DIFFRACTION' 3.1120 3.3522  . . 139 1988 100.00 . . . 0.2160 . 0.2074 . . . . . . . . 
'X-RAY DIFFRACTION' 3.3522 3.6894  . . 145 1996 100.00 . . . 0.2546 . 0.1903 . . . . . . . . 
'X-RAY DIFFRACTION' 3.6894 4.2227  . . 146 2011 100.00 . . . 0.2142 . 0.1735 . . . . . . . . 
'X-RAY DIFFRACTION' 4.2227 5.3184  . . 151 2039 100.00 . . . 0.1795 . 0.1737 . . . . . . . . 
'X-RAY DIFFRACTION' 5.3184 41.0833 . . 158 2134 99.00  . . . 0.2236 . 0.1917 . . . . . . . . 
# 
_struct.entry_id                     4TXQ 
_struct.title                        'Crystal structure of LIP5 N-terminal domain complexed with CHMP1B MIM' 
_struct.pdbx_descriptor              'LIP5 N-terminal domain, CHMP1B' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4TXQ 
_struct_keywords.text            'MIT, MIT domain, Protein Transport, ESCRT' 
_struct_keywords.pdbx_keywords   'PROTEIN TRANSPORT' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 PRO A 12  ? SER A 17  ? PRO A 11  SER A 16  5 ? 6  
HELX_P HELX_P2  AA2 ILE A 18  ? ASP A 29  ? ILE A 17  ASP A 28  1 ? 12 
HELX_P HELX_P3  AA3 ASP A 32  ? ASP A 51  ? ASP A 31  ASP A 50  1 ? 20 
HELX_P HELX_P4  AA4 THR A 54  ? GLY A 76  ? THR A 53  GLY A 75  1 ? 23 
HELX_P HELX_P5  AA5 ASN A 78  ? GLN A 83  ? ASN A 77  GLN A 82  1 ? 6  
HELX_P HELX_P6  AA6 GLN A 83  ? GLY A 109 ? GLN A 82  GLY A 108 1 ? 27 
HELX_P HELX_P7  AA7 HIS A 112 ? THR A 130 ? HIS A 111 THR A 129 1 ? 19 
HELX_P HELX_P8  AA8 VAL A 131 ? GLY A 133 ? VAL A 130 GLY A 132 5 ? 3  
HELX_P HELX_P9  AA9 THR A 136 ? ASN A 159 ? THR A 135 ASN A 158 1 ? 24 
HELX_P HELX_P10 AB1 PRO B 12  ? SER B 17  ? PRO B 11  SER B 16  5 ? 6  
HELX_P HELX_P11 AB2 ILE B 18  ? ASP B 29  ? ILE B 17  ASP B 28  1 ? 12 
HELX_P HELX_P12 AB3 ASP B 32  ? ASP B 51  ? ASP B 31  ASP B 50  1 ? 20 
HELX_P HELX_P13 AB4 THR B 54  ? LEU B 75  ? THR B 53  LEU B 74  1 ? 22 
HELX_P HELX_P14 AB5 ASN B 78  ? GLN B 83  ? ASN B 77  GLN B 82  1 ? 6  
HELX_P HELX_P15 AB6 GLN B 83  ? ALA B 108 ? GLN B 82  ALA B 107 1 ? 26 
HELX_P HELX_P16 AB7 HIS B 112 ? ILE B 129 ? HIS B 111 ILE B 128 1 ? 18 
HELX_P HELX_P17 AB8 THR B 130 ? GLY B 133 ? THR B 129 GLY B 132 5 ? 4  
HELX_P HELX_P18 AB9 THR B 136 ? ASN B 159 ? THR B 135 ASN B 158 1 ? 24 
HELX_P HELX_P19 AC1 GLU C 13  ? ARG C 22  ? GLU C 187 ARG C 196 1 ? 10 
HELX_P HELX_P20 AC2 GLU D 10  ? GLN D 24  ? GLU D 184 GLN D 198 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_atom_sites.entry_id                    4TXQ 
_atom_sites.fract_transf_matrix[1][1]   0.018891 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.018006 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005119 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . MET A 1 2   ? -13.440 24.475 6.703   1.00 45.86 ? 1   MET A N   1 
ATOM   2    C CA  . MET A 1 2   ? -13.584 24.894 5.315   1.00 47.82 ? 1   MET A CA  1 
ATOM   3    C C   . MET A 1 2   ? -14.743 24.149 4.654   1.00 46.04 ? 1   MET A C   1 
ATOM   4    O O   . MET A 1 2   ? -14.849 22.930 4.744   1.00 44.02 ? 1   MET A O   1 
ATOM   5    C CB  . MET A 1 2   ? -12.272 24.671 4.541   1.00 48.90 ? 1   MET A CB  1 
ATOM   6    C CG  . MET A 1 2   ? -12.352 24.987 3.038   1.00 52.41 ? 1   MET A CG  1 
ATOM   7    S SD  . MET A 1 2   ? -10.775 24.932 2.130   1.00 54.77 ? 1   MET A SD  1 
ATOM   8    C CE  . MET A 1 2   ? -10.433 23.175 2.081   1.00 41.84 ? 1   MET A CE  1 
ATOM   9    N N   . ALA A 1 3   ? -15.620 24.890 3.988   1.00 50.77 ? 2   ALA A N   1 
ATOM   10   C CA  . ALA A 1 3   ? -16.788 24.283 3.350   1.00 51.96 ? 2   ALA A CA  1 
ATOM   11   C C   . ALA A 1 3   ? -16.396 23.316 2.223   1.00 49.51 ? 2   ALA A C   1 
ATOM   12   O O   . ALA A 1 3   ? -15.397 23.539 1.518   1.00 45.01 ? 2   ALA A O   1 
ATOM   13   C CB  . ALA A 1 3   ? -17.722 25.384 2.805   1.00 47.13 ? 2   ALA A CB  1 
ATOM   14   N N   . ALA A 1 4   ? -17.177 22.247 2.054   1.00 46.58 ? 3   ALA A N   1 
ATOM   15   C CA  . ALA A 1 4   ? -17.087 21.457 0.831   1.00 42.95 ? 3   ALA A CA  1 
ATOM   16   C C   . ALA A 1 4   ? -17.286 22.409 -0.349  1.00 48.07 ? 3   ALA A C   1 
ATOM   17   O O   . ALA A 1 4   ? -18.151 23.289 -0.303  1.00 48.01 ? 3   ALA A O   1 
ATOM   18   C CB  . ALA A 1 4   ? -18.120 20.335 0.813   1.00 38.99 ? 3   ALA A CB  1 
ATOM   19   N N   . LEU A 1 5   ? -16.458 22.249 -1.380  1.00 44.66 ? 4   LEU A N   1 
ATOM   20   C CA  . LEU A 1 5   ? -16.491 23.097 -2.573  1.00 46.37 ? 4   LEU A CA  1 
ATOM   21   C C   . LEU A 1 5   ? -16.402 24.605 -2.268  1.00 49.12 ? 4   LEU A C   1 
ATOM   22   O O   . LEU A 1 5   ? -17.013 25.410 -2.968  1.00 49.91 ? 4   LEU A O   1 
ATOM   23   C CB  . LEU A 1 5   ? -17.760 22.812 -3.393  1.00 46.04 ? 4   LEU A CB  1 
ATOM   24   C CG  . LEU A 1 5   ? -17.913 21.385 -3.940  1.00 46.93 ? 4   LEU A CG  1 
ATOM   25   C CD1 . LEU A 1 5   ? -19.240 21.207 -4.677  1.00 39.71 ? 4   LEU A CD1 1 
ATOM   26   C CD2 . LEU A 1 5   ? -16.734 21.021 -4.834  1.00 47.45 ? 4   LEU A CD2 1 
ATOM   27   N N   . ALA A 1 6   ? -15.650 24.985 -1.234  1.00 46.06 ? 5   ALA A N   1 
ATOM   28   C CA  . ALA A 1 6   ? -15.407 26.400 -0.961  1.00 44.05 ? 5   ALA A CA  1 
ATOM   29   C C   . ALA A 1 6   ? -14.756 27.048 -2.190  1.00 54.95 ? 5   ALA A C   1 
ATOM   30   O O   . ALA A 1 6   ? -13.677 26.626 -2.625  1.00 53.58 ? 5   ALA A O   1 
ATOM   31   C CB  . ALA A 1 6   ? -14.538 26.572 0.261   1.00 43.26 ? 5   ALA A CB  1 
ATOM   32   N N   . PRO A 1 7   ? -15.427 28.058 -2.771  1.00 52.79 ? 6   PRO A N   1 
ATOM   33   C CA  . PRO A 1 7   ? -14.998 28.635 -4.052  1.00 51.05 ? 6   PRO A CA  1 
ATOM   34   C C   . PRO A 1 7   ? -13.793 29.572 -3.956  1.00 51.65 ? 6   PRO A C   1 
ATOM   35   O O   . PRO A 1 7   ? -13.679 30.392 -3.034  1.00 49.84 ? 6   PRO A O   1 
ATOM   36   C CB  . PRO A 1 7   ? -16.237 29.409 -4.511  1.00 52.28 ? 6   PRO A CB  1 
ATOM   37   C CG  . PRO A 1 7   ? -16.922 29.794 -3.236  1.00 49.61 ? 6   PRO A CG  1 
ATOM   38   C CD  . PRO A 1 7   ? -16.688 28.654 -2.284  1.00 50.67 ? 6   PRO A CD  1 
ATOM   39   N N   . LEU A 1 8   ? -12.884 29.420 -4.913  1.00 50.70 ? 7   LEU A N   1 
ATOM   40   C CA  . LEU A 1 8   ? -11.825 30.395 -5.138  1.00 51.18 ? 7   LEU A CA  1 
ATOM   41   C C   . LEU A 1 8   ? -12.347 31.398 -6.161  1.00 46.53 ? 7   LEU A C   1 
ATOM   42   O O   . LEU A 1 8   ? -13.349 31.124 -6.825  1.00 47.56 ? 7   LEU A O   1 
ATOM   43   C CB  . LEU A 1 8   ? -10.548 29.703 -5.628  1.00 47.70 ? 7   LEU A CB  1 
ATOM   44   C CG  . LEU A 1 8   ? -9.899  28.760 -4.607  1.00 50.72 ? 7   LEU A CG  1 
ATOM   45   C CD1 . LEU A 1 8   ? -8.752  27.978 -5.232  1.00 44.10 ? 7   LEU A CD1 1 
ATOM   46   C CD2 . LEU A 1 8   ? -9.413  29.538 -3.390  1.00 45.84 ? 7   LEU A CD2 1 
ATOM   47   N N   . PRO A 1 9   ? -11.690 32.564 -6.299  1.00 48.17 ? 8   PRO A N   1 
ATOM   48   C CA  . PRO A 1 9   ? -12.103 33.425 -7.417  1.00 48.25 ? 8   PRO A CA  1 
ATOM   49   C C   . PRO A 1 9   ? -11.861 32.730 -8.760  1.00 53.07 ? 8   PRO A C   1 
ATOM   50   O O   . PRO A 1 9   ? -11.254 31.658 -8.779  1.00 50.83 ? 8   PRO A O   1 
ATOM   51   C CB  . PRO A 1 9   ? -11.238 34.686 -7.233  1.00 50.27 ? 8   PRO A CB  1 
ATOM   52   C CG  . PRO A 1 9   ? -10.138 34.293 -6.326  1.00 49.92 ? 8   PRO A CG  1 
ATOM   53   C CD  . PRO A 1 9   ? -10.676 33.210 -5.447  1.00 46.57 ? 8   PRO A CD  1 
ATOM   54   N N   . PRO A 1 10  ? -12.371 33.294 -9.865  1.00 55.31 ? 9   PRO A N   1 
ATOM   55   C CA  . PRO A 1 10  ? -12.158 32.613 -11.146 1.00 53.04 ? 9   PRO A CA  1 
ATOM   56   C C   . PRO A 1 10  ? -10.676 32.314 -11.398 1.00 54.57 ? 9   PRO A C   1 
ATOM   57   O O   . PRO A 1 10  ? -9.812  33.077 -10.960 1.00 52.18 ? 9   PRO A O   1 
ATOM   58   C CB  . PRO A 1 10  ? -12.705 33.615 -12.171 1.00 51.09 ? 9   PRO A CB  1 
ATOM   59   C CG  . PRO A 1 10  ? -13.743 34.379 -11.422 1.00 51.01 ? 9   PRO A CG  1 
ATOM   60   C CD  . PRO A 1 10  ? -13.207 34.502 -10.013 1.00 55.02 ? 9   PRO A CD  1 
ATOM   61   N N   . LEU A 1 11  ? -10.396 31.201 -12.067 1.00 48.73 ? 10  LEU A N   1 
ATOM   62   C CA  . LEU A 1 11  ? -9.027  30.792 -12.320 1.00 50.63 ? 10  LEU A CA  1 
ATOM   63   C C   . LEU A 1 11  ? -8.447  31.642 -13.437 1.00 46.80 ? 10  LEU A C   1 
ATOM   64   O O   . LEU A 1 11  ? -8.970  31.627 -14.543 1.00 47.43 ? 10  LEU A O   1 
ATOM   65   C CB  . LEU A 1 11  ? -8.970  29.309 -12.704 1.00 44.53 ? 10  LEU A CB  1 
ATOM   66   C CG  . LEU A 1 11  ? -7.590  28.687 -12.958 1.00 48.62 ? 10  LEU A CG  1 
ATOM   67   C CD1 . LEU A 1 11  ? -6.764  28.592 -11.657 1.00 44.61 ? 10  LEU A CD1 1 
ATOM   68   C CD2 . LEU A 1 11  ? -7.719  27.325 -13.635 1.00 41.62 ? 10  LEU A CD2 1 
ATOM   69   N N   . PRO A 1 12  ? -7.373  32.394 -13.151 1.00 49.38 ? 11  PRO A N   1 
ATOM   70   C CA  . PRO A 1 12  ? -6.656  33.127 -14.204 1.00 50.48 ? 11  PRO A CA  1 
ATOM   71   C C   . PRO A 1 12  ? -6.316  32.230 -15.402 1.00 51.64 ? 11  PRO A C   1 
ATOM   72   O O   . PRO A 1 12  ? -5.964  31.066 -15.203 1.00 50.11 ? 11  PRO A O   1 
ATOM   73   C CB  . PRO A 1 12  ? -5.389  33.599 -13.494 1.00 48.51 ? 11  PRO A CB  1 
ATOM   74   C CG  . PRO A 1 12  ? -5.822  33.773 -12.070 1.00 49.63 ? 11  PRO A CG  1 
ATOM   75   C CD  . PRO A 1 12  ? -6.845  32.694 -11.809 1.00 47.92 ? 11  PRO A CD  1 
ATOM   76   N N   . ALA A 1 13  ? -6.443  32.764 -16.616 1.00 48.16 ? 12  ALA A N   1 
ATOM   77   C CA  . ALA A 1 13  ? -6.196  32.007 -17.853 1.00 51.69 ? 12  ALA A CA  1 
ATOM   78   C C   . ALA A 1 13  ? -4.800  31.414 -17.872 1.00 45.09 ? 12  ALA A C   1 
ATOM   79   O O   . ALA A 1 13  ? -4.567  30.302 -18.323 1.00 46.72 ? 12  ALA A O   1 
ATOM   80   C CB  . ALA A 1 13  ? -6.390  32.905 -19.063 1.00 48.88 ? 12  ALA A CB  1 
ATOM   81   N N   . GLN A 1 14  ? -3.872  32.204 -17.375 1.00 48.70 ? 13  GLN A N   1 
ATOM   82   C CA  . GLN A 1 14  ? -2.490  31.810 -17.183 1.00 52.17 ? 13  GLN A CA  1 
ATOM   83   C C   . GLN A 1 14  ? -2.252  30.649 -16.193 1.00 52.30 ? 13  GLN A C   1 
ATOM   84   O O   . GLN A 1 14  ? -1.210  29.987 -16.258 1.00 43.56 ? 13  GLN A O   1 
ATOM   85   C CB  . GLN A 1 14  ? -1.752  33.084 -16.817 1.00 48.64 ? 13  GLN A CB  1 
ATOM   86   C CG  . GLN A 1 14  ? -2.786  34.161 -16.443 1.00 59.44 ? 13  GLN A CG  1 
ATOM   87   C CD  . GLN A 1 14  ? -2.161  35.479 -16.118 1.00 65.51 ? 13  GLN A CD  1 
ATOM   88   O OE1 . GLN A 1 14  ? -0.943  35.611 -16.102 1.00 77.42 ? 13  GLN A OE1 1 
ATOM   89   N NE2 . GLN A 1 14  ? -2.992  36.502 -15.981 1.00 69.91 ? 13  GLN A NE2 1 
ATOM   90   N N   . PHE A 1 15  ? -3.234  30.351 -15.341 1.00 51.18 ? 14  PHE A N   1 
ATOM   91   C CA  . PHE A 1 15  ? -3.127  29.190 -14.466 1.00 46.07 ? 14  PHE A CA  1 
ATOM   92   C C   . PHE A 1 15  ? -3.922  27.993 -14.993 1.00 45.14 ? 14  PHE A C   1 
ATOM   93   O O   . PHE A 1 15  ? -4.216  27.065 -14.238 1.00 45.01 ? 14  PHE A O   1 
ATOM   94   C CB  . PHE A 1 15  ? -3.598  29.524 -13.050 1.00 46.73 ? 14  PHE A CB  1 
ATOM   95   C CG  . PHE A 1 15  ? -2.744  30.540 -12.327 1.00 44.86 ? 14  PHE A CG  1 
ATOM   96   C CD1 . PHE A 1 15  ? -1.517  30.940 -12.833 1.00 46.88 ? 14  PHE A CD1 1 
ATOM   97   C CD2 . PHE A 1 15  ? -3.147  31.042 -11.095 1.00 44.44 ? 14  PHE A CD2 1 
ATOM   98   C CE1 . PHE A 1 15  ? -0.733  31.862 -12.150 1.00 44.04 ? 14  PHE A CE1 1 
ATOM   99   C CE2 . PHE A 1 15  ? -2.362  31.963 -10.409 1.00 47.08 ? 14  PHE A CE2 1 
ATOM   100  C CZ  . PHE A 1 15  ? -1.153  32.367 -10.940 1.00 44.97 ? 14  PHE A CZ  1 
ATOM   101  N N   . LYS A 1 16  ? -4.267  27.998 -16.279 1.00 41.26 ? 15  LYS A N   1 
ATOM   102  C CA  . LYS A 1 16  ? -5.086  26.919 -16.827 1.00 41.29 ? 15  LYS A CA  1 
ATOM   103  C C   . LYS A 1 16  ? -4.447  25.542 -16.590 1.00 41.51 ? 15  LYS A C   1 
ATOM   104  O O   . LYS A 1 16  ? -5.154  24.540 -16.445 1.00 36.77 ? 15  LYS A O   1 
ATOM   105  C CB  . LYS A 1 16  ? -5.334  27.124 -18.329 1.00 37.92 ? 15  LYS A CB  1 
ATOM   106  N N   . SER A 1 17  ? -3.118  25.491 -16.528 1.00 36.31 ? 16  SER A N   1 
ATOM   107  C CA  . SER A 1 17  ? -2.437  24.205 -16.364 1.00 38.53 ? 16  SER A CA  1 
ATOM   108  C C   . SER A 1 17  ? -2.576  23.573 -14.964 1.00 36.71 ? 16  SER A C   1 
ATOM   109  O O   . SER A 1 17  ? -2.215  22.425 -14.788 1.00 40.24 ? 16  SER A O   1 
ATOM   110  C CB  . SER A 1 17  ? -0.954  24.348 -16.699 1.00 38.59 ? 16  SER A CB  1 
ATOM   111  O OG  . SER A 1 17  ? -0.322  25.217 -15.780 1.00 38.43 ? 16  SER A OG  1 
ATOM   112  N N   . ILE A 1 18  ? -3.072  24.300 -13.966 1.00 37.23 ? 17  ILE A N   1 
ATOM   113  C CA  . ILE A 1 18  ? -3.291  23.674 -12.661 1.00 38.55 ? 17  ILE A CA  1 
ATOM   114  C C   . ILE A 1 18  ? -4.774  23.440 -12.360 1.00 39.38 ? 17  ILE A C   1 
ATOM   115  O O   . ILE A 1 18  ? -5.130  23.044 -11.249 1.00 33.75 ? 17  ILE A O   1 
ATOM   116  C CB  . ILE A 1 18  ? -2.684  24.515 -11.517 1.00 42.97 ? 17  ILE A CB  1 
ATOM   117  C CG1 . ILE A 1 18  ? -3.297  25.920 -11.509 1.00 41.52 ? 17  ILE A CG1 1 
ATOM   118  C CG2 . ILE A 1 18  ? -1.178  24.549 -11.632 1.00 38.84 ? 17  ILE A CG2 1 
ATOM   119  C CD1 . ILE A 1 18  ? -2.850  26.782 -10.380 1.00 47.30 ? 17  ILE A CD1 1 
ATOM   120  N N   . GLN A 1 19  ? -5.632  23.699 -13.344 1.00 36.67 ? 18  GLN A N   1 
ATOM   121  C CA  . GLN A 1 19  ? -7.070  23.538 -13.164 1.00 37.91 ? 18  GLN A CA  1 
ATOM   122  C C   . GLN A 1 19  ? -7.474  22.159 -12.626 1.00 39.72 ? 18  GLN A C   1 
ATOM   123  O O   . GLN A 1 19  ? -8.290  22.053 -11.714 1.00 38.69 ? 18  GLN A O   1 
ATOM   124  C CB  . GLN A 1 19  ? -7.801  23.769 -14.481 1.00 38.31 ? 18  GLN A CB  1 
ATOM   125  C CG  . GLN A 1 19  ? -9.309  23.601 -14.341 1.00 44.11 ? 18  GLN A CG  1 
ATOM   126  C CD  . GLN A 1 19  ? -10.041 23.727 -15.666 1.00 51.54 ? 18  GLN A CD  1 
ATOM   127  O OE1 . GLN A 1 19  ? -9.439  24.038 -16.696 1.00 53.83 ? 18  GLN A OE1 1 
ATOM   128  N NE2 . GLN A 1 19  ? -11.337 23.445 -15.651 1.00 49.57 ? 18  GLN A NE2 1 
ATOM   129  N N   . HIS A 1 20  ? -6.920  21.103 -13.206 1.00 33.84 ? 19  HIS A N   1 
ATOM   130  C CA  . HIS A 1 20  ? -7.317  19.763 -12.817 1.00 39.20 ? 19  HIS A CA  1 
ATOM   131  C C   . HIS A 1 20  ? -6.695  19.302 -11.506 1.00 37.58 ? 19  HIS A C   1 
ATOM   132  O O   . HIS A 1 20  ? -7.230  18.401 -10.855 1.00 35.34 ? 19  HIS A O   1 
ATOM   133  C CB  . HIS A 1 20  ? -6.992  18.795 -13.936 1.00 36.26 ? 19  HIS A CB  1 
ATOM   134  C CG  . HIS A 1 20  ? -7.781  19.068 -15.176 1.00 46.34 ? 19  HIS A CG  1 
ATOM   135  N ND1 . HIS A 1 20  ? -7.404  18.613 -16.421 1.00 47.54 ? 19  HIS A ND1 1 
ATOM   136  C CD2 . HIS A 1 20  ? -8.928  19.762 -15.356 1.00 47.63 ? 19  HIS A CD2 1 
ATOM   137  C CE1 . HIS A 1 20  ? -8.287  19.022 -17.317 1.00 49.37 ? 19  HIS A CE1 1 
ATOM   138  N NE2 . HIS A 1 20  ? -9.220  19.721 -16.697 1.00 45.30 ? 19  HIS A NE2 1 
ATOM   139  N N   . HIS A 1 21  ? -5.591  19.931 -11.109 1.00 33.99 ? 20  HIS A N   1 
ATOM   140  C CA  . HIS A 1 21  ? -4.979  19.615 -9.819  1.00 35.88 ? 20  HIS A CA  1 
ATOM   141  C C   . HIS A 1 21  ? -5.876  20.203 -8.739  1.00 33.87 ? 20  HIS A C   1 
ATOM   142  O O   . HIS A 1 21  ? -6.084  19.600 -7.695  1.00 35.74 ? 20  HIS A O   1 
ATOM   143  C CB  . HIS A 1 21  ? -3.552  20.172 -9.743  1.00 31.55 ? 20  HIS A CB  1 
ATOM   144  C CG  . HIS A 1 21  ? -2.691  19.723 -10.883 1.00 34.61 ? 20  HIS A CG  1 
ATOM   145  N ND1 . HIS A 1 21  ? -2.717  20.336 -12.120 1.00 34.03 ? 20  HIS A ND1 1 
ATOM   146  C CD2 . HIS A 1 21  ? -1.819  18.684 -10.996 1.00 26.24 ? 20  HIS A CD2 1 
ATOM   147  C CE1 . HIS A 1 21  ? -1.884  19.715 -12.942 1.00 31.41 ? 20  HIS A CE1 1 
ATOM   148  N NE2 . HIS A 1 21  ? -1.335  18.705 -12.282 1.00 36.27 ? 20  HIS A NE2 1 
ATOM   149  N N   . LEU A 1 22  ? -6.429  21.380 -9.010  1.00 35.76 ? 21  LEU A N   1 
ATOM   150  C CA  . LEU A 1 22  ? -7.359  22.007 -8.078  1.00 36.17 ? 21  LEU A CA  1 
ATOM   151  C C   . LEU A 1 22  ? -8.663  21.237 -7.983  1.00 35.81 ? 21  LEU A C   1 
ATOM   152  O O   . LEU A 1 22  ? -9.221  21.083 -6.897  1.00 35.89 ? 21  LEU A O   1 
ATOM   153  C CB  . LEU A 1 22  ? -7.640  23.451 -8.484  1.00 35.25 ? 21  LEU A CB  1 
ATOM   154  C CG  . LEU A 1 22  ? -6.467  24.389 -8.268  1.00 38.33 ? 21  LEU A CG  1 
ATOM   155  C CD1 . LEU A 1 22  ? -6.777  25.759 -8.864  1.00 44.38 ? 21  LEU A CD1 1 
ATOM   156  C CD2 . LEU A 1 22  ? -6.193  24.504 -6.779  1.00 34.58 ? 21  LEU A CD2 1 
ATOM   157  N N   . ARG A 1 23  ? -9.153  20.753 -9.118  1.00 35.99 ? 22  ARG A N   1 
ATOM   158  C CA  . ARG A 1 23  ? -10.362 19.943 -9.108  1.00 37.79 ? 22  ARG A CA  1 
ATOM   159  C C   . ARG A 1 23  ? -10.145 18.672 -8.285  1.00 36.88 ? 22  ARG A C   1 
ATOM   160  O O   . ARG A 1 23  ? -11.023 18.266 -7.526  1.00 36.03 ? 22  ARG A O   1 
ATOM   161  C CB  . ARG A 1 23  ? -10.792 19.591 -10.534 1.00 38.28 ? 22  ARG A CB  1 
ATOM   162  C CG  . ARG A 1 23  ? -11.974 18.669 -10.608 1.00 41.51 ? 22  ARG A CG  1 
ATOM   163  C CD  . ARG A 1 23  ? -12.336 18.289 -12.064 1.00 53.03 ? 22  ARG A CD  1 
ATOM   164  N NE  . ARG A 1 23  ? -11.214 17.703 -12.814 1.00 53.71 ? 22  ARG A NE  1 
ATOM   165  C CZ  . ARG A 1 23  ? -10.737 16.465 -12.658 1.00 54.65 ? 22  ARG A CZ  1 
ATOM   166  N NH1 . ARG A 1 23  ? -11.241 15.644 -11.734 1.00 54.00 ? 22  ARG A NH1 1 
ATOM   167  N NH2 . ARG A 1 23  ? -9.718  16.055 -13.409 1.00 48.36 ? 22  ARG A NH2 1 
ATOM   168  N N   . THR A 1 24  ? -8.976  18.053 -8.446  1.00 33.97 ? 23  THR A N   1 
ATOM   169  C CA  . THR A 1 24  ? -8.646  16.827 -7.732  1.00 34.86 ? 23  THR A CA  1 
ATOM   170  C C   . THR A 1 24  ? -8.626  17.102 -6.226  1.00 33.06 ? 23  THR A C   1 
ATOM   171  O O   . THR A 1 24  ? -9.063  16.274 -5.428  1.00 33.11 ? 23  THR A O   1 
ATOM   172  C CB  . THR A 1 24  ? -7.270  16.243 -8.186  1.00 36.67 ? 23  THR A CB  1 
ATOM   173  O OG1 . THR A 1 24  ? -7.307  15.962 -9.589  1.00 35.60 ? 23  THR A OG1 1 
ATOM   174  C CG2 . THR A 1 24  ? -6.929  14.935 -7.431  1.00 29.04 ? 23  THR A CG2 1 
ATOM   175  N N   . ALA A 1 25  ? -8.111  18.269 -5.854  1.00 35.01 ? 24  ALA A N   1 
ATOM   176  C CA  . ALA A 1 25  ? -8.083  18.692 -4.464  1.00 35.87 ? 24  ALA A CA  1 
ATOM   177  C C   . ALA A 1 25  ? -9.506  18.735 -3.902  1.00 36.44 ? 24  ALA A C   1 
ATOM   178  O O   . ALA A 1 25  ? -9.794  18.088 -2.894  1.00 33.63 ? 24  ALA A O   1 
ATOM   179  C CB  . ALA A 1 25  ? -7.401  20.052 -4.328  1.00 28.09 ? 24  ALA A CB  1 
ATOM   180  N N   . GLN A 1 26  ? -10.389 19.476 -4.569  1.00 32.77 ? 25  GLN A N   1 
ATOM   181  C CA  . GLN A 1 26  ? -11.788 19.577 -4.147  1.00 35.98 ? 25  GLN A CA  1 
ATOM   182  C C   . GLN A 1 26  ? -12.482 18.237 -4.067  1.00 35.61 ? 25  GLN A C   1 
ATOM   183  O O   . GLN A 1 26  ? -13.239 17.991 -3.136  1.00 37.38 ? 25  GLN A O   1 
ATOM   184  C CB  . GLN A 1 26  ? -12.595 20.477 -5.082  1.00 33.85 ? 25  GLN A CB  1 
ATOM   185  C CG  . GLN A 1 26  ? -12.270 21.927 -4.944  1.00 39.52 ? 25  GLN A CG  1 
ATOM   186  C CD  . GLN A 1 26  ? -13.148 22.795 -5.812  1.00 46.17 ? 25  GLN A CD  1 
ATOM   187  O OE1 . GLN A 1 26  ? -13.502 22.427 -6.938  1.00 45.67 ? 25  GLN A OE1 1 
ATOM   188  N NE2 . GLN A 1 26  ? -13.584 23.918 -5.253  1.00 44.83 ? 25  GLN A NE2 1 
ATOM   189  N N   . GLU A 1 27  ? -12.221 17.362 -5.026  1.00 34.56 ? 26  GLU A N   1 
ATOM   190  C CA  . GLU A 1 27  ? -12.846 16.048 -4.990  1.00 32.97 ? 26  GLU A CA  1 
ATOM   191  C C   . GLU A 1 27  ? -12.338 15.190 -3.829  1.00 34.65 ? 26  GLU A C   1 
ATOM   192  O O   . GLU A 1 27  ? -13.007 14.243 -3.438  1.00 34.29 ? 26  GLU A O   1 
ATOM   193  C CB  . GLU A 1 27  ? -12.642 15.319 -6.325  1.00 35.10 ? 26  GLU A CB  1 
ATOM   194  C CG  . GLU A 1 27  ? -13.357 16.009 -7.504  1.00 41.25 ? 26  GLU A CG  1 
ATOM   195  C CD  . GLU A 1 27  ? -13.143 15.311 -8.844  1.00 47.65 ? 26  GLU A CD  1 
ATOM   196  O OE1 . GLU A 1 27  ? -12.422 14.289 -8.887  1.00 48.54 ? 26  GLU A OE1 1 
ATOM   197  O OE2 . GLU A 1 27  ? -13.671 15.813 -9.866  1.00 51.37 ? 26  GLU A OE2 1 
ATOM   198  N N   . HIS A 1 28  ? -11.170 15.511 -3.271  1.00 31.01 ? 27  HIS A N   1 
ATOM   199  C CA  . HIS A 1 28  ? -10.663 14.746 -2.124  1.00 33.16 ? 27  HIS A CA  1 
ATOM   200  C C   . HIS A 1 28  ? -10.809 15.462 -0.776  1.00 31.09 ? 27  HIS A C   1 
ATOM   201  O O   . HIS A 1 28  ? -10.370 14.927 0.237   1.00 34.75 ? 27  HIS A O   1 
ATOM   202  C CB  . HIS A 1 28  ? -9.176  14.365 -2.344  1.00 28.51 ? 27  HIS A CB  1 
ATOM   203  C CG  . HIS A 1 28  ? -8.979  13.342 -3.410  1.00 30.97 ? 27  HIS A CG  1 
ATOM   204  N ND1 . HIS A 1 28  ? -8.979  13.650 -4.758  1.00 31.65 ? 27  HIS A ND1 1 
ATOM   205  C CD2 . HIS A 1 28  ? -8.819  11.996 -3.342  1.00 30.75 ? 27  HIS A CD2 1 
ATOM   206  C CE1 . HIS A 1 28  ? -8.831  12.547 -5.462  1.00 31.31 ? 27  HIS A CE1 1 
ATOM   207  N NE2 . HIS A 1 28  ? -8.721  11.528 -4.618  1.00 31.37 ? 27  HIS A NE2 1 
ATOM   208  N N   . ASP A 1 29  ? -11.420 16.651 -0.754  1.00 32.76 ? 28  ASP A N   1 
ATOM   209  C CA  . ASP A 1 29  ? -11.529 17.434 0.491   1.00 37.84 ? 28  ASP A CA  1 
ATOM   210  C C   . ASP A 1 29  ? -12.115 16.697 1.702   1.00 35.18 ? 28  ASP A C   1 
ATOM   211  O O   . ASP A 1 29  ? -11.728 16.988 2.830   1.00 38.00 ? 28  ASP A O   1 
ATOM   212  C CB  . ASP A 1 29  ? -12.323 18.728 0.254   1.00 34.93 ? 28  ASP A CB  1 
ATOM   213  C CG  . ASP A 1 29  ? -11.434 19.881 -0.186  1.00 38.20 ? 28  ASP A CG  1 
ATOM   214  O OD1 . ASP A 1 29  ? -10.224 19.832 0.111   1.00 40.52 ? 28  ASP A OD1 1 
ATOM   215  O OD2 . ASP A 1 29  ? -11.925 20.838 -0.820  1.00 37.91 ? 28  ASP A OD2 1 
ATOM   216  N N   . LYS A 1 30  ? -13.017 15.743 1.498   1.00 35.52 ? 29  LYS A N   1 
ATOM   217  C CA  . LYS A 1 30  ? -13.487 14.942 2.639   1.00 34.11 ? 29  LYS A CA  1 
ATOM   218  C C   . LYS A 1 30  ? -12.853 13.582 2.626   1.00 32.84 ? 29  LYS A C   1 
ATOM   219  O O   . LYS A 1 30  ? -12.467 13.074 3.666   1.00 35.28 ? 29  LYS A O   1 
ATOM   220  C CB  . LYS A 1 30  ? -15.014 14.780 2.638   1.00 35.40 ? 29  LYS A CB  1 
ATOM   221  C CG  . LYS A 1 30  ? -15.736 16.092 2.648   1.00 39.26 ? 29  LYS A CG  1 
ATOM   222  C CD  . LYS A 1 30  ? -15.383 16.833 3.885   1.00 43.93 ? 29  LYS A CD  1 
ATOM   223  C CE  . LYS A 1 30  ? -15.968 18.230 3.912   1.00 43.66 ? 29  LYS A CE  1 
ATOM   224  N NZ  . LYS A 1 30  ? -15.614 18.782 5.262   1.00 39.34 ? 29  LYS A NZ  1 
ATOM   225  N N   . ARG A 1 31  ? -12.758 12.975 1.446   1.00 30.08 ? 30  ARG A N   1 
ATOM   226  C CA  . ARG A 1 31  ? -12.239 11.611 1.352   1.00 33.47 ? 30  ARG A CA  1 
ATOM   227  C C   . ARG A 1 31  ? -10.791 11.508 1.839   1.00 34.92 ? 30  ARG A C   1 
ATOM   228  O O   . ARG A 1 31  ? -10.438 10.579 2.576   1.00 33.92 ? 30  ARG A O   1 
ATOM   229  C CB  . ARG A 1 31  ? -12.358 11.082 -0.088  1.00 34.57 ? 30  ARG A CB  1 
ATOM   230  C CG  . ARG A 1 31  ? -11.812 9.663  -0.255  1.00 34.53 ? 30  ARG A CG  1 
ATOM   231  C CD  . ARG A 1 31  ? -12.526 8.726  0.693   1.00 37.87 ? 30  ARG A CD  1 
ATOM   232  N NE  . ARG A 1 31  ? -13.943 8.657  0.369   1.00 39.59 ? 30  ARG A NE  1 
ATOM   233  C CZ  . ARG A 1 31  ? -14.887 8.279  1.224   1.00 39.43 ? 30  ARG A CZ  1 
ATOM   234  N NH1 . ARG A 1 31  ? -14.577 7.983  2.487   1.00 40.15 ? 30  ARG A NH1 1 
ATOM   235  N NH2 . ARG A 1 31  ? -16.150 8.250  0.826   1.00 37.61 ? 30  ARG A NH2 1 
ATOM   236  N N   . ASP A 1 32  ? -9.958  12.469 1.454   1.00 33.31 ? 31  ASP A N   1 
ATOM   237  C CA  . ASP A 1 32  ? -8.535  12.401 1.796   1.00 33.24 ? 31  ASP A CA  1 
ATOM   238  C C   . ASP A 1 32  ? -7.928  13.800 1.783   1.00 34.86 ? 31  ASP A C   1 
ATOM   239  O O   . ASP A 1 32  ? -7.355  14.248 0.780   1.00 35.61 ? 31  ASP A O   1 
ATOM   240  C CB  . ASP A 1 32  ? -7.810  11.440 0.830   1.00 37.90 ? 31  ASP A CB  1 
ATOM   241  C CG  . ASP A 1 32  ? -6.364  11.136 1.250   1.00 40.32 ? 31  ASP A CG  1 
ATOM   242  O OD1 . ASP A 1 32  ? -5.801  11.846 2.114   1.00 39.41 ? 31  ASP A OD1 1 
ATOM   243  O OD2 . ASP A 1 32  ? -5.818  10.128 0.756   1.00 43.01 ? 31  ASP A OD2 1 
ATOM   244  N N   . PRO A 1 33  ? -8.088  14.514 2.905   1.00 33.93 ? 32  PRO A N   1 
ATOM   245  C CA  . PRO A 1 33  ? -7.573  15.868 3.101   1.00 34.70 ? 32  PRO A CA  1 
ATOM   246  C C   . PRO A 1 33  ? -6.062  15.997 2.880   1.00 35.86 ? 32  PRO A C   1 
ATOM   247  O O   . PRO A 1 33  ? -5.614  17.096 2.575   1.00 36.35 ? 32  PRO A O   1 
ATOM   248  C CB  . PRO A 1 33  ? -7.910  16.162 4.564   1.00 34.58 ? 32  PRO A CB  1 
ATOM   249  C CG  . PRO A 1 33  ? -9.058  15.266 4.876   1.00 36.30 ? 32  PRO A CG  1 
ATOM   250  C CD  . PRO A 1 33  ? -8.805  14.020 4.096   1.00 34.26 ? 32  PRO A CD  1 
ATOM   251  N N   . VAL A 1 34  ? -5.303  14.920 3.057   1.00 32.90 ? 33  VAL A N   1 
ATOM   252  C CA  . VAL A 1 34  ? -3.862  14.948 2.808   1.00 33.60 ? 33  VAL A CA  1 
ATOM   253  C C   . VAL A 1 34  ? -3.587  15.133 1.310   1.00 32.44 ? 33  VAL A C   1 
ATOM   254  O O   . VAL A 1 34  ? -2.775  15.969 0.905   1.00 31.33 ? 33  VAL A O   1 
ATOM   255  C CB  . VAL A 1 34  ? -3.179  13.662 3.312   1.00 36.84 ? 33  VAL A CB  1 
ATOM   256  C CG1 . VAL A 1 34  ? -1.733  13.592 2.823   1.00 35.22 ? 33  VAL A CG1 1 
ATOM   257  C CG2 . VAL A 1 34  ? -3.245  13.576 4.850   1.00 35.05 ? 33  VAL A CG2 1 
ATOM   258  N N   . VAL A 1 35  ? -4.285  14.361 0.488   1.00 35.89 ? 34  VAL A N   1 
ATOM   259  C CA  . VAL A 1 35  ? -4.192  14.519 -0.958  1.00 34.05 ? 34  VAL A CA  1 
ATOM   260  C C   . VAL A 1 35  ? -4.705  15.895 -1.371  1.00 35.66 ? 34  VAL A C   1 
ATOM   261  O O   . VAL A 1 35  ? -4.113  16.555 -2.229  1.00 35.50 ? 34  VAL A O   1 
ATOM   262  C CB  . VAL A 1 35  ? -4.969  13.407 -1.690  1.00 34.01 ? 34  VAL A CB  1 
ATOM   263  C CG1 . VAL A 1 35  ? -5.078  13.693 -3.185  1.00 30.33 ? 34  VAL A CG1 1 
ATOM   264  C CG2 . VAL A 1 35  ? -4.286  12.070 -1.461  1.00 32.87 ? 34  VAL A CG2 1 
ATOM   265  N N   . ALA A 1 36  ? -5.786  16.345 -0.740  1.00 36.06 ? 35  ALA A N   1 
ATOM   266  C CA  . ALA A 1 36  ? -6.373  17.637 -1.087  1.00 34.25 ? 35  ALA A CA  1 
ATOM   267  C C   . ALA A 1 36  ? -5.399  18.756 -0.762  1.00 36.87 ? 35  ALA A C   1 
ATOM   268  O O   . ALA A 1 36  ? -5.271  19.737 -1.511  1.00 33.14 ? 35  ALA A O   1 
ATOM   269  C CB  . ALA A 1 36  ? -7.699  17.856 -0.342  1.00 34.43 ? 35  ALA A CB  1 
ATOM   270  N N   . TYR A 1 37  ? -4.722  18.606 0.370   1.00 31.19 ? 36  TYR A N   1 
ATOM   271  C CA  . TYR A 1 37  ? -3.728  19.577 0.792   1.00 31.59 ? 36  TYR A CA  1 
ATOM   272  C C   . TYR A 1 37  ? -2.549  19.664 -0.184  1.00 30.37 ? 36  TYR A C   1 
ATOM   273  O O   . TYR A 1 37  ? -2.210  20.748 -0.653  1.00 31.50 ? 36  TYR A O   1 
ATOM   274  C CB  . TYR A 1 37  ? -3.226  19.236 2.193   1.00 33.25 ? 36  TYR A CB  1 
ATOM   275  C CG  . TYR A 1 37  ? -2.136  20.167 2.676   1.00 36.64 ? 36  TYR A CG  1 
ATOM   276  C CD1 . TYR A 1 37  ? -2.440  21.407 3.220   1.00 36.81 ? 36  TYR A CD1 1 
ATOM   277  C CD2 . TYR A 1 37  ? -0.801  19.806 2.565   1.00 33.83 ? 36  TYR A CD2 1 
ATOM   278  C CE1 . TYR A 1 37  ? -1.434  22.249 3.670   1.00 42.38 ? 36  TYR A CE1 1 
ATOM   279  C CE2 . TYR A 1 37  ? 0.200   20.636 2.991   1.00 37.94 ? 36  TYR A CE2 1 
ATOM   280  C CZ  . TYR A 1 37  ? -0.108  21.850 3.545   1.00 40.62 ? 36  TYR A CZ  1 
ATOM   281  O OH  . TYR A 1 37  ? 0.924   22.661 3.966   1.00 46.98 ? 36  TYR A OH  1 
ATOM   282  N N   . TYR A 1 38  ? -1.928  18.535 -0.507  1.00 30.84 ? 37  TYR A N   1 
ATOM   283  C CA  . TYR A 1 38  ? -0.766  18.595 -1.394  1.00 31.39 ? 37  TYR A CA  1 
ATOM   284  C C   . TYR A 1 38  ? -1.129  18.974 -2.823  1.00 32.66 ? 37  TYR A C   1 
ATOM   285  O O   . TYR A 1 38  ? -0.317  19.572 -3.523  1.00 33.51 ? 37  TYR A O   1 
ATOM   286  C CB  . TYR A 1 38  ? 0.018   17.280 -1.374  1.00 30.14 ? 37  TYR A CB  1 
ATOM   287  C CG  . TYR A 1 38  ? 0.798   17.107 -0.080  1.00 30.89 ? 37  TYR A CG  1 
ATOM   288  C CD1 . TYR A 1 38  ? 1.889   17.925 0.187   1.00 29.86 ? 37  TYR A CD1 1 
ATOM   289  C CD2 . TYR A 1 38  ? 0.502   16.091 0.828   1.00 33.07 ? 37  TYR A CD2 1 
ATOM   290  C CE1 . TYR A 1 38  ? 2.625   17.792 1.350   1.00 36.05 ? 37  TYR A CE1 1 
ATOM   291  C CE2 . TYR A 1 38  ? 1.252   15.932 1.999   1.00 30.69 ? 37  TYR A CE2 1 
ATOM   292  C CZ  . TYR A 1 38  ? 2.316   16.796 2.248   1.00 36.14 ? 37  TYR A CZ  1 
ATOM   293  O OH  . TYR A 1 38  ? 3.089   16.673 3.385   1.00 42.39 ? 37  TYR A OH  1 
ATOM   294  N N   . CYS A 1 39  ? -2.343  18.644 -3.257  1.00 32.30 ? 38  CYS A N   1 
ATOM   295  C CA  . CYS A 1 39  ? -2.797  19.092 -4.566  1.00 30.51 ? 38  CYS A CA  1 
ATOM   296  C C   . CYS A 1 39  ? -2.871  20.600 -4.623  1.00 35.25 ? 38  CYS A C   1 
ATOM   297  O O   . CYS A 1 39  ? -2.416  21.198 -5.605  1.00 34.42 ? 38  CYS A O   1 
ATOM   298  C CB  . CYS A 1 39  ? -4.156  18.488 -4.935  1.00 29.73 ? 38  CYS A CB  1 
ATOM   299  S SG  . CYS A 1 39  ? -4.094  16.785 -5.445  1.00 34.16 ? 38  CYS A SG  1 
ATOM   300  N N   . ARG A 1 40  ? -3.447  21.216 -3.586  1.00 32.61 ? 39  ARG A N   1 
ATOM   301  C CA  . ARG A 1 40  ? -3.420  22.671 -3.480  1.00 34.90 ? 39  ARG A CA  1 
ATOM   302  C C   . ARG A 1 40  ? -2.004  23.248 -3.354  1.00 37.90 ? 39  ARG A C   1 
ATOM   303  O O   . ARG A 1 40  ? -1.723  24.325 -3.898  1.00 35.72 ? 39  ARG A O   1 
ATOM   304  C CB  . ARG A 1 40  ? -4.263  23.155 -2.291  1.00 34.70 ? 39  ARG A CB  1 
ATOM   305  C CG  . ARG A 1 40  ? -5.757  23.090 -2.512  1.00 36.13 ? 39  ARG A CG  1 
ATOM   306  C CD  . ARG A 1 40  ? -6.494  23.618 -1.286  1.00 41.03 ? 39  ARG A CD  1 
ATOM   307  N NE  . ARG A 1 40  ? -7.932  23.729 -1.517  1.00 41.06 ? 39  ARG A NE  1 
ATOM   308  C CZ  . ARG A 1 40  ? -8.796  22.741 -1.334  1.00 41.89 ? 39  ARG A CZ  1 
ATOM   309  N NH1 . ARG A 1 40  ? -8.365  21.566 -0.894  1.00 35.75 ? 39  ARG A NH1 1 
ATOM   310  N NH2 . ARG A 1 40  ? -10.092 22.936 -1.574  1.00 40.26 ? 39  ARG A NH2 1 
ATOM   311  N N   . LEU A 1 41  ? -1.125  22.555 -2.629  1.00 34.37 ? 40  LEU A N   1 
ATOM   312  C CA  . LEU A 1 41  ? 0.248   23.034 -2.451  1.00 34.00 ? 40  LEU A CA  1 
ATOM   313  C C   . LEU A 1 41  ? 0.969   23.067 -3.797  1.00 36.34 ? 40  LEU A C   1 
ATOM   314  O O   . LEU A 1 41  ? 1.616   24.043 -4.131  1.00 36.48 ? 40  LEU A O   1 
ATOM   315  C CB  . LEU A 1 41  ? 1.016   22.154 -1.466  1.00 33.37 ? 40  LEU A CB  1 
ATOM   316  C CG  . LEU A 1 41  ? 2.448   22.614 -1.143  1.00 39.78 ? 40  LEU A CG  1 
ATOM   317  C CD1 . LEU A 1 41  ? 2.449   23.978 -0.443  1.00 40.78 ? 40  LEU A CD1 1 
ATOM   318  C CD2 . LEU A 1 41  ? 3.164   21.594 -0.280  1.00 39.13 ? 40  LEU A CD2 1 
ATOM   319  N N   . TYR A 1 42  ? 0.844   21.993 -4.569  1.00 36.57 ? 41  TYR A N   1 
ATOM   320  C CA  . TYR A 1 42  ? 1.378   21.977 -5.927  1.00 35.56 ? 41  TYR A CA  1 
ATOM   321  C C   . TYR A 1 42  ? 0.844   23.134 -6.777  1.00 32.21 ? 41  TYR A C   1 
ATOM   322  O O   . TYR A 1 42  ? 1.597   23.761 -7.514  1.00 32.63 ? 41  TYR A O   1 
ATOM   323  C CB  . TYR A 1 42  ? 1.069   20.639 -6.621  1.00 28.77 ? 41  TYR A CB  1 
ATOM   324  C CG  . TYR A 1 42  ? 1.443   20.656 -8.096  1.00 31.09 ? 41  TYR A CG  1 
ATOM   325  C CD1 . TYR A 1 42  ? 2.776   20.558 -8.511  1.00 31.37 ? 41  TYR A CD1 1 
ATOM   326  C CD2 . TYR A 1 42  ? 0.466   20.784 -9.068  1.00 30.94 ? 41  TYR A CD2 1 
ATOM   327  C CE1 . TYR A 1 42  ? 3.117   20.582 -9.873  1.00 30.18 ? 41  TYR A CE1 1 
ATOM   328  C CE2 . TYR A 1 42  ? 0.795   20.814 -10.427 1.00 34.30 ? 41  TYR A CE2 1 
ATOM   329  C CZ  . TYR A 1 42  ? 2.114   20.714 -10.819 1.00 32.74 ? 41  TYR A CZ  1 
ATOM   330  O OH  . TYR A 1 42  ? 2.410   20.745 -12.165 1.00 33.78 ? 41  TYR A OH  1 
ATOM   331  N N   . ALA A 1 43  ? -0.449  23.409 -6.669  1.00 27.97 ? 42  ALA A N   1 
ATOM   332  C CA  . ALA A 1 43  ? -1.077  24.448 -7.476  1.00 37.55 ? 42  ALA A CA  1 
ATOM   333  C C   . ALA A 1 43  ? -0.588  25.837 -7.059  1.00 36.89 ? 42  ALA A C   1 
ATOM   334  O O   . ALA A 1 43  ? -0.328  26.691 -7.898  1.00 35.69 ? 42  ALA A O   1 
ATOM   335  C CB  . ALA A 1 43  ? -2.616  24.366 -7.369  1.00 34.14 ? 42  ALA A CB  1 
ATOM   336  N N   . MET A 1 44  ? -0.479  26.048 -5.754  1.00 38.19 ? 43  MET A N   1 
ATOM   337  C CA  . MET A 1 44  ? 0.088   27.272 -5.205  1.00 39.31 ? 43  MET A CA  1 
ATOM   338  C C   . MET A 1 44  ? 1.493   27.499 -5.767  1.00 42.06 ? 43  MET A C   1 
ATOM   339  O O   . MET A 1 44  ? 1.812   28.533 -6.336  1.00 43.72 ? 43  MET A O   1 
ATOM   340  C CB  . MET A 1 44  ? 0.154   27.178 -3.678  1.00 37.91 ? 43  MET A CB  1 
ATOM   341  C CG  . MET A 1 44  ? 0.643   28.459 -2.994  1.00 45.06 ? 43  MET A CG  1 
ATOM   342  S SD  . MET A 1 44  ? -0.658  29.695 -3.133  1.00 47.73 ? 43  MET A SD  1 
ATOM   343  C CE  . MET A 1 44  ? 0.072   31.143 -2.377  1.00 54.42 ? 43  MET A CE  1 
ATOM   344  N N   . GLN A 1 45  ? 2.319   26.480 -5.616  1.00 41.03 ? 44  GLN A N   1 
ATOM   345  C CA  . GLN A 1 45  ? 3.734   26.568 -5.914  1.00 43.90 ? 44  GLN A CA  1 
ATOM   346  C C   . GLN A 1 45  ? 3.957   26.708 -7.425  1.00 45.47 ? 44  GLN A C   1 
ATOM   347  O O   . GLN A 1 45  ? 4.837   27.445 -7.869  1.00 49.39 ? 44  GLN A O   1 
ATOM   348  C CB  . GLN A 1 45  ? 4.406   25.340 -5.296  1.00 44.84 ? 44  GLN A CB  1 
ATOM   349  C CG  . GLN A 1 45  ? 5.894   25.348 -5.164  1.00 59.88 ? 44  GLN A CG  1 
ATOM   350  C CD  . GLN A 1 45  ? 6.357   24.405 -4.049  1.00 58.87 ? 44  GLN A CD  1 
ATOM   351  O OE1 . GLN A 1 45  ? 5.570   23.997 -3.198  1.00 59.37 ? 44  GLN A OE1 1 
ATOM   352  N NE2 . GLN A 1 45  ? 7.630   24.039 -4.073  1.00 62.38 ? 44  GLN A NE2 1 
ATOM   353  N N   . THR A 1 46  ? 3.116   26.055 -8.219  1.00 42.11 ? 45  THR A N   1 
ATOM   354  C CA  . THR A 1 46  ? 3.189   26.197 -9.664  1.00 42.12 ? 45  THR A CA  1 
ATOM   355  C C   . THR A 1 46  ? 2.708   27.595 -10.084 1.00 42.51 ? 45  THR A C   1 
ATOM   356  O O   . THR A 1 46  ? 3.257   28.211 -10.996 1.00 40.85 ? 45  THR A O   1 
ATOM   357  C CB  . THR A 1 46  ? 2.345   25.116 -10.362 1.00 38.66 ? 45  THR A CB  1 
ATOM   358  O OG1 . THR A 1 46  ? 2.789   23.831 -9.929  1.00 37.61 ? 45  THR A OG1 1 
ATOM   359  C CG2 . THR A 1 46  ? 2.467   25.204 -11.894 1.00 35.84 ? 45  THR A CG2 1 
ATOM   360  N N   . GLY A 1 47  ? 1.672   28.088 -9.412  1.00 41.42 ? 46  GLY A N   1 
ATOM   361  C CA  . GLY A 1 47  ? 1.102   29.383 -9.737  1.00 44.78 ? 46  GLY A CA  1 
ATOM   362  C C   . GLY A 1 47  ? 2.077   30.523 -9.500  1.00 47.30 ? 46  GLY A C   1 
ATOM   363  O O   . GLY A 1 47  ? 2.181   31.440 -10.315 1.00 45.98 ? 46  GLY A O   1 
ATOM   364  N N   . MET A 1 48  ? 2.788   30.454 -8.377  1.00 43.71 ? 47  MET A N   1 
ATOM   365  C CA  . MET A 1 48  ? 3.818   31.427 -8.034  1.00 48.10 ? 47  MET A CA  1 
ATOM   366  C C   . MET A 1 48  ? 4.897   31.546 -9.103  1.00 53.49 ? 47  MET A C   1 
ATOM   367  O O   . MET A 1 48  ? 5.226   32.648 -9.529  1.00 59.87 ? 47  MET A O   1 
ATOM   368  C CB  . MET A 1 48  ? 4.471   31.064 -6.710  1.00 42.21 ? 47  MET A CB  1 
ATOM   369  C CG  . MET A 1 48  ? 3.575   31.205 -5.496  1.00 48.83 ? 47  MET A CG  1 
ATOM   370  S SD  . MET A 1 48  ? 4.585   30.757 -4.071  1.00 74.54 ? 47  MET A SD  1 
ATOM   371  C CE  . MET A 1 48  ? 3.438   30.857 -2.715  1.00 62.04 ? 47  MET A CE  1 
ATOM   372  N N   . LYS A 1 49  ? 5.442   30.410 -9.528  1.00 50.87 ? 48  LYS A N   1 
ATOM   373  C CA  . LYS A 1 49  ? 6.453   30.368 -10.582 1.00 51.94 ? 48  LYS A CA  1 
ATOM   374  C C   . LYS A 1 49  ? 5.970   30.942 -11.911 1.00 52.69 ? 48  LYS A C   1 
ATOM   375  O O   . LYS A 1 49  ? 6.737   31.571 -12.633 1.00 58.03 ? 48  LYS A O   1 
ATOM   376  C CB  . LYS A 1 49  ? 6.920   28.931 -10.804 1.00 49.54 ? 48  LYS A CB  1 
ATOM   377  C CG  . LYS A 1 49  ? 7.741   28.358 -9.666  1.00 59.99 ? 48  LYS A CG  1 
ATOM   378  C CD  . LYS A 1 49  ? 8.265   26.976 -10.034 1.00 64.39 ? 48  LYS A CD  1 
ATOM   379  C CE  . LYS A 1 49  ? 7.105   25.998 -10.209 1.00 59.58 ? 48  LYS A CE  1 
ATOM   380  N NZ  . LYS A 1 49  ? 7.574   24.620 -10.511 1.00 67.54 ? 48  LYS A NZ  1 
ATOM   381  N N   . ILE A 1 50  ? 4.705   30.711 -12.244 1.00 52.60 ? 49  ILE A N   1 
ATOM   382  C CA  . ILE A 1 50  ? 4.160   31.178 -13.518 1.00 54.51 ? 49  ILE A CA  1 
ATOM   383  C C   . ILE A 1 50  ? 3.969   32.691 -13.557 1.00 58.09 ? 49  ILE A C   1 
ATOM   384  O O   . ILE A 1 50  ? 4.441   33.362 -14.476 1.00 61.20 ? 49  ILE A O   1 
ATOM   385  C CB  . ILE A 1 50  ? 2.811   30.504 -13.832 1.00 51.68 ? 49  ILE A CB  1 
ATOM   386  C CG1 . ILE A 1 50  ? 3.018   29.025 -14.144 1.00 46.17 ? 49  ILE A CG1 1 
ATOM   387  C CG2 . ILE A 1 50  ? 2.101   31.205 -14.992 1.00 52.36 ? 49  ILE A CG2 1 
ATOM   388  C CD1 . ILE A 1 50  ? 1.729   28.276 -14.357 1.00 42.17 ? 49  ILE A CD1 1 
ATOM   389  N N   . ASP A 1 51  ? 3.276   33.218 -12.556 1.00 57.70 ? 50  ASP A N   1 
ATOM   390  C CA  . ASP A 1 51  ? 2.973   34.641 -12.491 1.00 58.91 ? 50  ASP A CA  1 
ATOM   391  C C   . ASP A 1 51  ? 2.496   35.017 -11.099 1.00 58.35 ? 50  ASP A C   1 
ATOM   392  O O   . ASP A 1 51  ? 1.347   34.775 -10.736 1.00 56.51 ? 50  ASP A O   1 
ATOM   393  C CB  . ASP A 1 51  ? 1.921   35.015 -13.543 1.00 61.82 ? 50  ASP A CB  1 
ATOM   394  C CG  . ASP A 1 51  ? 1.577   36.509 -13.540 1.00 65.95 ? 50  ASP A CG  1 
ATOM   395  O OD1 . ASP A 1 51  ? 2.053   37.260 -12.655 1.00 61.03 ? 50  ASP A OD1 1 
ATOM   396  O OD2 . ASP A 1 51  ? 0.834   36.931 -14.449 1.00 59.77 ? 50  ASP A OD2 1 
ATOM   397  N N   . SER A 1 52  ? 3.386   35.631 -10.331 1.00 64.07 ? 51  SER A N   1 
ATOM   398  C CA  . SER A 1 52  ? 3.061   36.068 -8.978  1.00 61.31 ? 51  SER A CA  1 
ATOM   399  C C   . SER A 1 52  ? 3.068   37.595 -8.833  1.00 66.54 ? 51  SER A C   1 
ATOM   400  O O   . SER A 1 52  ? 3.252   38.118 -7.736  1.00 68.21 ? 51  SER A O   1 
ATOM   401  C CB  . SER A 1 52  ? 4.036   35.429 -7.984  1.00 59.10 ? 51  SER A CB  1 
ATOM   402  O OG  . SER A 1 52  ? 5.377   35.736 -8.328  1.00 65.13 ? 51  SER A OG  1 
ATOM   403  N N   . LYS A 1 53  ? 2.848   38.317 -9.927  1.00 65.83 ? 52  LYS A N   1 
ATOM   404  C CA  . LYS A 1 53  ? 2.868   39.776 -9.842  1.00 71.41 ? 52  LYS A CA  1 
ATOM   405  C C   . LYS A 1 53  ? 1.658   40.463 -10.494 1.00 67.50 ? 52  LYS A C   1 
ATOM   406  O O   . LYS A 1 53  ? 1.190   41.479 -9.988  1.00 68.58 ? 52  LYS A O   1 
ATOM   407  C CB  . LYS A 1 53  ? 4.191   40.302 -10.414 1.00 74.54 ? 52  LYS A CB  1 
ATOM   408  C CG  . LYS A 1 53  ? 5.374   39.947 -9.490  1.00 78.25 ? 52  LYS A CG  1 
ATOM   409  C CD  . LYS A 1 53  ? 6.742   40.336 -10.031 1.00 84.50 ? 52  LYS A CD  1 
ATOM   410  C CE  . LYS A 1 53  ? 7.832   39.967 -9.018  1.00 87.44 ? 52  LYS A CE  1 
ATOM   411  N NZ  . LYS A 1 53  ? 9.214   40.249 -9.512  1.00 84.25 ? 52  LYS A NZ  1 
ATOM   412  N N   . THR A 1 54  ? 1.141   39.915 -11.589 1.00 67.59 ? 53  THR A N   1 
ATOM   413  C CA  . THR A 1 54  ? -0.176  40.327 -12.079 1.00 62.75 ? 53  THR A CA  1 
ATOM   414  C C   . THR A 1 54  ? -1.201  40.251 -10.944 1.00 67.72 ? 53  THR A C   1 
ATOM   415  O O   . THR A 1 54  ? -1.262  39.245 -10.229 1.00 68.95 ? 53  THR A O   1 
ATOM   416  C CB  . THR A 1 54  ? -0.637  39.456 -13.262 1.00 66.86 ? 53  THR A CB  1 
ATOM   417  O OG1 . THR A 1 54  ? 0.200   39.702 -14.403 1.00 73.13 ? 53  THR A OG1 1 
ATOM   418  C CG2 . THR A 1 54  ? -2.091  39.724 -13.623 1.00 65.59 ? 53  THR A CG2 1 
ATOM   419  N N   . PRO A 1 55  ? -1.993  41.323 -10.756 1.00 71.78 ? 54  PRO A N   1 
ATOM   420  C CA  . PRO A 1 55  ? -2.909  41.443 -9.611  1.00 68.09 ? 54  PRO A CA  1 
ATOM   421  C C   . PRO A 1 55  ? -3.960  40.331 -9.486  1.00 63.82 ? 54  PRO A C   1 
ATOM   422  O O   . PRO A 1 55  ? -4.114  39.793 -8.388  1.00 65.50 ? 54  PRO A O   1 
ATOM   423  C CB  . PRO A 1 55  ? -3.586  42.802 -9.854  1.00 67.17 ? 54  PRO A CB  1 
ATOM   424  C CG  . PRO A 1 55  ? -3.431  43.056 -11.316 1.00 65.42 ? 54  PRO A CG  1 
ATOM   425  C CD  . PRO A 1 55  ? -2.069  42.509 -11.628 1.00 70.68 ? 54  PRO A CD  1 
ATOM   426  N N   . GLU A 1 56  ? -4.678  40.014 -10.562 1.00 62.48 ? 55  GLU A N   1 
ATOM   427  C CA  . GLU A 1 56  ? -5.650  38.925 -10.526 1.00 62.32 ? 55  GLU A CA  1 
ATOM   428  C C   . GLU A 1 56  ? -5.029  37.669 -9.932  1.00 61.23 ? 55  GLU A C   1 
ATOM   429  O O   . GLU A 1 56  ? -5.598  37.042 -9.045  1.00 59.13 ? 55  GLU A O   1 
ATOM   430  C CB  . GLU A 1 56  ? -6.174  38.595 -11.922 1.00 61.90 ? 55  GLU A CB  1 
ATOM   431  C CG  . GLU A 1 56  ? -7.226  37.495 -11.893 1.00 59.44 ? 55  GLU A CG  1 
ATOM   432  C CD  . GLU A 1 56  ? -7.616  36.999 -13.275 1.00 63.68 ? 55  GLU A CD  1 
ATOM   433  O OE1 . GLU A 1 56  ? -6.977  37.425 -14.267 1.00 60.71 ? 55  GLU A OE1 1 
ATOM   434  O OE2 . GLU A 1 56  ? -8.560  36.176 -13.361 1.00 61.55 ? 55  GLU A OE2 1 
ATOM   435  N N   . CYS A 1 57  ? -3.847  37.322 -10.432 1.00 61.34 ? 56  CYS A N   1 
ATOM   436  C CA  . CYS A 1 57  ? -3.130  36.136 -9.986  1.00 57.44 ? 56  CYS A CA  1 
ATOM   437  C C   . CYS A 1 57  ? -2.765  36.203 -8.515  1.00 58.35 ? 56  CYS A C   1 
ATOM   438  O O   . CYS A 1 57  ? -2.923  35.214 -7.797  1.00 59.90 ? 56  CYS A O   1 
ATOM   439  C CB  . CYS A 1 57  ? -1.874  35.931 -10.827 1.00 53.89 ? 56  CYS A CB  1 
ATOM   440  S SG  . CYS A 1 57  ? -2.258  35.564 -12.537 1.00 58.92 ? 56  CYS A SG  1 
ATOM   441  N N   . ARG A 1 58  ? -2.288  37.360 -8.059  1.00 60.41 ? 57  ARG A N   1 
ATOM   442  C CA  . ARG A 1 58  ? -1.929  37.514 -6.655  1.00 57.18 ? 57  ARG A CA  1 
ATOM   443  C C   . ARG A 1 58  ? -3.154  37.383 -5.772  1.00 55.68 ? 57  ARG A C   1 
ATOM   444  O O   . ARG A 1 58  ? -3.059  36.892 -4.648  1.00 61.97 ? 57  ARG A O   1 
ATOM   445  C CB  . ARG A 1 58  ? -1.235  38.855 -6.381  1.00 63.86 ? 57  ARG A CB  1 
ATOM   446  C CG  . ARG A 1 58  ? 0.178   38.963 -6.946  1.00 68.83 ? 57  ARG A CG  1 
ATOM   447  C CD  . ARG A 1 58  ? 0.886   40.243 -6.490  1.00 71.01 ? 57  ARG A CD  1 
ATOM   448  N NE  . ARG A 1 58  ? 1.138   40.253 -5.045  1.00 75.97 ? 57  ARG A NE  1 
ATOM   449  C CZ  . ARG A 1 58  ? 2.184   39.670 -4.457  1.00 73.05 ? 57  ARG A CZ  1 
ATOM   450  N NH1 . ARG A 1 58  ? 3.082   39.022 -5.188  1.00 72.95 ? 57  ARG A NH1 1 
ATOM   451  N NH2 . ARG A 1 58  ? 2.335   39.730 -3.139  1.00 65.99 ? 57  ARG A NH2 1 
ATOM   452  N N   . LYS A 1 59  ? -4.304  37.825 -6.269  1.00 59.00 ? 58  LYS A N   1 
ATOM   453  C CA  . LYS A 1 59  ? -5.548  37.660 -5.522  1.00 62.55 ? 58  LYS A CA  1 
ATOM   454  C C   . LYS A 1 59  ? -5.913  36.177 -5.403  1.00 53.89 ? 58  LYS A C   1 
ATOM   455  O O   . LYS A 1 59  ? -6.217  35.680 -4.312  1.00 50.01 ? 58  LYS A O   1 
ATOM   456  C CB  . LYS A 1 59  ? -6.695  38.420 -6.189  1.00 62.40 ? 58  LYS A CB  1 
ATOM   457  C CG  . LYS A 1 59  ? -8.034  38.230 -5.477  1.00 65.27 ? 58  LYS A CG  1 
ATOM   458  C CD  . LYS A 1 59  ? -9.167  38.886 -6.254  1.00 72.79 ? 58  LYS A CD  1 
ATOM   459  C CE  . LYS A 1 59  ? -9.510  38.063 -7.497  1.00 67.98 ? 58  LYS A CE  1 
ATOM   460  N NZ  . LYS A 1 59  ? -10.630 38.649 -8.280  1.00 68.13 ? 58  LYS A NZ  1 
ATOM   461  N N   . PHE A 1 60  ? -5.890  35.490 -6.543  1.00 53.32 ? 59  PHE A N   1 
ATOM   462  C CA  . PHE A 1 60  ? -6.193  34.068 -6.598  1.00 50.34 ? 59  PHE A CA  1 
ATOM   463  C C   . PHE A 1 60  ? -5.264  33.320 -5.650  1.00 48.28 ? 59  PHE A C   1 
ATOM   464  O O   . PHE A 1 60  ? -5.722  32.590 -4.773  1.00 49.84 ? 59  PHE A O   1 
ATOM   465  C CB  . PHE A 1 60  ? -6.044  33.520 -8.019  1.00 51.10 ? 59  PHE A CB  1 
ATOM   466  C CG  . PHE A 1 60  ? -6.427  32.078 -8.139  1.00 51.70 ? 59  PHE A CG  1 
ATOM   467  C CD1 . PHE A 1 60  ? -7.748  31.722 -8.361  1.00 48.48 ? 59  PHE A CD1 1 
ATOM   468  C CD2 . PHE A 1 60  ? -5.485  31.076 -7.973  1.00 46.75 ? 59  PHE A CD2 1 
ATOM   469  C CE1 . PHE A 1 60  ? -8.115  30.400 -8.450  1.00 48.82 ? 59  PHE A CE1 1 
ATOM   470  C CE2 . PHE A 1 60  ? -5.849  29.745 -8.058  1.00 45.92 ? 59  PHE A CE2 1 
ATOM   471  C CZ  . PHE A 1 60  ? -7.164  29.406 -8.291  1.00 46.71 ? 59  PHE A CZ  1 
ATOM   472  N N   . LEU A 1 61  ? -3.960  33.533 -5.816  1.00 45.00 ? 60  LEU A N   1 
ATOM   473  C CA  . LEU A 1 61  ? -2.962  32.871 -4.988  1.00 49.25 ? 60  LEU A CA  1 
ATOM   474  C C   . LEU A 1 61  ? -3.188  33.104 -3.495  1.00 46.58 ? 60  LEU A C   1 
ATOM   475  O O   . LEU A 1 61  ? -2.982  32.197 -2.695  1.00 45.96 ? 60  LEU A O   1 
ATOM   476  C CB  . LEU A 1 61  ? -1.543  33.307 -5.394  1.00 48.03 ? 60  LEU A CB  1 
ATOM   477  C CG  . LEU A 1 61  ? -1.078  32.792 -6.765  1.00 54.04 ? 60  LEU A CG  1 
ATOM   478  C CD1 . LEU A 1 61  ? 0.306   33.302 -7.147  1.00 51.26 ? 60  LEU A CD1 1 
ATOM   479  C CD2 . LEU A 1 61  ? -1.113  31.268 -6.824  1.00 49.35 ? 60  LEU A CD2 1 
ATOM   480  N N   . SER A 1 62  ? -3.637  34.302 -3.122  1.00 51.83 ? 61  SER A N   1 
ATOM   481  C CA  . SER A 1 62  ? -3.853  34.638 -1.712  1.00 50.49 ? 61  SER A CA  1 
ATOM   482  C C   . SER A 1 62  ? -5.006  33.843 -1.133  1.00 45.88 ? 61  SER A C   1 
ATOM   483  O O   . SER A 1 62  ? -4.938  33.358 -0.002  1.00 46.44 ? 61  SER A O   1 
ATOM   484  C CB  . SER A 1 62  ? -4.133  36.131 -1.549  1.00 55.96 ? 61  SER A CB  1 
ATOM   485  O OG  . SER A 1 62  ? -3.047  36.894 -2.037  1.00 64.43 ? 61  SER A OG  1 
ATOM   486  N N   . LYS A 1 63  ? -6.075  33.733 -1.916  1.00 43.49 ? 62  LYS A N   1 
ATOM   487  C CA  . LYS A 1 63  ? -7.242  32.945 -1.528  1.00 49.24 ? 62  LYS A CA  1 
ATOM   488  C C   . LYS A 1 63  ? -6.908  31.452 -1.432  1.00 47.39 ? 62  LYS A C   1 
ATOM   489  O O   . LYS A 1 63  ? -7.436  30.740 -0.569  1.00 44.12 ? 62  LYS A O   1 
ATOM   490  C CB  . LYS A 1 63  ? -8.384  33.161 -2.527  1.00 46.98 ? 62  LYS A CB  1 
ATOM   491  C CG  . LYS A 1 63  ? -8.852  34.606 -2.652  1.00 50.42 ? 62  LYS A CG  1 
ATOM   492  C CD  . LYS A 1 63  ? -9.457  35.107 -1.359  1.00 51.00 ? 62  LYS A CD  1 
ATOM   493  C CE  . LYS A 1 63  ? -10.023 36.509 -1.537  1.00 54.94 ? 62  LYS A CE  1 
ATOM   494  N NZ  . LYS A 1 63  ? -10.595 37.030 -0.256  1.00 64.25 ? 62  LYS A NZ  1 
ATOM   495  N N   . LEU A 1 64  ? -6.040  30.985 -2.329  1.00 46.02 ? 63  LEU A N   1 
ATOM   496  C CA  . LEU A 1 64  ? -5.615  29.589 -2.320  1.00 43.36 ? 63  LEU A CA  1 
ATOM   497  C C   . LEU A 1 64  ? -4.782  29.322 -1.072  1.00 43.20 ? 63  LEU A C   1 
ATOM   498  O O   . LEU A 1 64  ? -5.004  28.326 -0.384  1.00 41.91 ? 63  LEU A O   1 
ATOM   499  C CB  . LEU A 1 64  ? -4.839  29.230 -3.600  1.00 38.08 ? 63  LEU A CB  1 
ATOM   500  C CG  . LEU A 1 64  ? -4.255  27.815 -3.689  1.00 39.19 ? 63  LEU A CG  1 
ATOM   501  C CD1 . LEU A 1 64  ? -5.336  26.731 -3.512  1.00 34.78 ? 63  LEU A CD1 1 
ATOM   502  C CD2 . LEU A 1 64  ? -3.533  27.623 -5.021  1.00 36.07 ? 63  LEU A CD2 1 
ATOM   503  N N   . MET A 1 65  ? -3.853  30.222 -0.750  1.00 42.76 ? 64  MET A N   1 
ATOM   504  C CA  . MET A 1 65  ? -3.105  30.085 0.502   1.00 45.00 ? 64  MET A CA  1 
ATOM   505  C C   . MET A 1 65  ? -4.037  30.091 1.733   1.00 49.36 ? 64  MET A C   1 
ATOM   506  O O   . MET A 1 65  ? -3.742  29.444 2.746   1.00 49.72 ? 64  MET A O   1 
ATOM   507  C CB  . MET A 1 65  ? -2.052  31.189 0.616   1.00 48.38 ? 64  MET A CB  1 
ATOM   508  C CG  . MET A 1 65  ? -1.209  31.135 1.885   1.00 51.78 ? 64  MET A CG  1 
ATOM   509  S SD  . MET A 1 65  ? -0.236  29.621 2.055   1.00 56.67 ? 64  MET A SD  1 
ATOM   510  C CE  . MET A 1 65  ? 1.017   29.876 0.811   1.00 52.07 ? 64  MET A CE  1 
ATOM   511  N N   . ASP A 1 66  ? -5.165  30.797 1.644   1.00 48.43 ? 65  ASP A N   1 
ATOM   512  C CA  . ASP A 1 66  ? -6.150  30.788 2.736   1.00 49.09 ? 65  ASP A CA  1 
ATOM   513  C C   . ASP A 1 66  ? -6.685  29.385 2.978   1.00 44.75 ? 65  ASP A C   1 
ATOM   514  O O   . ASP A 1 66  ? -6.856  28.956 4.121   1.00 47.57 ? 65  ASP A O   1 
ATOM   515  C CB  . ASP A 1 66  ? -7.319  31.734 2.442   1.00 47.91 ? 65  ASP A CB  1 
ATOM   516  C CG  . ASP A 1 66  ? -6.930  33.192 2.539   1.00 51.52 ? 65  ASP A CG  1 
ATOM   517  O OD1 . ASP A 1 66  ? -5.895  33.502 3.177   1.00 53.09 ? 65  ASP A OD1 1 
ATOM   518  O OD2 . ASP A 1 66  ? -7.655  34.029 1.958   1.00 54.95 ? 65  ASP A OD2 1 
ATOM   519  N N   . GLN A 1 67  ? -6.942  28.666 1.893   1.00 43.04 ? 66  GLN A N   1 
ATOM   520  C CA  . GLN A 1 67  ? -7.444  27.315 2.004   1.00 43.26 ? 66  GLN A CA  1 
ATOM   521  C C   . GLN A 1 67  ? -6.344  26.364 2.467   1.00 43.20 ? 66  GLN A C   1 
ATOM   522  O O   . GLN A 1 67  ? -6.618  25.393 3.186   1.00 43.41 ? 66  GLN A O   1 
ATOM   523  C CB  . GLN A 1 67  ? -8.040  26.844 0.671   1.00 43.32 ? 66  GLN A CB  1 
ATOM   524  C CG  . GLN A 1 67  ? -9.265  27.627 0.238   1.00 38.89 ? 66  GLN A CG  1 
ATOM   525  C CD  . GLN A 1 67  ? -9.915  27.052 -1.011  1.00 43.65 ? 66  GLN A CD  1 
ATOM   526  O OE1 . GLN A 1 67  ? -9.291  26.310 -1.771  1.00 44.60 ? 66  GLN A OE1 1 
ATOM   527  N NE2 . GLN A 1 67  ? -11.176 27.407 -1.235  1.00 47.55 ? 66  GLN A NE2 1 
ATOM   528  N N   . LEU A 1 68  ? -5.109  26.623 2.042   1.00 42.42 ? 67  LEU A N   1 
ATOM   529  C CA  . LEU A 1 68  ? -3.976  25.803 2.492   1.00 47.74 ? 67  LEU A CA  1 
ATOM   530  C C   . LEU A 1 68  ? -3.787  25.939 3.991   1.00 43.83 ? 67  LEU A C   1 
ATOM   531  O O   . LEU A 1 68  ? -3.727  24.940 4.714   1.00 44.44 ? 67  LEU A O   1 
ATOM   532  C CB  . LEU A 1 68  ? -2.683  26.179 1.756   1.00 38.39 ? 67  LEU A CB  1 
ATOM   533  C CG  . LEU A 1 68  ? -2.525  25.621 0.345   1.00 42.26 ? 67  LEU A CG  1 
ATOM   534  C CD1 . LEU A 1 68  ? -1.398  26.329 -0.394  1.00 40.03 ? 67  LEU A CD1 1 
ATOM   535  C CD2 . LEU A 1 68  ? -2.224  24.115 0.439   1.00 36.54 ? 67  LEU A CD2 1 
ATOM   536  N N   . GLU A 1 69  ? -3.716  27.181 4.450   1.00 42.86 ? 68  GLU A N   1 
ATOM   537  C CA  . GLU A 1 69  ? -3.557  27.466 5.876   1.00 47.69 ? 68  GLU A CA  1 
ATOM   538  C C   . GLU A 1 69  ? -4.717  26.914 6.695   1.00 46.20 ? 68  GLU A C   1 
ATOM   539  O O   . GLU A 1 69  ? -4.512  26.346 7.769   1.00 49.61 ? 68  GLU A O   1 
ATOM   540  C CB  . GLU A 1 69  ? -3.395  28.968 6.082   1.00 46.28 ? 68  GLU A CB  1 
ATOM   541  C CG  . GLU A 1 69  ? -2.057  29.467 5.545   1.00 48.47 ? 68  GLU A CG  1 
ATOM   542  C CD  . GLU A 1 69  ? -1.935  30.980 5.528   1.00 56.75 ? 68  GLU A CD  1 
ATOM   543  O OE1 . GLU A 1 69  ? -2.968  31.659 5.717   1.00 57.68 ? 68  GLU A OE1 1 
ATOM   544  O OE2 . GLU A 1 69  ? -0.805  31.488 5.319   1.00 55.80 ? 68  GLU A OE2 1 
ATOM   545  N N   . ALA A 1 70  ? -5.932  27.042 6.170   1.00 47.46 ? 69  ALA A N   1 
ATOM   546  C CA  . ALA A 1 70  ? -7.103  26.473 6.834   1.00 47.04 ? 69  ALA A CA  1 
ATOM   547  C C   . ALA A 1 70  ? -6.959  24.964 6.981   1.00 47.18 ? 69  ALA A C   1 
ATOM   548  O O   . ALA A 1 70  ? -7.272  24.375 8.022   1.00 46.56 ? 69  ALA A O   1 
ATOM   549  C CB  . ALA A 1 70  ? -8.377  26.809 6.057   1.00 46.61 ? 69  ALA A CB  1 
ATOM   550  N N   . LEU A 1 71  ? -6.455  24.340 5.925   1.00 48.48 ? 70  LEU A N   1 
ATOM   551  C CA  . LEU A 1 71  ? -6.408  22.893 5.869   1.00 43.64 ? 70  LEU A CA  1 
ATOM   552  C C   . LEU A 1 71  ? -5.224  22.349 6.680   1.00 40.75 ? 70  LEU A C   1 
ATOM   553  O O   . LEU A 1 71  ? -5.320  21.291 7.285   1.00 44.51 ? 70  LEU A O   1 
ATOM   554  C CB  . LEU A 1 71  ? -6.367  22.455 4.405   1.00 43.09 ? 70  LEU A CB  1 
ATOM   555  C CG  . LEU A 1 71  ? -6.429  20.987 4.044   1.00 44.55 ? 70  LEU A CG  1 
ATOM   556  C CD1 . LEU A 1 71  ? -7.626  20.355 4.721   1.00 44.51 ? 70  LEU A CD1 1 
ATOM   557  C CD2 . LEU A 1 71  ? -6.604  20.926 2.536   1.00 43.09 ? 70  LEU A CD2 1 
ATOM   558  N N   . LYS A 1 72  ? -4.121  23.085 6.710   1.00 43.54 ? 71  LYS A N   1 
ATOM   559  C CA  . LYS A 1 72  ? -3.008  22.743 7.588   1.00 45.55 ? 71  LYS A CA  1 
ATOM   560  C C   . LYS A 1 72  ? -3.476  22.750 9.037   1.00 48.23 ? 71  LYS A C   1 
ATOM   561  O O   . LYS A 1 72  ? -3.134  21.861 9.812   1.00 51.18 ? 71  LYS A O   1 
ATOM   562  C CB  . LYS A 1 72  ? -1.841  23.719 7.413   1.00 46.93 ? 71  LYS A CB  1 
ATOM   563  C CG  . LYS A 1 72  ? -0.660  23.390 8.314   1.00 50.16 ? 71  LYS A CG  1 
ATOM   564  C CD  . LYS A 1 72  ? 0.531   24.311 8.094   1.00 54.92 ? 71  LYS A CD  1 
ATOM   565  C CE  . LYS A 1 72  ? 1.676   23.935 9.048   1.00 61.07 ? 71  LYS A CE  1 
ATOM   566  N NZ  . LYS A 1 72  ? 2.894   24.786 8.897   1.00 60.72 ? 71  LYS A NZ  1 
ATOM   567  N N   . LYS A 1 73  ? -4.274  23.755 9.386   1.00 48.70 ? 72  LYS A N   1 
ATOM   568  C CA  . LYS A 1 73  ? -4.876  23.842 10.714  1.00 49.70 ? 72  LYS A CA  1 
ATOM   569  C C   . LYS A 1 73  ? -5.709  22.596 10.996  1.00 51.05 ? 72  LYS A C   1 
ATOM   570  O O   . LYS A 1 73  ? -5.492  21.908 11.994  1.00 54.06 ? 72  LYS A O   1 
ATOM   571  C CB  . LYS A 1 73  ? -5.731  25.112 10.826  1.00 53.38 ? 72  LYS A CB  1 
ATOM   572  C CG  . LYS A 1 73  ? -6.076  25.532 12.253  1.00 56.09 ? 72  LYS A CG  1 
ATOM   573  N N   . GLN A 1 74  ? -6.646  22.293 10.101  1.00 48.35 ? 73  GLN A N   1 
ATOM   574  C CA  . GLN A 1 74  ? -7.471  21.088 10.224  1.00 49.34 ? 73  GLN A CA  1 
ATOM   575  C C   . GLN A 1 74  ? -6.677  19.791 10.385  1.00 52.92 ? 73  GLN A C   1 
ATOM   576  O O   . GLN A 1 74  ? -7.085  18.885 11.124  1.00 54.72 ? 73  GLN A O   1 
ATOM   577  C CB  . GLN A 1 74  ? -8.389  20.962 9.007   1.00 49.58 ? 73  GLN A CB  1 
ATOM   578  C CG  . GLN A 1 74  ? -9.188  19.663 8.959   1.00 50.10 ? 73  GLN A CG  1 
ATOM   579  C CD  . GLN A 1 74  ? -10.123 19.597 7.757   1.00 55.71 ? 73  GLN A CD  1 
ATOM   580  O OE1 . GLN A 1 74  ? -10.407 20.614 7.119   1.00 50.51 ? 73  GLN A OE1 1 
ATOM   581  N NE2 . GLN A 1 74  ? -10.541 18.386 7.399   1.00 47.56 ? 73  GLN A NE2 1 
ATOM   582  N N   . LEU A 1 75  ? -5.551  19.685 9.684   1.00 51.31 ? 74  LEU A N   1 
ATOM   583  C CA  . LEU A 1 75  ? -4.781  18.441 9.699   1.00 53.17 ? 74  LEU A CA  1 
ATOM   584  C C   . LEU A 1 75  ? -3.911  18.276 10.940  1.00 51.54 ? 74  LEU A C   1 
ATOM   585  O O   . LEU A 1 75  ? -3.644  17.153 11.356  1.00 53.39 ? 74  LEU A O   1 
ATOM   586  C CB  . LEU A 1 75  ? -3.917  18.344 8.449   1.00 48.41 ? 74  LEU A CB  1 
ATOM   587  C CG  . LEU A 1 75  ? -4.761  18.066 7.212   1.00 52.80 ? 74  LEU A CG  1 
ATOM   588  C CD1 . LEU A 1 75  ? -3.931  18.228 5.949   1.00 42.38 ? 74  LEU A CD1 1 
ATOM   589  C CD2 . LEU A 1 75  ? -5.317  16.651 7.334   1.00 46.28 ? 74  LEU A CD2 1 
ATOM   590  N N   . GLY A 1 76  ? -3.472  19.390 11.515  1.00 50.98 ? 75  GLY A N   1 
ATOM   591  C CA  . GLY A 1 76  ? -2.701  19.362 12.747  1.00 54.95 ? 75  GLY A CA  1 
ATOM   592  C C   . GLY A 1 76  ? -1.467  18.485 12.690  1.00 54.34 ? 75  GLY A C   1 
ATOM   593  O O   . GLY A 1 76  ? -0.661  18.606 11.762  1.00 53.50 ? 75  GLY A O   1 
ATOM   594  N N   . ASP A 1 77  ? -1.345  17.580 13.664  1.00 51.97 ? 76  ASP A N   1 
ATOM   595  C CA  . ASP A 1 77  ? -0.158  16.738 13.828  1.00 51.88 ? 76  ASP A CA  1 
ATOM   596  C C   . ASP A 1 77  ? -0.193  15.463 12.978  1.00 53.00 ? 76  ASP A C   1 
ATOM   597  O O   . ASP A 1 77  ? 0.471   14.478 13.293  1.00 55.14 ? 76  ASP A O   1 
ATOM   598  C CB  . ASP A 1 77  ? 0.025   16.364 15.308  1.00 58.64 ? 76  ASP A CB  1 
ATOM   599  N N   . ASN A 1 78  ? -0.960  15.490 11.896  1.00 52.62 ? 77  ASN A N   1 
ATOM   600  C CA  . ASN A 1 78  ? -0.968  14.399 10.937  1.00 45.66 ? 77  ASN A CA  1 
ATOM   601  C C   . ASN A 1 78  ? 0.445   14.218 10.375  1.00 43.73 ? 77  ASN A C   1 
ATOM   602  O O   . ASN A 1 78  ? 1.059   15.161 9.890   1.00 47.21 ? 77  ASN A O   1 
ATOM   603  C CB  . ASN A 1 78  ? -2.026  14.686 9.858   1.00 47.96 ? 77  ASN A CB  1 
ATOM   604  C CG  . ASN A 1 78  ? -2.152  13.586 8.821   1.00 48.42 ? 77  ASN A CG  1 
ATOM   605  O OD1 . ASN A 1 78  ? -1.163  13.011 8.351   1.00 45.14 ? 77  ASN A OD1 1 
ATOM   606  N ND2 . ASN A 1 78  ? -3.396  13.236 8.505   1.00 51.35 ? 77  ASN A ND2 1 
ATOM   607  N N   . GLU A 1 79  ? 0.971   13.007 10.491  1.00 43.94 ? 78  GLU A N   1 
ATOM   608  C CA  . GLU A 1 79  ? 2.364   12.745 10.161  1.00 47.55 ? 78  GLU A CA  1 
ATOM   609  C C   . GLU A 1 79  ? 2.670   12.994 8.659   1.00 49.26 ? 78  GLU A C   1 
ATOM   610  O O   . GLU A 1 79  ? 3.783   13.415 8.305   1.00 44.42 ? 78  GLU A O   1 
ATOM   611  C CB  . GLU A 1 79  ? 2.715   11.307 10.557  1.00 52.33 ? 78  GLU A CB  1 
ATOM   612  C CG  . GLU A 1 79  ? 4.198   10.989 10.511  1.00 61.59 ? 78  GLU A CG  1 
ATOM   613  C CD  . GLU A 1 79  ? 4.494   9.522  10.792  1.00 69.76 ? 78  GLU A CD  1 
ATOM   614  O OE1 . GLU A 1 79  ? 3.534   8.733  10.924  1.00 71.82 ? 78  GLU A OE1 1 
ATOM   615  O OE2 . GLU A 1 79  ? 5.689   9.155  10.878  1.00 77.20 ? 78  GLU A OE2 1 
ATOM   616  N N   . ALA A 1 80  ? 1.676   12.765 7.792   1.00 41.97 ? 79  ALA A N   1 
ATOM   617  C CA  . ALA A 1 80  ? 1.830   12.945 6.341   1.00 40.86 ? 79  ALA A CA  1 
ATOM   618  C C   . ALA A 1 80  ? 2.075   14.400 5.998   1.00 43.20 ? 79  ALA A C   1 
ATOM   619  O O   . ALA A 1 80  ? 2.532   14.719 4.899   1.00 41.64 ? 79  ALA A O   1 
ATOM   620  C CB  . ALA A 1 80  ? 0.597   12.417 5.588   1.00 34.24 ? 79  ALA A CB  1 
ATOM   621  N N   . ILE A 1 81  ? 1.791   15.286 6.952   1.00 42.22 ? 80  ILE A N   1 
ATOM   622  C CA  . ILE A 1 81  ? 2.021   16.713 6.762   1.00 38.96 ? 80  ILE A CA  1 
ATOM   623  C C   . ILE A 1 81  ? 3.311   17.156 7.448   1.00 46.54 ? 80  ILE A C   1 
ATOM   624  O O   . ILE A 1 81  ? 4.109   17.888 6.865   1.00 48.75 ? 80  ILE A O   1 
ATOM   625  C CB  . ILE A 1 81  ? 0.839   17.539 7.296   1.00 45.64 ? 80  ILE A CB  1 
ATOM   626  C CG1 . ILE A 1 81  ? -0.461  17.080 6.630   1.00 44.53 ? 80  ILE A CG1 1 
ATOM   627  C CG2 . ILE A 1 81  ? 1.073   19.027 7.069   1.00 42.67 ? 80  ILE A CG2 1 
ATOM   628  C CD1 . ILE A 1 81  ? -0.444  17.199 5.107   1.00 38.59 ? 80  ILE A CD1 1 
ATOM   629  N N   . THR A 1 82  ? 3.524   16.703 8.681   1.00 48.50 ? 81  THR A N   1 
ATOM   630  C CA  . THR A 1 82  ? 4.713   17.093 9.438   1.00 47.39 ? 81  THR A CA  1 
ATOM   631  C C   . THR A 1 82  ? 5.985   16.472 8.847   1.00 46.78 ? 81  THR A C   1 
ATOM   632  O O   . THR A 1 82  ? 7.046   17.096 8.852   1.00 48.04 ? 81  THR A O   1 
ATOM   633  C CB  . THR A 1 82  ? 4.584   16.696 10.929  1.00 44.34 ? 81  THR A CB  1 
ATOM   634  O OG1 . THR A 1 82  ? 4.428   15.277 11.036  1.00 50.83 ? 81  THR A OG1 1 
ATOM   635  C CG2 . THR A 1 82  ? 3.368   17.367 11.558  1.00 43.92 ? 81  THR A CG2 1 
ATOM   636  N N   . GLN A 1 83  ? 5.864   15.251 8.334   1.00 42.71 ? 82  GLN A N   1 
ATOM   637  C CA  . GLN A 1 83  ? 6.959   14.548 7.649   1.00 43.05 ? 82  GLN A CA  1 
ATOM   638  C C   . GLN A 1 83  ? 6.735   14.458 6.127   1.00 44.75 ? 82  GLN A C   1 
ATOM   639  O O   . GLN A 1 83  ? 5.888   13.676 5.672   1.00 40.86 ? 82  GLN A O   1 
ATOM   640  C CB  . GLN A 1 83  ? 7.104   13.130 8.219   1.00 50.71 ? 82  GLN A CB  1 
ATOM   641  C CG  . GLN A 1 83  ? 7.574   13.075 9.676   1.00 58.55 ? 82  GLN A CG  1 
ATOM   642  C CD  . GLN A 1 83  ? 9.032   13.452 9.789   1.00 65.54 ? 82  GLN A CD  1 
ATOM   643  O OE1 . GLN A 1 83  ? 9.375   14.601 10.079  1.00 66.46 ? 82  GLN A OE1 1 
ATOM   644  N NE2 . GLN A 1 83  ? 9.909   12.482 9.533   1.00 64.48 ? 82  GLN A NE2 1 
ATOM   645  N N   . GLU A 1 84  ? 7.500   15.221 5.342   1.00 41.47 ? 83  GLU A N   1 
ATOM   646  C CA  . GLU A 1 84  ? 7.292   15.251 3.893   1.00 41.20 ? 83  GLU A CA  1 
ATOM   647  C C   . GLU A 1 84  ? 7.311   13.860 3.280   1.00 40.78 ? 83  GLU A C   1 
ATOM   648  O O   . GLU A 1 84  ? 6.474   13.533 2.441   1.00 39.76 ? 83  GLU A O   1 
ATOM   649  C CB  . GLU A 1 84  ? 8.342   16.102 3.166   1.00 39.69 ? 83  GLU A CB  1 
ATOM   650  C CG  . GLU A 1 84  ? 8.303   17.569 3.490   1.00 42.37 ? 83  GLU A CG  1 
ATOM   651  C CD  . GLU A 1 84  ? 9.116   18.410 2.519   1.00 46.29 ? 83  GLU A CD  1 
ATOM   652  O OE1 . GLU A 1 84  ? 9.672   17.860 1.537   1.00 48.76 ? 83  GLU A OE1 1 
ATOM   653  O OE2 . GLU A 1 84  ? 9.225   19.630 2.753   1.00 56.77 ? 83  GLU A OE2 1 
ATOM   654  N N   . ILE A 1 85  ? 8.257   13.034 3.704   1.00 35.90 ? 84  ILE A N   1 
ATOM   655  C CA  . ILE A 1 85  ? 8.446   11.759 3.036   1.00 37.90 ? 84  ILE A CA  1 
ATOM   656  C C   . ILE A 1 85  ? 7.242   10.846 3.281   1.00 37.83 ? 84  ILE A C   1 
ATOM   657  O O   . ILE A 1 85  ? 6.915   10.023 2.435   1.00 37.23 ? 84  ILE A O   1 
ATOM   658  C CB  . ILE A 1 85  ? 9.760   11.055 3.484   1.00 41.11 ? 84  ILE A CB  1 
ATOM   659  C CG1 . ILE A 1 85  ? 10.117  9.924  2.520   1.00 40.17 ? 84  ILE A CG1 1 
ATOM   660  C CG2 . ILE A 1 85  ? 9.656   10.532 4.912   1.00 40.84 ? 84  ILE A CG2 1 
ATOM   661  C CD1 . ILE A 1 85  ? 10.511  10.417 1.126   1.00 39.05 ? 84  ILE A CD1 1 
ATOM   662  N N   . VAL A 1 86  ? 6.587   10.989 4.434   1.00 40.88 ? 85  VAL A N   1 
ATOM   663  C CA  . VAL A 1 86  ? 5.347   10.250 4.702   1.00 39.27 ? 85  VAL A CA  1 
ATOM   664  C C   . VAL A 1 86  ? 4.224   10.739 3.773   1.00 34.29 ? 85  VAL A C   1 
ATOM   665  O O   . VAL A 1 86  ? 3.466   9.948  3.242   1.00 34.28 ? 85  VAL A O   1 
ATOM   666  C CB  . VAL A 1 86  ? 4.899   10.398 6.179   1.00 43.42 ? 85  VAL A CB  1 
ATOM   667  C CG1 . VAL A 1 86  ? 3.548   9.725  6.413   1.00 36.08 ? 85  VAL A CG1 1 
ATOM   668  C CG2 . VAL A 1 86  ? 5.954   9.821  7.112   1.00 47.25 ? 85  VAL A CG2 1 
ATOM   669  N N   . GLY A 1 87  ? 4.124   12.052 3.589   1.00 35.31 ? 86  GLY A N   1 
ATOM   670  C CA  . GLY A 1 87  ? 3.212   12.601 2.605   1.00 34.98 ? 86  GLY A CA  1 
ATOM   671  C C   . GLY A 1 87  ? 3.541   12.096 1.209   1.00 33.93 ? 86  GLY A C   1 
ATOM   672  O O   . GLY A 1 87  ? 2.646   11.769 0.428   1.00 33.63 ? 86  GLY A O   1 
ATOM   673  N N   . CYS A 1 88  ? 4.829   12.001 0.897   1.00 34.50 ? 87  CYS A N   1 
ATOM   674  C CA  . CYS A 1 88  ? 5.240   11.544 -0.423  1.00 31.09 ? 87  CYS A CA  1 
ATOM   675  C C   . CYS A 1 88  ? 4.824   10.105 -0.630  1.00 32.07 ? 87  CYS A C   1 
ATOM   676  O O   . CYS A 1 88  ? 4.256   9.761  -1.659  1.00 32.06 ? 87  CYS A O   1 
ATOM   677  C CB  . CYS A 1 88  ? 6.751   11.694 -0.615  1.00 34.14 ? 87  CYS A CB  1 
ATOM   678  S SG  . CYS A 1 88  ? 7.297   11.312 -2.318  1.00 39.51 ? 87  CYS A SG  1 
ATOM   679  N N   . ALA A 1 89  ? 5.107   9.252  0.344   1.00 32.37 ? 88  ALA A N   1 
ATOM   680  C CA  . ALA A 1 89  ? 4.697   7.855  0.245   1.00 33.56 ? 88  ALA A CA  1 
ATOM   681  C C   . ALA A 1 89  ? 3.175   7.715  0.100   1.00 31.75 ? 88  ALA A C   1 
ATOM   682  O O   . ALA A 1 89  ? 2.698   6.880  -0.663  1.00 34.33 ? 88  ALA A O   1 
ATOM   683  C CB  . ALA A 1 89  ? 5.183   7.073  1.462   1.00 32.55 ? 88  ALA A CB  1 
ATOM   684  N N   . HIS A 1 90  ? 2.428   8.528  0.845   1.00 32.23 ? 89  HIS A N   1 
ATOM   685  C CA  . HIS A 1 90  ? 0.961   8.523  0.785   1.00 34.20 ? 89  HIS A CA  1 
ATOM   686  C C   . HIS A 1 90  ? 0.461   8.795  -0.645  1.00 33.76 ? 89  HIS A C   1 
ATOM   687  O O   . HIS A 1 90  ? -0.366  8.059  -1.183  1.00 33.22 ? 89  HIS A O   1 
ATOM   688  C CB  . HIS A 1 90  ? 0.390   9.577  1.744   1.00 32.42 ? 89  HIS A CB  1 
ATOM   689  C CG  . HIS A 1 90  ? -1.110  9.575  1.844   1.00 41.54 ? 89  HIS A CG  1 
ATOM   690  N ND1 . HIS A 1 90  ? -1.818  8.564  2.460   1.00 46.95 ? 89  HIS A ND1 1 
ATOM   691  C CD2 . HIS A 1 90  ? -2.038  10.451 1.385   1.00 38.93 ? 89  HIS A CD2 1 
ATOM   692  C CE1 . HIS A 1 90  ? -3.111  8.830  2.402   1.00 41.92 ? 89  HIS A CE1 1 
ATOM   693  N NE2 . HIS A 1 90  ? -3.272  9.965  1.748   1.00 40.81 ? 89  HIS A NE2 1 
ATOM   694  N N   . LEU A 1 91  ? 0.967   9.859  -1.258  1.00 30.48 ? 90  LEU A N   1 
ATOM   695  C CA  . LEU A 1 91  ? 0.547   10.211 -2.611  1.00 30.26 ? 90  LEU A CA  1 
ATOM   696  C C   . LEU A 1 91  ? 1.009   9.203  -3.628  1.00 33.55 ? 90  LEU A C   1 
ATOM   697  O O   . LEU A 1 91  ? 0.240   8.770  -4.489  1.00 36.39 ? 90  LEU A O   1 
ATOM   698  C CB  . LEU A 1 91  ? 1.052   11.595 -2.989  1.00 32.82 ? 90  LEU A CB  1 
ATOM   699  C CG  . LEU A 1 91  ? -0.009  12.647 -2.662  1.00 32.64 ? 90  LEU A CG  1 
ATOM   700  C CD1 . LEU A 1 91  ? -0.250  12.793 -1.164  1.00 31.61 ? 90  LEU A CD1 1 
ATOM   701  C CD2 . LEU A 1 91  ? 0.387   13.942 -3.283  1.00 38.14 ? 90  LEU A CD2 1 
ATOM   702  N N   . GLU A 1 92  ? 2.271   8.820  -3.517  1.00 33.82 ? 91  GLU A N   1 
ATOM   703  C CA  . GLU A 1 92  ? 2.846   7.809  -4.393  1.00 37.56 ? 91  GLU A CA  1 
ATOM   704  C C   . GLU A 1 92  ? 2.096   6.478  -4.356  1.00 36.17 ? 91  GLU A C   1 
ATOM   705  O O   . GLU A 1 92  ? 1.758   5.929  -5.411  1.00 39.96 ? 91  GLU A O   1 
ATOM   706  C CB  . GLU A 1 92  ? 4.334   7.651  -4.035  1.00 39.05 ? 91  GLU A CB  1 
ATOM   707  C CG  . GLU A 1 92  ? 5.004   6.369  -4.482  1.00 45.13 ? 91  GLU A CG  1 
ATOM   708  C CD  . GLU A 1 92  ? 6.517   6.393  -4.241  1.00 49.96 ? 91  GLU A CD  1 
ATOM   709  O OE1 . GLU A 1 92  ? 7.144   7.476  -4.336  1.00 45.48 ? 91  GLU A OE1 1 
ATOM   710  O OE2 . GLU A 1 92  ? 7.045   5.355  -3.787  1.00 49.69 ? 91  GLU A OE2 1 
ATOM   711  N N   . ASN A 1 93  ? 1.798   5.964  -3.165  1.00 35.31 ? 92  ASN A N   1 
ATOM   712  C CA  . ASN A 1 93  ? 1.026   4.722  -3.074  1.00 35.08 ? 92  ASN A CA  1 
ATOM   713  C C   . ASN A 1 93  ? -0.374  4.846  -3.683  1.00 31.10 ? 92  ASN A C   1 
ATOM   714  O O   . ASN A 1 93  ? -0.882  3.919  -4.305  1.00 32.53 ? 92  ASN A O   1 
ATOM   715  C CB  . ASN A 1 93  ? 0.918   4.281  -1.616  1.00 38.74 ? 92  ASN A CB  1 
ATOM   716  C CG  . ASN A 1 93  ? 2.233   3.780  -1.071  1.00 42.96 ? 92  ASN A CG  1 
ATOM   717  O OD1 . ASN A 1 93  ? 3.061   3.236  -1.810  1.00 46.12 ? 92  ASN A OD1 1 
ATOM   718  N ND2 . ASN A 1 93  ? 2.453   3.991  0.218   1.00 43.95 ? 92  ASN A ND2 1 
ATOM   719  N N   . TYR A 1 94  ? -0.987  6.006  -3.501  1.00 33.96 ? 93  TYR A N   1 
ATOM   720  C CA  . TYR A 1 94  ? -2.308  6.254  -4.040  1.00 32.93 ? 93  TYR A CA  1 
ATOM   721  C C   . TYR A 1 94  ? -2.262  6.390  -5.576  1.00 34.23 ? 93  TYR A C   1 
ATOM   722  O O   . TYR A 1 94  ? -3.069  5.777  -6.285  1.00 33.05 ? 93  TYR A O   1 
ATOM   723  C CB  . TYR A 1 94  ? -2.905  7.479  -3.353  1.00 32.91 ? 93  TYR A CB  1 
ATOM   724  C CG  . TYR A 1 94  ? -4.307  7.830  -3.796  1.00 40.22 ? 93  TYR A CG  1 
ATOM   725  C CD1 . TYR A 1 94  ? -5.321  6.874  -3.754  1.00 36.59 ? 93  TYR A CD1 1 
ATOM   726  C CD2 . TYR A 1 94  ? -4.652  9.140  -4.114  1.00 34.00 ? 93  TYR A CD2 1 
ATOM   727  C CE1 . TYR A 1 94  ? -6.610  7.188  -4.124  1.00 37.31 ? 93  TYR A CE1 1 
ATOM   728  C CE2 . TYR A 1 94  ? -5.950  9.467  -4.475  1.00 34.87 ? 93  TYR A CE2 1 
ATOM   729  C CZ  . TYR A 1 94  ? -6.920  8.485  -4.477  1.00 33.95 ? 93  TYR A CZ  1 
ATOM   730  O OH  . TYR A 1 94  ? -8.207  8.787  -4.823  1.00 37.01 ? 93  TYR A OH  1 
ATOM   731  N N   . ALA A 1 95  ? -1.287  7.133  -6.096  1.00 37.45 ? 94  ALA A N   1 
ATOM   732  C CA  . ALA A 1 95  ? -1.079  7.201  -7.557  1.00 35.11 ? 94  ALA A CA  1 
ATOM   733  C C   . ALA A 1 95  ? -0.895  5.805  -8.169  1.00 32.89 ? 94  ALA A C   1 
ATOM   734  O O   . ALA A 1 95  ? -1.472  5.487  -9.207  1.00 36.50 ? 94  ALA A O   1 
ATOM   735  C CB  . ALA A 1 95  ? 0.125   8.085  -7.877  1.00 30.82 ? 94  ALA A CB  1 
ATOM   736  N N   . LEU A 1 96  ? -0.095  4.967  -7.518  1.00 33.73 ? 95  LEU A N   1 
ATOM   737  C CA  . LEU A 1 96  ? 0.205   3.632  -8.045  1.00 35.75 ? 95  LEU A CA  1 
ATOM   738  C C   . LEU A 1 96  ? -1.036  2.743  -8.017  1.00 38.67 ? 95  LEU A C   1 
ATOM   739  O O   . LEU A 1 96  ? -1.320  2.015  -8.967  1.00 40.57 ? 95  LEU A O   1 
ATOM   740  C CB  . LEU A 1 96  ? 1.344   2.994  -7.251  1.00 35.22 ? 95  LEU A CB  1 
ATOM   741  C CG  . LEU A 1 96  ? 1.831   1.604  -7.643  1.00 44.87 ? 95  LEU A CG  1 
ATOM   742  C CD1 . LEU A 1 96  ? 2.349   1.593  -9.070  1.00 44.18 ? 95  LEU A CD1 1 
ATOM   743  C CD2 . LEU A 1 96  ? 2.917   1.141  -6.670  1.00 45.76 ? 95  LEU A CD2 1 
ATOM   744  N N   . LYS A 1 97  ? -1.781  2.836  -6.926  1.00 39.56 ? 96  LYS A N   1 
ATOM   745  C CA  . LYS A 1 97  ? -3.077  2.177  -6.791  1.00 43.03 ? 96  LYS A CA  1 
ATOM   746  C C   . LYS A 1 97  ? -4.036  2.511  -7.947  1.00 39.64 ? 96  LYS A C   1 
ATOM   747  O O   . LYS A 1 97  ? -4.672  1.636  -8.506  1.00 41.24 ? 96  LYS A O   1 
ATOM   748  C CB  . LYS A 1 97  ? -3.702  2.580  -5.453  1.00 43.19 ? 96  LYS A CB  1 
ATOM   749  C CG  . LYS A 1 97  ? -5.075  2.006  -5.156  1.00 50.11 ? 96  LYS A CG  1 
ATOM   750  C CD  . LYS A 1 97  ? -5.623  2.648  -3.872  1.00 52.16 ? 96  LYS A CD  1 
ATOM   751  C CE  . LYS A 1 97  ? -7.095  2.333  -3.637  1.00 59.25 ? 96  LYS A CE  1 
ATOM   752  N NZ  . LYS A 1 97  ? -7.323  0.887  -3.390  1.00 59.92 ? 96  LYS A NZ  1 
ATOM   753  N N   . MET A 1 98  ? -4.150  3.779  -8.308  1.00 41.39 ? 97  MET A N   1 
ATOM   754  C CA  . MET A 1 98  ? -5.040  4.122  -9.410  1.00 40.54 ? 97  MET A CA  1 
ATOM   755  C C   . MET A 1 98  ? -4.486  3.660  -10.759 1.00 40.64 ? 97  MET A C   1 
ATOM   756  O O   . MET A 1 98  ? -5.230  3.232  -11.641 1.00 40.92 ? 97  MET A O   1 
ATOM   757  C CB  . MET A 1 98  ? -5.279  5.611  -9.439  1.00 37.33 ? 97  MET A CB  1 
ATOM   758  C CG  . MET A 1 98  ? -5.927  6.089  -8.190  1.00 46.00 ? 97  MET A CG  1 
ATOM   759  S SD  . MET A 1 98  ? -6.302  7.821  -8.345  1.00 55.21 ? 97  MET A SD  1 
ATOM   760  C CE  . MET A 1 98  ? -7.765  7.650  -9.355  1.00 47.75 ? 97  MET A CE  1 
ATOM   761  N N   . PHE A 1 99  ? -3.171  3.751  -10.903 1.00 36.29 ? 98  PHE A N   1 
ATOM   762  C CA  . PHE A 1 99  ? -2.514  3.365  -12.130 1.00 37.64 ? 98  PHE A CA  1 
ATOM   763  C C   . PHE A 1 99  ? -2.662  1.859  -12.347 1.00 41.57 ? 98  PHE A C   1 
ATOM   764  O O   . PHE A 1 99  ? -2.988  1.404  -13.449 1.00 37.18 ? 98  PHE A O   1 
ATOM   765  C CB  . PHE A 1 99  ? -1.036  3.758  -12.076 1.00 36.29 ? 98  PHE A CB  1 
ATOM   766  C CG  . PHE A 1 99  ? -0.273  3.431  -13.324 1.00 40.06 ? 98  PHE A CG  1 
ATOM   767  C CD1 . PHE A 1 99  ? -0.139  4.370  -14.335 1.00 39.30 ? 98  PHE A CD1 1 
ATOM   768  C CD2 . PHE A 1 99  ? 0.282   2.177  -13.506 1.00 42.13 ? 98  PHE A CD2 1 
ATOM   769  C CE1 . PHE A 1 99  ? 0.562   4.074  -15.483 1.00 40.74 ? 98  PHE A CE1 1 
ATOM   770  C CE2 . PHE A 1 99  ? 0.978   1.874  -14.659 1.00 44.70 ? 98  PHE A CE2 1 
ATOM   771  C CZ  . PHE A 1 99  ? 1.118   2.820  -15.649 1.00 40.72 ? 98  PHE A CZ  1 
ATOM   772  N N   . LEU A 1 100 ? -2.396  1.082  -11.300 1.00 38.66 ? 99  LEU A N   1 
ATOM   773  C CA  . LEU A 1 100 ? -2.552  -0.363 -11.409 1.00 43.53 ? 99  LEU A CA  1 
ATOM   774  C C   . LEU A 1 100 ? -4.021  -0.727 -11.647 1.00 41.89 ? 99  LEU A C   1 
ATOM   775  O O   . LEU A 1 100 ? -4.311  -1.599 -12.465 1.00 41.62 ? 99  LEU A O   1 
ATOM   776  C CB  . LEU A 1 100 ? -1.986  -1.075 -10.172 1.00 44.09 ? 99  LEU A CB  1 
ATOM   777  C CG  . LEU A 1 100 ? -0.450  -1.097 -10.109 1.00 44.89 ? 99  LEU A CG  1 
ATOM   778  C CD1 . LEU A 1 100 ? 0.083   -1.709 -8.802  1.00 41.77 ? 99  LEU A CD1 1 
ATOM   779  C CD2 . LEU A 1 100 ? 0.100   -1.855 -11.318 1.00 40.23 ? 99  LEU A CD2 1 
ATOM   780  N N   . TYR A 1 101 ? -4.946  -0.040 -10.980 1.00 38.07 ? 100 TYR A N   1 
ATOM   781  C CA  . TYR A 1 101 ? -6.350  -0.238 -11.309 1.00 42.39 ? 100 TYR A CA  1 
ATOM   782  C C   . TYR A 1 101 ? -6.605  -0.029 -12.795 1.00 43.56 ? 100 TYR A C   1 
ATOM   783  O O   . TYR A 1 101 ? -7.094  -0.937 -13.472 1.00 43.97 ? 100 TYR A O   1 
ATOM   784  C CB  . TYR A 1 101 ? -7.264  0.699  -10.514 1.00 42.78 ? 100 TYR A CB  1 
ATOM   785  C CG  . TYR A 1 101 ? -8.691  0.728  -11.056 1.00 43.93 ? 100 TYR A CG  1 
ATOM   786  C CD1 . TYR A 1 101 ? -9.594  -0.294 -10.775 1.00 45.93 ? 100 TYR A CD1 1 
ATOM   787  C CD2 . TYR A 1 101 ? -9.120  1.770  -11.878 1.00 43.93 ? 100 TYR A CD2 1 
ATOM   788  C CE1 . TYR A 1 101 ? -10.889 -0.267 -11.275 1.00 41.05 ? 100 TYR A CE1 1 
ATOM   789  C CE2 . TYR A 1 101 ? -10.402 1.802  -12.384 1.00 42.80 ? 100 TYR A CE2 1 
ATOM   790  C CZ  . TYR A 1 101 ? -11.286 0.783  -12.080 1.00 45.06 ? 100 TYR A CZ  1 
ATOM   791  O OH  . TYR A 1 101 ? -12.564 0.833  -12.593 1.00 44.20 ? 100 TYR A OH  1 
ATOM   792  N N   . ALA A 1 102 ? -6.291  1.170  -13.294 1.00 39.30 ? 101 ALA A N   1 
ATOM   793  C CA  . ALA A 1 102 ? -6.613  1.525  -14.686 1.00 38.98 ? 101 ALA A CA  1 
ATOM   794  C C   . ALA A 1 102 ? -5.921  0.615  -15.687 1.00 37.62 ? 101 ALA A C   1 
ATOM   795  O O   . ALA A 1 102 ? -6.486  0.290  -16.729 1.00 39.61 ? 101 ALA A O   1 
ATOM   796  C CB  . ALA A 1 102 ? -6.244  2.982  -14.969 1.00 33.11 ? 101 ALA A CB  1 
ATOM   797  N N   . ASP A 1 103 ? -4.688  0.235  -15.369 1.00 39.03 ? 102 ASP A N   1 
ATOM   798  C CA  . ASP A 1 103 ? -3.889  -0.659 -16.198 1.00 43.73 ? 102 ASP A CA  1 
ATOM   799  C C   . ASP A 1 103 ? -4.508  -2.050 -16.309 1.00 48.55 ? 102 ASP A C   1 
ATOM   800  O O   . ASP A 1 103 ? -4.449  -2.680 -17.364 1.00 49.86 ? 102 ASP A O   1 
ATOM   801  C CB  . ASP A 1 103 ? -2.463  -0.775 -15.640 1.00 39.63 ? 102 ASP A CB  1 
ATOM   802  C CG  . ASP A 1 103 ? -1.605  -1.770 -16.421 1.00 50.73 ? 102 ASP A CG  1 
ATOM   803  O OD1 . ASP A 1 103 ? -1.321  -1.526 -17.621 1.00 49.97 ? 102 ASP A OD1 1 
ATOM   804  O OD2 . ASP A 1 103 ? -1.209  -2.799 -15.827 1.00 50.22 ? 102 ASP A OD2 1 
ATOM   805  N N   . ASN A 1 104 ? -5.083  -2.528 -15.209 1.00 48.82 ? 103 ASN A N   1 
ATOM   806  C CA  . ASN A 1 104 ? -5.730  -3.825 -15.193 1.00 49.15 ? 103 ASN A CA  1 
ATOM   807  C C   . ASN A 1 104 ? -6.962  -3.797 -16.086 1.00 48.41 ? 103 ASN A C   1 
ATOM   808  O O   . ASN A 1 104 ? -7.231  -4.747 -16.810 1.00 48.65 ? 103 ASN A O   1 
ATOM   809  C CB  . ASN A 1 104 ? -6.137  -4.220 -13.774 1.00 52.80 ? 103 ASN A CB  1 
ATOM   810  C CG  . ASN A 1 104 ? -6.414  -5.711 -13.646 1.00 55.75 ? 103 ASN A CG  1 
ATOM   811  O OD1 . ASN A 1 104 ? -5.634  -6.541 -14.113 1.00 57.29 ? 103 ASN A OD1 1 
ATOM   812  N ND2 . ASN A 1 104 ? -7.570  -6.050 -13.090 1.00 52.41 ? 103 ASN A ND2 1 
ATOM   813  N N   . GLU A 1 105 ? -7.711  -2.699 -16.020 1.00 45.54 ? 104 GLU A N   1 
ATOM   814  C CA  . GLU A 1 105 ? -8.882  -2.522 -16.872 1.00 46.04 ? 104 GLU A CA  1 
ATOM   815  C C   . GLU A 1 105 ? -8.447  -2.517 -18.330 1.00 49.31 ? 104 GLU A C   1 
ATOM   816  O O   . GLU A 1 105 ? -9.050  -3.172 -19.184 1.00 48.24 ? 104 GLU A O   1 
ATOM   817  C CB  . GLU A 1 105 ? -9.607  -1.226 -16.526 1.00 38.92 ? 104 GLU A CB  1 
ATOM   818  C CG  . GLU A 1 105 ? -10.147 -1.223 -15.120 1.00 45.03 ? 104 GLU A CG  1 
ATOM   819  C CD  . GLU A 1 105 ? -11.254 -2.252 -14.913 1.00 49.98 ? 104 GLU A CD  1 
ATOM   820  O OE1 . GLU A 1 105 ? -12.270 -2.208 -15.648 1.00 45.85 ? 104 GLU A OE1 1 
ATOM   821  O OE2 . GLU A 1 105 ? -11.067 -3.141 -14.055 1.00 48.57 ? 104 GLU A OE2 1 
ATOM   822  N N   . ASP A 1 106 ? -7.372  -1.781 -18.590 1.00 48.37 ? 105 ASP A N   1 
ATOM   823  C CA  . ASP A 1 106 ? -6.836  -1.623 -19.929 1.00 46.58 ? 105 ASP A CA  1 
ATOM   824  C C   . ASP A 1 106 ? -6.456  -2.977 -20.521 1.00 48.67 ? 105 ASP A C   1 
ATOM   825  O O   . ASP A 1 106 ? -6.834  -3.295 -21.644 1.00 50.32 ? 105 ASP A O   1 
ATOM   826  C CB  . ASP A 1 106 ? -5.627  -0.679 -19.898 1.00 46.71 ? 105 ASP A CB  1 
ATOM   827  C CG  . ASP A 1 106 ? -5.040  -0.418 -21.284 1.00 46.09 ? 105 ASP A CG  1 
ATOM   828  O OD1 . ASP A 1 106 ? -5.766  0.080  -22.172 1.00 44.44 ? 105 ASP A OD1 1 
ATOM   829  O OD2 . ASP A 1 106 ? -3.840  -0.677 -21.468 1.00 47.83 ? 105 ASP A OD2 1 
ATOM   830  N N   . ARG A 1 107 ? -5.719  -3.777 -19.757 1.00 49.22 ? 106 ARG A N   1 
ATOM   831  C CA  . ARG A 1 107 ? -5.316  -5.094 -20.229 1.00 54.78 ? 106 ARG A CA  1 
ATOM   832  C C   . ARG A 1 107 ? -6.508  -6.030 -20.467 1.00 57.56 ? 106 ARG A C   1 
ATOM   833  O O   . ARG A 1 107 ? -6.401  -6.965 -21.261 1.00 56.63 ? 106 ARG A O   1 
ATOM   834  C CB  . ARG A 1 107 ? -4.324  -5.737 -19.250 1.00 53.86 ? 106 ARG A CB  1 
ATOM   835  C CG  . ARG A 1 107 ? -2.922  -5.133 -19.324 1.00 50.71 ? 106 ARG A CG  1 
ATOM   836  C CD  . ARG A 1 107 ? -1.937  -5.834 -18.393 1.00 55.47 ? 106 ARG A CD  1 
ATOM   837  N NE  . ARG A 1 107 ? -2.204  -5.591 -16.972 1.00 61.21 ? 106 ARG A NE  1 
ATOM   838  C CZ  . ARG A 1 107 ? -2.813  -6.453 -16.157 1.00 62.60 ? 106 ARG A CZ  1 
ATOM   839  N NH1 . ARG A 1 107 ? -3.240  -7.622 -16.619 1.00 66.15 ? 106 ARG A NH1 1 
ATOM   840  N NH2 . ARG A 1 107 ? -3.008  -6.145 -14.878 1.00 56.47 ? 106 ARG A NH2 1 
ATOM   841  N N   . ALA A 1 108 ? -7.638  -5.773 -19.806 1.00 51.56 ? 107 ALA A N   1 
ATOM   842  C CA  . ALA A 1 108 ? -8.821  -6.622 -19.972 1.00 52.58 ? 107 ALA A CA  1 
ATOM   843  C C   . ALA A 1 108 ? -9.722  -6.134 -21.105 1.00 57.02 ? 107 ALA A C   1 
ATOM   844  O O   . ALA A 1 108 ? -10.711 -6.785 -21.444 1.00 59.44 ? 107 ALA A O   1 
ATOM   845  C CB  . ALA A 1 108 ? -9.610  -6.692 -18.679 1.00 50.04 ? 107 ALA A CB  1 
ATOM   846  N N   . GLY A 1 109 ? -9.385  -4.986 -21.688 1.00 55.02 ? 108 GLY A N   1 
ATOM   847  C CA  . GLY A 1 109 ? -10.185 -4.416 -22.761 1.00 49.62 ? 108 GLY A CA  1 
ATOM   848  C C   . GLY A 1 109 ? -11.436 -3.718 -22.253 1.00 49.63 ? 108 GLY A C   1 
ATOM   849  O O   . GLY A 1 109 ? -12.343 -3.389 -23.019 1.00 45.20 ? 108 GLY A O   1 
ATOM   850  N N   . ARG A 1 110 ? -11.484 -3.486 -20.948 1.00 48.06 ? 109 ARG A N   1 
ATOM   851  C CA  . ARG A 1 110 ? -12.583 -2.741 -20.357 1.00 48.10 ? 109 ARG A CA  1 
ATOM   852  C C   . ARG A 1 110 ? -12.270 -1.248 -20.388 1.00 51.43 ? 109 ARG A C   1 
ATOM   853  O O   . ARG A 1 110 ? -11.414 -0.756 -19.633 1.00 48.75 ? 109 ARG A O   1 
ATOM   854  C CB  . ARG A 1 110 ? -12.840 -3.215 -18.923 1.00 50.16 ? 109 ARG A CB  1 
ATOM   855  C CG  . ARG A 1 110 ? -13.394 -4.641 -18.831 1.00 49.46 ? 109 ARG A CG  1 
ATOM   856  C CD  . ARG A 1 110 ? -13.923 -4.957 -17.426 1.00 48.48 ? 109 ARG A CD  1 
ATOM   857  N NE  . ARG A 1 110 ? -12.873 -4.980 -16.404 1.00 46.15 ? 109 ARG A NE  1 
ATOM   858  C CZ  . ARG A 1 110 ? -12.148 -6.058 -16.118 1.00 51.98 ? 109 ARG A CZ  1 
ATOM   859  N NH1 . ARG A 1 110 ? -12.361 -7.195 -16.773 1.00 51.15 ? 109 ARG A NH1 1 
ATOM   860  N NH2 . ARG A 1 110 ? -11.212 -6.006 -15.181 1.00 50.70 ? 109 ARG A NH2 1 
ATOM   861  N N   . PHE A 1 111 ? -12.962 -0.524 -21.265 1.00 48.74 ? 110 PHE A N   1 
ATOM   862  C CA  . PHE A 1 111 ? -12.703 0.899  -21.441 1.00 45.84 ? 110 PHE A CA  1 
ATOM   863  C C   . PHE A 1 111 ? -13.899 1.737  -21.003 1.00 45.93 ? 110 PHE A C   1 
ATOM   864  O O   . PHE A 1 111 ? -15.001 1.582  -21.529 1.00 48.14 ? 110 PHE A O   1 
ATOM   865  C CB  . PHE A 1 111 ? -12.346 1.195  -22.901 1.00 43.95 ? 110 PHE A CB  1 
ATOM   866  C CG  . PHE A 1 111 ? -11.164 0.408  -23.399 1.00 45.89 ? 110 PHE A CG  1 
ATOM   867  C CD1 . PHE A 1 111 ? -9.878  0.723  -22.980 1.00 43.53 ? 110 PHE A CD1 1 
ATOM   868  C CD2 . PHE A 1 111 ? -11.337 -0.633 -24.307 1.00 45.35 ? 110 PHE A CD2 1 
ATOM   869  C CE1 . PHE A 1 111 ? -8.789  0.003  -23.433 1.00 45.49 ? 110 PHE A CE1 1 
ATOM   870  C CE2 . PHE A 1 111 ? -10.251 -1.356 -24.772 1.00 46.65 ? 110 PHE A CE2 1 
ATOM   871  C CZ  . PHE A 1 111 ? -8.974  -1.039 -24.340 1.00 48.86 ? 110 PHE A CZ  1 
ATOM   872  N N   . HIS A 1 112 ? -13.671 2.637  -20.049 1.00 42.97 ? 111 HIS A N   1 
ATOM   873  C CA  . HIS A 1 112 ? -14.759 3.377  -19.415 1.00 44.98 ? 111 HIS A CA  1 
ATOM   874  C C   . HIS A 1 112 ? -14.269 4.579  -18.588 1.00 46.15 ? 111 HIS A C   1 
ATOM   875  O O   . HIS A 1 112 ? -13.071 4.745  -18.350 1.00 44.50 ? 111 HIS A O   1 
ATOM   876  C CB  . HIS A 1 112 ? -15.583 2.421  -18.543 1.00 42.64 ? 111 HIS A CB  1 
ATOM   877  C CG  . HIS A 1 112 ? -14.750 1.584  -17.618 1.00 47.08 ? 111 HIS A CG  1 
ATOM   878  N ND1 . HIS A 1 112 ? -14.216 2.072  -16.443 1.00 42.20 ? 111 HIS A ND1 1 
ATOM   879  C CD2 . HIS A 1 112 ? -14.347 0.296  -17.709 1.00 42.60 ? 111 HIS A CD2 1 
ATOM   880  C CE1 . HIS A 1 112 ? -13.518 1.118  -15.853 1.00 40.77 ? 111 HIS A CE1 1 
ATOM   881  N NE2 . HIS A 1 112 ? -13.582 0.029  -16.596 1.00 46.15 ? 111 HIS A NE2 1 
ATOM   882  N N   . LYS A 1 113 ? -15.209 5.409  -18.155 1.00 44.44 ? 112 LYS A N   1 
ATOM   883  C CA  . LYS A 1 113 ? -14.879 6.659  -17.489 1.00 49.45 ? 112 LYS A CA  1 
ATOM   884  C C   . LYS A 1 113 ? -14.002 6.470  -16.257 1.00 47.28 ? 112 LYS A C   1 
ATOM   885  O O   . LYS A 1 113 ? -13.104 7.281  -16.020 1.00 45.87 ? 112 LYS A O   1 
ATOM   886  C CB  . LYS A 1 113 ? -16.153 7.419  -17.107 1.00 44.20 ? 112 LYS A CB  1 
ATOM   887  C CG  . LYS A 1 113 ? -16.878 8.004  -18.317 1.00 50.62 ? 112 LYS A CG  1 
ATOM   888  C CD  . LYS A 1 113 ? -17.805 9.158  -17.921 1.00 61.22 ? 112 LYS A CD  1 
ATOM   889  N N   . ASN A 1 114 ? -14.240 5.410  -15.486 1.00 44.61 ? 113 ASN A N   1 
ATOM   890  C CA  . ASN A 1 114 ? -13.469 5.207  -14.262 1.00 44.49 ? 113 ASN A CA  1 
ATOM   891  C C   . ASN A 1 114 ? -12.012 4.918  -14.525 1.00 42.58 ? 113 ASN A C   1 
ATOM   892  O O   . ASN A 1 114 ? -11.139 5.412  -13.806 1.00 42.92 ? 113 ASN A O   1 
ATOM   893  C CB  . ASN A 1 114 ? -14.039 4.072  -13.405 1.00 46.74 ? 113 ASN A CB  1 
ATOM   894  C CG  . ASN A 1 114 ? -15.254 4.492  -12.630 1.00 52.43 ? 113 ASN A CG  1 
ATOM   895  O OD1 . ASN A 1 114 ? -15.495 5.687  -12.438 1.00 56.80 ? 113 ASN A OD1 1 
ATOM   896  N ND2 . ASN A 1 114 ? -16.014 3.519  -12.141 1.00 54.81 ? 113 ASN A ND2 1 
ATOM   897  N N   . MET A 1 115 ? -11.743 4.108  -15.541 1.00 39.93 ? 114 MET A N   1 
ATOM   898  C CA  . MET A 1 115 ? -10.372 3.723  -15.826 1.00 37.26 ? 114 MET A CA  1 
ATOM   899  C C   . MET A 1 115 ? -9.651  4.932  -16.470 1.00 36.23 ? 114 MET A C   1 
ATOM   900  O O   . MET A 1 115 ? -8.430  5.054  -16.393 1.00 38.10 ? 114 MET A O   1 
ATOM   901  C CB  . MET A 1 115 ? -10.307 2.554  -16.789 1.00 40.55 ? 114 MET A CB  1 
ATOM   902  C CG  . MET A 1 115 ? -10.386 3.189  -18.148 1.00 48.93 ? 114 MET A CG  1 
ATOM   903  S SD  . MET A 1 115 ? -9.831  2.372  -19.532 1.00 46.50 ? 114 MET A SD  1 
ATOM   904  C CE  . MET A 1 115 ? -8.219  1.810  -19.051 1.00 39.28 ? 114 MET A CE  1 
ATOM   905  N N   . ILE A 1 116 ? -10.409 5.792  -17.147 1.00 37.57 ? 115 ILE A N   1 
ATOM   906  C CA  . ILE A 1 116 ? -9.834  6.939  -17.836 1.00 42.49 ? 115 ILE A CA  1 
ATOM   907  C C   . ILE A 1 116 ? -9.430  7.957  -16.798 1.00 39.01 ? 115 ILE A C   1 
ATOM   908  O O   . ILE A 1 116 ? -8.318  8.485  -16.826 1.00 35.30 ? 115 ILE A O   1 
ATOM   909  C CB  . ILE A 1 116 ? -10.815 7.591  -18.833 1.00 39.61 ? 115 ILE A CB  1 
ATOM   910  C CG1 . ILE A 1 116 ? -11.019 6.692  -20.061 1.00 44.43 ? 115 ILE A CG1 1 
ATOM   911  C CG2 . ILE A 1 116 ? -10.343 9.019  -19.217 1.00 36.09 ? 115 ILE A CG2 1 
ATOM   912  C CD1 . ILE A 1 116 ? -12.189 7.147  -20.981 1.00 42.26 ? 115 ILE A CD1 1 
ATOM   913  N N   . LYS A 1 117 ? -10.346 8.201  -15.870 1.00 36.83 ? 116 LYS A N   1 
ATOM   914  C CA  . LYS A 1 117 ? -10.128 9.160  -14.809 1.00 40.15 ? 116 LYS A CA  1 
ATOM   915  C C   . LYS A 1 117 ? -9.016  8.696  -13.862 1.00 37.58 ? 116 LYS A C   1 
ATOM   916  O O   . LYS A 1 117 ? -8.238  9.515  -13.377 1.00 36.40 ? 116 LYS A O   1 
ATOM   917  C CB  . LYS A 1 117 ? -11.424 9.396  -14.028 1.00 42.04 ? 116 LYS A CB  1 
ATOM   918  C CG  . LYS A 1 117 ? -11.288 10.478 -12.983 1.00 42.20 ? 116 LYS A CG  1 
ATOM   919  C CD  . LYS A 1 117 ? -12.589 10.767 -12.261 1.00 46.71 ? 116 LYS A CD  1 
ATOM   920  C CE  . LYS A 1 117 ? -12.388 11.878 -11.230 1.00 42.26 ? 116 LYS A CE  1 
ATOM   921  N NZ  . LYS A 1 117 ? -13.636 12.181 -10.480 1.00 56.42 ? 116 LYS A NZ  1 
ATOM   922  N N   . SER A 1 118 ? -8.944  7.392  -13.604 1.00 34.19 ? 117 SER A N   1 
ATOM   923  C CA  . SER A 1 118 ? -7.888  6.831  -12.757 1.00 36.78 ? 117 SER A CA  1 
ATOM   924  C C   . SER A 1 118 ? -6.504  6.976  -13.393 1.00 37.44 ? 117 SER A C   1 
ATOM   925  O O   . SER A 1 118 ? -5.541  7.339  -12.699 1.00 33.90 ? 117 SER A O   1 
ATOM   926  C CB  . SER A 1 118 ? -8.153  5.354  -12.441 1.00 38.24 ? 117 SER A CB  1 
ATOM   927  O OG  . SER A 1 118 ? -9.322  5.187  -11.654 1.00 43.72 ? 117 SER A OG  1 
ATOM   928  N N   . PHE A 1 119 ? -6.389  6.675  -14.695 1.00 35.72 ? 118 PHE A N   1 
ATOM   929  C CA  . PHE A 1 119 ? -5.175  7.041  -15.424 1.00 35.57 ? 118 PHE A CA  1 
ATOM   930  C C   . PHE A 1 119 ? -4.825  8.520  -15.292 1.00 33.67 ? 118 PHE A C   1 
ATOM   931  O O   . PHE A 1 119 ? -3.694  8.854  -14.964 1.00 32.94 ? 118 PHE A O   1 
ATOM   932  C CB  . PHE A 1 119 ? -5.244  6.711  -16.916 1.00 37.47 ? 118 PHE A CB  1 
ATOM   933  C CG  . PHE A 1 119 ? -4.900  5.286  -17.249 1.00 36.33 ? 118 PHE A CG  1 
ATOM   934  C CD1 . PHE A 1 119 ? -3.668  4.780  -16.887 1.00 31.74 ? 118 PHE A CD1 1 
ATOM   935  C CD2 . PHE A 1 119 ? -5.720  4.518  -18.068 1.00 36.61 ? 118 PHE A CD2 1 
ATOM   936  C CE1 . PHE A 1 119 ? -3.305  3.492  -17.219 1.00 38.73 ? 118 PHE A CE1 1 
ATOM   937  C CE2 . PHE A 1 119 ? -5.350  3.232  -18.420 1.00 38.35 ? 118 PHE A CE2 1 
ATOM   938  C CZ  . PHE A 1 119 ? -4.142  2.719  -17.997 1.00 38.59 ? 118 PHE A CZ  1 
ATOM   939  N N   . TYR A 1 120 ? -5.779  9.405  -15.541 1.00 32.54 ? 119 TYR A N   1 
ATOM   940  C CA  . TYR A 1 120 ? -5.436  10.823 -15.586 1.00 32.90 ? 119 TYR A CA  1 
ATOM   941  C C   . TYR A 1 120 ? -5.124  11.367 -14.182 1.00 31.64 ? 119 TYR A C   1 
ATOM   942  O O   . TYR A 1 120 ? -4.189  12.134 -13.997 1.00 31.07 ? 119 TYR A O   1 
ATOM   943  C CB  . TYR A 1 120 ? -6.557  11.617 -16.261 1.00 32.39 ? 119 TYR A CB  1 
ATOM   944  C CG  . TYR A 1 120 ? -6.212  13.073 -16.466 1.00 35.42 ? 119 TYR A CG  1 
ATOM   945  C CD1 . TYR A 1 120 ? -5.202  13.449 -17.355 1.00 40.32 ? 119 TYR A CD1 1 
ATOM   946  C CD2 . TYR A 1 120 ? -6.930  14.077 -15.837 1.00 31.13 ? 119 TYR A CD2 1 
ATOM   947  C CE1 . TYR A 1 120 ? -4.878  14.797 -17.552 1.00 37.26 ? 119 TYR A CE1 1 
ATOM   948  C CE2 . TYR A 1 120 ? -6.618  15.413 -16.033 1.00 35.52 ? 119 TYR A CE2 1 
ATOM   949  C CZ  . TYR A 1 120 ? -5.589  15.767 -16.882 1.00 37.39 ? 119 TYR A CZ  1 
ATOM   950  O OH  . TYR A 1 120 ? -5.309  17.106 -17.074 1.00 48.90 ? 119 TYR A OH  1 
ATOM   951  N N   . THR A 1 121 ? -5.876  10.929 -13.183 1.00 31.54 ? 120 THR A N   1 
ATOM   952  C CA  . THR A 1 121 ? -5.611  11.334 -11.810 1.00 33.27 ? 120 THR A CA  1 
ATOM   953  C C   . THR A 1 121 ? -4.248  10.835 -11.326 1.00 29.04 ? 120 THR A C   1 
ATOM   954  O O   . THR A 1 121 ? -3.532  11.543 -10.623 1.00 29.75 ? 120 THR A O   1 
ATOM   955  C CB  . THR A 1 121 ? -6.701  10.820 -10.854 1.00 31.52 ? 120 THR A CB  1 
ATOM   956  O OG1 . THR A 1 121 ? -7.959  11.354 -11.269 1.00 33.65 ? 120 THR A OG1 1 
ATOM   957  C CG2 . THR A 1 121 ? -6.409  11.291 -9.423  1.00 30.91 ? 120 THR A CG2 1 
ATOM   958  N N   . ALA A 1 122 ? -3.898  9.614  -11.694 1.00 29.75 ? 121 ALA A N   1 
ATOM   959  C CA  . ALA A 1 122 ? -2.587  9.099  -11.356 1.00 34.77 ? 121 ALA A CA  1 
ATOM   960  C C   . ALA A 1 122 ? -1.511  10.038 -11.899 1.00 31.73 ? 121 ALA A C   1 
ATOM   961  O O   . ALA A 1 122 ? -0.533  10.309 -11.205 1.00 32.13 ? 121 ALA A O   1 
ATOM   962  C CB  . ALA A 1 122 ? -2.399  7.675  -11.894 1.00 30.72 ? 121 ALA A CB  1 
ATOM   963  N N   . SER A 1 123 ? -1.690  10.545 -13.125 1.00 31.55 ? 122 SER A N   1 
ATOM   964  C CA  . SER A 1 123 ? -0.690  11.450 -13.711 1.00 32.56 ? 122 SER A CA  1 
ATOM   965  C C   . SER A 1 123 ? -0.714  12.798 -13.009 1.00 30.05 ? 122 SER A C   1 
ATOM   966  O O   . SER A 1 123 ? 0.322   13.436 -12.849 1.00 29.48 ? 122 SER A O   1 
ATOM   967  C CB  . SER A 1 123 ? -0.919  11.669 -15.221 1.00 32.85 ? 122 SER A CB  1 
ATOM   968  O OG  . SER A 1 123 ? -2.030  12.525 -15.460 1.00 30.52 ? 122 SER A OG  1 
ATOM   969  N N   . LEU A 1 124 ? -1.903  13.248 -12.610 1.00 29.62 ? 123 LEU A N   1 
ATOM   970  C CA  . LEU A 1 124 ? -2.019  14.485 -11.843 1.00 30.64 ? 123 LEU A CA  1 
ATOM   971  C C   . LEU A 1 124 ? -1.309  14.383 -10.478 1.00 30.26 ? 123 LEU A C   1 
ATOM   972  O O   . LEU A 1 124 ? -0.666  15.339 -10.028 1.00 27.90 ? 123 LEU A O   1 
ATOM   973  C CB  . LEU A 1 124 ? -3.495  14.850 -11.639 1.00 33.11 ? 123 LEU A CB  1 
ATOM   974  C CG  . LEU A 1 124 ? -4.285  15.161 -12.924 1.00 34.36 ? 123 LEU A CG  1 
ATOM   975  C CD1 . LEU A 1 124 ? -5.775  15.359 -12.619 1.00 33.06 ? 123 LEU A CD1 1 
ATOM   976  C CD2 . LEU A 1 124 ? -3.708  16.381 -13.621 1.00 33.03 ? 123 LEU A CD2 1 
ATOM   977  N N   . LEU A 1 125 ? -1.441  13.230 -9.829  1.00 27.59 ? 124 LEU A N   1 
ATOM   978  C CA  . LEU A 1 125 ? -0.747  12.964 -8.566  1.00 32.92 ? 124 LEU A CA  1 
ATOM   979  C C   . LEU A 1 125 ? 0.772   12.932 -8.704  1.00 30.96 ? 124 LEU A C   1 
ATOM   980  O O   . LEU A 1 125 ? 1.478   13.388 -7.811  1.00 30.86 ? 124 LEU A O   1 
ATOM   981  C CB  . LEU A 1 125 ? -1.221  11.644 -7.958  1.00 27.11 ? 124 LEU A CB  1 
ATOM   982  C CG  . LEU A 1 125 ? -2.664  11.708 -7.448  1.00 34.35 ? 124 LEU A CG  1 
ATOM   983  C CD1 . LEU A 1 125 ? -3.114  10.336 -6.953  1.00 38.47 ? 124 LEU A CD1 1 
ATOM   984  C CD2 . LEU A 1 125 ? -2.825  12.796 -6.365  1.00 27.36 ? 124 LEU A CD2 1 
ATOM   985  N N   . ILE A 1 126 ? 1.276   12.403 -9.817  1.00 27.39 ? 125 ILE A N   1 
ATOM   986  C CA  . ILE A 1 126 ? 2.718   12.454 -10.065 1.00 26.91 ? 125 ILE A CA  1 
ATOM   987  C C   . ILE A 1 126 ? 3.218   13.892 -10.243 1.00 30.43 ? 125 ILE A C   1 
ATOM   988  O O   . ILE A 1 126 ? 4.271   14.235 -9.724  1.00 34.55 ? 125 ILE A O   1 
ATOM   989  C CB  . ILE A 1 126 ? 3.088   11.608 -11.280 1.00 32.18 ? 125 ILE A CB  1 
ATOM   990  C CG1 . ILE A 1 126 ? 2.800   10.137 -10.958 1.00 26.88 ? 125 ILE A CG1 1 
ATOM   991  C CG2 . ILE A 1 126 ? 4.558   11.848 -11.674 1.00 31.54 ? 125 ILE A CG2 1 
ATOM   992  C CD1 . ILE A 1 126 ? 2.804   9.187  -12.186 1.00 26.31 ? 125 ILE A CD1 1 
ATOM   993  N N   . ASP A 1 127 ? 2.456   14.739 -10.943 1.00 29.84 ? 126 ASP A N   1 
ATOM   994  C CA  . ASP A 1 127 ? 2.735   16.182 -10.974 1.00 29.67 ? 126 ASP A CA  1 
ATOM   995  C C   . ASP A 1 127 ? 2.898   16.734 -9.551  1.00 30.58 ? 126 ASP A C   1 
ATOM   996  O O   . ASP A 1 127 ? 3.869   17.428 -9.243  1.00 27.88 ? 126 ASP A O   1 
ATOM   997  C CB  . ASP A 1 127 ? 1.610   16.960 -11.663 1.00 27.41 ? 126 ASP A CB  1 
ATOM   998  C CG  . ASP A 1 127 ? 1.539   16.711 -13.173 1.00 33.57 ? 126 ASP A CG  1 
ATOM   999  O OD1 . ASP A 1 127 ? 2.545   16.296 -13.783 1.00 33.43 ? 126 ASP A OD1 1 
ATOM   1000 O OD2 . ASP A 1 127 ? 0.448   16.920 -13.744 1.00 32.20 ? 126 ASP A OD2 1 
ATOM   1001 N N   . VAL A 1 128 ? 1.915   16.434 -8.708  1.00 30.22 ? 127 VAL A N   1 
ATOM   1002 C CA  . VAL A 1 128 ? 1.857   16.943 -7.337  1.00 30.01 ? 127 VAL A CA  1 
ATOM   1003 C C   . VAL A 1 128 ? 3.092   16.510 -6.529  1.00 28.98 ? 127 VAL A C   1 
ATOM   1004 O O   . VAL A 1 128 ? 3.604   17.258 -5.707  1.00 32.65 ? 127 VAL A O   1 
ATOM   1005 C CB  . VAL A 1 128 ? 0.563   16.462 -6.646  1.00 32.65 ? 127 VAL A CB  1 
ATOM   1006 C CG1 . VAL A 1 128 ? 0.549   16.842 -5.153  1.00 25.78 ? 127 VAL A CG1 1 
ATOM   1007 C CG2 . VAL A 1 128 ? -0.652  17.047 -7.363  1.00 26.92 ? 127 VAL A CG2 1 
ATOM   1008 N N   . ILE A 1 129 ? 3.585   15.315 -6.828  1.00 27.81 ? 128 ILE A N   1 
ATOM   1009 C CA  . ILE A 1 129 ? 4.735   14.735 -6.149  1.00 31.80 ? 128 ILE A CA  1 
ATOM   1010 C C   . ILE A 1 129 ? 6.047   15.517 -6.371  1.00 35.90 ? 128 ILE A C   1 
ATOM   1011 O O   . ILE A 1 129 ? 7.006   15.371 -5.593  1.00 32.33 ? 128 ILE A O   1 
ATOM   1012 C CB  . ILE A 1 129 ? 4.844   13.242 -6.558  1.00 30.85 ? 128 ILE A CB  1 
ATOM   1013 C CG1 . ILE A 1 129 ? 3.822   12.434 -5.728  1.00 29.37 ? 128 ILE A CG1 1 
ATOM   1014 C CG2 . ILE A 1 129 ? 6.253   12.695 -6.441  1.00 36.34 ? 128 ILE A CG2 1 
ATOM   1015 C CD1 . ILE A 1 129 ? 3.616   10.964 -6.177  1.00 30.47 ? 128 ILE A CD1 1 
ATOM   1016 N N   . THR A 1 130 ? 6.066   16.411 -7.362  1.00 26.24 ? 129 THR A N   1 
ATOM   1017 C CA  . THR A 1 130 ? 7.193   17.317 -7.501  1.00 31.67 ? 129 THR A CA  1 
ATOM   1018 C C   . THR A 1 130 ? 7.365   18.249 -6.284  1.00 34.18 ? 129 THR A C   1 
ATOM   1019 O O   . THR A 1 130 ? 8.442   18.801 -6.097  1.00 36.17 ? 129 THR A O   1 
ATOM   1020 C CB  . THR A 1 130 ? 7.082   18.208 -8.787  1.00 34.42 ? 129 THR A CB  1 
ATOM   1021 O OG1 . THR A 1 130 ? 5.901   19.012 -8.723  1.00 34.98 ? 129 THR A OG1 1 
ATOM   1022 C CG2 . THR A 1 130 ? 7.011   17.353 -10.031 1.00 29.78 ? 129 THR A CG2 1 
ATOM   1023 N N   . VAL A 1 131 ? 6.338   18.434 -5.447  1.00 33.21 ? 130 VAL A N   1 
ATOM   1024 C CA  . VAL A 1 131 ? 6.533   19.299 -4.280  1.00 36.75 ? 130 VAL A CA  1 
ATOM   1025 C C   . VAL A 1 131 ? 7.464   18.633 -3.272  1.00 33.38 ? 130 VAL A C   1 
ATOM   1026 O O   . VAL A 1 131 ? 7.950   19.288 -2.352  1.00 35.83 ? 130 VAL A O   1 
ATOM   1027 C CB  . VAL A 1 131 ? 5.208   19.671 -3.544  1.00 41.08 ? 130 VAL A CB  1 
ATOM   1028 C CG1 . VAL A 1 131 ? 4.244   20.406 -4.490  1.00 36.75 ? 130 VAL A CG1 1 
ATOM   1029 C CG2 . VAL A 1 131 ? 4.567   18.443 -2.886  1.00 27.47 ? 130 VAL A CG2 1 
ATOM   1030 N N   . PHE A 1 132 ? 7.709   17.337 -3.439  1.00 33.08 ? 131 PHE A N   1 
ATOM   1031 C CA  . PHE A 1 132 ? 8.595   16.628 -2.516  1.00 33.22 ? 131 PHE A CA  1 
ATOM   1032 C C   . PHE A 1 132 ? 10.016  16.558 -3.056  1.00 36.07 ? 131 PHE A C   1 
ATOM   1033 O O   . PHE A 1 132 ? 10.944  16.235 -2.329  1.00 33.21 ? 131 PHE A O   1 
ATOM   1034 C CB  . PHE A 1 132 ? 8.079   15.230 -2.230  1.00 27.42 ? 131 PHE A CB  1 
ATOM   1035 C CG  . PHE A 1 132 ? 6.679   15.218 -1.684  1.00 36.34 ? 131 PHE A CG  1 
ATOM   1036 C CD1 . PHE A 1 132 ? 6.415   15.699 -0.404  1.00 33.75 ? 131 PHE A CD1 1 
ATOM   1037 C CD2 . PHE A 1 132 ? 5.630   14.690 -2.433  1.00 33.13 ? 131 PHE A CD2 1 
ATOM   1038 C CE1 . PHE A 1 132 ? 5.125   15.695 0.113   1.00 35.12 ? 131 PHE A CE1 1 
ATOM   1039 C CE2 . PHE A 1 132 ? 4.332   14.669 -1.922  1.00 33.19 ? 131 PHE A CE2 1 
ATOM   1040 C CZ  . PHE A 1 132 ? 4.076   15.180 -0.648  1.00 33.71 ? 131 PHE A CZ  1 
ATOM   1041 N N   . GLY A 1 133 ? 10.178  16.893 -4.330  1.00 35.31 ? 132 GLY A N   1 
ATOM   1042 C CA  . GLY A 1 133 ? 11.484  16.901 -4.957  1.00 36.93 ? 132 GLY A CA  1 
ATOM   1043 C C   . GLY A 1 133 ? 11.348  16.533 -6.418  1.00 40.69 ? 132 GLY A C   1 
ATOM   1044 O O   . GLY A 1 133 ? 10.237  16.408 -6.943  1.00 41.03 ? 132 GLY A O   1 
ATOM   1045 N N   . GLU A 1 134 ? 12.475  16.340 -7.080  1.00 38.74 ? 133 GLU A N   1 
ATOM   1046 C CA  . GLU A 1 134 ? 12.457  16.009 -8.494  1.00 39.57 ? 133 GLU A CA  1 
ATOM   1047 C C   . GLU A 1 134 ? 11.833  14.647 -8.772  1.00 40.16 ? 133 GLU A C   1 
ATOM   1048 O O   . GLU A 1 134 ? 11.938  13.713 -7.963  1.00 36.46 ? 133 GLU A O   1 
ATOM   1049 C CB  . GLU A 1 134 ? 13.877  16.085 -9.052  1.00 42.72 ? 133 GLU A CB  1 
ATOM   1050 C CG  . GLU A 1 134 ? 14.364  17.534 -9.106  1.00 52.97 ? 133 GLU A CG  1 
ATOM   1051 C CD  . GLU A 1 134 ? 15.784  17.685 -9.604  1.00 62.75 ? 133 GLU A CD  1 
ATOM   1052 O OE1 . GLU A 1 134 ? 16.515  16.673 -9.673  1.00 61.66 ? 133 GLU A OE1 1 
ATOM   1053 O OE2 . GLU A 1 134 ? 16.161  18.827 -9.944  1.00 74.34 ? 133 GLU A OE2 1 
ATOM   1054 N N   . LEU A 1 135 ? 11.161  14.540 -9.918  1.00 36.73 ? 134 LEU A N   1 
ATOM   1055 C CA  . LEU A 1 135 ? 10.579  13.267 -10.315 1.00 35.44 ? 134 LEU A CA  1 
ATOM   1056 C C   . LEU A 1 135 ? 11.666  12.253 -10.632 1.00 36.17 ? 134 LEU A C   1 
ATOM   1057 O O   . LEU A 1 135 ? 12.760  12.616 -11.062 1.00 40.54 ? 134 LEU A O   1 
ATOM   1058 C CB  . LEU A 1 135 ? 9.649   13.432 -11.528 1.00 33.53 ? 134 LEU A CB  1 
ATOM   1059 C CG  . LEU A 1 135 ? 8.413   14.279 -11.232 1.00 34.68 ? 134 LEU A CG  1 
ATOM   1060 C CD1 . LEU A 1 135 ? 7.482   14.300 -12.433 1.00 34.60 ? 134 LEU A CD1 1 
ATOM   1061 C CD2 . LEU A 1 135 ? 7.702   13.780 -9.960  1.00 32.44 ? 134 LEU A CD2 1 
ATOM   1062 N N   . THR A 1 136 ? 11.369  10.984 -10.395 1.00 33.08 ? 135 THR A N   1 
ATOM   1063 C CA  . THR A 1 136 ? 12.274  9.913  -10.784 1.00 35.09 ? 135 THR A CA  1 
ATOM   1064 C C   . THR A 1 136 ? 11.996  9.585  -12.260 1.00 38.02 ? 135 THR A C   1 
ATOM   1065 O O   . THR A 1 136 ? 10.991  10.029 -12.834 1.00 33.22 ? 135 THR A O   1 
ATOM   1066 C CB  . THR A 1 136 ? 12.080  8.654  -9.922  1.00 36.57 ? 135 THR A CB  1 
ATOM   1067 O OG1 . THR A 1 136 ? 10.784  8.092  -10.176 1.00 34.36 ? 135 THR A OG1 1 
ATOM   1068 C CG2 . THR A 1 136 ? 12.177  9.013  -8.413  1.00 37.53 ? 135 THR A CG2 1 
ATOM   1069 N N   . ASP A 1 137 ? 12.868  8.802  -12.872 1.00 39.52 ? 136 ASP A N   1 
ATOM   1070 C CA  . ASP A 1 137 ? 12.638  8.406  -14.251 1.00 42.36 ? 136 ASP A CA  1 
ATOM   1071 C C   . ASP A 1 137 ? 11.352  7.577  -14.355 1.00 39.49 ? 136 ASP A C   1 
ATOM   1072 O O   . ASP A 1 137 ? 10.573  7.731  -15.297 1.00 38.20 ? 136 ASP A O   1 
ATOM   1073 C CB  . ASP A 1 137 ? 13.845  7.644  -14.790 1.00 48.44 ? 136 ASP A CB  1 
ATOM   1074 C CG  . ASP A 1 137 ? 13.659  7.226  -16.224 1.00 54.50 ? 136 ASP A CG  1 
ATOM   1075 O OD1 . ASP A 1 137 ? 13.371  8.109  -17.070 1.00 57.74 ? 136 ASP A OD1 1 
ATOM   1076 O OD2 . ASP A 1 137 ? 13.811  6.020  -16.501 1.00 56.05 ? 136 ASP A OD2 1 
ATOM   1077 N N   . GLU A 1 138 ? 11.111  6.738  -13.356 1.00 37.98 ? 137 GLU A N   1 
ATOM   1078 C CA  . GLU A 1 138 ? 9.887   5.951  -13.294 1.00 38.05 ? 137 GLU A CA  1 
ATOM   1079 C C   . GLU A 1 138 ? 8.626   6.814  -13.120 1.00 36.79 ? 137 GLU A C   1 
ATOM   1080 O O   . GLU A 1 138 ? 7.608   6.536  -13.765 1.00 39.80 ? 137 GLU A O   1 
ATOM   1081 C CB  . GLU A 1 138 ? 9.976   4.925  -12.161 1.00 37.35 ? 137 GLU A CB  1 
ATOM   1082 C CG  . GLU A 1 138 ? 10.942  3.790  -12.454 1.00 43.35 ? 137 GLU A CG  1 
ATOM   1083 N N   . ASN A 1 139 ? 8.678   7.830  -12.253 1.00 32.17 ? 138 ASN A N   1 
ATOM   1084 C CA  . ASN A 1 139 ? 7.578   8.795  -12.150 1.00 34.11 ? 138 ASN A CA  1 
ATOM   1085 C C   . ASN A 1 139 ? 7.256   9.342  -13.546 1.00 34.53 ? 138 ASN A C   1 
ATOM   1086 O O   . ASN A 1 139 ? 6.115   9.312  -13.984 1.00 30.86 ? 138 ASN A O   1 
ATOM   1087 C CB  . ASN A 1 139 ? 7.895   10.005 -11.243 1.00 29.92 ? 138 ASN A CB  1 
ATOM   1088 C CG  . ASN A 1 139 ? 8.145   9.649  -9.769  1.00 34.79 ? 138 ASN A CG  1 
ATOM   1089 O OD1 . ASN A 1 139 ? 8.992   10.278 -9.124  1.00 37.06 ? 138 ASN A OD1 1 
ATOM   1090 N ND2 . ASN A 1 139 ? 7.420   8.669  -9.233  1.00 30.82 ? 138 ASN A ND2 1 
ATOM   1091 N N   . VAL A 1 140 ? 8.289   9.849  -14.217 1.00 32.75 ? 139 VAL A N   1 
ATOM   1092 C CA  . VAL A 1 140 ? 8.157   10.479 -15.525 1.00 31.80 ? 139 VAL A CA  1 
ATOM   1093 C C   . VAL A 1 140 ? 7.506   9.545  -16.551 1.00 31.07 ? 139 VAL A C   1 
ATOM   1094 O O   . VAL A 1 140 ? 6.584   9.949  -17.264 1.00 34.08 ? 139 VAL A O   1 
ATOM   1095 C CB  . VAL A 1 140 ? 9.538   10.980 -16.021 1.00 37.11 ? 139 VAL A CB  1 
ATOM   1096 C CG1 . VAL A 1 140 ? 9.505   11.345 -17.503 1.00 34.98 ? 139 VAL A CG1 1 
ATOM   1097 C CG2 . VAL A 1 140 ? 9.974   12.222 -15.197 1.00 31.77 ? 139 VAL A CG2 1 
ATOM   1098 N N   . LYS A 1 141 ? 7.939   8.293  -16.593 1.00 34.92 ? 140 LYS A N   1 
ATOM   1099 C CA  . LYS A 1 141 ? 7.357   7.321  -17.531 1.00 38.67 ? 140 LYS A CA  1 
ATOM   1100 C C   . LYS A 1 141 ? 5.908   6.953  -17.218 1.00 37.36 ? 140 LYS A C   1 
ATOM   1101 O O   . LYS A 1 141 ? 5.090   6.841  -18.136 1.00 33.62 ? 140 LYS A O   1 
ATOM   1102 C CB  . LYS A 1 141 ? 8.186   6.046  -17.566 1.00 38.73 ? 140 LYS A CB  1 
ATOM   1103 C CG  . LYS A 1 141 ? 9.587   6.239  -18.096 1.00 47.18 ? 140 LYS A CG  1 
ATOM   1104 C CD  . LYS A 1 141 ? 10.286  4.889  -18.227 1.00 59.19 ? 140 LYS A CD  1 
ATOM   1105 C CE  . LYS A 1 141 ? 11.764  5.071  -18.511 1.00 61.87 ? 140 LYS A CE  1 
ATOM   1106 N NZ  . LYS A 1 141 ? 12.015  5.892  -19.717 1.00 64.55 ? 140 LYS A NZ  1 
ATOM   1107 N N   . HIS A 1 142 ? 5.594   6.743  -15.936 1.00 30.42 ? 141 HIS A N   1 
ATOM   1108 C CA  . HIS A 1 142 ? 4.211   6.452  -15.544 1.00 33.58 ? 141 HIS A CA  1 
ATOM   1109 C C   . HIS A 1 142 ? 3.292   7.630  -15.810 1.00 30.11 ? 141 HIS A C   1 
ATOM   1110 O O   . HIS A 1 142 ? 2.156   7.450  -16.232 1.00 32.84 ? 141 HIS A O   1 
ATOM   1111 C CB  . HIS A 1 142 ? 4.132   6.046  -14.057 1.00 35.12 ? 141 HIS A CB  1 
ATOM   1112 C CG  . HIS A 1 142 ? 4.674   4.675  -13.781 1.00 43.65 ? 141 HIS A CG  1 
ATOM   1113 N ND1 . HIS A 1 142 ? 6.026   4.398  -13.770 1.00 46.42 ? 141 HIS A ND1 1 
ATOM   1114 C CD2 . HIS A 1 142 ? 4.047   3.510  -13.500 1.00 47.19 ? 141 HIS A CD2 1 
ATOM   1115 C CE1 . HIS A 1 142 ? 6.205   3.117  -13.499 1.00 46.77 ? 141 HIS A CE1 1 
ATOM   1116 N NE2 . HIS A 1 142 ? 5.023   2.555  -13.326 1.00 49.47 ? 141 HIS A NE2 1 
ATOM   1117 N N   . ARG A 1 143 ? 3.772   8.838  -15.551 1.00 28.23 ? 142 ARG A N   1 
ATOM   1118 C CA  . ARG A 1 143 ? 2.991   10.022 -15.854 1.00 31.49 ? 142 ARG A CA  1 
ATOM   1119 C C   . ARG A 1 143 ? 2.659   10.137 -17.362 1.00 27.20 ? 142 ARG A C   1 
ATOM   1120 O O   . ARG A 1 143 ? 1.513   10.334 -17.739 1.00 29.91 ? 142 ARG A O   1 
ATOM   1121 C CB  . ARG A 1 143 ? 3.729   11.277 -15.408 1.00 28.53 ? 142 ARG A CB  1 
ATOM   1122 C CG  . ARG A 1 143 ? 2.983   12.542 -15.798 1.00 31.85 ? 142 ARG A CG  1 
ATOM   1123 C CD  . ARG A 1 143 ? 3.879   13.761 -15.637 1.00 34.37 ? 142 ARG A CD  1 
ATOM   1124 N NE  . ARG A 1 143 ? 3.186   14.977 -16.040 1.00 35.60 ? 142 ARG A NE  1 
ATOM   1125 C CZ  . ARG A 1 143 ? 3.104   15.412 -17.292 1.00 39.53 ? 142 ARG A CZ  1 
ATOM   1126 N NH1 . ARG A 1 143 ? 3.661   14.711 -18.274 1.00 37.58 ? 142 ARG A NH1 1 
ATOM   1127 N NH2 . ARG A 1 143 ? 2.452   16.539 -17.559 1.00 39.67 ? 142 ARG A NH2 1 
ATOM   1128 N N   . LYS A 1 144 ? 3.668   10.022 -18.210 1.00 30.32 ? 143 LYS A N   1 
ATOM   1129 C CA  . LYS A 1 144 ? 3.462   10.101 -19.655 1.00 32.13 ? 143 LYS A CA  1 
ATOM   1130 C C   . LYS A 1 144 ? 2.536   8.987  -20.157 1.00 32.24 ? 143 LYS A C   1 
ATOM   1131 O O   . LYS A 1 144 ? 1.620   9.218  -20.942 1.00 30.88 ? 143 LYS A O   1 
ATOM   1132 C CB  . LYS A 1 144 ? 4.805   10.015 -20.384 1.00 33.00 ? 143 LYS A CB  1 
ATOM   1133 C CG  . LYS A 1 144 ? 4.704   10.293 -21.873 1.00 30.08 ? 143 LYS A CG  1 
ATOM   1134 C CD  . LYS A 1 144 ? 6.047   10.183 -22.562 1.00 34.20 ? 143 LYS A CD  1 
ATOM   1135 C CE  . LYS A 1 144 ? 5.914   10.536 -24.044 1.00 37.47 ? 143 LYS A CE  1 
ATOM   1136 N NZ  . LYS A 1 144 ? 7.215   10.424 -24.741 1.00 36.61 ? 143 LYS A NZ  1 
ATOM   1137 N N   . TYR A 1 145 ? 2.793   7.773  -19.689 1.00 34.63 ? 144 TYR A N   1 
ATOM   1138 C CA  . TYR A 1 145 ? 1.995   6.616  -20.053 1.00 31.85 ? 144 TYR A CA  1 
ATOM   1139 C C   . TYR A 1 145 ? 0.526   6.840  -19.706 1.00 32.04 ? 144 TYR A C   1 
ATOM   1140 O O   . TYR A 1 145 ? -0.375  6.641  -20.538 1.00 33.03 ? 144 TYR A O   1 
ATOM   1141 C CB  . TYR A 1 145 ? 2.527   5.387  -19.326 1.00 34.71 ? 144 TYR A CB  1 
ATOM   1142 C CG  . TYR A 1 145 ? 1.863   4.087  -19.702 1.00 37.13 ? 144 TYR A CG  1 
ATOM   1143 C CD1 . TYR A 1 145 ? 2.371   3.294  -20.728 1.00 36.47 ? 144 TYR A CD1 1 
ATOM   1144 C CD2 . TYR A 1 145 ? 0.700   3.671  -19.063 1.00 38.89 ? 144 TYR A CD2 1 
ATOM   1145 C CE1 . TYR A 1 145 ? 1.760   2.091  -21.074 1.00 41.88 ? 144 TYR A CE1 1 
ATOM   1146 C CE2 . TYR A 1 145 ? 0.077   2.475  -19.403 1.00 42.50 ? 144 TYR A CE2 1 
ATOM   1147 C CZ  . TYR A 1 145 ? 0.611   1.687  -20.409 1.00 44.49 ? 144 TYR A CZ  1 
ATOM   1148 O OH  . TYR A 1 145 ? -0.010  0.499  -20.739 1.00 43.22 ? 144 TYR A OH  1 
ATOM   1149 N N   . ALA A 1 146 ? 0.294   7.291  -18.477 1.00 30.25 ? 145 ALA A N   1 
ATOM   1150 C CA  . ALA A 1 146 ? -1.052  7.464  -17.958 1.00 29.82 ? 145 ALA A CA  1 
ATOM   1151 C C   . ALA A 1 146 ? -1.791  8.595  -18.673 1.00 31.25 ? 145 ALA A C   1 
ATOM   1152 O O   . ALA A 1 146 ? -2.963  8.449  -19.015 1.00 33.58 ? 145 ALA A O   1 
ATOM   1153 C CB  . ALA A 1 146 ? -1.014  7.719  -16.428 1.00 29.60 ? 145 ALA A CB  1 
ATOM   1154 N N   . ARG A 1 147 ? -1.118  9.721  -18.889 1.00 29.38 ? 146 ARG A N   1 
ATOM   1155 C CA  . ARG A 1 147 ? -1.722  10.811 -19.663 1.00 32.43 ? 146 ARG A CA  1 
ATOM   1156 C C   . ARG A 1 147 ? -2.094  10.352 -21.070 1.00 32.34 ? 146 ARG A C   1 
ATOM   1157 O O   . ARG A 1 147 ? -3.169  10.678 -21.585 1.00 34.29 ? 146 ARG A O   1 
ATOM   1158 C CB  . ARG A 1 147 ? -0.780  12.007 -19.750 1.00 31.55 ? 146 ARG A CB  1 
ATOM   1159 C CG  . ARG A 1 147 ? -0.686  12.810 -18.471 1.00 39.72 ? 146 ARG A CG  1 
ATOM   1160 C CD  . ARG A 1 147 ? 0.394   13.856 -18.570 1.00 38.63 ? 146 ARG A CD  1 
ATOM   1161 N NE  . ARG A 1 147 ? 0.124   14.835 -19.614 1.00 41.95 ? 146 ARG A NE  1 
ATOM   1162 C CZ  . ARG A 1 147 ? -0.557  15.965 -19.438 1.00 46.95 ? 146 ARG A CZ  1 
ATOM   1163 N NH1 . ARG A 1 147 ? -1.046  16.292 -18.227 1.00 34.71 ? 146 ARG A NH1 1 
ATOM   1164 N NH2 . ARG A 1 147 ? -0.715  16.789 -20.481 1.00 41.72 ? 146 ARG A NH2 1 
ATOM   1165 N N   . TRP A 1 148 ? -1.207  9.583  -21.686 1.00 34.58 ? 147 TRP A N   1 
ATOM   1166 C CA  . TRP A 1 148 ? -1.480  9.092  -23.029 1.00 31.53 ? 147 TRP A CA  1 
ATOM   1167 C C   . TRP A 1 148 ? -2.722  8.204  -23.062 1.00 34.78 ? 147 TRP A C   1 
ATOM   1168 O O   . TRP A 1 148 ? -3.658  8.507  -23.797 1.00 33.63 ? 147 TRP A O   1 
ATOM   1169 C CB  . TRP A 1 148 ? -0.280  8.342  -23.600 1.00 29.13 ? 147 TRP A CB  1 
ATOM   1170 C CG  . TRP A 1 148 ? -0.659  7.655  -24.849 1.00 35.12 ? 147 TRP A CG  1 
ATOM   1171 C CD1 . TRP A 1 148 ? -0.778  6.310  -25.043 1.00 38.26 ? 147 TRP A CD1 1 
ATOM   1172 C CD2 . TRP A 1 148 ? -1.083  8.281  -26.065 1.00 31.33 ? 147 TRP A CD2 1 
ATOM   1173 N NE1 . TRP A 1 148 ? -1.197  6.055  -26.321 1.00 34.76 ? 147 TRP A NE1 1 
ATOM   1174 C CE2 . TRP A 1 148 ? -1.396  7.247  -26.970 1.00 37.91 ? 147 TRP A CE2 1 
ATOM   1175 C CE3 . TRP A 1 148 ? -1.201  9.616  -26.479 1.00 32.55 ? 147 TRP A CE3 1 
ATOM   1176 C CZ2 . TRP A 1 148 ? -1.832  7.506  -28.277 1.00 32.76 ? 147 TRP A CZ2 1 
ATOM   1177 C CZ3 . TRP A 1 148 ? -1.634  9.874  -27.780 1.00 38.10 ? 147 TRP A CZ3 1 
ATOM   1178 C CH2 . TRP A 1 148 ? -1.947  8.819  -28.661 1.00 35.94 ? 147 TRP A CH2 1 
ATOM   1179 N N   . LYS A 1 149 ? -2.758  7.149  -22.237 1.00 35.45 ? 148 LYS A N   1 
ATOM   1180 C CA  . LYS A 1 149 ? -3.898  6.229  -22.245 1.00 35.62 ? 148 LYS A CA  1 
ATOM   1181 C C   . LYS A 1 149 ? -5.187  6.978  -22.000 1.00 35.27 ? 148 LYS A C   1 
ATOM   1182 O O   . LYS A 1 149 ? -6.173  6.753  -22.695 1.00 37.69 ? 148 LYS A O   1 
ATOM   1183 C CB  . LYS A 1 149 ? -3.761  5.120  -21.193 1.00 36.80 ? 148 LYS A CB  1 
ATOM   1184 C CG  . LYS A 1 149 ? -2.492  4.320  -21.284 1.00 40.08 ? 148 LYS A CG  1 
ATOM   1185 C CD  . LYS A 1 149 ? -2.332  3.565  -22.593 1.00 45.84 ? 148 LYS A CD  1 
ATOM   1186 C CE  . LYS A 1 149 ? -3.048  2.245  -22.565 1.00 44.78 ? 148 LYS A CE  1 
ATOM   1187 N NZ  . LYS A 1 149 ? -2.685  1.411  -23.748 1.00 51.85 ? 148 LYS A NZ  1 
ATOM   1188 N N   . ALA A 1 150 ? -5.172  7.880  -21.021 1.00 36.08 ? 149 ALA A N   1 
ATOM   1189 C CA  . ALA A 1 150 ? -6.370  8.630  -20.659 1.00 36.41 ? 149 ALA A CA  1 
ATOM   1190 C C   . ALA A 1 150 ? -6.900  9.473  -21.820 1.00 36.70 ? 149 ALA A C   1 
ATOM   1191 O O   . ALA A 1 150 ? -8.066  9.359  -22.180 1.00 36.12 ? 149 ALA A O   1 
ATOM   1192 C CB  . ALA A 1 150 ? -6.108  9.517  -19.443 1.00 30.31 ? 149 ALA A CB  1 
ATOM   1193 N N   . THR A 1 151 ? -6.070  10.330 -22.402 1.00 34.74 ? 150 THR A N   1 
ATOM   1194 C CA  . THR A 1 151 ? -6.601  11.197 -23.443 1.00 39.15 ? 150 THR A CA  1 
ATOM   1195 C C   . THR A 1 151 ? -6.922  10.356 -24.690 1.00 38.08 ? 150 THR A C   1 
ATOM   1196 O O   . THR A 1 151 ? -7.927  10.595 -25.353 1.00 38.92 ? 150 THR A O   1 
ATOM   1197 C CB  . THR A 1 151 ? -5.639  12.366 -23.798 1.00 37.56 ? 150 THR A CB  1 
ATOM   1198 O OG1 . THR A 1 151 ? -4.373  11.854 -24.236 1.00 41.51 ? 150 THR A OG1 1 
ATOM   1199 C CG2 . THR A 1 151 ? -5.426  13.275 -22.582 1.00 43.76 ? 150 THR A CG2 1 
ATOM   1200 N N   . TYR A 1 152 ? -6.101  9.353  -24.977 1.00 36.73 ? 151 TYR A N   1 
ATOM   1201 C CA  . TYR A 1 152 ? -6.322  8.518  -26.159 1.00 36.93 ? 151 TYR A CA  1 
ATOM   1202 C C   . TYR A 1 152 ? -7.602  7.697  -26.063 1.00 42.00 ? 151 TYR A C   1 
ATOM   1203 O O   . TYR A 1 152 ? -8.409  7.688  -27.009 1.00 40.29 ? 151 TYR A O   1 
ATOM   1204 C CB  . TYR A 1 152 ? -5.129  7.589  -26.398 1.00 34.40 ? 151 TYR A CB  1 
ATOM   1205 C CG  . TYR A 1 152 ? -5.346  6.541  -27.481 1.00 35.99 ? 151 TYR A CG  1 
ATOM   1206 C CD1 . TYR A 1 152 ? -5.354  6.893  -28.830 1.00 39.79 ? 151 TYR A CD1 1 
ATOM   1207 C CD2 . TYR A 1 152 ? -5.515  5.201  -27.156 1.00 40.55 ? 151 TYR A CD2 1 
ATOM   1208 C CE1 . TYR A 1 152 ? -5.538  5.937  -29.827 1.00 42.82 ? 151 TYR A CE1 1 
ATOM   1209 C CE2 . TYR A 1 152 ? -5.709  4.232  -28.141 1.00 38.59 ? 151 TYR A CE2 1 
ATOM   1210 C CZ  . TYR A 1 152 ? -5.724  4.607  -29.474 1.00 46.56 ? 151 TYR A CZ  1 
ATOM   1211 O OH  . TYR A 1 152 ? -5.918  3.653  -30.460 1.00 48.63 ? 151 TYR A OH  1 
ATOM   1212 N N   . ILE A 1 153 ? -7.783  6.999  -24.937 1.00 40.88 ? 152 ILE A N   1 
ATOM   1213 C CA  . ILE A 1 153 ? -8.963  6.150  -24.751 1.00 40.75 ? 152 ILE A CA  1 
ATOM   1214 C C   . ILE A 1 153 ? -10.200 7.034  -24.734 1.00 44.20 ? 152 ILE A C   1 
ATOM   1215 O O   . ILE A 1 153 ? -11.200 6.743  -25.392 1.00 45.98 ? 152 ILE A O   1 
ATOM   1216 C CB  . ILE A 1 153 ? -8.876  5.304  -23.451 1.00 38.46 ? 152 ILE A CB  1 
ATOM   1217 C CG1 . ILE A 1 153 ? -7.728  4.294  -23.554 1.00 39.39 ? 152 ILE A CG1 1 
ATOM   1218 C CG2 . ILE A 1 153 ? -10.187 4.571  -23.188 1.00 38.35 ? 152 ILE A CG2 1 
ATOM   1219 C CD1 . ILE A 1 153 ? -7.396  3.571  -22.229 1.00 40.78 ? 152 ILE A CD1 1 
ATOM   1220 N N   . HIS A 1 154 ? -10.111 8.138  -24.004 1.00 40.39 ? 153 HIS A N   1 
ATOM   1221 C CA  . HIS A 1 154 ? -11.185 9.121  -23.967 1.00 41.80 ? 153 HIS A CA  1 
ATOM   1222 C C   . HIS A 1 154 ? -11.585 9.584  -25.363 1.00 47.88 ? 153 HIS A C   1 
ATOM   1223 O O   . HIS A 1 154 ? -12.765 9.563  -25.707 1.00 47.35 ? 153 HIS A O   1 
ATOM   1224 C CB  . HIS A 1 154 ? -10.773 10.329 -23.135 1.00 42.03 ? 153 HIS A CB  1 
ATOM   1225 C CG  . HIS A 1 154 ? -11.837 11.372 -23.012 1.00 46.27 ? 153 HIS A CG  1 
ATOM   1226 N ND1 . HIS A 1 154 ? -12.982 11.185 -22.268 1.00 48.79 ? 153 HIS A ND1 1 
ATOM   1227 C CD2 . HIS A 1 154 ? -11.945 12.602 -23.568 1.00 50.16 ? 153 HIS A CD2 1 
ATOM   1228 C CE1 . HIS A 1 154 ? -13.733 12.269 -22.341 1.00 49.32 ? 153 HIS A CE1 1 
ATOM   1229 N NE2 . HIS A 1 154 ? -13.131 13.140 -23.130 1.00 54.44 ? 153 HIS A NE2 1 
ATOM   1230 N N   . ASN A 1 155 ? -10.611 10.008 -26.169 1.00 45.84 ? 154 ASN A N   1 
ATOM   1231 C CA  . ASN A 1 155 ? -10.940 10.527 -27.496 1.00 48.30 ? 154 ASN A CA  1 
ATOM   1232 C C   . ASN A 1 155 ? -11.478 9.468  -28.426 1.00 48.52 ? 154 ASN A C   1 
ATOM   1233 O O   . ASN A 1 155 ? -12.344 9.767  -29.243 1.00 52.75 ? 154 ASN A O   1 
ATOM   1234 C CB  . ASN A 1 155 ? -9.742  11.253 -28.127 1.00 45.76 ? 154 ASN A CB  1 
ATOM   1235 C CG  . ASN A 1 155 ? -10.065 11.832 -29.515 1.00 54.37 ? 154 ASN A CG  1 
ATOM   1236 O OD1 . ASN A 1 155 ? -10.286 11.102 -30.484 1.00 57.44 ? 154 ASN A OD1 1 
ATOM   1237 N ND2 . ASN A 1 155 ? -10.295 13.138 -29.550 1.00 55.72 ? 154 ASN A ND2 1 
ATOM   1238 N N   . CYS A 1 156 ? -10.999 8.237  -28.293 1.00 47.23 ? 155 CYS A N   1 
ATOM   1239 C CA  . CYS A 1 156 ? -11.593 7.143  -29.035 1.00 48.30 ? 155 CYS A CA  1 
ATOM   1240 C C   . CYS A 1 156 ? -13.079 7.023  -28.694 1.00 55.07 ? 155 CYS A C   1 
ATOM   1241 O O   . CYS A 1 156 ? -13.932 7.141  -29.578 1.00 54.54 ? 155 CYS A O   1 
ATOM   1242 C CB  . CYS A 1 156 ? -10.864 5.826  -28.759 1.00 48.87 ? 155 CYS A CB  1 
ATOM   1243 S SG  . CYS A 1 156 ? -9.228  5.704  -29.525 1.00 47.54 ? 155 CYS A SG  1 
ATOM   1244 N N   . LEU A 1 157 ? -13.387 6.819  -27.415 1.00 52.21 ? 156 LEU A N   1 
ATOM   1245 C CA  . LEU A 1 157 ? -14.771 6.611  -26.999 1.00 54.06 ? 156 LEU A CA  1 
ATOM   1246 C C   . LEU A 1 157 ? -15.648 7.805  -27.364 1.00 55.80 ? 156 LEU A C   1 
ATOM   1247 O O   . LEU A 1 157 ? -16.810 7.639  -27.720 1.00 57.49 ? 156 LEU A O   1 
ATOM   1248 C CB  . LEU A 1 157 ? -14.856 6.351  -25.499 1.00 50.49 ? 156 LEU A CB  1 
ATOM   1249 C CG  . LEU A 1 157 ? -14.035 5.151  -25.029 1.00 52.16 ? 156 LEU A CG  1 
ATOM   1250 C CD1 . LEU A 1 157 ? -14.220 4.949  -23.532 1.00 52.50 ? 156 LEU A CD1 1 
ATOM   1251 C CD2 . LEU A 1 157 ? -14.349 3.889  -25.811 1.00 51.32 ? 156 LEU A CD2 1 
ATOM   1252 N N   . LYS A 1 158 ? -15.082 9.002  -27.284 1.00 53.24 ? 157 LYS A N   1 
ATOM   1253 C CA  . LYS A 1 158 ? -15.804 10.218 -27.636 1.00 54.74 ? 157 LYS A CA  1 
ATOM   1254 C C   . LYS A 1 158 ? -16.265 10.164 -29.091 1.00 60.15 ? 157 LYS A C   1 
ATOM   1255 O O   . LYS A 1 158 ? -17.334 10.663 -29.436 1.00 61.51 ? 157 LYS A O   1 
ATOM   1256 C CB  . LYS A 1 158 ? -14.917 11.442 -27.403 1.00 57.12 ? 157 LYS A CB  1 
ATOM   1257 C CG  . LYS A 1 158 ? -15.594 12.779 -27.628 1.00 61.97 ? 157 LYS A CG  1 
ATOM   1258 C CD  . LYS A 1 158 ? -14.661 13.927 -27.258 1.00 68.68 ? 157 LYS A CD  1 
ATOM   1259 C CE  . LYS A 1 158 ? -15.320 15.280 -27.482 1.00 66.92 ? 157 LYS A CE  1 
ATOM   1260 N NZ  . LYS A 1 158 ? -15.538 15.547 -28.923 1.00 66.09 ? 157 LYS A NZ  1 
ATOM   1261 N N   . ASN A 1 159 ? -15.452 9.536  -29.936 1.00 59.57 ? 158 ASN A N   1 
ATOM   1262 C CA  . ASN A 1 159 ? -15.717 9.479  -31.368 1.00 59.92 ? 158 ASN A CA  1 
ATOM   1263 C C   . ASN A 1 159 ? -16.185 8.099  -31.807 1.00 61.33 ? 158 ASN A C   1 
ATOM   1264 O O   . ASN A 1 159 ? -16.046 7.721  -32.974 1.00 62.07 ? 158 ASN A O   1 
ATOM   1265 C CB  . ASN A 1 159 ? -14.467 9.896  -32.150 1.00 56.84 ? 158 ASN A CB  1 
ATOM   1266 C CG  . ASN A 1 159 ? -14.170 11.379 -32.010 1.00 59.88 ? 158 ASN A CG  1 
ATOM   1267 O OD1 . ASN A 1 159 ? -14.798 12.210 -32.660 1.00 63.28 ? 158 ASN A OD1 1 
ATOM   1268 N ND2 . ASN A 1 159 ? -13.232 11.720 -31.132 1.00 57.86 ? 158 ASN A ND2 1 
ATOM   1269 N N   . GLY A 1 160 ? -16.734 7.349  -30.857 1.00 58.04 ? 159 GLY A N   1 
ATOM   1270 C CA  . GLY A 1 160 ? -17.305 6.048  -31.139 1.00 58.26 ? 159 GLY A CA  1 
ATOM   1271 C C   . GLY A 1 160 ? -16.336 5.020  -31.685 1.00 59.46 ? 159 GLY A C   1 
ATOM   1272 O O   . GLY A 1 160 ? -16.760 4.009  -32.236 1.00 66.40 ? 159 GLY A O   1 
ATOM   1273 N N   . GLU A 1 161 ? -15.037 5.269  -31.542 1.00 60.36 ? 160 GLU A N   1 
ATOM   1274 C CA  . GLU A 1 161 ? -14.033 4.285  -31.937 1.00 60.18 ? 160 GLU A CA  1 
ATOM   1275 C C   . GLU A 1 161 ? -13.526 3.446  -30.768 1.00 61.38 ? 160 GLU A C   1 
ATOM   1276 O O   . GLU A 1 161 ? -13.542 3.891  -29.617 1.00 59.97 ? 160 GLU A O   1 
ATOM   1277 C CB  . GLU A 1 161 ? -12.845 4.964  -32.614 1.00 61.83 ? 160 GLU A CB  1 
ATOM   1278 C CG  . GLU A 1 161 ? -13.077 5.380  -34.054 1.00 68.16 ? 160 GLU A CG  1 
ATOM   1279 C CD  . GLU A 1 161 ? -11.862 6.069  -34.650 1.00 71.44 ? 160 GLU A CD  1 
ATOM   1280 O OE1 . GLU A 1 161 ? -10.992 6.526  -33.874 1.00 73.18 ? 160 GLU A OE1 1 
ATOM   1281 O OE2 . GLU A 1 161 ? -11.754 6.110  -35.893 1.00 75.69 ? 160 GLU A OE2 1 
ATOM   1282 N N   . THR A 1 162 ? -13.073 2.232  -31.072 1.00 53.69 ? 161 THR A N   1 
ATOM   1283 C CA  . THR A 1 162 ? -12.429 1.391  -30.071 1.00 57.02 ? 161 THR A CA  1 
ATOM   1284 C C   . THR A 1 162 ? -10.950 1.742  -29.993 1.00 54.69 ? 161 THR A C   1 
ATOM   1285 O O   . THR A 1 162 ? -10.304 1.943  -31.016 1.00 52.59 ? 161 THR A O   1 
ATOM   1286 C CB  . THR A 1 162 ? -12.568 -0.117 -30.393 1.00 56.41 ? 161 THR A CB  1 
ATOM   1287 O OG1 . THR A 1 162 ? -11.984 -0.378 -31.674 1.00 61.20 ? 161 THR A OG1 1 
ATOM   1288 C CG2 . THR A 1 162 ? -14.035 -0.545 -30.406 1.00 56.39 ? 161 THR A CG2 1 
ATOM   1289 N N   . PRO A 1 163 ? -10.403 1.811  -28.773 1.00 55.52 ? 162 PRO A N   1 
ATOM   1290 C CA  . PRO A 1 163 ? -8.973  2.104  -28.634 1.00 53.94 ? 162 PRO A CA  1 
ATOM   1291 C C   . PRO A 1 163 ? -8.086  0.948  -29.096 1.00 50.50 ? 162 PRO A C   1 
ATOM   1292 O O   . PRO A 1 163 ? -7.255  1.186  -29.979 1.00 53.72 ? 162 PRO A O   1 
ATOM   1293 C CB  . PRO A 1 163 ? -8.811  2.357  -27.133 1.00 50.40 ? 162 PRO A CB  1 
ATOM   1294 C CG  . PRO A 1 163 ? -9.918  1.611  -26.510 1.00 53.18 ? 162 PRO A CG  1 
ATOM   1295 C CD  . PRO A 1 163 ? -11.065 1.630  -27.473 1.00 48.84 ? 162 PRO A CD  1 
ATOM   1296 N N   . MET B 1 2   ? 0.886   17.434 -66.844 1.00 65.63 ? 1   MET B N   1 
ATOM   1297 C CA  . MET B 1 2   ? 0.018   17.955 -65.791 1.00 67.33 ? 1   MET B CA  1 
ATOM   1298 C C   . MET B 1 2   ? 0.228   19.457 -65.551 1.00 68.31 ? 1   MET B C   1 
ATOM   1299 O O   . MET B 1 2   ? -0.705  20.187 -65.218 1.00 59.82 ? 1   MET B O   1 
ATOM   1300 C CB  . MET B 1 2   ? 0.231   17.183 -64.491 1.00 66.42 ? 1   MET B CB  1 
ATOM   1301 C CG  . MET B 1 2   ? -0.664  17.690 -63.395 1.00 61.07 ? 1   MET B CG  1 
ATOM   1302 S SD  . MET B 1 2   ? -0.694  16.738 -61.878 1.00 64.19 ? 1   MET B SD  1 
ATOM   1303 C CE  . MET B 1 2   ? -1.724  17.839 -60.957 1.00 56.82 ? 1   MET B CE  1 
ATOM   1304 N N   . ALA B 1 3   ? 1.463   19.917 -65.704 1.00 71.57 ? 2   ALA B N   1 
ATOM   1305 C CA  . ALA B 1 3   ? 1.672   21.338 -65.919 1.00 71.78 ? 2   ALA B CA  1 
ATOM   1306 C C   . ALA B 1 3   ? 0.926   21.664 -67.211 1.00 75.15 ? 2   ALA B C   1 
ATOM   1307 O O   . ALA B 1 3   ? 0.812   20.798 -68.090 1.00 80.46 ? 2   ALA B O   1 
ATOM   1308 C CB  . ALA B 1 3   ? 3.149   21.679 -66.023 1.00 68.48 ? 2   ALA B CB  1 
ATOM   1309 N N   . ALA B 1 4   ? 0.413   22.892 -67.297 1.00 77.03 ? 3   ALA B N   1 
ATOM   1310 C CA  . ALA B 1 4   ? -0.474  23.370 -68.374 1.00 76.45 ? 3   ALA B CA  1 
ATOM   1311 C C   . ALA B 1 4   ? -1.911  22.884 -68.190 1.00 70.63 ? 3   ALA B C   1 
ATOM   1312 O O   . ALA B 1 4   ? -2.757  23.099 -69.059 1.00 74.06 ? 3   ALA B O   1 
ATOM   1313 C CB  . ALA B 1 4   ? 0.050   22.961 -69.771 1.00 78.69 ? 3   ALA B CB  1 
ATOM   1314 N N   . LEU B 1 5   ? -2.205  22.261 -67.052 1.00 72.00 ? 4   LEU B N   1 
ATOM   1315 C CA  . LEU B 1 5   ? -3.517  21.648 -66.894 1.00 72.69 ? 4   LEU B CA  1 
ATOM   1316 C C   . LEU B 1 5   ? -4.432  22.475 -66.003 1.00 65.14 ? 4   LEU B C   1 
ATOM   1317 O O   . LEU B 1 5   ? -5.484  21.999 -65.581 1.00 75.43 ? 4   LEU B O   1 
ATOM   1318 C CB  . LEU B 1 5   ? -3.378  20.228 -66.348 1.00 70.37 ? 4   LEU B CB  1 
ATOM   1319 C CG  . LEU B 1 5   ? -4.583  19.301 -66.376 1.00 59.04 ? 4   LEU B CG  1 
ATOM   1320 C CD1 . LEU B 1 5   ? -4.997  19.079 -67.811 1.00 60.85 ? 4   LEU B CD1 1 
ATOM   1321 C CD2 . LEU B 1 5   ? -4.202  18.010 -65.735 1.00 56.77 ? 4   LEU B CD2 1 
ATOM   1322 N N   . ALA B 1 6   ? -4.029  23.713 -65.728 1.00 62.13 ? 5   ALA B N   1 
ATOM   1323 C CA  . ALA B 1 6   ? -4.887  24.691 -65.054 1.00 65.52 ? 5   ALA B CA  1 
ATOM   1324 C C   . ALA B 1 6   ? -5.217  24.304 -63.620 1.00 59.34 ? 5   ALA B C   1 
ATOM   1325 O O   . ALA B 1 6   ? -5.564  23.160 -63.338 1.00 59.52 ? 5   ALA B O   1 
ATOM   1326 C CB  . ALA B 1 6   ? -6.181  24.906 -65.846 1.00 66.79 ? 5   ALA B CB  1 
ATOM   1327 N N   . PRO B 1 7   ? -5.123  25.272 -62.703 1.00 59.33 ? 6   PRO B N   1 
ATOM   1328 C CA  . PRO B 1 7   ? -5.390  24.967 -61.294 1.00 55.44 ? 6   PRO B CA  1 
ATOM   1329 C C   . PRO B 1 7   ? -6.790  24.403 -61.064 1.00 53.31 ? 6   PRO B C   1 
ATOM   1330 O O   . PRO B 1 7   ? -7.720  24.711 -61.812 1.00 52.25 ? 6   PRO B O   1 
ATOM   1331 C CB  . PRO B 1 7   ? -5.226  26.332 -60.601 1.00 52.51 ? 6   PRO B CB  1 
ATOM   1332 C CG  . PRO B 1 7   ? -5.483  27.354 -61.693 1.00 57.05 ? 6   PRO B CG  1 
ATOM   1333 C CD  . PRO B 1 7   ? -4.898  26.711 -62.933 1.00 59.68 ? 6   PRO B CD  1 
ATOM   1334 N N   . LEU B 1 8   ? -6.924  23.565 -60.043 1.00 47.84 ? 7   LEU B N   1 
ATOM   1335 C CA  . LEU B 1 8   ? -8.229  23.163 -59.570 1.00 41.10 ? 7   LEU B CA  1 
ATOM   1336 C C   . LEU B 1 8   ? -8.958  24.409 -59.070 1.00 40.99 ? 7   LEU B C   1 
ATOM   1337 O O   . LEU B 1 8   ? -8.334  25.307 -58.517 1.00 43.56 ? 7   LEU B O   1 
ATOM   1338 C CB  . LEU B 1 8   ? -8.104  22.125 -58.449 1.00 44.43 ? 7   LEU B CB  1 
ATOM   1339 C CG  . LEU B 1 8   ? -7.421  20.784 -58.762 1.00 47.71 ? 7   LEU B CG  1 
ATOM   1340 C CD1 . LEU B 1 8   ? -7.285  19.958 -57.496 1.00 39.05 ? 7   LEU B CD1 1 
ATOM   1341 C CD2 . LEU B 1 8   ? -8.153  19.991 -59.858 1.00 42.78 ? 7   LEU B CD2 1 
ATOM   1342 N N   . PRO B 1 9   ? -10.282 24.467 -59.247 1.00 39.90 ? 8   PRO B N   1 
ATOM   1343 C CA  . PRO B 1 9   ? -11.047 25.543 -58.611 1.00 42.21 ? 8   PRO B CA  1 
ATOM   1344 C C   . PRO B 1 9   ? -10.973 25.443 -57.086 1.00 43.31 ? 8   PRO B C   1 
ATOM   1345 O O   . PRO B 1 9   ? -10.517 24.421 -56.581 1.00 43.41 ? 8   PRO B O   1 
ATOM   1346 C CB  . PRO B 1 9   ? -12.479 25.306 -59.121 1.00 39.79 ? 8   PRO B CB  1 
ATOM   1347 C CG  . PRO B 1 9   ? -12.526 23.881 -59.482 1.00 44.31 ? 8   PRO B CG  1 
ATOM   1348 C CD  . PRO B 1 9   ? -11.148 23.525 -59.975 1.00 43.88 ? 8   PRO B CD  1 
ATOM   1349 N N   . PRO B 1 10  ? -11.393 26.497 -56.366 1.00 43.90 ? 9   PRO B N   1 
ATOM   1350 C CA  . PRO B 1 10  ? -11.416 26.452 -54.899 1.00 41.86 ? 9   PRO B CA  1 
ATOM   1351 C C   . PRO B 1 10  ? -12.101 25.190 -54.400 1.00 44.57 ? 9   PRO B C   1 
ATOM   1352 O O   . PRO B 1 10  ? -13.029 24.703 -55.061 1.00 40.18 ? 9   PRO B O   1 
ATOM   1353 C CB  . PRO B 1 10  ? -12.215 27.700 -54.518 1.00 40.65 ? 9   PRO B CB  1 
ATOM   1354 C CG  . PRO B 1 10  ? -11.936 28.663 -55.640 1.00 43.39 ? 9   PRO B CG  1 
ATOM   1355 C CD  . PRO B 1 10  ? -11.770 27.827 -56.888 1.00 43.45 ? 9   PRO B CD  1 
ATOM   1356 N N   . LEU B 1 11  ? -11.633 24.660 -53.272 1.00 39.03 ? 10  LEU B N   1 
ATOM   1357 C CA  . LEU B 1 11  ? -12.162 23.413 -52.748 1.00 40.49 ? 10  LEU B CA  1 
ATOM   1358 C C   . LEU B 1 11  ? -13.565 23.657 -52.198 1.00 43.28 ? 10  LEU B C   1 
ATOM   1359 O O   . LEU B 1 11  ? -13.750 24.520 -51.343 1.00 44.76 ? 10  LEU B O   1 
ATOM   1360 C CB  . LEU B 1 11  ? -11.251 22.856 -51.655 1.00 38.49 ? 10  LEU B CB  1 
ATOM   1361 C CG  . LEU B 1 11  ? -11.646 21.515 -51.031 1.00 42.34 ? 10  LEU B CG  1 
ATOM   1362 C CD1 . LEU B 1 11  ? -11.533 20.365 -52.057 1.00 35.86 ? 10  LEU B CD1 1 
ATOM   1363 C CD2 . LEU B 1 11  ? -10.804 21.234 -49.784 1.00 36.63 ? 10  LEU B CD2 1 
ATOM   1364 N N   . PRO B 1 12  ? -14.561 22.924 -52.713 1.00 43.65 ? 11  PRO B N   1 
ATOM   1365 C CA  . PRO B 1 12  ? -15.922 23.005 -52.167 1.00 45.54 ? 11  PRO B CA  1 
ATOM   1366 C C   . PRO B 1 12  ? -15.984 22.738 -50.663 1.00 43.63 ? 11  PRO B C   1 
ATOM   1367 O O   . PRO B 1 12  ? -15.242 21.901 -50.149 1.00 44.30 ? 11  PRO B O   1 
ATOM   1368 C CB  . PRO B 1 12  ? -16.671 21.914 -52.940 1.00 45.78 ? 11  PRO B CB  1 
ATOM   1369 C CG  . PRO B 1 12  ? -15.938 21.840 -54.269 1.00 45.02 ? 11  PRO B CG  1 
ATOM   1370 C CD  . PRO B 1 12  ? -14.493 22.074 -53.921 1.00 42.56 ? 11  PRO B CD  1 
ATOM   1371 N N   . ALA B 1 13  ? -16.872 23.450 -49.978 1.00 43.39 ? 12  ALA B N   1 
ATOM   1372 C CA  . ALA B 1 13  ? -17.118 23.255 -48.555 1.00 45.50 ? 12  ALA B CA  1 
ATOM   1373 C C   . ALA B 1 13  ? -17.406 21.790 -48.227 1.00 45.14 ? 12  ALA B C   1 
ATOM   1374 O O   . ALA B 1 13  ? -17.016 21.289 -47.174 1.00 42.95 ? 12  ALA B O   1 
ATOM   1375 C CB  . ALA B 1 13  ? -18.282 24.130 -48.096 1.00 43.03 ? 12  ALA B CB  1 
ATOM   1376 N N   . GLN B 1 14  ? -18.090 21.118 -49.147 1.00 44.55 ? 13  GLN B N   1 
ATOM   1377 C CA  . GLN B 1 14  ? -18.467 19.723 -48.988 1.00 44.56 ? 13  GLN B CA  1 
ATOM   1378 C C   . GLN B 1 14  ? -17.249 18.794 -48.891 1.00 44.20 ? 13  GLN B C   1 
ATOM   1379 O O   . GLN B 1 14  ? -17.324 17.692 -48.328 1.00 41.11 ? 13  GLN B O   1 
ATOM   1380 C CB  . GLN B 1 14  ? -19.350 19.287 -50.164 1.00 47.30 ? 13  GLN B CB  1 
ATOM   1381 C CG  . GLN B 1 14  ? -20.717 19.980 -50.273 1.00 50.41 ? 13  GLN B CG  1 
ATOM   1382 C CD  . GLN B 1 14  ? -20.664 21.347 -50.960 1.00 51.97 ? 13  GLN B CD  1 
ATOM   1383 O OE1 . GLN B 1 14  ? -19.593 21.882 -51.248 1.00 50.78 ? 13  GLN B OE1 1 
ATOM   1384 N NE2 . GLN B 1 14  ? -21.834 21.897 -51.256 1.00 56.40 ? 13  GLN B NE2 1 
ATOM   1385 N N   . PHE B 1 15  ? -16.131 19.231 -49.457 1.00 42.49 ? 14  PHE B N   1 
ATOM   1386 C CA  . PHE B 1 15  ? -14.953 18.369 -49.558 1.00 42.91 ? 14  PHE B CA  1 
ATOM   1387 C C   . PHE B 1 15  ? -13.896 18.745 -48.549 1.00 41.57 ? 14  PHE B C   1 
ATOM   1388 O O   . PHE B 1 15  ? -12.715 18.461 -48.744 1.00 41.95 ? 14  PHE B O   1 
ATOM   1389 C CB  . PHE B 1 15  ? -14.352 18.433 -50.962 1.00 39.75 ? 14  PHE B CB  1 
ATOM   1390 C CG  . PHE B 1 15  ? -15.234 17.863 -52.024 1.00 40.90 ? 14  PHE B CG  1 
ATOM   1391 C CD1 . PHE B 1 15  ? -16.311 17.054 -51.691 1.00 40.74 ? 14  PHE B CD1 1 
ATOM   1392 C CD2 . PHE B 1 15  ? -14.964 18.100 -53.362 1.00 36.77 ? 14  PHE B CD2 1 
ATOM   1393 C CE1 . PHE B 1 15  ? -17.124 16.509 -52.674 1.00 41.71 ? 14  PHE B CE1 1 
ATOM   1394 C CE2 . PHE B 1 15  ? -15.768 17.556 -54.349 1.00 41.39 ? 14  PHE B CE2 1 
ATOM   1395 C CZ  . PHE B 1 15  ? -16.851 16.759 -54.003 1.00 41.30 ? 14  PHE B CZ  1 
ATOM   1396 N N   . LYS B 1 16  ? -14.327 19.407 -47.482 1.00 43.55 ? 15  LYS B N   1 
ATOM   1397 C CA  . LYS B 1 16  ? -13.434 19.825 -46.403 1.00 44.56 ? 15  LYS B CA  1 
ATOM   1398 C C   . LYS B 1 16  ? -12.588 18.674 -45.835 1.00 39.34 ? 15  LYS B C   1 
ATOM   1399 O O   . LYS B 1 16  ? -11.418 18.853 -45.517 1.00 37.89 ? 15  LYS B O   1 
ATOM   1400 C CB  . LYS B 1 16  ? -14.255 20.463 -45.285 1.00 42.87 ? 15  LYS B CB  1 
ATOM   1401 C CG  . LYS B 1 16  ? -13.452 20.876 -44.058 1.00 49.06 ? 15  LYS B CG  1 
ATOM   1402 C CD  . LYS B 1 16  ? -12.450 21.965 -44.383 1.00 51.13 ? 15  LYS B CD  1 
ATOM   1403 C CE  . LYS B 1 16  ? -11.796 22.490 -43.103 1.00 55.40 ? 15  LYS B CE  1 
ATOM   1404 N NZ  . LYS B 1 16  ? -10.663 23.400 -43.422 1.00 54.42 ? 15  LYS B NZ  1 
ATOM   1405 N N   . SER B 1 17  ? -13.181 17.493 -45.734 1.00 37.39 ? 16  SER B N   1 
ATOM   1406 C CA  . SER B 1 17  ? -12.506 16.349 -45.128 1.00 39.51 ? 16  SER B CA  1 
ATOM   1407 C C   . SER B 1 17  ? -11.327 15.793 -45.967 1.00 41.70 ? 16  SER B C   1 
ATOM   1408 O O   . SER B 1 17  ? -10.491 15.064 -45.438 1.00 44.76 ? 16  SER B O   1 
ATOM   1409 C CB  . SER B 1 17  ? -13.526 15.236 -44.859 1.00 38.02 ? 16  SER B CB  1 
ATOM   1410 O OG  . SER B 1 17  ? -14.056 14.730 -46.075 1.00 44.59 ? 16  SER B OG  1 
ATOM   1411 N N   . ILE B 1 18  ? -11.239 16.134 -47.253 1.00 39.16 ? 17  ILE B N   1 
ATOM   1412 C CA  . ILE B 1 18  ? -10.104 15.675 -48.064 1.00 37.65 ? 17  ILE B CA  1 
ATOM   1413 C C   . ILE B 1 18  ? -9.110  16.793 -48.369 1.00 35.68 ? 17  ILE B C   1 
ATOM   1414 O O   . ILE B 1 18  ? -8.178  16.624 -49.166 1.00 34.26 ? 17  ILE B O   1 
ATOM   1415 C CB  . ILE B 1 18  ? -10.565 15.058 -49.413 1.00 42.71 ? 17  ILE B CB  1 
ATOM   1416 C CG1 . ILE B 1 18  ? -11.258 16.125 -50.269 1.00 42.33 ? 17  ILE B CG1 1 
ATOM   1417 C CG2 . ILE B 1 18  ? -11.482 13.875 -49.166 1.00 35.89 ? 17  ILE B CG2 1 
ATOM   1418 C CD1 . ILE B 1 18  ? -11.587 15.682 -51.670 1.00 42.80 ? 17  ILE B CD1 1 
ATOM   1419 N N   . GLN B 1 19  ? -9.297  17.933 -47.721 1.00 36.25 ? 18  GLN B N   1 
ATOM   1420 C CA  . GLN B 1 19  ? -8.423  19.076 -47.939 1.00 34.52 ? 18  GLN B CA  1 
ATOM   1421 C C   . GLN B 1 19  ? -6.952  18.748 -47.713 1.00 34.18 ? 18  GLN B C   1 
ATOM   1422 O O   . GLN B 1 19  ? -6.086  19.138 -48.502 1.00 34.50 ? 18  GLN B O   1 
ATOM   1423 C CB  . GLN B 1 19  ? -8.810  20.235 -47.015 1.00 33.17 ? 18  GLN B CB  1 
ATOM   1424 C CG  . GLN B 1 19  ? -8.023  21.490 -47.327 1.00 37.16 ? 18  GLN B CG  1 
ATOM   1425 C CD  . GLN B 1 19  ? -8.346  22.643 -46.386 1.00 42.31 ? 18  GLN B CD  1 
ATOM   1426 O OE1 . GLN B 1 19  ? -9.152  22.517 -45.468 1.00 49.36 ? 18  GLN B OE1 1 
ATOM   1427 N NE2 . GLN B 1 19  ? -7.726  23.772 -46.626 1.00 51.06 ? 18  GLN B NE2 1 
ATOM   1428 N N   . HIS B 1 20  ? -6.656  18.042 -46.626 1.00 32.02 ? 19  HIS B N   1 
ATOM   1429 C CA  . HIS B 1 20  ? -5.252  17.840 -46.256 1.00 36.79 ? 19  HIS B CA  1 
ATOM   1430 C C   . HIS B 1 20  ? -4.589  16.753 -47.104 1.00 33.22 ? 19  HIS B C   1 
ATOM   1431 O O   . HIS B 1 20  ? -3.386  16.797 -47.359 1.00 35.80 ? 19  HIS B O   1 
ATOM   1432 C CB  . HIS B 1 20  ? -5.138  17.536 -44.753 1.00 39.16 ? 19  HIS B CB  1 
ATOM   1433 C CG  . HIS B 1 20  ? -5.545  18.685 -43.881 1.00 42.52 ? 19  HIS B CG  1 
ATOM   1434 N ND1 . HIS B 1 20  ? -5.796  18.559 -42.534 1.00 41.96 ? 19  HIS B ND1 1 
ATOM   1435 C CD2 . HIS B 1 20  ? -5.764  19.997 -44.186 1.00 37.30 ? 19  HIS B CD2 1 
ATOM   1436 C CE1 . HIS B 1 20  ? -6.142  19.739 -42.036 1.00 44.80 ? 19  HIS B CE1 1 
ATOM   1437 N NE2 . HIS B 1 20  ? -6.129  20.624 -43.021 1.00 43.17 ? 19  HIS B NE2 1 
ATOM   1438 N N   . HIS B 1 21  ? -5.379  15.802 -47.578 1.00 30.88 ? 20  HIS B N   1 
ATOM   1439 C CA  . HIS B 1 21  ? -4.854  14.811 -48.510 1.00 34.91 ? 20  HIS B CA  1 
ATOM   1440 C C   . HIS B 1 21  ? -4.455  15.505 -49.826 1.00 32.40 ? 20  HIS B C   1 
ATOM   1441 O O   . HIS B 1 21  ? -3.388  15.226 -50.381 1.00 33.35 ? 20  HIS B O   1 
ATOM   1442 C CB  . HIS B 1 21  ? -5.895  13.715 -48.741 1.00 33.60 ? 20  HIS B CB  1 
ATOM   1443 C CG  . HIS B 1 21  ? -6.439  13.141 -47.470 1.00 32.36 ? 20  HIS B CG  1 
ATOM   1444 N ND1 . HIS B 1 21  ? -7.443  13.757 -46.751 1.00 36.65 ? 20  HIS B ND1 1 
ATOM   1445 C CD2 . HIS B 1 21  ? -6.112  12.021 -46.771 1.00 33.05 ? 20  HIS B CD2 1 
ATOM   1446 C CE1 . HIS B 1 21  ? -7.718  13.042 -45.671 1.00 33.27 ? 20  HIS B CE1 1 
ATOM   1447 N NE2 . HIS B 1 21  ? -6.927  11.979 -45.666 1.00 32.90 ? 20  HIS B NE2 1 
ATOM   1448 N N   . LEU B 1 22  ? -5.293  16.426 -50.315 1.00 33.88 ? 21  LEU B N   1 
ATOM   1449 C CA  . LEU B 1 22  ? -4.923  17.229 -51.504 1.00 35.40 ? 21  LEU B CA  1 
ATOM   1450 C C   . LEU B 1 22  ? -3.704  18.097 -51.271 1.00 35.80 ? 21  LEU B C   1 
ATOM   1451 O O   . LEU B 1 22  ? -2.869  18.236 -52.156 1.00 35.41 ? 21  LEU B O   1 
ATOM   1452 C CB  . LEU B 1 22  ? -6.079  18.132 -51.958 1.00 31.99 ? 21  LEU B CB  1 
ATOM   1453 C CG  . LEU B 1 22  ? -7.278  17.381 -52.525 1.00 39.99 ? 21  LEU B CG  1 
ATOM   1454 C CD1 . LEU B 1 22  ? -8.461  18.334 -52.736 1.00 38.93 ? 21  LEU B CD1 1 
ATOM   1455 C CD2 . LEU B 1 22  ? -6.838  16.752 -53.840 1.00 34.46 ? 21  LEU B CD2 1 
ATOM   1456 N N   . ARG B 1 23  ? -3.609  18.714 -50.092 1.00 36.75 ? 22  ARG B N   1 
ATOM   1457 C CA  . ARG B 1 23  ? -2.407  19.476 -49.772 1.00 37.81 ? 22  ARG B CA  1 
ATOM   1458 C C   . ARG B 1 23  ? -1.192  18.558 -49.755 1.00 37.45 ? 22  ARG B C   1 
ATOM   1459 O O   . ARG B 1 23  ? -0.118  18.932 -50.235 1.00 37.00 ? 22  ARG B O   1 
ATOM   1460 C CB  . ARG B 1 23  ? -2.535  20.193 -48.418 1.00 38.41 ? 22  ARG B CB  1 
ATOM   1461 C CG  . ARG B 1 23  ? -1.228  20.832 -47.940 1.00 43.04 ? 22  ARG B CG  1 
ATOM   1462 C CD  . ARG B 1 23  ? -0.681  21.931 -48.892 1.00 50.00 ? 22  ARG B CD  1 
ATOM   1463 N NE  . ARG B 1 23  ? 0.557   22.520 -48.366 1.00 54.40 ? 22  ARG B NE  1 
ATOM   1464 C CZ  . ARG B 1 23  ? 1.376   23.327 -49.044 1.00 58.67 ? 22  ARG B CZ  1 
ATOM   1465 N NH1 . ARG B 1 23  ? 1.104   23.669 -50.296 1.00 56.30 ? 22  ARG B NH1 1 
ATOM   1466 N NH2 . ARG B 1 23  ? 2.471   23.805 -48.459 1.00 57.81 ? 22  ARG B NH2 1 
ATOM   1467 N N   . THR B 1 24  ? -1.358  17.364 -49.180 1.00 38.85 ? 23  THR B N   1 
ATOM   1468 C CA  . THR B 1 24  ? -0.263  16.386 -49.130 1.00 38.98 ? 23  THR B CA  1 
ATOM   1469 C C   . THR B 1 24  ? 0.170   16.027 -50.559 1.00 37.30 ? 23  THR B C   1 
ATOM   1470 O O   . THR B 1 24  ? 1.357   15.895 -50.846 1.00 37.69 ? 23  THR B O   1 
ATOM   1471 C CB  . THR B 1 24  ? -0.660  15.098 -48.370 1.00 38.57 ? 23  THR B CB  1 
ATOM   1472 O OG1 . THR B 1 24  ? -1.157  15.431 -47.067 1.00 34.95 ? 23  THR B OG1 1 
ATOM   1473 C CG2 . THR B 1 24  ? 0.551   14.196 -48.201 1.00 37.14 ? 23  THR B CG2 1 
ATOM   1474 N N   . ALA B 1 25  ? -0.793  15.908 -51.467 1.00 33.94 ? 24  ALA B N   1 
ATOM   1475 C CA  . ALA B 1 25  ? -0.451  15.655 -52.863 1.00 35.66 ? 24  ALA B CA  1 
ATOM   1476 C C   . ALA B 1 25  ? 0.378   16.798 -53.449 1.00 40.15 ? 24  ALA B C   1 
ATOM   1477 O O   . ALA B 1 25  ? 1.399   16.574 -54.110 1.00 39.14 ? 24  ALA B O   1 
ATOM   1478 C CB  . ALA B 1 25  ? -1.709  15.434 -53.684 1.00 34.57 ? 24  ALA B CB  1 
ATOM   1479 N N   . GLN B 1 26  ? -0.047  18.031 -53.200 1.00 40.54 ? 25  GLN B N   1 
ATOM   1480 C CA  . GLN B 1 26  ? 0.653   19.184 -53.759 1.00 41.23 ? 25  GLN B CA  1 
ATOM   1481 C C   . GLN B 1 26  ? 2.082   19.268 -53.226 1.00 38.36 ? 25  GLN B C   1 
ATOM   1482 O O   . GLN B 1 26  ? 3.018   19.560 -53.971 1.00 40.75 ? 25  GLN B O   1 
ATOM   1483 C CB  . GLN B 1 26  ? -0.110  20.476 -53.452 1.00 47.67 ? 25  GLN B CB  1 
ATOM   1484 C CG  . GLN B 1 26  ? -1.382  20.664 -54.282 1.00 48.67 ? 25  GLN B CG  1 
ATOM   1485 C CD  . GLN B 1 26  ? -2.317  21.688 -53.663 1.00 58.44 ? 25  GLN B CD  1 
ATOM   1486 N N   . GLU B 1 27  ? 2.258   18.991 -51.940 1.00 38.93 ? 26  GLU B N   1 
ATOM   1487 C CA  . GLU B 1 27  ? 3.596   19.046 -51.343 1.00 41.76 ? 26  GLU B CA  1 
ATOM   1488 C C   . GLU B 1 27  ? 4.528   17.974 -51.907 1.00 41.90 ? 26  GLU B C   1 
ATOM   1489 O O   . GLU B 1 27  ? 5.745   18.118 -51.841 1.00 44.46 ? 26  GLU B O   1 
ATOM   1490 C CB  . GLU B 1 27  ? 3.537   18.886 -49.819 1.00 46.50 ? 26  GLU B CB  1 
ATOM   1491 C CG  . GLU B 1 27  ? 2.805   19.995 -49.072 1.00 50.56 ? 26  GLU B CG  1 
ATOM   1492 C CD  . GLU B 1 27  ? 2.811   19.779 -47.561 1.00 56.89 ? 26  GLU B CD  1 
ATOM   1493 O OE1 . GLU B 1 27  ? 3.345   18.740 -47.110 1.00 60.87 ? 26  GLU B OE1 1 
ATOM   1494 O OE2 . GLU B 1 27  ? 2.255   20.628 -46.828 1.00 62.92 ? 26  GLU B OE2 1 
ATOM   1495 N N   . HIS B 1 28  ? 3.964   16.892 -52.439 1.00 43.76 ? 27  HIS B N   1 
ATOM   1496 C CA  . HIS B 1 28  ? 4.788   15.808 -52.981 1.00 43.29 ? 27  HIS B CA  1 
ATOM   1497 C C   . HIS B 1 28  ? 4.886   15.772 -54.495 1.00 43.05 ? 27  HIS B C   1 
ATOM   1498 O O   . HIS B 1 28  ? 5.582   14.911 -55.039 1.00 41.85 ? 27  HIS B O   1 
ATOM   1499 C CB  . HIS B 1 28  ? 4.274   14.448 -52.487 1.00 39.12 ? 27  HIS B CB  1 
ATOM   1500 C CG  . HIS B 1 28  ? 4.557   14.197 -51.043 1.00 38.66 ? 27  HIS B CG  1 
ATOM   1501 N ND1 . HIS B 1 28  ? 3.737   14.647 -50.034 1.00 38.56 ? 27  HIS B ND1 1 
ATOM   1502 C CD2 . HIS B 1 28  ? 5.595   13.574 -50.437 1.00 39.33 ? 27  HIS B CD2 1 
ATOM   1503 C CE1 . HIS B 1 28  ? 4.245   14.294 -48.865 1.00 39.36 ? 27  HIS B CE1 1 
ATOM   1504 N NE2 . HIS B 1 28  ? 5.375   13.647 -49.082 1.00 42.57 ? 27  HIS B NE2 1 
ATOM   1505 N N   . ASP B 1 29  ? 4.203   16.687 -55.181 1.00 43.69 ? 28  ASP B N   1 
ATOM   1506 C CA  . ASP B 1 29  ? 4.233   16.681 -56.648 1.00 42.71 ? 28  ASP B CA  1 
ATOM   1507 C C   . ASP B 1 29  ? 5.641   16.669 -57.224 1.00 47.48 ? 28  ASP B C   1 
ATOM   1508 O O   . ASP B 1 29  ? 5.900   16.018 -58.246 1.00 44.36 ? 28  ASP B O   1 
ATOM   1509 C CB  . ASP B 1 29  ? 3.453   17.877 -57.222 1.00 42.78 ? 28  ASP B CB  1 
ATOM   1510 C CG  . ASP B 1 29  ? 1.979   17.564 -57.451 1.00 44.77 ? 28  ASP B CG  1 
ATOM   1511 O OD1 . ASP B 1 29  ? 1.634   16.376 -57.633 1.00 45.82 ? 28  ASP B OD1 1 
ATOM   1512 O OD2 . ASP B 1 29  ? 1.152   18.494 -57.444 1.00 42.96 ? 28  ASP B OD2 1 
ATOM   1513 N N   . LYS B 1 30  ? 6.550   17.369 -56.561 1.00 43.12 ? 29  LYS B N   1 
ATOM   1514 C CA  . LYS B 1 30  ? 7.891   17.542 -57.095 1.00 49.82 ? 29  LYS B CA  1 
ATOM   1515 C C   . LYS B 1 30  ? 8.778   16.352 -56.754 1.00 46.59 ? 29  LYS B C   1 
ATOM   1516 O O   . LYS B 1 30  ? 9.399   15.768 -57.633 1.00 50.94 ? 29  LYS B O   1 
ATOM   1517 C CB  . LYS B 1 30  ? 8.502   18.847 -56.558 1.00 47.80 ? 29  LYS B CB  1 
ATOM   1518 C CG  . LYS B 1 30  ? 9.822   19.278 -57.188 1.00 51.25 ? 29  LYS B CG  1 
ATOM   1519 C CD  . LYS B 1 30  ? 10.216  20.659 -56.644 1.00 57.11 ? 29  LYS B CD  1 
ATOM   1520 C CE  . LYS B 1 30  ? 11.493  21.204 -57.264 1.00 62.03 ? 29  LYS B CE  1 
ATOM   1521 N NZ  . LYS B 1 30  ? 11.785  22.591 -56.752 1.00 63.46 ? 29  LYS B NZ  1 
ATOM   1522 N N   . ARG B 1 31  ? 8.824   15.986 -55.478 1.00 45.40 ? 30  ARG B N   1 
ATOM   1523 C CA  . ARG B 1 31  ? 9.774   14.980 -55.010 1.00 46.82 ? 30  ARG B CA  1 
ATOM   1524 C C   . ARG B 1 31  ? 9.236   13.543 -54.996 1.00 45.18 ? 30  ARG B C   1 
ATOM   1525 O O   . ARG B 1 31  ? 10.023  12.597 -55.009 1.00 44.61 ? 30  ARG B O   1 
ATOM   1526 C CB  . ARG B 1 31  ? 10.271  15.347 -53.606 1.00 45.90 ? 30  ARG B CB  1 
ATOM   1527 N N   . ASP B 1 32  ? 7.917   13.362 -54.949 1.00 41.55 ? 31  ASP B N   1 
ATOM   1528 C CA  . ASP B 1 32  ? 7.376   12.001 -54.999 1.00 39.57 ? 31  ASP B CA  1 
ATOM   1529 C C   . ASP B 1 32  ? 5.973   11.965 -55.626 1.00 36.38 ? 31  ASP B C   1 
ATOM   1530 O O   . ASP B 1 32  ? 4.975   11.835 -54.927 1.00 33.79 ? 31  ASP B O   1 
ATOM   1531 C CB  . ASP B 1 32  ? 7.376   11.373 -53.599 1.00 38.22 ? 31  ASP B CB  1 
ATOM   1532 C CG  . ASP B 1 32  ? 7.104   9.858  -53.629 1.00 41.48 ? 31  ASP B CG  1 
ATOM   1533 O OD1 . ASP B 1 32  ? 6.730   9.323  -54.687 1.00 43.62 ? 31  ASP B OD1 1 
ATOM   1534 O OD2 . ASP B 1 32  ? 7.313   9.186  -52.605 1.00 46.31 ? 31  ASP B OD2 1 
ATOM   1535 N N   . PRO B 1 33  ? 5.918   12.052 -56.966 1.00 32.43 ? 32  PRO B N   1 
ATOM   1536 C CA  . PRO B 1 33  ? 4.720   11.988 -57.815 1.00 35.53 ? 32  PRO B CA  1 
ATOM   1537 C C   . PRO B 1 33  ? 3.836   10.757 -57.548 1.00 35.59 ? 32  PRO B C   1 
ATOM   1538 O O   . PRO B 1 33  ? 2.618   10.820 -57.729 1.00 35.87 ? 32  PRO B O   1 
ATOM   1539 C CB  . PRO B 1 33  ? 5.296   11.908 -59.224 1.00 34.29 ? 32  PRO B CB  1 
ATOM   1540 C CG  . PRO B 1 33  ? 6.668   12.415 -59.122 1.00 39.04 ? 32  PRO B CG  1 
ATOM   1541 C CD  . PRO B 1 33  ? 7.152   12.035 -57.768 1.00 32.37 ? 32  PRO B CD  1 
ATOM   1542 N N   . VAL B 1 34  ? 4.446   9.652  -57.127 1.00 34.44 ? 33  VAL B N   1 
ATOM   1543 C CA  . VAL B 1 34  ? 3.691   8.456  -56.788 1.00 34.05 ? 33  VAL B CA  1 
ATOM   1544 C C   . VAL B 1 34  ? 2.796   8.745  -55.580 1.00 32.85 ? 33  VAL B C   1 
ATOM   1545 O O   . VAL B 1 34  ? 1.605   8.433  -55.596 1.00 32.03 ? 33  VAL B O   1 
ATOM   1546 C CB  . VAL B 1 34  ? 4.634   7.240  -56.503 1.00 34.66 ? 33  VAL B CB  1 
ATOM   1547 C CG1 . VAL B 1 34  ? 3.836   6.038  -55.996 1.00 34.25 ? 33  VAL B CG1 1 
ATOM   1548 C CG2 . VAL B 1 34  ? 5.410   6.870  -57.749 1.00 32.23 ? 33  VAL B CG2 1 
ATOM   1549 N N   . VAL B 1 35  ? 3.356   9.358  -54.540 1.00 33.88 ? 34  VAL B N   1 
ATOM   1550 C CA  . VAL B 1 35  ? 2.543   9.744  -53.382 1.00 35.41 ? 34  VAL B CA  1 
ATOM   1551 C C   . VAL B 1 35  ? 1.504   10.787 -53.803 1.00 30.86 ? 34  VAL B C   1 
ATOM   1552 O O   . VAL B 1 35  ? 0.337   10.696 -53.446 1.00 31.31 ? 34  VAL B O   1 
ATOM   1553 C CB  . VAL B 1 35  ? 3.427   10.285 -52.220 1.00 39.02 ? 34  VAL B CB  1 
ATOM   1554 C CG1 . VAL B 1 35  ? 2.570   10.913 -51.103 1.00 32.71 ? 34  VAL B CG1 1 
ATOM   1555 C CG2 . VAL B 1 35  ? 4.290   9.157  -51.662 1.00 37.12 ? 34  VAL B CG2 1 
ATOM   1556 N N   . ALA B 1 36  ? 1.945   11.762 -54.585 1.00 31.91 ? 35  ALA B N   1 
ATOM   1557 C CA  . ALA B 1 36  ? 1.062   12.787 -55.131 1.00 36.98 ? 35  ALA B CA  1 
ATOM   1558 C C   . ALA B 1 36  ? -0.115  12.177 -55.890 1.00 38.50 ? 35  ALA B C   1 
ATOM   1559 O O   . ALA B 1 36  ? -1.265  12.594 -55.736 1.00 37.31 ? 35  ALA B O   1 
ATOM   1560 C CB  . ALA B 1 36  ? 1.848   13.707 -56.058 1.00 36.38 ? 35  ALA B CB  1 
ATOM   1561 N N   . TYR B 1 37  ? 0.185   11.192 -56.726 1.00 35.32 ? 36  TYR B N   1 
ATOM   1562 C CA  . TYR B 1 37  ? -0.843  10.553 -57.517 1.00 32.84 ? 36  TYR B CA  1 
ATOM   1563 C C   . TYR B 1 37  ? -1.866  9.856  -56.650 1.00 30.57 ? 36  TYR B C   1 
ATOM   1564 O O   . TYR B 1 37  ? -3.070  10.038 -56.838 1.00 32.58 ? 36  TYR B O   1 
ATOM   1565 C CB  . TYR B 1 37  ? -0.219  9.547  -58.490 1.00 37.10 ? 36  TYR B CB  1 
ATOM   1566 C CG  . TYR B 1 37  ? -1.243  8.770  -59.285 1.00 37.21 ? 36  TYR B CG  1 
ATOM   1567 C CD1 . TYR B 1 37  ? -1.818  9.310  -60.436 1.00 38.20 ? 36  TYR B CD1 1 
ATOM   1568 C CD2 . TYR B 1 37  ? -1.660  7.503  -58.869 1.00 34.61 ? 36  TYR B CD2 1 
ATOM   1569 C CE1 . TYR B 1 37  ? -2.766  8.595  -61.169 1.00 37.61 ? 36  TYR B CE1 1 
ATOM   1570 C CE2 . TYR B 1 37  ? -2.600  6.780  -59.594 1.00 35.96 ? 36  TYR B CE2 1 
ATOM   1571 C CZ  . TYR B 1 37  ? -3.148  7.335  -60.744 1.00 36.76 ? 36  TYR B CZ  1 
ATOM   1572 O OH  . TYR B 1 37  ? -4.086  6.633  -61.458 1.00 36.37 ? 36  TYR B OH  1 
ATOM   1573 N N   . TYR B 1 38  ? -1.418  9.032  -55.706 1.00 30.33 ? 37  TYR B N   1 
ATOM   1574 C CA  . TYR B 1 38  ? -2.398  8.284  -54.920 1.00 31.24 ? 37  TYR B CA  1 
ATOM   1575 C C   . TYR B 1 38  ? -3.141  9.142  -53.899 1.00 34.75 ? 37  TYR B C   1 
ATOM   1576 O O   . TYR B 1 38  ? -4.305  8.850  -53.592 1.00 33.80 ? 37  TYR B O   1 
ATOM   1577 C CB  . TYR B 1 38  ? -1.760  7.067  -54.222 1.00 32.96 ? 37  TYR B CB  1 
ATOM   1578 C CG  . TYR B 1 38  ? -1.433  5.951  -55.203 1.00 35.21 ? 37  TYR B CG  1 
ATOM   1579 C CD1 . TYR B 1 38  ? -2.455  5.187  -55.766 1.00 31.31 ? 37  TYR B CD1 1 
ATOM   1580 C CD2 . TYR B 1 38  ? -0.119  5.621  -55.513 1.00 31.85 ? 37  TYR B CD2 1 
ATOM   1581 C CE1 . TYR B 1 38  ? -2.177  4.158  -56.668 1.00 36.05 ? 37  TYR B CE1 1 
ATOM   1582 C CE2 . TYR B 1 38  ? 0.173   4.579  -56.405 1.00 35.39 ? 37  TYR B CE2 1 
ATOM   1583 C CZ  . TYR B 1 38  ? -0.864  3.851  -56.976 1.00 32.06 ? 37  TYR B CZ  1 
ATOM   1584 O OH  . TYR B 1 38  ? -0.596  2.823  -57.864 1.00 33.01 ? 37  TYR B OH  1 
ATOM   1585 N N   . CYS B 1 39  ? -2.492  10.177 -53.362 1.00 32.79 ? 38  CYS B N   1 
ATOM   1586 C CA  . CYS B 1 39  ? -3.230  11.164 -52.571 1.00 33.21 ? 38  CYS B CA  1 
ATOM   1587 C C   . CYS B 1 39  ? -4.420  11.734 -53.361 1.00 32.97 ? 38  CYS B C   1 
ATOM   1588 O O   . CYS B 1 39  ? -5.540  11.778 -52.859 1.00 33.47 ? 38  CYS B O   1 
ATOM   1589 C CB  . CYS B 1 39  ? -2.306  12.297 -52.111 1.00 31.91 ? 38  CYS B CB  1 
ATOM   1590 S SG  . CYS B 1 39  ? -1.116  11.789 -50.824 1.00 35.91 ? 38  CYS B SG  1 
ATOM   1591 N N   . ARG B 1 40  ? -4.181  12.151 -54.599 1.00 30.87 ? 39  ARG B N   1 
ATOM   1592 C CA  . ARG B 1 40  ? -5.271  12.638 -55.442 1.00 33.70 ? 39  ARG B CA  1 
ATOM   1593 C C   . ARG B 1 40  ? -6.325  11.584 -55.740 1.00 35.50 ? 39  ARG B C   1 
ATOM   1594 O O   . ARG B 1 40  ? -7.521  11.908 -55.820 1.00 32.95 ? 39  ARG B O   1 
ATOM   1595 C CB  . ARG B 1 40  ? -4.748  13.176 -56.773 1.00 32.54 ? 39  ARG B CB  1 
ATOM   1596 C CG  . ARG B 1 40  ? -4.031  14.515 -56.683 1.00 37.80 ? 39  ARG B CG  1 
ATOM   1597 C CD  . ARG B 1 40  ? -3.590  14.931 -58.070 1.00 37.84 ? 39  ARG B CD  1 
ATOM   1598 N NE  . ARG B 1 40  ? -3.004  16.266 -58.110 1.00 41.52 ? 39  ARG B NE  1 
ATOM   1599 C CZ  . ARG B 1 40  ? -1.724  16.531 -57.885 1.00 44.12 ? 39  ARG B CZ  1 
ATOM   1600 N NH1 . ARG B 1 40  ? -0.880  15.545 -57.593 1.00 40.67 ? 39  ARG B NH1 1 
ATOM   1601 N NH2 . ARG B 1 40  ? -1.291  17.788 -57.948 1.00 39.36 ? 39  ARG B NH2 1 
ATOM   1602 N N   . LEU B 1 41  ? -5.883  10.338 -55.943 1.00 34.32 ? 40  LEU B N   1 
ATOM   1603 C CA  . LEU B 1 41  ? -6.812  9.257  -56.218 1.00 31.63 ? 40  LEU B CA  1 
ATOM   1604 C C   . LEU B 1 41  ? -7.720  9.108  -55.016 1.00 33.43 ? 40  LEU B C   1 
ATOM   1605 O O   . LEU B 1 41  ? -8.939  9.002  -55.168 1.00 35.84 ? 40  LEU B O   1 
ATOM   1606 C CB  . LEU B 1 41  ? -6.076  7.935  -56.531 1.00 33.44 ? 40  LEU B CB  1 
ATOM   1607 C CG  . LEU B 1 41  ? -6.911  6.690  -56.877 1.00 40.32 ? 40  LEU B CG  1 
ATOM   1608 C CD1 . LEU B 1 41  ? -7.788  6.962  -58.070 1.00 40.34 ? 40  LEU B CD1 1 
ATOM   1609 C CD2 . LEU B 1 41  ? -6.019  5.481  -57.186 1.00 36.88 ? 40  LEU B CD2 1 
ATOM   1610 N N   . TYR B 1 42  ? -7.135  9.110  -53.819 1.00 30.63 ? 41  TYR B N   1 
ATOM   1611 C CA  . TYR B 1 42  ? -7.943  9.005  -52.611 1.00 34.74 ? 41  TYR B CA  1 
ATOM   1612 C C   . TYR B 1 42  ? -8.961  10.134 -52.516 1.00 33.54 ? 41  TYR B C   1 
ATOM   1613 O O   . TYR B 1 42  ? -10.125 9.906  -52.206 1.00 33.00 ? 41  TYR B O   1 
ATOM   1614 C CB  . TYR B 1 42  ? -7.072  8.997  -51.351 1.00 34.34 ? 41  TYR B CB  1 
ATOM   1615 C CG  . TYR B 1 42  ? -7.900  9.090  -50.089 1.00 35.06 ? 41  TYR B CG  1 
ATOM   1616 C CD1 . TYR B 1 42  ? -8.564  7.979  -49.578 1.00 39.70 ? 41  TYR B CD1 1 
ATOM   1617 C CD2 . TYR B 1 42  ? -8.038  10.302 -49.416 1.00 32.82 ? 41  TYR B CD2 1 
ATOM   1618 C CE1 . TYR B 1 42  ? -9.339  8.078  -48.411 1.00 36.71 ? 41  TYR B CE1 1 
ATOM   1619 C CE2 . TYR B 1 42  ? -8.798  10.400 -48.269 1.00 34.46 ? 41  TYR B CE2 1 
ATOM   1620 C CZ  . TYR B 1 42  ? -9.438  9.296  -47.772 1.00 34.16 ? 41  TYR B CZ  1 
ATOM   1621 O OH  . TYR B 1 42  ? -10.192 9.433  -46.636 1.00 40.42 ? 41  TYR B OH  1 
ATOM   1622 N N   . ALA B 1 43  ? -8.515  11.358 -52.771 1.00 34.76 ? 42  ALA B N   1 
ATOM   1623 C CA  . ALA B 1 43  ? -9.407  12.513 -52.737 1.00 35.75 ? 42  ALA B CA  1 
ATOM   1624 C C   . ALA B 1 43  ? -10.558 12.379 -53.751 1.00 37.06 ? 42  ALA B C   1 
ATOM   1625 O O   . ALA B 1 43  ? -11.717 12.677 -53.440 1.00 34.70 ? 42  ALA B O   1 
ATOM   1626 C CB  . ALA B 1 43  ? -8.613  13.790 -53.011 1.00 34.57 ? 42  ALA B CB  1 
ATOM   1627 N N   . MET B 1 44  ? -10.218 11.958 -54.969 1.00 34.40 ? 43  MET B N   1 
ATOM   1628 C CA  . MET B 1 44  ? -11.213 11.769 -56.032 1.00 35.00 ? 43  MET B CA  1 
ATOM   1629 C C   . MET B 1 44  ? -12.274 10.782 -55.599 1.00 38.71 ? 43  MET B C   1 
ATOM   1630 O O   . MET B 1 44  ? -13.478 11.041 -55.620 1.00 37.60 ? 43  MET B O   1 
ATOM   1631 C CB  . MET B 1 44  ? -10.562 11.235 -57.308 1.00 36.49 ? 43  MET B CB  1 
ATOM   1632 C CG  . MET B 1 44  ? -11.569 11.055 -58.443 1.00 39.51 ? 43  MET B CG  1 
ATOM   1633 S SD  . MET B 1 44  ? -12.010 12.665 -59.149 1.00 38.34 ? 43  MET B SD  1 
ATOM   1634 C CE  . MET B 1 44  ? -13.454 12.265 -60.128 1.00 36.58 ? 43  MET B CE  1 
ATOM   1635 N N   . GLN B 1 45  ? -11.778 9.617  -55.230 1.00 37.32 ? 44  GLN B N   1 
ATOM   1636 C CA  . GLN B 1 45  ? -12.581 8.495  -54.827 1.00 39.31 ? 44  GLN B CA  1 
ATOM   1637 C C   . GLN B 1 45  ? -13.419 8.830  -53.581 1.00 40.96 ? 44  GLN B C   1 
ATOM   1638 O O   . GLN B 1 45  ? -14.600 8.509  -53.516 1.00 43.14 ? 44  GLN B O   1 
ATOM   1639 C CB  . GLN B 1 45  ? -11.617 7.316  -54.665 1.00 41.32 ? 44  GLN B CB  1 
ATOM   1640 C CG  . GLN B 1 45  ? -12.131 6.004  -54.179 1.00 52.73 ? 44  GLN B CG  1 
ATOM   1641 C CD  . GLN B 1 45  ? -11.191 4.845  -54.583 1.00 52.74 ? 44  GLN B CD  1 
ATOM   1642 O OE1 . GLN B 1 45  ? -10.494 4.896  -55.617 1.00 45.76 ? 44  GLN B OE1 1 
ATOM   1643 N NE2 . GLN B 1 45  ? -11.111 3.843  -53.722 1.00 56.28 ? 44  GLN B NE2 1 
ATOM   1644 N N   . THR B 1 46  ? -12.838 9.547  -52.630 1.00 38.92 ? 45  THR B N   1 
ATOM   1645 C CA  . THR B 1 46  ? -13.587 9.978  -51.456 1.00 40.43 ? 45  THR B CA  1 
ATOM   1646 C C   . THR B 1 46  ? -14.622 11.068 -51.810 1.00 40.06 ? 45  THR B C   1 
ATOM   1647 O O   . THR B 1 46  ? -15.744 11.075 -51.301 1.00 38.59 ? 45  THR B O   1 
ATOM   1648 C CB  . THR B 1 46  ? -12.638 10.499 -50.359 1.00 37.73 ? 45  THR B CB  1 
ATOM   1649 O OG1 . THR B 1 46  ? -11.696 9.471  -50.016 1.00 37.02 ? 45  THR B OG1 1 
ATOM   1650 C CG2 . THR B 1 46  ? -13.428 10.879 -49.115 1.00 37.11 ? 45  THR B CG2 1 
ATOM   1651 N N   . GLY B 1 47  ? -14.237 11.992 -52.679 1.00 39.60 ? 46  GLY B N   1 
ATOM   1652 C CA  . GLY B 1 47  ? -15.135 13.048 -53.097 1.00 41.37 ? 46  GLY B CA  1 
ATOM   1653 C C   . GLY B 1 47  ? -16.351 12.543 -53.861 1.00 44.89 ? 46  GLY B C   1 
ATOM   1654 O O   . GLY B 1 47  ? -17.459 13.059 -53.675 1.00 46.65 ? 46  GLY B O   1 
ATOM   1655 N N   . MET B 1 48  ? -16.145 11.549 -54.726 1.00 42.12 ? 47  MET B N   1 
ATOM   1656 C CA  . MET B 1 48  ? -17.244 10.908 -55.458 1.00 46.99 ? 47  MET B CA  1 
ATOM   1657 C C   . MET B 1 48  ? -18.321 10.377 -54.509 1.00 46.98 ? 47  MET B C   1 
ATOM   1658 O O   . MET B 1 48  ? -19.511 10.463 -54.808 1.00 49.61 ? 47  MET B O   1 
ATOM   1659 C CB  . MET B 1 48  ? -16.727 9.759  -56.339 1.00 42.34 ? 47  MET B CB  1 
ATOM   1660 C CG  . MET B 1 48  ? -15.930 10.180 -57.563 1.00 41.38 ? 47  MET B CG  1 
ATOM   1661 S SD  . MET B 1 48  ? -16.941 11.107 -58.740 1.00 53.13 ? 47  MET B SD  1 
ATOM   1662 C CE  . MET B 1 48  ? -18.140 9.861  -59.230 1.00 50.18 ? 47  MET B CE  1 
ATOM   1663 N N   . LYS B 1 49  ? -17.900 9.831  -53.373 1.00 40.87 ? 48  LYS B N   1 
ATOM   1664 C CA  . LYS B 1 49  ? -18.836 9.319  -52.370 1.00 49.25 ? 48  LYS B CA  1 
ATOM   1665 C C   . LYS B 1 49  ? -19.544 10.442 -51.606 1.00 49.78 ? 48  LYS B C   1 
ATOM   1666 O O   . LYS B 1 49  ? -20.729 10.339 -51.299 1.00 51.75 ? 48  LYS B O   1 
ATOM   1667 C CB  . LYS B 1 49  ? -18.111 8.395  -51.373 1.00 48.15 ? 48  LYS B CB  1 
ATOM   1668 C CG  . LYS B 1 49  ? -17.602 7.097  -51.995 1.00 57.96 ? 48  LYS B CG  1 
ATOM   1669 C CD  . LYS B 1 49  ? -16.771 6.275  -51.017 1.00 64.47 ? 48  LYS B CD  1 
ATOM   1670 C CE  . LYS B 1 49  ? -16.260 4.992  -51.681 1.00 68.12 ? 48  LYS B CE  1 
ATOM   1671 N NZ  . LYS B 1 49  ? -15.362 4.189  -50.798 1.00 66.86 ? 48  LYS B NZ  1 
ATOM   1672 N N   . ILE B 1 50  ? -18.815 11.506 -51.285 1.00 47.60 ? 49  ILE B N   1 
ATOM   1673 C CA  . ILE B 1 50  ? -19.404 12.609 -50.536 1.00 48.66 ? 49  ILE B CA  1 
ATOM   1674 C C   . ILE B 1 50  ? -20.518 13.283 -51.334 1.00 52.43 ? 49  ILE B C   1 
ATOM   1675 O O   . ILE B 1 50  ? -21.652 13.381 -50.867 1.00 55.01 ? 49  ILE B O   1 
ATOM   1676 C CB  . ILE B 1 50  ? -18.344 13.668 -50.143 1.00 49.56 ? 49  ILE B CB  1 
ATOM   1677 C CG1 . ILE B 1 50  ? -17.374 13.099 -49.099 1.00 45.20 ? 49  ILE B CG1 1 
ATOM   1678 C CG2 . ILE B 1 50  ? -19.016 14.937 -49.628 1.00 47.56 ? 49  ILE B CG2 1 
ATOM   1679 C CD1 . ILE B 1 50  ? -16.160 13.966 -48.858 1.00 39.68 ? 49  ILE B CD1 1 
ATOM   1680 N N   . ASP B 1 51  ? -20.191 13.732 -52.542 1.00 53.04 ? 50  ASP B N   1 
ATOM   1681 C CA  . ASP B 1 51  ? -21.122 14.514 -53.350 1.00 52.52 ? 50  ASP B CA  1 
ATOM   1682 C C   . ASP B 1 51  ? -20.619 14.616 -54.780 1.00 52.15 ? 50  ASP B C   1 
ATOM   1683 O O   . ASP B 1 51  ? -19.592 15.238 -55.042 1.00 54.81 ? 50  ASP B O   1 
ATOM   1684 C CB  . ASP B 1 51  ? -21.310 15.911 -52.740 1.00 52.36 ? 50  ASP B CB  1 
ATOM   1685 C CG  . ASP B 1 51  ? -22.311 16.780 -53.510 1.00 57.48 ? 50  ASP B CG  1 
ATOM   1686 O OD1 . ASP B 1 51  ? -22.831 16.358 -54.565 1.00 54.12 ? 50  ASP B OD1 1 
ATOM   1687 O OD2 . ASP B 1 51  ? -22.589 17.903 -53.034 1.00 57.58 ? 50  ASP B OD2 1 
ATOM   1688 N N   . SER B 1 52  ? -21.354 14.010 -55.704 1.00 55.33 ? 51  SER B N   1 
ATOM   1689 C CA  . SER B 1 52  ? -21.015 14.082 -57.119 1.00 57.97 ? 51  SER B CA  1 
ATOM   1690 C C   . SER B 1 52  ? -22.194 14.612 -57.932 1.00 63.03 ? 51  SER B C   1 
ATOM   1691 O O   . SER B 1 52  ? -22.302 14.348 -59.131 1.00 67.40 ? 51  SER B O   1 
ATOM   1692 C CB  . SER B 1 52  ? -20.586 12.706 -57.635 1.00 59.50 ? 51  SER B CB  1 
ATOM   1693 O OG  . SER B 1 52  ? -21.646 11.773 -57.521 1.00 66.44 ? 51  SER B OG  1 
ATOM   1694 N N   . LYS B 1 53  ? -23.075 15.354 -57.266 1.00 63.51 ? 52  LYS B N   1 
ATOM   1695 C CA  . LYS B 1 53  ? -24.276 15.900 -57.895 1.00 61.09 ? 52  LYS B CA  1 
ATOM   1696 C C   . LYS B 1 53  ? -24.241 17.428 -57.915 1.00 60.29 ? 52  LYS B C   1 
ATOM   1697 O O   . LYS B 1 53  ? -24.440 18.041 -58.966 1.00 59.74 ? 52  LYS B O   1 
ATOM   1698 C CB  . LYS B 1 53  ? -25.532 15.403 -57.170 1.00 61.37 ? 52  LYS B CB  1 
ATOM   1699 N N   . THR B 1 54  ? -24.003 18.038 -56.754 1.00 58.15 ? 53  THR B N   1 
ATOM   1700 C CA  . THR B 1 54  ? -23.795 19.482 -56.686 1.00 57.09 ? 53  THR B CA  1 
ATOM   1701 C C   . THR B 1 54  ? -22.833 19.935 -57.776 1.00 55.92 ? 53  THR B C   1 
ATOM   1702 O O   . THR B 1 54  ? -21.727 19.406 -57.887 1.00 56.93 ? 53  THR B O   1 
ATOM   1703 C CB  . THR B 1 54  ? -23.234 19.915 -55.331 1.00 56.68 ? 53  THR B CB  1 
ATOM   1704 O OG1 . THR B 1 54  ? -24.164 19.573 -54.298 1.00 61.78 ? 53  THR B OG1 1 
ATOM   1705 C CG2 . THR B 1 54  ? -22.964 21.414 -55.313 1.00 55.02 ? 53  THR B CG2 1 
ATOM   1706 N N   . PRO B 1 55  ? -23.268 20.899 -58.600 1.00 55.66 ? 54  PRO B N   1 
ATOM   1707 C CA  . PRO B 1 55  ? -22.504 21.410 -59.745 1.00 53.12 ? 54  PRO B CA  1 
ATOM   1708 C C   . PRO B 1 55  ? -21.088 21.879 -59.391 1.00 49.75 ? 54  PRO B C   1 
ATOM   1709 O O   . PRO B 1 55  ? -20.153 21.550 -60.122 1.00 48.30 ? 54  PRO B O   1 
ATOM   1710 C CB  . PRO B 1 55  ? -23.362 22.584 -60.232 1.00 57.49 ? 54  PRO B CB  1 
ATOM   1711 C CG  . PRO B 1 55  ? -24.754 22.213 -59.830 1.00 53.02 ? 54  PRO B CG  1 
ATOM   1712 C CD  . PRO B 1 55  ? -24.616 21.494 -58.522 1.00 56.88 ? 54  PRO B CD  1 
ATOM   1713 N N   . GLU B 1 56  ? -20.934 22.654 -58.319 1.00 48.78 ? 55  GLU B N   1 
ATOM   1714 C CA  . GLU B 1 56  ? -19.603 23.056 -57.876 1.00 48.94 ? 55  GLU B CA  1 
ATOM   1715 C C   . GLU B 1 56  ? -18.721 21.827 -57.615 1.00 47.65 ? 55  GLU B C   1 
ATOM   1716 O O   . GLU B 1 56  ? -17.543 21.797 -57.981 1.00 45.52 ? 55  GLU B O   1 
ATOM   1717 C CB  . GLU B 1 56  ? -19.668 23.898 -56.606 1.00 50.48 ? 55  GLU B CB  1 
ATOM   1718 C CG  . GLU B 1 56  ? -18.297 24.390 -56.204 1.00 51.19 ? 55  GLU B CG  1 
ATOM   1719 C CD  . GLU B 1 56  ? -18.265 25.058 -54.853 1.00 54.93 ? 55  GLU B CD  1 
ATOM   1720 O OE1 . GLU B 1 56  ? -19.309 25.065 -54.154 1.00 62.38 ? 55  GLU B OE1 1 
ATOM   1721 O OE2 . GLU B 1 56  ? -17.181 25.563 -54.486 1.00 51.15 ? 55  GLU B OE2 1 
ATOM   1722 N N   . CYS B 1 57  ? -19.303 20.811 -56.987 1.00 44.86 ? 56  CYS B N   1 
ATOM   1723 C CA  . CYS B 1 57  ? -18.561 19.601 -56.668 1.00 46.63 ? 56  CYS B CA  1 
ATOM   1724 C C   . CYS B 1 57  ? -18.182 18.794 -57.903 1.00 45.96 ? 56  CYS B C   1 
ATOM   1725 O O   . CYS B 1 57  ? -17.032 18.370 -58.025 1.00 45.40 ? 56  CYS B O   1 
ATOM   1726 C CB  . CYS B 1 57  ? -19.359 18.738 -55.699 1.00 49.94 ? 56  CYS B CB  1 
ATOM   1727 S SG  . CYS B 1 57  ? -19.535 19.496 -54.064 1.00 53.37 ? 56  CYS B SG  1 
ATOM   1728 N N   . ARG B 1 58  ? -19.139 18.589 -58.811 1.00 47.46 ? 57  ARG B N   1 
ATOM   1729 C CA  . ARG B 1 58  ? -18.900 17.834 -60.041 1.00 45.54 ? 57  ARG B CA  1 
ATOM   1730 C C   . ARG B 1 58  ? -17.786 18.470 -60.833 1.00 44.07 ? 57  ARG B C   1 
ATOM   1731 O O   . ARG B 1 58  ? -16.905 17.786 -61.376 1.00 45.31 ? 57  ARG B O   1 
ATOM   1732 C CB  . ARG B 1 58  ? -20.156 17.774 -60.922 1.00 49.93 ? 57  ARG B CB  1 
ATOM   1733 C CG  . ARG B 1 58  ? -21.207 16.775 -60.490 1.00 52.77 ? 57  ARG B CG  1 
ATOM   1734 N N   . LYS B 1 59  ? -17.848 19.789 -60.910 1.00 42.65 ? 58  LYS B N   1 
ATOM   1735 C CA  . LYS B 1 59  ? -16.871 20.566 -61.650 1.00 44.93 ? 58  LYS B CA  1 
ATOM   1736 C C   . LYS B 1 59  ? -15.496 20.370 -61.028 1.00 44.00 ? 58  LYS B C   1 
ATOM   1737 O O   . LYS B 1 59  ? -14.499 20.234 -61.734 1.00 43.39 ? 58  LYS B O   1 
ATOM   1738 C CB  . LYS B 1 59  ? -17.260 22.048 -61.656 1.00 44.24 ? 58  LYS B CB  1 
ATOM   1739 C CG  . LYS B 1 59  ? -16.380 22.925 -62.529 1.00 48.95 ? 58  LYS B CG  1 
ATOM   1740 C CD  . LYS B 1 59  ? -16.423 22.460 -63.980 1.00 57.29 ? 58  LYS B CD  1 
ATOM   1741 N N   . PHE B 1 60  ? -15.449 20.360 -59.698 1.00 44.66 ? 59  PHE B N   1 
ATOM   1742 C CA  . PHE B 1 60  ? -14.181 20.183 -59.004 1.00 43.40 ? 59  PHE B CA  1 
ATOM   1743 C C   . PHE B 1 60  ? -13.617 18.789 -59.290 1.00 37.28 ? 59  PHE B C   1 
ATOM   1744 O O   . PHE B 1 60  ? -12.450 18.653 -59.644 1.00 39.93 ? 59  PHE B O   1 
ATOM   1745 C CB  . PHE B 1 60  ? -14.331 20.385 -57.489 1.00 38.74 ? 59  PHE B CB  1 
ATOM   1746 C CG  . PHE B 1 60  ? -13.055 20.169 -56.744 1.00 41.16 ? 59  PHE B CG  1 
ATOM   1747 C CD1 . PHE B 1 60  ? -12.149 21.206 -56.593 1.00 41.33 ? 59  PHE B CD1 1 
ATOM   1748 C CD2 . PHE B 1 60  ? -12.720 18.906 -56.261 1.00 38.39 ? 59  PHE B CD2 1 
ATOM   1749 C CE1 . PHE B 1 60  ? -10.951 21.016 -55.930 1.00 40.07 ? 59  PHE B CE1 1 
ATOM   1750 C CE2 . PHE B 1 60  ? -11.523 18.704 -55.605 1.00 40.34 ? 59  PHE B CE2 1 
ATOM   1751 C CZ  . PHE B 1 60  ? -10.635 19.766 -55.435 1.00 38.29 ? 59  PHE B CZ  1 
ATOM   1752 N N   . LEU B 1 61  ? -14.454 17.765 -59.128 1.00 35.60 ? 60  LEU B N   1 
ATOM   1753 C CA  . LEU B 1 61  ? -14.040 16.370 -59.356 1.00 42.28 ? 60  LEU B CA  1 
ATOM   1754 C C   . LEU B 1 61  ? -13.562 16.143 -60.783 1.00 41.99 ? 60  LEU B C   1 
ATOM   1755 O O   . LEU B 1 61  ? -12.587 15.420 -61.016 1.00 41.20 ? 60  LEU B O   1 
ATOM   1756 C CB  . LEU B 1 61  ? -15.187 15.414 -59.037 1.00 38.38 ? 60  LEU B CB  1 
ATOM   1757 C CG  . LEU B 1 61  ? -15.553 15.445 -57.553 1.00 41.12 ? 60  LEU B CG  1 
ATOM   1758 C CD1 . LEU B 1 61  ? -16.792 14.619 -57.269 1.00 41.14 ? 60  LEU B CD1 1 
ATOM   1759 C CD2 . LEU B 1 61  ? -14.370 14.956 -56.726 1.00 39.90 ? 60  LEU B CD2 1 
ATOM   1760 N N   . SER B 1 62  ? -14.253 16.771 -61.729 1.00 39.44 ? 61  SER B N   1 
ATOM   1761 C CA  . SER B 1 62  ? -13.886 16.699 -63.141 1.00 42.01 ? 61  SER B CA  1 
ATOM   1762 C C   . SER B 1 62  ? -12.464 17.200 -63.359 1.00 39.20 ? 61  SER B C   1 
ATOM   1763 O O   . SER B 1 62  ? -11.660 16.545 -64.034 1.00 40.69 ? 61  SER B O   1 
ATOM   1764 C CB  . SER B 1 62  ? -14.881 17.507 -63.996 1.00 38.85 ? 61  SER B CB  1 
ATOM   1765 O OG  . SER B 1 62  ? -14.521 17.482 -65.367 1.00 50.15 ? 61  SER B OG  1 
ATOM   1766 N N   . LYS B 1 63  ? -12.143 18.357 -62.783 1.00 38.63 ? 62  LYS B N   1 
ATOM   1767 C CA  . LYS B 1 63  ? -10.795 18.907 -62.927 1.00 38.10 ? 62  LYS B CA  1 
ATOM   1768 C C   . LYS B 1 63  ? -9.757  18.041 -62.186 1.00 38.39 ? 62  LYS B C   1 
ATOM   1769 O O   . LYS B 1 63  ? -8.613  17.903 -62.625 1.00 37.79 ? 62  LYS B O   1 
ATOM   1770 C CB  . LYS B 1 63  ? -10.755 20.354 -62.423 1.00 40.56 ? 62  LYS B CB  1 
ATOM   1771 C CG  . LYS B 1 63  ? -11.730 21.307 -63.132 1.00 46.40 ? 62  LYS B CG  1 
ATOM   1772 C CD  . LYS B 1 63  ? -11.344 21.527 -64.602 1.00 42.79 ? 62  LYS B CD  1 
ATOM   1773 N N   . LEU B 1 64  ? -10.162 17.457 -61.063 1.00 38.41 ? 63  LEU B N   1 
ATOM   1774 C CA  . LEU B 1 64  ? -9.280  16.549 -60.334 1.00 38.27 ? 63  LEU B CA  1 
ATOM   1775 C C   . LEU B 1 64  ? -9.025  15.342 -61.221 1.00 38.65 ? 63  LEU B C   1 
ATOM   1776 O O   . LEU B 1 64  ? -7.891  14.858 -61.347 1.00 39.17 ? 63  LEU B O   1 
ATOM   1777 C CB  . LEU B 1 64  ? -9.893  16.149 -58.987 1.00 33.94 ? 63  LEU B CB  1 
ATOM   1778 C CG  . LEU B 1 64  ? -9.104  15.206 -58.059 1.00 35.57 ? 63  LEU B CG  1 
ATOM   1779 C CD1 . LEU B 1 64  ? -7.727  15.736 -57.762 1.00 34.79 ? 63  LEU B CD1 1 
ATOM   1780 C CD2 . LEU B 1 64  ? -9.845  15.038 -56.742 1.00 29.56 ? 63  LEU B CD2 1 
ATOM   1781 N N   . MET B 1 65  ? -10.080 14.880 -61.881 1.00 37.23 ? 64  MET B N   1 
ATOM   1782 C CA  . MET B 1 65  ? -9.935  13.724 -62.737 1.00 35.69 ? 64  MET B CA  1 
ATOM   1783 C C   . MET B 1 65  ? -9.006  14.067 -63.898 1.00 40.51 ? 64  MET B C   1 
ATOM   1784 O O   . MET B 1 65  ? -8.193  13.236 -64.292 1.00 38.68 ? 64  MET B O   1 
ATOM   1785 C CB  . MET B 1 65  ? -11.294 13.229 -63.225 1.00 39.48 ? 64  MET B CB  1 
ATOM   1786 C CG  . MET B 1 65  ? -11.214 11.961 -64.063 1.00 40.39 ? 64  MET B CG  1 
ATOM   1787 S SD  . MET B 1 65  ? -10.464 10.526 -63.222 1.00 45.32 ? 64  MET B SD  1 
ATOM   1788 C CE  . MET B 1 65  ? -11.719 10.131 -62.055 1.00 38.76 ? 64  MET B CE  1 
ATOM   1789 N N   . ASP B 1 66  ? -9.082  15.300 -64.409 1.00 38.94 ? 65  ASP B N   1 
ATOM   1790 C CA  . ASP B 1 66  ? -8.127  15.749 -65.429 1.00 40.46 ? 65  ASP B CA  1 
ATOM   1791 C C   . ASP B 1 66  ? -6.676  15.626 -64.956 1.00 40.11 ? 65  ASP B C   1 
ATOM   1792 O O   . ASP B 1 66  ? -5.799  15.243 -65.730 1.00 41.85 ? 65  ASP B O   1 
ATOM   1793 C CB  . ASP B 1 66  ? -8.385  17.209 -65.837 1.00 42.77 ? 65  ASP B CB  1 
ATOM   1794 C CG  . ASP B 1 66  ? -9.671  17.391 -66.623 1.00 43.86 ? 65  ASP B CG  1 
ATOM   1795 O OD1 . ASP B 1 66  ? -10.221 16.398 -67.153 1.00 45.15 ? 65  ASP B OD1 1 
ATOM   1796 O OD2 . ASP B 1 66  ? -10.135 18.546 -66.702 1.00 53.25 ? 65  ASP B OD2 1 
ATOM   1797 N N   . GLN B 1 67  ? -6.417  15.982 -63.700 1.00 38.65 ? 66  GLN B N   1 
ATOM   1798 C CA  . GLN B 1 67  ? -5.075  15.849 -63.132 1.00 41.49 ? 66  GLN B CA  1 
ATOM   1799 C C   . GLN B 1 67  ? -4.636  14.385 -63.000 1.00 38.24 ? 66  GLN B C   1 
ATOM   1800 O O   . GLN B 1 67  ? -3.508  14.044 -63.346 1.00 38.50 ? 66  GLN B O   1 
ATOM   1801 C CB  . GLN B 1 67  ? -4.985  16.538 -61.760 1.00 44.66 ? 66  GLN B CB  1 
ATOM   1802 C CG  . GLN B 1 67  ? -5.123  18.056 -61.817 1.00 42.20 ? 66  GLN B CG  1 
ATOM   1803 C CD  . GLN B 1 67  ? -4.850  18.710 -60.482 1.00 47.36 ? 66  GLN B CD  1 
ATOM   1804 O OE1 . GLN B 1 67  ? -4.946  18.068 -59.436 1.00 47.42 ? 66  GLN B OE1 1 
ATOM   1805 N NE2 . GLN B 1 67  ? -4.492  19.995 -60.509 1.00 49.01 ? 66  GLN B NE2 1 
ATOM   1806 N N   . LEU B 1 68  ? -5.524  13.538 -62.489 1.00 35.97 ? 67  LEU B N   1 
ATOM   1807 C CA  . LEU B 1 68  ? -5.244  12.105 -62.361 1.00 40.34 ? 67  LEU B CA  1 
ATOM   1808 C C   . LEU B 1 68  ? -4.894  11.459 -63.694 1.00 41.84 ? 67  LEU B C   1 
ATOM   1809 O O   . LEU B 1 68  ? -3.887  10.769 -63.797 1.00 40.50 ? 67  LEU B O   1 
ATOM   1810 C CB  . LEU B 1 68  ? -6.437  11.382 -61.740 1.00 32.62 ? 67  LEU B CB  1 
ATOM   1811 C CG  . LEU B 1 68  ? -6.600  11.655 -60.252 1.00 39.60 ? 67  LEU B CG  1 
ATOM   1812 C CD1 . LEU B 1 68  ? -7.948  11.170 -59.771 1.00 34.95 ? 67  LEU B CD1 1 
ATOM   1813 C CD2 . LEU B 1 68  ? -5.469  10.923 -59.503 1.00 34.78 ? 67  LEU B CD2 1 
ATOM   1814 N N   . GLU B 1 69  ? -5.718  11.698 -64.711 1.00 37.86 ? 68  GLU B N   1 
ATOM   1815 C CA  . GLU B 1 69  ? -5.462  11.149 -66.043 1.00 44.06 ? 68  GLU B CA  1 
ATOM   1816 C C   . GLU B 1 69  ? -4.123  11.602 -66.627 1.00 42.81 ? 68  GLU B C   1 
ATOM   1817 O O   . GLU B 1 69  ? -3.385  10.803 -67.206 1.00 43.41 ? 68  GLU B O   1 
ATOM   1818 C CB  . GLU B 1 69  ? -6.606  11.520 -66.992 1.00 41.00 ? 68  GLU B CB  1 
ATOM   1819 C CG  . GLU B 1 69  ? -7.891  10.799 -66.644 1.00 42.18 ? 68  GLU B CG  1 
ATOM   1820 C CD  . GLU B 1 69  ? -9.073  11.223 -67.487 1.00 43.44 ? 68  GLU B CD  1 
ATOM   1821 O OE1 . GLU B 1 69  ? -8.968  12.228 -68.217 1.00 48.25 ? 68  GLU B OE1 1 
ATOM   1822 O OE2 . GLU B 1 69  ? -10.122 10.552 -67.404 1.00 44.37 ? 68  GLU B OE2 1 
ATOM   1823 N N   . ALA B 1 70  ? -3.797  12.878 -66.467 1.00 41.68 ? 69  ALA B N   1 
ATOM   1824 C CA  . ALA B 1 70  ? -2.521  13.374 -66.962 1.00 42.73 ? 69  ALA B CA  1 
ATOM   1825 C C   . ALA B 1 70  ? -1.371  12.864 -66.105 1.00 43.02 ? 69  ALA B C   1 
ATOM   1826 O O   . ALA B 1 70  ? -0.273  12.624 -66.609 1.00 45.16 ? 69  ALA B O   1 
ATOM   1827 C CB  . ALA B 1 70  ? -2.512  14.902 -67.005 1.00 44.35 ? 69  ALA B CB  1 
ATOM   1828 N N   . LEU B 1 71  ? -1.611  12.695 -64.809 1.00 42.26 ? 70  LEU B N   1 
ATOM   1829 C CA  . LEU B 1 71  ? -0.517  12.321 -63.935 1.00 44.46 ? 70  LEU B CA  1 
ATOM   1830 C C   . LEU B 1 71  ? -0.212  10.837 -64.198 1.00 42.29 ? 70  LEU B C   1 
ATOM   1831 O O   . LEU B 1 71  ? 0.944   10.419 -64.193 1.00 44.80 ? 70  LEU B O   1 
ATOM   1832 C CB  . LEU B 1 71  ? -0.860  12.533 -62.463 1.00 48.48 ? 70  LEU B CB  1 
ATOM   1833 C CG  . LEU B 1 71  ? 0.271   13.026 -61.537 1.00 46.64 ? 70  LEU B CG  1 
ATOM   1834 C CD1 . LEU B 1 71  ? -0.219  13.238 -60.086 1.00 41.80 ? 70  LEU B CD1 1 
ATOM   1835 C CD2 . LEU B 1 71  ? 1.593   12.308 -61.607 1.00 41.99 ? 70  LEU B CD2 1 
ATOM   1836 N N   . LYS B 1 72  ? -1.256  10.050 -64.451 1.00 41.59 ? 71  LYS B N   1 
ATOM   1837 C CA  . LYS B 1 72  ? -1.089  8.620  -64.722 1.00 42.23 ? 71  LYS B CA  1 
ATOM   1838 C C   . LYS B 1 72  ? -0.321  8.352  -66.015 1.00 43.84 ? 71  LYS B C   1 
ATOM   1839 O O   . LYS B 1 72  ? 0.567   7.501  -66.039 1.00 39.15 ? 71  LYS B O   1 
ATOM   1840 C CB  . LYS B 1 72  ? -2.439  7.892  -64.796 1.00 40.97 ? 71  LYS B CB  1 
ATOM   1841 C CG  . LYS B 1 72  ? -2.250  6.378  -64.926 1.00 40.69 ? 71  LYS B CG  1 
ATOM   1842 C CD  . LYS B 1 72  ? -3.545  5.581  -64.994 1.00 38.82 ? 71  LYS B CD  1 
ATOM   1843 C CE  . LYS B 1 72  ? -3.238  4.082  -65.069 1.00 34.82 ? 71  LYS B CE  1 
ATOM   1844 N NZ  . LYS B 1 72  ? -4.502  3.277  -65.120 1.00 35.45 ? 71  LYS B NZ  1 
ATOM   1845 N N   . LYS B 1 73  ? -0.670  9.057  -67.091 1.00 44.70 ? 72  LYS B N   1 
ATOM   1846 C CA  . LYS B 1 73  ? 0.040   8.877  -68.359 1.00 46.18 ? 72  LYS B CA  1 
ATOM   1847 C C   . LYS B 1 73  ? 1.515   9.269  -68.195 1.00 47.71 ? 72  LYS B C   1 
ATOM   1848 O O   . LYS B 1 73  ? 2.416   8.523  -68.552 1.00 48.90 ? 72  LYS B O   1 
ATOM   1849 C CB  . LYS B 1 73  ? -0.618  9.691  -69.479 1.00 47.60 ? 72  LYS B CB  1 
ATOM   1850 C CG  . LYS B 1 73  ? -1.966  9.135  -69.924 1.00 46.85 ? 72  LYS B CG  1 
ATOM   1851 C CD  . LYS B 1 73  ? -2.672  10.080 -70.891 1.00 52.70 ? 72  LYS B CD  1 
ATOM   1852 N N   . GLN B 1 74  ? 1.742   10.445 -67.635 1.00 47.48 ? 73  GLN B N   1 
ATOM   1853 C CA  . GLN B 1 74  ? 3.061   10.893 -67.215 1.00 46.82 ? 73  GLN B CA  1 
ATOM   1854 C C   . GLN B 1 74  ? 3.839   9.899  -66.341 1.00 45.60 ? 73  GLN B C   1 
ATOM   1855 O O   . GLN B 1 74  ? 5.061   9.802  -66.442 1.00 42.24 ? 73  GLN B O   1 
ATOM   1856 C CB  . GLN B 1 74  ? 2.885   12.230 -66.494 1.00 54.60 ? 73  GLN B CB  1 
ATOM   1857 C CG  . GLN B 1 74  ? 4.091   12.790 -65.780 1.00 56.54 ? 73  GLN B CG  1 
ATOM   1858 C CD  . GLN B 1 74  ? 3.861   14.251 -65.448 1.00 70.25 ? 73  GLN B CD  1 
ATOM   1859 O OE1 . GLN B 1 74  ? 2.986   14.901 -66.044 1.00 66.08 ? 73  GLN B OE1 1 
ATOM   1860 N NE2 . GLN B 1 74  ? 4.593   14.763 -64.460 1.00 70.70 ? 73  GLN B NE2 1 
ATOM   1861 N N   . LEU B 1 75  ? 3.143   9.169  -65.477 1.00 42.13 ? 74  LEU B N   1 
ATOM   1862 C CA  . LEU B 1 75  ? 3.805   8.149  -64.684 1.00 42.86 ? 74  LEU B CA  1 
ATOM   1863 C C   . LEU B 1 75  ? 3.611   6.755  -65.288 1.00 48.18 ? 74  LEU B C   1 
ATOM   1864 O O   . LEU B 1 75  ? 3.732   5.755  -64.582 1.00 44.66 ? 74  LEU B O   1 
ATOM   1865 C CB  . LEU B 1 75  ? 3.289   8.157  -63.243 1.00 44.79 ? 74  LEU B CB  1 
ATOM   1866 C CG  . LEU B 1 75  ? 3.579   9.411  -62.415 1.00 45.31 ? 74  LEU B CG  1 
ATOM   1867 C CD1 . LEU B 1 75  ? 2.931   9.261  -61.049 1.00 41.43 ? 74  LEU B CD1 1 
ATOM   1868 C CD2 . LEU B 1 75  ? 5.072   9.633  -62.290 1.00 42.28 ? 74  LEU B CD2 1 
ATOM   1869 N N   . GLY B 1 76  ? 3.335   6.701  -66.589 1.00 41.55 ? 75  GLY B N   1 
ATOM   1870 C CA  . GLY B 1 76  ? 2.933   5.481  -67.259 1.00 42.49 ? 75  GLY B CA  1 
ATOM   1871 C C   . GLY B 1 76  ? 3.846   4.274  -67.150 1.00 45.38 ? 75  GLY B C   1 
ATOM   1872 O O   . GLY B 1 76  ? 3.383   3.150  -67.089 1.00 46.62 ? 75  GLY B O   1 
ATOM   1873 N N   . ASP B 1 77  ? 5.149   4.495  -67.135 1.00 43.43 ? 76  ASP B N   1 
ATOM   1874 C CA  . ASP B 1 77  ? 6.069   3.382  -67.022 1.00 47.24 ? 76  ASP B CA  1 
ATOM   1875 C C   . ASP B 1 77  ? 6.671   3.298  -65.616 1.00 50.79 ? 76  ASP B C   1 
ATOM   1876 O O   . ASP B 1 77  ? 7.759   2.752  -65.413 1.00 51.75 ? 76  ASP B O   1 
ATOM   1877 C CB  . ASP B 1 77  ? 7.149   3.505  -68.096 1.00 54.60 ? 76  ASP B CB  1 
ATOM   1878 C CG  . ASP B 1 77  ? 6.624   3.155  -69.490 1.00 68.85 ? 76  ASP B CG  1 
ATOM   1879 O OD1 . ASP B 1 77  ? 5.600   2.431  -69.586 1.00 73.84 ? 76  ASP B OD1 1 
ATOM   1880 O OD2 . ASP B 1 77  ? 7.225   3.613  -70.491 1.00 77.79 ? 76  ASP B OD2 1 
ATOM   1881 N N   . ASN B 1 78  ? 5.947   3.836  -64.641 1.00 44.32 ? 77  ASN B N   1 
ATOM   1882 C CA  . ASN B 1 78  ? 6.353   3.720  -63.248 1.00 39.45 ? 77  ASN B CA  1 
ATOM   1883 C C   . ASN B 1 78  ? 5.640   2.525  -62.635 1.00 36.63 ? 77  ASN B C   1 
ATOM   1884 O O   . ASN B 1 78  ? 4.412   2.441  -62.584 1.00 38.74 ? 77  ASN B O   1 
ATOM   1885 C CB  . ASN B 1 78  ? 6.082   5.034  -62.500 1.00 39.35 ? 77  ASN B CB  1 
ATOM   1886 C CG  . ASN B 1 78  ? 6.587   5.019  -61.075 1.00 42.56 ? 77  ASN B CG  1 
ATOM   1887 O OD1 . ASN B 1 78  ? 6.473   4.018  -60.361 1.00 38.85 ? 77  ASN B OD1 1 
ATOM   1888 N ND2 . ASN B 1 78  ? 7.240   6.112  -60.680 1.00 42.06 ? 77  ASN B ND2 1 
ATOM   1889 N N   . GLU B 1 79  ? 6.434   1.572  -62.196 1.00 39.57 ? 78  GLU B N   1 
ATOM   1890 C CA  . GLU B 1 79  ? 5.897   0.313  -61.752 1.00 40.15 ? 78  GLU B CA  1 
ATOM   1891 C C   . GLU B 1 79  ? 4.975   0.496  -60.546 1.00 37.66 ? 78  GLU B C   1 
ATOM   1892 O O   . GLU B 1 79  ? 4.045   -0.288 -60.354 1.00 37.66 ? 78  GLU B O   1 
ATOM   1893 C CB  . GLU B 1 79  ? 7.056   -0.641 -61.466 1.00 45.05 ? 78  GLU B CB  1 
ATOM   1894 C CG  . GLU B 1 79  ? 6.643   -2.080 -61.245 1.00 56.49 ? 78  GLU B CG  1 
ATOM   1895 C CD  . GLU B 1 79  ? 7.817   -3.056 -61.342 1.00 64.43 ? 78  GLU B CD  1 
ATOM   1896 O OE1 . GLU B 1 79  ? 8.959   -2.609 -61.590 1.00 69.69 ? 78  GLU B OE1 1 
ATOM   1897 O OE2 . GLU B 1 79  ? 7.588   -4.277 -61.186 1.00 66.13 ? 78  GLU B OE2 1 
ATOM   1898 N N   . ALA B 1 80  ? 5.191   1.556  -59.759 1.00 37.24 ? 79  ALA B N   1 
ATOM   1899 C CA  . ALA B 1 80  ? 4.299   1.852  -58.625 1.00 33.54 ? 79  ALA B CA  1 
ATOM   1900 C C   . ALA B 1 80  ? 2.914   2.309  -59.100 1.00 35.45 ? 79  ALA B C   1 
ATOM   1901 O O   . ALA B 1 80  ? 1.939   2.297  -58.342 1.00 32.70 ? 79  ALA B O   1 
ATOM   1902 C CB  . ALA B 1 80  ? 4.929   2.910  -57.705 1.00 36.57 ? 79  ALA B CB  1 
ATOM   1903 N N   . ILE B 1 81  ? 2.819   2.704  -60.366 1.00 32.19 ? 80  ILE B N   1 
ATOM   1904 C CA  . ILE B 1 81  ? 1.534   3.073  -60.919 1.00 29.39 ? 80  ILE B CA  1 
ATOM   1905 C C   . ILE B 1 81  ? 0.892   1.909  -61.685 1.00 33.12 ? 80  ILE B C   1 
ATOM   1906 O O   . ILE B 1 81  ? -0.326  1.710  -61.612 1.00 32.47 ? 80  ILE B O   1 
ATOM   1907 C CB  . ILE B 1 81  ? 1.672   4.295  -61.853 1.00 34.11 ? 80  ILE B CB  1 
ATOM   1908 C CG1 . ILE B 1 81  ? 2.375   5.440  -61.118 1.00 37.69 ? 80  ILE B CG1 1 
ATOM   1909 C CG2 . ILE B 1 81  ? 0.304   4.720  -62.371 1.00 34.88 ? 80  ILE B CG2 1 
ATOM   1910 C CD1 . ILE B 1 81  ? 1.639   5.935  -59.858 1.00 30.92 ? 80  ILE B CD1 1 
ATOM   1911 N N   . THR B 1 82  ? 1.700   1.141  -62.417 1.00 35.74 ? 81  THR B N   1 
ATOM   1912 C CA  . THR B 1 82  ? 1.164   -0.005 -63.169 1.00 37.66 ? 81  THR B CA  1 
ATOM   1913 C C   . THR B 1 82  ? 0.865   -1.220 -62.284 1.00 38.80 ? 81  THR B C   1 
ATOM   1914 O O   . THR B 1 82  ? 0.076   -2.083 -62.669 1.00 37.30 ? 81  THR B O   1 
ATOM   1915 C CB  . THR B 1 82  ? 2.115   -0.465 -64.298 1.00 37.25 ? 81  THR B CB  1 
ATOM   1916 O OG1 . THR B 1 82  ? 3.383   -0.832 -63.745 1.00 38.95 ? 81  THR B OG1 1 
ATOM   1917 C CG2 . THR B 1 82  ? 2.299   0.642  -65.360 1.00 38.40 ? 81  THR B CG2 1 
ATOM   1918 N N   . GLN B 1 83  ? 1.474   -1.289 -61.098 1.00 39.82 ? 82  GLN B N   1 
ATOM   1919 C CA  . GLN B 1 83  ? 1.246   -2.438 -60.210 1.00 34.72 ? 82  GLN B CA  1 
ATOM   1920 C C   . GLN B 1 83  ? 0.814   -1.956 -58.821 1.00 39.24 ? 82  GLN B C   1 
ATOM   1921 O O   . GLN B 1 83  ? 1.598   -1.334 -58.112 1.00 32.26 ? 82  GLN B O   1 
ATOM   1922 C CB  . GLN B 1 83  ? 2.513   -3.284 -60.086 1.00 38.46 ? 82  GLN B CB  1 
ATOM   1923 C CG  . GLN B 1 83  ? 3.173   -3.596 -61.424 1.00 43.26 ? 82  GLN B CG  1 
ATOM   1924 C CD  . GLN B 1 83  ? 4.333   -4.568 -61.332 1.00 47.74 ? 82  GLN B CD  1 
ATOM   1925 O OE1 . GLN B 1 83  ? 4.641   -5.103 -60.269 1.00 46.02 ? 82  GLN B OE1 1 
ATOM   1926 N NE2 . GLN B 1 83  ? 5.067   -4.690 -62.429 1.00 52.95 ? 82  GLN B NE2 1 
ATOM   1927 N N   . GLU B 1 84  ? -0.429  -2.238 -58.437 1.00 38.44 ? 83  GLU B N   1 
ATOM   1928 C CA  . GLU B 1 84  ? -0.934  -1.794 -57.148 1.00 38.12 ? 83  GLU B CA  1 
ATOM   1929 C C   . GLU B 1 84  ? -0.156  -2.362 -55.972 1.00 40.81 ? 83  GLU B C   1 
ATOM   1930 O O   . GLU B 1 84  ? -0.103  -1.733 -54.919 1.00 40.58 ? 83  GLU B O   1 
ATOM   1931 C CB  . GLU B 1 84  ? -2.422  -2.135 -56.997 1.00 36.79 ? 83  GLU B CB  1 
ATOM   1932 C CG  . GLU B 1 84  ? -3.324  -1.218 -57.839 1.00 43.84 ? 83  GLU B CG  1 
ATOM   1933 C CD  . GLU B 1 84  ? -3.402  -1.646 -59.299 1.00 44.55 ? 83  GLU B CD  1 
ATOM   1934 O OE1 . GLU B 1 84  ? -2.847  -2.722 -59.641 1.00 42.49 ? 83  GLU B OE1 1 
ATOM   1935 O OE2 . GLU B 1 84  ? -3.970  -0.880 -60.112 1.00 44.41 ? 83  GLU B OE2 1 
ATOM   1936 N N   . ILE B 1 85  ? 0.454   -3.530 -56.144 1.00 34.88 ? 84  ILE B N   1 
ATOM   1937 C CA  . ILE B 1 85  ? 1.184   -4.125 -55.049 1.00 38.35 ? 84  ILE B CA  1 
ATOM   1938 C C   . ILE B 1 85  ? 2.472   -3.312 -54.824 1.00 38.91 ? 84  ILE B C   1 
ATOM   1939 O O   . ILE B 1 85  ? 2.951   -3.203 -53.702 1.00 40.41 ? 84  ILE B O   1 
ATOM   1940 C CB  . ILE B 1 85  ? 1.482   -5.621 -55.311 1.00 42.24 ? 84  ILE B CB  1 
ATOM   1941 C CG1 . ILE B 1 85  ? 1.896   -6.326 -54.023 1.00 46.48 ? 84  ILE B CG1 1 
ATOM   1942 C CG2 . ILE B 1 85  ? 2.581   -5.792 -56.343 1.00 42.14 ? 84  ILE B CG2 1 
ATOM   1943 C CD1 . ILE B 1 85  ? 1.936   -7.827 -54.164 1.00 49.56 ? 84  ILE B CD1 1 
ATOM   1944 N N   . VAL B 1 86  ? 3.005   -2.709 -55.882 1.00 33.39 ? 85  VAL B N   1 
ATOM   1945 C CA  . VAL B 1 86  ? 4.204   -1.890 -55.770 1.00 32.10 ? 85  VAL B CA  1 
ATOM   1946 C C   . VAL B 1 86  ? 3.838   -0.495 -55.214 1.00 38.26 ? 85  VAL B C   1 
ATOM   1947 O O   . VAL B 1 86  ? 4.568   0.072  -54.397 1.00 35.34 ? 85  VAL B O   1 
ATOM   1948 C CB  . VAL B 1 86  ? 4.921   -1.757 -57.137 1.00 36.73 ? 85  VAL B CB  1 
ATOM   1949 C CG1 . VAL B 1 86  ? 6.137   -0.842 -57.042 1.00 30.19 ? 85  VAL B CG1 1 
ATOM   1950 C CG2 . VAL B 1 86  ? 5.317   -3.172 -57.702 1.00 34.98 ? 85  VAL B CG2 1 
ATOM   1951 N N   . GLY B 1 87  ? 2.698   0.047  -55.646 1.00 34.33 ? 86  GLY B N   1 
ATOM   1952 C CA  . GLY B 1 87  ? 2.255   1.345  -55.180 1.00 35.12 ? 86  GLY B CA  1 
ATOM   1953 C C   . GLY B 1 87  ? 1.880   1.327  -53.709 1.00 34.57 ? 86  GLY B C   1 
ATOM   1954 O O   . GLY B 1 87  ? 2.197   2.255  -52.960 1.00 31.68 ? 86  GLY B O   1 
ATOM   1955 N N   . CYS B 1 88  ? 1.187   0.272  -53.299 1.00 33.18 ? 87  CYS B N   1 
ATOM   1956 C CA  . CYS B 1 88  ? 0.856   0.090  -51.897 1.00 36.04 ? 87  CYS B CA  1 
ATOM   1957 C C   . CYS B 1 88  ? 2.137   -0.024 -51.048 1.00 40.07 ? 87  CYS B C   1 
ATOM   1958 O O   . CYS B 1 88  ? 2.250   0.619  -49.989 1.00 37.39 ? 87  CYS B O   1 
ATOM   1959 C CB  . CYS B 1 88  ? -0.032  -1.136 -51.717 1.00 39.27 ? 87  CYS B CB  1 
ATOM   1960 S SG  . CYS B 1 88  ? -0.636  -1.407 -50.028 1.00 41.93 ? 87  CYS B SG  1 
ATOM   1961 N N   . ALA B 1 89  ? 3.110   -0.805 -51.519 1.00 34.43 ? 88  ALA B N   1 
ATOM   1962 C CA  . ALA B 1 89  ? 4.381   -0.917 -50.811 1.00 33.97 ? 88  ALA B CA  1 
ATOM   1963 C C   . ALA B 1 89  ? 5.073   0.439  -50.672 1.00 35.46 ? 88  ALA B C   1 
ATOM   1964 O O   . ALA B 1 89  ? 5.642   0.742  -49.620 1.00 34.08 ? 88  ALA B O   1 
ATOM   1965 C CB  . ALA B 1 89  ? 5.300   -1.903 -51.510 1.00 32.10 ? 88  ALA B CB  1 
ATOM   1966 N N   . HIS B 1 90  ? 5.005   1.251  -51.727 1.00 34.52 ? 89  HIS B N   1 
ATOM   1967 C CA  . HIS B 1 90  ? 5.637   2.568  -51.752 1.00 35.66 ? 89  HIS B CA  1 
ATOM   1968 C C   . HIS B 1 90  ? 5.045   3.471  -50.668 1.00 36.65 ? 89  HIS B C   1 
ATOM   1969 O O   . HIS B 1 90  ? 5.768   4.140  -49.930 1.00 34.72 ? 89  HIS B O   1 
ATOM   1970 C CB  . HIS B 1 90  ? 5.459   3.243  -53.126 1.00 31.52 ? 89  HIS B CB  1 
ATOM   1971 C CG  . HIS B 1 90  ? 6.219   4.526  -53.264 1.00 38.38 ? 89  HIS B CG  1 
ATOM   1972 N ND1 . HIS B 1 90  ? 7.587   4.559  -53.446 1.00 47.78 ? 89  HIS B ND1 1 
ATOM   1973 C CD2 . HIS B 1 90  ? 5.825   5.811  -53.143 1.00 37.02 ? 89  HIS B CD2 1 
ATOM   1974 C CE1 . HIS B 1 90  ? 7.988   5.815  -53.497 1.00 42.52 ? 89  HIS B CE1 1 
ATOM   1975 N NE2 . HIS B 1 90  ? 6.943   6.597  -53.311 1.00 40.10 ? 89  HIS B NE2 1 
ATOM   1976 N N   . LEU B 1 91  ? 3.719   3.488  -50.594 1.00 31.89 ? 90  LEU B N   1 
ATOM   1977 C CA  . LEU B 1 91  ? 3.019   4.329  -49.640 1.00 38.62 ? 90  LEU B CA  1 
ATOM   1978 C C   . LEU B 1 91  ? 3.231   3.870  -48.207 1.00 37.96 ? 90  LEU B C   1 
ATOM   1979 O O   . LEU B 1 91  ? 3.592   4.693  -47.358 1.00 35.30 ? 90  LEU B O   1 
ATOM   1980 C CB  . LEU B 1 91  ? 1.522   4.389  -49.968 1.00 34.01 ? 90  LEU B CB  1 
ATOM   1981 C CG  . LEU B 1 91  ? 1.172   5.616  -50.827 1.00 41.73 ? 90  LEU B CG  1 
ATOM   1982 C CD1 . LEU B 1 91  ? 1.884   5.624  -52.173 1.00 36.27 ? 90  LEU B CD1 1 
ATOM   1983 C CD2 . LEU B 1 91  ? -0.310  5.649  -51.036 1.00 43.70 ? 90  LEU B CD2 1 
ATOM   1984 N N   . GLU B 1 92  ? 3.027   2.571  -47.954 1.00 33.17 ? 91  GLU B N   1 
ATOM   1985 C CA  . GLU B 1 92  ? 3.239   1.989  -46.625 1.00 37.53 ? 91  GLU B CA  1 
ATOM   1986 C C   . GLU B 1 92  ? 4.631   2.207  -46.079 1.00 35.61 ? 91  GLU B C   1 
ATOM   1987 O O   . GLU B 1 92  ? 4.786   2.616  -44.929 1.00 33.74 ? 91  GLU B O   1 
ATOM   1988 C CB  . GLU B 1 92  ? 2.954   0.484  -46.611 1.00 35.30 ? 91  GLU B CB  1 
ATOM   1989 C CG  . GLU B 1 92  ? 1.480   0.152  -46.573 1.00 45.34 ? 91  GLU B CG  1 
ATOM   1990 C CD  . GLU B 1 92  ? 1.206   -1.319 -46.270 1.00 53.64 ? 91  GLU B CD  1 
ATOM   1991 O OE1 . GLU B 1 92  ? 2.132   -2.165 -46.372 1.00 54.12 ? 91  GLU B OE1 1 
ATOM   1992 O OE2 . GLU B 1 92  ? 0.060   -1.607 -45.862 1.00 56.83 ? 91  GLU B OE2 1 
ATOM   1993 N N   . ASN B 1 93  ? 5.635   1.893  -46.888 1.00 32.09 ? 92  ASN B N   1 
ATOM   1994 C CA  . ASN B 1 93  ? 7.014   2.111  -46.496 1.00 36.78 ? 92  ASN B CA  1 
ATOM   1995 C C   . ASN B 1 93  ? 7.277   3.557  -46.118 1.00 39.38 ? 92  ASN B C   1 
ATOM   1996 O O   . ASN B 1 93  ? 8.053   3.841  -45.206 1.00 38.75 ? 92  ASN B O   1 
ATOM   1997 C CB  . ASN B 1 93  ? 7.965   1.731  -47.618 1.00 37.59 ? 92  ASN B CB  1 
ATOM   1998 C CG  . ASN B 1 93  ? 9.404   1.750  -47.177 1.00 46.14 ? 92  ASN B CG  1 
ATOM   1999 O OD1 . ASN B 1 93  ? 9.749   1.221  -46.119 1.00 59.21 ? 92  ASN B OD1 1 
ATOM   2000 N ND2 . ASN B 1 93  ? 10.239  2.459  -47.924 1.00 51.35 ? 92  ASN B ND2 1 
ATOM   2001 N N   . TYR B 1 94  ? 6.646   4.472  -46.846 1.00 36.65 ? 93  TYR B N   1 
ATOM   2002 C CA  . TYR B 1 94  ? 6.852   5.888  -46.609 1.00 36.48 ? 93  TYR B CA  1 
ATOM   2003 C C   . TYR B 1 94  ? 6.100   6.346  -45.352 1.00 36.03 ? 93  TYR B C   1 
ATOM   2004 O O   . TYR B 1 94  ? 6.655   7.074  -44.546 1.00 35.54 ? 93  TYR B O   1 
ATOM   2005 C CB  . TYR B 1 94  ? 6.441   6.694  -47.845 1.00 35.78 ? 93  TYR B CB  1 
ATOM   2006 C CG  . TYR B 1 94  ? 6.590   8.194  -47.714 1.00 34.78 ? 93  TYR B CG  1 
ATOM   2007 C CD1 . TYR B 1 94  ? 7.823   8.764  -47.429 1.00 34.92 ? 93  TYR B CD1 1 
ATOM   2008 C CD2 . TYR B 1 94  ? 5.530   9.042  -48.000 1.00 35.54 ? 93  TYR B CD2 1 
ATOM   2009 C CE1 . TYR B 1 94  ? 7.974   10.152 -47.329 1.00 39.48 ? 93  TYR B CE1 1 
ATOM   2010 C CE2 . TYR B 1 94  ? 5.670   10.421 -47.933 1.00 38.95 ? 93  TYR B CE2 1 
ATOM   2011 C CZ  . TYR B 1 94  ? 6.892   10.972 -47.597 1.00 41.71 ? 93  TYR B CZ  1 
ATOM   2012 O OH  . TYR B 1 94  ? 7.023   12.340 -47.534 1.00 39.53 ? 93  TYR B OH  1 
ATOM   2013 N N   . ALA B 1 95  ? 4.857   5.903  -45.179 1.00 32.26 ? 94  ALA B N   1 
ATOM   2014 C CA  . ALA B 1 95  ? 4.135   6.136  -43.934 1.00 33.70 ? 94  ALA B CA  1 
ATOM   2015 C C   . ALA B 1 95  ? 4.892   5.565  -42.724 1.00 38.99 ? 94  ALA B C   1 
ATOM   2016 O O   . ALA B 1 95  ? 4.974   6.216  -41.671 1.00 35.54 ? 94  ALA B O   1 
ATOM   2017 C CB  . ALA B 1 95  ? 2.744   5.530  -44.001 1.00 29.81 ? 94  ALA B CB  1 
ATOM   2018 N N   . LEU B 1 96  ? 5.421   4.349  -42.875 1.00 33.70 ? 95  LEU B N   1 
ATOM   2019 C CA  . LEU B 1 96  ? 6.173   3.698  -41.806 1.00 38.01 ? 95  LEU B CA  1 
ATOM   2020 C C   . LEU B 1 96  ? 7.407   4.516  -41.411 1.00 34.24 ? 95  LEU B C   1 
ATOM   2021 O O   . LEU B 1 96  ? 7.611   4.795  -40.240 1.00 34.52 ? 95  LEU B O   1 
ATOM   2022 C CB  . LEU B 1 96  ? 6.588   2.280  -42.210 1.00 34.76 ? 95  LEU B CB  1 
ATOM   2023 C CG  . LEU B 1 96  ? 7.395   1.469  -41.186 1.00 39.11 ? 95  LEU B CG  1 
ATOM   2024 C CD1 . LEU B 1 96  ? 6.571   1.237  -39.905 1.00 30.77 ? 95  LEU B CD1 1 
ATOM   2025 C CD2 . LEU B 1 96  ? 7.848   0.151  -41.795 1.00 36.50 ? 95  LEU B CD2 1 
ATOM   2026 N N   . LYS B 1 97  ? 8.216   4.904  -42.383 1.00 33.56 ? 96  LYS B N   1 
ATOM   2027 C CA  . LYS B 1 97  ? 9.370   5.753  -42.116 1.00 39.71 ? 96  LYS B CA  1 
ATOM   2028 C C   . LYS B 1 97  ? 9.022   6.993  -41.287 1.00 38.10 ? 96  LYS B C   1 
ATOM   2029 O O   . LYS B 1 97  ? 9.706   7.293  -40.318 1.00 34.28 ? 96  LYS B O   1 
ATOM   2030 C CB  . LYS B 1 97  ? 10.023  6.209  -43.424 1.00 37.62 ? 96  LYS B CB  1 
ATOM   2031 C CG  . LYS B 1 97  ? 11.249  5.410  -43.829 1.00 52.59 ? 96  LYS B CG  1 
ATOM   2032 C CD  . LYS B 1 97  ? 10.989  3.911  -43.811 1.00 44.24 ? 96  LYS B CD  1 
ATOM   2033 N N   . MET B 1 98  ? 7.993   7.740  -41.672 1.00 32.35 ? 97  MET B N   1 
ATOM   2034 C CA  . MET B 1 98  ? 7.790   8.980  -40.960 1.00 39.23 ? 97  MET B CA  1 
ATOM   2035 C C   . MET B 1 98  ? 7.099   8.710  -39.641 1.00 36.95 ? 97  MET B C   1 
ATOM   2036 O O   . MET B 1 98  ? 7.298   9.452  -38.689 1.00 33.35 ? 97  MET B O   1 
ATOM   2037 C CB  . MET B 1 98  ? 7.016   10.024 -41.775 1.00 38.89 ? 97  MET B CB  1 
ATOM   2038 C CG  . MET B 1 98  ? 5.597   9.746  -42.087 1.00 38.70 ? 97  MET B CG  1 
ATOM   2039 S SD  . MET B 1 98  ? 4.953   11.243 -42.911 1.00 45.15 ? 97  MET B SD  1 
ATOM   2040 C CE  . MET B 1 98  ? 5.631   11.031 -44.529 1.00 45.38 ? 97  MET B CE  1 
ATOM   2041 N N   . PHE B 1 99  ? 6.309   7.641  -39.585 1.00 34.79 ? 98  PHE B N   1 
ATOM   2042 C CA  . PHE B 1 99  ? 5.751   7.185  -38.322 1.00 35.97 ? 98  PHE B CA  1 
ATOM   2043 C C   . PHE B 1 99  ? 6.871   6.864  -37.330 1.00 36.96 ? 98  PHE B C   1 
ATOM   2044 O O   . PHE B 1 99  ? 6.814   7.254  -36.160 1.00 34.73 ? 98  PHE B O   1 
ATOM   2045 C CB  . PHE B 1 99  ? 4.872   5.941  -38.512 1.00 33.65 ? 98  PHE B CB  1 
ATOM   2046 C CG  . PHE B 1 99  ? 4.298   5.415  -37.226 1.00 37.78 ? 98  PHE B CG  1 
ATOM   2047 C CD1 . PHE B 1 99  ? 3.137   5.953  -36.704 1.00 41.57 ? 98  PHE B CD1 1 
ATOM   2048 C CD2 . PHE B 1 99  ? 4.951   4.425  -36.509 1.00 37.53 ? 98  PHE B CD2 1 
ATOM   2049 C CE1 . PHE B 1 99  ? 2.618   5.493  -35.507 1.00 38.06 ? 98  PHE B CE1 1 
ATOM   2050 C CE2 . PHE B 1 99  ? 4.440   3.962  -35.315 1.00 40.35 ? 98  PHE B CE2 1 
ATOM   2051 C CZ  . PHE B 1 99  ? 3.267   4.492  -34.816 1.00 42.75 ? 98  PHE B CZ  1 
ATOM   2052 N N   . LEU B 1 100 ? 7.877   6.135  -37.796 1.00 34.24 ? 99  LEU B N   1 
ATOM   2053 C CA  . LEU B 1 100 ? 8.955   5.706  -36.913 1.00 39.53 ? 99  LEU B CA  1 
ATOM   2054 C C   . LEU B 1 100 ? 9.835   6.881  -36.547 1.00 37.74 ? 99  LEU B C   1 
ATOM   2055 O O   . LEU B 1 100 ? 10.401  6.910  -35.456 1.00 37.86 ? 99  LEU B O   1 
ATOM   2056 C CB  . LEU B 1 100 ? 9.796   4.590  -37.549 1.00 33.18 ? 99  LEU B CB  1 
ATOM   2057 C CG  . LEU B 1 100 ? 9.143   3.214  -37.667 1.00 37.96 ? 99  LEU B CG  1 
ATOM   2058 C CD1 . LEU B 1 100 ? 10.055  2.268  -38.445 1.00 34.40 ? 99  LEU B CD1 1 
ATOM   2059 C CD2 . LEU B 1 100 ? 8.834   2.620  -36.271 1.00 35.94 ? 99  LEU B CD2 1 
ATOM   2060 N N   . TYR B 1 101 ? 9.969   7.834  -37.467 1.00 34.82 ? 100 TYR B N   1 
ATOM   2061 C CA  . TYR B 1 101 ? 10.654  9.069  -37.154 1.00 33.44 ? 100 TYR B CA  1 
ATOM   2062 C C   . TYR B 1 101 ? 9.945   9.804  -36.024 1.00 35.99 ? 100 TYR B C   1 
ATOM   2063 O O   . TYR B 1 101 ? 10.587  10.255 -35.083 1.00 35.01 ? 100 TYR B O   1 
ATOM   2064 C CB  . TYR B 1 101 ? 10.761  9.992  -38.374 1.00 32.75 ? 100 TYR B CB  1 
ATOM   2065 C CG  . TYR B 1 101 ? 11.053  11.418 -37.965 1.00 33.94 ? 100 TYR B CG  1 
ATOM   2066 C CD1 . TYR B 1 101 ? 12.326  11.803 -37.532 1.00 37.83 ? 100 TYR B CD1 1 
ATOM   2067 C CD2 . TYR B 1 101 ? 10.039  12.384 -37.975 1.00 33.27 ? 100 TYR B CD2 1 
ATOM   2068 C CE1 . TYR B 1 101 ? 12.581  13.129 -37.135 1.00 35.68 ? 100 TYR B CE1 1 
ATOM   2069 C CE2 . TYR B 1 101 ? 10.285  13.698 -37.572 1.00 35.71 ? 100 TYR B CE2 1 
ATOM   2070 C CZ  . TYR B 1 101 ? 11.552  14.060 -37.155 1.00 34.18 ? 100 TYR B CZ  1 
ATOM   2071 O OH  . TYR B 1 101 ? 11.783  15.352 -36.766 1.00 37.25 ? 100 TYR B OH  1 
ATOM   2072 N N   . ALA B 1 102 ? 8.624   9.933  -36.120 1.00 32.46 ? 101 ALA B N   1 
ATOM   2073 C CA  . ALA B 1 102 ? 7.897   10.747 -35.151 1.00 34.27 ? 101 ALA B CA  1 
ATOM   2074 C C   . ALA B 1 102 ? 7.895   10.048 -33.790 1.00 35.06 ? 101 ALA B C   1 
ATOM   2075 O O   . ALA B 1 102 ? 8.068   10.684 -32.743 1.00 33.65 ? 101 ALA B O   1 
ATOM   2076 C CB  . ALA B 1 102 ? 6.489   11.019 -35.631 1.00 26.53 ? 101 ALA B CB  1 
ATOM   2077 N N   . ASP B 1 103 ? 7.723   8.733  -33.825 1.00 33.99 ? 102 ASP B N   1 
ATOM   2078 C CA  . ASP B 1 103 ? 7.798   7.895  -32.633 1.00 35.33 ? 102 ASP B CA  1 
ATOM   2079 C C   . ASP B 1 103 ? 9.161   7.976  -31.945 1.00 35.90 ? 102 ASP B C   1 
ATOM   2080 O O   . ASP B 1 103 ? 9.231   8.003  -30.724 1.00 36.51 ? 102 ASP B O   1 
ATOM   2081 C CB  . ASP B 1 103 ? 7.483   6.440  -32.995 1.00 34.08 ? 102 ASP B CB  1 
ATOM   2082 C CG  . ASP B 1 103 ? 7.709   5.487  -31.831 1.00 42.42 ? 102 ASP B CG  1 
ATOM   2083 O OD1 . ASP B 1 103 ? 6.929   5.498  -30.849 1.00 35.68 ? 102 ASP B OD1 1 
ATOM   2084 O OD2 . ASP B 1 103 ? 8.711   4.747  -31.889 1.00 42.18 ? 102 ASP B OD2 1 
ATOM   2085 N N   . ASN B 1 104 ? 10.241  7.999  -32.723 1.00 35.99 ? 103 ASN B N   1 
ATOM   2086 C CA  . ASN B 1 104 ? 11.569  8.132  -32.142 1.00 36.76 ? 103 ASN B CA  1 
ATOM   2087 C C   . ASN B 1 104 ? 11.749  9.450  -31.382 1.00 37.85 ? 103 ASN B C   1 
ATOM   2088 O O   . ASN B 1 104 ? 12.331  9.455  -30.297 1.00 37.99 ? 103 ASN B O   1 
ATOM   2089 C CB  . ASN B 1 104 ? 12.661  8.059  -33.203 1.00 40.41 ? 103 ASN B CB  1 
ATOM   2090 C CG  . ASN B 1 104 ? 14.053  7.889  -32.589 1.00 42.09 ? 103 ASN B CG  1 
ATOM   2091 O OD1 . ASN B 1 104 ? 14.273  7.008  -31.754 1.00 42.53 ? 103 ASN B OD1 1 
ATOM   2092 N ND2 . ASN B 1 104 ? 14.963  8.800  -32.923 1.00 41.15 ? 103 ASN B ND2 1 
ATOM   2093 N N   . GLU B 1 105 ? 11.297  10.557 -31.983 1.00 34.05 ? 104 GLU B N   1 
ATOM   2094 C CA  . GLU B 1 105 ? 11.291  11.863 -31.325 1.00 34.73 ? 104 GLU B CA  1 
ATOM   2095 C C   . GLU B 1 105 ? 10.526  11.796 -30.002 1.00 32.74 ? 104 GLU B C   1 
ATOM   2096 O O   . GLU B 1 105 ? 11.020  12.212 -28.960 1.00 34.06 ? 104 GLU B O   1 
ATOM   2097 C CB  . GLU B 1 105 ? 10.678  12.924 -32.247 1.00 30.64 ? 104 GLU B CB  1 
ATOM   2098 C CG  . GLU B 1 105 ? 11.508  13.150 -33.507 1.00 36.05 ? 104 GLU B CG  1 
ATOM   2099 C CD  . GLU B 1 105 ? 12.899  13.698 -33.210 1.00 38.91 ? 104 GLU B CD  1 
ATOM   2100 O OE1 . GLU B 1 105 ? 13.016  14.823 -32.666 1.00 36.08 ? 104 GLU B OE1 1 
ATOM   2101 O OE2 . GLU B 1 105 ? 13.874  12.944 -33.417 1.00 38.35 ? 104 GLU B OE2 1 
ATOM   2102 N N   . ASP B 1 106 ? 9.324   11.240 -30.071 1.00 32.88 ? 105 ASP B N   1 
ATOM   2103 C CA  . ASP B 1 106 ? 8.432   11.106 -28.935 1.00 34.43 ? 105 ASP B CA  1 
ATOM   2104 C C   . ASP B 1 106 ? 9.112   10.353 -27.797 1.00 37.89 ? 105 ASP B C   1 
ATOM   2105 O O   . ASP B 1 106 ? 9.098   10.799 -26.645 1.00 31.35 ? 105 ASP B O   1 
ATOM   2106 C CB  . ASP B 1 106 ? 7.168   10.368 -29.361 1.00 33.42 ? 105 ASP B CB  1 
ATOM   2107 C CG  . ASP B 1 106 ? 6.127   10.313 -28.267 1.00 37.57 ? 105 ASP B CG  1 
ATOM   2108 O OD1 . ASP B 1 106 ? 6.237   11.064 -27.270 1.00 36.32 ? 105 ASP B OD1 1 
ATOM   2109 O OD2 . ASP B 1 106 ? 5.232   9.458  -28.377 1.00 35.09 ? 105 ASP B OD2 1 
ATOM   2110 N N   . ARG B 1 107 ? 9.718   9.214  -28.130 1.00 34.89 ? 106 ARG B N   1 
ATOM   2111 C CA  . ARG B 1 107 ? 10.387  8.410  -27.112 1.00 39.97 ? 106 ARG B CA  1 
ATOM   2112 C C   . ARG B 1 107 ? 11.590  9.145  -26.530 1.00 38.89 ? 106 ARG B C   1 
ATOM   2113 O O   . ARG B 1 107 ? 11.973  8.884  -25.408 1.00 42.19 ? 106 ARG B O   1 
ATOM   2114 C CB  . ARG B 1 107 ? 10.804  7.038  -27.673 1.00 41.17 ? 106 ARG B CB  1 
ATOM   2115 C CG  . ARG B 1 107 ? 9.609   6.078  -27.877 1.00 46.76 ? 106 ARG B CG  1 
ATOM   2116 C CD  . ARG B 1 107 ? 10.005  4.662  -28.333 1.00 49.14 ? 106 ARG B CD  1 
ATOM   2117 N NE  . ARG B 1 107 ? 10.526  4.636  -29.694 1.00 48.29 ? 106 ARG B NE  1 
ATOM   2118 C CZ  . ARG B 1 107 ? 11.820  4.607  -30.008 1.00 52.13 ? 106 ARG B CZ  1 
ATOM   2119 N NH1 . ARG B 1 107 ? 12.736  4.608  -29.045 1.00 52.15 ? 106 ARG B NH1 1 
ATOM   2120 N NH2 . ARG B 1 107 ? 12.198  4.587  -31.289 1.00 46.04 ? 106 ARG B NH2 1 
ATOM   2121 N N   . ALA B 1 108 ? 12.176  10.075 -27.281 1.00 39.24 ? 107 ALA B N   1 
ATOM   2122 C CA  . ALA B 1 108 ? 13.308  10.831 -26.758 1.00 41.63 ? 107 ALA B CA  1 
ATOM   2123 C C   . ALA B 1 108 ? 12.879  12.104 -26.022 1.00 36.20 ? 107 ALA B C   1 
ATOM   2124 O O   . ALA B 1 108 ? 13.720  12.853 -25.548 1.00 41.00 ? 107 ALA B O   1 
ATOM   2125 C CB  . ALA B 1 108 ? 14.277  11.179 -27.879 1.00 39.58 ? 107 ALA B CB  1 
ATOM   2126 N N   . GLY B 1 109 ? 11.576  12.352 -25.931 1.00 37.94 ? 108 GLY B N   1 
ATOM   2127 C CA  . GLY B 1 109 ? 11.085  13.553 -25.276 1.00 35.60 ? 108 GLY B CA  1 
ATOM   2128 C C   . GLY B 1 109 ? 11.285  14.832 -26.074 1.00 37.27 ? 108 GLY B C   1 
ATOM   2129 O O   . GLY B 1 109 ? 11.260  15.937 -25.518 1.00 38.88 ? 108 GLY B O   1 
ATOM   2130 N N   . ARG B 1 110 ? 11.473  14.703 -27.385 1.00 36.66 ? 109 ARG B N   1 
ATOM   2131 C CA  . ARG B 1 110 ? 11.622  15.891 -28.228 1.00 32.48 ? 109 ARG B CA  1 
ATOM   2132 C C   . ARG B 1 110 ? 10.298  16.200 -28.915 1.00 35.21 ? 109 ARG B C   1 
ATOM   2133 O O   . ARG B 1 110 ? 9.881   15.486 -29.832 1.00 35.31 ? 109 ARG B O   1 
ATOM   2134 C CB  . ARG B 1 110 ? 12.733  15.689 -29.257 1.00 35.32 ? 109 ARG B CB  1 
ATOM   2135 C CG  . ARG B 1 110 ? 14.152  15.621 -28.673 1.00 33.91 ? 109 ARG B CG  1 
ATOM   2136 C CD  . ARG B 1 110 ? 15.192  15.680 -29.799 1.00 41.48 ? 109 ARG B CD  1 
ATOM   2137 N NE  . ARG B 1 110 ? 15.121  14.515 -30.684 1.00 36.87 ? 109 ARG B NE  1 
ATOM   2138 C CZ  . ARG B 1 110 ? 15.815  13.401 -30.495 1.00 40.45 ? 109 ARG B CZ  1 
ATOM   2139 N NH1 . ARG B 1 110 ? 16.646  13.320 -29.461 1.00 40.62 ? 109 ARG B NH1 1 
ATOM   2140 N NH2 . ARG B 1 110 ? 15.690  12.374 -31.339 1.00 39.44 ? 109 ARG B NH2 1 
ATOM   2141 N N   . PHE B 1 111 ? 9.620   17.249 -28.468 1.00 30.90 ? 110 PHE B N   1 
ATOM   2142 C CA  . PHE B 1 111 ? 8.310   17.560 -29.010 1.00 35.94 ? 110 PHE B CA  1 
ATOM   2143 C C   . PHE B 1 111 ? 8.390   18.846 -29.797 1.00 40.12 ? 110 PHE B C   1 
ATOM   2144 O O   . PHE B 1 111 ? 8.892   19.851 -29.297 1.00 38.57 ? 110 PHE B O   1 
ATOM   2145 C CB  . PHE B 1 111 ? 7.274   17.657 -27.900 1.00 32.29 ? 110 PHE B CB  1 
ATOM   2146 C CG  . PHE B 1 111 ? 7.296   16.470 -26.979 1.00 33.69 ? 110 PHE B CG  1 
ATOM   2147 C CD1 . PHE B 1 111 ? 6.932   15.213 -27.438 1.00 32.81 ? 110 PHE B CD1 1 
ATOM   2148 C CD2 . PHE B 1 111 ? 7.648   16.613 -25.654 1.00 39.05 ? 110 PHE B CD2 1 
ATOM   2149 C CE1 . PHE B 1 111 ? 6.960   14.120 -26.600 1.00 37.06 ? 110 PHE B CE1 1 
ATOM   2150 C CE2 . PHE B 1 111 ? 7.658   15.512 -24.798 1.00 34.90 ? 110 PHE B CE2 1 
ATOM   2151 C CZ  . PHE B 1 111 ? 7.317   14.272 -25.277 1.00 34.19 ? 110 PHE B CZ  1 
ATOM   2152 N N   . HIS B 1 112 ? 7.928   18.793 -31.045 1.00 33.08 ? 111 HIS B N   1 
ATOM   2153 C CA  . HIS B 1 112 ? 8.107   19.905 -31.972 1.00 36.32 ? 111 HIS B CA  1 
ATOM   2154 C C   . HIS B 1 112 ? 7.223   19.726 -33.206 1.00 36.92 ? 111 HIS B C   1 
ATOM   2155 O O   . HIS B 1 112 ? 6.699   18.639 -33.452 1.00 32.04 ? 111 HIS B O   1 
ATOM   2156 C CB  . HIS B 1 112 ? 9.593   20.048 -32.344 1.00 29.18 ? 111 HIS B CB  1 
ATOM   2157 C CG  . HIS B 1 112 ? 10.226  18.777 -32.809 1.00 36.31 ? 111 HIS B CG  1 
ATOM   2158 N ND1 . HIS B 1 112 ? 10.026  18.258 -34.071 1.00 35.10 ? 111 HIS B ND1 1 
ATOM   2159 C CD2 . HIS B 1 112 ? 11.066  17.916 -32.177 1.00 33.69 ? 111 HIS B CD2 1 
ATOM   2160 C CE1 . HIS B 1 112 ? 10.716  17.137 -34.202 1.00 31.82 ? 111 HIS B CE1 1 
ATOM   2161 N NE2 . HIS B 1 112 ? 11.356  16.908 -33.065 1.00 34.16 ? 111 HIS B NE2 1 
ATOM   2162 N N   . LYS B 1 113 ? 7.033   20.807 -33.962 1.00 33.96 ? 112 LYS B N   1 
ATOM   2163 C CA  . LYS B 1 113 ? 6.102   20.805 -35.086 1.00 33.51 ? 112 LYS B CA  1 
ATOM   2164 C C   . LYS B 1 113 ? 6.415   19.745 -36.144 1.00 32.91 ? 112 LYS B C   1 
ATOM   2165 O O   . LYS B 1 113 ? 5.519   19.212 -36.778 1.00 30.18 ? 112 LYS B O   1 
ATOM   2166 C CB  . LYS B 1 113 ? 6.070   22.180 -35.745 1.00 34.84 ? 112 LYS B CB  1 
ATOM   2167 C CG  . LYS B 1 113 ? 5.407   23.236 -34.882 1.00 37.58 ? 112 LYS B CG  1 
ATOM   2168 C CD  . LYS B 1 113 ? 5.485   24.608 -35.509 1.00 36.67 ? 112 LYS B CD  1 
ATOM   2169 C CE  . LYS B 1 113 ? 4.777   25.654 -34.644 1.00 35.26 ? 112 LYS B CE  1 
ATOM   2170 N NZ  . LYS B 1 113 ? 4.929   26.984 -35.264 1.00 34.71 ? 112 LYS B NZ  1 
ATOM   2171 N N   . ASN B 1 114 ? 7.691   19.440 -36.305 1.00 31.71 ? 113 ASN B N   1 
ATOM   2172 C CA  . ASN B 1 114 ? 8.121   18.534 -37.338 1.00 33.75 ? 113 ASN B CA  1 
ATOM   2173 C C   . ASN B 1 114 ? 7.660   17.111 -37.038 1.00 33.57 ? 113 ASN B C   1 
ATOM   2174 O O   . ASN B 1 114 ? 7.137   16.423 -37.926 1.00 35.02 ? 113 ASN B O   1 
ATOM   2175 C CB  . ASN B 1 114 ? 9.630   18.583 -37.469 1.00 38.91 ? 113 ASN B CB  1 
ATOM   2176 C CG  . ASN B 1 114 ? 10.105  18.199 -38.857 1.00 52.79 ? 113 ASN B CG  1 
ATOM   2177 O OD1 . ASN B 1 114 ? 9.389   17.562 -39.627 1.00 50.84 ? 113 ASN B OD1 1 
ATOM   2178 N ND2 . ASN B 1 114 ? 11.314  18.632 -39.200 1.00 63.53 ? 113 ASN B ND2 1 
ATOM   2179 N N   . MET B 1 115 ? 7.811   16.669 -35.786 1.00 30.71 ? 114 MET B N   1 
ATOM   2180 C CA  . MET B 1 115 ? 7.421   15.322 -35.443 1.00 28.88 ? 114 MET B CA  1 
ATOM   2181 C C   . MET B 1 115 ? 5.875   15.323 -35.371 1.00 28.20 ? 114 MET B C   1 
ATOM   2182 O O   . MET B 1 115 ? 5.254   14.318 -35.593 1.00 31.59 ? 114 MET B O   1 
ATOM   2183 C CB  . MET B 1 115 ? 7.991   14.888 -34.097 1.00 36.70 ? 114 MET B CB  1 
ATOM   2184 C CG  . MET B 1 115 ? 6.948   15.326 -33.222 1.00 40.60 ? 114 MET B CG  1 
ATOM   2185 S SD  . MET B 1 115 ? 6.541   15.075 -31.639 1.00 35.70 ? 114 MET B SD  1 
ATOM   2186 C CE  . MET B 1 115 ? 6.530   13.266 -31.407 1.00 39.06 ? 114 MET B CE  1 
ATOM   2187 N N   . ILE B 1 116 ? 5.254   16.452 -35.035 1.00 28.88 ? 115 ILE B N   1 
ATOM   2188 C CA  . ILE B 1 116 ? 3.802   16.521 -35.034 1.00 31.72 ? 115 ILE B CA  1 
ATOM   2189 C C   . ILE B 1 116 ? 3.262   16.305 -36.453 1.00 33.45 ? 115 ILE B C   1 
ATOM   2190 O O   . ILE B 1 116 ? 2.298   15.575 -36.665 1.00 31.11 ? 115 ILE B O   1 
ATOM   2191 C CB  . ILE B 1 116 ? 3.287   17.880 -34.507 1.00 36.09 ? 115 ILE B CB  1 
ATOM   2192 C CG1 . ILE B 1 116 ? 3.503   18.003 -32.983 1.00 36.22 ? 115 ILE B CG1 1 
ATOM   2193 C CG2 . ILE B 1 116 ? 1.811   18.098 -34.881 1.00 34.18 ? 115 ILE B CG2 1 
ATOM   2194 C CD1 . ILE B 1 116 ? 3.173   19.395 -32.453 1.00 32.17 ? 115 ILE B CD1 1 
ATOM   2195 N N   . LYS B 1 117 ? 3.901   16.965 -37.410 1.00 30.16 ? 116 LYS B N   1 
ATOM   2196 C CA  . LYS B 1 117 ? 3.507   16.878 -38.806 1.00 33.77 ? 116 LYS B CA  1 
ATOM   2197 C C   . LYS B 1 117 ? 3.722   15.461 -39.364 1.00 31.17 ? 116 LYS B C   1 
ATOM   2198 O O   . LYS B 1 117 ? 2.881   14.957 -40.103 1.00 32.75 ? 116 LYS B O   1 
ATOM   2199 C CB  . LYS B 1 117 ? 4.281   17.898 -39.644 1.00 35.40 ? 116 LYS B CB  1 
ATOM   2200 C CG  . LYS B 1 117 ? 3.863   17.886 -41.112 1.00 38.57 ? 116 LYS B CG  1 
ATOM   2201 C CD  . LYS B 1 117 ? 4.616   18.911 -41.931 1.00 43.67 ? 116 LYS B CD  1 
ATOM   2202 C CE  . LYS B 1 117 ? 4.179   18.860 -43.405 1.00 47.91 ? 116 LYS B CE  1 
ATOM   2203 N NZ  . LYS B 1 117 ? 4.915   19.861 -44.223 1.00 54.33 ? 116 LYS B NZ  1 
ATOM   2204 N N   . SER B 1 118 ? 4.830   14.825 -38.984 1.00 30.42 ? 117 SER B N   1 
ATOM   2205 C CA  . SER B 1 118 ? 5.096   13.447 -39.371 1.00 35.29 ? 117 SER B CA  1 
ATOM   2206 C C   . SER B 1 118 ? 4.063   12.464 -38.821 1.00 34.18 ? 117 SER B C   1 
ATOM   2207 O O   . SER B 1 118 ? 3.636   11.571 -39.555 1.00 34.56 ? 117 SER B O   1 
ATOM   2208 C CB  . SER B 1 118 ? 6.481   13.005 -38.917 1.00 34.14 ? 117 SER B CB  1 
ATOM   2209 O OG  . SER B 1 118 ? 7.471   13.767 -39.545 1.00 35.80 ? 117 SER B OG  1 
ATOM   2210 N N   . PHE B 1 119 ? 3.675   12.591 -37.550 1.00 30.73 ? 118 PHE B N   1 
ATOM   2211 C CA  . PHE B 1 119 ? 2.549   11.772 -37.076 1.00 29.52 ? 118 PHE B CA  1 
ATOM   2212 C C   . PHE B 1 119 ? 1.291   12.019 -37.905 1.00 32.15 ? 118 PHE B C   1 
ATOM   2213 O O   . PHE B 1 119 ? 0.606   11.074 -38.294 1.00 31.44 ? 118 PHE B O   1 
ATOM   2214 C CB  . PHE B 1 119 ? 2.189   12.002 -35.601 1.00 29.20 ? 118 PHE B CB  1 
ATOM   2215 C CG  . PHE B 1 119 ? 3.046   11.245 -34.608 1.00 32.69 ? 118 PHE B CG  1 
ATOM   2216 C CD1 . PHE B 1 119 ? 3.062   9.851  -34.616 1.00 29.72 ? 118 PHE B CD1 1 
ATOM   2217 C CD2 . PHE B 1 119 ? 3.682   11.902 -33.562 1.00 35.44 ? 118 PHE B CD2 1 
ATOM   2218 C CE1 . PHE B 1 119 ? 3.815   9.116  -33.679 1.00 31.53 ? 118 PHE B CE1 1 
ATOM   2219 C CE2 . PHE B 1 119 ? 4.412   11.166 -32.591 1.00 33.35 ? 118 PHE B CE2 1 
ATOM   2220 C CZ  . PHE B 1 119 ? 4.479   9.773  -32.664 1.00 31.11 ? 118 PHE B CZ  1 
ATOM   2221 N N   . TYR B 1 120 ? 0.977   13.284 -38.167 1.00 28.04 ? 119 TYR B N   1 
ATOM   2222 C CA  . TYR B 1 120 ? -0.297  13.595 -38.800 1.00 31.64 ? 119 TYR B CA  1 
ATOM   2223 C C   . TYR B 1 120 ? -0.303  13.168 -40.290 1.00 29.13 ? 119 TYR B C   1 
ATOM   2224 O O   . TYR B 1 120 ? -1.297  12.663 -40.769 1.00 28.15 ? 119 TYR B O   1 
ATOM   2225 C CB  . TYR B 1 120 ? -0.620  15.089 -38.652 1.00 29.80 ? 119 TYR B CB  1 
ATOM   2226 C CG  . TYR B 1 120 ? -1.934  15.460 -39.272 1.00 34.46 ? 119 TYR B CG  1 
ATOM   2227 C CD1 . TYR B 1 120 ? -3.125  14.964 -38.749 1.00 38.98 ? 119 TYR B CD1 1 
ATOM   2228 C CD2 . TYR B 1 120 ? -2.001  16.324 -40.358 1.00 35.46 ? 119 TYR B CD2 1 
ATOM   2229 C CE1 . TYR B 1 120 ? -4.351  15.284 -39.312 1.00 34.89 ? 119 TYR B CE1 1 
ATOM   2230 C CE2 . TYR B 1 120 ? -3.217  16.663 -40.924 1.00 36.84 ? 119 TYR B CE2 1 
ATOM   2231 C CZ  . TYR B 1 120 ? -4.391  16.141 -40.393 1.00 44.21 ? 119 TYR B CZ  1 
ATOM   2232 O OH  . TYR B 1 120 ? -5.614  16.472 -40.943 1.00 44.41 ? 119 TYR B OH  1 
ATOM   2233 N N   . THR B 1 121 ? 0.816   13.364 -40.986 1.00 28.98 ? 120 THR B N   1 
ATOM   2234 C CA  . THR B 1 121 ? 0.942   12.990 -42.393 1.00 33.80 ? 120 THR B CA  1 
ATOM   2235 C C   . THR B 1 121 ? 0.923   11.474 -42.551 1.00 32.56 ? 120 THR B C   1 
ATOM   2236 O O   . THR B 1 121 ? 0.294   10.956 -43.470 1.00 33.09 ? 120 THR B O   1 
ATOM   2237 C CB  . THR B 1 121 ? 2.233   13.582 -43.023 1.00 31.41 ? 120 THR B CB  1 
ATOM   2238 O OG1 . THR B 1 121 ? 2.152   15.007 -42.975 1.00 37.09 ? 120 THR B OG1 1 
ATOM   2239 C CG2 . THR B 1 121 ? 2.394   13.153 -44.486 1.00 37.79 ? 120 THR B CG2 1 
ATOM   2240 N N   . ALA B 1 122 ? 1.582   10.764 -41.633 1.00 33.94 ? 121 ALA B N   1 
ATOM   2241 C CA  . ALA B 1 122 ? 1.493   9.307  -41.594 1.00 33.36 ? 121 ALA B CA  1 
ATOM   2242 C C   . ALA B 1 122 ? 0.045   8.845  -41.517 1.00 34.14 ? 121 ALA B C   1 
ATOM   2243 O O   . ALA B 1 122 ? -0.328  7.894  -42.205 1.00 32.05 ? 121 ALA B O   1 
ATOM   2244 C CB  . ALA B 1 122 ? 2.279   8.738  -40.421 1.00 30.66 ? 121 ALA B CB  1 
ATOM   2245 N N   . SER B 1 123 ? -0.768  9.505  -40.684 1.00 29.36 ? 122 SER B N   1 
ATOM   2246 C CA  . SER B 1 123 ? -2.169  9.112  -40.553 1.00 30.57 ? 122 SER B CA  1 
ATOM   2247 C C   . SER B 1 123 ? -2.940  9.435  -41.838 1.00 32.78 ? 122 SER B C   1 
ATOM   2248 O O   . SER B 1 123 ? -3.864  8.708  -42.194 1.00 32.46 ? 122 SER B O   1 
ATOM   2249 C CB  . SER B 1 123 ? -2.853  9.805  -39.361 1.00 30.86 ? 122 SER B CB  1 
ATOM   2250 O OG  . SER B 1 123 ? -3.104  11.178 -39.642 1.00 35.16 ? 122 SER B OG  1 
ATOM   2251 N N   . LEU B 1 124 ? -2.590  10.533 -42.512 1.00 30.60 ? 123 LEU B N   1 
ATOM   2252 C CA  . LEU B 1 124 ? -3.241  10.870 -43.789 1.00 32.02 ? 123 LEU B CA  1 
ATOM   2253 C C   . LEU B 1 124 ? -2.892  9.846  -44.885 1.00 33.58 ? 123 LEU B C   1 
ATOM   2254 O O   . LEU B 1 124 ? -3.751  9.457  -45.663 1.00 33.20 ? 123 LEU B O   1 
ATOM   2255 C CB  . LEU B 1 124 ? -2.843  12.277 -44.256 1.00 32.98 ? 123 LEU B CB  1 
ATOM   2256 C CG  . LEU B 1 124 ? -3.278  13.484 -43.404 1.00 37.19 ? 123 LEU B CG  1 
ATOM   2257 C CD1 . LEU B 1 124 ? -2.616  14.766 -43.912 1.00 31.89 ? 123 LEU B CD1 1 
ATOM   2258 C CD2 . LEU B 1 124 ? -4.799  13.638 -43.377 1.00 31.82 ? 123 LEU B CD2 1 
ATOM   2259 N N   . LEU B 1 125 ? -1.620  9.450  -44.951 1.00 33.52 ? 124 LEU B N   1 
ATOM   2260 C CA  . LEU B 1 125 ? -1.148  8.421  -45.880 1.00 34.64 ? 124 LEU B CA  1 
ATOM   2261 C C   . LEU B 1 125 ? -1.879  7.107  -45.684 1.00 32.73 ? 124 LEU B C   1 
ATOM   2262 O O   . LEU B 1 125 ? -2.169  6.401  -46.650 1.00 36.81 ? 124 LEU B O   1 
ATOM   2263 C CB  . LEU B 1 125 ? 0.361   8.195  -45.725 1.00 33.04 ? 124 LEU B CB  1 
ATOM   2264 C CG  . LEU B 1 125 ? 1.220   9.380  -46.156 1.00 36.82 ? 124 LEU B CG  1 
ATOM   2265 C CD1 . LEU B 1 125 ? 2.690   9.171  -45.797 1.00 35.28 ? 124 LEU B CD1 1 
ATOM   2266 C CD2 . LEU B 1 125 ? 1.057   9.599  -47.656 1.00 34.29 ? 124 LEU B CD2 1 
ATOM   2267 N N   . ILE B 1 126 ? -2.202  6.789  -44.439 1.00 31.70 ? 125 ILE B N   1 
ATOM   2268 C CA  . ILE B 1 126 ? -2.975  5.577  -44.156 1.00 33.44 ? 125 ILE B CA  1 
ATOM   2269 C C   . ILE B 1 126 ? -4.425  5.696  -44.667 1.00 35.98 ? 125 ILE B C   1 
ATOM   2270 O O   . ILE B 1 126 ? -4.987  4.716  -45.156 1.00 36.84 ? 125 ILE B O   1 
ATOM   2271 C CB  . ILE B 1 126 ? -2.960  5.239  -42.649 1.00 32.68 ? 125 ILE B CB  1 
ATOM   2272 C CG1 . ILE B 1 126 ? -1.547  4.828  -42.228 1.00 34.98 ? 125 ILE B CG1 1 
ATOM   2273 C CG2 . ILE B 1 126 ? -3.910  4.096  -42.345 1.00 34.61 ? 125 ILE B CG2 1 
ATOM   2274 C CD1 . ILE B 1 126 ? -1.365  4.727  -40.733 1.00 30.75 ? 125 ILE B CD1 1 
ATOM   2275 N N   . ASP B 1 127 ? -5.013  6.889  -44.589 1.00 32.46 ? 126 ASP B N   1 
ATOM   2276 C CA  . ASP B 1 127 ? -6.273  7.153  -45.291 1.00 32.83 ? 126 ASP B CA  1 
ATOM   2277 C C   . ASP B 1 127 ? -6.117  6.792  -46.767 1.00 36.39 ? 126 ASP B C   1 
ATOM   2278 O O   . ASP B 1 127 ? -6.939  6.087  -47.338 1.00 32.92 ? 126 ASP B O   1 
ATOM   2279 C CB  . ASP B 1 127 ? -6.685  8.625  -45.187 1.00 31.93 ? 126 ASP B CB  1 
ATOM   2280 C CG  . ASP B 1 127 ? -7.142  9.026  -43.795 1.00 34.90 ? 126 ASP B CG  1 
ATOM   2281 O OD1 . ASP B 1 127 ? -7.562  8.157  -43.007 1.00 37.86 ? 126 ASP B OD1 1 
ATOM   2282 O OD2 . ASP B 1 127 ? -7.066  10.231 -43.492 1.00 33.85 ? 126 ASP B OD2 1 
ATOM   2283 N N   . VAL B 1 128 ? -5.050  7.302  -47.372 1.00 31.50 ? 127 VAL B N   1 
ATOM   2284 C CA  . VAL B 1 128 ? -4.820  7.153  -48.802 1.00 37.81 ? 127 VAL B CA  1 
ATOM   2285 C C   . VAL B 1 128 ? -4.661  5.685  -49.231 1.00 34.77 ? 127 VAL B C   1 
ATOM   2286 O O   . VAL B 1 128 ? -5.104  5.278  -50.303 1.00 35.02 ? 127 VAL B O   1 
ATOM   2287 C CB  . VAL B 1 128 ? -3.583  7.974  -49.210 1.00 37.82 ? 127 VAL B CB  1 
ATOM   2288 C CG1 . VAL B 1 128 ? -3.160  7.669  -50.645 1.00 31.30 ? 127 VAL B CG1 1 
ATOM   2289 C CG2 . VAL B 1 128 ? -3.886  9.463  -49.043 1.00 32.48 ? 127 VAL B CG2 1 
ATOM   2290 N N   . ILE B 1 129 ? -4.069  4.893  -48.350 1.00 37.80 ? 128 ILE B N   1 
ATOM   2291 C CA  . ILE B 1 129 ? -3.784  3.492  -48.606 1.00 36.28 ? 128 ILE B CA  1 
ATOM   2292 C C   . ILE B 1 129 ? -5.073  2.670  -48.757 1.00 36.67 ? 128 ILE B C   1 
ATOM   2293 O O   . ILE B 1 129 ? -5.061  1.557  -49.293 1.00 39.02 ? 128 ILE B O   1 
ATOM   2294 C CB  . ILE B 1 129 ? -2.853  2.967  -47.481 1.00 37.55 ? 128 ILE B CB  1 
ATOM   2295 C CG1 . ILE B 1 129 ? -1.441  3.515  -47.710 1.00 38.43 ? 128 ILE B CG1 1 
ATOM   2296 C CG2 . ILE B 1 129 ? -2.840  1.453  -47.365 1.00 41.15 ? 128 ILE B CG2 1 
ATOM   2297 C CD1 . ILE B 1 129 ? -0.513  3.379  -46.480 1.00 34.14 ? 128 ILE B CD1 1 
ATOM   2298 N N   . THR B 1 130 ? -6.201  3.243  -48.359 1.00 35.18 ? 129 THR B N   1 
ATOM   2299 C CA  . THR B 1 130 ? -7.488  2.580  -48.578 1.00 39.77 ? 129 THR B CA  1 
ATOM   2300 C C   . THR B 1 130 ? -7.848  2.433  -50.062 1.00 39.84 ? 129 THR B C   1 
ATOM   2301 O O   . THR B 1 130 ? -8.711  1.634  -50.403 1.00 40.99 ? 129 THR B O   1 
ATOM   2302 C CB  . THR B 1 130 ? -8.646  3.323  -47.902 1.00 35.07 ? 129 THR B CB  1 
ATOM   2303 O OG1 . THR B 1 130 ? -8.745  4.640  -48.456 1.00 45.27 ? 129 THR B OG1 1 
ATOM   2304 C CG2 . THR B 1 130 ? -8.405  3.439  -46.416 1.00 38.12 ? 129 THR B CG2 1 
ATOM   2305 N N   . VAL B 1 131 ? -7.203  3.194  -50.943 1.00 37.69 ? 130 VAL B N   1 
ATOM   2306 C CA  . VAL B 1 131 ? -7.452  3.020  -52.380 1.00 38.32 ? 130 VAL B CA  1 
ATOM   2307 C C   . VAL B 1 131 ? -7.006  1.628  -52.848 1.00 40.94 ? 130 VAL B C   1 
ATOM   2308 O O   . VAL B 1 131 ? -7.398  1.185  -53.918 1.00 41.45 ? 130 VAL B O   1 
ATOM   2309 C CB  . VAL B 1 131 ? -6.723  4.083  -53.263 1.00 36.88 ? 130 VAL B CB  1 
ATOM   2310 C CG1 . VAL B 1 131 ? -7.128  5.506  -52.866 1.00 35.72 ? 130 VAL B CG1 1 
ATOM   2311 C CG2 . VAL B 1 131 ? -5.208  3.902  -53.233 1.00 35.77 ? 130 VAL B CG2 1 
ATOM   2312 N N   . PHE B 1 132 ? -6.175  0.953  -52.058 1.00 39.00 ? 131 PHE B N   1 
ATOM   2313 C CA  . PHE B 1 132 ? -5.643  -0.346 -52.466 1.00 40.12 ? 131 PHE B CA  1 
ATOM   2314 C C   . PHE B 1 132 ? -6.444  -1.509 -51.911 1.00 42.56 ? 131 PHE B C   1 
ATOM   2315 O O   . PHE B 1 132 ? -6.168  -2.661 -52.242 1.00 47.55 ? 131 PHE B O   1 
ATOM   2316 C CB  . PHE B 1 132 ? -4.186  -0.503 -52.042 1.00 36.08 ? 131 PHE B CB  1 
ATOM   2317 C CG  . PHE B 1 132 ? -3.268  0.498  -52.664 1.00 40.34 ? 131 PHE B CG  1 
ATOM   2318 C CD1 . PHE B 1 132 ? -2.907  0.389  -54.002 1.00 37.82 ? 131 PHE B CD1 1 
ATOM   2319 C CD2 . PHE B 1 132 ? -2.736  1.528  -51.909 1.00 34.56 ? 131 PHE B CD2 1 
ATOM   2320 C CE1 . PHE B 1 132 ? -2.044  1.312  -54.580 1.00 36.27 ? 131 PHE B CE1 1 
ATOM   2321 C CE2 . PHE B 1 132 ? -1.879  2.441  -52.472 1.00 33.72 ? 131 PHE B CE2 1 
ATOM   2322 C CZ  . PHE B 1 132 ? -1.532  2.336  -53.814 1.00 36.98 ? 131 PHE B CZ  1 
ATOM   2323 N N   . GLY B 1 133 ? -7.429  -1.206 -51.072 1.00 41.46 ? 132 GLY B N   1 
ATOM   2324 C CA  . GLY B 1 133 ? -8.254  -2.224 -50.452 1.00 35.78 ? 132 GLY B CA  1 
ATOM   2325 C C   . GLY B 1 133 ? -8.498  -1.951 -48.972 1.00 45.91 ? 132 GLY B C   1 
ATOM   2326 O O   . GLY B 1 133 ? -8.152  -0.882 -48.448 1.00 42.64 ? 132 GLY B O   1 
ATOM   2327 N N   . GLU B 1 134 ? -9.092  -2.927 -48.297 1.00 40.81 ? 133 GLU B N   1 
ATOM   2328 C CA  . GLU B 1 134 ? -9.432  -2.801 -46.892 1.00 44.86 ? 133 GLU B CA  1 
ATOM   2329 C C   . GLU B 1 134 ? -8.156  -2.668 -46.058 1.00 46.97 ? 133 GLU B C   1 
ATOM   2330 O O   . GLU B 1 134 ? -7.186  -3.404 -46.264 1.00 47.54 ? 133 GLU B O   1 
ATOM   2331 C CB  . GLU B 1 134 ? -10.260 -4.016 -46.430 1.00 46.35 ? 133 GLU B CB  1 
ATOM   2332 C CG  . GLU B 1 134 ? -10.699 -3.974 -44.955 1.00 51.13 ? 133 GLU B CG  1 
ATOM   2333 N N   . LEU B 1 135 ? -8.158  -1.735 -45.113 1.00 42.10 ? 134 LEU B N   1 
ATOM   2334 C CA  . LEU B 1 135 ? -7.000  -1.567 -44.237 1.00 42.71 ? 134 LEU B CA  1 
ATOM   2335 C C   . LEU B 1 135 ? -6.802  -2.775 -43.321 1.00 39.62 ? 134 LEU B C   1 
ATOM   2336 O O   . LEU B 1 135 ? -7.766  -3.363 -42.847 1.00 39.92 ? 134 LEU B O   1 
ATOM   2337 C CB  . LEU B 1 135 ? -7.141  -0.310 -43.381 1.00 39.65 ? 134 LEU B CB  1 
ATOM   2338 C CG  . LEU B 1 135 ? -7.152  1.045  -44.085 1.00 39.55 ? 134 LEU B CG  1 
ATOM   2339 C CD1 . LEU B 1 135 ? -7.351  2.157  -43.048 1.00 40.02 ? 134 LEU B CD1 1 
ATOM   2340 C CD2 . LEU B 1 135 ? -5.880  1.253  -44.896 1.00 38.96 ? 134 LEU B CD2 1 
ATOM   2341 N N   . THR B 1 136 ? -5.542  -3.121 -43.079 1.00 42.23 ? 135 THR B N   1 
ATOM   2342 C CA  . THR B 1 136 ? -5.172  -4.064 -42.023 1.00 45.99 ? 135 THR B CA  1 
ATOM   2343 C C   . THR B 1 136 ? -5.479  -3.471 -40.653 1.00 46.35 ? 135 THR B C   1 
ATOM   2344 O O   . THR B 1 136 ? -5.527  -2.245 -40.513 1.00 44.21 ? 135 THR B O   1 
ATOM   2345 C CB  . THR B 1 136 ? -3.686  -4.401 -42.076 1.00 46.64 ? 135 THR B CB  1 
ATOM   2346 O OG1 . THR B 1 136 ? -2.929  -3.228 -41.759 1.00 47.50 ? 135 THR B OG1 1 
ATOM   2347 C CG2 . THR B 1 136 ? -3.306  -4.875 -43.484 1.00 38.87 ? 135 THR B CG2 1 
ATOM   2348 N N   . ASP B 1 137 ? -5.680  -4.328 -39.648 1.00 44.68 ? 136 ASP B N   1 
ATOM   2349 C CA  . ASP B 1 137 ? -5.899  -3.867 -38.274 1.00 48.09 ? 136 ASP B CA  1 
ATOM   2350 C C   . ASP B 1 137 ? -4.695  -3.023 -37.834 1.00 43.22 ? 136 ASP B C   1 
ATOM   2351 O O   . ASP B 1 137 ? -4.835  -2.082 -37.058 1.00 42.37 ? 136 ASP B O   1 
ATOM   2352 C CB  . ASP B 1 137 ? -6.108  -5.048 -37.288 1.00 47.74 ? 136 ASP B CB  1 
ATOM   2353 C CG  . ASP B 1 137 ? -7.452  -5.776 -37.483 1.00 50.98 ? 136 ASP B CG  1 
ATOM   2354 O OD1 . ASP B 1 137 ? -8.369  -5.234 -38.141 1.00 55.28 ? 136 ASP B OD1 1 
ATOM   2355 O OD2 . ASP B 1 137 ? -7.595  -6.910 -36.963 1.00 56.78 ? 136 ASP B OD2 1 
ATOM   2356 N N   . GLU B 1 138 ? -3.519  -3.373 -38.340 1.00 38.17 ? 137 GLU B N   1 
ATOM   2357 C CA  . GLU B 1 138 ? -2.301  -2.673 -37.987 1.00 44.80 ? 137 GLU B CA  1 
ATOM   2358 C C   . GLU B 1 138 ? -2.351  -1.248 -38.558 1.00 45.82 ? 137 GLU B C   1 
ATOM   2359 O O   . GLU B 1 138 ? -2.070  -0.289 -37.843 1.00 39.45 ? 137 GLU B O   1 
ATOM   2360 C CB  . GLU B 1 138 ? -1.071  -3.418 -38.507 1.00 44.43 ? 137 GLU B CB  1 
ATOM   2361 C CG  . GLU B 1 138 ? 0.235   -2.955 -37.874 1.00 51.55 ? 137 GLU B CG  1 
ATOM   2362 C CD  . GLU B 1 138 ? 1.460   -3.637 -38.469 1.00 58.53 ? 137 GLU B CD  1 
ATOM   2363 O OE1 . GLU B 1 138 ? 1.338   -4.237 -39.552 1.00 66.45 ? 137 GLU B OE1 1 
ATOM   2364 O OE2 . GLU B 1 138 ? 2.533   -3.623 -37.828 1.00 58.61 ? 137 GLU B OE2 1 
ATOM   2365 N N   . ASN B 1 139 ? -2.725  -1.118 -39.836 1.00 40.43 ? 138 ASN B N   1 
ATOM   2366 C CA  . ASN B 1 139 ? -2.980  0.197  -40.419 1.00 37.33 ? 138 ASN B CA  1 
ATOM   2367 C C   . ASN B 1 139 ? -3.973  0.994  -39.594 1.00 37.67 ? 138 ASN B C   1 
ATOM   2368 O O   . ASN B 1 139 ? -3.731  2.167  -39.320 1.00 38.09 ? 138 ASN B O   1 
ATOM   2369 C CB  . ASN B 1 139 ? -3.502  0.095  -41.850 1.00 38.00 ? 138 ASN B CB  1 
ATOM   2370 C CG  . ASN B 1 139 ? -2.425  -0.286 -42.841 1.00 44.72 ? 138 ASN B CG  1 
ATOM   2371 O OD1 . ASN B 1 139 ? -1.237  -0.148 -42.565 1.00 47.65 ? 138 ASN B OD1 1 
ATOM   2372 N ND2 . ASN B 1 139 ? -2.841  -0.727 -44.021 1.00 44.71 ? 138 ASN B ND2 1 
ATOM   2373 N N   . VAL B 1 140 ? -5.079  0.353  -39.206 1.00 34.06 ? 139 VAL B N   1 
ATOM   2374 C CA  . VAL B 1 140 ? -6.131  1.013  -38.454 1.00 35.10 ? 139 VAL B CA  1 
ATOM   2375 C C   . VAL B 1 140 ? -5.585  1.485  -37.115 1.00 41.26 ? 139 VAL B C   1 
ATOM   2376 O O   . VAL B 1 140 ? -5.865  2.601  -36.667 1.00 39.30 ? 139 VAL B O   1 
ATOM   2377 C CB  . VAL B 1 140 ? -7.354  0.082  -38.236 1.00 43.87 ? 139 VAL B CB  1 
ATOM   2378 C CG1 . VAL B 1 140 ? -8.326  0.672  -37.212 1.00 34.05 ? 139 VAL B CG1 1 
ATOM   2379 C CG2 . VAL B 1 140 ? -8.089  -0.154 -39.558 1.00 42.35 ? 139 VAL B CG2 1 
ATOM   2380 N N   . LYS B 1 141 ? -4.787  0.626  -36.493 1.00 40.41 ? 140 LYS B N   1 
ATOM   2381 C CA  . LYS B 1 141 ? -4.157  0.938  -35.218 1.00 42.42 ? 140 LYS B CA  1 
ATOM   2382 C C   . LYS B 1 141 ? -3.231  2.141  -35.327 1.00 36.86 ? 140 LYS B C   1 
ATOM   2383 O O   . LYS B 1 141 ? -3.335  3.069  -34.543 1.00 33.72 ? 140 LYS B O   1 
ATOM   2384 C CB  . LYS B 1 141 ? -3.396  -0.293 -34.707 1.00 45.56 ? 140 LYS B CB  1 
ATOM   2385 C CG  . LYS B 1 141 ? -2.558  -0.101 -33.457 1.00 50.47 ? 140 LYS B CG  1 
ATOM   2386 C CD  . LYS B 1 141 ? -1.959  -1.464 -33.084 1.00 58.33 ? 140 LYS B CD  1 
ATOM   2387 C CE  . LYS B 1 141 ? -0.925  -1.915 -34.134 1.00 56.94 ? 140 LYS B CE  1 
ATOM   2388 N NZ  . LYS B 1 141 ? -0.424  -3.315 -33.907 1.00 62.59 ? 140 LYS B NZ  1 
ATOM   2389 N N   . HIS B 1 142 ? -2.338  2.132  -36.308 1.00 32.89 ? 141 HIS B N   1 
ATOM   2390 C CA  . HIS B 1 142 ? -1.370  3.204  -36.426 1.00 37.14 ? 141 HIS B CA  1 
ATOM   2391 C C   . HIS B 1 142 ? -1.997  4.551  -36.813 1.00 38.09 ? 141 HIS B C   1 
ATOM   2392 O O   . HIS B 1 142 ? -1.493  5.609  -36.418 1.00 33.49 ? 141 HIS B O   1 
ATOM   2393 C CB  . HIS B 1 142 ? -0.292  2.833  -37.428 1.00 35.06 ? 141 HIS B CB  1 
ATOM   2394 C CG  . HIS B 1 142 ? 0.522   1.651  -37.010 1.00 46.19 ? 141 HIS B CG  1 
ATOM   2395 N ND1 . HIS B 1 142 ? 1.410   1.024  -37.854 1.00 48.56 ? 141 HIS B ND1 1 
ATOM   2396 C CD2 . HIS B 1 142 ? 0.575   0.980  -35.836 1.00 51.26 ? 141 HIS B CD2 1 
ATOM   2397 C CE1 . HIS B 1 142 ? 1.985   0.019  -37.214 1.00 51.43 ? 141 HIS B CE1 1 
ATOM   2398 N NE2 . HIS B 1 142 ? 1.493   -0.034 -35.993 1.00 53.57 ? 141 HIS B NE2 1 
ATOM   2399 N N   . ARG B 1 143 ? -3.086  4.517  -37.572 1.00 34.00 ? 142 ARG B N   1 
ATOM   2400 C CA  . ARG B 1 143 ? -3.739  5.757  -37.963 1.00 37.93 ? 142 ARG B CA  1 
ATOM   2401 C C   . ARG B 1 143 ? -4.343  6.444  -36.748 1.00 37.26 ? 142 ARG B C   1 
ATOM   2402 O O   . ARG B 1 143 ? -4.158  7.649  -36.547 1.00 32.78 ? 142 ARG B O   1 
ATOM   2403 C CB  . ARG B 1 143 ? -4.821  5.515  -39.015 1.00 32.67 ? 142 ARG B CB  1 
ATOM   2404 C CG  . ARG B 1 143 ? -5.548  6.801  -39.414 1.00 35.14 ? 142 ARG B CG  1 
ATOM   2405 C CD  . ARG B 1 143 ? -6.516  6.566  -40.593 1.00 38.97 ? 142 ARG B CD  1 
ATOM   2406 N NE  . ARG B 1 143 ? -7.578  5.623  -40.264 1.00 45.01 ? 142 ARG B NE  1 
ATOM   2407 C CZ  . ARG B 1 143 ? -8.410  5.074  -41.148 1.00 42.98 ? 142 ARG B CZ  1 
ATOM   2408 N NH1 . ARG B 1 143 ? -8.342  5.404  -42.434 1.00 32.33 ? 142 ARG B NH1 1 
ATOM   2409 N NH2 . ARG B 1 143 ? -9.338  4.222  -40.728 1.00 38.59 ? 142 ARG B NH2 1 
ATOM   2410 N N   . LYS B 1 144 ? -5.088  5.680  -35.960 1.00 33.22 ? 143 LYS B N   1 
ATOM   2411 C CA  . LYS B 1 144 ? -5.643  6.205  -34.726 1.00 38.40 ? 143 LYS B CA  1 
ATOM   2412 C C   . LYS B 1 144 ? -4.552  6.728  -33.796 1.00 37.05 ? 143 LYS B C   1 
ATOM   2413 O O   . LYS B 1 144 ? -4.663  7.834  -33.284 1.00 35.82 ? 143 LYS B O   1 
ATOM   2414 C CB  . LYS B 1 144 ? -6.475  5.143  -34.008 1.00 39.27 ? 143 LYS B CB  1 
ATOM   2415 C CG  . LYS B 1 144 ? -7.817  4.940  -34.650 1.00 48.32 ? 143 LYS B CG  1 
ATOM   2416 C CD  . LYS B 1 144 ? -8.734  4.032  -33.854 1.00 51.81 ? 143 LYS B CD  1 
ATOM   2417 C CE  . LYS B 1 144 ? -8.235  2.620  -33.850 1.00 46.50 ? 143 LYS B CE  1 
ATOM   2418 N NZ  . LYS B 1 144 ? -9.280  1.695  -33.329 1.00 48.81 ? 143 LYS B NZ  1 
ATOM   2419 N N   . TYR B 1 145 ? -3.516  5.923  -33.578 1.00 34.79 ? 144 TYR B N   1 
ATOM   2420 C CA  . TYR B 1 145 ? -2.411  6.287  -32.690 1.00 35.86 ? 144 TYR B CA  1 
ATOM   2421 C C   . TYR B 1 145 ? -1.758  7.574  -33.191 1.00 34.35 ? 144 TYR B C   1 
ATOM   2422 O O   . TYR B 1 145 ? -1.625  8.543  -32.443 1.00 31.61 ? 144 TYR B O   1 
ATOM   2423 C CB  . TYR B 1 145 ? -1.379  5.156  -32.641 1.00 31.04 ? 144 TYR B CB  1 
ATOM   2424 C CG  . TYR B 1 145 ? -0.163  5.331  -31.728 1.00 35.39 ? 144 TYR B CG  1 
ATOM   2425 C CD1 . TYR B 1 145 ? -0.193  4.893  -30.398 1.00 38.09 ? 144 TYR B CD1 1 
ATOM   2426 C CD2 . TYR B 1 145 ? 1.022   5.903  -32.199 1.00 31.63 ? 144 TYR B CD2 1 
ATOM   2427 C CE1 . TYR B 1 145 ? 0.925   5.019  -29.555 1.00 32.91 ? 144 TYR B CE1 1 
ATOM   2428 C CE2 . TYR B 1 145 ? 2.135   6.040  -31.378 1.00 32.39 ? 144 TYR B CE2 1 
ATOM   2429 C CZ  . TYR B 1 145 ? 2.078   5.588  -30.044 1.00 37.32 ? 144 TYR B CZ  1 
ATOM   2430 O OH  . TYR B 1 145 ? 3.167   5.716  -29.205 1.00 32.96 ? 144 TYR B OH  1 
ATOM   2431 N N   . ALA B 1 146 ? -1.346  7.574  -34.458 1.00 29.58 ? 145 ALA B N   1 
ATOM   2432 C CA  . ALA B 1 146 ? -0.575  8.697  -34.992 1.00 33.41 ? 145 ALA B CA  1 
ATOM   2433 C C   . ALA B 1 146 ? -1.409  9.964  -35.055 1.00 30.53 ? 145 ALA B C   1 
ATOM   2434 O O   . ALA B 1 146 ? -0.906  11.042 -34.764 1.00 32.43 ? 145 ALA B O   1 
ATOM   2435 C CB  . ALA B 1 146 ? -0.011  8.373  -36.368 1.00 28.03 ? 145 ALA B CB  1 
ATOM   2436 N N   . ARG B 1 147 ? -2.680  9.842  -35.421 1.00 31.48 ? 146 ARG B N   1 
ATOM   2437 C CA  . ARG B 1 147 ? -3.509  11.030 -35.525 1.00 33.89 ? 146 ARG B CA  1 
ATOM   2438 C C   . ARG B 1 147 ? -3.721  11.638 -34.144 1.00 35.02 ? 146 ARG B C   1 
ATOM   2439 O O   . ARG B 1 147 ? -3.703  12.858 -33.994 1.00 30.87 ? 146 ARG B O   1 
ATOM   2440 C CB  . ARG B 1 147 ? -4.866  10.750 -36.195 1.00 32.92 ? 146 ARG B CB  1 
ATOM   2441 C CG  . ARG B 1 147 ? -5.655  12.066 -36.389 1.00 36.70 ? 146 ARG B CG  1 
ATOM   2442 C CD  . ARG B 1 147 ? -6.746  12.076 -37.482 1.00 40.02 ? 146 ARG B CD  1 
ATOM   2443 N NE  . ARG B 1 147 ? -6.186  11.812 -38.811 1.00 44.26 ? 146 ARG B NE  1 
ATOM   2444 C CZ  . ARG B 1 147 ? -6.732  11.028 -39.744 1.00 45.78 ? 146 ARG B CZ  1 
ATOM   2445 N NH1 . ARG B 1 147 ? -7.937  10.502 -39.565 1.00 49.37 ? 146 ARG B NH1 1 
ATOM   2446 N NH2 . ARG B 1 147 ? -6.106  10.840 -40.905 1.00 35.40 ? 146 ARG B NH2 1 
ATOM   2447 N N   . TRP B 1 148 ? -3.913  10.809 -33.127 1.00 32.94 ? 147 TRP B N   1 
ATOM   2448 C CA  . TRP B 1 148 ? -4.158  11.401 -31.820 1.00 35.40 ? 147 TRP B CA  1 
ATOM   2449 C C   . TRP B 1 148 ? -2.844  11.901 -31.182 1.00 33.29 ? 147 TRP B C   1 
ATOM   2450 O O   . TRP B 1 148 ? -2.866  12.898 -30.471 1.00 33.38 ? 147 TRP B O   1 
ATOM   2451 C CB  . TRP B 1 148 ? -4.900  10.438 -30.875 1.00 33.62 ? 147 TRP B CB  1 
ATOM   2452 C CG  . TRP B 1 148 ? -5.219  11.156 -29.589 1.00 42.35 ? 147 TRP B CG  1 
ATOM   2453 C CD1 . TRP B 1 148 ? -4.687  10.921 -28.346 1.00 43.96 ? 147 TRP B CD1 1 
ATOM   2454 C CD2 . TRP B 1 148 ? -6.074  12.304 -29.446 1.00 45.63 ? 147 TRP B CD2 1 
ATOM   2455 N NE1 . TRP B 1 148 ? -5.200  11.822 -27.428 1.00 41.82 ? 147 TRP B NE1 1 
ATOM   2456 C CE2 . TRP B 1 148 ? -6.045  12.685 -28.081 1.00 45.39 ? 147 TRP B CE2 1 
ATOM   2457 C CE3 . TRP B 1 148 ? -6.879  13.031 -30.331 1.00 42.71 ? 147 TRP B CE3 1 
ATOM   2458 C CZ2 . TRP B 1 148 ? -6.782  13.765 -27.591 1.00 48.29 ? 147 TRP B CZ2 1 
ATOM   2459 C CZ3 . TRP B 1 148 ? -7.600  14.101 -29.844 1.00 48.88 ? 147 TRP B CZ3 1 
ATOM   2460 C CH2 . TRP B 1 148 ? -7.557  14.453 -28.484 1.00 46.15 ? 147 TRP B CH2 1 
ATOM   2461 N N   . LYS B 1 149 ? -1.702  11.257 -31.457 1.00 31.97 ? 148 LYS B N   1 
ATOM   2462 C CA  . LYS B 1 149 ? -0.418  11.836 -31.038 1.00 30.69 ? 148 LYS B CA  1 
ATOM   2463 C C   . LYS B 1 149 ? -0.264  13.258 -31.562 1.00 34.56 ? 148 LYS B C   1 
ATOM   2464 O O   . LYS B 1 149 ? 0.120   14.158 -30.813 1.00 34.05 ? 148 LYS B O   1 
ATOM   2465 C CB  . LYS B 1 149 ? 0.802   11.046 -31.527 1.00 32.03 ? 148 LYS B CB  1 
ATOM   2466 C CG  . LYS B 1 149 ? 0.981   9.617  -31.055 1.00 36.35 ? 148 LYS B CG  1 
ATOM   2467 C CD  . LYS B 1 149 ? 1.085   9.408  -29.556 1.00 40.85 ? 148 LYS B CD  1 
ATOM   2468 C CE  . LYS B 1 149 ? 2.398   9.735  -28.941 1.00 42.92 ? 148 LYS B CE  1 
ATOM   2469 N NZ  . LYS B 1 149 ? 2.560   9.065  -27.553 1.00 27.89 ? 148 LYS B NZ  1 
ATOM   2470 N N   . ALA B 1 150 ? -0.528  13.438 -32.861 1.00 30.05 ? 149 ALA B N   1 
ATOM   2471 C CA  . ALA B 1 150 ? -0.372  14.734 -33.499 1.00 34.69 ? 149 ALA B CA  1 
ATOM   2472 C C   . ALA B 1 150 ? -1.234  15.776 -32.792 1.00 30.10 ? 149 ALA B C   1 
ATOM   2473 O O   . ALA B 1 150 ? -0.750  16.835 -32.412 1.00 32.05 ? 149 ALA B O   1 
ATOM   2474 C CB  . ALA B 1 150 ? -0.731  14.655 -35.009 1.00 31.16 ? 149 ALA B CB  1 
ATOM   2475 N N   . THR B 1 151 ? -2.504  15.452 -32.595 1.00 28.36 ? 150 THR B N   1 
ATOM   2476 C CA  . THR B 1 151 ? -3.433  16.382 -31.973 1.00 33.33 ? 150 THR B CA  1 
ATOM   2477 C C   . THR B 1 151 ? -3.093  16.632 -30.505 1.00 34.70 ? 150 THR B C   1 
ATOM   2478 O O   . THR B 1 151 ? -3.051  17.774 -30.061 1.00 31.50 ? 150 THR B O   1 
ATOM   2479 C CB  . THR B 1 151 ? -4.873  15.862 -32.078 1.00 35.93 ? 150 THR B CB  1 
ATOM   2480 O OG1 . THR B 1 151 ? -5.199  15.683 -33.454 1.00 38.62 ? 150 THR B OG1 1 
ATOM   2481 C CG2 . THR B 1 151 ? -5.839  16.853 -31.478 1.00 35.07 ? 150 THR B CG2 1 
ATOM   2482 N N   . TYR B 1 152 ? -2.828  15.558 -29.763 1.00 32.10 ? 151 TYR B N   1 
ATOM   2483 C CA  . TYR B 1 152 ? -2.533  15.675 -28.347 1.00 34.44 ? 151 TYR B CA  1 
ATOM   2484 C C   . TYR B 1 152 ? -1.244  16.475 -28.093 1.00 32.73 ? 151 TYR B C   1 
ATOM   2485 O O   . TYR B 1 152 ? -1.247  17.422 -27.303 1.00 26.80 ? 151 TYR B O   1 
ATOM   2486 C CB  . TYR B 1 152 ? -2.466  14.274 -27.698 1.00 35.00 ? 151 TYR B CB  1 
ATOM   2487 C CG  . TYR B 1 152 ? -1.944  14.310 -26.285 1.00 36.43 ? 151 TYR B CG  1 
ATOM   2488 C CD1 . TYR B 1 152 ? -2.697  14.879 -25.265 1.00 30.47 ? 151 TYR B CD1 1 
ATOM   2489 C CD2 . TYR B 1 152 ? -0.704  13.770 -25.974 1.00 34.47 ? 151 TYR B CD2 1 
ATOM   2490 C CE1 . TYR B 1 152 ? -2.227  14.925 -23.968 1.00 35.21 ? 151 TYR B CE1 1 
ATOM   2491 C CE2 . TYR B 1 152 ? -0.220  13.806 -24.684 1.00 37.07 ? 151 TYR B CE2 1 
ATOM   2492 C CZ  . TYR B 1 152 ? -0.992  14.386 -23.685 1.00 38.34 ? 151 TYR B CZ  1 
ATOM   2493 O OH  . TYR B 1 152 ? -0.513  14.439 -22.411 1.00 34.66 ? 151 TYR B OH  1 
ATOM   2494 N N   . ILE B 1 153 ? -0.162  16.124 -28.786 1.00 30.95 ? 152 ILE B N   1 
ATOM   2495 C CA  . ILE B 1 153 ? 1.120   16.813 -28.603 1.00 30.33 ? 152 ILE B CA  1 
ATOM   2496 C C   . ILE B 1 153 ? 1.011   18.292 -29.025 1.00 34.94 ? 152 ILE B C   1 
ATOM   2497 O O   . ILE B 1 153 ? 1.488   19.200 -28.315 1.00 31.56 ? 152 ILE B O   1 
ATOM   2498 C CB  . ILE B 1 153 ? 2.246   16.089 -29.384 1.00 31.09 ? 152 ILE B CB  1 
ATOM   2499 C CG1 . ILE B 1 153 ? 2.476   14.691 -28.796 1.00 32.09 ? 152 ILE B CG1 1 
ATOM   2500 C CG2 . ILE B 1 153 ? 3.570   16.884 -29.371 1.00 26.62 ? 152 ILE B CG2 1 
ATOM   2501 C CD1 . ILE B 1 153 ? 3.431   13.816 -29.607 1.00 28.37 ? 152 ILE B CD1 1 
ATOM   2502 N N   . HIS B 1 154 ? 0.346   18.533 -30.154 1.00 34.80 ? 153 HIS B N   1 
ATOM   2503 C CA  . HIS B 1 154 ? 0.041   19.897 -30.597 1.00 35.79 ? 153 HIS B CA  1 
ATOM   2504 C C   . HIS B 1 154 ? -0.644  20.709 -29.489 1.00 32.15 ? 153 HIS B C   1 
ATOM   2505 O O   . HIS B 1 154 ? -0.249  21.832 -29.193 1.00 32.81 ? 153 HIS B O   1 
ATOM   2506 C CB  . HIS B 1 154 ? -0.865  19.882 -31.838 1.00 31.87 ? 153 HIS B CB  1 
ATOM   2507 C CG  . HIS B 1 154 ? -1.239  21.245 -32.327 1.00 33.55 ? 153 HIS B CG  1 
ATOM   2508 N ND1 . HIS B 1 154 ? -0.376  22.047 -33.046 1.00 35.54 ? 153 HIS B ND1 1 
ATOM   2509 C CD2 . HIS B 1 154 ? -2.361  21.979 -32.135 1.00 35.69 ? 153 HIS B CD2 1 
ATOM   2510 C CE1 . HIS B 1 154 ? -0.969  23.196 -33.315 1.00 38.33 ? 153 HIS B CE1 1 
ATOM   2511 N NE2 . HIS B 1 154 ? -2.170  23.184 -32.762 1.00 37.75 ? 153 HIS B NE2 1 
ATOM   2512 N N   . ASN B 1 155 ? -1.703  20.153 -28.920 1.00 31.05 ? 154 ASN B N   1 
ATOM   2513 C CA  . ASN B 1 155 ? -2.458  20.854 -27.892 1.00 35.08 ? 154 ASN B CA  1 
ATOM   2514 C C   . ASN B 1 155 ? -1.632  21.105 -26.637 1.00 35.56 ? 154 ASN B C   1 
ATOM   2515 O O   . ASN B 1 155 ? -1.780  22.146 -26.012 1.00 36.13 ? 154 ASN B O   1 
ATOM   2516 C CB  . ASN B 1 155 ? -3.732  20.085 -27.550 1.00 33.40 ? 154 ASN B CB  1 
ATOM   2517 C CG  . ASN B 1 155 ? -4.833  20.300 -28.582 1.00 49.08 ? 154 ASN B CG  1 
ATOM   2518 O OD1 . ASN B 1 155 ? -4.873  21.334 -29.260 1.00 51.40 ? 154 ASN B OD1 1 
ATOM   2519 N ND2 . ASN B 1 155 ? -5.727  19.318 -28.716 1.00 51.87 ? 154 ASN B ND2 1 
ATOM   2520 N N   . CYS B 1 156 ? -0.747  20.171 -26.286 1.00 35.27 ? 155 CYS B N   1 
ATOM   2521 C CA  . CYS B 1 156 ? 0.136   20.366 -25.130 1.00 38.00 ? 155 CYS B CA  1 
ATOM   2522 C C   . CYS B 1 156 ? 1.103   21.519 -25.337 1.00 37.46 ? 155 CYS B C   1 
ATOM   2523 O O   . CYS B 1 156 ? 1.278   22.359 -24.454 1.00 35.83 ? 155 CYS B O   1 
ATOM   2524 C CB  . CYS B 1 156 ? 0.934   19.093 -24.821 1.00 32.85 ? 155 CYS B CB  1 
ATOM   2525 S SG  . CYS B 1 156 ? -0.069  17.762 -24.185 1.00 33.25 ? 155 CYS B SG  1 
ATOM   2526 N N   . LEU B 1 157 ? 1.750   21.541 -26.499 1.00 32.27 ? 156 LEU B N   1 
ATOM   2527 C CA  . LEU B 1 157 ? 2.686   22.603 -26.808 1.00 35.36 ? 156 LEU B CA  1 
ATOM   2528 C C   . LEU B 1 157 ? 1.956   23.945 -26.829 1.00 35.98 ? 156 LEU B C   1 
ATOM   2529 O O   . LEU B 1 157 ? 2.433   24.930 -26.273 1.00 36.92 ? 156 LEU B O   1 
ATOM   2530 C CB  . LEU B 1 157 ? 3.394   22.339 -28.135 1.00 35.91 ? 156 LEU B CB  1 
ATOM   2531 C CG  . LEU B 1 157 ? 4.404   21.196 -28.103 1.00 41.42 ? 156 LEU B CG  1 
ATOM   2532 C CD1 . LEU B 1 157 ? 4.981   20.909 -29.490 1.00 31.95 ? 156 LEU B CD1 1 
ATOM   2533 C CD2 . LEU B 1 157 ? 5.531   21.534 -27.125 1.00 40.00 ? 156 LEU B CD2 1 
ATOM   2534 N N   . LYS B 1 158 ? 0.785   23.954 -27.446 1.00 35.31 ? 157 LYS B N   1 
ATOM   2535 C CA  . LYS B 1 158 ? -0.049  25.138 -27.527 1.00 36.32 ? 157 LYS B CA  1 
ATOM   2536 C C   . LYS B 1 158 ? -0.318  25.736 -26.154 1.00 41.93 ? 157 LYS B C   1 
ATOM   2537 O O   . LYS B 1 158 ? -0.249  26.944 -25.995 1.00 38.53 ? 157 LYS B O   1 
ATOM   2538 C CB  . LYS B 1 158 ? -1.380  24.807 -28.199 1.00 35.71 ? 157 LYS B CB  1 
ATOM   2539 C CG  . LYS B 1 158 ? -2.317  25.994 -28.337 1.00 41.91 ? 157 LYS B CG  1 
ATOM   2540 C CD  . LYS B 1 158 ? -3.639  25.561 -28.949 1.00 46.00 ? 157 LYS B CD  1 
ATOM   2541 C CE  . LYS B 1 158 ? -4.636  26.699 -28.940 1.00 60.47 ? 157 LYS B CE  1 
ATOM   2542 N NZ  . LYS B 1 158 ? -5.943  26.270 -29.502 1.00 68.91 ? 157 LYS B NZ  1 
ATOM   2543 N N   . ASN B 1 159 ? -0.627  24.881 -25.180 1.00 38.27 ? 158 ASN B N   1 
ATOM   2544 C CA  . ASN B 1 159 ? -1.023  25.321 -23.841 1.00 40.49 ? 158 ASN B CA  1 
ATOM   2545 C C   . ASN B 1 159 ? 0.077   25.207 -22.792 1.00 41.11 ? 158 ASN B C   1 
ATOM   2546 O O   . ASN B 1 159 ? -0.185  25.316 -21.605 1.00 47.73 ? 158 ASN B O   1 
ATOM   2547 C CB  . ASN B 1 159 ? -2.248  24.537 -23.354 1.00 38.79 ? 158 ASN B CB  1 
ATOM   2548 C CG  . ASN B 1 159 ? -3.522  24.944 -24.075 1.00 47.34 ? 158 ASN B CG  1 
ATOM   2549 O OD1 . ASN B 1 159 ? -4.040  26.043 -23.861 1.00 56.87 ? 158 ASN B OD1 1 
ATOM   2550 N ND2 . ASN B 1 159 ? -4.055  24.052 -24.899 1.00 41.48 ? 158 ASN B ND2 1 
ATOM   2551 N N   . GLY B 1 160 ? 1.309   24.994 -23.224 1.00 43.05 ? 159 GLY B N   1 
ATOM   2552 C CA  . GLY B 1 160 ? 2.420   24.961 -22.288 1.00 45.14 ? 159 GLY B CA  1 
ATOM   2553 C C   . GLY B 1 160 ? 2.464   23.755 -21.354 1.00 46.94 ? 159 GLY B C   1 
ATOM   2554 O O   . GLY B 1 160 ? 3.105   23.812 -20.303 1.00 46.33 ? 159 GLY B O   1 
ATOM   2555 N N   . GLU B 1 161 ? 1.794   22.668 -21.734 1.00 41.41 ? 160 GLU B N   1 
ATOM   2556 C CA  . GLU B 1 161 ? 1.823   21.429 -20.961 1.00 39.53 ? 160 GLU B CA  1 
ATOM   2557 C C   . GLU B 1 161 ? 2.834   20.409 -21.508 1.00 42.96 ? 160 GLU B C   1 
ATOM   2558 O O   . GLU B 1 161 ? 3.083   20.355 -22.717 1.00 43.83 ? 160 GLU B O   1 
ATOM   2559 C CB  . GLU B 1 161 ? 0.426   20.791 -20.916 1.00 40.66 ? 160 GLU B CB  1 
ATOM   2560 C CG  . GLU B 1 161 ? -0.628  21.594 -20.130 1.00 51.79 ? 160 GLU B CG  1 
ATOM   2561 C CD  . GLU B 1 161 ? -1.909  20.797 -19.841 1.00 63.29 ? 160 GLU B CD  1 
ATOM   2562 O OE1 . GLU B 1 161 ? -2.057  19.655 -20.347 1.00 62.36 ? 160 GLU B OE1 1 
ATOM   2563 O OE2 . GLU B 1 161 ? -2.769  21.308 -19.086 1.00 63.77 ? 160 GLU B OE2 1 
ATOM   2564 N N   . THR B 1 162 ? 3.411   19.600 -20.621 1.00 34.59 ? 161 THR B N   1 
ATOM   2565 C CA  . THR B 1 162 ? 4.238   18.473 -21.034 1.00 36.75 ? 161 THR B CA  1 
ATOM   2566 C C   . THR B 1 162 ? 3.351   17.290 -21.438 1.00 37.80 ? 161 THR B C   1 
ATOM   2567 O O   . THR B 1 162 ? 2.467   16.893 -20.688 1.00 36.37 ? 161 THR B O   1 
ATOM   2568 C CB  . THR B 1 162 ? 5.200   18.020 -19.916 1.00 40.56 ? 161 THR B CB  1 
ATOM   2569 O OG1 . THR B 1 162 ? 6.083   19.092 -19.569 1.00 42.41 ? 161 THR B OG1 1 
ATOM   2570 C CG2 . THR B 1 162 ? 6.022   16.821 -20.375 1.00 36.78 ? 161 THR B CG2 1 
ATOM   2571 N N   . PRO B 1 163 ? 3.556   16.748 -22.650 1.00 36.71 ? 162 PRO B N   1 
ATOM   2572 C CA  . PRO B 1 163 ? 2.750   15.591 -23.056 1.00 37.29 ? 162 PRO B CA  1 
ATOM   2573 C C   . PRO B 1 163 ? 2.847   14.423 -22.046 1.00 40.61 ? 162 PRO B C   1 
ATOM   2574 O O   . PRO B 1 163 ? 1.836   13.773 -21.755 1.00 35.34 ? 162 PRO B O   1 
ATOM   2575 C CB  . PRO B 1 163 ? 3.345   15.222 -24.410 1.00 36.03 ? 162 PRO B CB  1 
ATOM   2576 C CG  . PRO B 1 163 ? 3.857   16.523 -24.950 1.00 35.00 ? 162 PRO B CG  1 
ATOM   2577 C CD  . PRO B 1 163 ? 4.398   17.251 -23.749 1.00 37.12 ? 162 PRO B CD  1 
ATOM   2578 O OXT . PRO B 1 163 ? 3.906   14.138 -21.464 1.00 36.63 ? 162 PRO B OXT 1 
ATOM   2579 N N   . ASP C 2 12  ? 5.725   38.045 -2.385  1.00 69.47 ? 186 ASP C N   1 
ATOM   2580 C CA  . ASP C 2 12  ? 6.682   38.012 -1.261  1.00 76.73 ? 186 ASP C CA  1 
ATOM   2581 C C   . ASP C 2 12  ? 5.980   37.886 0.087   1.00 74.25 ? 186 ASP C C   1 
ATOM   2582 O O   . ASP C 2 12  ? 6.477   37.203 0.988   1.00 76.75 ? 186 ASP C O   1 
ATOM   2583 C CB  . ASP C 2 12  ? 7.589   39.240 -1.282  1.00 79.07 ? 186 ASP C CB  1 
ATOM   2584 C CG  . ASP C 2 12  ? 8.450   39.358 -0.026  1.00 80.84 ? 186 ASP C CG  1 
ATOM   2585 O OD1 . ASP C 2 12  ? 9.114   38.369 0.335   1.00 79.47 ? 186 ASP C OD1 1 
ATOM   2586 O OD2 . ASP C 2 12  ? 8.486   40.449 0.581   1.00 85.63 ? 186 ASP C OD2 1 
ATOM   2587 N N   . GLU C 2 13  ? 4.838   38.549 0.238   1.00 70.92 ? 187 GLU C N   1 
ATOM   2588 C CA  . GLU C 2 13  ? 3.959   38.237 1.357   1.00 70.67 ? 187 GLU C CA  1 
ATOM   2589 C C   . GLU C 2 13  ? 3.517   36.784 1.183   1.00 71.10 ? 187 GLU C C   1 
ATOM   2590 O O   . GLU C 2 13  ? 3.428   36.019 2.143   1.00 69.70 ? 187 GLU C O   1 
ATOM   2591 C CB  . GLU C 2 13  ? 2.760   39.172 1.411   1.00 70.90 ? 187 GLU C CB  1 
ATOM   2592 N N   . LEU C 2 14  ? 3.245   36.425 -0.068  1.00 71.89 ? 188 LEU C N   1 
ATOM   2593 C CA  . LEU C 2 14  ? 2.915   35.055 -0.439  1.00 69.55 ? 188 LEU C CA  1 
ATOM   2594 C C   . LEU C 2 14  ? 4.074   34.101 -0.158  1.00 67.35 ? 188 LEU C C   1 
ATOM   2595 O O   . LEU C 2 14  ? 3.880   33.043 0.448   1.00 66.91 ? 188 LEU C O   1 
ATOM   2596 C CB  . LEU C 2 14  ? 2.528   34.982 -1.913  1.00 61.80 ? 188 LEU C CB  1 
ATOM   2597 C CG  . LEU C 2 14  ? 1.272   35.759 -2.307  1.00 63.80 ? 188 LEU C CG  1 
ATOM   2598 C CD1 . LEU C 2 14  ? 1.060   35.680 -3.806  1.00 63.84 ? 188 LEU C CD1 1 
ATOM   2599 C CD2 . LEU C 2 14  ? 0.053   35.244 -1.549  1.00 62.09 ? 188 LEU C CD2 1 
ATOM   2600 N N   . SER C 2 15  ? 5.273   34.477 -0.597  1.00 67.66 ? 189 SER C N   1 
ATOM   2601 C CA  . SER C 2 15  ? 6.452   33.631 -0.422  1.00 67.08 ? 189 SER C CA  1 
ATOM   2602 C C   . SER C 2 15  ? 6.669   33.277 1.042   1.00 68.88 ? 189 SER C C   1 
ATOM   2603 O O   . SER C 2 15  ? 7.084   32.159 1.363   1.00 69.15 ? 189 SER C O   1 
ATOM   2604 C CB  . SER C 2 15  ? 7.708   34.311 -0.981  1.00 70.04 ? 189 SER C CB  1 
ATOM   2605 O OG  . SER C 2 15  ? 7.647   34.452 -2.390  1.00 71.34 ? 189 SER C OG  1 
ATOM   2606 N N   . GLN C 2 16  ? 6.370   34.220 1.932   1.00 69.71 ? 190 GLN C N   1 
ATOM   2607 C CA  . GLN C 2 16  ? 6.596   33.992 3.351   1.00 68.07 ? 190 GLN C CA  1 
ATOM   2608 C C   . GLN C 2 16  ? 5.515   33.117 3.970   1.00 63.63 ? 190 GLN C C   1 
ATOM   2609 O O   . GLN C 2 16  ? 5.805   32.285 4.836   1.00 61.94 ? 190 GLN C O   1 
ATOM   2610 C CB  . GLN C 2 16  ? 6.694   35.316 4.117   1.00 73.13 ? 190 GLN C CB  1 
ATOM   2611 C CG  . GLN C 2 16  ? 7.897   36.166 3.727   1.00 75.02 ? 190 GLN C CG  1 
ATOM   2612 C CD  . GLN C 2 16  ? 9.192   35.361 3.727   1.00 80.83 ? 190 GLN C CD  1 
ATOM   2613 O OE1 . GLN C 2 16  ? 9.794   35.136 2.674   1.00 83.22 ? 190 GLN C OE1 1 
ATOM   2614 N NE2 . GLN C 2 16  ? 9.584   34.862 4.896   1.00 81.21 ? 190 GLN C NE2 1 
ATOM   2615 N N   . ARG C 2 17  ? 4.271   33.309 3.544   1.00 60.84 ? 191 ARG C N   1 
ATOM   2616 C CA  . ARG C 2 17  ? 3.189   32.449 4.002   1.00 60.62 ? 191 ARG C CA  1 
ATOM   2617 C C   . ARG C 2 17  ? 3.481   31.000 3.590   1.00 58.31 ? 191 ARG C C   1 
ATOM   2618 O O   . ARG C 2 17  ? 3.250   30.078 4.367   1.00 56.75 ? 191 ARG C O   1 
ATOM   2619 C CB  . ARG C 2 17  ? 1.843   32.922 3.448   1.00 59.37 ? 191 ARG C CB  1 
ATOM   2620 C CG  . ARG C 2 17  ? 1.426   34.304 3.934   1.00 60.23 ? 191 ARG C CG  1 
ATOM   2621 C CD  . ARG C 2 17  ? 0.140   34.797 3.263   1.00 54.50 ? 191 ARG C CD  1 
ATOM   2622 N NE  . ARG C 2 17  ? -1.055  34.049 3.659   1.00 51.46 ? 191 ARG C NE  1 
ATOM   2623 C CZ  . ARG C 2 17  ? -2.251  34.200 3.089   1.00 49.91 ? 191 ARG C CZ  1 
ATOM   2624 N NH1 . ARG C 2 17  ? -2.410  35.055 2.087   1.00 48.16 ? 191 ARG C NH1 1 
ATOM   2625 N NH2 . ARG C 2 17  ? -3.288  33.487 3.510   1.00 51.35 ? 191 ARG C NH2 1 
ATOM   2626 N N   . LEU C 2 18  ? 4.020   30.811 2.386   1.00 60.07 ? 192 LEU C N   1 
ATOM   2627 C CA  . LEU C 2 18  ? 4.391   29.476 1.909   1.00 57.38 ? 192 LEU C CA  1 
ATOM   2628 C C   . LEU C 2 18  ? 5.464   28.837 2.794   1.00 58.45 ? 192 LEU C C   1 
ATOM   2629 O O   . LEU C 2 18  ? 5.318   27.696 3.250   1.00 54.58 ? 192 LEU C O   1 
ATOM   2630 C CB  . LEU C 2 18  ? 4.876   29.536 0.464   1.00 56.00 ? 192 LEU C CB  1 
ATOM   2631 C CG  . LEU C 2 18  ? 5.276   28.198 -0.157  1.00 58.20 ? 192 LEU C CG  1 
ATOM   2632 C CD1 . LEU C 2 18  ? 4.078   27.280 -0.197  1.00 54.16 ? 192 LEU C CD1 1 
ATOM   2633 C CD2 . LEU C 2 18  ? 5.838   28.382 -1.565  1.00 60.58 ? 192 LEU C CD2 1 
ATOM   2634 N N   . ALA C 2 19  ? 6.539   29.578 3.041   1.00 61.44 ? 193 ALA C N   1 
ATOM   2635 C CA  . ALA C 2 19  ? 7.616   29.086 3.896   1.00 62.32 ? 193 ALA C CA  1 
ATOM   2636 C C   . ALA C 2 19  ? 7.090   28.746 5.291   1.00 57.53 ? 193 ALA C C   1 
ATOM   2637 O O   . ALA C 2 19  ? 7.494   27.751 5.887   1.00 60.45 ? 193 ALA C O   1 
ATOM   2638 C CB  . ALA C 2 19  ? 8.738   30.109 3.976   1.00 62.51 ? 193 ALA C CB  1 
ATOM   2639 N N   . ARG C 2 20  ? 6.171   29.563 5.799   1.00 59.56 ? 194 ARG C N   1 
ATOM   2640 C CA  . ARG C 2 20  ? 5.572   29.302 7.106   1.00 60.19 ? 194 ARG C CA  1 
ATOM   2641 C C   . ARG C 2 20  ? 4.624   28.112 7.020   1.00 58.95 ? 194 ARG C C   1 
ATOM   2642 O O   . ARG C 2 20  ? 4.513   27.317 7.954   1.00 55.70 ? 194 ARG C O   1 
ATOM   2643 C CB  . ARG C 2 20  ? 4.828   30.534 7.640   1.00 59.79 ? 194 ARG C CB  1 
ATOM   2644 C CG  . ARG C 2 20  ? 4.283   30.318 9.053   1.00 65.51 ? 194 ARG C CG  1 
ATOM   2645 C CD  . ARG C 2 20  ? 3.608   31.549 9.681   1.00 75.65 ? 194 ARG C CD  1 
ATOM   2646 N NE  . ARG C 2 20  ? 2.316   31.902 9.090   1.00 74.00 ? 194 ARG C NE  1 
ATOM   2647 C CZ  . ARG C 2 20  ? 2.090   32.976 8.338   1.00 72.46 ? 194 ARG C CZ  1 
ATOM   2648 N NH1 . ARG C 2 20  ? 3.074   33.831 8.074   1.00 72.49 ? 194 ARG C NH1 1 
ATOM   2649 N NH2 . ARG C 2 20  ? 0.869   33.202 7.861   1.00 65.61 ? 194 ARG C NH2 1 
ATOM   2650 N N   . LEU C 2 21  ? 3.937   28.000 5.889   1.00 58.46 ? 195 LEU C N   1 
ATOM   2651 C CA  . LEU C 2 21  ? 3.030   26.884 5.663   1.00 59.43 ? 195 LEU C CA  1 
ATOM   2652 C C   . LEU C 2 21  ? 3.810   25.577 5.724   1.00 55.88 ? 195 LEU C C   1 
ATOM   2653 O O   . LEU C 2 21  ? 3.404   24.631 6.397   1.00 58.45 ? 195 LEU C O   1 
ATOM   2654 C CB  . LEU C 2 21  ? 2.323   27.018 4.314   1.00 54.33 ? 195 LEU C CB  1 
ATOM   2655 C CG  . LEU C 2 21  ? 1.255   25.975 3.992   1.00 55.59 ? 195 LEU C CG  1 
ATOM   2656 C CD1 . LEU C 2 21  ? 0.061   26.121 4.942   1.00 46.22 ? 195 LEU C CD1 1 
ATOM   2657 C CD2 . LEU C 2 21  ? 0.821   26.091 2.529   1.00 48.99 ? 195 LEU C CD2 1 
ATOM   2658 N N   . ARG C 2 22  ? 4.952   25.539 5.049   1.00 55.90 ? 196 ARG C N   1 
ATOM   2659 C CA  . ARG C 2 22  ? 5.715   24.303 4.972   1.00 58.53 ? 196 ARG C CA  1 
ATOM   2660 C C   . ARG C 2 22  ? 6.733   24.187 6.099   1.00 64.59 ? 196 ARG C C   1 
ATOM   2661 O O   . ARG C 2 22  ? 7.780   23.565 5.926   1.00 69.87 ? 196 ARG C O   1 
ATOM   2662 C CB  . ARG C 2 22  ? 6.402   24.180 3.611   1.00 56.35 ? 196 ARG C CB  1 
ATOM   2663 C CG  . ARG C 2 22  ? 5.399   24.209 2.466   1.00 56.01 ? 196 ARG C CG  1 
ATOM   2664 C CD  . ARG C 2 22  ? 6.010   23.898 1.112   1.00 50.08 ? 196 ARG C CD  1 
ATOM   2665 N NE  . ARG C 2 22  ? 6.408   22.496 1.054   1.00 48.67 ? 196 ARG C NE  1 
ATOM   2666 C CZ  . ARG C 2 22  ? 6.941   21.912 -0.012  1.00 49.13 ? 196 ARG C CZ  1 
ATOM   2667 N NH1 . ARG C 2 22  ? 7.118   22.607 -1.132  1.00 49.33 ? 196 ARG C NH1 1 
ATOM   2668 N NH2 . ARG C 2 22  ? 7.265   20.622 0.030   1.00 44.47 ? 196 ARG C NH2 1 
ATOM   2669 N N   . ASP C 2 23  ? 6.407   24.799 7.240   1.00 65.41 ? 197 ASP C N   1 
ATOM   2670 C CA  . ASP C 2 23  ? 7.110   24.597 8.511   1.00 65.50 ? 197 ASP C CA  1 
ATOM   2671 C C   . ASP C 2 23  ? 8.637   24.608 8.338   1.00 72.11 ? 197 ASP C C   1 
ATOM   2672 O O   . ASP C 2 23  ? 9.326   23.606 8.554   1.00 71.40 ? 197 ASP C O   1 
ATOM   2673 C CB  . ASP C 2 23  ? 6.617   23.294 9.162   1.00 64.88 ? 197 ASP C CB  1 
ATOM   2674 C CG  . ASP C 2 23  ? 7.269   23.009 10.510  1.00 72.75 ? 197 ASP C CG  1 
ATOM   2675 O OD1 . ASP C 2 23  ? 7.186   23.863 11.425  1.00 73.24 ? 197 ASP C OD1 1 
ATOM   2676 O OD2 . ASP C 2 23  ? 7.832   21.901 10.664  1.00 75.77 ? 197 ASP C OD2 1 
ATOM   2677 N N   . GLN C 2 24  ? 9.151   25.758 7.915   1.00 71.56 ? 198 GLN C N   1 
ATOM   2678 C CA  . GLN C 2 24  ? 10.583  25.943 7.746   1.00 72.96 ? 198 GLN C CA  1 
ATOM   2679 C C   . GLN C 2 24  ? 10.989  27.374 8.097   1.00 73.42 ? 198 GLN C C   1 
ATOM   2680 O O   . GLN C 2 24  ? 12.039  27.851 7.668   1.00 77.49 ? 198 GLN C O   1 
ATOM   2681 C CB  . GLN C 2 24  ? 11.003  25.603 6.314   1.00 74.67 ? 198 GLN C CB  1 
ATOM   2682 C CG  . GLN C 2 24  ? 10.241  26.353 5.233   1.00 70.29 ? 198 GLN C CG  1 
ATOM   2683 N N   . ALA D 2 9   ? -26.866 12.942 -65.982 1.00 83.87 ? 183 ALA D N   1 
ATOM   2684 C CA  . ALA D 2 9   ? -25.804 12.427 -65.123 1.00 77.12 ? 183 ALA D CA  1 
ATOM   2685 C C   . ALA D 2 9   ? -24.419 12.549 -65.770 1.00 79.16 ? 183 ALA D C   1 
ATOM   2686 O O   . ALA D 2 9   ? -23.987 11.675 -66.531 1.00 74.29 ? 183 ALA D O   1 
ATOM   2687 C CB  . ALA D 2 9   ? -26.085 10.983 -64.752 1.00 79.07 ? 183 ALA D CB  1 
ATOM   2688 N N   . GLU D 2 10  ? -23.731 13.651 -65.467 1.00 79.96 ? 184 GLU D N   1 
ATOM   2689 C CA  . GLU D 2 10  ? -22.311 13.790 -65.789 1.00 73.02 ? 184 GLU D CA  1 
ATOM   2690 C C   . GLU D 2 10  ? -21.522 13.077 -64.699 1.00 68.88 ? 184 GLU D C   1 
ATOM   2691 O O   . GLU D 2 10  ? -20.305 12.923 -64.763 1.00 63.68 ? 184 GLU D O   1 
ATOM   2692 C CB  . GLU D 2 10  ? -21.914 15.268 -65.900 1.00 69.29 ? 184 GLU D CB  1 
ATOM   2693 N N   . GLN D 2 11  ? -22.267 12.664 -63.683 1.00 69.12 ? 185 GLN D N   1 
ATOM   2694 C CA  . GLN D 2 11  ? -21.776 11.821 -62.599 1.00 70.45 ? 185 GLN D CA  1 
ATOM   2695 C C   . GLN D 2 11  ? -21.246 10.477 -63.137 1.00 66.06 ? 185 GLN D C   1 
ATOM   2696 O O   . GLN D 2 11  ? -20.164 10.019 -62.756 1.00 65.11 ? 185 GLN D O   1 
ATOM   2697 C CB  . GLN D 2 11  ? -22.904 11.592 -61.600 1.00 71.41 ? 185 GLN D CB  1 
ATOM   2698 C CG  . GLN D 2 11  ? -22.543 10.729 -60.407 1.00 70.59 ? 185 GLN D CG  1 
ATOM   2699 C CD  . GLN D 2 11  ? -23.721 10.475 -59.469 1.00 78.94 ? 185 GLN D CD  1 
ATOM   2700 O OE1 . GLN D 2 11  ? -24.821 11.001 -59.664 1.00 82.41 ? 185 GLN D OE1 1 
ATOM   2701 N NE2 . GLN D 2 11  ? -23.488 9.661  -58.441 1.00 80.54 ? 185 GLN D NE2 1 
ATOM   2702 N N   . ASP D 2 12  ? -22.021 9.862  -64.032 1.00 68.29 ? 186 ASP D N   1 
ATOM   2703 C CA  . ASP D 2 12  ? -21.669 8.589  -64.644 1.00 62.59 ? 186 ASP D CA  1 
ATOM   2704 C C   . ASP D 2 12  ? -20.387 8.707  -65.461 1.00 59.40 ? 186 ASP D C   1 
ATOM   2705 O O   . ASP D 2 12  ? -19.558 7.806  -65.459 1.00 59.24 ? 186 ASP D O   1 
ATOM   2706 C CB  . ASP D 2 12  ? -22.815 8.086  -65.527 1.00 67.53 ? 186 ASP D CB  1 
ATOM   2707 C CG  . ASP D 2 12  ? -24.048 7.690  -64.718 1.00 80.95 ? 186 ASP D CG  1 
ATOM   2708 O OD1 . ASP D 2 12  ? -23.924 7.530  -63.482 1.00 79.70 ? 186 ASP D OD1 1 
ATOM   2709 O OD2 . ASP D 2 12  ? -25.140 7.537  -65.316 1.00 87.14 ? 186 ASP D OD2 1 
ATOM   2710 N N   . GLU D 2 13  ? -20.237 9.825  -66.159 1.00 55.79 ? 187 GLU D N   1 
ATOM   2711 C CA  . GLU D 2 13  ? -19.058 10.088 -66.966 1.00 55.73 ? 187 GLU D CA  1 
ATOM   2712 C C   . GLU D 2 13  ? -17.845 10.159 -66.021 1.00 55.38 ? 187 GLU D C   1 
ATOM   2713 O O   . GLU D 2 13  ? -16.755 9.693  -66.362 1.00 51.09 ? 187 GLU D O   1 
ATOM   2714 C CB  . GLU D 2 13  ? -19.285 11.374 -67.778 1.00 55.27 ? 187 GLU D CB  1 
ATOM   2715 C CG  . GLU D 2 13  ? -18.364 11.698 -68.981 1.00 61.13 ? 187 GLU D CG  1 
ATOM   2716 C CD  . GLU D 2 13  ? -17.182 12.627 -68.686 1.00 67.88 ? 187 GLU D CD  1 
ATOM   2717 O OE1 . GLU D 2 13  ? -17.122 13.227 -67.584 1.00 68.92 ? 187 GLU D OE1 1 
ATOM   2718 O OE2 . GLU D 2 13  ? -16.362 12.842 -69.613 1.00 61.53 ? 187 GLU D OE2 1 
ATOM   2719 N N   . LEU D 2 14  ? -18.046 10.701 -64.818 1.00 51.54 ? 188 LEU D N   1 
ATOM   2720 C CA  . LEU D 2 14  ? -16.987 10.714 -63.805 1.00 51.93 ? 188 LEU D CA  1 
ATOM   2721 C C   . LEU D 2 14  ? -16.714 9.325  -63.214 1.00 46.98 ? 188 LEU D C   1 
ATOM   2722 O O   . LEU D 2 14  ? -15.561 8.966  -63.005 1.00 43.12 ? 188 LEU D O   1 
ATOM   2723 C CB  . LEU D 2 14  ? -17.307 11.686 -62.662 1.00 45.26 ? 188 LEU D CB  1 
ATOM   2724 C CG  . LEU D 2 14  ? -17.265 13.196 -62.907 1.00 51.78 ? 188 LEU D CG  1 
ATOM   2725 C CD1 . LEU D 2 14  ? -17.716 13.940 -61.653 1.00 43.75 ? 188 LEU D CD1 1 
ATOM   2726 C CD2 . LEU D 2 14  ? -15.875 13.654 -63.340 1.00 45.21 ? 188 LEU D CD2 1 
ATOM   2727 N N   . SER D 2 15  ? -17.765 8.557  -62.932 1.00 47.29 ? 189 SER D N   1 
ATOM   2728 C CA  . SER D 2 15  ? -17.592 7.190  -62.438 1.00 46.34 ? 189 SER D CA  1 
ATOM   2729 C C   . SER D 2 15  ? -16.835 6.357  -63.445 1.00 47.59 ? 189 SER D C   1 
ATOM   2730 O O   . SER D 2 15  ? -15.947 5.584  -63.088 1.00 48.31 ? 189 SER D O   1 
ATOM   2731 C CB  . SER D 2 15  ? -18.934 6.531  -62.145 1.00 51.51 ? 189 SER D CB  1 
ATOM   2732 O OG  . SER D 2 15  ? -19.603 7.190  -61.090 1.00 55.83 ? 189 SER D OG  1 
ATOM   2733 N N   . GLN D 2 16  ? -17.185 6.532  -64.713 1.00 50.17 ? 190 GLN D N   1 
ATOM   2734 C CA  . GLN D 2 16  ? -16.581 5.765  -65.786 1.00 50.48 ? 190 GLN D CA  1 
ATOM   2735 C C   . GLN D 2 16  ? -15.107 6.103  -65.977 1.00 48.65 ? 190 GLN D C   1 
ATOM   2736 O O   . GLN D 2 16  ? -14.296 5.212  -66.238 1.00 51.14 ? 190 GLN D O   1 
ATOM   2737 C CB  . GLN D 2 16  ? -17.365 5.985  -67.083 1.00 53.75 ? 190 GLN D CB  1 
ATOM   2738 C CG  . GLN D 2 16  ? -18.765 5.372  -67.010 1.00 58.83 ? 190 GLN D CG  1 
ATOM   2739 C CD  . GLN D 2 16  ? -19.608 5.629  -68.247 1.00 69.91 ? 190 GLN D CD  1 
ATOM   2740 O OE1 . GLN D 2 16  ? -19.341 6.550  -69.023 1.00 66.63 ? 190 GLN D OE1 1 
ATOM   2741 N NE2 . GLN D 2 16  ? -20.653 4.825  -68.421 1.00 74.07 ? 190 GLN D NE2 1 
ATOM   2742 N N   . ARG D 2 17  ? -14.750 7.377  -65.848 1.00 44.81 ? 191 ARG D N   1 
ATOM   2743 C CA  . ARG D 2 17  ? -13.349 7.769  -65.977 1.00 47.03 ? 191 ARG D CA  1 
ATOM   2744 C C   . ARG D 2 17  ? -12.518 7.250  -64.792 1.00 42.59 ? 191 ARG D C   1 
ATOM   2745 O O   . ARG D 2 17  ? -11.358 6.880  -64.959 1.00 42.10 ? 191 ARG D O   1 
ATOM   2746 C CB  . ARG D 2 17  ? -13.219 9.292  -66.090 1.00 45.76 ? 191 ARG D CB  1 
ATOM   2747 C CG  . ARG D 2 17  ? -13.798 9.881  -67.367 1.00 44.94 ? 191 ARG D CG  1 
ATOM   2748 C CD  . ARG D 2 17  ? -13.864 11.414 -67.305 1.00 45.04 ? 191 ARG D CD  1 
ATOM   2749 N NE  . ARG D 2 17  ? -12.549 12.047 -67.266 1.00 43.43 ? 191 ARG D NE  1 
ATOM   2750 C CZ  . ARG D 2 17  ? -12.352 13.347 -67.062 1.00 45.26 ? 191 ARG D CZ  1 
ATOM   2751 N NH1 . ARG D 2 17  ? -13.388 14.147 -66.853 1.00 46.13 ? 191 ARG D NH1 1 
ATOM   2752 N NH2 . ARG D 2 17  ? -11.118 13.849 -67.051 1.00 42.68 ? 191 ARG D NH2 1 
ATOM   2753 N N   . LEU D 2 18  ? -13.115 7.226  -63.604 1.00 42.24 ? 192 LEU D N   1 
ATOM   2754 C CA  . LEU D 2 18  ? -12.442 6.713  -62.420 1.00 42.32 ? 192 LEU D CA  1 
ATOM   2755 C C   . LEU D 2 18  ? -12.187 5.212  -62.559 1.00 42.20 ? 192 LEU D C   1 
ATOM   2756 O O   . LEU D 2 18  ? -11.078 4.738  -62.288 1.00 38.13 ? 192 LEU D O   1 
ATOM   2757 C CB  . LEU D 2 18  ? -13.264 6.995  -61.152 1.00 41.16 ? 192 LEU D CB  1 
ATOM   2758 C CG  . LEU D 2 18  ? -12.646 6.482  -59.843 1.00 42.77 ? 192 LEU D CG  1 
ATOM   2759 C CD1 . LEU D 2 18  ? -11.329 7.191  -59.550 1.00 39.22 ? 192 LEU D CD1 1 
ATOM   2760 C CD2 . LEU D 2 18  ? -13.596 6.599  -58.655 1.00 43.51 ? 192 LEU D CD2 1 
ATOM   2761 N N   . ALA D 2 19  ? -13.213 4.470  -62.981 1.00 41.54 ? 193 ALA D N   1 
ATOM   2762 C CA  . ALA D 2 19  ? -13.086 3.020  -63.156 1.00 41.23 ? 193 ALA D CA  1 
ATOM   2763 C C   . ALA D 2 19  ? -11.989 2.723  -64.160 1.00 43.18 ? 193 ALA D C   1 
ATOM   2764 O O   . ALA D 2 19  ? -11.141 1.863  -63.928 1.00 42.73 ? 193 ALA D O   1 
ATOM   2765 C CB  . ALA D 2 19  ? -14.396 2.407  -63.614 1.00 39.97 ? 193 ALA D CB  1 
ATOM   2766 N N   . ARG D 2 20  ? -12.002 3.448  -65.273 1.00 41.56 ? 194 ARG D N   1 
ATOM   2767 C CA  . ARG D 2 20  ? -10.969 3.291  -66.289 1.00 41.80 ? 194 ARG D CA  1 
ATOM   2768 C C   . ARG D 2 20  ? -9.601  3.540  -65.686 1.00 43.71 ? 194 ARG D C   1 
ATOM   2769 O O   . ARG D 2 20  ? -8.649  2.792  -65.929 1.00 42.50 ? 194 ARG D O   1 
ATOM   2770 C CB  . ARG D 2 20  ? -11.212 4.243  -67.460 1.00 40.75 ? 194 ARG D CB  1 
ATOM   2771 N N   . LEU D 2 21  ? -9.516  4.602  -64.889 1.00 39.99 ? 195 LEU D N   1 
ATOM   2772 C CA  . LEU D 2 21  ? -8.277  4.979  -64.226 1.00 41.30 ? 195 LEU D CA  1 
ATOM   2773 C C   . LEU D 2 21  ? -7.781  3.817  -63.344 1.00 38.81 ? 195 LEU D C   1 
ATOM   2774 O O   . LEU D 2 21  ? -6.593  3.502  -63.329 1.00 39.14 ? 195 LEU D O   1 
ATOM   2775 C CB  . LEU D 2 21  ? -8.493  6.243  -63.385 1.00 41.40 ? 195 LEU D CB  1 
ATOM   2776 C CG  . LEU D 2 21  ? -7.288  6.990  -62.814 1.00 44.38 ? 195 LEU D CG  1 
ATOM   2777 C CD1 . LEU D 2 21  ? -6.553  7.718  -63.942 1.00 40.75 ? 195 LEU D CD1 1 
ATOM   2778 C CD2 . LEU D 2 21  ? -7.708  7.964  -61.715 1.00 43.53 ? 195 LEU D CD2 1 
ATOM   2779 N N   . ARG D 2 22  ? -8.697  3.179  -62.621 1.00 38.33 ? 196 ARG D N   1 
ATOM   2780 C CA  . ARG D 2 22  ? -8.345  2.056  -61.743 1.00 42.44 ? 196 ARG D CA  1 
ATOM   2781 C C   . ARG D 2 22  ? -8.070  0.748  -62.487 1.00 45.02 ? 196 ARG D C   1 
ATOM   2782 O O   . ARG D 2 22  ? -7.136  0.016  -62.148 1.00 41.66 ? 196 ARG D O   1 
ATOM   2783 C CB  . ARG D 2 22  ? -9.459  1.766  -60.747 1.00 40.09 ? 196 ARG D CB  1 
ATOM   2784 C CG  . ARG D 2 22  ? -9.879  2.901  -59.853 1.00 41.95 ? 196 ARG D CG  1 
ATOM   2785 C CD  . ARG D 2 22  ? -8.789  3.340  -58.925 1.00 42.42 ? 196 ARG D CD  1 
ATOM   2786 N NE  . ARG D 2 22  ? -8.065  2.210  -58.346 1.00 49.28 ? 196 ARG D NE  1 
ATOM   2787 C CZ  . ARG D 2 22  ? -7.607  2.169  -57.102 1.00 46.61 ? 196 ARG D CZ  1 
ATOM   2788 N NH1 . ARG D 2 22  ? -7.975  3.108  -56.253 1.00 55.47 ? 196 ARG D NH1 1 
ATOM   2789 N NH2 . ARG D 2 22  ? -6.922  1.119  -56.663 1.00 45.70 ? 196 ARG D NH2 1 
ATOM   2790 N N   . ASP D 2 23  ? -8.912  0.449  -63.475 1.00 39.50 ? 197 ASP D N   1 
ATOM   2791 C CA  . ASP D 2 23  ? -8.941  -0.873 -64.095 1.00 40.58 ? 197 ASP D CA  1 
ATOM   2792 C C   . ASP D 2 23  ? -7.862  -1.059 -65.151 1.00 40.48 ? 197 ASP D C   1 
ATOM   2793 O O   . ASP D 2 23  ? -7.313  -2.145 -65.284 1.00 38.77 ? 197 ASP D O   1 
ATOM   2794 C CB  . ASP D 2 23  ? -10.307 -1.140 -64.733 1.00 43.87 ? 197 ASP D CB  1 
ATOM   2795 C CG  . ASP D 2 23  ? -11.423 -1.188 -63.721 1.00 45.06 ? 197 ASP D CG  1 
ATOM   2796 O OD1 . ASP D 2 23  ? -11.128 -1.239 -62.512 1.00 46.34 ? 197 ASP D OD1 1 
ATOM   2797 O OD2 . ASP D 2 23  ? -12.600 -1.168 -64.133 1.00 53.34 ? 197 ASP D OD2 1 
ATOM   2798 N N   . GLN D 2 24  ? -7.571  -0.014 -65.920 1.00 35.08 ? 198 GLN D N   1 
ATOM   2799 C CA  . GLN D 2 24  ? -6.561  -0.134 -66.949 1.00 37.52 ? 198 GLN D CA  1 
ATOM   2800 C C   . GLN D 2 24  ? -5.180  -0.174 -66.315 1.00 38.40 ? 198 GLN D C   1 
ATOM   2801 O O   . GLN D 2 24  ? -4.869  0.616  -65.430 1.00 36.12 ? 198 GLN D O   1 
ATOM   2802 C CB  . GLN D 2 24  ? -6.654  1.014  -67.978 1.00 34.20 ? 198 GLN D CB  1 
ATOM   2803 N N   . VAL D 2 25  ? -4.352  -1.101 -66.782 1.00 37.17 ? 199 VAL D N   1 
ATOM   2804 C CA  . VAL D 2 25  ? -2.971  -1.196 -66.330 1.00 39.79 ? 199 VAL D CA  1 
ATOM   2805 C C   . VAL D 2 25  ? -2.154  0.004  -66.802 1.00 42.60 ? 199 VAL D C   1 
ATOM   2806 O O   . VAL D 2 25  ? -2.030  0.246  -68.009 1.00 44.55 ? 199 VAL D O   1 
ATOM   2807 C CB  . VAL D 2 25  ? -2.308  -2.500 -66.836 1.00 38.53 ? 199 VAL D CB  1 
ATOM   2808 C CG1 . VAL D 2 25  ? -0.825  -2.536 -66.462 1.00 40.17 ? 199 VAL D CG1 1 
ATOM   2809 C CG2 . VAL D 2 25  ? -3.039  -3.721 -66.270 1.00 36.21 ? 199 VAL D CG2 1 
ATOM   2810 O OXT . VAL D 2 25  ? -1.583  0.751  -65.998 1.00 40.01 ? 199 VAL D OXT 1 
HETATM 2811 O O   . HOH E 3 .   ? 8.852   22.383 -3.303  1.00 43.66 ? 201 HOH A O   1 
HETATM 2812 O O   . HOH E 3 .   ? 7.124   8.992  -6.186  1.00 39.30 ? 202 HOH A O   1 
HETATM 2813 O O   . HOH E 3 .   ? 15.236  12.485 -10.963 1.00 45.41 ? 203 HOH A O   1 
HETATM 2814 O O   . HOH E 3 .   ? -13.834 23.382 8.994   1.00 47.70 ? 204 HOH A O   1 
HETATM 2815 O O   . HOH E 3 .   ? -16.604 21.129 5.699   1.00 41.89 ? 205 HOH A O   1 
HETATM 2816 O O   . HOH E 3 .   ? 15.308  8.397  -11.755 1.00 42.77 ? 206 HOH A O   1 
HETATM 2817 O O   . HOH E 3 .   ? 11.927  19.905 2.500   1.00 50.90 ? 207 HOH A O   1 
HETATM 2818 O O   . HOH E 3 .   ? 10.544  15.578 0.300   1.00 29.99 ? 208 HOH A O   1 
HETATM 2819 O O   . HOH E 3 .   ? 9.841   6.102  -8.543  1.00 38.71 ? 209 HOH A O   1 
HETATM 2820 O O   . HOH E 3 .   ? 13.839  13.058 -6.087  1.00 35.56 ? 210 HOH A O   1 
HETATM 2821 O O   . HOH E 3 .   ? -16.389 7.366  4.470   1.00 41.55 ? 211 HOH A O   1 
HETATM 2822 O O   . HOH E 3 .   ? -14.755 -0.457 -11.498 1.00 51.80 ? 212 HOH A O   1 
HETATM 2823 O O   . HOH E 3 .   ? 10.611  19.244 -7.776  1.00 45.16 ? 213 HOH A O   1 
HETATM 2824 O O   . HOH E 3 .   ? -14.025 14.117 -0.749  1.00 31.47 ? 214 HOH A O   1 
HETATM 2825 O O   . HOH E 3 .   ? -12.639 17.411 5.432   1.00 37.58 ? 215 HOH A O   1 
HETATM 2826 O O   . HOH E 3 .   ? -11.558 11.057 5.392   1.00 31.08 ? 216 HOH A O   1 
HETATM 2827 O O   . HOH E 3 .   ? -16.548 3.489  -15.620 1.00 51.60 ? 217 HOH A O   1 
HETATM 2828 O O   . HOH E 3 .   ? -17.204 16.672 6.377   1.00 32.21 ? 218 HOH A O   1 
HETATM 2829 O O   . HOH E 3 .   ? 9.314   13.719 -6.024  1.00 37.25 ? 219 HOH A O   1 
HETATM 2830 O O   . HOH E 3 .   ? 13.209  5.699  -11.640 1.00 47.10 ? 220 HOH A O   1 
HETATM 2831 O O   . HOH E 3 .   ? 10.748  13.969 4.946   1.00 41.50 ? 221 HOH A O   1 
HETATM 2832 O O   . HOH E 3 .   ? -10.766 3.482  -8.522  1.00 56.39 ? 222 HOH A O   1 
HETATM 2833 O O   . HOH E 3 .   ? -2.035  0.025  -19.455 1.00 45.84 ? 223 HOH A O   1 
HETATM 2834 O O   . HOH E 3 .   ? 6.068   12.708 -18.092 1.00 33.88 ? 224 HOH A O   1 
HETATM 2835 O O   . HOH E 3 .   ? -14.298 20.721 -1.859  1.00 42.72 ? 225 HOH A O   1 
HETATM 2836 O O   . HOH E 3 .   ? -1.153  27.533 -17.339 1.00 40.16 ? 226 HOH A O   1 
HETATM 2837 O O   . HOH E 3 .   ? -13.347 22.807 -0.478  1.00 43.94 ? 227 HOH A O   1 
HETATM 2838 O O   . HOH E 3 .   ? -4.762  20.922 -15.052 1.00 37.93 ? 228 HOH A O   1 
HETATM 2839 O O   . HOH E 3 .   ? -8.976  -3.271 -12.755 1.00 49.48 ? 229 HOH A O   1 
HETATM 2840 O O   . HOH E 3 .   ? -10.206 13.295 -8.163  1.00 40.65 ? 230 HOH A O   1 
HETATM 2841 O O   . HOH E 3 .   ? 7.492   7.548  -24.798 1.00 40.94 ? 231 HOH A O   1 
HETATM 2842 O O   . HOH E 3 .   ? 5.023   17.350 -13.677 1.00 45.35 ? 232 HOH A O   1 
HETATM 2843 O O   . HOH E 3 .   ? 2.119   23.937 -15.408 1.00 45.27 ? 233 HOH A O   1 
HETATM 2844 O O   . HOH E 3 .   ? 3.290   21.464 4.385   1.00 47.73 ? 234 HOH A O   1 
HETATM 2845 O O   . HOH E 3 .   ? -9.952  27.022 -9.086  1.00 46.68 ? 235 HOH A O   1 
HETATM 2846 O O   . HOH E 3 .   ? 4.269   -0.156 -12.894 1.00 56.11 ? 236 HOH A O   1 
HETATM 2847 O O   . HOH E 3 .   ? 0.984   21.830 -14.204 1.00 41.64 ? 237 HOH A O   1 
HETATM 2848 O O   . HOH E 3 .   ? -10.385 31.312 0.090   1.00 42.29 ? 238 HOH A O   1 
HETATM 2849 O O   . HOH E 3 .   ? -11.935 28.891 -9.127  1.00 51.31 ? 239 HOH A O   1 
HETATM 2850 O O   . HOH E 3 .   ? -2.717  18.386 -16.361 1.00 49.39 ? 240 HOH A O   1 
HETATM 2851 O O   . HOH E 3 .   ? -14.655 27.716 3.617   1.00 54.90 ? 241 HOH A O   1 
HETATM 2852 O O   . HOH E 3 .   ? -10.519 25.111 -3.998  1.00 45.61 ? 242 HOH A O   1 
HETATM 2853 O O   . HOH E 3 .   ? -0.572  1.118  -4.146  1.00 44.97 ? 243 HOH A O   1 
HETATM 2854 O O   . HOH E 3 .   ? -13.146 27.448 -7.009  1.00 50.10 ? 244 HOH A O   1 
HETATM 2855 O O   . HOH E 3 .   ? -8.814  13.854 -10.411 1.00 37.82 ? 245 HOH A O   1 
HETATM 2856 O O   . HOH E 3 .   ? 1.009   18.411 -15.898 1.00 42.49 ? 246 HOH A O   1 
HETATM 2857 O O   . HOH E 3 .   ? -10.570 23.281 -11.016 1.00 46.86 ? 247 HOH A O   1 
HETATM 2858 O O   . HOH E 3 .   ? 11.190  16.803 -11.686 1.00 39.32 ? 248 HOH A O   1 
HETATM 2859 O O   . HOH E 3 .   ? -12.721 24.112 -2.468  1.00 48.13 ? 249 HOH A O   1 
HETATM 2860 O O   . HOH E 3 .   ? 4.773   20.006 -12.774 1.00 43.31 ? 250 HOH A O   1 
HETATM 2861 O O   . HOH E 3 .   ? -11.706 31.908 -1.772  1.00 52.73 ? 251 HOH A O   1 
HETATM 2862 O O   . HOH E 3 .   ? -0.565  11.058 11.784  1.00 53.77 ? 252 HOH A O   1 
HETATM 2863 O O   . HOH E 3 .   ? -11.537 23.345 -8.370  1.00 41.25 ? 253 HOH A O   1 
HETATM 2864 O O   . HOH E 3 .   ? -14.385 -1.996 -23.110 1.00 47.52 ? 254 HOH A O   1 
HETATM 2865 O O   . HOH E 3 .   ? -9.984  25.950 -11.348 1.00 46.69 ? 255 HOH A O   1 
HETATM 2866 O O   . HOH E 3 .   ? 7.247   14.538 -16.544 1.00 44.19 ? 256 HOH A O   1 
HETATM 2867 O O   . HOH E 3 .   ? -7.577  30.142 6.376   1.00 50.98 ? 257 HOH A O   1 
HETATM 2868 O O   . HOH E 3 .   ? -6.571  8.507  -0.732  1.00 46.37 ? 258 HOH A O   1 
HETATM 2869 O O   . HOH E 3 .   ? -5.121  -0.899 -7.730  1.00 48.41 ? 259 HOH A O   1 
HETATM 2870 O O   . HOH E 3 .   ? -9.085  13.040 -25.236 1.00 49.57 ? 260 HOH A O   1 
HETATM 2871 O O   . HOH E 3 .   ? -3.903  2.635  -31.844 1.00 40.38 ? 261 HOH A O   1 
HETATM 2872 O O   . HOH E 3 .   ? -11.133 25.377 -6.914  1.00 45.55 ? 262 HOH A O   1 
HETATM 2873 O O   . HOH E 3 .   ? -2.602  2.051  -29.426 1.00 45.14 ? 263 HOH A O   1 
HETATM 2874 O O   . HOH E 3 .   ? -1.871  3.425  -27.177 1.00 45.03 ? 264 HOH A O   1 
HETATM 2875 O O   . HOH E 3 .   ? -5.025  31.938 6.992   1.00 55.63 ? 265 HOH A O   1 
HETATM 2876 O O   . HOH E 3 .   ? -13.304 9.617  -17.242 1.00 51.68 ? 266 HOH A O   1 
HETATM 2877 O O   . HOH E 3 .   ? -5.937  11.071 4.570   1.00 47.89 ? 267 HOH A O   1 
HETATM 2878 O O   . HOH E 3 .   ? 5.387   23.321 -10.457 1.00 54.09 ? 268 HOH A O   1 
HETATM 2879 O O   . HOH E 3 .   ? -12.341 29.628 0.387   1.00 50.06 ? 269 HOH A O   1 
HETATM 2880 O O   . HOH E 3 .   ? -10.901 22.901 7.238   1.00 51.98 ? 270 HOH A O   1 
HETATM 2881 O O   . HOH E 3 .   ? -10.842 13.945 -27.212 1.00 57.03 ? 271 HOH A O   1 
HETATM 2882 O O   . HOH E 3 .   ? -10.049 19.327 2.980   1.00 46.99 ? 272 HOH A O   1 
HETATM 2883 O O   . HOH E 3 .   ? 1.074   30.172 6.484   1.00 57.84 ? 273 HOH A O   1 
HETATM 2884 O O   . HOH E 3 .   ? -4.844  1.779  -25.165 1.00 51.75 ? 274 HOH A O   1 
HETATM 2885 O O   . HOH E 3 .   ? -2.107  27.024 9.034   1.00 53.29 ? 275 HOH A O   1 
HETATM 2886 O O   . HOH E 3 .   ? -3.212  4.592  -1.351  1.00 43.94 ? 276 HOH A O   1 
HETATM 2887 O O   . HOH E 3 .   ? -1.969  6.279  -0.028  1.00 38.96 ? 277 HOH A O   1 
HETATM 2888 O O   . HOH E 3 .   ? -0.856  15.257 -15.706 1.00 34.29 ? 278 HOH A O   1 
HETATM 2889 O O   . HOH E 3 .   ? 0.412   27.882 8.197   1.00 55.00 ? 279 HOH A O   1 
HETATM 2890 O O   . HOH E 3 .   ? -6.688  22.804 -17.794 1.00 54.66 ? 280 HOH A O   1 
HETATM 2891 O O   . HOH E 3 .   ? -0.053  -3.284 -19.785 1.00 61.12 ? 281 HOH A O   1 
HETATM 2892 O O   . HOH E 3 .   ? 6.177   3.361  -21.343 1.00 54.10 ? 282 HOH A O   1 
HETATM 2893 O O   . HOH E 3 .   ? 6.042   6.219  -20.736 1.00 40.05 ? 283 HOH A O   1 
HETATM 2894 O O   . HOH E 3 .   ? 4.893   6.557  10.439  1.00 68.63 ? 284 HOH A O   1 
HETATM 2895 O O   . HOH E 3 .   ? 6.946   16.849 -15.466 1.00 50.97 ? 285 HOH A O   1 
HETATM 2896 O O   . HOH E 3 .   ? 4.175   18.903 4.444   1.00 48.42 ? 286 HOH A O   1 
HETATM 2897 O O   . HOH E 3 .   ? -12.661 29.115 -12.054 1.00 56.64 ? 287 HOH A O   1 
HETATM 2898 O O   . HOH E 3 .   ? 4.574   25.116 -14.775 1.00 57.37 ? 288 HOH A O   1 
HETATM 2899 O O   . HOH E 3 .   ? -9.127  13.811 -20.047 1.00 53.83 ? 289 HOH A O   1 
HETATM 2900 O O   . HOH E 3 .   ? -12.098 29.008 3.930   1.00 56.60 ? 290 HOH A O   1 
HETATM 2901 O O   . HOH E 3 .   ? 7.537   4.903  -9.146  1.00 43.12 ? 291 HOH A O   1 
HETATM 2902 O O   . HOH E 3 .   ? 5.698   6.564  -10.209 1.00 37.13 ? 292 HOH A O   1 
HETATM 2903 O O   . HOH E 3 .   ? 3.074   -0.302 -17.865 1.00 59.06 ? 293 HOH A O   1 
HETATM 2904 O O   . HOH E 3 .   ? 5.380   1.608  -17.982 1.00 55.44 ? 294 HOH A O   1 
HETATM 2905 O O   . HOH E 3 .   ? 9.241   11.938 -23.243 1.00 42.99 ? 295 HOH A O   1 
HETATM 2906 O O   . HOH F 3 .   ? -3.378  -1.746 -46.207 1.00 45.72 ? 201 HOH B O   1 
HETATM 2907 O O   . HOH F 3 .   ? -4.729  -3.164 -54.197 1.00 47.12 ? 202 HOH B O   1 
HETATM 2908 O O   . HOH F 3 .   ? -1.973  -3.409 -61.970 1.00 39.80 ? 203 HOH B O   1 
HETATM 2909 O O   . HOH F 3 .   ? -4.707  4.210  -60.911 1.00 35.14 ? 204 HOH B O   1 
HETATM 2910 O O   . HOH F 3 .   ? 4.464   -2.904 -64.820 1.00 50.27 ? 205 HOH B O   1 
HETATM 2911 O O   . HOH F 3 .   ? -6.180  25.045 -57.034 1.00 46.18 ? 206 HOH B O   1 
HETATM 2912 O O   . HOH F 3 .   ? 3.308   20.545 -37.285 1.00 32.68 ? 207 HOH B O   1 
HETATM 2913 O O   . HOH F 3 .   ? 9.060   22.525 -29.385 1.00 48.56 ? 208 HOH B O   1 
HETATM 2914 O O   . HOH F 3 .   ? 5.386   0.136  -65.271 1.00 53.94 ? 209 HOH B O   1 
HETATM 2915 O O   . HOH F 3 .   ? -5.329  -0.844 -48.086 1.00 43.65 ? 210 HOH B O   1 
HETATM 2916 O O   . HOH F 3 .   ? 2.017   -3.258 -35.193 1.00 57.86 ? 211 HOH B O   1 
HETATM 2917 O O   . HOH F 3 .   ? -2.516  2.505  -60.202 1.00 40.67 ? 212 HOH B O   1 
HETATM 2918 O O   . HOH F 3 .   ? -6.120  -8.965 -38.000 1.00 51.53 ? 213 HOH B O   1 
HETATM 2919 O O   . HOH F 3 .   ? -9.220  25.567 -52.329 1.00 46.96 ? 214 HOH B O   1 
HETATM 2920 O O   . HOH F 3 .   ? -9.592  -3.556 -39.957 1.00 57.40 ? 215 HOH B O   1 
HETATM 2921 O O   . HOH F 3 .   ? -5.346  -7.002 -40.282 1.00 49.52 ? 216 HOH B O   1 
HETATM 2922 O O   . HOH F 3 .   ? -4.680  22.902 -58.513 1.00 50.35 ? 217 HOH B O   1 
HETATM 2923 O O   . HOH F 3 .   ? 2.983   -3.449 -48.743 1.00 46.29 ? 218 HOH B O   1 
HETATM 2924 O O   . HOH F 3 .   ? 7.339   -0.033 -53.779 1.00 38.57 ? 219 HOH B O   1 
HETATM 2925 O O   . HOH F 3 .   ? -3.610  -5.287 -58.683 1.00 40.24 ? 220 HOH B O   1 
HETATM 2926 O O   . HOH F 3 .   ? -5.864  23.307 -44.004 1.00 47.12 ? 221 HOH B O   1 
HETATM 2927 O O   . HOH F 3 .   ? 5.660   20.059 -55.005 1.00 45.30 ? 222 HOH B O   1 
HETATM 2928 O O   . HOH F 3 .   ? -0.178  -3.447 -42.733 1.00 52.80 ? 223 HOH B O   1 
HETATM 2929 O O   . HOH F 3 .   ? 9.938   21.282 -35.772 1.00 42.03 ? 224 HOH B O   1 
HETATM 2930 O O   . HOH F 3 .   ? 1.618   21.808 -35.269 1.00 42.70 ? 225 HOH B O   1 
HETATM 2931 O O   . HOH F 3 .   ? -2.882  28.636 -24.824 1.00 52.48 ? 226 HOH B O   1 
HETATM 2932 O O   . HOH F 3 .   ? -3.127  -6.195 -39.354 1.00 49.86 ? 227 HOH B O   1 
HETATM 2933 O O   . HOH F 3 .   ? -6.446  -6.912 -34.153 1.00 60.85 ? 228 HOH B O   1 
HETATM 2934 O O   . HOH F 3 .   ? -8.092  25.144 -43.642 1.00 43.60 ? 229 HOH B O   1 
HETATM 2935 O O   . HOH F 3 .   ? -3.268  -4.547 -34.480 1.00 55.75 ? 230 HOH B O   1 
HETATM 2936 O O   . HOH F 3 .   ? -7.269  -6.320 -44.063 1.00 46.55 ? 231 HOH B O   1 
HETATM 2937 O O   . HOH F 3 .   ? 8.625   0.280  -51.236 1.00 43.54 ? 232 HOH B O   1 
HETATM 2938 O O   . HOH F 3 .   ? -2.622  17.949 -35.364 1.00 48.20 ? 233 HOH B O   1 
HETATM 2939 O O   . HOH F 3 .   ? 4.048   -8.668 -60.930 1.00 54.67 ? 234 HOH B O   1 
HETATM 2940 O O   . HOH F 3 .   ? -5.338  -3.934 -33.645 1.00 51.83 ? 235 HOH B O   1 
HETATM 2941 O O   . HOH F 3 .   ? 12.475  3.993  -40.478 1.00 45.61 ? 236 HOH B O   1 
HETATM 2942 O O   . HOH F 3 .   ? 1.956   -8.827 -60.381 1.00 48.20 ? 237 HOH B O   1 
HETATM 2943 O O   . HOH F 3 .   ? 1.582   11.373 -22.804 1.00 29.39 ? 238 HOH B O   1 
HETATM 2944 O O   . HOH F 3 .   ? 3.183   6.462  -26.109 1.00 38.00 ? 239 HOH B O   1 
HETATM 2945 O O   . HOH F 3 .   ? 1.245   1.079  -41.014 1.00 51.15 ? 240 HOH B O   1 
HETATM 2946 O O   . HOH F 3 .   ? -8.322  16.919 -44.924 1.00 38.19 ? 241 HOH B O   1 
HETATM 2947 O O   . HOH F 3 .   ? 13.548  10.603 -34.727 1.00 41.56 ? 242 HOH B O   1 
HETATM 2948 O O   . HOH F 3 .   ? -8.147  4.155  -38.004 1.00 44.72 ? 243 HOH B O   1 
HETATM 2949 O O   . HOH F 3 .   ? 12.125  6.625  -39.860 1.00 40.88 ? 244 HOH B O   1 
HETATM 2950 O O   . HOH F 3 .   ? 2.731   -0.990 -41.823 1.00 54.07 ? 245 HOH B O   1 
HETATM 2951 O O   . HOH F 3 .   ? 3.907   12.584 -26.390 1.00 38.24 ? 246 HOH B O   1 
HETATM 2952 O O   . HOH F 3 .   ? 14.380  16.295 -36.475 1.00 46.57 ? 247 HOH B O   1 
HETATM 2953 O O   . HOH F 3 .   ? -15.931 16.892 -46.363 1.00 44.79 ? 248 HOH B O   1 
HETATM 2954 O O   . HOH F 3 .   ? 8.437   4.545  -49.948 1.00 43.12 ? 249 HOH B O   1 
HETATM 2955 O O   . HOH F 3 .   ? -12.690 16.867 -67.120 1.00 48.93 ? 250 HOH B O   1 
HETATM 2956 O O   . HOH F 3 .   ? 9.327   1.907  -62.211 1.00 49.26 ? 251 HOH B O   1 
HETATM 2957 O O   . HOH F 3 .   ? 10.493  4.703  -33.563 1.00 41.96 ? 252 HOH B O   1 
HETATM 2958 O O   . HOH F 3 .   ? 5.019   7.129  -30.122 1.00 38.14 ? 253 HOH B O   1 
HETATM 2959 O O   . HOH F 3 .   ? -15.328 25.609 -56.246 1.00 45.11 ? 254 HOH B O   1 
HETATM 2960 O O   . HOH F 3 .   ? -11.161 11.769 -45.553 1.00 44.55 ? 255 HOH B O   1 
HETATM 2961 O O   . HOH F 3 .   ? 2.082   11.007 -25.574 1.00 37.93 ? 256 HOH B O   1 
HETATM 2962 O O   . HOH F 3 .   ? -9.456  9.135  -40.866 1.00 48.52 ? 257 HOH B O   1 
HETATM 2963 O O   . HOH F 3 .   ? 5.118   24.593 -24.972 1.00 51.07 ? 258 HOH B O   1 
HETATM 2964 O O   . HOH F 3 .   ? 10.749  18.916 -26.526 1.00 38.83 ? 259 HOH B O   1 
HETATM 2965 O O   . HOH F 3 .   ? 2.235   19.666 -18.133 1.00 39.58 ? 260 HOH B O   1 
HETATM 2966 O O   . HOH F 3 .   ? -7.675  -0.359 -33.825 1.00 43.20 ? 261 HOH B O   1 
HETATM 2967 O O   . HOH F 3 .   ? -14.001 11.761 -45.665 1.00 50.07 ? 262 HOH B O   1 
HETATM 2968 O O   . HOH F 3 .   ? -0.144  -5.375 -58.300 1.00 40.83 ? 263 HOH B O   1 
HETATM 2969 O O   . HOH F 3 .   ? 8.283   8.740  -56.542 1.00 46.66 ? 264 HOH B O   1 
HETATM 2970 O O   . HOH F 3 .   ? 3.191   16.481 -46.544 1.00 45.11 ? 265 HOH B O   1 
HETATM 2971 O O   . HOH F 3 .   ? -15.510 27.772 -57.617 1.00 52.10 ? 266 HOH B O   1 
HETATM 2972 O O   . HOH F 3 .   ? 3.558   15.313 -59.376 1.00 43.40 ? 267 HOH B O   1 
HETATM 2973 O O   . HOH F 3 .   ? 17.012  14.886 -27.246 1.00 51.69 ? 268 HOH B O   1 
HETATM 2974 O O   . HOH F 3 .   ? 0.464   13.755 -68.862 1.00 56.33 ? 269 HOH B O   1 
HETATM 2975 O O   . HOH F 3 .   ? 10.592  16.192 -22.908 1.00 46.31 ? 270 HOH B O   1 
HETATM 2976 O O   . HOH F 3 .   ? 16.715  12.614 -25.442 1.00 58.11 ? 271 HOH B O   1 
HETATM 2977 O O   . HOH F 3 .   ? 5.232   22.364 -23.848 1.00 42.99 ? 272 HOH B O   1 
HETATM 2978 O O   . HOH F 3 .   ? -18.794 24.660 -51.525 1.00 58.21 ? 273 HOH B O   1 
HETATM 2979 O O   . HOH F 3 .   ? -7.098  -2.206 -35.112 1.00 47.10 ? 274 HOH B O   1 
HETATM 2980 O O   . HOH F 3 .   ? 14.458  7.746  -29.019 1.00 50.54 ? 275 HOH B O   1 
HETATM 2981 O O   . HOH F 3 .   ? 1.093   16.565 -45.426 1.00 46.91 ? 276 HOH B O   1 
HETATM 2982 O O   . HOH F 3 .   ? 6.042   6.839  -26.879 1.00 48.72 ? 277 HOH B O   1 
HETATM 2983 O O   . HOH F 3 .   ? 15.016  16.533 -33.652 1.00 50.67 ? 278 HOH B O   1 
HETATM 2984 O O   . HOH F 3 .   ? 17.048  9.868  -31.380 1.00 52.26 ? 279 HOH B O   1 
HETATM 2985 O O   . HOH F 3 .   ? -7.558  14.332 -34.043 1.00 46.50 ? 280 HOH B O   1 
HETATM 2986 O O   . HOH F 3 .   ? -10.275 -0.386 -44.867 1.00 52.67 ? 281 HOH B O   1 
HETATM 2987 O O   . HOH F 3 .   ? -11.009 12.008 -70.279 1.00 48.35 ? 282 HOH B O   1 
HETATM 2988 O O   . HOH F 3 .   ? -15.636 23.755 -58.647 1.00 44.98 ? 283 HOH B O   1 
HETATM 2989 O O   . HOH F 3 .   ? -6.059  4.520  -67.766 1.00 42.64 ? 284 HOH B O   1 
HETATM 2990 O O   . HOH F 3 .   ? 9.975   5.907  -48.224 1.00 50.12 ? 285 HOH B O   1 
HETATM 2991 O O   . HOH F 3 .   ? 2.632   3.934  -26.176 1.00 53.15 ? 286 HOH B O   1 
HETATM 2992 O O   . HOH F 3 .   ? -8.139  24.320 -55.012 1.00 44.39 ? 287 HOH B O   1 
HETATM 2993 O O   . HOH F 3 .   ? -5.991  15.461 -68.461 1.00 44.05 ? 288 HOH B O   1 
HETATM 2994 O O   . HOH F 3 .   ? -4.773  8.444  -67.935 1.00 47.89 ? 289 HOH B O   1 
HETATM 2995 O O   . HOH F 3 .   ? 8.962   7.123  -58.375 1.00 53.06 ? 290 HOH B O   1 
HETATM 2996 O O   . HOH F 3 .   ? -3.318  23.986 -20.044 1.00 46.54 ? 291 HOH B O   1 
HETATM 2997 O O   . HOH F 3 .   ? 9.828   2.560  -51.605 1.00 51.76 ? 292 HOH B O   1 
HETATM 2998 O O   . HOH F 3 .   ? -22.996 24.499 -57.053 1.00 51.29 ? 293 HOH B O   1 
HETATM 2999 O O   . HOH F 3 .   ? -15.741 6.327  -55.111 1.00 54.22 ? 294 HOH B O   1 
HETATM 3000 O O   . HOH F 3 .   ? 13.592  7.046  -37.644 1.00 54.08 ? 295 HOH B O   1 
HETATM 3001 O O   . HOH F 3 .   ? 6.455   13.346 -20.970 1.00 44.67 ? 296 HOH B O   1 
HETATM 3002 O O   . HOH G 3 .   ? 8.476   30.065 0.305   1.00 58.18 ? 201 HOH C O   1 
HETATM 3003 O O   . HOH H 3 .   ? -8.633  -4.513 -64.513 1.00 40.44 ? 201 HOH D O   1 
HETATM 3004 O O   . HOH H 3 .   ? -5.489  -2.716 -68.933 1.00 39.86 ? 202 HOH D O   1 
HETATM 3005 O O   . HOH H 3 .   ? -9.947  7.556  -66.920 1.00 43.47 ? 203 HOH D O   1 
HETATM 3006 O O   . HOH H 3 .   ? -7.071  7.130  -67.543 1.00 45.47 ? 204 HOH D O   1 
HETATM 3007 O O   . HOH H 3 .   ? -14.854 2.899  -67.317 1.00 56.18 ? 205 HOH D O   1 
HETATM 3008 O O   . HOH H 3 .   ? -21.931 3.466  -62.521 1.00 63.26 ? 206 HOH D O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   0   ?   ?   ?   A . n 
A 1 2   MET 2   1   1   MET MET A . n 
A 1 3   ALA 3   2   2   ALA ALA A . n 
A 1 4   ALA 4   3   3   ALA ALA A . n 
A 1 5   LEU 5   4   4   LEU LEU A . n 
A 1 6   ALA 6   5   5   ALA ALA A . n 
A 1 7   PRO 7   6   6   PRO PRO A . n 
A 1 8   LEU 8   7   7   LEU LEU A . n 
A 1 9   PRO 9   8   8   PRO PRO A . n 
A 1 10  PRO 10  9   9   PRO PRO A . n 
A 1 11  LEU 11  10  10  LEU LEU A . n 
A 1 12  PRO 12  11  11  PRO PRO A . n 
A 1 13  ALA 13  12  12  ALA ALA A . n 
A 1 14  GLN 14  13  13  GLN GLN A . n 
A 1 15  PHE 15  14  14  PHE PHE A . n 
A 1 16  LYS 16  15  15  LYS LYS A . n 
A 1 17  SER 17  16  16  SER SER A . n 
A 1 18  ILE 18  17  17  ILE ILE A . n 
A 1 19  GLN 19  18  18  GLN GLN A . n 
A 1 20  HIS 20  19  19  HIS HIS A . n 
A 1 21  HIS 21  20  20  HIS HIS A . n 
A 1 22  LEU 22  21  21  LEU LEU A . n 
A 1 23  ARG 23  22  22  ARG ARG A . n 
A 1 24  THR 24  23  23  THR THR A . n 
A 1 25  ALA 25  24  24  ALA ALA A . n 
A 1 26  GLN 26  25  25  GLN GLN A . n 
A 1 27  GLU 27  26  26  GLU GLU A . n 
A 1 28  HIS 28  27  27  HIS HIS A . n 
A 1 29  ASP 29  28  28  ASP ASP A . n 
A 1 30  LYS 30  29  29  LYS LYS A . n 
A 1 31  ARG 31  30  30  ARG ARG A . n 
A 1 32  ASP 32  31  31  ASP ASP A . n 
A 1 33  PRO 33  32  32  PRO PRO A . n 
A 1 34  VAL 34  33  33  VAL VAL A . n 
A 1 35  VAL 35  34  34  VAL VAL A . n 
A 1 36  ALA 36  35  35  ALA ALA A . n 
A 1 37  TYR 37  36  36  TYR TYR A . n 
A 1 38  TYR 38  37  37  TYR TYR A . n 
A 1 39  CYS 39  38  38  CYS CYS A . n 
A 1 40  ARG 40  39  39  ARG ARG A . n 
A 1 41  LEU 41  40  40  LEU LEU A . n 
A 1 42  TYR 42  41  41  TYR TYR A . n 
A 1 43  ALA 43  42  42  ALA ALA A . n 
A 1 44  MET 44  43  43  MET MET A . n 
A 1 45  GLN 45  44  44  GLN GLN A . n 
A 1 46  THR 46  45  45  THR THR A . n 
A 1 47  GLY 47  46  46  GLY GLY A . n 
A 1 48  MET 48  47  47  MET MET A . n 
A 1 49  LYS 49  48  48  LYS LYS A . n 
A 1 50  ILE 50  49  49  ILE ILE A . n 
A 1 51  ASP 51  50  50  ASP ASP A . n 
A 1 52  SER 52  51  51  SER SER A . n 
A 1 53  LYS 53  52  52  LYS LYS A . n 
A 1 54  THR 54  53  53  THR THR A . n 
A 1 55  PRO 55  54  54  PRO PRO A . n 
A 1 56  GLU 56  55  55  GLU GLU A . n 
A 1 57  CYS 57  56  56  CYS CYS A . n 
A 1 58  ARG 58  57  57  ARG ARG A . n 
A 1 59  LYS 59  58  58  LYS LYS A . n 
A 1 60  PHE 60  59  59  PHE PHE A . n 
A 1 61  LEU 61  60  60  LEU LEU A . n 
A 1 62  SER 62  61  61  SER SER A . n 
A 1 63  LYS 63  62  62  LYS LYS A . n 
A 1 64  LEU 64  63  63  LEU LEU A . n 
A 1 65  MET 65  64  64  MET MET A . n 
A 1 66  ASP 66  65  65  ASP ASP A . n 
A 1 67  GLN 67  66  66  GLN GLN A . n 
A 1 68  LEU 68  67  67  LEU LEU A . n 
A 1 69  GLU 69  68  68  GLU GLU A . n 
A 1 70  ALA 70  69  69  ALA ALA A . n 
A 1 71  LEU 71  70  70  LEU LEU A . n 
A 1 72  LYS 72  71  71  LYS LYS A . n 
A 1 73  LYS 73  72  72  LYS LYS A . n 
A 1 74  GLN 74  73  73  GLN GLN A . n 
A 1 75  LEU 75  74  74  LEU LEU A . n 
A 1 76  GLY 76  75  75  GLY GLY A . n 
A 1 77  ASP 77  76  76  ASP ASP A . n 
A 1 78  ASN 78  77  77  ASN ASN A . n 
A 1 79  GLU 79  78  78  GLU GLU A . n 
A 1 80  ALA 80  79  79  ALA ALA A . n 
A 1 81  ILE 81  80  80  ILE ILE A . n 
A 1 82  THR 82  81  81  THR THR A . n 
A 1 83  GLN 83  82  82  GLN GLN A . n 
A 1 84  GLU 84  83  83  GLU GLU A . n 
A 1 85  ILE 85  84  84  ILE ILE A . n 
A 1 86  VAL 86  85  85  VAL VAL A . n 
A 1 87  GLY 87  86  86  GLY GLY A . n 
A 1 88  CYS 88  87  87  CYS CYS A . n 
A 1 89  ALA 89  88  88  ALA ALA A . n 
A 1 90  HIS 90  89  89  HIS HIS A . n 
A 1 91  LEU 91  90  90  LEU LEU A . n 
A 1 92  GLU 92  91  91  GLU GLU A . n 
A 1 93  ASN 93  92  92  ASN ASN A . n 
A 1 94  TYR 94  93  93  TYR TYR A . n 
A 1 95  ALA 95  94  94  ALA ALA A . n 
A 1 96  LEU 96  95  95  LEU LEU A . n 
A 1 97  LYS 97  96  96  LYS LYS A . n 
A 1 98  MET 98  97  97  MET MET A . n 
A 1 99  PHE 99  98  98  PHE PHE A . n 
A 1 100 LEU 100 99  99  LEU LEU A . n 
A 1 101 TYR 101 100 100 TYR TYR A . n 
A 1 102 ALA 102 101 101 ALA ALA A . n 
A 1 103 ASP 103 102 102 ASP ASP A . n 
A 1 104 ASN 104 103 103 ASN ASN A . n 
A 1 105 GLU 105 104 104 GLU GLU A . n 
A 1 106 ASP 106 105 105 ASP ASP A . n 
A 1 107 ARG 107 106 106 ARG ARG A . n 
A 1 108 ALA 108 107 107 ALA ALA A . n 
A 1 109 GLY 109 108 108 GLY GLY A . n 
A 1 110 ARG 110 109 109 ARG ARG A . n 
A 1 111 PHE 111 110 110 PHE PHE A . n 
A 1 112 HIS 112 111 111 HIS HIS A . n 
A 1 113 LYS 113 112 112 LYS LYS A . n 
A 1 114 ASN 114 113 113 ASN ASN A . n 
A 1 115 MET 115 114 114 MET MET A . n 
A 1 116 ILE 116 115 115 ILE ILE A . n 
A 1 117 LYS 117 116 116 LYS LYS A . n 
A 1 118 SER 118 117 117 SER SER A . n 
A 1 119 PHE 119 118 118 PHE PHE A . n 
A 1 120 TYR 120 119 119 TYR TYR A . n 
A 1 121 THR 121 120 120 THR THR A . n 
A 1 122 ALA 122 121 121 ALA ALA A . n 
A 1 123 SER 123 122 122 SER SER A . n 
A 1 124 LEU 124 123 123 LEU LEU A . n 
A 1 125 LEU 125 124 124 LEU LEU A . n 
A 1 126 ILE 126 125 125 ILE ILE A . n 
A 1 127 ASP 127 126 126 ASP ASP A . n 
A 1 128 VAL 128 127 127 VAL VAL A . n 
A 1 129 ILE 129 128 128 ILE ILE A . n 
A 1 130 THR 130 129 129 THR THR A . n 
A 1 131 VAL 131 130 130 VAL VAL A . n 
A 1 132 PHE 132 131 131 PHE PHE A . n 
A 1 133 GLY 133 132 132 GLY GLY A . n 
A 1 134 GLU 134 133 133 GLU GLU A . n 
A 1 135 LEU 135 134 134 LEU LEU A . n 
A 1 136 THR 136 135 135 THR THR A . n 
A 1 137 ASP 137 136 136 ASP ASP A . n 
A 1 138 GLU 138 137 137 GLU GLU A . n 
A 1 139 ASN 139 138 138 ASN ASN A . n 
A 1 140 VAL 140 139 139 VAL VAL A . n 
A 1 141 LYS 141 140 140 LYS LYS A . n 
A 1 142 HIS 142 141 141 HIS HIS A . n 
A 1 143 ARG 143 142 142 ARG ARG A . n 
A 1 144 LYS 144 143 143 LYS LYS A . n 
A 1 145 TYR 145 144 144 TYR TYR A . n 
A 1 146 ALA 146 145 145 ALA ALA A . n 
A 1 147 ARG 147 146 146 ARG ARG A . n 
A 1 148 TRP 148 147 147 TRP TRP A . n 
A 1 149 LYS 149 148 148 LYS LYS A . n 
A 1 150 ALA 150 149 149 ALA ALA A . n 
A 1 151 THR 151 150 150 THR THR A . n 
A 1 152 TYR 152 151 151 TYR TYR A . n 
A 1 153 ILE 153 152 152 ILE ILE A . n 
A 1 154 HIS 154 153 153 HIS HIS A . n 
A 1 155 ASN 155 154 154 ASN ASN A . n 
A 1 156 CYS 156 155 155 CYS CYS A . n 
A 1 157 LEU 157 156 156 LEU LEU A . n 
A 1 158 LYS 158 157 157 LYS LYS A . n 
A 1 159 ASN 159 158 158 ASN ASN A . n 
A 1 160 GLY 160 159 159 GLY GLY A . n 
A 1 161 GLU 161 160 160 GLU GLU A . n 
A 1 162 THR 162 161 161 THR THR A . n 
A 1 163 PRO 163 162 162 PRO PRO A . n 
B 1 1   SER 1   0   ?   ?   ?   B . n 
B 1 2   MET 2   1   1   MET MET B . n 
B 1 3   ALA 3   2   2   ALA ALA B . n 
B 1 4   ALA 4   3   3   ALA ALA B . n 
B 1 5   LEU 5   4   4   LEU LEU B . n 
B 1 6   ALA 6   5   5   ALA ALA B . n 
B 1 7   PRO 7   6   6   PRO PRO B . n 
B 1 8   LEU 8   7   7   LEU LEU B . n 
B 1 9   PRO 9   8   8   PRO PRO B . n 
B 1 10  PRO 10  9   9   PRO PRO B . n 
B 1 11  LEU 11  10  10  LEU LEU B . n 
B 1 12  PRO 12  11  11  PRO PRO B . n 
B 1 13  ALA 13  12  12  ALA ALA B . n 
B 1 14  GLN 14  13  13  GLN GLN B . n 
B 1 15  PHE 15  14  14  PHE PHE B . n 
B 1 16  LYS 16  15  15  LYS LYS B . n 
B 1 17  SER 17  16  16  SER SER B . n 
B 1 18  ILE 18  17  17  ILE ILE B . n 
B 1 19  GLN 19  18  18  GLN GLN B . n 
B 1 20  HIS 20  19  19  HIS HIS B . n 
B 1 21  HIS 21  20  20  HIS HIS B . n 
B 1 22  LEU 22  21  21  LEU LEU B . n 
B 1 23  ARG 23  22  22  ARG ARG B . n 
B 1 24  THR 24  23  23  THR THR B . n 
B 1 25  ALA 25  24  24  ALA ALA B . n 
B 1 26  GLN 26  25  25  GLN GLN B . n 
B 1 27  GLU 27  26  26  GLU GLU B . n 
B 1 28  HIS 28  27  27  HIS HIS B . n 
B 1 29  ASP 29  28  28  ASP ASP B . n 
B 1 30  LYS 30  29  29  LYS LYS B . n 
B 1 31  ARG 31  30  30  ARG ARG B . n 
B 1 32  ASP 32  31  31  ASP ASP B . n 
B 1 33  PRO 33  32  32  PRO PRO B . n 
B 1 34  VAL 34  33  33  VAL VAL B . n 
B 1 35  VAL 35  34  34  VAL VAL B . n 
B 1 36  ALA 36  35  35  ALA ALA B . n 
B 1 37  TYR 37  36  36  TYR TYR B . n 
B 1 38  TYR 38  37  37  TYR TYR B . n 
B 1 39  CYS 39  38  38  CYS CYS B . n 
B 1 40  ARG 40  39  39  ARG ARG B . n 
B 1 41  LEU 41  40  40  LEU LEU B . n 
B 1 42  TYR 42  41  41  TYR TYR B . n 
B 1 43  ALA 43  42  42  ALA ALA B . n 
B 1 44  MET 44  43  43  MET MET B . n 
B 1 45  GLN 45  44  44  GLN GLN B . n 
B 1 46  THR 46  45  45  THR THR B . n 
B 1 47  GLY 47  46  46  GLY GLY B . n 
B 1 48  MET 48  47  47  MET MET B . n 
B 1 49  LYS 49  48  48  LYS LYS B . n 
B 1 50  ILE 50  49  49  ILE ILE B . n 
B 1 51  ASP 51  50  50  ASP ASP B . n 
B 1 52  SER 52  51  51  SER SER B . n 
B 1 53  LYS 53  52  52  LYS LYS B . n 
B 1 54  THR 54  53  53  THR THR B . n 
B 1 55  PRO 55  54  54  PRO PRO B . n 
B 1 56  GLU 56  55  55  GLU GLU B . n 
B 1 57  CYS 57  56  56  CYS CYS B . n 
B 1 58  ARG 58  57  57  ARG ARG B . n 
B 1 59  LYS 59  58  58  LYS LYS B . n 
B 1 60  PHE 60  59  59  PHE PHE B . n 
B 1 61  LEU 61  60  60  LEU LEU B . n 
B 1 62  SER 62  61  61  SER SER B . n 
B 1 63  LYS 63  62  62  LYS LYS B . n 
B 1 64  LEU 64  63  63  LEU LEU B . n 
B 1 65  MET 65  64  64  MET MET B . n 
B 1 66  ASP 66  65  65  ASP ASP B . n 
B 1 67  GLN 67  66  66  GLN GLN B . n 
B 1 68  LEU 68  67  67  LEU LEU B . n 
B 1 69  GLU 69  68  68  GLU GLU B . n 
B 1 70  ALA 70  69  69  ALA ALA B . n 
B 1 71  LEU 71  70  70  LEU LEU B . n 
B 1 72  LYS 72  71  71  LYS LYS B . n 
B 1 73  LYS 73  72  72  LYS LYS B . n 
B 1 74  GLN 74  73  73  GLN GLN B . n 
B 1 75  LEU 75  74  74  LEU LEU B . n 
B 1 76  GLY 76  75  75  GLY GLY B . n 
B 1 77  ASP 77  76  76  ASP ASP B . n 
B 1 78  ASN 78  77  77  ASN ASN B . n 
B 1 79  GLU 79  78  78  GLU GLU B . n 
B 1 80  ALA 80  79  79  ALA ALA B . n 
B 1 81  ILE 81  80  80  ILE ILE B . n 
B 1 82  THR 82  81  81  THR THR B . n 
B 1 83  GLN 83  82  82  GLN GLN B . n 
B 1 84  GLU 84  83  83  GLU GLU B . n 
B 1 85  ILE 85  84  84  ILE ILE B . n 
B 1 86  VAL 86  85  85  VAL VAL B . n 
B 1 87  GLY 87  86  86  GLY GLY B . n 
B 1 88  CYS 88  87  87  CYS CYS B . n 
B 1 89  ALA 89  88  88  ALA ALA B . n 
B 1 90  HIS 90  89  89  HIS HIS B . n 
B 1 91  LEU 91  90  90  LEU LEU B . n 
B 1 92  GLU 92  91  91  GLU GLU B . n 
B 1 93  ASN 93  92  92  ASN ASN B . n 
B 1 94  TYR 94  93  93  TYR TYR B . n 
B 1 95  ALA 95  94  94  ALA ALA B . n 
B 1 96  LEU 96  95  95  LEU LEU B . n 
B 1 97  LYS 97  96  96  LYS LYS B . n 
B 1 98  MET 98  97  97  MET MET B . n 
B 1 99  PHE 99  98  98  PHE PHE B . n 
B 1 100 LEU 100 99  99  LEU LEU B . n 
B 1 101 TYR 101 100 100 TYR TYR B . n 
B 1 102 ALA 102 101 101 ALA ALA B . n 
B 1 103 ASP 103 102 102 ASP ASP B . n 
B 1 104 ASN 104 103 103 ASN ASN B . n 
B 1 105 GLU 105 104 104 GLU GLU B . n 
B 1 106 ASP 106 105 105 ASP ASP B . n 
B 1 107 ARG 107 106 106 ARG ARG B . n 
B 1 108 ALA 108 107 107 ALA ALA B . n 
B 1 109 GLY 109 108 108 GLY GLY B . n 
B 1 110 ARG 110 109 109 ARG ARG B . n 
B 1 111 PHE 111 110 110 PHE PHE B . n 
B 1 112 HIS 112 111 111 HIS HIS B . n 
B 1 113 LYS 113 112 112 LYS LYS B . n 
B 1 114 ASN 114 113 113 ASN ASN B . n 
B 1 115 MET 115 114 114 MET MET B . n 
B 1 116 ILE 116 115 115 ILE ILE B . n 
B 1 117 LYS 117 116 116 LYS LYS B . n 
B 1 118 SER 118 117 117 SER SER B . n 
B 1 119 PHE 119 118 118 PHE PHE B . n 
B 1 120 TYR 120 119 119 TYR TYR B . n 
B 1 121 THR 121 120 120 THR THR B . n 
B 1 122 ALA 122 121 121 ALA ALA B . n 
B 1 123 SER 123 122 122 SER SER B . n 
B 1 124 LEU 124 123 123 LEU LEU B . n 
B 1 125 LEU 125 124 124 LEU LEU B . n 
B 1 126 ILE 126 125 125 ILE ILE B . n 
B 1 127 ASP 127 126 126 ASP ASP B . n 
B 1 128 VAL 128 127 127 VAL VAL B . n 
B 1 129 ILE 129 128 128 ILE ILE B . n 
B 1 130 THR 130 129 129 THR THR B . n 
B 1 131 VAL 131 130 130 VAL VAL B . n 
B 1 132 PHE 132 131 131 PHE PHE B . n 
B 1 133 GLY 133 132 132 GLY GLY B . n 
B 1 134 GLU 134 133 133 GLU GLU B . n 
B 1 135 LEU 135 134 134 LEU LEU B . n 
B 1 136 THR 136 135 135 THR THR B . n 
B 1 137 ASP 137 136 136 ASP ASP B . n 
B 1 138 GLU 138 137 137 GLU GLU B . n 
B 1 139 ASN 139 138 138 ASN ASN B . n 
B 1 140 VAL 140 139 139 VAL VAL B . n 
B 1 141 LYS 141 140 140 LYS LYS B . n 
B 1 142 HIS 142 141 141 HIS HIS B . n 
B 1 143 ARG 143 142 142 ARG ARG B . n 
B 1 144 LYS 144 143 143 LYS LYS B . n 
B 1 145 TYR 145 144 144 TYR TYR B . n 
B 1 146 ALA 146 145 145 ALA ALA B . n 
B 1 147 ARG 147 146 146 ARG ARG B . n 
B 1 148 TRP 148 147 147 TRP TRP B . n 
B 1 149 LYS 149 148 148 LYS LYS B . n 
B 1 150 ALA 150 149 149 ALA ALA B . n 
B 1 151 THR 151 150 150 THR THR B . n 
B 1 152 TYR 152 151 151 TYR TYR B . n 
B 1 153 ILE 153 152 152 ILE ILE B . n 
B 1 154 HIS 154 153 153 HIS HIS B . n 
B 1 155 ASN 155 154 154 ASN ASN B . n 
B 1 156 CYS 156 155 155 CYS CYS B . n 
B 1 157 LEU 157 156 156 LEU LEU B . n 
B 1 158 LYS 158 157 157 LYS LYS B . n 
B 1 159 ASN 159 158 158 ASN ASN B . n 
B 1 160 GLY 160 159 159 GLY GLY B . n 
B 1 161 GLU 161 160 160 GLU GLU B . n 
B 1 162 THR 162 161 161 THR THR B . n 
B 1 163 PRO 163 162 162 PRO PRO B . n 
C 2 1   SER 1   175 ?   ?   ?   C . n 
C 2 2   VAL 2   176 ?   ?   ?   C . n 
C 2 3   GLY 3   177 ?   ?   ?   C . n 
C 2 4   THR 4   178 ?   ?   ?   C . n 
C 2 5   SER 5   179 ?   ?   ?   C . n 
C 2 6   VAL 6   180 ?   ?   ?   C . n 
C 2 7   ALA 7   181 ?   ?   ?   C . n 
C 2 8   SER 8   182 ?   ?   ?   C . n 
C 2 9   ALA 9   183 ?   ?   ?   C . n 
C 2 10  GLU 10  184 ?   ?   ?   C . n 
C 2 11  GLN 11  185 ?   ?   ?   C . n 
C 2 12  ASP 12  186 186 ASP ASP C . n 
C 2 13  GLU 13  187 187 GLU GLU C . n 
C 2 14  LEU 14  188 188 LEU LEU C . n 
C 2 15  SER 15  189 189 SER SER C . n 
C 2 16  GLN 16  190 190 GLN GLN C . n 
C 2 17  ARG 17  191 191 ARG ARG C . n 
C 2 18  LEU 18  192 192 LEU LEU C . n 
C 2 19  ALA 19  193 193 ALA ALA C . n 
C 2 20  ARG 20  194 194 ARG ARG C . n 
C 2 21  LEU 21  195 195 LEU LEU C . n 
C 2 22  ARG 22  196 196 ARG ARG C . n 
C 2 23  ASP 23  197 197 ASP ASP C . n 
C 2 24  GLN 24  198 198 GLN GLN C . n 
C 2 25  VAL 25  199 ?   ?   ?   C . n 
D 2 1   SER 1   175 ?   ?   ?   D . n 
D 2 2   VAL 2   176 ?   ?   ?   D . n 
D 2 3   GLY 3   177 ?   ?   ?   D . n 
D 2 4   THR 4   178 ?   ?   ?   D . n 
D 2 5   SER 5   179 ?   ?   ?   D . n 
D 2 6   VAL 6   180 ?   ?   ?   D . n 
D 2 7   ALA 7   181 ?   ?   ?   D . n 
D 2 8   SER 8   182 ?   ?   ?   D . n 
D 2 9   ALA 9   183 183 ALA ALA D . n 
D 2 10  GLU 10  184 184 GLU GLU D . n 
D 2 11  GLN 11  185 185 GLN GLN D . n 
D 2 12  ASP 12  186 186 ASP ASP D . n 
D 2 13  GLU 13  187 187 GLU GLU D . n 
D 2 14  LEU 14  188 188 LEU LEU D . n 
D 2 15  SER 15  189 189 SER SER D . n 
D 2 16  GLN 16  190 190 GLN GLN D . n 
D 2 17  ARG 17  191 191 ARG ARG D . n 
D 2 18  LEU 18  192 192 LEU LEU D . n 
D 2 19  ALA 19  193 193 ALA ALA D . n 
D 2 20  ARG 20  194 194 ARG ARG D . n 
D 2 21  LEU 21  195 195 LEU LEU D . n 
D 2 22  ARG 22  196 196 ARG ARG D . n 
D 2 23  ASP 23  197 197 ASP ASP D . n 
D 2 24  GLN 24  198 198 GLN GLN D . n 
D 2 25  VAL 25  199 199 VAL VAL D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 HOH 1  201 158 HOH HOH A . 
E 3 HOH 2  202 141 HOH HOH A . 
E 3 HOH 3  203 71  HOH HOH A . 
E 3 HOH 4  204 185 HOH HOH A . 
E 3 HOH 5  205 29  HOH HOH A . 
E 3 HOH 6  206 129 HOH HOH A . 
E 3 HOH 7  207 49  HOH HOH A . 
E 3 HOH 8  208 1   HOH HOH A . 
E 3 HOH 9  209 55  HOH HOH A . 
E 3 HOH 10 210 7   HOH HOH A . 
E 3 HOH 11 211 42  HOH HOH A . 
E 3 HOH 12 212 16  HOH HOH A . 
E 3 HOH 13 213 38  HOH HOH A . 
E 3 HOH 14 214 11  HOH HOH A . 
E 3 HOH 15 215 62  HOH HOH A . 
E 3 HOH 16 216 2   HOH HOH A . 
E 3 HOH 17 217 122 HOH HOH A . 
E 3 HOH 18 218 128 HOH HOH A . 
E 3 HOH 19 219 127 HOH HOH A . 
E 3 HOH 20 220 164 HOH HOH A . 
E 3 HOH 21 221 107 HOH HOH A . 
E 3 HOH 22 222 200 HOH HOH A . 
E 3 HOH 23 223 4   HOH HOH A . 
E 3 HOH 24 224 5   HOH HOH A . 
E 3 HOH 25 225 6   HOH HOH A . 
E 3 HOH 26 226 12  HOH HOH A . 
E 3 HOH 27 227 13  HOH HOH A . 
E 3 HOH 28 228 21  HOH HOH A . 
E 3 HOH 29 229 23  HOH HOH A . 
E 3 HOH 30 230 24  HOH HOH A . 
E 3 HOH 31 231 26  HOH HOH A . 
E 3 HOH 32 232 27  HOH HOH A . 
E 3 HOH 33 233 31  HOH HOH A . 
E 3 HOH 34 234 35  HOH HOH A . 
E 3 HOH 35 235 44  HOH HOH A . 
E 3 HOH 36 236 47  HOH HOH A . 
E 3 HOH 37 237 48  HOH HOH A . 
E 3 HOH 38 238 50  HOH HOH A . 
E 3 HOH 39 239 52  HOH HOH A . 
E 3 HOH 40 240 53  HOH HOH A . 
E 3 HOH 41 241 58  HOH HOH A . 
E 3 HOH 42 242 63  HOH HOH A . 
E 3 HOH 43 243 67  HOH HOH A . 
E 3 HOH 44 244 69  HOH HOH A . 
E 3 HOH 45 245 73  HOH HOH A . 
E 3 HOH 46 246 75  HOH HOH A . 
E 3 HOH 47 247 82  HOH HOH A . 
E 3 HOH 48 248 85  HOH HOH A . 
E 3 HOH 49 249 88  HOH HOH A . 
E 3 HOH 50 250 90  HOH HOH A . 
E 3 HOH 51 251 91  HOH HOH A . 
E 3 HOH 52 252 92  HOH HOH A . 
E 3 HOH 53 253 96  HOH HOH A . 
E 3 HOH 54 254 105 HOH HOH A . 
E 3 HOH 55 255 106 HOH HOH A . 
E 3 HOH 56 256 109 HOH HOH A . 
E 3 HOH 57 257 111 HOH HOH A . 
E 3 HOH 58 258 113 HOH HOH A . 
E 3 HOH 59 259 114 HOH HOH A . 
E 3 HOH 60 260 115 HOH HOH A . 
E 3 HOH 61 261 117 HOH HOH A . 
E 3 HOH 62 262 119 HOH HOH A . 
E 3 HOH 63 263 120 HOH HOH A . 
E 3 HOH 64 264 121 HOH HOH A . 
E 3 HOH 65 265 124 HOH HOH A . 
E 3 HOH 66 266 126 HOH HOH A . 
E 3 HOH 67 267 130 HOH HOH A . 
E 3 HOH 68 268 132 HOH HOH A . 
E 3 HOH 69 269 133 HOH HOH A . 
E 3 HOH 70 270 139 HOH HOH A . 
E 3 HOH 71 271 144 HOH HOH A . 
E 3 HOH 72 272 145 HOH HOH A . 
E 3 HOH 73 273 147 HOH HOH A . 
E 3 HOH 74 274 148 HOH HOH A . 
E 3 HOH 75 275 150 HOH HOH A . 
E 3 HOH 76 276 153 HOH HOH A . 
E 3 HOH 77 277 154 HOH HOH A . 
E 3 HOH 78 278 157 HOH HOH A . 
E 3 HOH 79 279 160 HOH HOH A . 
E 3 HOH 80 280 162 HOH HOH A . 
E 3 HOH 81 281 165 HOH HOH A . 
E 3 HOH 82 282 173 HOH HOH A . 
E 3 HOH 83 283 174 HOH HOH A . 
E 3 HOH 84 284 177 HOH HOH A . 
E 3 HOH 85 285 179 HOH HOH A . 
E 3 HOH 86 286 183 HOH HOH A . 
E 3 HOH 87 287 186 HOH HOH A . 
E 3 HOH 88 288 192 HOH HOH A . 
E 3 HOH 89 289 194 HOH HOH A . 
E 3 HOH 90 290 195 HOH HOH A . 
E 3 HOH 91 291 196 HOH HOH A . 
E 3 HOH 92 292 197 HOH HOH A . 
E 3 HOH 93 293 198 HOH HOH A . 
E 3 HOH 94 294 199 HOH HOH A . 
E 3 HOH 95 295 201 HOH HOH A . 
F 3 HOH 1  201 176 HOH HOH B . 
F 3 HOH 2  202 86  HOH HOH B . 
F 3 HOH 3  203 45  HOH HOH B . 
F 3 HOH 4  204 46  HOH HOH B . 
F 3 HOH 5  205 76  HOH HOH B . 
F 3 HOH 6  206 108 HOH HOH B . 
F 3 HOH 7  207 15  HOH HOH B . 
F 3 HOH 8  208 163 HOH HOH B . 
F 3 HOH 9  209 87  HOH HOH B . 
F 3 HOH 10 210 100 HOH HOH B . 
F 3 HOH 11 211 138 HOH HOH B . 
F 3 HOH 12 212 84  HOH HOH B . 
F 3 HOH 13 213 169 HOH HOH B . 
F 3 HOH 14 214 103 HOH HOH B . 
F 3 HOH 15 215 149 HOH HOH B . 
F 3 HOH 16 216 118 HOH HOH B . 
F 3 HOH 17 217 142 HOH HOH B . 
F 3 HOH 18 218 80  HOH HOH B . 
F 3 HOH 19 219 64  HOH HOH B . 
F 3 HOH 20 220 94  HOH HOH B . 
F 3 HOH 21 221 171 HOH HOH B . 
F 3 HOH 22 222 17  HOH HOH B . 
F 3 HOH 23 223 161 HOH HOH B . 
F 3 HOH 24 224 51  HOH HOH B . 
F 3 HOH 25 225 83  HOH HOH B . 
F 3 HOH 26 226 143 HOH HOH B . 
F 3 HOH 27 227 190 HOH HOH B . 
F 3 HOH 28 228 74  HOH HOH B . 
F 3 HOH 29 229 102 HOH HOH B . 
F 3 HOH 30 230 152 HOH HOH B . 
F 3 HOH 31 231 95  HOH HOH B . 
F 3 HOH 32 232 146 HOH HOH B . 
F 3 HOH 33 233 43  HOH HOH B . 
F 3 HOH 34 234 181 HOH HOH B . 
F 3 HOH 35 235 112 HOH HOH B . 
F 3 HOH 36 236 110 HOH HOH B . 
F 3 HOH 37 237 72  HOH HOH B . 
F 3 HOH 38 238 3   HOH HOH B . 
F 3 HOH 39 239 8   HOH HOH B . 
F 3 HOH 40 240 9   HOH HOH B . 
F 3 HOH 41 241 10  HOH HOH B . 
F 3 HOH 42 242 14  HOH HOH B . 
F 3 HOH 43 243 18  HOH HOH B . 
F 3 HOH 44 244 19  HOH HOH B . 
F 3 HOH 45 245 20  HOH HOH B . 
F 3 HOH 46 246 22  HOH HOH B . 
F 3 HOH 47 247 25  HOH HOH B . 
F 3 HOH 48 248 28  HOH HOH B . 
F 3 HOH 49 249 30  HOH HOH B . 
F 3 HOH 50 250 32  HOH HOH B . 
F 3 HOH 51 251 33  HOH HOH B . 
F 3 HOH 52 252 34  HOH HOH B . 
F 3 HOH 53 253 36  HOH HOH B . 
F 3 HOH 54 254 37  HOH HOH B . 
F 3 HOH 55 255 39  HOH HOH B . 
F 3 HOH 56 256 41  HOH HOH B . 
F 3 HOH 57 257 54  HOH HOH B . 
F 3 HOH 58 258 56  HOH HOH B . 
F 3 HOH 59 259 57  HOH HOH B . 
F 3 HOH 60 260 59  HOH HOH B . 
F 3 HOH 61 261 60  HOH HOH B . 
F 3 HOH 62 262 61  HOH HOH B . 
F 3 HOH 63 263 65  HOH HOH B . 
F 3 HOH 64 264 66  HOH HOH B . 
F 3 HOH 65 265 68  HOH HOH B . 
F 3 HOH 66 266 70  HOH HOH B . 
F 3 HOH 67 267 77  HOH HOH B . 
F 3 HOH 68 268 78  HOH HOH B . 
F 3 HOH 69 269 79  HOH HOH B . 
F 3 HOH 70 270 81  HOH HOH B . 
F 3 HOH 71 271 89  HOH HOH B . 
F 3 HOH 72 272 93  HOH HOH B . 
F 3 HOH 73 273 97  HOH HOH B . 
F 3 HOH 74 274 98  HOH HOH B . 
F 3 HOH 75 275 99  HOH HOH B . 
F 3 HOH 76 276 101 HOH HOH B . 
F 3 HOH 77 277 104 HOH HOH B . 
F 3 HOH 78 278 123 HOH HOH B . 
F 3 HOH 79 279 125 HOH HOH B . 
F 3 HOH 80 280 131 HOH HOH B . 
F 3 HOH 81 281 134 HOH HOH B . 
F 3 HOH 82 282 135 HOH HOH B . 
F 3 HOH 83 283 137 HOH HOH B . 
F 3 HOH 84 284 140 HOH HOH B . 
F 3 HOH 85 285 151 HOH HOH B . 
F 3 HOH 86 286 155 HOH HOH B . 
F 3 HOH 87 287 156 HOH HOH B . 
F 3 HOH 88 288 159 HOH HOH B . 
F 3 HOH 89 289 170 HOH HOH B . 
F 3 HOH 90 290 172 HOH HOH B . 
F 3 HOH 91 291 180 HOH HOH B . 
F 3 HOH 92 292 182 HOH HOH B . 
F 3 HOH 93 293 184 HOH HOH B . 
F 3 HOH 94 294 189 HOH HOH B . 
F 3 HOH 95 295 191 HOH HOH B . 
F 3 HOH 96 296 193 HOH HOH B . 
G 3 HOH 1  201 116 HOH HOH C . 
H 3 HOH 1  201 40  HOH HOH D . 
H 3 HOH 2  202 187 HOH HOH D . 
H 3 HOH 3  203 136 HOH HOH D . 
H 3 HOH 4  204 168 HOH HOH D . 
H 3 HOH 5  205 188 HOH HOH D . 
H 3 HOH 6  206 202 HOH HOH D . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric 2 
2 author_and_software_defined_assembly PISA dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,E,G 
2 1 B,D,F,H 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1120 ? 
1 MORE         -1   ? 
1 'SSA (A^2)'  9650 ? 
2 'ABSA (A^2)' 1280 ? 
2 MORE         -3   ? 
2 'SSA (A^2)'  9740 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2015-02-11 
2 'Structure model' 1 1 2015-02-18 
3 'Structure model' 1 2 2015-03-25 
4 'Structure model' 1 3 2019-12-04 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'        
2 3 'Structure model' 'Database references'        
3 4 'Structure model' 'Author supporting evidence' 
4 4 'Structure model' 'Database references'        
5 4 'Structure model' 'Derived calculations'       
6 4 'Structure model' Other                        
7 4 'Structure model' 'Source and taxonomy'        
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' citation              
2 4 'Structure model' entity_src_gen        
3 4 'Structure model' pdbx_audit_support    
4 4 'Structure model' pdbx_database_status  
5 4 'Structure model' pdbx_struct_oper_list 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_citation.journal_id_CSD'                    
2 4 'Structure model' '_entity_src_gen.pdbx_alt_source_flag'        
3 4 'Structure model' '_pdbx_audit_support.funding_organization'    
4 4 'Structure model' '_pdbx_database_status.pdb_format_compatible' 
5 4 'Structure model' '_pdbx_struct_oper_list.symmetry_operation'   
# 
_software.citation_id            ? 
_software.classification         refinement 
_software.compiler_name          ? 
_software.compiler_version       ? 
_software.contact_author         ? 
_software.contact_author_email   ? 
_software.date                   ? 
_software.description            ? 
_software.dependencies           ? 
_software.hardware               ? 
_software.language               ? 
_software.location               ? 
_software.mods                   ? 
_software.name                   PHENIX 
_software.os                     ? 
_software.os_version             ? 
_software.type                   ? 
_software.version                '(phenix.refine: dev_1593)' 
_software.pdbx_ordinal           1 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   B 
_pdbx_validate_close_contact.auth_comp_id_1   HOH 
_pdbx_validate_close_contact.auth_seq_id_1    234 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   B 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    237 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.17 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CA B MET 114 ? ? CB B MET 114 ? ? CG B MET 114 ? ? 100.39 113.30 -12.91 1.70 N 
2 1 CB B MET 114 ? ? CG B MET 114 ? ? SD B MET 114 ? ? 135.95 112.40 23.55  3.00 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 31 ? ? -156.38 83.64  
2 1 ASP A 50 ? ? -165.48 102.82 
3 1 LYS A 52 ? ? -130.96 -35.01 
4 1 ALA B 5  ? ? 65.79   135.08 
5 1 ASP B 31 ? ? -151.36 77.80  
6 1 ASP B 50 ? ? -167.00 113.92 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 15  ? CG  ? A LYS 16  CG  
2  1 Y 1 A LYS 15  ? CD  ? A LYS 16  CD  
3  1 Y 1 A LYS 15  ? CE  ? A LYS 16  CE  
4  1 Y 1 A LYS 15  ? NZ  ? A LYS 16  NZ  
5  1 Y 1 A LYS 72  ? CD  ? A LYS 73  CD  
6  1 Y 1 A LYS 72  ? CE  ? A LYS 73  CE  
7  1 Y 1 A LYS 72  ? NZ  ? A LYS 73  NZ  
8  1 Y 1 A ASP 76  ? CG  ? A ASP 77  CG  
9  1 Y 1 A ASP 76  ? OD1 ? A ASP 77  OD1 
10 1 Y 1 A ASP 76  ? OD2 ? A ASP 77  OD2 
11 1 Y 1 A LYS 112 ? CE  ? A LYS 113 CE  
12 1 Y 1 A LYS 112 ? NZ  ? A LYS 113 NZ  
13 1 Y 1 A GLU 137 ? CD  ? A GLU 138 CD  
14 1 Y 1 A GLU 137 ? OE1 ? A GLU 138 OE1 
15 1 Y 1 A GLU 137 ? OE2 ? A GLU 138 OE2 
16 1 Y 1 B GLN 25  ? OE1 ? B GLN 26  OE1 
17 1 Y 1 B GLN 25  ? NE2 ? B GLN 26  NE2 
18 1 Y 1 B ARG 30  ? CG  ? B ARG 31  CG  
19 1 Y 1 B ARG 30  ? CD  ? B ARG 31  CD  
20 1 Y 1 B ARG 30  ? NE  ? B ARG 31  NE  
21 1 Y 1 B ARG 30  ? CZ  ? B ARG 31  CZ  
22 1 Y 1 B ARG 30  ? NH1 ? B ARG 31  NH1 
23 1 Y 1 B ARG 30  ? NH2 ? B ARG 31  NH2 
24 1 Y 1 B LYS 52  ? CG  ? B LYS 53  CG  
25 1 Y 1 B LYS 52  ? CD  ? B LYS 53  CD  
26 1 Y 1 B LYS 52  ? CE  ? B LYS 53  CE  
27 1 Y 1 B LYS 52  ? NZ  ? B LYS 53  NZ  
28 1 Y 1 B ARG 57  ? CD  ? B ARG 58  CD  
29 1 Y 1 B ARG 57  ? NE  ? B ARG 58  NE  
30 1 Y 1 B ARG 57  ? CZ  ? B ARG 58  CZ  
31 1 Y 1 B ARG 57  ? NH1 ? B ARG 58  NH1 
32 1 Y 1 B ARG 57  ? NH2 ? B ARG 58  NH2 
33 1 Y 1 B LYS 58  ? CE  ? B LYS 59  CE  
34 1 Y 1 B LYS 58  ? NZ  ? B LYS 59  NZ  
35 1 Y 1 B LYS 62  ? CE  ? B LYS 63  CE  
36 1 Y 1 B LYS 62  ? NZ  ? B LYS 63  NZ  
37 1 Y 1 B LYS 72  ? CE  ? B LYS 73  CE  
38 1 Y 1 B LYS 72  ? NZ  ? B LYS 73  NZ  
39 1 Y 1 B LYS 96  ? CE  ? B LYS 97  CE  
40 1 Y 1 B LYS 96  ? NZ  ? B LYS 97  NZ  
41 1 Y 1 B GLU 133 ? CD  ? B GLU 134 CD  
42 1 Y 1 B GLU 133 ? OE1 ? B GLU 134 OE1 
43 1 Y 1 B GLU 133 ? OE2 ? B GLU 134 OE2 
44 1 Y 1 C GLU 187 ? CG  ? C GLU 13  CG  
45 1 Y 1 C GLU 187 ? CD  ? C GLU 13  CD  
46 1 Y 1 C GLU 187 ? OE1 ? C GLU 13  OE1 
47 1 Y 1 C GLU 187 ? OE2 ? C GLU 13  OE2 
48 1 Y 1 C GLN 198 ? CD  ? C GLN 24  CD  
49 1 Y 1 C GLN 198 ? OE1 ? C GLN 24  OE1 
50 1 Y 1 C GLN 198 ? NE2 ? C GLN 24  NE2 
51 1 Y 1 D GLU 184 ? CG  ? D GLU 10  CG  
52 1 Y 1 D GLU 184 ? CD  ? D GLU 10  CD  
53 1 Y 1 D GLU 184 ? OE1 ? D GLU 10  OE1 
54 1 Y 1 D GLU 184 ? OE2 ? D GLU 10  OE2 
55 1 Y 1 D ARG 194 ? CG  ? D ARG 20  CG  
56 1 Y 1 D ARG 194 ? CD  ? D ARG 20  CD  
57 1 Y 1 D ARG 194 ? NE  ? D ARG 20  NE  
58 1 Y 1 D ARG 194 ? CZ  ? D ARG 20  CZ  
59 1 Y 1 D ARG 194 ? NH1 ? D ARG 20  NH1 
60 1 Y 1 D ARG 194 ? NH2 ? D ARG 20  NH2 
61 1 Y 1 D GLN 198 ? CG  ? D GLN 24  CG  
62 1 Y 1 D GLN 198 ? CD  ? D GLN 24  CD  
63 1 Y 1 D GLN 198 ? OE1 ? D GLN 24  OE1 
64 1 Y 1 D GLN 198 ? NE2 ? D GLN 24  NE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 0   ? A SER 1  
2  1 Y 1 B SER 0   ? B SER 1  
3  1 Y 1 C SER 175 ? C SER 1  
4  1 Y 1 C VAL 176 ? C VAL 2  
5  1 Y 1 C GLY 177 ? C GLY 3  
6  1 Y 1 C THR 178 ? C THR 4  
7  1 Y 1 C SER 179 ? C SER 5  
8  1 Y 1 C VAL 180 ? C VAL 6  
9  1 Y 1 C ALA 181 ? C ALA 7  
10 1 Y 1 C SER 182 ? C SER 8  
11 1 Y 1 C ALA 183 ? C ALA 9  
12 1 Y 1 C GLU 184 ? C GLU 10 
13 1 Y 1 C GLN 185 ? C GLN 11 
14 1 Y 1 C VAL 199 ? C VAL 25 
15 1 Y 1 D SER 175 ? D SER 1  
16 1 Y 1 D VAL 176 ? D VAL 2  
17 1 Y 1 D GLY 177 ? D GLY 3  
18 1 Y 1 D THR 178 ? D THR 4  
19 1 Y 1 D SER 179 ? D SER 5  
20 1 Y 1 D VAL 180 ? D VAL 6  
21 1 Y 1 D ALA 181 ? D ALA 7  
22 1 Y 1 D SER 182 ? D SER 8  
# 
_pdbx_audit_support.funding_organization   
'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 
_pdbx_audit_support.country                'United States' 
_pdbx_audit_support.grant_number           F027259 
_pdbx_audit_support.ordinal                1 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#