data_4TZ1
# 
_entry.id   4TZ1 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4TZ1         
WWPDB D_1000202552 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
re-refinement 4PEY PDB . 
unspecified   4TYV PDB . 
unspecified   4TZ3 PDB . 
unspecified   4TZ5 PDB . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4TZ1 
_pdbx_database_status.recvd_initial_deposition_date   2014-07-09 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Bianchetti, C.M.' 1 
'Takasuka, T.E.'   2 
'Yik, E.J.'        3 
'Bergeman, L.F.'   4 
'Fox, B.G.'        5 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_id_ASTM           JBCHA3 
_citation.journal_id_CSD            0071 
_citation.journal_id_ISSN           1083-351X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            290 
_citation.language                  ? 
_citation.page_first                11819 
_citation.page_last                 11832 
_citation.title                     'Active site and laminarin binding in glycoside hydrolase family 55.' 
_citation.year                      2015 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1074/jbc.M114.623579 
_citation.pdbx_database_id_PubMed   25752603 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Bianchetti, C.M.' 1 ? 
primary 'Takasuka, T.E.'   2 ? 
primary 'Deutsch, S.'      3 ? 
primary 'Udell, H.S.'      4 ? 
primary 'Yik, E.J.'        5 ? 
primary 'Bergeman, L.F.'   6 ? 
primary 'Fox, B.G.'        7 ? 
# 
_cell.length_a           49.775 
_cell.length_b           100.195 
_cell.length_c           53.862 
_cell.angle_alpha        90.000 
_cell.angle_beta         103.490 
_cell.angle_gamma        90.000 
_cell.entry_id           4TZ1 
_cell.Z_PDB              2 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4TZ1 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer  man 'Putative secreted protein'                                                  58884.359 1   ? ? 
'UNP residues 57-605' ? 
2 branched man 'beta-D-glucopyranose-(1-3)-beta-D-glucopyranose-(1-3)-beta-D-glucopyranose' 504.438   2   ? ? ? ? 
3 water    nat water                                                                        18.015    339 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;EVVGGGDLGPNVLVFDPSTPDIQGKVDEVFRKQESNQFGTDRYALMFKPGTYNDINAQIGFYTSIAGLGLNPDDTTFNGD
VTVDAGWFDGNATQNFWRSAENLALNPVNGTNRWAVSQAAPFRRMHVKGGLNLAPDGYGWASGGYIADSKIDGEVGPYSQ
QQWYTRDSSVGGWGNGVWNMTFSGVEGAPAQSFPEPPYTTLETTPVSREKPFLYLDGDDYKVFVPAKRTNARGTSWGNGT
PEGESLPLDQFYVVKPGATAETINAAVDQGLHLLFTPGVYHVDQPIEIDRANTVALGLGLATIIPDNGVTALKVGDVDGV
KVAGLLVDAGPVNSETLVEVGSDGASGDHAANPTSLQDVFVRIGGAGPGKATTSIVVNSNDTIIDHTWVWRADHGEGVGW
ETNRADYGVHVKGDNVLATGLFVEHFNKYDVQWSGENGKTIFYQNAKAYDAPDQAAIQNGDIKGYAAYKVDDSVTTHEGW
GMGSYCYFNVNPDIRQQHGFQAPVKPGVKFHDLLVVSLGGKGQYEHVINDIGDPTSGDTTIPSQVVSFP
;
_entity_poly.pdbx_seq_one_letter_code_can   
;EVVGGGDLGPNVLVFDPSTPDIQGKVDEVFRKQESNQFGTDRYALMFKPGTYNDINAQIGFYTSIAGLGLNPDDTTFNGD
VTVDAGWFDGNATQNFWRSAENLALNPVNGTNRWAVSQAAPFRRMHVKGGLNLAPDGYGWASGGYIADSKIDGEVGPYSQ
QQWYTRDSSVGGWGNGVWNMTFSGVEGAPAQSFPEPPYTTLETTPVSREKPFLYLDGDDYKVFVPAKRTNARGTSWGNGT
PEGESLPLDQFYVVKPGATAETINAAVDQGLHLLFTPGVYHVDQPIEIDRANTVALGLGLATIIPDNGVTALKVGDVDGV
KVAGLLVDAGPVNSETLVEVGSDGASGDHAANPTSLQDVFVRIGGAGPGKATTSIVVNSNDTIIDHTWVWRADHGEGVGW
ETNRADYGVHVKGDNVLATGLFVEHFNKYDVQWSGENGKTIFYQNAKAYDAPDQAAIQNGDIKGYAAYKVDDSVTTHEGW
GMGSYCYFNVNPDIRQQHGFQAPVKPGVKFHDLLVVSLGGKGQYEHVINDIGDPTSGDTTIPSQVVSFP
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLU n 
1 2   VAL n 
1 3   VAL n 
1 4   GLY n 
1 5   GLY n 
1 6   GLY n 
1 7   ASP n 
1 8   LEU n 
1 9   GLY n 
1 10  PRO n 
1 11  ASN n 
1 12  VAL n 
1 13  LEU n 
1 14  VAL n 
1 15  PHE n 
1 16  ASP n 
1 17  PRO n 
1 18  SER n 
1 19  THR n 
1 20  PRO n 
1 21  ASP n 
1 22  ILE n 
1 23  GLN n 
1 24  GLY n 
1 25  LYS n 
1 26  VAL n 
1 27  ASP n 
1 28  GLU n 
1 29  VAL n 
1 30  PHE n 
1 31  ARG n 
1 32  LYS n 
1 33  GLN n 
1 34  GLU n 
1 35  SER n 
1 36  ASN n 
1 37  GLN n 
1 38  PHE n 
1 39  GLY n 
1 40  THR n 
1 41  ASP n 
1 42  ARG n 
1 43  TYR n 
1 44  ALA n 
1 45  LEU n 
1 46  MET n 
1 47  PHE n 
1 48  LYS n 
1 49  PRO n 
1 50  GLY n 
1 51  THR n 
1 52  TYR n 
1 53  ASN n 
1 54  ASP n 
1 55  ILE n 
1 56  ASN n 
1 57  ALA n 
1 58  GLN n 
1 59  ILE n 
1 60  GLY n 
1 61  PHE n 
1 62  TYR n 
1 63  THR n 
1 64  SER n 
1 65  ILE n 
1 66  ALA n 
1 67  GLY n 
1 68  LEU n 
1 69  GLY n 
1 70  LEU n 
1 71  ASN n 
1 72  PRO n 
1 73  ASP n 
1 74  ASP n 
1 75  THR n 
1 76  THR n 
1 77  PHE n 
1 78  ASN n 
1 79  GLY n 
1 80  ASP n 
1 81  VAL n 
1 82  THR n 
1 83  VAL n 
1 84  ASP n 
1 85  ALA n 
1 86  GLY n 
1 87  TRP n 
1 88  PHE n 
1 89  ASP n 
1 90  GLY n 
1 91  ASN n 
1 92  ALA n 
1 93  THR n 
1 94  GLN n 
1 95  ASN n 
1 96  PHE n 
1 97  TRP n 
1 98  ARG n 
1 99  SER n 
1 100 ALA n 
1 101 GLU n 
1 102 ASN n 
1 103 LEU n 
1 104 ALA n 
1 105 LEU n 
1 106 ASN n 
1 107 PRO n 
1 108 VAL n 
1 109 ASN n 
1 110 GLY n 
1 111 THR n 
1 112 ASN n 
1 113 ARG n 
1 114 TRP n 
1 115 ALA n 
1 116 VAL n 
1 117 SER n 
1 118 GLN n 
1 119 ALA n 
1 120 ALA n 
1 121 PRO n 
1 122 PHE n 
1 123 ARG n 
1 124 ARG n 
1 125 MET n 
1 126 HIS n 
1 127 VAL n 
1 128 LYS n 
1 129 GLY n 
1 130 GLY n 
1 131 LEU n 
1 132 ASN n 
1 133 LEU n 
1 134 ALA n 
1 135 PRO n 
1 136 ASP n 
1 137 GLY n 
1 138 TYR n 
1 139 GLY n 
1 140 TRP n 
1 141 ALA n 
1 142 SER n 
1 143 GLY n 
1 144 GLY n 
1 145 TYR n 
1 146 ILE n 
1 147 ALA n 
1 148 ASP n 
1 149 SER n 
1 150 LYS n 
1 151 ILE n 
1 152 ASP n 
1 153 GLY n 
1 154 GLU n 
1 155 VAL n 
1 156 GLY n 
1 157 PRO n 
1 158 TYR n 
1 159 SER n 
1 160 GLN n 
1 161 GLN n 
1 162 GLN n 
1 163 TRP n 
1 164 TYR n 
1 165 THR n 
1 166 ARG n 
1 167 ASP n 
1 168 SER n 
1 169 SER n 
1 170 VAL n 
1 171 GLY n 
1 172 GLY n 
1 173 TRP n 
1 174 GLY n 
1 175 ASN n 
1 176 GLY n 
1 177 VAL n 
1 178 TRP n 
1 179 ASN n 
1 180 MET n 
1 181 THR n 
1 182 PHE n 
1 183 SER n 
1 184 GLY n 
1 185 VAL n 
1 186 GLU n 
1 187 GLY n 
1 188 ALA n 
1 189 PRO n 
1 190 ALA n 
1 191 GLN n 
1 192 SER n 
1 193 PHE n 
1 194 PRO n 
1 195 GLU n 
1 196 PRO n 
1 197 PRO n 
1 198 TYR n 
1 199 THR n 
1 200 THR n 
1 201 LEU n 
1 202 GLU n 
1 203 THR n 
1 204 THR n 
1 205 PRO n 
1 206 VAL n 
1 207 SER n 
1 208 ARG n 
1 209 GLU n 
1 210 LYS n 
1 211 PRO n 
1 212 PHE n 
1 213 LEU n 
1 214 TYR n 
1 215 LEU n 
1 216 ASP n 
1 217 GLY n 
1 218 ASP n 
1 219 ASP n 
1 220 TYR n 
1 221 LYS n 
1 222 VAL n 
1 223 PHE n 
1 224 VAL n 
1 225 PRO n 
1 226 ALA n 
1 227 LYS n 
1 228 ARG n 
1 229 THR n 
1 230 ASN n 
1 231 ALA n 
1 232 ARG n 
1 233 GLY n 
1 234 THR n 
1 235 SER n 
1 236 TRP n 
1 237 GLY n 
1 238 ASN n 
1 239 GLY n 
1 240 THR n 
1 241 PRO n 
1 242 GLU n 
1 243 GLY n 
1 244 GLU n 
1 245 SER n 
1 246 LEU n 
1 247 PRO n 
1 248 LEU n 
1 249 ASP n 
1 250 GLN n 
1 251 PHE n 
1 252 TYR n 
1 253 VAL n 
1 254 VAL n 
1 255 LYS n 
1 256 PRO n 
1 257 GLY n 
1 258 ALA n 
1 259 THR n 
1 260 ALA n 
1 261 GLU n 
1 262 THR n 
1 263 ILE n 
1 264 ASN n 
1 265 ALA n 
1 266 ALA n 
1 267 VAL n 
1 268 ASP n 
1 269 GLN n 
1 270 GLY n 
1 271 LEU n 
1 272 HIS n 
1 273 LEU n 
1 274 LEU n 
1 275 PHE n 
1 276 THR n 
1 277 PRO n 
1 278 GLY n 
1 279 VAL n 
1 280 TYR n 
1 281 HIS n 
1 282 VAL n 
1 283 ASP n 
1 284 GLN n 
1 285 PRO n 
1 286 ILE n 
1 287 GLU n 
1 288 ILE n 
1 289 ASP n 
1 290 ARG n 
1 291 ALA n 
1 292 ASN n 
1 293 THR n 
1 294 VAL n 
1 295 ALA n 
1 296 LEU n 
1 297 GLY n 
1 298 LEU n 
1 299 GLY n 
1 300 LEU n 
1 301 ALA n 
1 302 THR n 
1 303 ILE n 
1 304 ILE n 
1 305 PRO n 
1 306 ASP n 
1 307 ASN n 
1 308 GLY n 
1 309 VAL n 
1 310 THR n 
1 311 ALA n 
1 312 LEU n 
1 313 LYS n 
1 314 VAL n 
1 315 GLY n 
1 316 ASP n 
1 317 VAL n 
1 318 ASP n 
1 319 GLY n 
1 320 VAL n 
1 321 LYS n 
1 322 VAL n 
1 323 ALA n 
1 324 GLY n 
1 325 LEU n 
1 326 LEU n 
1 327 VAL n 
1 328 ASP n 
1 329 ALA n 
1 330 GLY n 
1 331 PRO n 
1 332 VAL n 
1 333 ASN n 
1 334 SER n 
1 335 GLU n 
1 336 THR n 
1 337 LEU n 
1 338 VAL n 
1 339 GLU n 
1 340 VAL n 
1 341 GLY n 
1 342 SER n 
1 343 ASP n 
1 344 GLY n 
1 345 ALA n 
1 346 SER n 
1 347 GLY n 
1 348 ASP n 
1 349 HIS n 
1 350 ALA n 
1 351 ALA n 
1 352 ASN n 
1 353 PRO n 
1 354 THR n 
1 355 SER n 
1 356 LEU n 
1 357 GLN n 
1 358 ASP n 
1 359 VAL n 
1 360 PHE n 
1 361 VAL n 
1 362 ARG n 
1 363 ILE n 
1 364 GLY n 
1 365 GLY n 
1 366 ALA n 
1 367 GLY n 
1 368 PRO n 
1 369 GLY n 
1 370 LYS n 
1 371 ALA n 
1 372 THR n 
1 373 THR n 
1 374 SER n 
1 375 ILE n 
1 376 VAL n 
1 377 VAL n 
1 378 ASN n 
1 379 SER n 
1 380 ASN n 
1 381 ASP n 
1 382 THR n 
1 383 ILE n 
1 384 ILE n 
1 385 ASP n 
1 386 HIS n 
1 387 THR n 
1 388 TRP n 
1 389 VAL n 
1 390 TRP n 
1 391 ARG n 
1 392 ALA n 
1 393 ASP n 
1 394 HIS n 
1 395 GLY n 
1 396 GLU n 
1 397 GLY n 
1 398 VAL n 
1 399 GLY n 
1 400 TRP n 
1 401 GLU n 
1 402 THR n 
1 403 ASN n 
1 404 ARG n 
1 405 ALA n 
1 406 ASP n 
1 407 TYR n 
1 408 GLY n 
1 409 VAL n 
1 410 HIS n 
1 411 VAL n 
1 412 LYS n 
1 413 GLY n 
1 414 ASP n 
1 415 ASN n 
1 416 VAL n 
1 417 LEU n 
1 418 ALA n 
1 419 THR n 
1 420 GLY n 
1 421 LEU n 
1 422 PHE n 
1 423 VAL n 
1 424 GLU n 
1 425 HIS n 
1 426 PHE n 
1 427 ASN n 
1 428 LYS n 
1 429 TYR n 
1 430 ASP n 
1 431 VAL n 
1 432 GLN n 
1 433 TRP n 
1 434 SER n 
1 435 GLY n 
1 436 GLU n 
1 437 ASN n 
1 438 GLY n 
1 439 LYS n 
1 440 THR n 
1 441 ILE n 
1 442 PHE n 
1 443 TYR n 
1 444 GLN n 
1 445 ASN n 
1 446 ALA n 
1 447 LYS n 
1 448 ALA n 
1 449 TYR n 
1 450 ASP n 
1 451 ALA n 
1 452 PRO n 
1 453 ASP n 
1 454 GLN n 
1 455 ALA n 
1 456 ALA n 
1 457 ILE n 
1 458 GLN n 
1 459 ASN n 
1 460 GLY n 
1 461 ASP n 
1 462 ILE n 
1 463 LYS n 
1 464 GLY n 
1 465 TYR n 
1 466 ALA n 
1 467 ALA n 
1 468 TYR n 
1 469 LYS n 
1 470 VAL n 
1 471 ASP n 
1 472 ASP n 
1 473 SER n 
1 474 VAL n 
1 475 THR n 
1 476 THR n 
1 477 HIS n 
1 478 GLU n 
1 479 GLY n 
1 480 TRP n 
1 481 GLY n 
1 482 MET n 
1 483 GLY n 
1 484 SER n 
1 485 TYR n 
1 486 CYS n 
1 487 TYR n 
1 488 PHE n 
1 489 ASN n 
1 490 VAL n 
1 491 ASN n 
1 492 PRO n 
1 493 ASP n 
1 494 ILE n 
1 495 ARG n 
1 496 GLN n 
1 497 GLN n 
1 498 HIS n 
1 499 GLY n 
1 500 PHE n 
1 501 GLN n 
1 502 ALA n 
1 503 PRO n 
1 504 VAL n 
1 505 LYS n 
1 506 PRO n 
1 507 GLY n 
1 508 VAL n 
1 509 LYS n 
1 510 PHE n 
1 511 HIS n 
1 512 ASP n 
1 513 LEU n 
1 514 LEU n 
1 515 VAL n 
1 516 VAL n 
1 517 SER n 
1 518 LEU n 
1 519 GLY n 
1 520 GLY n 
1 521 LYS n 
1 522 GLY n 
1 523 GLN n 
1 524 TYR n 
1 525 GLU n 
1 526 HIS n 
1 527 VAL n 
1 528 ILE n 
1 529 ASN n 
1 530 ASP n 
1 531 ILE n 
1 532 GLY n 
1 533 ASP n 
1 534 PRO n 
1 535 THR n 
1 536 SER n 
1 537 GLY n 
1 538 ASP n 
1 539 THR n 
1 540 THR n 
1 541 ILE n 
1 542 PRO n 
1 543 SER n 
1 544 GLN n 
1 545 VAL n 
1 546 VAL n 
1 547 SER n 
1 548 PHE n 
1 549 PRO n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   549 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 SACTE_4363 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Streptomyces sp. SirexAA-E' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     862751 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PVP67K 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.db_code                    G2NFJ9_9ACTO 
_struct_ref.db_name                    UNP 
_struct_ref.details                    ? 
_struct_ref.entity_id                  1 
_struct_ref.id                         1 
_struct_ref.seq_align                  ? 
_struct_ref.seq_dif                    ? 
_struct_ref.pdbx_db_accession          G2NFJ9 
_struct_ref.pdbx_seq_one_letter_code   
;EVVGGGDLGPNVLVFDPSTPDIQGKVDEVFRKQESNQFGTDRYALMFKPGTYNDINAQIGFYTSIAGLGLNPDDTTFNGD
VTVDAGWFDGNATQNFWRSAENLALNPVNGTNRWAVSQAAPFRRMHVKGGLNLAPDGYGWASGGYIADSKIDGEVGPYSQ
QQWYTRDSSVGGWGNGVWNMTFSGVEGAPAQSFPEPPYTTLETTPVSREKPFLYLDGDDYKVFVPAKRTNARGTSWGNGT
PEGESLPLDQFYVVKPGATAETINAAVDQGLHLLFTPGVYHVDQPIEIDRANTVALGLGLATIIPDNGVTALKVGDVDGV
KVAGLLVDAGPVNSETLVEVGSDGASGDHAANPTSLQDVFVRIGGAGPGKATTSIVVNSNDTIIDHTWVWRADHGEGVGW
ETNRADYGVHVKGDNVLATGLFVEHFNKYDVQWSGENGKTIFYQNEKAYDAPDQAAIQNGDIKGYAAYKVDDSVTTHEGW
GMGSYCYFNVNPDIRQQHGFQAPVKPGVKFHDLLVVSLGGKGQYEHVINDIGDPTSGDTTIPSQVVSFP
;
_struct_ref.pdbx_align_begin           57 
_struct_ref.pdbx_align_end             ? 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              4TZ1 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 549 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             G2NFJ9 
_struct_ref_seq.db_align_beg                  57 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  605 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       57 
_struct_ref_seq.pdbx_auth_seq_align_end       605 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             4TZ1 
_struct_ref_seq_dif.mon_id                       ALA 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      446 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   G2NFJ9 
_struct_ref_seq_dif.db_mon_id                    GLU 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          502 
_struct_ref_seq_dif.details                      'engineered mutation' 
_struct_ref_seq_dif.pdbx_auth_seq_num            502 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE              ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE             ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE           ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'      ? 'C4 H7 N O4'     133.103 
BGC 'D-saccharide, beta linking' . beta-D-glucopyranose ? 'C6 H12 O6'      180.156 
CYS 'L-peptide linking'          y CYSTEINE             ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'          y GLUTAMINE            ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'      ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE              ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE            ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                  . WATER                ? 'H2 O'           18.015  
ILE 'L-peptide linking'          y ISOLEUCINE           ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE              ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE               ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE           ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking'          y PHENYLALANINE        ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE              ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE               ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'          y THREONINE            ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN           ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE             ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE               ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4TZ1 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.22 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         44.54 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
;Protein Solution (20 mg/ml protein, 0.05 M NaCl, and 0.010 M MOPS pH 7) mixed in a 1:1 ratio with the Well Solution (20% PEG 3350, 75mM NaCH02, and 100mM BTP pH 6.0). Cryoprotected with 20% PEG 3350, 75mM NaCH02, 25mM laminaritriose, 100mM BTP pH 6.0 and 15% ethylene glycol
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      'mirrors and beryllium lenses' 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'MARMOSAIC 300 mm CCD' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2013-08-08 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'C(111)' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97857 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 21-ID-G' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97857 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   21-ID-G 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         4TZ1 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.400 
_reflns.d_resolution_low                 50.000 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       100816 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             100.000 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.900 
_reflns.pdbx_Rmerge_I_obs                0.065 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         17.333 
_reflns.pdbx_netI_over_sigmaI            9.500 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 0.939 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         395273 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
1.400 1.420  ? ? ? ? ? 5039 ? 99.900  ? ? ? ? 0.481 ? ? ? ? ? ? ? ? 3.300 ? 0.628 ? ? ? ? 0 1  1 ? ? 
1.420 1.450  ? ? ? ? ? 4993 ? 100.000 ? ? ? ? 0.425 ? ? ? ? ? ? ? ? 3.600 ? 0.657 ? ? ? ? 0 2  1 ? ? 
1.450 1.480  ? ? ? ? ? 5032 ? 100.000 ? ? ? ? 0.365 ? ? ? ? ? ? ? ? 3.900 ? 0.703 ? ? ? ? 0 3  1 ? ? 
1.480 1.510  ? ? ? ? ? 5051 ? 100.000 ? ? ? ? 0.326 ? ? ? ? ? ? ? ? 3.900 ? 0.756 ? ? ? ? 0 4  1 ? ? 
1.510 1.540  ? ? ? ? ? 5024 ? 100.000 ? ? ? ? 0.280 ? ? ? ? ? ? ? ? 3.900 ? 0.818 ? ? ? ? 0 5  1 ? ? 
1.540 1.580  ? ? ? ? ? 4995 ? 100.000 ? ? ? ? 0.249 ? ? ? ? ? ? ? ? 3.900 ? 0.885 ? ? ? ? 0 6  1 ? ? 
1.580 1.620  ? ? ? ? ? 5033 ? 100.000 ? ? ? ? 0.223 ? ? ? ? ? ? ? ? 3.900 ? 0.910 ? ? ? ? 0 7  1 ? ? 
1.620 1.660  ? ? ? ? ? 5060 ? 100.000 ? ? ? ? 0.204 ? ? ? ? ? ? ? ? 4.000 ? 0.996 ? ? ? ? 0 8  1 ? ? 
1.660 1.710  ? ? ? ? ? 4978 ? 100.000 ? ? ? ? 0.182 ? ? ? ? ? ? ? ? 4.000 ? 1.004 ? ? ? ? 0 9  1 ? ? 
1.710 1.760  ? ? ? ? ? 5055 ? 100.000 ? ? ? ? 0.163 ? ? ? ? ? ? ? ? 4.000 ? 1.092 ? ? ? ? 0 10 1 ? ? 
1.760 1.830  ? ? ? ? ? 5043 ? 100.000 ? ? ? ? 0.142 ? ? ? ? ? ? ? ? 4.000 ? 1.191 ? ? ? ? 0 11 1 ? ? 
1.830 1.900  ? ? ? ? ? 5057 ? 100.000 ? ? ? ? 0.125 ? ? ? ? ? ? ? ? 4.000 ? 1.297 ? ? ? ? 0 12 1 ? ? 
1.900 1.990  ? ? ? ? ? 5056 ? 100.000 ? ? ? ? 0.107 ? ? ? ? ? ? ? ? 4.000 ? 1.338 ? ? ? ? 0 13 1 ? ? 
1.990 2.090  ? ? ? ? ? 5009 ? 100.000 ? ? ? ? 0.091 ? ? ? ? ? ? ? ? 4.000 ? 1.233 ? ? ? ? 0 14 1 ? ? 
2.090 2.220  ? ? ? ? ? 5049 ? 100.000 ? ? ? ? 0.079 ? ? ? ? ? ? ? ? 4.000 ? 1.139 ? ? ? ? 0 15 1 ? ? 
2.220 2.390  ? ? ? ? ? 5054 ? 100.000 ? ? ? ? 0.070 ? ? ? ? ? ? ? ? 4.000 ? 1.085 ? ? ? ? 0 16 1 ? ? 
2.390 2.630  ? ? ? ? ? 5053 ? 100.000 ? ? ? ? 0.065 ? ? ? ? ? ? ? ? 4.000 ? 1.097 ? ? ? ? 0 17 1 ? ? 
2.630 3.020  ? ? ? ? ? 5051 ? 100.000 ? ? ? ? 0.052 ? ? ? ? ? ? ? ? 4.000 ? 0.896 ? ? ? ? 0 18 1 ? ? 
3.020 3.800  ? ? ? ? ? 5078 ? 99.900  ? ? ? ? 0.037 ? ? ? ? ? ? ? ? 4.000 ? 0.561 ? ? ? ? 0 19 1 ? ? 
3.800 50.000 ? ? ? ? ? 5106 ? 99.400  ? ? ? ? 0.030 ? ? ? ? ? ? ? ? 3.900 ? 0.358 ? ? ? ? 0 20 1 ? ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                99999.000 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 4TZ1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.5000 
_refine.ls_d_res_low                             24.2260 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     81428 
_refine.ls_number_reflns_R_free                  4085 
_refine.ls_number_reflns_R_work                  77343 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.4000 
_refine.ls_percent_reflns_R_free                 5.0200 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1009 
_refine.ls_R_factor_R_free                       0.1236 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.0997 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.360 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4PEW 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 10.3500 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.0600 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       1.5000 
_refine_hist.d_res_low                        24.2260 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               4167 
_refine_hist.pdbx_number_residues_total       0 
_refine_hist.pdbx_number_atoms_protein        4167 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
'X-RAY DIFFRACTION' 1.5000 1.5177  2500 . 114 2386 89.0000  . . . 0.1715 . 0.1201 . . . . . . 29 . 
'X-RAY DIFFRACTION' 1.5177 1.5362  2693 . 153 2540 96.0000  . . . 0.1641 . 0.1109 . . . . . . 29 . 
'X-RAY DIFFRACTION' 1.5362 1.5556  2764 . 129 2635 99.0000  . . . 0.1428 . 0.1059 . . . . . . 29 . 
'X-RAY DIFFRACTION' 1.5556 1.5761  2794 . 151 2643 100.0000 . . . 0.1340 . 0.1016 . . . . . . 29 . 
'X-RAY DIFFRACTION' 1.5761 1.5977  2836 . 139 2697 100.0000 . . . 0.1399 . 0.0979 . . . . . . 29 . 
'X-RAY DIFFRACTION' 1.5977 1.6205  2812 . 132 2680 100.0000 . . . 0.1277 . 0.0999 . . . . . . 29 . 
'X-RAY DIFFRACTION' 1.6205 1.6447  2817 . 144 2673 100.0000 . . . 0.1605 . 0.0972 . . . . . . 29 . 
'X-RAY DIFFRACTION' 1.6447 1.6703  2816 . 143 2673 100.0000 . . . 0.1467 . 0.0927 . . . . . . 29 . 
'X-RAY DIFFRACTION' 1.6703 1.6977  2845 . 150 2695 100.0000 . . . 0.1309 . 0.0924 . . . . . . 29 . 
'X-RAY DIFFRACTION' 1.6977 1.7270  2800 . 126 2674 100.0000 . . . 0.1292 . 0.0859 . . . . . . 29 . 
'X-RAY DIFFRACTION' 1.7270 1.7584  2783 . 134 2649 100.0000 . . . 0.1384 . 0.0885 . . . . . . 29 . 
'X-RAY DIFFRACTION' 1.7584 1.7922  2863 . 162 2701 100.0000 . . . 0.1352 . 0.0837 . . . . . . 29 . 
'X-RAY DIFFRACTION' 1.7922 1.8288  2814 . 141 2673 100.0000 . . . 0.1152 . 0.0827 . . . . . . 29 . 
'X-RAY DIFFRACTION' 1.8288 1.8685  2808 . 132 2676 100.0000 . . . 0.1244 . 0.0831 . . . . . . 29 . 
'X-RAY DIFFRACTION' 1.8685 1.9120  2827 . 140 2687 100.0000 . . . 0.1258 . 0.0811 . . . . . . 29 . 
'X-RAY DIFFRACTION' 1.9120 1.9598  2825 . 140 2685 100.0000 . . . 0.1101 . 0.0791 . . . . . . 29 . 
'X-RAY DIFFRACTION' 1.9598 2.0127  2807 . 147 2660 100.0000 . . . 0.1157 . 0.0824 . . . . . . 29 . 
'X-RAY DIFFRACTION' 2.0127 2.0719  2868 . 143 2725 100.0000 . . . 0.1142 . 0.0887 . . . . . . 29 . 
'X-RAY DIFFRACTION' 2.0719 2.1388  2791 . 144 2647 100.0000 . . . 0.1276 . 0.0872 . . . . . . 29 . 
'X-RAY DIFFRACTION' 2.1388 2.2151  2797 . 139 2658 100.0000 . . . 0.1093 . 0.0870 . . . . . . 29 . 
'X-RAY DIFFRACTION' 2.2151 2.3038  2845 . 136 2709 100.0000 . . . 0.1293 . 0.0925 . . . . . . 29 . 
'X-RAY DIFFRACTION' 2.3038 2.4085  2807 . 142 2665 100.0000 . . . 0.1095 . 0.0911 . . . . . . 29 . 
'X-RAY DIFFRACTION' 2.4085 2.5354  2856 . 138 2718 100.0000 . . . 0.1225 . 0.0942 . . . . . . 29 . 
'X-RAY DIFFRACTION' 2.5354 2.6940  2832 . 152 2680 100.0000 . . . 0.1180 . 0.0985 . . . . . . 29 . 
'X-RAY DIFFRACTION' 2.6940 2.9017  2839 . 143 2696 100.0000 . . . 0.1265 . 0.1021 . . . . . . 29 . 
'X-RAY DIFFRACTION' 2.9017 3.1932  2823 . 142 2681 100.0000 . . . 0.1241 . 0.1112 . . . . . . 29 . 
'X-RAY DIFFRACTION' 3.1932 3.6539  2822 . 143 2679 100.0000 . . . 0.1290 . 0.1092 . . . . . . 29 . 
'X-RAY DIFFRACTION' 3.6539 4.5983  2870 . 144 2726 100.0000 . . . 0.1005 . 0.1008 . . . . . . 29 . 
'X-RAY DIFFRACTION' 4.5983 24.2292 2874 . 142 2732 100.0000 . . . 0.1329 . 0.1343 . . . . . . 29 . 
# 
_struct.entry_id                     4TZ1 
_struct.title                        
'Ensemble refinement of the E502A variant of sacteLam55A from Streptomyces sp. SirexAA-E in complex with laminaritriose' 
_struct.pdbx_descriptor              sacteLam55A 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4TZ1 
_struct_keywords.text            'exo-beta-1, 3-glucanase, beta-1, GH55, laminaritriose, secreted, biomass degradation, HYDROLASE' 
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 ASP A 21  ? GLU A 34  ? ASP A 77  GLU A 90  1 ? 14 
HELX_P HELX_P2 AA2 ASN A 71  ? ASP A 73  ? ASN A 127 ASP A 129 5 ? 3  
HELX_P HELX_P3 AA3 ALA A 85  ? ASP A 89  ? ALA A 141 ASP A 145 5 ? 5  
HELX_P HELX_P4 AA4 PRO A 247 ? ASP A 249 ? PRO A 303 ASP A 305 5 ? 3  
HELX_P HELX_P5 AA5 THR A 259 ? GLY A 270 ? THR A 315 GLY A 326 1 ? 12 
HELX_P HELX_P6 AA6 GLN A 454 ? ALA A 456 ? GLN A 510 ALA A 512 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1 covale one ? B BGC . O3 ? ? ? 1_555 B BGC . C1 ? ? B BGC 1 B BGC 2 1_555 ? ? ? ? ? ? ? 1.432 ? ? 
covale2 covale one ? B BGC . O3 ? ? ? 1_555 B BGC . C1 ? ? B BGC 2 B BGC 3 1_555 ? ? ? ? ? ? ? 1.419 ? ? 
covale3 covale one ? C BGC . O3 ? ? ? 1_555 C BGC . C1 ? ? C BGC 1 C BGC 2 1_555 ? ? ? ? ? ? ? 1.435 ? ? 
covale4 covale one ? C BGC . O3 ? ? ? 1_555 C BGC . C1 ? ? C BGC 2 C BGC 3 1_555 ? ? ? ? ? ? ? 1.405 ? ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1   GLY 143 A . ? GLY 199 A GLY 144 A ? GLY 200 A 1  -2.35  
2   PHE 193 A . ? PHE 249 A PRO 194 A ? PRO 250 A 1  16.80  
3   GLU 195 A . ? GLU 251 A PRO 196 A ? PRO 252 A 1  -5.55  
4   PHE 548 A . ? PHE 604 A PRO 549 A ? PRO 605 A 1  2.43   
5   GLY 143 A . ? GLY 199 A GLY 144 A ? GLY 200 A 2  3.52   
6   PHE 193 A . ? PHE 249 A PRO 194 A ? PRO 250 A 2  18.09  
7   GLU 195 A . ? GLU 251 A PRO 196 A ? PRO 252 A 2  -12.66 
8   PHE 548 A . ? PHE 604 A PRO 549 A ? PRO 605 A 2  3.47   
9   GLY 143 A . ? GLY 199 A GLY 144 A ? GLY 200 A 3  -9.38  
10  PHE 193 A . ? PHE 249 A PRO 194 A ? PRO 250 A 3  18.48  
11  GLU 195 A . ? GLU 251 A PRO 196 A ? PRO 252 A 3  -12.19 
12  PHE 548 A . ? PHE 604 A PRO 549 A ? PRO 605 A 3  -11.98 
13  GLY 143 A . ? GLY 199 A GLY 144 A ? GLY 200 A 4  2.75   
14  PHE 193 A . ? PHE 249 A PRO 194 A ? PRO 250 A 4  19.93  
15  GLU 195 A . ? GLU 251 A PRO 196 A ? PRO 252 A 4  -14.01 
16  PHE 548 A . ? PHE 604 A PRO 549 A ? PRO 605 A 4  24.64  
17  GLY 143 A . ? GLY 199 A GLY 144 A ? GLY 200 A 5  -4.77  
18  PHE 193 A . ? PHE 249 A PRO 194 A ? PRO 250 A 5  14.38  
19  GLU 195 A . ? GLU 251 A PRO 196 A ? PRO 252 A 5  -18.44 
20  PHE 548 A . ? PHE 604 A PRO 549 A ? PRO 605 A 5  7.10   
21  GLY 143 A . ? GLY 199 A GLY 144 A ? GLY 200 A 6  -10.40 
22  PHE 193 A . ? PHE 249 A PRO 194 A ? PRO 250 A 6  16.69  
23  GLU 195 A . ? GLU 251 A PRO 196 A ? PRO 252 A 6  -8.01  
24  PHE 548 A . ? PHE 604 A PRO 549 A ? PRO 605 A 6  6.06   
25  GLY 143 A . ? GLY 199 A GLY 144 A ? GLY 200 A 7  -4.28  
26  PHE 193 A . ? PHE 249 A PRO 194 A ? PRO 250 A 7  8.77   
27  GLU 195 A . ? GLU 251 A PRO 196 A ? PRO 252 A 7  -14.71 
28  PHE 548 A . ? PHE 604 A PRO 549 A ? PRO 605 A 7  -13.32 
29  GLY 143 A . ? GLY 199 A GLY 144 A ? GLY 200 A 8  -0.95  
30  PHE 193 A . ? PHE 249 A PRO 194 A ? PRO 250 A 8  7.56   
31  GLU 195 A . ? GLU 251 A PRO 196 A ? PRO 252 A 8  -12.85 
32  PHE 548 A . ? PHE 604 A PRO 549 A ? PRO 605 A 8  -11.69 
33  GLY 143 A . ? GLY 199 A GLY 144 A ? GLY 200 A 9  -7.73  
34  PHE 193 A . ? PHE 249 A PRO 194 A ? PRO 250 A 9  5.25   
35  GLU 195 A . ? GLU 251 A PRO 196 A ? PRO 252 A 9  -23.80 
36  PHE 548 A . ? PHE 604 A PRO 549 A ? PRO 605 A 9  7.40   
37  GLY 143 A . ? GLY 199 A GLY 144 A ? GLY 200 A 10 -0.48  
38  PHE 193 A . ? PHE 249 A PRO 194 A ? PRO 250 A 10 16.80  
39  GLU 195 A . ? GLU 251 A PRO 196 A ? PRO 252 A 10 -15.55 
40  PHE 548 A . ? PHE 604 A PRO 549 A ? PRO 605 A 10 -5.08  
41  GLY 143 A . ? GLY 199 A GLY 144 A ? GLY 200 A 11 0.31   
42  PHE 193 A . ? PHE 249 A PRO 194 A ? PRO 250 A 11 19.28  
43  GLU 195 A . ? GLU 251 A PRO 196 A ? PRO 252 A 11 -15.35 
44  PHE 548 A . ? PHE 604 A PRO 549 A ? PRO 605 A 11 5.37   
45  GLY 143 A . ? GLY 199 A GLY 144 A ? GLY 200 A 12 4.89   
46  PHE 193 A . ? PHE 249 A PRO 194 A ? PRO 250 A 12 13.63  
47  GLU 195 A . ? GLU 251 A PRO 196 A ? PRO 252 A 12 -12.25 
48  PHE 548 A . ? PHE 604 A PRO 549 A ? PRO 605 A 12 14.27  
49  GLY 143 A . ? GLY 199 A GLY 144 A ? GLY 200 A 13 5.29   
50  PHE 193 A . ? PHE 249 A PRO 194 A ? PRO 250 A 13 19.24  
51  GLU 195 A . ? GLU 251 A PRO 196 A ? PRO 252 A 13 -10.45 
52  PHE 548 A . ? PHE 604 A PRO 549 A ? PRO 605 A 13 9.64   
53  GLY 143 A . ? GLY 199 A GLY 144 A ? GLY 200 A 14 6.10   
54  PHE 193 A . ? PHE 249 A PRO 194 A ? PRO 250 A 14 16.12  
55  GLU 195 A . ? GLU 251 A PRO 196 A ? PRO 252 A 14 -12.52 
56  PHE 548 A . ? PHE 604 A PRO 549 A ? PRO 605 A 14 -6.94  
57  GLY 143 A . ? GLY 199 A GLY 144 A ? GLY 200 A 15 2.66   
58  PHE 193 A . ? PHE 249 A PRO 194 A ? PRO 250 A 15 11.62  
59  GLU 195 A . ? GLU 251 A PRO 196 A ? PRO 252 A 15 -11.52 
60  PHE 548 A . ? PHE 604 A PRO 549 A ? PRO 605 A 15 15.33  
61  GLY 143 A . ? GLY 199 A GLY 144 A ? GLY 200 A 16 -6.54  
62  PHE 193 A . ? PHE 249 A PRO 194 A ? PRO 250 A 16 11.05  
63  GLU 195 A . ? GLU 251 A PRO 196 A ? PRO 252 A 16 -14.73 
64  PHE 548 A . ? PHE 604 A PRO 549 A ? PRO 605 A 16 -19.36 
65  GLY 143 A . ? GLY 199 A GLY 144 A ? GLY 200 A 17 0.71   
66  PHE 193 A . ? PHE 249 A PRO 194 A ? PRO 250 A 17 9.56   
67  GLU 195 A . ? GLU 251 A PRO 196 A ? PRO 252 A 17 -13.17 
68  PHE 548 A . ? PHE 604 A PRO 549 A ? PRO 605 A 17 6.71   
69  GLY 143 A . ? GLY 199 A GLY 144 A ? GLY 200 A 18 4.42   
70  PHE 193 A . ? PHE 249 A PRO 194 A ? PRO 250 A 18 12.54  
71  GLU 195 A . ? GLU 251 A PRO 196 A ? PRO 252 A 18 -13.53 
72  PHE 548 A . ? PHE 604 A PRO 549 A ? PRO 605 A 18 -11.91 
73  GLY 143 A . ? GLY 199 A GLY 144 A ? GLY 200 A 19 -6.55  
74  PHE 193 A . ? PHE 249 A PRO 194 A ? PRO 250 A 19 22.79  
75  GLU 195 A . ? GLU 251 A PRO 196 A ? PRO 252 A 19 -14.19 
76  PHE 548 A . ? PHE 604 A PRO 549 A ? PRO 605 A 19 8.32   
77  GLY 143 A . ? GLY 199 A GLY 144 A ? GLY 200 A 20 -5.71  
78  PHE 193 A . ? PHE 249 A PRO 194 A ? PRO 250 A 20 8.07   
79  GLU 195 A . ? GLU 251 A PRO 196 A ? PRO 252 A 20 -13.30 
80  PHE 548 A . ? PHE 604 A PRO 549 A ? PRO 605 A 20 7.70   
81  GLY 143 A . ? GLY 199 A GLY 144 A ? GLY 200 A 21 -2.60  
82  PHE 193 A . ? PHE 249 A PRO 194 A ? PRO 250 A 21 12.84  
83  GLU 195 A . ? GLU 251 A PRO 196 A ? PRO 252 A 21 -18.85 
84  PHE 548 A . ? PHE 604 A PRO 549 A ? PRO 605 A 21 -6.68  
85  GLY 143 A . ? GLY 199 A GLY 144 A ? GLY 200 A 22 -0.18  
86  PHE 193 A . ? PHE 249 A PRO 194 A ? PRO 250 A 22 12.43  
87  GLU 195 A . ? GLU 251 A PRO 196 A ? PRO 252 A 22 -18.51 
88  PHE 548 A . ? PHE 604 A PRO 549 A ? PRO 605 A 22 2.20   
89  GLY 143 A . ? GLY 199 A GLY 144 A ? GLY 200 A 23 3.65   
90  PHE 193 A . ? PHE 249 A PRO 194 A ? PRO 250 A 23 9.77   
91  GLU 195 A . ? GLU 251 A PRO 196 A ? PRO 252 A 23 -13.93 
92  PHE 548 A . ? PHE 604 A PRO 549 A ? PRO 605 A 23 -2.04  
93  GLY 143 A . ? GLY 199 A GLY 144 A ? GLY 200 A 24 3.55   
94  PHE 193 A . ? PHE 249 A PRO 194 A ? PRO 250 A 24 12.70  
95  GLU 195 A . ? GLU 251 A PRO 196 A ? PRO 252 A 24 -13.17 
96  PHE 548 A . ? PHE 604 A PRO 549 A ? PRO 605 A 24 -3.88  
97  GLY 143 A . ? GLY 199 A GLY 144 A ? GLY 200 A 25 0.29   
98  PHE 193 A . ? PHE 249 A PRO 194 A ? PRO 250 A 25 15.35  
99  GLU 195 A . ? GLU 251 A PRO 196 A ? PRO 252 A 25 -20.00 
100 PHE 548 A . ? PHE 604 A PRO 549 A ? PRO 605 A 25 5.91   
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 10 ? 
AA2 ? 8  ? 
AA3 ? 2  ? 
AA4 ? 3  ? 
AA5 ? 6  ? 
AA6 ? 11 ? 
AA7 ? 8  ? 
AA8 ? 2  ? 
AA9 ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1  2  ? parallel      
AA1 2  3  ? parallel      
AA1 3  4  ? parallel      
AA1 4  5  ? parallel      
AA1 5  6  ? parallel      
AA1 6  7  ? parallel      
AA1 7  8  ? parallel      
AA1 8  9  ? parallel      
AA1 9  10 ? parallel      
AA2 1  2  ? parallel      
AA2 2  3  ? parallel      
AA2 3  4  ? parallel      
AA2 4  5  ? parallel      
AA2 5  6  ? parallel      
AA2 6  7  ? parallel      
AA2 7  8  ? parallel      
AA3 1  2  ? anti-parallel 
AA4 1  2  ? anti-parallel 
AA4 2  3  ? anti-parallel 
AA5 1  2  ? parallel      
AA5 2  3  ? parallel      
AA5 3  4  ? parallel      
AA5 4  5  ? parallel      
AA5 5  6  ? parallel      
AA6 1  2  ? parallel      
AA6 2  3  ? parallel      
AA6 3  4  ? parallel      
AA6 4  5  ? parallel      
AA6 5  6  ? parallel      
AA6 6  7  ? parallel      
AA6 7  8  ? parallel      
AA6 8  9  ? parallel      
AA6 9  10 ? parallel      
AA6 10 11 ? anti-parallel 
AA7 1  2  ? parallel      
AA7 2  3  ? parallel      
AA7 3  4  ? parallel      
AA7 4  5  ? parallel      
AA7 5  6  ? parallel      
AA7 6  7  ? parallel      
AA7 7  8  ? parallel      
AA8 1  2  ? anti-parallel 
AA9 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  VAL A 12  ? PHE A 15  ? VAL A 68  PHE A 71  
AA1 2  TYR A 43  ? PHE A 47  ? TYR A 99  PHE A 103 
AA1 3  THR A 63  ? GLY A 67  ? THR A 119 GLY A 123 
AA1 4  ARG A 98  ? GLU A 101 ? ARG A 154 GLU A 157 
AA1 5  PHE A 122 ? ARG A 123 ? PHE A 178 ARG A 179 
AA1 6  TYR A 145 ? ALA A 147 ? TYR A 201 ALA A 203 
AA1 7  GLN A 162 ? TRP A 173 ? GLN A 218 TRP A 229 
AA1 8  LYS A 150 ? GLY A 156 ? LYS A 206 GLY A 212 
AA1 9  GLY A 130 ? ASN A 132 ? GLY A 186 ASN A 188 
AA1 10 THR A 111 ? ARG A 113 ? THR A 167 ARG A 169 
AA2 1  GLY A 50  ? GLN A 58  ? GLY A 106 GLN A 114 
AA2 2  THR A 75  ? THR A 82  ? THR A 131 THR A 138 
AA2 3  ALA A 104 ? ASN A 106 ? ALA A 160 ASN A 162 
AA2 4  HIS A 126 ? VAL A 127 ? HIS A 182 VAL A 183 
AA2 5  LYS A 150 ? GLY A 156 ? LYS A 206 GLY A 212 
AA2 6  GLN A 162 ? TRP A 173 ? GLN A 218 TRP A 229 
AA2 7  ASN A 179 ? GLU A 186 ? ASN A 235 GLU A 242 
AA2 8  TYR A 198 ? LEU A 201 ? TYR A 254 LEU A 257 
AA3 1  THR A 204 ? SER A 207 ? THR A 260 SER A 263 
AA3 2  ARG A 228 ? ALA A 231 ? ARG A 284 ALA A 287 
AA4 1  PHE A 212 ? ASP A 216 ? PHE A 268 ASP A 272 
AA4 2  ASP A 219 ? PRO A 225 ? ASP A 275 PRO A 281 
AA4 3  GLY A 243 ? GLU A 244 ? GLY A 299 GLU A 300 
AA5 1  PHE A 251 ? VAL A 254 ? PHE A 307 VAL A 310 
AA5 2  HIS A 272 ? PHE A 275 ? HIS A 328 PHE A 331 
AA5 3  VAL A 294 ? GLY A 297 ? VAL A 350 GLY A 353 
AA5 4  LYS A 321 ? ASP A 328 ? LYS A 377 ASP A 384 
AA5 5  THR A 302 ? PRO A 305 ? THR A 358 PRO A 361 
AA5 6  VAL A 279 ? VAL A 282 ? VAL A 335 VAL A 338 
AA6 1  PHE A 251 ? VAL A 254 ? PHE A 307 VAL A 310 
AA6 2  HIS A 272 ? PHE A 275 ? HIS A 328 PHE A 331 
AA6 3  VAL A 294 ? GLY A 297 ? VAL A 350 GLY A 353 
AA6 4  LYS A 321 ? ASP A 328 ? LYS A 377 ASP A 384 
AA6 5  SER A 355 ? ILE A 363 ? SER A 411 ILE A 419 
AA6 6  ILE A 383 ? ARG A 391 ? ILE A 439 ARG A 447 
AA6 7  LEU A 417 ? GLU A 424 ? LEU A 473 GLU A 480 
AA6 8  GLY A 438 ? ALA A 446 ? GLY A 494 ALA A 502 
AA6 9  HIS A 477 ? CYS A 486 ? HIS A 533 CYS A 542 
AA6 10 VAL A 508 ? SER A 517 ? VAL A 564 SER A 573 
AA6 11 SER A 543 ? PHE A 548 ? SER A 599 PHE A 604 
AA7 1  ILE A 286 ? ILE A 288 ? ILE A 342 ILE A 344 
AA7 2  LEU A 312 ? VAL A 314 ? LEU A 368 VAL A 370 
AA7 3  SER A 334 ? VAL A 340 ? SER A 390 VAL A 396 
AA7 4  ALA A 371 ? VAL A 377 ? ALA A 427 VAL A 433 
AA7 5  TYR A 407 ? VAL A 411 ? TYR A 463 VAL A 467 
AA7 6  VAL A 431 ? TRP A 433 ? VAL A 487 TRP A 489 
AA7 7  TYR A 468 ? VAL A 470 ? TYR A 524 VAL A 526 
AA7 8  PHE A 500 ? GLN A 501 ? PHE A 556 GLN A 557 
AA8 1  GLN A 458 ? ASN A 459 ? GLN A 514 ASN A 515 
AA8 2  ILE A 462 ? LYS A 463 ? ILE A 518 LYS A 519 
AA9 1  ARG A 495 ? GLN A 496 ? ARG A 551 GLN A 552 
AA9 2  GLN A 523 ? TYR A 524 ? GLN A 579 TYR A 580 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1  2  N LEU A 13  ? N LEU A 69  O ALA A 44  ? O ALA A 100 
AA1 2  3  N LEU A 45  ? N LEU A 101 O SER A 64  ? O SER A 120 
AA1 3  4  N ILE A 65  ? N ILE A 121 O SER A 99  ? O SER A 155 
AA1 4  5  N ALA A 100 ? N ALA A 156 O ARG A 123 ? O ARG A 179 
AA1 5  6  N PHE A 122 ? N PHE A 178 O ALA A 147 ? O ALA A 203 
AA1 6  7  N ILE A 146 ? N ILE A 202 O ARG A 166 ? O ARG A 222 
AA1 7  8  O SER A 169 ? O SER A 225 N ILE A 151 ? N ILE A 207 
AA1 8  9  O GLY A 156 ? O GLY A 212 N LEU A 131 ? N LEU A 187 
AA1 9  10 O ASN A 132 ? O ASN A 188 N ASN A 112 ? N ASN A 168 
AA2 1  2  N TYR A 52  ? N TYR A 108 O ASN A 78  ? O ASN A 134 
AA2 2  3  N PHE A 77  ? N PHE A 133 O ALA A 104 ? O ALA A 160 
AA2 3  4  N LEU A 105 ? N LEU A 161 O HIS A 126 ? O HIS A 182 
AA2 4  5  N VAL A 127 ? N VAL A 183 O ASP A 152 ? O ASP A 208 
AA2 5  6  N ILE A 151 ? N ILE A 207 O SER A 169 ? O SER A 225 
AA2 6  7  N TRP A 163 ? N TRP A 219 O THR A 181 ? O THR A 237 
AA2 7  8  N PHE A 182 ? N PHE A 238 O LEU A 201 ? O LEU A 257 
AA3 1  2  N SER A 207 ? N SER A 263 O ARG A 228 ? O ARG A 284 
AA4 1  2  N PHE A 212 ? N PHE A 268 O PHE A 223 ? O PHE A 279 
AA4 2  3  N VAL A 224 ? N VAL A 280 O GLU A 244 ? O GLU A 300 
AA5 1  2  N TYR A 252 ? N TYR A 308 O HIS A 272 ? O HIS A 328 
AA5 2  3  N LEU A 273 ? N LEU A 329 O VAL A 294 ? O VAL A 350 
AA5 3  4  N GLY A 297 ? N GLY A 353 O ALA A 323 ? O ALA A 379 
AA5 4  5  O ASP A 328 ? O ASP A 384 N ILE A 303 ? N ILE A 359 
AA5 5  6  O THR A 302 ? O THR A 358 N TYR A 280 ? N TYR A 336 
AA6 1  2  N TYR A 252 ? N TYR A 308 O HIS A 272 ? O HIS A 328 
AA6 2  3  N LEU A 273 ? N LEU A 329 O VAL A 294 ? O VAL A 350 
AA6 3  4  N GLY A 297 ? N GLY A 353 O ALA A 323 ? O ALA A 379 
AA6 4  5  N VAL A 327 ? N VAL A 383 O PHE A 360 ? O PHE A 416 
AA6 5  6  N VAL A 361 ? N VAL A 417 O TRP A 388 ? O TRP A 444 
AA6 6  7  N ILE A 384 ? N ILE A 440 O LEU A 417 ? O LEU A 473 
AA6 7  8  N ALA A 418 ? N ALA A 474 O ILE A 441 ? O ILE A 497 
AA6 8  9  N PHE A 442 ? N PHE A 498 O TRP A 480 ? O TRP A 536 
AA6 9  10 N CYS A 486 ? N CYS A 542 O VAL A 516 ? O VAL A 572 
AA6 10 11 N LEU A 513 ? N LEU A 569 O VAL A 545 ? O VAL A 601 
AA7 1  2  N ILE A 288 ? N ILE A 344 O LYS A 313 ? O LYS A 369 
AA7 2  3  N VAL A 314 ? N VAL A 370 O GLU A 339 ? O GLU A 395 
AA7 3  4  N VAL A 340 ? N VAL A 396 O VAL A 376 ? O VAL A 432 
AA7 4  5  N VAL A 377 ? N VAL A 433 O HIS A 410 ? O HIS A 466 
AA7 5  6  N VAL A 411 ? N VAL A 467 O GLN A 432 ? O GLN A 488 
AA7 6  7  N VAL A 431 ? N VAL A 487 O LYS A 469 ? O LYS A 525 
AA7 7  8  N VAL A 470 ? N VAL A 526 O GLN A 501 ? O GLN A 557 
AA8 1  2  N ASN A 459 ? N ASN A 515 O ILE A 462 ? O ILE A 518 
AA9 1  2  N GLN A 496 ? N GLN A 552 O GLN A 523 ? O GLN A 579 
# 
_atom_sites.entry_id                    4TZ1 
_atom_sites.fract_transf_matrix[1][1]   0.020090 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.004820 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009981 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.019093 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1      N N    . GLU A 1 1   ? -10.070 -31.581 20.161  0.04 21.04 ? 57   GLU A N    1  
ATOM   2      C CA   . GLU A 1 1   ? -10.277 -30.175 19.848  0.04 20.43 ? 57   GLU A CA   1  
ATOM   3      C C    . GLU A 1 1   ? -9.122  -29.558 18.961  0.04 19.85 ? 57   GLU A C    1  
ATOM   4      O O    . GLU A 1 1   ? -8.707  -30.254 18.074  0.04 19.96 ? 57   GLU A O    1  
ATOM   5      C CB   . GLU A 1 1   ? -10.609 -29.414 21.117  0.04 20.14 ? 57   GLU A CB   1  
ATOM   6      C CG   . GLU A 1 1   ? -12.122 -29.443 21.416  0.04 20.64 ? 57   GLU A CG   1  
ATOM   7      C CD   . GLU A 1 1   ? -12.837 -28.191 20.876  0.04 20.68 ? 57   GLU A CD   1  
ATOM   8      O OE1  . GLU A 1 1   ? -12.302 -27.052 21.068  0.04 20.41 ? 57   GLU A OE1  1  
ATOM   9      O OE2  . GLU A 1 1   ? -13.918 -28.342 20.260  0.04 21.01 ? 57   GLU A OE2  1  
ATOM   10     H HA   . GLU A 1 1   ? -11.074 -30.139 19.297  0.04 20.61 ? 57   GLU A HA   1  
ATOM   11     H HB2  . GLU A 1 1   ? -10.145 -29.837 21.856  0.04 20.06 ? 57   GLU A HB2  1  
ATOM   12     H HB3  . GLU A 1 1   ? -10.331 -28.489 21.034  0.04 19.75 ? 57   GLU A HB3  1  
ATOM   13     H HG2  . GLU A 1 1   ? -12.505 -30.234 21.012  0.04 21.10 ? 57   GLU A HG2  1  
ATOM   14     H HG3  . GLU A 1 1   ? -12.247 -29.479 22.378  0.04 20.53 ? 57   GLU A HG3  1  
ATOM   15     N N    . VAL A 1 2   ? -8.596  -28.339 19.215  0.04 19.28 ? 58   VAL A N    1  
ATOM   16     C CA   . VAL A 1 2   ? -8.162  -27.373 18.142  0.04 18.73 ? 58   VAL A CA   1  
ATOM   17     C C    . VAL A 1 2   ? -7.673  -27.827 16.736  0.04 18.75 ? 58   VAL A C    1  
ATOM   18     O O    . VAL A 1 2   ? -6.981  -28.848 16.552  0.04 18.68 ? 58   VAL A O    1  
ATOM   19     C CB   . VAL A 1 2   ? -7.177  -26.195 18.660  0.04 18.16 ? 58   VAL A CB   1  
ATOM   20     C CG1  . VAL A 1 2   ? -7.463  -24.865 17.940  0.04 17.65 ? 58   VAL A CG1  1  
ATOM   21     C CG2  . VAL A 1 2   ? -7.315  -25.883 20.179  0.04 18.11 ? 58   VAL A CG2  1  
ATOM   22     H H    . VAL A 1 2   ? -8.461  -28.038 20.010  0.04 19.23 ? 58   VAL A H    1  
ATOM   23     H HA   . VAL A 1 2   ? -8.981  -26.897 17.933  0.04 18.72 ? 58   VAL A HA   1  
ATOM   24     H HB   . VAL A 1 2   ? -6.255  -26.437 18.478  0.04 18.18 ? 58   VAL A HB   1  
ATOM   25     H HG11 . VAL A 1 2   ? -6.831  -24.200 18.262  0.04 17.31 ? 58   VAL A HG11 1  
ATOM   26     H HG12 . VAL A 1 2   ? -7.359  -24.959 16.983  0.04 17.68 ? 58   VAL A HG12 1  
ATOM   27     H HG13 . VAL A 1 2   ? -8.365  -24.580 18.160  0.04 17.67 ? 58   VAL A HG13 1  
ATOM   28     H HG21 . VAL A 1 2   ? -6.789  -25.092 20.384  0.04 17.79 ? 58   VAL A HG21 1  
ATOM   29     H HG22 . VAL A 1 2   ? -8.245  -25.705 20.379  0.04 18.08 ? 58   VAL A HG22 1  
ATOM   30     H HG23 . VAL A 1 2   ? -7.012  -26.611 20.721  0.04 18.48 ? 58   VAL A HG23 1  
ATOM   31     N N    . VAL A 1 3   ? -7.998  -26.988 15.747  0.04 18.87 ? 59   VAL A N    1  
ATOM   32     C CA   . VAL A 1 3   ? -7.942  -27.355 14.339  0.04 18.95 ? 59   VAL A CA   1  
ATOM   33     C C    . VAL A 1 3   ? -7.103  -26.411 13.489  0.04 18.32 ? 59   VAL A C    1  
ATOM   34     O O    . VAL A 1 3   ? -7.475  -25.248 13.316  0.04 18.00 ? 59   VAL A O    1  
ATOM   35     C CB   . VAL A 1 3   ? -9.369  -27.304 13.795  0.04 19.37 ? 59   VAL A CB   1  
ATOM   36     C CG1  . VAL A 1 3   ? -10.120 -26.149 14.464  0.04 19.22 ? 59   VAL A CG1  1  
ATOM   37     C CG2  . VAL A 1 3   ? -9.385  -27.191 12.238  0.04 19.40 ? 59   VAL A CG2  1  
ATOM   38     H H    . VAL A 1 3   ? -8.256  -26.181 15.879  0.04 18.93 ? 59   VAL A H    1  
ATOM   39     H HA   . VAL A 1 3   ? -7.593  -28.254 14.231  0.04 19.17 ? 59   VAL A HA   1  
ATOM   40     H HB   . VAL A 1 3   ? -9.825  -28.127 14.039  0.04 19.81 ? 59   VAL A HB   1  
ATOM   41     H HG11 . VAL A 1 3   ? -10.951 -26.002 13.981  0.04 19.40 ? 59   VAL A HG11 1  
ATOM   42     H HG12 . VAL A 1 3   ? -10.318 -26.378 15.388  0.04 19.43 ? 59   VAL A HG12 1  
ATOM   43     H HG13 . VAL A 1 3   ? -9.581  -25.345 14.423  0.04 18.78 ? 59   VAL A HG13 1  
ATOM   44     H HG21 . VAL A 1 3   ? -10.280 -27.399 11.923  0.04 19.72 ? 59   VAL A HG21 1  
ATOM   45     H HG22 . VAL A 1 3   ? -9.150  -26.296 11.958  0.04 19.00 ? 59   VAL A HG22 1  
ATOM   46     H HG23 . VAL A 1 3   ? -8.757  -27.834 11.868  0.04 19.54 ? 59   VAL A HG23 1  
ATOM   47     N N    . GLY A 1 4   ? -5.983  -26.895 12.958  0.04 18.15 ? 60   GLY A N    1  
ATOM   48     C CA   . GLY A 1 4   ? -5.164  -26.080 12.088  0.04 17.67 ? 60   GLY A CA   1  
ATOM   49     C C    . GLY A 1 4   ? -5.834  -25.809 10.749  0.04 17.71 ? 60   GLY A C    1  
ATOM   50     O O    . GLY A 1 4   ? -6.756  -26.566 10.352  0.04 18.15 ? 60   GLY A O    1  
ATOM   51     H H    . GLY A 1 4   ? -5.675  -27.684 13.092  0.04 18.32 ? 60   GLY A H    1  
ATOM   52     H HA2  . GLY A 1 4   ? -5.027  -25.230 12.530  0.04 17.33 ? 60   GLY A HA2  1  
ATOM   53     H HA3  . GLY A 1 4   ? -4.302  -26.491 11.939  0.04 17.67 ? 60   GLY A HA3  1  
ATOM   54     N N    . GLY A 1 5   ? -5.404  -24.711 10.105  0.04 17.27 ? 61   GLY A N    1  
ATOM   55     C CA   . GLY A 1 5   ? -5.617  -24.471 8.682   0.04 17.27 ? 61   GLY A CA   1  
ATOM   56     C C    . GLY A 1 5   ? -6.999  -23.880 8.479   0.04 17.12 ? 61   GLY A C    1  
ATOM   57     O O    . GLY A 1 5   ? -7.614  -23.514 9.485   0.04 16.77 ? 61   GLY A O    1  
ATOM   58     H H    . GLY A 1 5   ? -4.991  -24.065 10.490  0.04 16.98 ? 61   GLY A H    1  
ATOM   59     H HA2  . GLY A 1 5   ? -4.960  -23.844 8.357   0.04 17.04 ? 61   GLY A HA2  1  
ATOM   60     H HA3  . GLY A 1 5   ? -5.532  -25.296 8.183   0.04 17.64 ? 61   GLY A HA3  1  
ATOM   61     N N    . GLY A 1 6   ? -7.426  -23.739 7.210   0.04 17.43 ? 62   GLY A N    1  
ATOM   62     C CA   . GLY A 1 6   ? -8.743  -23.176 6.822   0.04 17.37 ? 62   GLY A CA   1  
ATOM   63     C C    . GLY A 1 6   ? -8.714  -21.809 6.089   0.04 17.07 ? 62   GLY A C    1  
ATOM   64     O O    . GLY A 1 6   ? -7.652  -21.254 5.999   0.04 16.58 ? 62   GLY A O    1  
ATOM   65     H H    . GLY A 1 6   ? -6.947  -23.964 6.536   0.04 17.71 ? 62   GLY A H    1  
ATOM   66     H HA2  . GLY A 1 6   ? -9.172  -23.811 6.226   0.04 17.75 ? 62   GLY A HA2  1  
ATOM   67     H HA3  . GLY A 1 6   ? -9.297  -23.083 7.606   0.04 17.24 ? 62   GLY A HA3  1  
ATOM   68     N N    . ASP A 1 7   ? -9.864  -21.271 5.620   0.04 17.41 ? 63   ASP A N    1  
ATOM   69     C CA   . ASP A 1 7   ? -10.007 -19.920 4.963   0.04 17.33 ? 63   ASP A CA   1  
ATOM   70     C C    . ASP A 1 7   ? -9.467  -18.805 5.874   0.04 16.85 ? 63   ASP A C    1  
ATOM   71     O O    . ASP A 1 7   ? -9.550  -18.934 7.091   0.04 16.77 ? 63   ASP A O    1  
ATOM   72     C CB   . ASP A 1 7   ? -11.519 -19.646 4.619   0.04 17.81 ? 63   ASP A CB   1  
ATOM   73     C CG   . ASP A 1 7   ? -11.840 -18.170 4.194   0.04 17.68 ? 63   ASP A CG   1  
ATOM   74     O OD1  . ASP A 1 7   ? -11.860 -17.872 2.972   0.04 17.64 ? 63   ASP A OD1  1  
ATOM   75     O OD2  . ASP A 1 7   ? -12.148 -17.320 5.068   0.04 17.63 ? 63   ASP A OD2  1  
ATOM   76     H H    . ASP A 1 7   ? -10.616 -21.677 5.679   0.04 17.75 ? 63   ASP A H    1  
ATOM   77     H HA   . ASP A 1 7   ? -9.506  -19.917 4.134   0.04 17.30 ? 63   ASP A HA   1  
ATOM   78     H HB2  . ASP A 1 7   ? -11.784 -20.238 3.899   0.04 18.13 ? 63   ASP A HB2  1  
ATOM   79     H HB3  . ASP A 1 7   ? -12.046 -19.836 5.412   0.04 17.91 ? 63   ASP A HB3  1  
ATOM   80     N N    . LEU A 1 8   ? -8.931  -17.714 5.315   0.04 16.57 ? 64   LEU A N    1  
ATOM   81     C CA   . LEU A 1 8   ? -8.181  -16.740 6.160   0.04 16.08 ? 64   LEU A CA   1  
ATOM   82     C C    . LEU A 1 8   ? -9.014  -15.537 6.665   0.04 16.06 ? 64   LEU A C    1  
ATOM   83     O O    . LEU A 1 8   ? -8.479  -14.548 7.143   0.04 15.75 ? 64   LEU A O    1  
ATOM   84     C CB   . LEU A 1 8   ? -6.879  -16.237 5.486   0.04 15.77 ? 64   LEU A CB   1  
ATOM   85     C CG   . LEU A 1 8   ? -5.547  -17.018 5.276   0.04 15.53 ? 64   LEU A CG   1  
ATOM   86     C CD1  . LEU A 1 8   ? -4.292  -16.114 5.344   0.04 15.22 ? 64   LEU A CD1  1  
ATOM   87     C CD2  . LEU A 1 8   ? -5.323  -18.181 6.221   0.04 15.31 ? 64   LEU A CD2  1  
ATOM   88     H H    . LEU A 1 8   ? -8.984  -17.506 4.482   0.04 16.67 ? 64   LEU A H    1  
ATOM   89     H HA   . LEU A 1 8   ? -7.893  -17.217 6.954   0.04 15.96 ? 64   LEU A HA   1  
ATOM   90     H HB2  . LEU A 1 8   ? -7.133  -15.902 4.612   0.04 15.99 ? 64   LEU A HB2  1  
ATOM   91     H HB3  . LEU A 1 8   ? -6.602  -15.481 6.021   0.04 15.56 ? 64   LEU A HB3  1  
ATOM   92     H HG   . LEU A 1 8   ? -5.567  -17.386 4.379   0.04 15.76 ? 64   LEU A HG   1  
ATOM   93     H HD11 . LEU A 1 8   ? -3.515  -16.687 5.424   0.04 15.12 ? 64   LEU A HD11 1  
ATOM   94     H HD12 . LEU A 1 8   ? -4.249  -15.627 4.501   0.04 15.39 ? 64   LEU A HD12 1  
ATOM   95     H HD13 . LEU A 1 8   ? -4.356  -15.502 6.081   0.04 14.99 ? 64   LEU A HD13 1  
ATOM   96     H HD21 . LEU A 1 8   ? -4.561  -18.695 5.909   0.04 15.15 ? 64   LEU A HD21 1  
ATOM   97     H HD22 . LEU A 1 8   ? -5.150  -17.837 7.111   0.04 15.12 ? 64   LEU A HD22 1  
ATOM   98     H HD23 . LEU A 1 8   ? -6.117  -18.737 6.229   0.04 15.54 ? 64   LEU A HD23 1  
ATOM   99     N N    . GLY A 1 9   ? -10.334 -15.648 6.573   0.04 16.45 ? 65   GLY A N    1  
ATOM   100    C CA   . GLY A 1 9   ? -11.222 -14.610 7.066   0.04 16.56 ? 65   GLY A CA   1  
ATOM   101    C C    . GLY A 1 9   ? -11.428 -13.495 6.060   0.04 16.50 ? 65   GLY A C    1  
ATOM   102    O O    . GLY A 1 9   ? -10.775 -13.470 5.012   0.04 16.34 ? 65   GLY A O    1  
ATOM   103    H H    . GLY A 1 9   ? -10.737 -16.324 6.231   0.04 16.66 ? 65   GLY A H    1  
ATOM   104    H HA2  . GLY A 1 9   ? -12.087 -15.001 7.264   0.04 16.93 ? 65   GLY A HA2  1  
ATOM   105    H HA3  . GLY A 1 9   ? -10.869 -14.238 7.888   0.04 16.38 ? 65   GLY A HA3  1  
ATOM   106    N N    . PRO A 1 10  ? -12.304 -12.541 6.390   0.04 16.65 ? 66   PRO A N    1  
ATOM   107    C CA   . PRO A 1 10  ? -12.711 -11.605 5.335   0.04 16.77 ? 66   PRO A CA   1  
ATOM   108    C C    . PRO A 1 10  ? -11.604 -10.618 4.989   0.04 16.33 ? 66   PRO A C    1  
ATOM   109    O O    . PRO A 1 10  ? -11.478 -10.126 3.867   0.04 16.44 ? 66   PRO A O    1  
ATOM   110    C CB   . PRO A 1 10  ? -13.934 -10.895 5.925   0.04 17.17 ? 66   PRO A CB   1  
ATOM   111    C CG   . PRO A 1 10  ? -13.938 -11.191 7.414   0.04 17.11 ? 66   PRO A CG   1  
ATOM   112    C CD   . PRO A 1 10  ? -13.006 -12.338 7.677   0.04 16.93 ? 66   PRO A CD   1  
ATOM   113    H HA   . PRO A 1 10  ? -12.976 -12.088 4.536   0.04 16.96 ? 66   PRO A HA   1  
ATOM   114    H HB2  . PRO A 1 10  ? -13.854 -9.941  5.773   0.04 17.10 ? 66   PRO A HB2  1  
ATOM   115    H HB3  . PRO A 1 10  ? -14.738 -11.235 5.502   0.04 17.54 ? 66   PRO A HB3  1  
ATOM   116    H HG2  . PRO A 1 10  ? -13.657 -10.407 7.908   0.04 16.87 ? 66   PRO A HG2  1  
ATOM   117    H HG3  . PRO A 1 10  ? -14.841 -11.432 7.680   0.04 17.48 ? 66   PRO A HG3  1  
ATOM   118    H HD2  . PRO A 1 10  ? -12.374 -12.094 8.373   0.04 16.71 ? 66   PRO A HD2  1  
ATOM   119    H HD3  . PRO A 1 10  ? -13.504 -13.134 7.916   0.04 17.25 ? 66   PRO A HD3  1  
ATOM   120    N N    . ASN A 1 11  ? -10.747 -10.387 5.972   0.04 15.88 ? 67   ASN A N    1  
ATOM   121    C CA   . ASN A 1 11  ? -9.800  -9.271  5.950   0.04 15.49 ? 67   ASN A CA   1  
ATOM   122    C C    . ASN A 1 11  ? -8.467  -9.572  5.257   0.04 15.19 ? 67   ASN A C    1  
ATOM   123    O O    . ASN A 1 11  ? -7.543  -8.741  5.229   0.04 14.83 ? 67   ASN A O    1  
ATOM   124    C CB   . ASN A 1 11  ? -9.572  -8.773  7.385   0.04 15.23 ? 67   ASN A CB   1  
ATOM   125    C CG   . ASN A 1 11  ? -10.881 -8.561  8.142   0.04 15.57 ? 67   ASN A CG   1  
ATOM   126    O OD1  . ASN A 1 11  ? -11.980 -8.593  7.536   0.04 15.90 ? 67   ASN A OD1  1  
ATOM   127    N ND2  . ASN A 1 11  ? -10.774 -8.311  9.473   0.04 15.51 ? 67   ASN A ND2  1  
ATOM   128    H H    . ASN A 1 11  ? -10.695 -10.872 6.678   0.04 15.82 ? 67   ASN A H    1  
ATOM   129    H HA   . ASN A 1 11  ? -10.208 -8.538  5.464   0.04 15.62 ? 67   ASN A HA   1  
ATOM   130    H HB2  . ASN A 1 11  ? -9.042  -9.426  7.869   0.04 15.02 ? 67   ASN A HB2  1  
ATOM   131    H HB3  . ASN A 1 11  ? -9.110  -7.927  7.342   0.04 15.10 ? 67   ASN A HB3  1  
ATOM   132    H HD21 . ASN A 1 11  ? -11.448 -8.435  9.993   0.04 15.57 ? 67   ASN A HD21 1  
ATOM   133    H HD22 . ASN A 1 11  ? -10.032 -8.032  9.801   0.04 15.44 ? 67   ASN A HD22 1  
ATOM   134    N N    . VAL A 1 12  ? -8.350  -10.775 4.712   0.04 15.37 ? 68   VAL A N    1  
ATOM   135    C CA   . VAL A 1 12  ? -7.238  -11.125 3.838   0.04 15.22 ? 68   VAL A CA   1  
ATOM   136    C C    . VAL A 1 12  ? -7.810  -11.167 2.414   0.04 15.58 ? 68   VAL A C    1  
ATOM   137    O O    . VAL A 1 12  ? -8.612  -12.029 2.059   0.04 15.97 ? 68   VAL A O    1  
ATOM   138    C CB   . VAL A 1 12  ? -6.600  -12.460 4.200   0.04 15.17 ? 68   VAL A CB   1  
ATOM   139    C CG1  . VAL A 1 12  ? -5.425  -12.728 3.261   0.04 15.06 ? 68   VAL A CG1  1  
ATOM   140    C CG2  . VAL A 1 12  ? -6.092  -12.453 5.653   0.04 14.84 ? 68   VAL A CG2  1  
ATOM   141    H H    . VAL A 1 12  ? -8.910  -11.416 4.833   0.04 15.60 ? 68   VAL A H    1  
ATOM   142    H HA   . VAL A 1 12  ? -6.559  -10.437 3.862   0.04 14.95 ? 68   VAL A HA   1  
ATOM   143    H HB   . VAL A 1 12  ? -7.242  -13.180 4.105   0.04 15.45 ? 68   VAL A HB   1  
ATOM   144    H HG11 . VAL A 1 12  ? -5.092  -13.622 3.434   0.04 14.83 ? 68   VAL A HG11 1  
ATOM   145    H HG12 . VAL A 1 12  ? -5.724  -12.657 2.345   0.04 15.31 ? 68   VAL A HG12 1  
ATOM   146    H HG13 . VAL A 1 12  ? -4.735  -12.071 3.439   0.04 14.98 ? 68   VAL A HG13 1  
ATOM   147    H HG21 . VAL A 1 12  ? -6.254  -13.321 6.046   0.04 14.85 ? 68   VAL A HG21 1  
ATOM   148    H HG22 . VAL A 1 12  ? -5.139  -12.278 5.644   0.04 14.57 ? 68   VAL A HG22 1  
ATOM   149    H HG23 . VAL A 1 12  ? -6.549  -11.760 6.149   0.04 14.91 ? 68   VAL A HG23 1  
ATOM   150    N N    . LEU A 1 13  ? -7.432  -10.158 1.644   0.04 15.49 ? 69   LEU A N    1  
ATOM   151    C CA   . LEU A 1 13  ? -7.911  -9.985  0.287   0.04 15.83 ? 69   LEU A CA   1  
ATOM   152    C C    . LEU A 1 13  ? -6.802  -10.551 -0.614  0.04 15.76 ? 69   LEU A C    1  
ATOM   153    O O    . LEU A 1 13  ? -5.656  -10.106 -0.582  0.04 15.43 ? 69   LEU A O    1  
ATOM   154    C CB   . LEU A 1 13  ? -8.213  -8.492  0.034   0.04 15.78 ? 69   LEU A CB   1  
ATOM   155    C CG   . LEU A 1 13  ? -9.393  -7.833  0.808   0.04 15.99 ? 69   LEU A CG   1  
ATOM   156    C CD1  . LEU A 1 13  ? -9.369  -7.838  2.366   0.04 15.77 ? 69   LEU A CD1  1  
ATOM   157    C CD2  . LEU A 1 13  ? -9.615  -6.380  0.301   0.04 15.99 ? 69   LEU A CD2  1  
ATOM   158    H H    . LEU A 1 13  ? -6.888  -9.546  1.893   0.04 15.26 ? 69   LEU A H    1  
ATOM   159    H HA   . LEU A 1 13  ? -8.720  -10.498 0.144   0.04 16.15 ? 69   LEU A HA   1  
ATOM   160    H HB2  . LEU A 1 13  ? -7.416  -7.977  0.234   0.04 15.46 ? 69   LEU A HB2  1  
ATOM   161    H HB3  . LEU A 1 13  ? -8.419  -8.405  -0.909  0.04 15.96 ? 69   LEU A HB3  1  
ATOM   162    H HG   . LEU A 1 13  ? -10.195 -8.332  0.566   0.04 16.33 ? 69   LEU A HG   1  
ATOM   163    H HD11 . LEU A 1 13  ? -10.095 -7.286  2.698   0.04 15.87 ? 69   LEU A HD11 1  
ATOM   164    H HD12 . LEU A 1 13  ? -9.483  -8.749  2.682   0.04 15.89 ? 69   LEU A HD12 1  
ATOM   165    H HD13 . LEU A 1 13  ? -8.519  -7.477  2.678   0.04 15.43 ? 69   LEU A HD13 1  
ATOM   166    H HD21 . LEU A 1 13  ? -10.305 -5.959  0.836   0.04 15.92 ? 69   LEU A HD21 1  
ATOM   167    H HD22 . LEU A 1 13  ? -8.788  -5.882  0.382   0.04 15.75 ? 69   LEU A HD22 1  
ATOM   168    H HD23 . LEU A 1 13  ? -9.896  -6.416  -0.627  0.04 16.31 ? 69   LEU A HD23 1  
ATOM   169    N N    . VAL A 1 14  ? -7.132  -11.577 -1.387  0.04 16.13 ? 70   VAL A N    1  
ATOM   170    C CA   . VAL A 1 14  ? -6.139  -12.370 -2.072  0.04 16.14 ? 70   VAL A CA   1  
ATOM   171    C C    . VAL A 1 14  ? -6.404  -12.346 -3.572  0.04 16.50 ? 70   VAL A C    1  
ATOM   172    O O    . VAL A 1 14  ? -7.432  -12.812 -4.026  0.04 16.91 ? 70   VAL A O    1  
ATOM   173    C CB   . VAL A 1 14  ? -6.147  -13.794 -1.547  0.04 16.34 ? 70   VAL A CB   1  
ATOM   174    C CG1  . VAL A 1 14  ? -5.129  -14.619 -2.270  0.04 16.50 ? 70   VAL A CG1  1  
ATOM   175    C CG2  . VAL A 1 14  ? -5.857  -13.777 -0.021  0.04 15.99 ? 70   VAL A CG2  1  
ATOM   176    H H    . VAL A 1 14  ? -7.941  -11.835 -1.532  0.04 16.39 ? 70   VAL A H    1  
ATOM   177    H HA   . VAL A 1 14  ? -5.261  -12.000 -1.917  0.04 15.84 ? 70   VAL A HA   1  
ATOM   178    H HB   . VAL A 1 14  ? -7.024  -14.182 -1.690  0.04 16.63 ? 70   VAL A HB   1  
ATOM   179    H HG11 . VAL A 1 14  ? -5.023  -15.460 -1.796  0.04 16.57 ? 70   VAL A HG11 1  
ATOM   180    H HG12 . VAL A 1 14  ? -5.436  -14.788 -3.175  0.04 16.81 ? 70   VAL A HG12 1  
ATOM   181    H HG13 . VAL A 1 14  ? -4.287  -14.140 -2.286  0.04 16.25 ? 70   VAL A HG13 1  
ATOM   182    H HG21 . VAL A 1 14  ? -5.692  -14.684 0.287   0.04 16.10 ? 70   VAL A HG21 1  
ATOM   183    H HG22 . VAL A 1 14  ? -5.079  -13.227 0.156   0.04 15.68 ? 70   VAL A HG22 1  
ATOM   184    H HG23 . VAL A 1 14  ? -6.634  -13.410 0.435   0.04 15.98 ? 70   VAL A HG23 1  
ATOM   185    N N    . PHE A 1 15  ? -5.415  -11.832 -4.306  0.04 16.36 ? 71   PHE A N    1  
ATOM   186    C CA   . PHE A 1 15  ? -5.513  -11.452 -5.722  0.04 16.68 ? 71   PHE A CA   1  
ATOM   187    C C    . PHE A 1 15  ? -4.597  -12.358 -6.615  0.04 16.79 ? 71   PHE A C    1  
ATOM   188    O O    . PHE A 1 15  ? -3.548  -12.836 -6.158  0.04 16.55 ? 71   PHE A O    1  
ATOM   189    C CB   . PHE A 1 15  ? -5.109  -9.953  -5.878  0.04 16.45 ? 71   PHE A CB   1  
ATOM   190    C CG   . PHE A 1 15  ? -6.063  -8.943  -5.213  0.04 16.34 ? 71   PHE A CG   1  
ATOM   191    C CD1  . PHE A 1 15  ? -7.287  -8.584  -5.799  0.04 16.73 ? 71   PHE A CD1  1  
ATOM   192    C CD2  . PHE A 1 15  ? -5.727  -8.320  -4.009  0.04 15.87 ? 71   PHE A CD2  1  
ATOM   193    C CE1  . PHE A 1 15  ? -8.139  -7.642  -5.207  0.04 16.65 ? 71   PHE A CE1  1  
ATOM   194    C CE2  . PHE A 1 15  ? -6.602  -7.399  -3.413  0.04 15.78 ? 71   PHE A CE2  1  
ATOM   195    C CZ   . PHE A 1 15  ? -7.805  -7.064  -4.030  0.04 16.17 ? 71   PHE A CZ   1  
ATOM   196    H H    . PHE A 1 15  ? -4.636  -11.679 -3.986  0.04 16.10 ? 71   PHE A H    1  
ATOM   197    H HA   . PHE A 1 15  ? -6.427  -11.551 -6.028  0.04 17.00 ? 71   PHE A HA   1  
ATOM   198    H HB2  . PHE A 1 15  ? -4.228  -9.823  -5.491  0.04 16.15 ? 71   PHE A HB2  1  
ATOM   199    H HB3  . PHE A 1 15  ? -5.080  -9.745  -6.828  0.04 16.69 ? 71   PHE A HB3  1  
ATOM   200    H HD1  . PHE A 1 15  ? -7.536  -8.963  -6.611  0.04 17.07 ? 71   PHE A HD1  1  
ATOM   201    H HD2  . PHE A 1 15  ? -4.930  -8.535  -3.584  0.04 15.63 ? 71   PHE A HD2  1  
ATOM   202    H HE1  . PHE A 1 15  ? -8.947  -7.425  -5.613  0.04 16.94 ? 71   PHE A HE1  1  
ATOM   203    H HE2  . PHE A 1 15  ? -6.368  -6.997  -2.607  0.04 15.49 ? 71   PHE A HE2  1  
ATOM   204    H HZ   . PHE A 1 15  ? -8.377  -6.447  -3.632  0.04 16.13 ? 71   PHE A HZ   1  
ATOM   205    N N    . ASP A 1 16  ? -4.970  -12.589 -7.891  0.04 17.19 ? 72   ASP A N    1  
ATOM   206    C CA   . ASP A 1 16  ? -4.010  -13.201 -8.869  0.04 17.32 ? 72   ASP A CA   1  
ATOM   207    C C    . ASP A 1 16  ? -3.778  -12.380 -10.181 0.04 17.62 ? 72   ASP A C    1  
ATOM   208    O O    . ASP A 1 16  ? -4.477  -11.393 -10.404 0.04 17.72 ? 72   ASP A O    1  
ATOM   209    C CB   . ASP A 1 16  ? -4.403  -14.646 -9.157  0.04 17.67 ? 72   ASP A CB   1  
ATOM   210    C CG   . ASP A 1 16  ? -5.808  -14.781 -9.606  0.04 18.17 ? 72   ASP A CG   1  
ATOM   211    O OD1  . ASP A 1 16  ? -6.533  -15.629 -9.055  0.04 18.60 ? 72   ASP A OD1  1  
ATOM   212    O OD2  . ASP A 1 16  ? -6.189  -14.045 -10.512 0.04 18.15 ? 72   ASP A OD2  1  
ATOM   213    H H    . ASP A 1 16  ? -5.742  -12.403 -8.214  0.04 17.40 ? 72   ASP A H    1  
ATOM   214    H HA   . ASP A 1 16  ? -3.153  -13.271 -8.434  0.04 17.02 ? 72   ASP A HA   1  
ATOM   215    H HB2  . ASP A 1 16  ? -3.833  -15.010 -9.852  0.04 17.79 ? 72   ASP A HB2  1  
ATOM   216    H HB3  . ASP A 1 16  ? -4.307  -15.161 -8.339  0.04 17.48 ? 72   ASP A HB3  1  
ATOM   217    N N    . PRO A 1 17  ? -2.805  -12.767 -11.047 0.04 17.78 ? 73   PRO A N    1  
ATOM   218    C CA   . PRO A 1 17  ? -2.719  -11.962 -12.281 0.04 18.19 ? 73   PRO A CA   1  
ATOM   219    C C    . PRO A 1 17  ? -3.996  -11.918 -13.166 0.04 18.72 ? 73   PRO A C    1  
ATOM   220    O O    . PRO A 1 17  ? -3.989  -11.238 -14.187 0.04 19.04 ? 73   PRO A O    1  
ATOM   221    C CB   . PRO A 1 17  ? -1.535  -12.601 -13.045 0.04 18.40 ? 73   PRO A CB   1  
ATOM   222    C CG   . PRO A 1 17  ? -0.705  -13.170 -11.991 0.04 17.93 ? 73   PRO A CG   1  
ATOM   223    C CD   . PRO A 1 17  ? -1.677  -13.724 -10.971 0.04 17.62 ? 73   PRO A CD   1  
ATOM   224    H HA   . PRO A 1 17  ? -2.477  -11.051 -12.047 0.04 18.04 ? 73   PRO A HA   1  
ATOM   225    H HB2  . PRO A 1 17  ? -1.854  -13.301 -13.637 0.04 18.72 ? 73   PRO A HB2  1  
ATOM   226    H HB3  . PRO A 1 17  ? -1.058  -11.923 -13.543 0.04 18.51 ? 73   PRO A HB3  1  
ATOM   227    H HG2  . PRO A 1 17  ? -0.151  -13.872 -12.363 0.04 18.07 ? 73   PRO A HG2  1  
ATOM   228    H HG3  . PRO A 1 17  ? -0.162  -12.466 -11.599 0.04 17.72 ? 73   PRO A HG3  1  
ATOM   229    H HD2  . PRO A 1 17  ? -1.962  -14.616 -11.221 0.04 17.74 ? 73   PRO A HD2  1  
ATOM   230    H HD3  . PRO A 1 17  ? -1.283  -13.714 -10.088 0.04 17.25 ? 73   PRO A HD3  1  
ATOM   231    N N    . SER A 1 18  ? -5.071  -12.581 -12.768 0.04 18.86 ? 74   SER A N    1  
ATOM   232    C CA   . SER A 1 18  ? -6.309  -12.539 -13.553 0.04 19.44 ? 74   SER A CA   1  
ATOM   233    C C    . SER A 1 18  ? -7.434  -11.796 -12.844 0.04 19.46 ? 74   SER A C    1  
ATOM   234    O O    . SER A 1 18  ? -8.288  -11.171 -13.497 0.04 19.97 ? 74   SER A O    1  
ATOM   235    C CB   . SER A 1 18  ? -6.770  -13.954 -13.810 0.04 19.79 ? 74   SER A CB   1  
ATOM   236    O OG   . SER A 1 18  ? -6.828  -14.647 -12.575 0.04 19.50 ? 74   SER A OG   1  
ATOM   237    H H    . SER A 1 18  ? -5.115  -13.072 -12.067 0.04 18.64 ? 74   SER A H    1  
ATOM   238    H HA   . SER A 1 18  ? -6.158  -12.116 -14.412 0.04 19.70 ? 74   SER A HA   1  
ATOM   239    H HB2  . SER A 1 18  ? -7.657  -13.931 -14.204 0.04 20.21 ? 74   SER A HB2  1  
ATOM   240    H HB3  . SER A 1 18  ? -6.155  -14.400 -14.413 0.04 19.82 ? 74   SER A HB3  1  
ATOM   241    H HG   . SER A 1 18  ? -6.052  -14.724 -12.256 0.04 19.33 ? 74   SER A HG   1  
ATOM   242    N N    . THR A 1 19  ? -7.447  -11.906 -11.509 0.04 18.94 ? 75   THR A N    1  
ATOM   243    C CA   . THR A 1 19  ? -8.580  -11.496 -10.675 0.04 18.97 ? 75   THR A CA   1  
ATOM   244    C C    . THR A 1 19  ? -9.216  -10.209 -11.168 0.04 19.24 ? 75   THR A C    1  
ATOM   245    O O    . THR A 1 19  ? -8.531  -9.390  -11.768 0.04 19.06 ? 75   THR A O    1  
ATOM   246    C CB   . THR A 1 19  ? -8.087  -11.297 -9.248  0.04 18.36 ? 75   THR A CB   1  
ATOM   247    O OG1  . THR A 1 19  ? -7.735  -12.582 -8.710  0.04 18.13 ? 75   THR A OG1  1  
ATOM   248    C CG2  . THR A 1 19  ? -9.153  -10.615 -8.341  0.04 18.41 ? 75   THR A CG2  1  
ATOM   249    H H    . THR A 1 19  ? -6.792  -12.222 -11.053 0.04 18.60 ? 75   THR A H    1  
ATOM   250    H HA   . THR A 1 19  ? -9.247  -12.196 -10.679 0.04 19.23 ? 75   THR A HA   1  
ATOM   251    H HB   . THR A 1 19  ? -7.295  -10.736 -9.268  0.04 18.12 ? 75   THR A HB   1  
ATOM   252    H HG1  . THR A 1 19  ? -8.222  -12.766 -8.051  0.04 18.36 ? 75   THR A HG1  1  
ATOM   253    H HG21 . THR A 1 19  ? -8.804  -10.509 -7.443  0.04 18.04 ? 75   THR A HG21 1  
ATOM   254    H HG22 . THR A 1 19  ? -9.391  -9.736  -8.674  0.04 18.71 ? 75   THR A HG22 1  
ATOM   255    H HG23 . THR A 1 19  ? -9.942  -11.167 -8.295  0.04 18.52 ? 75   THR A HG23 1  
ATOM   256    N N    . PRO A 1 20  ? -10.541 -10.034 -10.950 0.04 19.73 ? 76   PRO A N    1  
ATOM   257    C CA   . PRO A 1 20  ? -11.095 -8.802  -11.541 0.04 20.12 ? 76   PRO A CA   1  
ATOM   258    C C    . PRO A 1 20  ? -10.874 -7.520  -10.748 0.04 19.93 ? 76   PRO A C    1  
ATOM   259    O O    . PRO A 1 20  ? -10.929 -7.580  -9.556  0.04 20.26 ? 76   PRO A O    1  
ATOM   260    C CB   . PRO A 1 20  ? -12.611 -9.070  -11.616 0.04 20.81 ? 76   PRO A CB   1  
ATOM   261    C CG   . PRO A 1 20  ? -12.881 -10.189 -10.669 0.04 20.70 ? 76   PRO A CG   1  
ATOM   262    C CD   . PRO A 1 20  ? -11.591 -10.994 -10.553 0.04 20.10 ? 76   PRO A CD   1  
ATOM   263    H HA   . PRO A 1 20  ? -10.753 -8.685  -12.441 0.04 20.15 ? 76   PRO A HA   1  
ATOM   264    H HB2  . PRO A 1 20  ? -13.094 -8.272  -11.349 0.04 21.07 ? 76   PRO A HB2  1  
ATOM   265    H HB3  . PRO A 1 20  ? -12.851 -9.317  -12.520 0.04 21.05 ? 76   PRO A HB3  1  
ATOM   266    H HG2  . PRO A 1 20  ? -13.133 -9.831  -9.804  0.04 20.65 ? 76   PRO A HG2  1  
ATOM   267    H HG3  . PRO A 1 20  ? -13.595 -10.746 -11.023 0.04 21.10 ? 76   PRO A HG3  1  
ATOM   268    H HD2  . PRO A 1 20  ? -11.477 -11.282 -9.635  0.04 19.86 ? 76   PRO A HD2  1  
ATOM   269    H HD3  . PRO A 1 20  ? -11.604 -11.751 -11.160 0.04 20.22 ? 76   PRO A HD3  1  
ATOM   270    N N    . ASP A 1 21  ? -10.640 -6.396  -11.425 0.04 19.46 ? 77   ASP A N    1  
ATOM   271    C CA   . ASP A 1 21  ? -10.694 -5.078  -10.804 0.04 19.29 ? 77   ASP A CA   1  
ATOM   272    C C    . ASP A 1 21  ? -9.764  -4.956  -9.583  0.04 18.60 ? 77   ASP A C    1  
ATOM   273    O O    . ASP A 1 21  ? -10.106 -4.349  -8.552  0.04 18.38 ? 77   ASP A O    1  
ATOM   274    C CB   . ASP A 1 21  ? -12.143 -4.772  -10.412 0.04 19.65 ? 77   ASP A CB   1  
ATOM   275    C CG   . ASP A 1 21  ? -12.370 -3.321  -10.085 0.04 19.54 ? 77   ASP A CG   1  
ATOM   276    O OD1  . ASP A 1 21  ? -11.417 -2.526  -10.128 0.04 19.36 ? 77   ASP A OD1  1  
ATOM   277    O OD2  . ASP A 1 21  ? -13.528 -2.975  -9.793  0.04 19.69 ? 77   ASP A OD2  1  
ATOM   278    H H    . ASP A 1 21  ? -10.447 -6.375  -12.264 0.04 19.24 ? 77   ASP A H    1  
ATOM   279    H HA   . ASP A 1 21  ? -10.411 -4.422  -11.458 0.04 19.40 ? 77   ASP A HA   1  
ATOM   280    H HB2  . ASP A 1 21  ? -12.709 -4.985  -11.170 0.04 20.11 ? 77   ASP A HB2  1  
ATOM   281    H HB3  . ASP A 1 21  ? -12.401 -5.307  -9.646  0.04 19.54 ? 77   ASP A HB3  1  
ATOM   282    N N    . ILE A 1 22  ? -8.575  -5.536  -9.714  0.04 18.31 ? 78   ILE A N    1  
ATOM   283    C CA   . ILE A 1 22  ? -7.606  -5.522  -8.624  0.04 17.69 ? 78   ILE A CA   1  
ATOM   284    C C    . ILE A 1 22  ? -7.403  -4.070  -8.239  0.04 17.49 ? 78   ILE A C    1  
ATOM   285    O O    . ILE A 1 22  ? -7.375  -3.699  -7.058  0.04 17.11 ? 78   ILE A O    1  
ATOM   286    C CB   . ILE A 1 22  ? -6.265  -6.166  -9.066  0.04 17.49 ? 78   ILE A CB   1  
ATOM   287    C CG1  . ILE A 1 22  ? -6.290  -7.673  -8.762  0.04 17.62 ? 78   ILE A CG1  1  
ATOM   288    C CG2  . ILE A 1 22  ? -5.099  -5.497  -8.375  0.04 16.90 ? 78   ILE A CG2  1  
ATOM   289    C CD1  . ILE A 1 22  ? -5.224  -8.446  -9.433  0.04 17.42 ? 78   ILE A CD1  1  
ATOM   290    H H    . ILE A 1 22  ? -8.305  -5.943  -10.420 0.04 18.48 ? 78   ILE A H    1  
ATOM   291    H HA   . ILE A 1 22  ? -7.951  -6.014  -7.864  0.04 17.56 ? 78   ILE A HA   1  
ATOM   292    H HB   . ILE A 1 22  ? -6.174  -6.041  -10.025 0.04 17.70 ? 78   ILE A HB   1  
ATOM   293    H HG12 . ILE A 1 22  ? -6.150  -7.779  -7.817  0.04 17.48 ? 78   ILE A HG12 1  
ATOM   294    H HG13 . ILE A 1 22  ? -7.146  -8.046  -9.026  0.04 18.02 ? 78   ILE A HG13 1  
ATOM   295    H HG21 . ILE A 1 22  ? -4.308  -6.042  -8.488  0.04 16.77 ? 78   ILE A HG21 1  
ATOM   296    H HG22 . ILE A 1 22  ? -4.949  -4.628  -8.774  0.04 16.88 ? 78   ILE A HG22 1  
ATOM   297    H HG23 . ILE A 1 22  ? -5.292  -5.408  -7.428  0.04 16.72 ? 78   ILE A HG23 1  
ATOM   298    H HD11 . ILE A 1 22  ? -5.457  -9.385  -9.399  0.04 17.62 ? 78   ILE A HD11 1  
ATOM   299    H HD12 . ILE A 1 22  ? -5.140  -8.155  -10.352 0.04 17.52 ? 78   ILE A HD12 1  
ATOM   300    H HD13 . ILE A 1 22  ? -4.392  -8.289  -8.959  0.04 17.05 ? 78   ILE A HD13 1  
ATOM   301    N N    . GLN A 1 23  ? -7.297  -3.210  -9.245  0.04 17.78 ? 79   GLN A N    1  
ATOM   302    C CA   . GLN A 1 23  ? -7.013  -1.812  -8.960  0.04 17.59 ? 79   GLN A CA   1  
ATOM   303    C C    . GLN A 1 23  ? -8.144  -1.148  -8.160  0.04 17.69 ? 79   GLN A C    1  
ATOM   304    O O    . GLN A 1 23  ? -7.877  -0.438  -7.191  0.04 17.33 ? 79   GLN A O    1  
ATOM   305    C CB   . GLN A 1 23  ? -6.733  -1.035  -10.248 0.04 17.85 ? 79   GLN A CB   1  
ATOM   306    C CG   . GLN A 1 23  ? -6.370  0.414   -10.018 0.04 17.68 ? 79   GLN A CG   1  
ATOM   307    C CD   . GLN A 1 23  ? -5.004  0.600   -9.367  0.04 17.09 ? 79   GLN A CD   1  
ATOM   308    O OE1  . GLN A 1 23  ? -4.006  0.047   -9.829  0.04 16.90 ? 79   GLN A OE1  1  
ATOM   309    N NE2  . GLN A 1 23  ? -4.942  1.397   -8.317  0.04 16.84 ? 79   GLN A NE2  1  
ATOM   310    H H    . GLN A 1 23  ? -7.389  -3.402  -10.078 0.04 18.09 ? 79   GLN A H    1  
ATOM   311    H HA   . GLN A 1 23  ? -6.215  -1.767  -8.414  0.04 17.20 ? 79   GLN A HA   1  
ATOM   312    H HB2  . GLN A 1 23  ? -5.988  -1.451  -10.710 0.04 17.75 ? 79   GLN A HB2  1  
ATOM   313    H HB3  . GLN A 1 23  ? -7.529  -1.055  -10.796 0.04 18.27 ? 79   GLN A HB3  1  
ATOM   314    H HG2  . GLN A 1 23  ? -6.351  0.869   -10.876 0.04 17.93 ? 79   GLN A HG2  1  
ATOM   315    H HG3  . GLN A 1 23  ? -7.036  0.828   -9.450  0.04 17.74 ? 79   GLN A HG3  1  
ATOM   316    H HE21 . GLN A 1 23  ? -5.068  1.077   -7.528  0.04 16.81 ? 79   GLN A HE21 1  
ATOM   317    H HE22 . GLN A 1 23  ? -4.754  2.230   -8.414  0.04 16.72 ? 79   GLN A HE22 1  
ATOM   318    N N    . GLY A 1 24  ? -9.392  -1.394  -8.536  0.04 18.19 ? 80   GLY A N    1  
ATOM   319    C CA   . GLY A 1 24  ? -10.531 -0.850  -7.794  0.04 18.33 ? 80   GLY A CA   1  
ATOM   320    C C    . GLY A 1 24  ? -10.672 -1.455  -6.421  0.04 17.92 ? 80   GLY A C    1  
ATOM   321    O O    . GLY A 1 24  ? -11.096 -0.788  -5.464  0.04 17.79 ? 80   GLY A O    1  
ATOM   322    H H    . GLY A 1 24  ? -9.606  -1.874  -9.218  0.04 18.47 ? 80   GLY A H    1  
ATOM   323    H HA2  . GLY A 1 24  ? -10.402 0.087   -7.630  0.04 18.30 ? 80   GLY A HA2  1  
ATOM   324    H HA3  . GLY A 1 24  ? -11.359 -0.969  -8.281  0.04 18.74 ? 80   GLY A HA3  1  
ATOM   325    N N    . LYS A 1 25  ? -10.303 -2.718  -6.318  0.04 17.77 ? 81   LYS A N    1  
ATOM   326    C CA   . LYS A 1 25  ? -10.413 -3.415  -5.052  0.04 17.46 ? 81   LYS A CA   1  
ATOM   327    C C    . LYS A 1 25  ? -9.246  -3.214  -4.112  0.04 16.86 ? 81   LYS A C    1  
ATOM   328    O O    . LYS A 1 25  ? -9.394  -3.510  -2.952  0.04 16.67 ? 81   LYS A O    1  
ATOM   329    C CB   . LYS A 1 25  ? -10.648 -4.898  -5.299  0.04 17.60 ? 81   LYS A CB   1  
ATOM   330    C CG   . LYS A 1 25  ? -11.883 -5.237  -6.133  0.04 18.28 ? 81   LYS A CG   1  
ATOM   331    C CD   . LYS A 1 25  ? -11.664 -6.546  -6.828  0.04 18.51 ? 81   LYS A CD   1  
ATOM   332    C CE   . LYS A 1 25  ? -12.939 -7.162  -7.379  0.04 19.16 ? 81   LYS A CE   1  
ATOM   333    N NZ   . LYS A 1 25  ? -12.617 -8.582  -7.713  0.04 19.45 ? 81   LYS A NZ   1  
ATOM   334    H H    . LYS A 1 25  ? -9.995  -3.195  -6.963  0.04 17.87 ? 81   LYS A H    1  
ATOM   335    H HA   . LYS A 1 25  ? -11.201 -3.083  -4.594  0.04 17.64 ? 81   LYS A HA   1  
ATOM   336    H HB2  . LYS A 1 25  ? -9.869  -5.253  -5.754  0.04 17.44 ? 81   LYS A HB2  1  
ATOM   337    H HB3  . LYS A 1 25  ? -10.737 -5.332  -4.434  0.04 17.43 ? 81   LYS A HB3  1  
ATOM   338    H HG2  . LYS A 1 25  ? -12.659 -5.315  -5.553  0.04 18.42 ? 81   LYS A HG2  1  
ATOM   339    H HG3  . LYS A 1 25  ? -12.028 -4.557  -6.812  0.04 18.49 ? 81   LYS A HG3  1  
ATOM   340    H HD2  . LYS A 1 25  ? -11.053 -6.400  -7.564  0.04 18.53 ? 81   LYS A HD2  1  
ATOM   341    H HD3  . LYS A 1 25  ? -11.271 -7.170  -6.196  0.04 18.25 ? 81   LYS A HD3  1  
ATOM   342    H HE2  . LYS A 1 25  ? -13.641 -7.139  -6.709  0.04 19.15 ? 81   LYS A HE2  1  
ATOM   343    H HE3  . LYS A 1 25  ? -13.219 -6.702  -8.187  0.04 19.45 ? 81   LYS A HE3  1  
ATOM   344    H HZ1  . LYS A 1 25  ? -13.366 -9.044  -7.847  0.04 19.81 ? 81   LYS A HZ1  1  
ATOM   345    H HZ2  . LYS A 1 25  ? -12.122 -8.612  -8.453  0.04 19.54 ? 81   LYS A HZ2  1  
ATOM   346    H HZ3  . LYS A 1 25  ? -12.162 -8.953  -7.044  0.04 19.19 ? 81   LYS A HZ3  1  
ATOM   347    N N    . VAL A 1 26  ? -8.119  -2.710  -4.609  0.04 16.59 ? 82   VAL A N    1  
ATOM   348    C CA   . VAL A 1 26  ? -7.045  -2.219  -3.740  0.04 16.09 ? 82   VAL A CA   1  
ATOM   349    C C    . VAL A 1 26  ? -7.267  -0.749  -3.232  0.04 16.15 ? 82   VAL A C    1  
ATOM   350    O O    . VAL A 1 26  ? -7.232  -0.479  -2.026  0.04 15.82 ? 82   VAL A O    1  
ATOM   351    C CB   . VAL A 1 26  ? -5.663  -2.423  -4.438  0.04 15.76 ? 82   VAL A CB   1  
ATOM   352    C CG1  . VAL A 1 26  ? -4.629  -1.746  -3.704  0.04 15.25 ? 82   VAL A CG1  1  
ATOM   353    C CG2  . VAL A 1 26  ? -5.336  -3.919  -4.556  0.04 15.86 ? 82   VAL A CG2  1  
ATOM   354    H H    . VAL A 1 26  ? -7.945  -2.648  -5.448  0.04 16.71 ? 82   VAL A H    1  
ATOM   355    H HA   . VAL A 1 26  ? -7.037  -2.788  -2.959  0.04 15.94 ? 82   VAL A HA   1  
ATOM   356    H HB   . VAL A 1 26  ? -5.674  -2.038  -5.330  0.04 15.84 ? 82   VAL A HB   1  
ATOM   357    H HG11 . VAL A 1 26  ? -3.766  -2.092  -3.982  0.04 15.07 ? 82   VAL A HG11 1  
ATOM   358    H HG12 . VAL A 1 26  ? -4.680  -0.796  -3.881  0.04 15.20 ? 82   VAL A HG12 1  
ATOM   359    H HG13 . VAL A 1 26  ? -4.770  -1.920  -2.760  0.04 15.20 ? 82   VAL A HG13 1  
ATOM   360    H HG21 . VAL A 1 26  ? -4.391  -4.030  -4.744  0.04 15.63 ? 82   VAL A HG21 1  
ATOM   361    H HG22 . VAL A 1 26  ? -5.559  -4.357  -3.720  0.04 15.88 ? 82   VAL A HG22 1  
ATOM   362    H HG23 . VAL A 1 26  ? -5.858  -4.300  -5.277  0.04 16.18 ? 82   VAL A HG23 1  
ATOM   363    N N    . ASP A 1 27  ? -7.420  0.189   -4.171  0.04 16.60 ? 83   ASP A N    1  
ATOM   364    C CA   . ASP A 1 27  ? -8.177  1.452   -4.053  0.04 16.81 ? 83   ASP A CA   1  
ATOM   365    C C    . ASP A 1 27  ? -9.236  1.682   -3.010  0.04 16.87 ? 83   ASP A C    1  
ATOM   366    O O    . ASP A 1 27  ? -9.269  2.747   -2.364  0.04 16.72 ? 83   ASP A O    1  
ATOM   367    C CB   . ASP A 1 27  ? -8.991  1.650   -5.353  0.04 17.38 ? 83   ASP A CB   1  
ATOM   368    C CG   . ASP A 1 27  ? -8.210  2.319   -6.415  0.04 17.35 ? 83   ASP A CG   1  
ATOM   369    O OD1  . ASP A 1 27  ? -7.104  2.776   -6.088  0.04 16.90 ? 83   ASP A OD1  1  
ATOM   370    O OD2  . ASP A 1 27  ? -8.709  2.399   -7.555  0.04 17.81 ? 83   ASP A OD2  1  
ATOM   371    H H    . ASP A 1 27  ? -7.060  0.117   -4.948  0.04 16.83 ? 83   ASP A H    1  
ATOM   372    H HA   . ASP A 1 27  ? -7.541  2.172   -3.939  0.04 16.56 ? 83   ASP A HA   1  
ATOM   373    H HB2  . ASP A 1 27  ? -9.288  0.793   -5.685  0.04 17.60 ? 83   ASP A HB2  1  
ATOM   374    H HB3  . ASP A 1 27  ? -9.766  2.208   -5.173  0.04 17.59 ? 83   ASP A HB3  1  
ATOM   375    N N    . GLU A 1 28  ? -10.196 0.772   -2.971  0.04 17.09 ? 84   GLU A N    1  
ATOM   376    C CA   . GLU A 1 28  ? -11.309 0.971   -2.094  0.04 17.21 ? 84   GLU A CA   1  
ATOM   377    C C    . GLU A 1 28  ? -10.776 0.927   -0.678  0.04 16.69 ? 84   GLU A C    1  
ATOM   378    O O    . GLU A 1 28  ? -11.175 1.717   0.179   0.04 16.69 ? 84   GLU A O    1  
ATOM   379    C CB   . GLU A 1 28  ? -12.326 -0.115  -2.306  0.04 17.55 ? 84   GLU A CB   1  
ATOM   380    C CG   . GLU A 1 28  ? -13.576 0.138   -1.549  0.04 17.74 ? 84   GLU A CG   1  
ATOM   381    C CD   . GLU A 1 28  ? -14.665 -0.814  -1.962  0.04 18.16 ? 84   GLU A CD   1  
ATOM   382    O OE1  . GLU A 1 28  ? -14.680 -1.930  -1.428  0.04 17.99 ? 84   GLU A OE1  1  
ATOM   383    O OE2  . GLU A 1 28  ? -15.499 -0.456  -2.802  0.04 18.69 ? 84   GLU A OE2  1  
ATOM   384    H H    . GLU A 1 28  ? -10.223 0.048   -3.431  0.04 17.20 ? 84   GLU A H    1  
ATOM   385    H HA   . GLU A 1 28  ? -11.718 1.834   -2.265  0.04 17.45 ? 84   GLU A HA   1  
ATOM   386    H HB2  . GLU A 1 28  ? -12.554 -0.166  -3.249  0.04 17.89 ? 84   GLU A HB2  1  
ATOM   387    H HB3  . GLU A 1 28  ? -11.956 -0.956  -1.999  0.04 17.32 ? 84   GLU A HB3  1  
ATOM   388    H HG2  . GLU A 1 28  ? -13.405 0.022   -0.601  0.04 17.41 ? 84   GLU A HG2  1  
ATOM   389    H HG3  . GLU A 1 28  ? -13.877 1.043   -1.732  0.04 17.96 ? 84   GLU A HG3  1  
ATOM   390    N N    . VAL A 1 29  ? -9.860  -0.015  -0.454  0.04 16.29 ? 85   VAL A N    1  
ATOM   391    C CA   . VAL A 1 29  ? -9.241  -0.185  0.854   0.04 15.81 ? 85   VAL A CA   1  
ATOM   392    C C    . VAL A 1 29  ? -8.507  1.101   1.232   0.04 15.56 ? 85   VAL A C    1  
ATOM   393    O O    . VAL A 1 29  ? -8.603  1.625   2.340   0.04 15.37 ? 85   VAL A O    1  
ATOM   394    C CB   . VAL A 1 29  ? -8.302  -1.417  0.877   0.04 15.48 ? 85   VAL A CB   1  
ATOM   395    C CG1  . VAL A 1 29  ? -7.470  -1.433  2.133   0.04 15.02 ? 85   VAL A CG1  1  
ATOM   396    C CG2  . VAL A 1 29  ? -9.113  -2.720  0.787   0.04 15.72 ? 85   VAL A CG2  1  
ATOM   397    H H    . VAL A 1 29  ? -9.591  -0.575  -1.046  0.04 16.30 ? 85   VAL A H    1  
ATOM   398    H HA   . VAL A 1 29  ? -9.937  -0.336  1.512   0.04 15.89 ? 85   VAL A HA   1  
ATOM   399    H HB   . VAL A 1 29  ? -7.695  -1.385  0.126   0.04 15.45 ? 85   VAL A HB   1  
ATOM   400    H HG11 . VAL A 1 29  ? -7.300  -2.349  2.390   0.04 14.85 ? 85   VAL A HG11 1  
ATOM   401    H HG12 . VAL A 1 29  ? -6.629  -0.983  1.959   0.04 14.88 ? 85   VAL A HG12 1  
ATOM   402    H HG13 . VAL A 1 29  ? -7.951  -0.976  2.838   0.04 15.06 ? 85   VAL A HG13 1  
ATOM   403    H HG21 . VAL A 1 29  ? -8.514  -3.477  0.862   0.04 15.56 ? 85   VAL A HG21 1  
ATOM   404    H HG22 . VAL A 1 29  ? -9.758  -2.734  1.514   0.04 15.71 ? 85   VAL A HG22 1  
ATOM   405    H HG23 . VAL A 1 29  ? -9.580  -2.746  -0.064  0.04 16.06 ? 85   VAL A HG23 1  
ATOM   406    N N    . PHE A 1 30  ? -7.746  1.629   0.286   0.04 15.59 ? 86   PHE A N    1  
ATOM   407    C CA   . PHE A 1 30  ? -6.988  2.818   0.565   0.04 15.37 ? 86   PHE A CA   1  
ATOM   408    C C    . PHE A 1 30  ? -7.855  4.033   0.926   0.04 15.60 ? 86   PHE A C    1  
ATOM   409    O O    . PHE A 1 30  ? -7.534  4.775   1.853   0.04 15.36 ? 86   PHE A O    1  
ATOM   410    C CB   . PHE A 1 30  ? -6.065  3.126   -0.618  0.04 15.43 ? 86   PHE A CB   1  
ATOM   411    C CG   . PHE A 1 30  ? -5.366  4.418   -0.498  0.04 15.32 ? 86   PHE A CG   1  
ATOM   412    C CD1  . PHE A 1 30  ? -4.419  4.621   0.469   0.04 14.91 ? 86   PHE A CD1  1  
ATOM   413    C CD2  . PHE A 1 30  ? -5.692  5.443   -1.345  0.04 15.70 ? 86   PHE A CD2  1  
ATOM   414    C CE1  . PHE A 1 30  ? -3.770  5.851   0.565   0.04 14.85 ? 86   PHE A CE1  1  
ATOM   415    C CE2  . PHE A 1 30  ? -5.086  6.629   -1.262  0.04 15.66 ? 86   PHE A CE2  1  
ATOM   416    C CZ   . PHE A 1 30  ? -4.121  6.859   -0.311  0.04 15.23 ? 86   PHE A CZ   1  
ATOM   417    H H    . PHE A 1 30  ? -7.664  1.315   -0.506  0.04 15.76 ? 86   PHE A H    1  
ATOM   418    H HA   . PHE A 1 30  ? -6.431  2.642   1.339   0.04 15.05 ? 86   PHE A HA   1  
ATOM   419    H HB2  . PHE A 1 30  ? -5.392  2.430   -0.688  0.04 15.23 ? 86   PHE A HB2  1  
ATOM   420    H HB3  . PHE A 1 30  ? -6.592  3.154   -1.433  0.04 15.76 ? 86   PHE A HB3  1  
ATOM   421    H HD1  . PHE A 1 30  ? -4.193  3.929   1.046   0.04 14.67 ? 86   PHE A HD1  1  
ATOM   422    H HD2  . PHE A 1 30  ? -6.337  5.305   -1.999  0.04 16.01 ? 86   PHE A HD2  1  
ATOM   423    H HE1  . PHE A 1 30  ? -3.122  5.994   1.217   0.04 14.59 ? 86   PHE A HE1  1  
ATOM   424    H HE2  . PHE A 1 30  ? -5.329  7.305   -1.858  0.04 15.95 ? 86   PHE A HE2  1  
ATOM   425    H HZ   . PHE A 1 30  ? -3.704  7.687   -0.256  0.04 15.23 ? 86   PHE A HZ   1  
ATOM   426    N N    . ARG A 1 31  ? -8.952  4.262   0.216   0.04 16.09 ? 87   ARG A N    1  
ATOM   427    C CA   . ARG A 1 31  ? -9.776  5.423   0.531   0.04 16.38 ? 87   ARG A CA   1  
ATOM   428    C C    . ARG A 1 31  ? -10.395 5.218   1.962   0.04 16.29 ? 87   ARG A C    1  
ATOM   429    O O    . ARG A 1 31  ? -10.550 6.191   2.718   0.04 16.32 ? 87   ARG A O    1  
ATOM   430    C CB   . ARG A 1 31  ? -10.798 5.703   -0.620  0.04 16.98 ? 87   ARG A CB   1  
ATOM   431    C CG   . ARG A 1 31  ? -10.202 6.054   -2.089  0.04 17.17 ? 87   ARG A CG   1  
ATOM   432    C CD   . ARG A 1 31  ? -11.229 6.583   -3.215  0.04 17.83 ? 87   ARG A CD   1  
ATOM   433    N NE   . ARG A 1 31  ? -12.512 5.861   -3.373  0.04 18.06 ? 87   ARG A NE   1  
ATOM   434    C CZ   . ARG A 1 31  ? -12.699 4.721   -4.051  0.04 18.29 ? 87   ARG A CZ   1  
ATOM   435    N NH1  . ARG A 1 31  ? -13.910 4.163   -4.119  0.04 18.51 ? 87   ARG A NH1  1  
ATOM   436    N NH2  . ARG A 1 31  ? -11.703 4.120   -4.661  0.04 18.31 ? 87   ARG A NH2  1  
ATOM   437    H H    . ARG A 1 31  ? -9.237  3.773   -0.428  0.04 16.29 ? 87   ARG A H    1  
ATOM   438    H HA   . ARG A 1 31  ? -9.198  6.200   0.581   0.04 16.28 ? 87   ARG A HA   1  
ATOM   439    H HB2  . ARG A 1 31  ? -11.344 4.908   -0.725  0.04 17.08 ? 87   ARG A HB2  1  
ATOM   440    H HB3  . ARG A 1 31  ? -11.365 6.442   -0.342  0.04 17.20 ? 87   ARG A HB3  1  
ATOM   441    H HG2  . ARG A 1 31  ? -9.541  6.760   -1.979  0.04 17.07 ? 87   ARG A HG2  1  
ATOM   442    H HG3  . ARG A 1 31  ? -9.765  5.266   -2.448  0.04 17.01 ? 87   ARG A HG3  1  
ATOM   443    H HD2  . ARG A 1 31  ? -11.474 7.489   -2.967  0.04 18.01 ? 87   ARG A HD2  1  
ATOM   444    H HD3  . ARG A 1 31  ? -10.785 6.591   -4.079  0.04 17.97 ? 87   ARG A HD3  1  
ATOM   445    H HE   . ARG A 1 31  ? -13.189 6.166   -2.938  0.04 17.99 ? 87   ARG A HE   1  
ATOM   446    H HH11 . ARG A 1 31  ? -14.581 4.525   -3.721  0.04 18.52 ? 87   ARG A HH11 1  
ATOM   447    H HH12 . ARG A 1 31  ? -14.017 3.427   -4.557  0.04 18.68 ? 87   ARG A HH12 1  
ATOM   448    H HH21 . ARG A 1 31  ? -10.911 4.456   -4.639  0.04 18.19 ? 87   ARG A HH21 1  
ATOM   449    H HH22 . ARG A 1 31  ? -11.852 3.391   -5.089  0.04 18.48 ? 87   ARG A HH22 1  
ATOM   450    N N    . LYS A 1 32  ? -10.647 3.958   2.361   0.04 16.20 ? 88   LYS A N    1  
ATOM   451    C CA   . LYS A 1 32  ? -11.086 3.639   3.737   0.04 16.09 ? 88   LYS A CA   1  
ATOM   452    C C    . LYS A 1 32  ? -9.979  3.787   4.818   0.04 15.56 ? 88   LYS A C    1  
ATOM   453    O O    . LYS A 1 32  ? -10.255 4.144   5.951   0.04 15.50 ? 88   LYS A O    1  
ATOM   454    C CB   . LYS A 1 32  ? -11.681 2.200   3.817   0.04 16.22 ? 88   LYS A CB   1  
ATOM   455    C CG   . LYS A 1 32  ? -13.190 2.055   3.482   0.04 16.82 ? 88   LYS A CG   1  
ATOM   456    C CD   . LYS A 1 32  ? -13.757 0.643   3.860   0.04 16.95 ? 88   LYS A CD   1  
ATOM   457    C CE   . LYS A 1 32  ? -12.993 -0.518  3.227   0.04 16.78 ? 88   LYS A CE   1  
ATOM   458    N NZ   . LYS A 1 32  ? -13.782 -1.824  3.224   0.04 16.92 ? 88   LYS A NZ   1  
ATOM   459    H H    . LYS A 1 32  ? -10.579 3.266   1.858   0.04 16.22 ? 88   LYS A H    1  
ATOM   460    H HA   . LYS A 1 32  ? -11.799 4.258   3.966   0.04 16.33 ? 88   LYS A HA   1  
ATOM   461    H HB2  . LYS A 1 32  ? -11.199 1.642   3.187   0.04 16.07 ? 88   LYS A HB2  1  
ATOM   462    H HB3  . LYS A 1 32  ? -11.542 1.849   4.708   0.04 16.09 ? 88   LYS A HB3  1  
ATOM   463    H HG2  . LYS A 1 32  ? -13.692 2.723   3.977   0.04 17.00 ? 88   LYS A HG2  1  
ATOM   464    H HG3  . LYS A 1 32  ? -13.324 2.191   2.530   0.04 16.99 ? 88   LYS A HG3  1  
ATOM   465    H HD2  . LYS A 1 32  ? -13.700 0.533   4.826   0.04 16.77 ? 88   LYS A HD2  1  
ATOM   466    H HD3  . LYS A 1 32  ? -14.687 0.579   3.575   0.04 17.35 ? 88   LYS A HD3  1  
ATOM   467    H HE2  . LYS A 1 32  ? -12.781 -0.293  2.308   0.04 16.99 ? 88   LYS A HE2  1  
ATOM   468    H HE3  . LYS A 1 32  ? -12.172 -0.653  3.727   0.04 16.40 ? 88   LYS A HE3  1  
ATOM   469    H HZ1  . LYS A 1 32  ? -13.324 -2.459  2.804   0.04 16.83 ? 88   LYS A HZ1  1  
ATOM   470    H HZ2  . LYS A 1 32  ? -13.943 -2.088  4.058   0.04 16.77 ? 88   LYS A HZ2  1  
ATOM   471    H HZ3  . LYS A 1 32  ? -14.554 -1.710  2.798   0.04 17.29 ? 88   LYS A HZ3  1  
ATOM   472    N N    . GLN A 1 33  ? -8.716  3.510   4.458   0.04 15.21 ? 89   GLN A N    1  
ATOM   473    C CA   . GLN A 1 33  ? -7.617  3.418   5.437   0.04 14.74 ? 89   GLN A CA   1  
ATOM   474    C C    . GLN A 1 33  ? -6.654  4.582   5.469   0.04 14.59 ? 89   GLN A C    1  
ATOM   475    O O    . GLN A 1 33  ? -5.865  4.730   6.403   0.04 14.27 ? 89   GLN A O    1  
ATOM   476    C CB   . GLN A 1 33  ? -6.801  2.144   5.200   0.04 14.46 ? 89   GLN A CB   1  
ATOM   477    C CG   . GLN A 1 33  ? -7.590  0.877   5.475   0.04 14.55 ? 89   GLN A CG   1  
ATOM   478    C CD   . GLN A 1 33  ? -8.072  0.796   6.920   0.04 14.57 ? 89   GLN A CD   1  
ATOM   479    O OE1  . GLN A 1 33  ? -9.077  1.377   7.302   0.04 14.92 ? 89   GLN A OE1  1  
ATOM   480    N NE2  . GLN A 1 33  ? -7.334  0.033   7.730   0.04 14.23 ? 89   GLN A NE2  1  
ATOM   481    H H    . GLN A 1 33  ? -8.477  3.362   3.651   0.04 15.27 ? 89   GLN A H    1  
ATOM   482    H HA   . GLN A 1 33  ? -8.000  3.363   6.326   0.04 14.71 ? 89   GLN A HA   1  
ATOM   483    H HB2  . GLN A 1 33  ? -6.494  2.124   4.284   0.04 14.53 ? 89   GLN A HB2  1  
ATOM   484    H HB3  . GLN A 1 33  ? -6.039  2.152   5.796   0.04 14.18 ? 89   GLN A HB3  1  
ATOM   485    H HG2  . GLN A 1 33  ? -8.356  0.842   4.885   0.04 14.83 ? 89   GLN A HG2  1  
ATOM   486    H HG3  . GLN A 1 33  ? -7.013  0.113   5.325   0.04 14.35 ? 89   GLN A HG3  1  
ATOM   487    H HE21 . GLN A 1 33  ? -7.060  -0.731  7.466   0.04 14.00 ? 89   GLN A HE21 1  
ATOM   488    H HE22 . GLN A 1 33  ? -7.130  0.313   8.517   0.04 14.25 ? 89   GLN A HE22 1  
ATOM   489    N N    . GLU A 1 34  ? -6.730  5.418   4.463   0.04 14.86 ? 90   GLU A N    1  
ATOM   490    C CA   . GLU A 1 34  ? -5.742  6.461   4.261   0.04 14.80 ? 90   GLU A CA   1  
ATOM   491    C C    . GLU A 1 34  ? -5.561  7.402   5.466   0.04 14.64 ? 90   GLU A C    1  
ATOM   492    O O    . GLU A 1 34  ? -4.424  7.695   5.868   0.04 14.34 ? 90   GLU A O    1  
ATOM   493    C CB   . GLU A 1 34  ? -6.091  7.217   2.972   0.04 15.25 ? 90   GLU A CB   1  
ATOM   494    C CG   . GLU A 1 34  ? -5.859  8.706   3.033   0.04 15.26 ? 90   GLU A CG   1  
ATOM   495    C CD   . GLU A 1 34  ? -5.963  9.424   1.681   0.04 15.75 ? 90   GLU A CD   1  
ATOM   496    O OE1  . GLU A 1 34  ? -6.887  9.146   0.883   0.04 16.13 ? 90   GLU A OE1  1  
ATOM   497    O OE2  . GLU A 1 34  ? -5.133  10.324  1.446   0.04 15.79 ? 90   GLU A OE2  1  
ATOM   498    H H    . GLU A 1 34  ? -7.348  5.398   3.866   0.04 15.11 ? 90   GLU A H    1  
ATOM   499    H HA   . GLU A 1 34  ? -4.886  6.029   4.110   0.04 14.58 ? 90   GLU A HA   1  
ATOM   500    H HB2  . GLU A 1 34  ? -5.544  6.866   2.255   0.04 15.35 ? 90   GLU A HB2  1  
ATOM   501    H HB3  . GLU A 1 34  ? -7.026  7.079   2.758   0.04 15.49 ? 90   GLU A HB3  1  
ATOM   502    H HG2  . GLU A 1 34  ? -6.524  9.099   3.622   0.04 15.22 ? 90   GLU A HG2  1  
ATOM   503    H HG3  . GLU A 1 34  ? -4.967  8.872   3.379   0.04 15.02 ? 90   GLU A HG3  1  
ATOM   504    N N    . SER A 1 35  ? -6.668  7.879   6.030   0.04 14.90 ? 91   SER A N    1  
ATOM   505    C CA   . SER A 1 35  ? -6.583  8.770   7.193   0.04 14.82 ? 91   SER A CA   1  
ATOM   506    C C    . SER A 1 35  ? -7.048  8.067   8.472   0.04 14.69 ? 91   SER A C    1  
ATOM   507    O O    . SER A 1 35  ? -7.302  8.717   9.480   0.04 14.74 ? 91   SER A O    1  
ATOM   508    C CB   . SER A 1 35  ? -7.419  10.048  7.017   0.04 15.27 ? 91   SER A CB   1  
ATOM   509    O OG   . SER A 1 35  ? -7.244  10.645  5.766   0.04 15.50 ? 91   SER A OG   1  
ATOM   510    H H    . SER A 1 35  ? -7.464  7.696   5.771   0.04 15.12 ? 91   SER A H    1  
ATOM   511    H HA   . SER A 1 35  ? -5.663  9.043   7.321   0.04 14.61 ? 91   SER A HA   1  
ATOM   512    H HB2  . SER A 1 35  ? -8.356  9.846   7.122   0.04 15.49 ? 91   SER A HB2  1  
ATOM   513    H HB3  . SER A 1 35  ? -7.147  10.681  7.695   0.04 15.21 ? 91   SER A HB3  1  
ATOM   514    H HG   . SER A 1 35  ? -8.011  10.621  5.424   0.04 15.76 ? 91   SER A HG   1  
ATOM   515    N N    . ASN A 1 36  ? -7.222  6.751   8.401   0.04 14.58 ? 92   ASN A N    1  
ATOM   516    C CA   . ASN A 1 36  ? -7.824  5.988   9.517   0.04 14.54 ? 92   ASN A CA   1  
ATOM   517    C C    . ASN A 1 36  ? -6.763  5.620   10.568  0.04 14.12 ? 92   ASN A C    1  
ATOM   518    O O    . ASN A 1 36  ? -6.447  4.446   10.787  0.04 13.92 ? 92   ASN A O    1  
ATOM   519    C CB   . ASN A 1 36  ? -8.476  4.730   8.943   0.04 14.68 ? 92   ASN A CB   1  
ATOM   520    C CG   . ASN A 1 36  ? -9.504  4.094   9.869   0.04 14.81 ? 92   ASN A CG   1  
ATOM   521    O OD1  . ASN A 1 36  ? -9.640  4.471   11.046  0.04 14.84 ? 92   ASN A OD1  1  
ATOM   522    N ND2  . ASN A 1 36  ? -10.211 3.097   9.342   0.04 14.92 ? 92   ASN A ND2  1  
ATOM   523    H H    . ASN A 1 36  ? -7.018  6.270   7.720   0.04 14.55 ? 92   ASN A H    1  
ATOM   524    H HA   . ASN A 1 36  ? -8.506  6.525   9.948   0.04 14.75 ? 92   ASN A HA   1  
ATOM   525    H HB2  . ASN A 1 36  ? -8.939  4.970   8.125   0.04 14.95 ? 92   ASN A HB2  1  
ATOM   526    H HB3  . ASN A 1 36  ? -7.788  4.073   8.759   0.04 14.47 ? 92   ASN A HB3  1  
ATOM   527    H HD21 . ASN A 1 36  ? -10.865 2.751   9.782   0.04 14.92 ? 92   ASN A HD21 1  
ATOM   528    H HD22 . ASN A 1 36  ? -10.031 2.807   8.552   0.04 15.01 ? 92   ASN A HD22 1  
ATOM   529    N N    . GLN A 1 37  ? -6.213  6.630   11.234  0.04 14.02 ? 93   GLN A N    1  
ATOM   530    C CA   . GLN A 1 37  ? -5.043  6.444   12.066  0.04 13.65 ? 93   GLN A CA   1  
ATOM   531    C C    . GLN A 1 37  ? -5.300  5.584   13.303  0.04 13.55 ? 93   GLN A C    1  
ATOM   532    O O    . GLN A 1 37  ? -4.416  4.864   13.726  0.04 13.26 ? 93   GLN A O    1  
ATOM   533    C CB   . GLN A 1 37  ? -4.416  7.813   12.438  0.04 13.64 ? 93   GLN A CB   1  
ATOM   534    C CG   . GLN A 1 37  ? -3.157  7.695   13.297  0.04 13.30 ? 93   GLN A CG   1  
ATOM   535    C CD   . GLN A 1 37  ? -2.437  9.020   13.534  0.04 13.30 ? 93   GLN A CD   1  
ATOM   536    O OE1  . GLN A 1 37  ? -2.912  10.121  13.270  0.04 13.55 ? 93   GLN A OE1  1  
ATOM   537    N NE2  . GLN A 1 37  ? -1.317  8.912   14.051  0.04 13.05 ? 93   GLN A NE2  1  
ATOM   538    H H    . GLN A 1 37  ? -6.513  7.435   11.219  0.04 14.19 ? 93   GLN A H    1  
ATOM   539    H HA   . GLN A 1 37  ? -4.375  5.978   11.539  0.04 13.49 ? 93   GLN A HA   1  
ATOM   540    H HB2  . GLN A 1 37  ? -4.179  8.288   11.631  0.04 13.71 ? 93   GLN A HB2  1  
ATOM   541    H HB3  . GLN A 1 37  ? -5.080  8.330   12.923  0.04 13.84 ? 93   GLN A HB3  1  
ATOM   542    H HG2  . GLN A 1 37  ? -3.387  7.310   14.153  0.04 13.27 ? 93   GLN A HG2  1  
ATOM   543    H HG3  . GLN A 1 37  ? -2.523  7.108   12.860  0.04 13.12 ? 93   GLN A HG3  1  
ATOM   544    H HE21 . GLN A 1 37  ? -0.695  8.828   13.504  0.04 12.95 ? 93   GLN A HE21 1  
ATOM   545    H HE22 . GLN A 1 37  ? -1.219  9.057   14.866  0.04 13.03 ? 93   GLN A HE22 1  
ATOM   546    N N    . PHE A 1 38  ? -6.506  5.677   13.874  0.04 13.83 ? 94   PHE A N    1  
ATOM   547    C CA   . PHE A 1 38  ? -6.817  4.961   15.113  0.04 13.78 ? 94   PHE A CA   1  
ATOM   548    C C    . PHE A 1 38  ? -8.159  4.202   15.034  0.04 14.03 ? 94   PHE A C    1  
ATOM   549    O O    . PHE A 1 38  ? -8.869  4.033   16.054  0.04 14.07 ? 94   PHE A O    1  
ATOM   550    C CB   . PHE A 1 38  ? -6.867  5.947   16.292  0.04 13.89 ? 94   PHE A CB   1  
ATOM   551    C CG   . PHE A 1 38  ? -5.559  6.710   16.550  0.04 13.64 ? 94   PHE A CG   1  
ATOM   552    C CD1  . PHE A 1 38  ? -4.429  6.083   17.085  0.04 13.31 ? 94   PHE A CD1  1  
ATOM   553    C CD2  . PHE A 1 38  ? -5.495  8.096   16.316  0.04 13.79 ? 94   PHE A CD2  1  
ATOM   554    C CE1  . PHE A 1 38  ? -3.261  6.802   17.335  0.04 13.13 ? 94   PHE A CE1  1  
ATOM   555    C CE2  . PHE A 1 38  ? -4.321  8.810   16.580  0.04 13.61 ? 94   PHE A CE2  1  
ATOM   556    C CZ   . PHE A 1 38  ? -3.232  8.184   17.097  0.04 13.29 ? 94   PHE A CZ   1  
ATOM   557    H H    . PHE A 1 38  ? -7.151  6.150   13.569  0.04 14.06 ? 94   PHE A H    1  
ATOM   558    H HA   . PHE A 1 38  ? -6.127  4.304   15.294  0.04 13.54 ? 94   PHE A HA   1  
ATOM   559    H HB2  . PHE A 1 38  ? -7.561  6.601   16.117  0.04 14.14 ? 94   PHE A HB2  1  
ATOM   560    H HB3  . PHE A 1 38  ? -7.080  5.447   17.094  0.04 13.91 ? 94   PHE A HB3  1  
ATOM   561    H HD1  . PHE A 1 38  ? -4.444  5.169   17.254  0.04 13.23 ? 94   PHE A HD1  1  
ATOM   562    H HD2  . PHE A 1 38  ? -6.234  8.539   15.980  0.04 14.04 ? 94   PHE A HD2  1  
ATOM   563    H HE1  . PHE A 1 38  ? -2.516  6.372   17.679  0.04 12.94 ? 94   PHE A HE1  1  
ATOM   564    H HE2  . PHE A 1 38  ? -4.286  9.725   16.415  0.04 13.74 ? 94   PHE A HE2  1  
ATOM   565    H HZ   . PHE A 1 38  ? -2.453  8.665   17.253  0.04 13.19 ? 94   PHE A HZ   1  
ATOM   566    N N    . GLY A 1 39  ? -8.481  3.687   13.850  0.04 14.22 ? 95   GLY A N    1  
ATOM   567    C CA   . GLY A 1 39  ? -9.654  2.855   13.712  0.04 14.49 ? 95   GLY A CA   1  
ATOM   568    C C    . GLY A 1 39  ? -9.315  1.388   13.834  0.04 14.29 ? 95   GLY A C    1  
ATOM   569    O O    . GLY A 1 39  ? -8.146  1.028   13.871  0.04 13.94 ? 95   GLY A O    1  
ATOM   570    H H    . GLY A 1 39  ? -8.032  3.802   13.130  0.04 14.22 ? 95   GLY A H    1  
ATOM   571    H HA2  . GLY A 1 39  ? -10.303 3.078   14.398  0.04 14.69 ? 95   GLY A HA2  1  
ATOM   572    H HA3  . GLY A 1 39  ? -10.069 2.993   12.848  0.04 14.65 ? 95   GLY A HA3  1  
ATOM   573    N N    . THR A 1 40  ? -10.332 0.545   13.815  0.04 14.57 ? 96   THR A N    1  
ATOM   574    C CA   . THR A 1 40  ? -10.135 -0.887  14.020  0.04 14.46 ? 96   THR A CA   1  
ATOM   575    C C    . THR A 1 40  ? -10.223 -1.769  12.753  0.04 14.53 ? 96   THR A C    1  
ATOM   576    O O    . THR A 1 40  ? -9.964  -2.985  12.841  0.04 14.50 ? 96   THR A O    1  
ATOM   577    C CB   . THR A 1 40  ? -11.092 -1.404  15.124  0.04 14.75 ? 96   THR A CB   1  
ATOM   578    O OG1  . THR A 1 40  ? -12.443 -1.064  14.791  0.04 15.18 ? 96   THR A OG1  1  
ATOM   579    C CG2  . THR A 1 40  ? -10.751 -0.803  16.490  0.04 14.64 ? 96   THR A CG2  1  
ATOM   580    H H    . THR A 1 40  ? -11.146 0.768   13.664  0.04 14.84 ? 96   THR A H    1  
ATOM   581    H HA   . THR A 1 40  ? -9.240  -1.018  14.367  0.04 14.19 ? 96   THR A HA   1  
ATOM   582    H HB   . THR A 1 40  ? -11.008 -2.370  15.190  0.04 14.74 ? 96   THR A HB   1  
ATOM   583    H HG1  . THR A 1 40  ? -12.579 -1.213  13.976  0.04 15.28 ? 96   THR A HG1  1  
ATOM   584    H HG21 . THR A 1 40  ? -11.313 -0.034  16.665  0.04 14.89 ? 96   THR A HG21 1  
ATOM   585    H HG22 . THR A 1 40  ? -10.886 -1.463  17.186  0.04 14.56 ? 96   THR A HG22 1  
ATOM   586    H HG23 . THR A 1 40  ? -9.828  -0.518  16.510  0.04 14.42 ? 96   THR A HG23 1  
ATOM   587    N N    . ASP A 1 41  ? -10.551 -1.195  11.595  0.04 14.62 ? 97   ASP A N    1  
ATOM   588    C CA   . ASP A 1 41  ? -10.433 -1.912  10.319  0.04 14.67 ? 97   ASP A CA   1  
ATOM   589    C C    . ASP A 1 41  ? -8.953  -2.379  10.211  0.04 14.29 ? 97   ASP A C    1  
ATOM   590    O O    . ASP A 1 41  ? -8.047  -1.672  10.630  0.04 13.99 ? 97   ASP A O    1  
ATOM   591    C CB   . ASP A 1 41  ? -10.831 -1.019  9.107   0.04 14.97 ? 97   ASP A CB   1  
ATOM   592    C CG   . ASP A 1 41  ? -12.313 -1.267  8.574   0.04 15.43 ? 97   ASP A CG   1  
ATOM   593    O OD1  . ASP A 1 41  ? -12.756 -2.443  8.453   0.04 15.49 ? 97   ASP A OD1  1  
ATOM   594    O OD2  . ASP A 1 41  ? -13.002 -0.286  8.249   0.04 15.75 ? 97   ASP A OD2  1  
ATOM   595    H H    . ASP A 1 41  ? -10.848 -0.393  11.523  0.04 14.66 ? 97   ASP A H    1  
ATOM   596    H HA   . ASP A 1 41  ? -10.996 -2.697  10.332  0.04 14.83 ? 97   ASP A HA   1  
ATOM   597    H HB2  . ASP A 1 41  ? -10.759 -0.092  9.371   0.04 15.02 ? 97   ASP A HB2  1  
ATOM   598    H HB3  . ASP A 1 41  ? -10.218 -1.191  8.376   0.04 14.86 ? 97   ASP A HB3  1  
ATOM   599    N N    . ARG A 1 42  ? -8.750  -3.587  9.681   0.04 14.35 ? 98   ARG A N    1  
ATOM   600    C CA   . ARG A 1 42  ? -7.426  -4.146  9.418   0.04 14.05 ? 98   ARG A CA   1  
ATOM   601    C C    . ARG A 1 42  ? -7.492  -4.905  8.094   0.04 14.24 ? 98   ARG A C    1  
ATOM   602    O O    . ARG A 1 42  ? -8.481  -5.566  7.825   0.04 14.57 ? 98   ARG A O    1  
ATOM   603    C CB   . ARG A 1 42  ? -7.002  -5.111  10.543  0.04 13.94 ? 98   ARG A CB   1  
ATOM   604    C CG   . ARG A 1 42  ? -6.851  -4.519  11.972  0.04 13.77 ? 98   ARG A CG   1  
ATOM   605    C CD   . ARG A 1 42  ? -5.608  -3.671  12.126  0.04 13.44 ? 98   ARG A CD   1  
ATOM   606    N NE   . ARG A 1 42  ? -5.343  -3.222  13.484  0.04 13.28 ? 98   ARG A NE   1  
ATOM   607    C CZ   . ARG A 1 42  ? -5.824  -2.117  14.055  0.04 13.35 ? 98   ARG A CZ   1  
ATOM   608    N NH1  . ARG A 1 42  ? -6.693  -1.355  13.410  0.04 13.59 ? 98   ARG A NH1  1  
ATOM   609    N NH2  . ARG A 1 42  ? -5.467  -1.792  15.298  0.04 13.20 ? 98   ARG A NH2  1  
ATOM   610    H H    . ARG A 1 42  ? -9.386  -4.121  9.456   0.04 14.59 ? 98   ARG A H    1  
ATOM   611    H HA   . ARG A 1 42  ? -6.773  -3.436  9.343   0.04 13.84 ? 98   ARG A HA   1  
ATOM   612    H HB2  . ARG A 1 42  ? -7.634  -5.843  10.582  0.04 14.16 ? 98   ARG A HB2  1  
ATOM   613    H HB3  . ARG A 1 42  ? -6.128  -5.452  10.294  0.04 13.77 ? 98   ARG A HB3  1  
ATOM   614    H HG2  . ARG A 1 42  ? -7.626  -3.970  12.173  0.04 13.95 ? 98   ARG A HG2  1  
ATOM   615    H HG3  . ARG A 1 42  ? -6.794  -5.247  12.609  0.04 13.74 ? 98   ARG A HG3  1  
ATOM   616    H HD2  . ARG A 1 42  ? -4.839  -4.174  11.824  0.04 13.29 ? 98   ARG A HD2  1  
ATOM   617    H HD3  . ARG A 1 42  ? -5.710  -2.878  11.583  0.04 13.49 ? 98   ARG A HD3  1  
ATOM   618    H HE   . ARG A 1 42  ? -5.058  -3.825  14.029  0.04 13.15 ? 98   ARG A HE   1  
ATOM   619    H HH11 . ARG A 1 42  ? -6.923  -1.551  12.609  0.04 13.70 ? 98   ARG A HH11 1  
ATOM   620    H HH12 . ARG A 1 42  ? -7.010  -0.650  13.781  0.04 13.66 ? 98   ARG A HH12 1  
ATOM   621    H HH21 . ARG A 1 42  ? -4.916  -2.279  15.738  0.04 13.07 ? 98   ARG A HH21 1  
ATOM   622    H HH22 . ARG A 1 42  ? -5.804  -1.092  15.666  0.04 13.27 ? 98   ARG A HH22 1  
ATOM   623    N N    . TYR A 1 43  ? -6.423  -4.814  7.287   0.04 14.04 ? 99   TYR A N    1  
ATOM   624    C CA   . TYR A 1 43  ? -6.424  -5.441  5.970   0.04 14.23 ? 99   TYR A CA   1  
ATOM   625    C C    . TYR A 1 43  ? -5.061  -5.986  5.583   0.04 13.97 ? 99   TYR A C    1  
ATOM   626    O O    . TYR A 1 43  ? -4.010  -5.347  5.761   0.04 13.67 ? 99   TYR A O    1  
ATOM   627    C CB   . TYR A 1 43  ? -6.913  -4.461  4.876   0.04 14.43 ? 99   TYR A CB   1  
ATOM   628    C CG   . TYR A 1 43  ? -8.308  -3.912  5.128   0.04 14.77 ? 99   TYR A CG   1  
ATOM   629    C CD1  . TYR A 1 43  ? -8.486  -2.658  5.697   0.04 14.69 ? 99   TYR A CD1  1  
ATOM   630    C CD2  . TYR A 1 43  ? -9.426  -4.656  4.801   0.04 15.20 ? 99   TYR A CD2  1  
ATOM   631    C CE1  . TYR A 1 43  ? -9.733  -2.157  5.939   0.04 15.04 ? 99   TYR A CE1  1  
ATOM   632    C CE2  . TYR A 1 43  ? -10.723 -4.155  5.042   0.04 15.56 ? 99   TYR A CE2  1  
ATOM   633    C CZ   . TYR A 1 43  ? -10.847 -2.897  5.629   0.04 15.47 ? 99   TYR A CZ   1  
ATOM   634    O OH   . TYR A 1 43  ? -12.084 -2.356  5.886   0.04 15.86 ? 99   TYR A OH   1  
ATOM   635    H H    . TYR A 1 43  ? -5.704  -4.401  7.479   0.04 13.83 ? 99   TYR A H    1  
ATOM   636    H HA   . TYR A 1 43  ? -7.029  -6.195  5.988   0.04 14.44 ? 99   TYR A HA   1  
ATOM   637    H HB2  . TYR A 1 43  ? -6.309  -3.704  4.859   0.04 14.24 ? 99   TYR A HB2  1  
ATOM   638    H HB3  . TYR A 1 43  ? -6.903  -4.911  4.022   0.04 14.57 ? 99   TYR A HB3  1  
ATOM   639    H HD1  . TYR A 1 43  ? -7.743  -2.145  5.924   0.04 14.43 ? 99   TYR A HD1  1  
ATOM   640    H HD2  . TYR A 1 43  ? -9.325  -5.499  4.423   0.04 15.27 ? 99   TYR A HD2  1  
ATOM   641    H HE1  . TYR A 1 43  ? -9.827  -1.315  6.326   0.04 15.00 ? 99   TYR A HE1  1  
ATOM   642    H HE2  . TYR A 1 43  ? -11.476 -4.655  4.826   0.04 15.87 ? 99   TYR A HE2  1  
ATOM   643    H HH   . TYR A 1 43  ? -12.223 -1.692  5.392   0.04 16.12 ? 99   TYR A HH   1  
ATOM   644    N N    . ALA A 1 44  ? -5.098  -7.192  5.020   0.04 14.12 ? 100  ALA A N    1  
ATOM   645    C CA   . ALA A 1 44  ? -3.921  -7.759  4.351   0.04 13.98 ? 100  ALA A CA   1  
ATOM   646    C C    . ALA A 1 44  ? -4.255  -7.940  2.892   0.04 14.28 ? 100  ALA A C    1  
ATOM   647    O O    . ALA A 1 44  ? -5.308  -8.467  2.534   0.04 14.61 ? 100  ALA A O    1  
ATOM   648    C CB   . ALA A 1 44  ? -3.515  -9.087  4.962   0.04 13.92 ? 100  ALA A CB   1  
ATOM   649    H H    . ALA A 1 44  ? -5.786  -7.702  5.007   0.04 14.33 ? 100  ALA A H    1  
ATOM   650    H HA   . ALA A 1 44  ? -3.179  -7.147  4.419   0.04 13.76 ? 100  ALA A HA   1  
ATOM   651    H HB1  . ALA A 1 44  ? -2.782  -9.454  4.446   0.04 13.89 ? 100  ALA A HB1  1  
ATOM   652    H HB2  . ALA A 1 44  ? -3.231  -8.938  5.876   0.04 13.72 ? 100  ALA A HB2  1  
ATOM   653    H HB3  . ALA A 1 44  ? -4.269  -9.693  4.940   0.04 14.14 ? 100  ALA A HB3  1  
ATOM   654    N N    . LEU A 1 45  ? -3.350  -7.460  2.041   0.04 14.18 ? 101  LEU A N    1  
ATOM   655    C CA   . LEU A 1 45  ? -3.470  -7.610  0.584   0.04 14.48 ? 101  LEU A CA   1  
ATOM   656    C C    . LEU A 1 45  ? -2.367  -8.593  0.166   0.04 14.40 ? 101  LEU A C    1  
ATOM   657    O O    . LEU A 1 45  ? -1.160  -8.346  0.393   0.04 14.11 ? 101  LEU A O    1  
ATOM   658    C CB   . LEU A 1 45  ? -3.285  -6.249  -0.115  0.04 14.49 ? 101  LEU A CB   1  
ATOM   659    C CG   . LEU A 1 45  ? -4.100  -5.089  0.468   0.04 14.51 ? 101  LEU A CG   1  
ATOM   660    C CD1  . LEU A 1 45  ? -3.818  -3.775  -0.270  0.04 14.53 ? 101  LEU A CD1  1  
ATOM   661    C CD2  . LEU A 1 45  ? -5.601  -5.377  0.426   0.04 14.90 ? 101  LEU A CD2  1  
ATOM   662    H H    . LEU A 1 45  ? -2.645  -7.040  2.281   0.04 13.97 ? 101  LEU A H    1  
ATOM   663    H HA   . LEU A 1 45  ? -4.333  -7.974  0.348   0.04 14.74 ? 101  LEU A HA   1  
ATOM   664    H HB2  . LEU A 1 45  ? -2.349  -6.005  -0.055  0.04 14.27 ? 101  LEU A HB2  1  
ATOM   665    H HB3  . LEU A 1 45  ? -3.544  -6.347  -1.043  0.04 14.74 ? 101  LEU A HB3  1  
ATOM   666    H HG   . LEU A 1 45  ? -3.840  -4.973  1.396   0.04 14.28 ? 101  LEU A HG   1  
ATOM   667    H HD11 . LEU A 1 45  ? -4.334  -3.065  0.140   0.04 14.60 ? 101  LEU A HD11 1  
ATOM   668    H HD12 . LEU A 1 45  ? -2.870  -3.578  -0.212  0.04 14.28 ? 101  LEU A HD12 1  
ATOM   669    H HD13 . LEU A 1 45  ? -4.078  -3.873  -1.201  0.04 14.74 ? 101  LEU A HD13 1  
ATOM   670    H HD21 . LEU A 1 45  ? -6.076  -4.584  0.717   0.04 14.95 ? 101  LEU A HD21 1  
ATOM   671    H HD22 . LEU A 1 45  ? -5.855  -5.597  -0.485  0.04 15.14 ? 101  LEU A HD22 1  
ATOM   672    H HD23 . LEU A 1 45  ? -5.801  -6.117  1.019   0.04 14.88 ? 101  LEU A HD23 1  
ATOM   673    N N    . MET A 1 46  ? -2.763  -9.722  -0.408  0.04 14.70 ? 102  MET A N    1  
ATOM   674    C CA   . MET A 1 46  ? -1.838  -10.807 -0.730  0.04 14.70 ? 102  MET A CA   1  
ATOM   675    C C    . MET A 1 46  ? -1.949  -11.122 -2.204  0.04 15.05 ? 102  MET A C    1  
ATOM   676    O O    . MET A 1 46  ? -3.042  -11.260 -2.739  0.04 15.40 ? 102  MET A O    1  
ATOM   677    C CB   . MET A 1 46  ? -2.196  -12.068 0.057   0.04 14.78 ? 102  MET A CB   1  
ATOM   678    C CG   . MET A 1 46  ? -1.878  -12.042 1.542   0.04 14.45 ? 102  MET A CG   1  
ATOM   679    S SD   . MET A 1 46  ? -0.086  -12.059 1.785   0.04 14.10 ? 102  MET A SD   1  
ATOM   680    C CE   . MET A 1 46  ? 0.108   -12.197 3.526   0.04 13.82 ? 102  MET A CE   1  
ATOM   681    H H    . MET A 1 46  ? -3.576  -9.892  -0.629  0.04 14.93 ? 102  MET A H    1  
ATOM   682    H HA   . MET A 1 46  ? -0.931  -10.553 -0.506  0.04 14.45 ? 102  MET A HA   1  
ATOM   683    H HB2  . MET A 1 46  ? -3.147  -12.215 -0.036  0.04 15.00 ? 102  MET A HB2  1  
ATOM   684    H HB3  . MET A 1 46  ? -1.713  -12.811 -0.329  0.04 14.86 ? 102  MET A HB3  1  
ATOM   685    H HG2  . MET A 1 46  ? -2.229  -11.229 1.931   0.04 14.35 ? 102  MET A HG2  1  
ATOM   686    H HG3  . MET A 1 46  ? -2.238  -12.822 1.983   0.04 14.56 ? 102  MET A HG3  1  
ATOM   687    H HE1  . MET A 1 46  ? 1.026   -12.455 3.699   0.04 13.68 ? 102  MET A HE1  1  
ATOM   688    H HE2  . MET A 1 46  ? -0.080  -11.340 3.938   0.04 13.70 ? 102  MET A HE2  1  
ATOM   689    H HE3  . MET A 1 46  ? -0.503  -12.867 3.867   0.04 13.98 ? 102  MET A HE3  1  
ATOM   690    N N    . PHE A 1 47  ? -0.805  -11.253 -2.858  0.04 15.00 ? 103  PHE A N    1  
ATOM   691    C CA   . PHE A 1 47  ? -0.780  -11.439 -4.305  0.04 15.34 ? 103  PHE A CA   1  
ATOM   692    C C    . PHE A 1 47  ? -0.137  -12.754 -4.685  0.04 15.47 ? 103  PHE A C    1  
ATOM   693    O O    . PHE A 1 47  ? 1.011   -13.036 -4.345  0.04 15.24 ? 103  PHE A O    1  
ATOM   694    C CB   . PHE A 1 47  ? -0.046  -10.263 -4.965  0.04 15.23 ? 103  PHE A CB   1  
ATOM   695    C CG   . PHE A 1 47  ? -0.792  -8.961  -4.863  0.04 15.24 ? 103  PHE A CG   1  
ATOM   696    C CD1  . PHE A 1 47  ? -0.834  -8.248  -3.680  0.04 14.92 ? 103  PHE A CD1  1  
ATOM   697    C CD2  . PHE A 1 47  ? -1.475  -8.472  -5.959  0.04 15.61 ? 103  PHE A CD2  1  
ATOM   698    C CE1  . PHE A 1 47  ? -1.540  -7.084  -3.619  0.04 14.99 ? 103  PHE A CE1  1  
ATOM   699    C CE2  . PHE A 1 47  ? -2.175  -7.307  -5.881  0.04 15.68 ? 103  PHE A CE2  1  
ATOM   700    C CZ   . PHE A 1 47  ? -2.191  -6.605  -4.718  0.04 15.37 ? 103  PHE A CZ   1  
ATOM   701    H H    . PHE A 1 47  ? -0.034  -11.235 -2.488  0.04 14.78 ? 103  PHE A H    1  
ATOM   702    H HA   . PHE A 1 47  ? -1.686  -11.449 -4.645  0.04 15.59 ? 103  PHE A HA   1  
ATOM   703    H HB2  . PHE A 1 47  ? 0.819   -10.153 -4.540  0.04 14.96 ? 103  PHE A HB2  1  
ATOM   704    H HB3  . PHE A 1 47  ? 0.065   -10.463 -5.907  0.04 15.45 ? 103  PHE A HB3  1  
ATOM   705    H HD1  . PHE A 1 47  ? -0.387  -8.567  -2.929  0.04 14.69 ? 103  PHE A HD1  1  
ATOM   706    H HD2  . PHE A 1 47  ? -1.457  -8.943  -6.756  0.04 15.84 ? 103  PHE A HD2  1  
ATOM   707    H HE1  . PHE A 1 47  ? -1.563  -6.598  -2.826  0.04 14.80 ? 103  PHE A HE1  1  
ATOM   708    H HE2  . PHE A 1 47  ? -2.617  -6.986  -6.633  0.04 15.96 ? 103  PHE A HE2  1  
ATOM   709    H HZ   . PHE A 1 47  ? -2.668  -5.809  -4.661  0.04 15.44 ? 103  PHE A HZ   1  
ATOM   710    N N    . LYS A 1 48  ? -0.896  -13.552 -5.408  0.04 15.89 ? 104  LYS A N    1  
ATOM   711    C CA   . LYS A 1 48  ? -0.414  -14.836 -5.917  0.04 16.11 ? 104  LYS A CA   1  
ATOM   712    C C    . LYS A 1 48  ? 0.747   -14.619 -6.892  0.04 16.15 ? 104  LYS A C    1  
ATOM   713    O O    . LYS A 1 48  ? 0.813   -13.588 -7.567  0.04 16.19 ? 104  LYS A O    1  
ATOM   714    C CB   . LYS A 1 48  ? -1.541  -15.569 -6.637  0.04 16.60 ? 104  LYS A CB   1  
ATOM   715    C CG   . LYS A 1 48  ? -2.682  -16.046 -5.742  0.04 16.64 ? 104  LYS A CG   1  
ATOM   716    C CD   . LYS A 1 48  ? -3.462  -17.253 -6.372  0.04 17.17 ? 104  LYS A CD   1  
ATOM   717    C CE   . LYS A 1 48  ? -3.980  -18.188 -5.293  0.04 17.23 ? 104  LYS A CE   1  
ATOM   718    N NZ   . LYS A 1 48  ? -4.910  -19.224 -5.837  0.04 17.80 ? 104  LYS A NZ   1  
ATOM   719    H H    . LYS A 1 48  ? -1.705  -13.368 -5.628  0.04 16.08 ? 104  LYS A H    1  
ATOM   720    H HA   . LYS A 1 48  ? -0.119  -15.382 -5.173  0.04 15.93 ? 104  LYS A HA   1  
ATOM   721    H HB2  . LYS A 1 48  ? -1.911  -14.970 -7.303  0.04 16.78 ? 104  LYS A HB2  1  
ATOM   722    H HB3  . LYS A 1 48  ? -1.164  -16.351 -7.071  0.04 16.77 ? 104  LYS A HB3  1  
ATOM   723    H HG2  . LYS A 1 48  ? -2.314  -16.328 -4.891  0.04 16.39 ? 104  LYS A HG2  1  
ATOM   724    H HG3  . LYS A 1 48  ? -3.311  -15.320 -5.610  0.04 16.62 ? 104  LYS A HG3  1  
ATOM   725    H HD2  . LYS A 1 48  ? -4.213  -16.926 -6.886  0.04 17.44 ? 104  LYS A HD2  1  
ATOM   726    H HD3  . LYS A 1 48  ? -2.871  -17.768 -6.943  0.04 17.24 ? 104  LYS A HD3  1  
ATOM   727    H HE2  . LYS A 1 48  ? -3.236  -18.648 -4.884  0.04 17.04 ? 104  LYS A HE2  1  
ATOM   728    H HE3  . LYS A 1 48  ? -4.456  -17.668 -4.627  0.04 17.11 ? 104  LYS A HE3  1  
ATOM   729    H HZ1  . LYS A 1 48  ? -5.379  -19.593 -5.177  0.04 17.83 ? 104  LYS A HZ1  1  
ATOM   730    H HZ2  . LYS A 1 48  ? -5.471  -18.852 -6.417  0.04 18.03 ? 104  LYS A HZ2  1  
ATOM   731    H HZ3  . LYS A 1 48  ? -4.447  -19.863 -6.248  0.04 17.92 ? 104  LYS A HZ3  1  
ATOM   732    N N    . PRO A 1 49  ? 1.644   -15.591 -7.002  0.04 16.18 ? 105  PRO A N    1  
ATOM   733    C CA   . PRO A 1 49  ? 2.739   -15.435 -7.971  0.04 16.24 ? 105  PRO A CA   1  
ATOM   734    C C    . PRO A 1 49  ? 2.275   -15.189 -9.419  0.04 16.68 ? 105  PRO A C    1  
ATOM   735    O O    . PRO A 1 49  ? 1.295   -15.787 -9.909  0.04 17.03 ? 105  PRO A O    1  
ATOM   736    C CB   . PRO A 1 49  ? 3.484   -16.773 -7.877  0.04 16.32 ? 105  PRO A CB   1  
ATOM   737    C CG   . PRO A 1 49  ? 3.216   -17.260 -6.521  0.04 16.11 ? 105  PRO A CG   1  
ATOM   738    C CD   . PRO A 1 49  ? 1.825   -16.791 -6.164  0.04 16.17 ? 105  PRO A CD   1  
ATOM   739    H HA   . PRO A 1 49  ? 3.329   -14.721 -7.694  0.04 15.97 ? 105  PRO A HA   1  
ATOM   740    H HB2  . PRO A 1 49  ? 3.130   -17.389 -8.540  0.04 16.66 ? 105  PRO A HB2  1  
ATOM   741    H HB3  . PRO A 1 49  ? 4.434   -16.630 -8.008  0.04 16.21 ? 105  PRO A HB3  1  
ATOM   742    H HG2  . PRO A 1 49  ? 3.272   -18.229 -6.510  0.04 16.27 ? 105  PRO A HG2  1  
ATOM   743    H HG3  . PRO A 1 49  ? 3.867   -16.878 -5.912  0.04 15.79 ? 105  PRO A HG3  1  
ATOM   744    H HD2  . PRO A 1 49  ? 1.170   -17.464 -6.402  0.04 16.48 ? 105  PRO A HD2  1  
ATOM   745    H HD3  . PRO A 1 49  ? 1.772   -16.563 -5.224  0.04 15.94 ? 105  PRO A HD3  1  
ATOM   746    N N    . GLY A 1 50  ? 3.014   -14.291 -10.079 0.04 16.67 ? 106  GLY A N    1  
ATOM   747    C CA   . GLY A 1 50  ? 2.749   -13.885 -11.447 0.04 17.07 ? 106  GLY A CA   1  
ATOM   748    C C    . GLY A 1 50  ? 3.152   -12.446 -11.644 0.04 16.91 ? 106  GLY A C    1  
ATOM   749    O O    . GLY A 1 50  ? 3.949   -11.895 -10.878 0.04 16.50 ? 106  GLY A O    1  
ATOM   750    H H    . GLY A 1 50  ? 3.689   -13.887 -9.741  0.04 16.45 ? 106  GLY A H    1  
ATOM   751    H HA2  . GLY A 1 50  ? 3.252   -14.439 -12.065 0.04 17.31 ? 106  GLY A HA2  1  
ATOM   752    H HA3  . GLY A 1 50  ? 1.807   -13.971 -11.642 0.04 17.25 ? 106  GLY A HA3  1  
ATOM   753    N N    . THR A 1 51  ? 2.571   -11.830 -12.659 0.04 17.25 ? 107  THR A N    1  
ATOM   754    C CA   . THR A 1 51  ? 2.879   -10.454 -12.985 0.04 17.23 ? 107  THR A CA   1  
ATOM   755    C C    . THR A 1 51  ? 1.583   -9.659  -13.040 0.04 17.35 ? 107  THR A C    1  
ATOM   756    O O    . THR A 1 51  ? 0.580   -10.112 -13.592 0.04 17.73 ? 107  THR A O    1  
ATOM   757    C CB   . THR A 1 51  ? 3.647   -10.377 -14.313 0.04 17.65 ? 107  THR A CB   1  
ATOM   758    O OG1  . THR A 1 51  ? 4.940   -10.982 -14.156 0.04 17.59 ? 107  THR A OG1  1  
ATOM   759    C CG2  . THR A 1 51  ? 3.824   -8.919  -14.736 0.04 17.66 ? 107  THR A CG2  1  
ATOM   760    H H    . THR A 1 51  ? 1.995   -12.194 -13.180 0.04 17.54 ? 107  THR A H    1  
ATOM   761    H HA   . THR A 1 51  ? 3.443   -10.071 -12.297 0.04 16.90 ? 107  THR A HA   1  
ATOM   762    H HB   . THR A 1 51  ? 3.149   -10.848 -15.000 0.04 17.99 ? 107  THR A HB   1  
ATOM   763    H HG1  . THR A 1 51  ? 5.517   -10.401 -13.981 0.04 17.46 ? 107  THR A HG1  1  
ATOM   764    H HG21 . THR A 1 51  ? 4.676   -8.799  -15.186 0.04 17.75 ? 107  THR A HG21 1  
ATOM   765    H HG22 . THR A 1 51  ? 3.106   -8.674  -15.341 0.04 17.93 ? 107  THR A HG22 1  
ATOM   766    H HG23 . THR A 1 51  ? 3.797   -8.342  -13.958 0.04 17.33 ? 107  THR A HG23 1  
ATOM   767    N N    . TYR A 1 52  ? 1.615   -8.488  -12.417 0.04 17.03 ? 108  TYR A N    1  
ATOM   768    C CA   . TYR A 1 52  ? 0.483   -7.572  -12.332 0.04 17.10 ? 108  TYR A CA   1  
ATOM   769    C C    . TYR A 1 52  ? 0.846   -6.290  -13.047 0.04 17.20 ? 108  TYR A C    1  
ATOM   770    O O    . TYR A 1 52  ? 1.999   -5.862  -13.009 0.04 16.91 ? 108  TYR A O    1  
ATOM   771    C CB   . TYR A 1 52  ? 0.125   -7.286  -10.877 0.04 16.66 ? 108  TYR A CB   1  
ATOM   772    C CG   . TYR A 1 52  ? -0.199  -8.542  -10.137 0.04 16.56 ? 108  TYR A CG   1  
ATOM   773    C CD1  . TYR A 1 52  ? 0.794   -9.367  -9.622  0.04 16.30 ? 108  TYR A CD1  1  
ATOM   774    C CD2  . TYR A 1 52  ? -1.506  -8.924  -9.979  0.04 16.77 ? 108  TYR A CD2  1  
ATOM   775    C CE1  . TYR A 1 52  ? 0.475   -10.542 -8.982  0.04 16.27 ? 108  TYR A CE1  1  
ATOM   776    C CE2  . TYR A 1 52  ? -1.831  -10.087 -9.337  0.04 16.73 ? 108  TYR A CE2  1  
ATOM   777    C CZ   . TYR A 1 52  ? -0.839  -10.889 -8.820  0.04 16.47 ? 108  TYR A CZ   1  
ATOM   778    O OH   . TYR A 1 52  ? -1.240  -12.050 -8.182  0.04 16.48 ? 108  TYR A OH   1  
ATOM   779    H H    . TYR A 1 52  ? 2.308   -8.191  -12.010 0.04 16.77 ? 108  TYR A H    1  
ATOM   780    H HA   . TYR A 1 52  ? -0.287  -7.964  -12.772 0.04 17.41 ? 108  TYR A HA   1  
ATOM   781    H HB2  . TYR A 1 52  ? 0.874   -6.855  -10.436 0.04 16.37 ? 108  TYR A HB2  1  
ATOM   782    H HB3  . TYR A 1 52  ? -0.658  -6.714  -10.858 0.04 16.74 ? 108  TYR A HB3  1  
ATOM   783    H HD1  . TYR A 1 52  ? 1.690   -9.129  -9.732  0.04 16.18 ? 108  TYR A HD1  1  
ATOM   784    H HD2  . TYR A 1 52  ? -2.177  -8.382  -10.322 0.04 16.97 ? 108  TYR A HD2  1  
ATOM   785    H HE1  . TYR A 1 52  ? 1.142   -11.082 -8.634  0.04 16.12 ? 108  TYR A HE1  1  
ATOM   786    H HE2  . TYR A 1 52  ? -2.723  -10.326 -9.228  0.04 16.90 ? 108  TYR A HE2  1  
ATOM   787    H HH   . TYR A 1 52  ? -0.588  -12.393 -7.778  0.04 16.57 ? 108  TYR A HH   1  
ATOM   788    N N    . ASN A 1 53  ? -0.117  -5.730  -13.782 0.04 17.66 ? 109  ASN A N    1  
ATOM   789    C CA   . ASN A 1 53  ? 0.124   -4.495  -14.516 0.04 17.85 ? 109  ASN A CA   1  
ATOM   790    C C    . ASN A 1 53  ? -0.830  -3.378  -14.145 0.04 17.86 ? 109  ASN A C    1  
ATOM   791    O O    . ASN A 1 53  ? -1.896  -3.604  -13.571 0.04 17.86 ? 109  ASN A O    1  
ATOM   792    C CB   . ASN A 1 53  ? 0.149   -4.734  -16.019 0.04 18.44 ? 109  ASN A CB   1  
ATOM   793    C CG   . ASN A 1 53  ? 1.486   -5.276  -16.448 0.04 18.48 ? 109  ASN A CG   1  
ATOM   794    O OD1  . ASN A 1 53  ? 2.435   -4.542  -16.634 0.04 18.72 ? 109  ASN A OD1  1  
ATOM   795    N ND2  . ASN A 1 53  ? 1.583   -6.560  -16.460 0.04 18.30 ? 109  ASN A ND2  1  
ATOM   796    H H    . ASN A 1 53  ? -0.907  -6.054  -13.870 0.04 17.88 ? 109  ASN A H    1  
ATOM   797    H HA   . ASN A 1 53  ? 1.013   -4.176  -14.308 0.04 17.63 ? 109  ASN A HA   1  
ATOM   798    H HB2  . ASN A 1 53  ? -0.533  -5.388  -16.236 0.04 18.69 ? 109  ASN A HB2  1  
ATOM   799    H HB3  . ASN A 1 53  ? -0.014  -3.902  -16.488 0.04 18.59 ? 109  ASN A HB3  1  
ATOM   800    H HD21 . ASN A 1 53  ? 2.307   -6.952  -16.689 0.04 18.25 ? 109  ASN A HD21 1  
ATOM   801    H HD22 . ASN A 1 53  ? 0.880   -7.026  -16.266 0.04 18.27 ? 109  ASN A HD22 1  
ATOM   802    N N    . ASP A 1 54  ? -0.400  -2.174  -14.460 0.04 17.90 ? 110  ASP A N    1  
ATOM   803    C CA   . ASP A 1 54  ? -1.197  -0.962  -14.294 0.04 18.07 ? 110  ASP A CA   1  
ATOM   804    C C    . ASP A 1 54  ? -1.508  -0.609  -12.870 0.04 17.64 ? 110  ASP A C    1  
ATOM   805    O O    . ASP A 1 54  ? -2.298  0.283   -12.621 0.04 17.79 ? 110  ASP A O    1  
ATOM   806    C CB   . ASP A 1 54  ? -2.458  -1.076  -15.126 0.04 18.66 ? 110  ASP A CB   1  
ATOM   807    C CG   . ASP A 1 54  ? -2.123  -1.258  -16.552 0.04 19.13 ? 110  ASP A CG   1  
ATOM   808    O OD1  . ASP A 1 54  ? -1.442  -0.347  -17.059 0.04 19.26 ? 110  ASP A OD1  1  
ATOM   809    O OD2  . ASP A 1 54  ? -2.453  -2.305  -17.144 0.04 19.38 ? 110  ASP A OD2  1  
ATOM   810    H H    . ASP A 1 54  ? 0.379   -2.025  -14.786 0.04 17.85 ? 110  ASP A H    1  
ATOM   811    H HA   . ASP A 1 54  ? -0.687  -0.219  -14.655 0.04 18.15 ? 110  ASP A HA   1  
ATOM   812    H HB2  . ASP A 1 54  ? -2.994  -1.829  -14.838 0.04 18.62 ? 110  ASP A HB2  1  
ATOM   813    H HB3  . ASP A 1 54  ? -2.964  -0.254  -15.039 0.04 18.82 ? 110  ASP A HB3  1  
ATOM   814    N N    . ILE A 1 55  ? -0.809  -1.244  -11.952 0.04 17.13 ? 111  ILE A N    1  
ATOM   815    C CA   . ILE A 1 55  ? -1.123  -1.198  -10.540 0.04 16.74 ? 111  ILE A CA   1  
ATOM   816    C C    . ILE A 1 55  ? -0.352  -0.074  -9.823  0.04 16.34 ? 111  ILE A C    1  
ATOM   817    O O    . ILE A 1 55  ? 0.826   0.103   -10.051 0.04 16.08 ? 111  ILE A O    1  
ATOM   818    C CB   . ILE A 1 55  ? -0.889  -2.614  -9.979  0.04 16.50 ? 111  ILE A CB   1  
ATOM   819    C CG1  . ILE A 1 55  ? -1.351  -2.784  -8.542  0.04 16.24 ? 111  ILE A CG1  1  
ATOM   820    C CG2  . ILE A 1 55  ? 0.558   -3.077  -10.156 0.04 16.21 ? 111  ILE A CG2  1  
ATOM   821    C CD1  . ILE A 1 55  ? -1.743  -4.222  -8.304  0.04 15.98 ? 111  ILE A CD1  1  
ATOM   822    H H    . ILE A 1 55  ? -0.127  -1.729  -12.138 0.04 17.03 ? 111  ILE A H    1  
ATOM   823    H HA   . ILE A 1 55  ? -2.065  -1.019  -10.442 0.04 16.92 ? 111  ILE A HA   1  
ATOM   824    H HB   . ILE A 1 55  ? -1.433  -3.209  -10.520 0.04 16.79 ? 111  ILE A HB   1  
ATOM   825    H HG12 . ILE A 1 55  ? -0.624  -2.548  -7.947  0.04 16.03 ? 111  ILE A HG12 1  
ATOM   826    H HG13 . ILE A 1 55  ? -2.130  -2.226  -8.371  0.04 16.50 ? 111  ILE A HG13 1  
ATOM   827    H HG21 . ILE A 1 55  ? 0.656   -3.938  -9.719  0.04 16.21 ? 111  ILE A HG21 1  
ATOM   828    H HG22 . ILE A 1 55  ? 0.756   -3.175  -11.100 0.04 16.38 ? 111  ILE A HG22 1  
ATOM   829    H HG23 . ILE A 1 55  ? 1.155   -2.430  -9.752  0.04 15.89 ? 111  ILE A HG23 1  
ATOM   830    H HD11 . ILE A 1 55  ? -2.175  -4.293  -7.435  0.04 15.94 ? 111  ILE A HD11 1  
ATOM   831    H HD12 . ILE A 1 55  ? -2.357  -4.503  -9.001  0.04 16.19 ? 111  ILE A HD12 1  
ATOM   832    H HD13 . ILE A 1 55  ? -0.948  -4.778  -8.329  0.04 15.69 ? 111  ILE A HD13 1  
ATOM   833    N N    . ASN A 1 56  ? -1.060  0.750   -9.040  0.04 16.33 ? 112  ASN A N    1  
ATOM   834    C CA   . ASN A 1 56  ? -0.455  1.683   -8.075  0.04 15.95 ? 112  ASN A CA   1  
ATOM   835    C C    . ASN A 1 56  ? -1.201  1.511   -6.778  0.04 15.71 ? 112  ASN A C    1  
ATOM   836    O O    . ASN A 1 56  ? -2.302  2.072   -6.575  0.04 15.92 ? 112  ASN A O    1  
ATOM   837    C CB   . ASN A 1 56  ? -0.527  3.157   -8.524  0.04 16.19 ? 112  ASN A CB   1  
ATOM   838    C CG   . ASN A 1 56  ? 0.110   4.112   -7.512  0.04 15.86 ? 112  ASN A CG   1  
ATOM   839    O OD1  . ASN A 1 56  ? 0.846   3.694   -6.623  0.04 15.44 ? 112  ASN A OD1  1  
ATOM   840    N ND2  . ASN A 1 56  ? -0.146  5.414   -7.678  0.04 16.08 ? 112  ASN A ND2  1  
ATOM   841    H H    . ASN A 1 56  ? -1.917  0.780   -9.046  0.04 16.57 ? 112  ASN A H    1  
ATOM   842    H HA   . ASN A 1 56  ? 0.472   1.445   -7.923  0.04 15.72 ? 112  ASN A HA   1  
ATOM   843    H HB2  . ASN A 1 56  ? -0.060  3.254   -9.369  0.04 16.41 ? 112  ASN A HB2  1  
ATOM   844    H HB3  . ASN A 1 56  ? -1.457  3.406   -8.641  0.04 16.41 ? 112  ASN A HB3  1  
ATOM   845    H HD21 . ASN A 1 56  ? -0.909  5.731   -7.453  0.04 15.94 ? 112  ASN A HD21 1  
ATOM   846    H HD22 . ASN A 1 56  ? 0.450   5.929   -8.017  0.04 16.38 ? 112  ASN A HD22 1  
ATOM   847    N N    . ALA A 1 57  ? -0.623  0.692   -5.916  0.04 15.31 ? 113  ALA A N    1  
ATOM   848    C CA   . ALA A 1 57  ? -1.245  0.397   -4.645  0.04 15.08 ? 113  ALA A CA   1  
ATOM   849    C C    . ALA A 1 57  ? -0.765  1.421   -3.630  0.04 14.78 ? 113  ALA A C    1  
ATOM   850    O O    . ALA A 1 57  ? 0.316   1.278   -3.068  0.04 14.46 ? 113  ALA A O    1  
ATOM   851    C CB   . ALA A 1 57  ? -0.909  -1.024  -4.195  0.04 14.86 ? 113  ALA A CB   1  
ATOM   852    H H    . ALA A 1 57  ? 0.133   0.304   -6.041  0.04 15.19 ? 113  ALA A H    1  
ATOM   853    H HA   . ALA A 1 57  ? -2.207  0.476   -4.734  0.04 15.30 ? 113  ALA A HA   1  
ATOM   854    H HB1  . ALA A 1 57  ? -1.375  -1.213  -3.362  0.04 14.69 ? 113  ALA A HB1  1  
ATOM   855    H HB2  . ALA A 1 57  ? -1.193  -1.655  -4.876  0.04 15.09 ? 113  ALA A HB2  1  
ATOM   856    H HB3  . ALA A 1 57  ? 0.049   -1.100  -4.060  0.04 14.70 ? 113  ALA A HB3  1  
ATOM   857    N N    . GLN A 1 58  ? -1.560  2.464   -3.400  0.04 14.93 ? 114  GLN A N    1  
ATOM   858    C CA   . GLN A 1 58  ? -1.379  3.330   -2.252  0.04 14.71 ? 114  GLN A CA   1  
ATOM   859    C C    . GLN A 1 58  ? -1.745  2.512   -0.998  0.04 14.43 ? 114  GLN A C    1  
ATOM   860    O O    . GLN A 1 58  ? -2.815  1.889   -0.947  0.04 14.58 ? 114  GLN A O    1  
ATOM   861    C CB   . GLN A 1 58  ? -2.254  4.594   -2.388  0.04 15.05 ? 114  GLN A CB   1  
ATOM   862    C CG   . GLN A 1 58  ? -1.913  5.498   -3.609  0.04 15.32 ? 114  GLN A CG   1  
ATOM   863    C CD   . GLN A 1 58  ? -2.984  6.529   -3.898  0.04 15.65 ? 114  GLN A CD   1  
ATOM   864    O OE1  . GLN A 1 58  ? -2.919  7.676   -3.439  0.04 15.53 ? 114  GLN A OE1  1  
ATOM   865    N NE2  . GLN A 1 58  ? -3.976  6.125   -4.671  0.04 16.10 ? 114  GLN A NE2  1  
ATOM   866    H H    . GLN A 1 58  ? -2.221  2.685   -3.906  0.04 15.17 ? 114  GLN A H    1  
ATOM   867    H HA   . GLN A 1 58  ? -0.454  3.602   -2.184  0.04 14.55 ? 114  GLN A HA   1  
ATOM   868    H HB2  . GLN A 1 58  ? -3.173  4.312   -2.493  0.04 15.27 ? 114  GLN A HB2  1  
ATOM   869    H HB3  . GLN A 1 58  ? -2.162  5.138   -1.594  0.04 14.91 ? 114  GLN A HB3  1  
ATOM   870    H HG2  . GLN A 1 58  ? -1.081  5.968   -3.445  0.04 15.12 ? 114  GLN A HG2  1  
ATOM   871    H HG3  . GLN A 1 58  ? -1.828  4.934   -4.394  0.04 15.52 ? 114  GLN A HG3  1  
ATOM   872    H HE21 . GLN A 1 58  ? -4.648  5.711   -4.330  0.04 16.16 ? 114  GLN A HE21 1  
ATOM   873    H HE22 . GLN A 1 58  ? -3.947  6.278   -5.518  0.04 16.36 ? 114  GLN A HE22 1  
ATOM   874    N N    . ILE A 1 59  ? -0.856  2.514   -0.006  0.04 14.06 ? 115  ILE A N    1  
ATOM   875    C CA   . ILE A 1 59  ? -1.031  1.761   1.249   0.04 13.78 ? 115  ILE A CA   1  
ATOM   876    C C    . ILE A 1 59  ? -1.309  2.710   2.400   0.04 13.69 ? 115  ILE A C    1  
ATOM   877    O O    . ILE A 1 59  ? -0.504  3.604   2.707   0.04 13.56 ? 115  ILE A O    1  
ATOM   878    C CB   . ILE A 1 59  ? 0.197   0.908   1.547   0.04 13.46 ? 115  ILE A CB   1  
ATOM   879    C CG1  . ILE A 1 59  ? 0.593   0.068   0.314   0.04 13.58 ? 115  ILE A CG1  1  
ATOM   880    C CG2  . ILE A 1 59  ? -0.055  -0.023  2.743   0.04 13.22 ? 115  ILE A CG2  1  
ATOM   881    C CD1  . ILE A 1 59  ? -0.561  -0.739  -0.365  0.04 13.78 ? 115  ILE A CD1  1  
ATOM   882    H H    . ILE A 1 59  ? -0.121  2.954   -0.027  0.04 13.99 ? 115  ILE A H    1  
ATOM   883    H HA   . ILE A 1 59  ? -1.790  1.168   1.151   0.04 13.88 ? 115  ILE A HA   1  
ATOM   884    H HB   . ILE A 1 59  ? 0.936   1.492   1.771   0.04 13.36 ? 115  ILE A HB   1  
ATOM   885    H HG12 . ILE A 1 59  ? 0.960   0.662   -0.359  0.04 13.74 ? 115  ILE A HG12 1  
ATOM   886    H HG13 . ILE A 1 59  ? 1.267   -0.568  0.584   0.04 13.39 ? 115  ILE A HG13 1  
ATOM   887    H HG21 . ILE A 1 59  ? 0.801   -0.264  3.129   0.04 13.05 ? 115  ILE A HG21 1  
ATOM   888    H HG22 . ILE A 1 59  ? -0.603  0.430   3.402   0.04 13.15 ? 115  ILE A HG22 1  
ATOM   889    H HG23 . ILE A 1 59  ? -0.510  -0.817  2.425   0.04 13.33 ? 115  ILE A HG23 1  
ATOM   890    H HD11 . ILE A 1 59  ? -0.176  -1.470  -0.872  0.04 13.82 ? 115  ILE A HD11 1  
ATOM   891    H HD12 . ILE A 1 59  ? -1.152  -1.088  0.316   0.04 13.66 ? 115  ILE A HD12 1  
ATOM   892    H HD13 . ILE A 1 59  ? -1.051  -0.148  -0.956  0.04 14.02 ? 115  ILE A HD13 1  
ATOM   893    N N    . GLY A 1 60  ? -2.513  2.573   2.979   0.04 13.82 ? 116  GLY A N    1  
ATOM   894    C CA   . GLY A 1 60  ? -2.923  3.371   4.125   0.04 13.78 ? 116  GLY A CA   1  
ATOM   895    C C    . GLY A 1 60  ? -2.595  2.727   5.440   0.04 13.47 ? 116  GLY A C    1  
ATOM   896    O O    . GLY A 1 60  ? -1.809  1.808   5.511   0.04 13.25 ? 116  GLY A O    1  
ATOM   897    H H    . GLY A 1 60  ? -3.109  2.016   2.714   0.04 13.96 ? 116  GLY A H    1  
ATOM   898    H HA2  . GLY A 1 60  ? -2.494  4.237   4.093   0.04 13.77 ? 116  GLY A HA2  1  
ATOM   899    H HA3  . GLY A 1 60  ? -3.879  3.506   4.083   0.04 14.01 ? 116  GLY A HA3  1  
ATOM   900    N N    . PHE A 1 61  ? -3.230  3.224   6.497   0.04 13.51 ? 117  PHE A N    1  
ATOM   901    C CA   . PHE A 1 61  ? -3.030  2.670   7.827   0.04 13.27 ? 117  PHE A CA   1  
ATOM   902    C C    . PHE A 1 61  ? -3.501  1.219   7.893   0.04 13.29 ? 117  PHE A C    1  
ATOM   903    O O    . PHE A 1 61  ? -4.430  0.821   7.217   0.04 13.56 ? 117  PHE A O    1  
ATOM   904    C CB   . PHE A 1 61  ? -3.811  3.476   8.874   0.04 13.38 ? 117  PHE A CB   1  
ATOM   905    C CG   . PHE A 1 61  ? -3.172  4.791   9.232   0.04 13.31 ? 117  PHE A CG   1  
ATOM   906    C CD1  . PHE A 1 61  ? -3.518  5.967   8.563   0.04 13.57 ? 117  PHE A CD1  1  
ATOM   907    C CD2  . PHE A 1 61  ? -2.165  4.849   10.193  0.04 13.02 ? 117  PHE A CD2  1  
ATOM   908    C CE1  . PHE A 1 61  ? -2.902  7.157   8.885   0.04 13.54 ? 117  PHE A CE1  1  
ATOM   909    C CE2  . PHE A 1 61  ? -1.558  6.049   10.513  0.04 13.00 ? 117  PHE A CE2  1  
ATOM   910    C CZ   . PHE A 1 61  ? -1.928  7.190   9.862   0.04 13.25 ? 117  PHE A CZ   1  
ATOM   911    H H    . PHE A 1 61  ? -3.771  3.889   6.472   0.04 13.69 ? 117  PHE A H    1  
ATOM   912    H HA   . PHE A 1 61  ? -2.086  2.709   8.043   0.04 13.05 ? 117  PHE A HA   1  
ATOM   913    H HB2  . PHE A 1 61  ? -4.701  3.648   8.532   0.04 13.63 ? 117  PHE A HB2  1  
ATOM   914    H HB3  . PHE A 1 61  ? -3.868  2.952   9.687   0.04 13.28 ? 117  PHE A HB3  1  
ATOM   915    H HD1  . PHE A 1 61  ? -4.174  5.957   7.907   0.04 13.79 ? 117  PHE A HD1  1  
ATOM   916    H HD2  . PHE A 1 61  ? -1.913  4.082   10.646  0.04 12.87 ? 117  PHE A HD2  1  
ATOM   917    H HE1  . PHE A 1 61  ? -3.144  7.940   8.447   0.04 13.74 ? 117  PHE A HE1  1  
ATOM   918    H HE2  . PHE A 1 61  ? -0.898  6.077   11.167  0.04 12.83 ? 117  PHE A HE2  1  
ATOM   919    H HZ   . PHE A 1 61  ? -1.512  7.989   10.077  0.04 13.26 ? 117  PHE A HZ   1  
ATOM   920    N N    . TYR A 1 62  ? -2.803  0.438   8.711   0.04 13.03 ? 118  TYR A N    1  
ATOM   921    C CA   . TYR A 1 62  ? -3.213  -0.929  9.069   0.04 13.05 ? 118  TYR A CA   1  
ATOM   922    C C    . TYR A 1 62  ? -3.474  -1.777  7.817   0.04 13.22 ? 118  TYR A C    1  
ATOM   923    O O    . TYR A 1 62  ? -4.363  -2.591  7.784   0.04 13.43 ? 118  TYR A O    1  
ATOM   924    C CB   . TYR A 1 62  ? -4.435  -0.949  10.006  0.04 13.24 ? 118  TYR A CB   1  
ATOM   925    C CG   . TYR A 1 62  ? -4.294  -0.073  11.237  0.04 13.14 ? 118  TYR A CG   1  
ATOM   926    C CD1  . TYR A 1 62  ? -3.489  -0.432  12.294  0.04 12.90 ? 118  TYR A CD1  1  
ATOM   927    C CD2  . TYR A 1 62  ? -4.964  1.124   11.329  0.04 13.34 ? 118  TYR A CD2  1  
ATOM   928    C CE1  . TYR A 1 62  ? -3.375  0.366   13.421  0.04 12.85 ? 118  TYR A CE1  1  
ATOM   929    C CE2  . TYR A 1 62  ? -4.839  1.941   12.443  0.04 13.29 ? 118  TYR A CE2  1  
ATOM   930    C CZ   . TYR A 1 62  ? -4.054  1.549   13.488  0.04 13.04 ? 118  TYR A CZ   1  
ATOM   931    O OH   . TYR A 1 62  ? -3.913  2.368   14.611  0.04 13.03 ? 118  TYR A OH   1  
ATOM   932    H H    . TYR A 1 62  ? -2.057  0.673   9.061   0.04 12.85 ? 118  TYR A H    1  
ATOM   933    H HA   . TYR A 1 62  ? -2.486  -1.335  9.557   0.04 12.85 ? 118  TYR A HA   1  
ATOM   934    H HB2  . TYR A 1 62  ? -5.211  -0.657  9.509   0.04 13.47 ? 118  TYR A HB2  1  
ATOM   935    H HB3  . TYR A 1 62  ? -4.561  -1.865  10.277  0.04 13.24 ? 118  TYR A HB3  1  
ATOM   936    H HD1  . TYR A 1 62  ? -3.030  -1.242  12.267  0.04 12.79 ? 118  TYR A HD1  1  
ATOM   937    H HD2  . TYR A 1 62  ? -5.509  1.400   10.627  0.04 13.53 ? 118  TYR A HD2  1  
ATOM   938    H HE1  . TYR A 1 62  ? -2.830  0.111   14.129  0.04 12.71 ? 118  TYR A HE1  1  
ATOM   939    H HE2  . TYR A 1 62  ? -5.302  2.745   12.485  0.04 13.45 ? 118  TYR A HE2  1  
ATOM   940    H HH   . TYR A 1 62  ? -4.316  3.094   14.492  0.04 13.17 ? 118  TYR A HH   1  
ATOM   941    N N    . THR A 1 63  ? -2.604  -1.598  6.828   0.04 13.14 ? 119  THR A N    1  
ATOM   942    C CA   . THR A 1 63  ? -2.665  -2.369  5.588   0.04 13.31 ? 119  THR A CA   1  
ATOM   943    C C    . THR A 1 63  ? -1.290  -2.978  5.344   0.04 13.08 ? 119  THR A C    1  
ATOM   944    O O    . THR A 1 63  ? -0.301  -2.270  5.277   0.04 12.90 ? 119  THR A O    1  
ATOM   945    C CB   . THR A 1 63  ? -3.072  -1.494  4.378   0.04 13.54 ? 119  THR A CB   1  
ATOM   946    O OG1  . THR A 1 63  ? -4.310  -0.840  4.675   0.04 13.79 ? 119  THR A OG1  1  
ATOM   947    C CG2  . THR A 1 63  ? -3.314  -2.337  3.171   0.04 13.75 ? 119  THR A CG2  1  
ATOM   948    H H    . THR A 1 63  ? -1.962  -1.031  6.856   0.04 13.01 ? 119  THR A H    1  
ATOM   949    H HA   . THR A 1 63  ? -3.312  -3.078  5.676   0.04 13.45 ? 119  THR A HA   1  
ATOM   950    H HB   . THR A 1 63  ? -2.392  -0.833  4.187   0.04 13.43 ? 119  THR A HB   1  
ATOM   951    H HG1  . THR A 1 63  ? -4.220  -0.404  5.387   0.04 13.69 ? 119  THR A HG1  1  
ATOM   952    H HG21 . THR A 1 63  ? -3.594  -1.779  2.424   0.04 13.98 ? 119  THR A HG21 1  
ATOM   953    H HG22 . THR A 1 63  ? -2.498  -2.810  2.932   0.04 13.62 ? 119  THR A HG22 1  
ATOM   954    H HG23 . THR A 1 63  ? -4.021  -2.977  3.356   0.04 13.81 ? 119  THR A HG23 1  
ATOM   955    N N    . SER A 1 64  ? -1.252  -4.305  5.226   0.04 13.13 ? 120  SER A N    1  
ATOM   956    C CA   . SER A 1 64  ? -0.052  -5.028  4.778   0.04 13.01 ? 120  SER A CA   1  
ATOM   957    C C    . SER A 1 64  ? -0.261  -5.433  3.334   0.04 13.27 ? 120  SER A C    1  
ATOM   958    O O    . SER A 1 64  ? -1.381  -5.700  2.914   0.04 13.54 ? 120  SER A O    1  
ATOM   959    C CB   . SER A 1 64  ? 0.184   -6.306  5.598   0.04 12.91 ? 120  SER A CB   1  
ATOM   960    O OG   . SER A 1 64  ? -0.929  -7.191  5.497   0.04 13.15 ? 120  SER A OG   1  
ATOM   961    H H    . SER A 1 64  ? -1.925  -4.815  5.364   0.04 13.26 ? 120  SER A H    1  
ATOM   962    H HA   . SER A 1 64  ? 0.725   -4.464  4.844   0.04 12.86 ? 120  SER A HA   1  
ATOM   963    H HB2  . SER A 1 64  ? 0.970   -6.766  5.271   0.04 12.87 ? 120  SER A HB2  1  
ATOM   964    H HB3  . SER A 1 64  ? 0.310   -6.072  6.533   0.04 12.76 ? 120  SER A HB3  1  
ATOM   965    H HG   . SER A 1 64  ? -0.672  -7.986  5.574   0.04 13.21 ? 120  SER A HG   1  
ATOM   966    N N    . ILE A 1 65  ? 0.820   -5.410  2.562   0.04 13.21 ? 121  ILE A N    1  
ATOM   967    C CA   . ILE A 1 65  ? 0.781   -5.929  1.188   0.04 13.47 ? 121  ILE A CA   1  
ATOM   968    C C    . ILE A 1 65  ? 1.978   -6.846  1.018   0.04 13.38 ? 121  ILE A C    1  
ATOM   969    O O    . ILE A 1 65  ? 3.068   -6.587  1.521   0.04 13.14 ? 121  ILE A O    1  
ATOM   970    C CB   . ILE A 1 65  ? 0.754   -4.783  0.124   0.04 13.62 ? 121  ILE A CB   1  
ATOM   971    C CG1  . ILE A 1 65  ? 0.563   -5.375  -1.282  0.04 13.96 ? 121  ILE A CG1  1  
ATOM   972    C CG2  . ILE A 1 65  ? 1.994   -3.924  0.201   0.04 13.40 ? 121  ILE A CG2  1  
ATOM   973    C CD1  . ILE A 1 65  ? 0.119   -4.345  -2.317  0.04 14.21 ? 121  ILE A CD1  1  
ATOM   974    H H    . ILE A 1 65  ? 1.576   -5.102  2.803   0.04 13.04 ? 121  ILE A H    1  
ATOM   975    H HA   . ILE A 1 65  ? -0.012  -6.458  1.071   0.04 13.65 ? 121  ILE A HA   1  
ATOM   976    H HB   . ILE A 1 65  ? -0.003  -4.211  0.319   0.04 13.69 ? 121  ILE A HB   1  
ATOM   977    H HG12 . ILE A 1 65  ? 1.414   -5.735  -1.579  0.04 13.91 ? 121  ILE A HG12 1  
ATOM   978    H HG13 . ILE A 1 65  ? -0.097  -6.082  -1.248  0.04 14.09 ? 121  ILE A HG13 1  
ATOM   979    H HG21 . ILE A 1 65  ? 2.646   -4.251  -0.430  0.04 13.41 ? 121  ILE A HG21 1  
ATOM   980    H HG22 . ILE A 1 65  ? 1.765   -3.007  -0.008  0.04 13.48 ? 121  ILE A HG22 1  
ATOM   981    H HG23 . ILE A 1 65  ? 2.355   -3.971  1.096   0.04 13.19 ? 121  ILE A HG23 1  
ATOM   982    H HD11 . ILE A 1 65  ? -0.151  -4.806  -3.125  0.04 14.45 ? 121  ILE A HD11 1  
ATOM   983    H HD12 . ILE A 1 65  ? -0.630  -3.836  -1.964  0.04 14.27 ? 121  ILE A HD12 1  
ATOM   984    H HD13 . ILE A 1 65  ? 0.858   -3.748  -2.509  0.04 14.11 ? 121  ILE A HD13 1  
ATOM   985    N N    . ALA A 1 66  ? 1.747   -7.962  0.344   0.04 13.62 ? 122  ALA A N    1  
ATOM   986    C CA   . ALA A 1 66  ? 2.818   -8.908  0.126   0.04 13.60 ? 122  ALA A CA   1  
ATOM   987    C C    . ALA A 1 66  ? 2.545   -9.851  -1.028  0.04 13.95 ? 122  ALA A C    1  
ATOM   988    O O    . ALA A 1 66  ? 1.418   -10.094 -1.420  0.04 14.21 ? 122  ALA A O    1  
ATOM   989    C CB   . ALA A 1 66  ? 3.080   -9.708  1.403   0.04 13.45 ? 122  ALA A CB   1  
ATOM   990    H H    . ALA A 1 66  ? 0.995   -8.192  0.014   0.04 13.81 ? 122  ALA A H    1  
ATOM   991    H HA   . ALA A 1 66  ? 3.618   -8.413  -0.085  0.04 13.49 ? 122  ALA A HA   1  
ATOM   992    H HB1  . ALA A 1 66  ? 3.746   -10.389 1.226   0.04 13.50 ? 122  ALA A HB1  1  
ATOM   993    H HB2  . ALA A 1 66  ? 3.392   -9.104  2.093   0.04 13.23 ? 122  ALA A HB2  1  
ATOM   994    H HB3  . ALA A 1 66  ? 2.249   -10.128 1.675   0.04 13.55 ? 122  ALA A HB3  1  
ATOM   995    N N    . GLY A 1 67  ? 3.628   -10.380 -1.544  0.04 13.98 ? 123  GLY A N    1  
ATOM   996    C CA   . GLY A 1 67  ? 3.574   -11.463 -2.515  0.04 14.31 ? 123  GLY A CA   1  
ATOM   997    C C    . GLY A 1 67  ? 3.629   -12.824 -1.843  0.04 14.35 ? 123  GLY A C    1  
ATOM   998    O O    . GLY A 1 67  ? 4.078   -12.978 -0.710  0.04 14.10 ? 123  GLY A O    1  
ATOM   999    H H    . GLY A 1 67  ? 4.423   -10.143 -1.333  0.04 13.82 ? 123  GLY A H    1  
ATOM   1000   H HA2  . GLY A 1 67  ? 2.770   -11.399 -3.045  0.04 14.51 ? 123  GLY A HA2  1  
ATOM   1001   H HA3  . GLY A 1 67  ? 4.333   -11.396 -3.111  0.04 14.34 ? 123  GLY A HA3  1  
ATOM   1002   N N    . LEU A 1 68  ? 3.204   -13.820 -2.610  0.04 14.71 ? 124  LEU A N    1  
ATOM   1003   C CA   . LEU A 1 68  ? 3.061   -15.180 -2.131  0.04 14.85 ? 124  LEU A CA   1  
ATOM   1004   C C    . LEU A 1 68  ? 3.966   -16.169 -2.836  0.04 15.07 ? 124  LEU A C    1  
ATOM   1005   O O    . LEU A 1 68  ? 3.759   -17.375 -2.752  0.04 15.33 ? 124  LEU A O    1  
ATOM   1006   C CB   . LEU A 1 68  ? 1.602   -15.619 -2.247  0.04 15.15 ? 124  LEU A CB   1  
ATOM   1007   C CG   . LEU A 1 68  ? 0.569   -14.936 -1.353  0.04 15.01 ? 124  LEU A CG   1  
ATOM   1008   C CD1  . LEU A 1 68  ? -0.860  -15.223 -1.815  0.04 15.40 ? 124  LEU A CD1  1  
ATOM   1009   C CD2  . LEU A 1 68  ? 0.761   -15.395 0.098   0.04 14.78 ? 124  LEU A CD2  1  
ATOM   1010   H H    . LEU A 1 68  ? 2.985   -13.719 -3.433  0.04 14.89 ? 124  LEU A H    1  
ATOM   1011   H HA   . LEU A 1 68  ? 3.300   -15.207 -1.190  0.04 14.65 ? 124  LEU A HA   1  
ATOM   1012   H HB2  . LEU A 1 68  ? 1.317   -15.466 -3.164  0.04 15.35 ? 124  LEU A HB2  1  
ATOM   1013   H HB3  . LEU A 1 68  ? 1.564   -16.574 -2.063  0.04 15.31 ? 124  LEU A HB3  1  
ATOM   1014   H HG   . LEU A 1 68  ? 0.706   -13.979 -1.388  0.04 14.85 ? 124  LEU A HG   1  
ATOM   1015   H HD11 . LEU A 1 68  ? -1.489  -14.851 -1.179  0.04 15.32 ? 124  LEU A HD11 1  
ATOM   1016   H HD12 . LEU A 1 68  ? -0.992  -14.819 -2.689  0.04 15.56 ? 124  LEU A HD12 1  
ATOM   1017   H HD13 . LEU A 1 68  ? -0.983  -16.184 -1.871  0.04 15.58 ? 124  LEU A HD13 1  
ATOM   1018   H HD21 . LEU A 1 68  ? 1.276   -14.720 0.567   0.04 14.50 ? 124  LEU A HD21 1  
ATOM   1019   H HD22 . LEU A 1 68  ? -0.105  -15.504 0.517   0.04 14.86 ? 124  LEU A HD22 1  
ATOM   1020   H HD23 . LEU A 1 68  ? 1.233   -16.238 0.106   0.04 14.85 ? 124  LEU A HD23 1  
ATOM   1021   N N    . GLY A 1 69  ? 5.004   -15.664 -3.498  0.04 14.99 ? 125  GLY A N    1  
ATOM   1022   C CA   . GLY A 1 69  ? 6.060   -16.520 -3.975  0.04 15.19 ? 125  GLY A CA   1  
ATOM   1023   C C    . GLY A 1 69  ? 7.012   -16.806 -2.841  0.04 14.99 ? 125  GLY A C    1  
ATOM   1024   O O    . GLY A 1 69  ? 6.730   -16.442 -1.694  0.04 14.64 ? 125  GLY A O    1  
ATOM   1025   H H    . GLY A 1 69  ? 5.112   -14.835 -3.678  0.04 14.84 ? 125  GLY A H    1  
ATOM   1026   H HA2  . GLY A 1 69  ? 5.691   -17.359 -4.293  0.04 15.46 ? 125  GLY A HA2  1  
ATOM   1027   H HA3  . GLY A 1 69  ? 6.545   -16.089 -4.696  0.04 15.24 ? 125  GLY A HA3  1  
ATOM   1028   N N    . LEU A 1 70  ? 8.145   -17.433 -3.165  0.04 15.25 ? 126  LEU A N    1  
ATOM   1029   C CA   . LEU A 1 70  ? 9.168   -17.693 -2.175  0.04 15.14 ? 126  LEU A CA   1  
ATOM   1030   C C    . LEU A 1 70  ? 10.152  -16.568 -2.249  0.04 14.96 ? 126  LEU A C    1  
ATOM   1031   O O    . LEU A 1 70  ? 10.810  -16.219 -1.282  0.04 14.77 ? 126  LEU A O    1  
ATOM   1032   C CB   . LEU A 1 70  ? 9.871   -18.985 -2.515  0.04 15.52 ? 126  LEU A CB   1  
ATOM   1033   C CG   . LEU A 1 70  ? 10.668  -19.688 -1.420  0.04 15.45 ? 126  LEU A CG   1  
ATOM   1034   C CD1  . LEU A 1 70  ? 9.986   -19.795 -0.027  0.04 15.18 ? 126  LEU A CD1  1  
ATOM   1035   C CD2  . LEU A 1 70  ? 10.939  -21.058 -2.010  0.04 15.89 ? 126  LEU A CD2  1  
ATOM   1036   H H    . LEU A 1 70  ? 8.343   -17.703 -3.956  0.04 15.52 ? 126  LEU A H    1  
ATOM   1037   H HA   . LEU A 1 70  ? 8.780   -17.729 -1.291  0.04 14.94 ? 126  LEU A HA   1  
ATOM   1038   H HB2  . LEU A 1 70  ? 9.199   -19.599 -2.850  0.04 15.70 ? 126  LEU A HB2  1  
ATOM   1039   H HB3  . LEU A 1 70  ? 10.501  -18.797 -3.229  0.04 15.68 ? 126  LEU A HB3  1  
ATOM   1040   H HG   . LEU A 1 70  ? 11.522  -19.242 -1.312  0.04 15.31 ? 126  LEU A HG   1  
ATOM   1041   H HD11 . LEU A 1 70  ? 10.658  -19.701 0.666   0.04 14.96 ? 126  LEU A HD11 1  
ATOM   1042   H HD12 . LEU A 1 70  ? 9.308   -19.113 0.080   0.04 15.08 ? 126  LEU A HD12 1  
ATOM   1043   H HD13 . LEU A 1 70  ? 9.573   -20.670 0.044   0.04 15.36 ? 126  LEU A HD13 1  
ATOM   1044   H HD21 . LEU A 1 70  ? 11.162  -21.668 -1.291  0.04 15.86 ? 126  LEU A HD21 1  
ATOM   1045   H HD22 . LEU A 1 70  ? 10.148  -21.379 -2.470  0.04 16.04 ? 126  LEU A HD22 1  
ATOM   1046   H HD23 . LEU A 1 70  ? 11.675  -20.992 -2.637  0.04 16.07 ? 126  LEU A HD23 1  
ATOM   1047   N N    . ASN A 1 71  ? 10.244  -16.044 -3.463  0.04 15.07 ? 127  ASN A N    1  
ATOM   1048   C CA   . ASN A 1 71  ? 11.200  -15.046 -3.830  0.04 14.93 ? 127  ASN A CA   1  
ATOM   1049   C C    . ASN A 1 71  ? 10.454  -13.852 -4.257  0.04 14.73 ? 127  ASN A C    1  
ATOM   1050   O O    . ASN A 1 71  ? 9.405   -13.984 -4.911  0.04 14.85 ? 127  ASN A O    1  
ATOM   1051   C CB   . ASN A 1 71  ? 11.939  -15.536 -5.035  0.04 15.30 ? 127  ASN A CB   1  
ATOM   1052   C CG   . ASN A 1 71  ? 12.224  -16.911 -4.914  0.04 15.57 ? 127  ASN A CG   1  
ATOM   1053   O OD1  . ASN A 1 71  ? 11.471  -17.788 -5.376  0.04 15.97 ? 127  ASN A OD1  1  
ATOM   1054   N ND2  . ASN A 1 71  ? 13.298  -17.174 -4.224  0.04 15.41 ? 127  ASN A ND2  1  
ATOM   1055   H H    . ASN A 1 71  ? 9.746   -16.270 -4.120  0.04 15.25 ? 127  ASN A H    1  
ATOM   1056   H HA   . ASN A 1 71  ? 11.813  -14.874 -3.099  0.04 14.76 ? 127  ASN A HA   1  
ATOM   1057   H HB2  . ASN A 1 71  ? 11.386  -15.419 -5.825  0.04 15.47 ? 127  ASN A HB2  1  
ATOM   1058   H HB3  . ASN A 1 71  ? 12.773  -15.054 -5.135  0.04 15.22 ? 127  ASN A HB3  1  
ATOM   1059   H HD21 . ASN A 1 71  ? 13.666  -17.952 -4.270  0.04 15.56 ? 127  ASN A HD21 1  
ATOM   1060   H HD22 . ASN A 1 71  ? 13.642  -16.569 -3.718  0.04 15.15 ? 127  ASN A HD22 1  
ATOM   1061   N N    . PRO A 1 72  ? 11.006  -12.686 -3.963  0.04 14.48 ? 128  PRO A N    1  
ATOM   1062   C CA   . PRO A 1 72  ? 10.393  -11.434 -4.406  0.04 14.34 ? 128  PRO A CA   1  
ATOM   1063   C C    . PRO A 1 72  ? 10.009  -11.435 -5.905  0.04 14.64 ? 128  PRO A C    1  
ATOM   1064   O O    . PRO A 1 72  ? 8.888   -11.075 -6.251  0.04 14.65 ? 128  PRO A O    1  
ATOM   1065   C CB   . PRO A 1 72  ? 11.474  -10.403 -4.076  0.04 14.04 ? 128  PRO A CB   1  
ATOM   1066   C CG   . PRO A 1 72  ? 12.241  -11.010 -2.920  0.04 13.98 ? 128  PRO A CG   1  
ATOM   1067   C CD   . PRO A 1 72  ? 12.122  -12.462 -3.016  0.04 14.27 ? 128  PRO A CD   1  
ATOM   1068   H HA   . PRO A 1 72  ? 9.602   -11.254 -3.878  0.04 14.27 ? 128  PRO A HA   1  
ATOM   1069   H HB2  . PRO A 1 72  ? 12.062  -10.271 -4.837  0.04 14.11 ? 128  PRO A HB2  1  
ATOM   1070   H HB3  . PRO A 1 72  ? 11.046  -9.571  -3.813  0.04 13.85 ? 128  PRO A HB3  1  
ATOM   1071   H HG2  . PRO A 1 72  ? 13.169  -10.732 -2.965  0.04 13.99 ? 128  PRO A HG2  1  
ATOM   1072   H HG3  . PRO A 1 72  ? 11.845  -10.720 -2.087  0.04 13.78 ? 128  PRO A HG3  1  
ATOM   1073   H HD2  . PRO A 1 72  ? 12.941  -12.855 -3.360  0.04 14.41 ? 128  PRO A HD2  1  
ATOM   1074   H HD3  . PRO A 1 72  ? 11.891  -12.826 -2.148  0.04 14.20 ? 128  PRO A HD3  1  
ATOM   1075   N N    . ASP A 1 73  ? 10.898  -11.921 -6.764  0.04 14.91 ? 129  ASP A N    1  
ATOM   1076   C CA   . ASP A 1 73  ? 10.686  -11.816 -8.209  0.04 15.24 ? 129  ASP A CA   1  
ATOM   1077   C C    . ASP A 1 73  ? 9.587   -12.753 -8.718  0.04 15.55 ? 129  ASP A C    1  
ATOM   1078   O O    . ASP A 1 73  ? 9.128   -12.617 -9.838  0.04 15.89 ? 129  ASP A O    1  
ATOM   1079   C CB   . ASP A 1 73  ? 12.010  -12.045 -8.943  0.04 15.47 ? 129  ASP A CB   1  
ATOM   1080   C CG   . ASP A 1 73  ? 13.035  -10.933 -8.657  0.04 15.25 ? 129  ASP A CG   1  
ATOM   1081   O OD1  . ASP A 1 73  ? 12.672  -9.748  -8.742  0.04 15.37 ? 129  ASP A OD1  1  
ATOM   1082   O OD2  . ASP A 1 73  ? 14.193  -11.232 -8.337  0.04 14.99 ? 129  ASP A OD2  1  
ATOM   1083   H H    . ASP A 1 73  ? 11.630  -12.306 -6.535  0.04 14.93 ? 129  ASP A H    1  
ATOM   1084   H HA   . ASP A 1 73  ? 10.411  -10.912 -8.407  0.04 15.15 ? 129  ASP A HA   1  
ATOM   1085   H HB2  . ASP A 1 73  ? 12.375  -12.900 -8.672  0.04 15.53 ? 129  ASP A HB2  1  
ATOM   1086   H HB3  . ASP A 1 73  ? 11.843  -12.056 -9.896  0.04 15.74 ? 129  ASP A HB3  1  
ATOM   1087   N N    . ASP A 1 74  ? 9.124   -13.674 -7.885  0.04 15.48 ? 130  ASP A N    1  
ATOM   1088   C CA   . ASP A 1 74  ? 7.988   -14.509 -8.270  0.04 15.76 ? 130  ASP A CA   1  
ATOM   1089   C C    . ASP A 1 74  ? 6.672   -13.740 -8.384  0.04 15.75 ? 130  ASP A C    1  
ATOM   1090   O O    . ASP A 1 74  ? 5.760   -14.185 -9.075  0.04 16.07 ? 130  ASP A O    1  
ATOM   1091   C CB   . ASP A 1 74  ? 7.775   -15.645 -7.267  0.04 15.71 ? 130  ASP A CB   1  
ATOM   1092   C CG   . ASP A 1 74  ? 8.897   -16.689 -7.283  0.04 15.86 ? 130  ASP A CG   1  
ATOM   1093   O OD1  . ASP A 1 74  ? 9.032   -17.375 -6.241  0.04 15.80 ? 130  ASP A OD1  1  
ATOM   1094   O OD2  . ASP A 1 74  ? 9.627   -16.844 -8.292  0.04 16.08 ? 130  ASP A OD2  1  
ATOM   1095   H H    . ASP A 1 74  ? 9.431   -13.829 -7.099  0.04 15.29 ? 130  ASP A H    1  
ATOM   1096   H HA   . ASP A 1 74  ? 8.177   -14.904 -9.136  0.04 16.06 ? 130  ASP A HA   1  
ATOM   1097   H HB2  . ASP A 1 74  ? 7.738   -15.266 -6.377  0.04 15.42 ? 130  ASP A HB2  1  
ATOM   1098   H HB3  . ASP A 1 74  ? 6.935   -16.082 -7.472  0.04 15.89 ? 130  ASP A HB3  1  
ATOM   1099   N N    . THR A 1 75  ? 6.598   -12.586 -7.719  0.04 15.40 ? 131  THR A N    1  
ATOM   1100   C CA   . THR A 1 75  ? 5.421   -11.726 -7.744  0.04 15.39 ? 131  THR A CA   1  
ATOM   1101   C C    . THR A 1 75  ? 5.845   -10.313 -8.130  0.04 15.30 ? 131  THR A C    1  
ATOM   1102   O O    . THR A 1 75  ? 6.344   -9.575  -7.291  0.04 14.95 ? 131  THR A O    1  
ATOM   1103   C CB   . THR A 1 75  ? 4.706   -11.691 -6.380  0.04 15.10 ? 131  THR A CB   1  
ATOM   1104   O OG1  . THR A 1 75  ? 4.610   -13.028 -5.864  0.04 15.18 ? 131  THR A OG1  1  
ATOM   1105   C CG2  . THR A 1 75  ? 3.282   -11.149 -6.525  0.04 15.22 ? 131  THR A CG2  1  
ATOM   1106   H H    . THR A 1 75  ? 7.234   -12.273 -7.242  0.04 15.20 ? 131  THR A H    1  
ATOM   1107   H HA   . THR A 1 75  ? 4.792   -12.044 -8.409  0.04 15.67 ? 131  THR A HA   1  
ATOM   1108   H HB   . THR A 1 75  ? 5.200   -11.125 -5.766  0.04 14.82 ? 131  THR A HB   1  
ATOM   1109   H HG1  . THR A 1 75  ? 4.019   -13.061 -5.274  0.04 15.12 ? 131  THR A HG1  1  
ATOM   1110   H HG21 . THR A 1 75  ? 2.655   -11.882 -6.617  0.04 15.40 ? 131  THR A HG21 1  
ATOM   1111   H HG22 . THR A 1 75  ? 3.044   -10.623 -5.749  0.04 14.99 ? 131  THR A HG22 1  
ATOM   1112   H HG23 . THR A 1 75  ? 3.222   -10.589 -7.314  0.04 15.38 ? 131  THR A HG23 1  
ATOM   1113   N N    . THR A 1 76  ? 5.634   -9.946  -9.386  0.04 15.65 ? 132  THR A N    1  
ATOM   1114   C CA   . THR A 1 76  ? 6.159   -8.691  -9.889  0.04 15.67 ? 132  THR A CA   1  
ATOM   1115   C C    . THR A 1 76  ? 5.027   -7.736  -10.263 0.04 15.81 ? 132  THR A C    1  
ATOM   1116   O O    . THR A 1 76  ? 4.067   -8.104  -10.922 0.04 16.15 ? 132  THR A O    1  
ATOM   1117   C CB   . THR A 1 76  ? 7.131   -8.891  -11.077 0.04 16.02 ? 132  THR A CB   1  
ATOM   1118   O OG1  . THR A 1 76  ? 8.307   -9.588  -10.617 0.04 15.96 ? 132  THR A OG1  1  
ATOM   1119   C CG2  . THR A 1 76  ? 7.587   -7.514  -11.645 0.04 16.03 ? 132  THR A CG2  1  
ATOM   1120   H H    . THR A 1 76  ? 5.199   -10.412 -9.962  0.04 15.90 ? 132  THR A H    1  
ATOM   1121   H HA   . THR A 1 76  ? 6.668   -8.259  -9.189  0.04 15.40 ? 132  THR A HA   1  
ATOM   1122   H HB   . THR A 1 76  ? 6.700   -9.398  -11.781 0.04 16.32 ? 132  THR A HB   1  
ATOM   1123   H HG1  . THR A 1 76  ? 8.844   -9.706  -11.250 0.04 16.18 ? 132  THR A HG1  1  
ATOM   1124   H HG21 . THR A 1 76  ? 8.147   -7.651  -12.423 0.04 16.28 ? 132  THR A HG21 1  
ATOM   1125   H HG22 . THR A 1 76  ? 6.828   -6.973  -11.909 0.04 16.10 ? 132  THR A HG22 1  
ATOM   1126   H HG23 . THR A 1 76  ? 8.106   -7.041  -10.975 0.04 15.76 ? 132  THR A HG23 1  
ATOM   1127   N N    . PHE A 1 77  ? 5.166   -6.511  -9.803  0.04 15.59 ? 133  PHE A N    1  
ATOM   1128   C CA   . PHE A 1 77  ? 4.251   -5.434  -10.184 0.04 15.77 ? 133  PHE A CA   1  
ATOM   1129   C C    . PHE A 1 77  ? 4.941   -4.549  -11.200 0.04 16.00 ? 133  PHE A C    1  
ATOM   1130   O O    . PHE A 1 77  ? 6.041   -4.062  -10.967 0.04 15.81 ? 133  PHE A O    1  
ATOM   1131   C CB   . PHE A 1 77  ? 3.913   -4.518  -8.995  0.04 15.42 ? 133  PHE A CB   1  
ATOM   1132   C CG   . PHE A 1 77  ? 2.943   -5.095  -7.972  0.04 15.22 ? 133  PHE A CG   1  
ATOM   1133   C CD1  . PHE A 1 77  ? 2.499   -6.406  -8.024  0.04 15.32 ? 133  PHE A CD1  1  
ATOM   1134   C CD2  . PHE A 1 77  ? 2.493   -4.279  -6.955  0.04 14.98 ? 133  PHE A CD2  1  
ATOM   1135   C CE1  . PHE A 1 77  ? 1.611   -6.889  -7.074  0.04 15.17 ? 133  PHE A CE1  1  
ATOM   1136   C CE2  . PHE A 1 77  ? 1.613   -4.757  -6.018  0.04 14.83 ? 133  PHE A CE2  1  
ATOM   1137   C CZ   . PHE A 1 77  ? 1.185   -6.052  -6.075  0.04 14.92 ? 133  PHE A CZ   1  
ATOM   1138   H H    . PHE A 1 77  ? 5.783   -6.266  -9.259  0.04 15.36 ? 133  PHE A H    1  
ATOM   1139   H HA   . PHE A 1 77  ? 3.435   -5.787  -10.564 0.04 15.99 ? 133  PHE A HA   1  
ATOM   1140   H HB2  . PHE A 1 77  ? 4.735   -4.318  -8.522  0.04 15.20 ? 133  PHE A HB2  1  
ATOM   1141   H HB3  . PHE A 1 77  ? 3.529   -3.702  -9.342  0.04 15.57 ? 133  PHE A HB3  1  
ATOM   1142   H HD1  . PHE A 1 77  ? 2.796   -6.966  -8.705  0.04 15.50 ? 133  PHE A HD1  1  
ATOM   1143   H HD2  . PHE A 1 77  ? 2.784   -3.398  -6.910  0.04 14.93 ? 133  PHE A HD2  1  
ATOM   1144   H HE1  . PHE A 1 77  ? 1.317   -7.769  -7.113  0.04 15.26 ? 133  PHE A HE1  1  
ATOM   1145   H HE2  . PHE A 1 77  ? 1.318   -4.202  -5.335  0.04 14.68 ? 133  PHE A HE2  1  
ATOM   1146   H HZ   . PHE A 1 77  ? 0.591   -6.363  -5.431  0.04 14.85 ? 133  PHE A HZ   1  
ATOM   1147   N N    . ASN A 1 78  ? 4.289   -4.352  -12.326 0.04 16.45 ? 134  ASN A N    1  
ATOM   1148   C CA   . ASN A 1 78  ? 4.632   -3.243  -13.211 0.04 16.72 ? 134  ASN A CA   1  
ATOM   1149   C C    . ASN A 1 78  ? 3.760   -2.136  -12.700 0.04 16.66 ? 134  ASN A C    1  
ATOM   1150   O O    . ASN A 1 78  ? 2.550   -2.077  -12.971 0.04 16.94 ? 134  ASN A O    1  
ATOM   1151   C CB   . ASN A 1 78  ? 4.377   -3.629  -14.648 0.04 17.27 ? 134  ASN A CB   1  
ATOM   1152   C CG   . ASN A 1 78  ? 5.325   -4.682  -15.112 0.04 17.34 ? 134  ASN A CG   1  
ATOM   1153   O OD1  . ASN A 1 78  ? 6.522   -4.616  -14.871 0.04 17.13 ? 134  ASN A OD1  1  
ATOM   1154   N ND2  . ASN A 1 78  ? 4.796   -5.662  -15.754 0.04 17.66 ? 134  ASN A ND2  1  
ATOM   1155   H H    . ASN A 1 78  ? 3.643   -4.839  -12.606 0.04 16.63 ? 134  ASN A H    1  
ATOM   1156   H HA   . ASN A 1 78  ? 5.559   -2.987  -13.107 0.04 16.59 ? 134  ASN A HA   1  
ATOM   1157   H HB2  . ASN A 1 78  ? 3.480   -3.975  -14.696 0.04 17.41 ? 134  ASN A HB2  1  
ATOM   1158   H HB3  . ASN A 1 78  ? 4.480   -2.861  -15.230 0.04 17.48 ? 134  ASN A HB3  1  
ATOM   1159   H HD21 . ASN A 1 78  ? 5.160   -6.438  -15.729 0.04 17.67 ? 134  ASN A HD21 1  
ATOM   1160   H HD22 . ASN A 1 78  ? 4.079   -5.535  -16.208 0.04 17.88 ? 134  ASN A HD22 1  
ATOM   1161   N N    . GLY A 1 79  ? 4.390   -1.343  -11.850 0.04 16.30 ? 135  GLY A N    1  
ATOM   1162   C CA   . GLY A 1 79  ? 3.697   -0.389  -11.008 0.04 16.14 ? 135  GLY A CA   1  
ATOM   1163   C C    . GLY A 1 79  ? 4.394   -0.253  -9.683  0.04 15.63 ? 135  GLY A C    1  
ATOM   1164   O O    . GLY A 1 79  ? 5.583   -0.552  -9.544  0.04 15.45 ? 135  GLY A O    1  
ATOM   1165   H H    . GLY A 1 79  ? 5.240   -1.344  -11.740 0.04 16.16 ? 135  GLY A H    1  
ATOM   1166   H HA2  . GLY A 1 79  ? 3.665   0.480   -11.430 0.04 16.32 ? 135  GLY A HA2  1  
ATOM   1167   H HA3  . GLY A 1 79  ? 2.800   -0.702  -10.859 0.04 16.20 ? 135  GLY A HA3  1  
ATOM   1168   N N    . ASP A 1 80  ? 3.610   0.184   -8.698  0.04 15.43 ? 136  ASP A N    1  
ATOM   1169   C CA   . ASP A 1 80  ? 4.147   0.762   -7.487  0.04 15.04 ? 136  ASP A CA   1  
ATOM   1170   C C    . ASP A 1 80  ? 3.412   0.227   -6.269  0.04 14.75 ? 136  ASP A C    1  
ATOM   1171   O O    . ASP A 1 80  ? 2.227   -0.141  -6.322  0.04 14.90 ? 136  ASP A O    1  
ATOM   1172   C CB   . ASP A 1 80  ? 4.021   2.299   -7.546  0.04 15.18 ? 136  ASP A CB   1  
ATOM   1173   C CG   . ASP A 1 80  ? 4.926   2.950   -8.594  0.04 15.48 ? 136  ASP A CG   1  
ATOM   1174   O OD1  . ASP A 1 80  ? 4.696   2.739   -9.805  0.04 15.85 ? 136  ASP A OD1  1  
ATOM   1175   O OD2  . ASP A 1 80  ? 5.806   3.737   -8.196  0.04 15.39 ? 136  ASP A OD2  1  
ATOM   1176   H H    . ASP A 1 80  ? 2.755   0.167   -8.719  0.04 15.54 ? 136  ASP A H    1  
ATOM   1177   H HA   . ASP A 1 80  ? 5.084   0.532   -7.406  0.04 14.90 ? 136  ASP A HA   1  
ATOM   1178   H HB2  . ASP A 1 80  ? 3.110   2.535   -7.775  0.04 15.37 ? 136  ASP A HB2  1  
ATOM   1179   H HB3  . ASP A 1 80  ? 4.261   2.660   -6.679  0.04 14.94 ? 136  ASP A HB3  1  
ATOM   1180   N N    . VAL A 1 81  ? 4.140   0.211   -5.167  0.04 14.37 ? 137  VAL A N    1  
ATOM   1181   C CA   . VAL A 1 81  ? 3.583   -0.026  -3.838  0.04 14.10 ? 137  VAL A CA   1  
ATOM   1182   C C    . VAL A 1 81  ? 4.000   1.210   -3.050  0.04 13.98 ? 137  VAL A C    1  
ATOM   1183   O O    . VAL A 1 81  ? 5.173   1.386   -2.697  0.04 13.78 ? 137  VAL A O    1  
ATOM   1184   C CB   . VAL A 1 81  ? 4.108   -1.362  -3.259  0.04 13.80 ? 137  VAL A CB   1  
ATOM   1185   C CG1  . VAL A 1 81  ? 3.697   -1.547  -1.833  0.04 13.52 ? 137  VAL A CG1  1  
ATOM   1186   C CG2  . VAL A 1 81  ? 3.587   -2.557  -4.085  0.04 13.95 ? 137  VAL A CG2  1  
ATOM   1187   H H    . VAL A 1 81  ? 4.987   0.348   -5.154  0.04 14.28 ? 137  VAL A H    1  
ATOM   1188   H HA   . VAL A 1 81  ? 2.615   -0.052  -3.889  0.04 14.24 ? 137  VAL A HA   1  
ATOM   1189   H HB   . VAL A 1 81  ? 5.080   -1.358  -3.294  0.04 13.70 ? 137  VAL A HB   1  
ATOM   1190   H HG11 . VAL A 1 81  ? 3.846   -2.473  -1.582  0.04 13.37 ? 137  VAL A HG11 1  
ATOM   1191   H HG12 . VAL A 1 81  ? 4.227   -0.960  -1.274  0.04 13.42 ? 137  VAL A HG12 1  
ATOM   1192   H HG13 . VAL A 1 81  ? 2.756   -1.327  -1.750  0.04 13.63 ? 137  VAL A HG13 1  
ATOM   1193   H HG21 . VAL A 1 81  ? 3.823   -3.384  -3.641  0.04 13.78 ? 137  VAL A HG21 1  
ATOM   1194   H HG22 . VAL A 1 81  ? 2.620   -2.487  -4.146  0.04 14.09 ? 137  VAL A HG22 1  
ATOM   1195   H HG23 . VAL A 1 81  ? 3.978   -2.527  -4.972  0.04 14.12 ? 137  VAL A HG23 1  
ATOM   1196   N N    . THR A 1 82  ? 3.033   2.089   -2.816  0.04 14.16 ? 138  THR A N    1  
ATOM   1197   C CA   . THR A 1 82  ? 3.295   3.511   -2.512  0.04 14.19 ? 138  THR A CA   1  
ATOM   1198   C C    . THR A 1 82  ? 2.734   4.017   -1.198  0.04 13.95 ? 138  THR A C    1  
ATOM   1199   O O    . THR A 1 82  ? 1.546   3.794   -0.888  0.04 14.00 ? 138  THR A O    1  
ATOM   1200   C CB   . THR A 1 82  ? 2.651   4.413   -3.593  0.04 14.63 ? 138  THR A CB   1  
ATOM   1201   O OG1  . THR A 1 82  ? 3.349   4.247   -4.824  0.04 14.87 ? 138  THR A OG1  1  
ATOM   1202   C CG2  . THR A 1 82  ? 2.643   5.895   -3.236  0.04 14.72 ? 138  THR A CG2  1  
ATOM   1203   H H    . THR A 1 82  ? 2.201   1.885   -2.821  0.04 14.30 ? 138  THR A H    1  
ATOM   1204   H HA   . THR A 1 82  ? 4.252   3.655   -2.521  0.04 14.12 ? 138  THR A HA   1  
ATOM   1205   H HB   . THR A 1 82  ? 1.725   4.147   -3.708  0.04 14.73 ? 138  THR A HB   1  
ATOM   1206   H HG1  . THR A 1 82  ? 3.094   3.544   -5.205  0.04 14.83 ? 138  THR A HG1  1  
ATOM   1207   H HG21 . THR A 1 82  ? 2.322   6.405   -3.994  0.04 15.02 ? 138  THR A HG21 1  
ATOM   1208   H HG22 . THR A 1 82  ? 2.066   6.087   -2.481  0.04 14.54 ? 138  THR A HG22 1  
ATOM   1209   H HG23 . THR A 1 82  ? 3.550   6.180   -3.030  0.04 14.71 ? 138  THR A HG23 1  
ATOM   1210   N N    . VAL A 1 83  ? 3.579   4.709   -0.436  0.04 13.73 ? 139  VAL A N    1  
ATOM   1211   C CA   . VAL A 1 83  ? 3.132   5.563   0.661   0.04 13.62 ? 139  VAL A CA   1  
ATOM   1212   C C    . VAL A 1 83  ? 3.542   7.027   0.431   0.04 13.77 ? 139  VAL A C    1  
ATOM   1213   O O    . VAL A 1 83  ? 4.716   7.305   0.152   0.04 13.70 ? 139  VAL A O    1  
ATOM   1214   C CB   . VAL A 1 83  ? 3.641   5.061   2.057   0.04 13.24 ? 139  VAL A CB   1  
ATOM   1215   C CG1  . VAL A 1 83  ? 3.074   5.926   3.116   0.04 13.18 ? 139  VAL A CG1  1  
ATOM   1216   C CG2  . VAL A 1 83  ? 3.263   3.624   2.364   0.04 13.14 ? 139  VAL A CG2  1  
ATOM   1217   H H    . VAL A 1 83  ? 4.432   4.703   -0.534  0.04 13.67 ? 139  VAL A H    1  
ATOM   1218   H HA   . VAL A 1 83  ? 2.166   5.544   0.681   0.04 13.74 ? 139  VAL A HA   1  
ATOM   1219   H HB   . VAL A 1 83  ? 4.609   5.135   2.080   0.04 13.13 ? 139  VAL A HB   1  
ATOM   1220   H HG11 . VAL A 1 83  ? 3.342   5.591   3.986   0.04 12.97 ? 139  VAL A HG11 1  
ATOM   1221   H HG12 . VAL A 1 83  ? 3.401   6.829   2.989   0.04 13.23 ? 139  VAL A HG12 1  
ATOM   1222   H HG13 . VAL A 1 83  ? 2.108   5.909   3.031   0.04 13.34 ? 139  VAL A HG13 1  
ATOM   1223   H HG21 . VAL A 1 83  ? 3.702   3.368   3.189   0.04 12.93 ? 139  VAL A HG21 1  
ATOM   1224   H HG22 . VAL A 1 83  ? 2.300   3.558   2.476   0.04 13.28 ? 139  VAL A HG22 1  
ATOM   1225   H HG23 . VAL A 1 83  ? 3.556   3.051   1.639   0.04 13.19 ? 139  VAL A HG23 1  
ATOM   1226   N N    . ASP A 1 84  ? 2.580   7.936   0.588   0.04 14.02 ? 140  ASP A N    1  
ATOM   1227   C CA   . ASP A 1 84  ? 2.814   9.385   0.464   0.04 14.24 ? 140  ASP A CA   1  
ATOM   1228   C C    . ASP A 1 84  ? 1.984   10.022  1.584   0.04 14.21 ? 140  ASP A C    1  
ATOM   1229   O O    . ASP A 1 84  ? 1.593   9.333   2.537   0.04 14.03 ? 140  ASP A O    1  
ATOM   1230   C CB   . ASP A 1 84  ? 2.513   9.893   -0.959  0.04 14.70 ? 140  ASP A CB   1  
ATOM   1231   C CG   . ASP A 1 84  ? 3.105   11.309  -1.268  0.04 14.94 ? 140  ASP A CG   1  
ATOM   1232   O OD1  . ASP A 1 84  ? 3.910   11.895  -0.488  0.04 14.77 ? 140  ASP A OD1  1  
ATOM   1233   O OD2  . ASP A 1 84  ? 2.725   11.854  -2.332  0.04 15.35 ? 140  ASP A OD2  1  
ATOM   1234   H H    . ASP A 1 84  ? 1.765   7.736   0.775   0.04 14.09 ? 140  ASP A H    1  
ATOM   1235   H HA   . ASP A 1 84  ? 3.750   9.572   0.646   0.04 14.14 ? 140  ASP A HA   1  
ATOM   1236   H HB2  . ASP A 1 84  ? 2.919   9.271   -1.580  0.04 14.71 ? 140  ASP A HB2  1  
ATOM   1237   H HB3  . ASP A 1 84  ? 1.553   9.919   -1.102  0.04 14.86 ? 140  ASP A HB3  1  
ATOM   1238   N N    . ALA A 1 85  ? 1.748   11.319  1.500   0.04 14.37 ? 141  ALA A N    1  
ATOM   1239   C CA   . ALA A 1 85  ? 1.382   12.071  2.677   0.04 14.35 ? 141  ALA A CA   1  
ATOM   1240   C C    . ALA A 1 85  ? 0.255   13.075  2.426   0.04 14.80 ? 141  ALA A C    1  
ATOM   1241   O O    . ALA A 1 85  ? 0.078   14.011  3.185   0.04 14.88 ? 141  ALA A O    1  
ATOM   1242   C CB   . ALA A 1 85  ? 2.634   12.746  3.246   0.04 14.16 ? 141  ALA A CB   1  
ATOM   1243   H H    . ALA A 1 85  ? 1.771   11.773  0.772   0.04 14.51 ? 141  ALA A H    1  
ATOM   1244   H HA   . ALA A 1 85  ? 1.052   11.465  3.356   0.04 14.19 ? 141  ALA A HA   1  
ATOM   1245   H HB1  . ALA A 1 85  ? 2.400   13.274  4.023   0.04 14.02 ? 141  ALA A HB1  1  
ATOM   1246   H HB2  . ALA A 1 85  ? 3.261   12.056  3.503   0.04 13.98 ? 141  ALA A HB2  1  
ATOM   1247   H HB3  . ALA A 1 85  ? 3.035   13.312  2.569   0.04 14.38 ? 141  ALA A HB3  1  
ATOM   1248   N N    . GLY A 1 86  ? -0.518  12.868  1.365   0.04 15.11 ? 142  GLY A N    1  
ATOM   1249   C CA   . GLY A 1 86  ? -1.603  13.789  1.029   0.04 15.59 ? 142  GLY A CA   1  
ATOM   1250   C C    . GLY A 1 86  ? -2.556  14.061  2.180   0.04 15.65 ? 142  GLY A C    1  
ATOM   1251   O O    . GLY A 1 86  ? -2.985  15.211  2.373   0.04 15.98 ? 142  GLY A O    1  
ATOM   1252   H H    . GLY A 1 86  ? -0.439  12.202  0.828   0.04 15.08 ? 142  GLY A H    1  
ATOM   1253   H HA2  . GLY A 1 86  ? -1.235  14.636  0.731   0.04 15.76 ? 142  GLY A HA2  1  
ATOM   1254   H HA3  . GLY A 1 86  ? -2.133  13.416  0.319   0.04 15.77 ? 142  GLY A HA3  1  
ATOM   1255   N N    . TRP A 1 87  ? -2.871  13.010  2.945   0.04 15.37 ? 143  TRP A N    1  
ATOM   1256   C CA   . TRP A 1 87  ? -3.887  13.127  3.991   0.04 15.47 ? 143  TRP A CA   1  
ATOM   1257   C C    . TRP A 1 87  ? -3.477  14.197  4.981   0.04 15.36 ? 143  TRP A C    1  
ATOM   1258   O O    . TRP A 1 87  ? -4.342  14.848  5.591   0.04 15.54 ? 143  TRP A O    1  
ATOM   1259   C CB   . TRP A 1 87  ? -4.151  11.780  4.707   0.04 15.20 ? 143  TRP A CB   1  
ATOM   1260   C CG   . TRP A 1 87  ? -3.022  11.271  5.611   0.04 14.71 ? 143  TRP A CG   1  
ATOM   1261   C CD1  . TRP A 1 87  ? -1.833  10.709  5.203   0.04 14.40 ? 143  TRP A CD1  1  
ATOM   1262   C CD2  . TRP A 1 87  ? -2.978  11.288  7.052   0.04 14.51 ? 143  TRP A CD2  1  
ATOM   1263   N NE1  . TRP A 1 87  ? -1.055  10.382  6.307   0.04 14.03 ? 143  TRP A NE1  1  
ATOM   1264   C CE2  . TRP A 1 87  ? -1.735  10.731  7.448   0.04 14.09 ? 143  TRP A CE2  1  
ATOM   1265   C CE3  . TRP A 1 87  ? -3.864  11.729  8.040   0.04 14.69 ? 143  TRP A CE3  1  
ATOM   1266   C CZ2  . TRP A 1 87  ? -1.373  10.591  8.790   0.04 13.84 ? 143  TRP A CZ2  1  
ATOM   1267   C CZ3  . TRP A 1 87  ? -3.493  11.580  9.386   0.04 14.44 ? 143  TRP A CZ3  1  
ATOM   1268   C CH2  . TRP A 1 87  ? -2.251  11.024  9.740   0.04 14.02 ? 143  TRP A CH2  1  
ATOM   1269   H H    . TRP A 1 87  ? -2.525  12.225  2.864   0.04 15.14 ? 143  TRP A H    1  
ATOM   1270   H HA   . TRP A 1 87  ? -4.719  13.413  3.584   0.04 15.82 ? 143  TRP A HA   1  
ATOM   1271   H HB2  . TRP A 1 87  ? -4.945  11.871  5.255   0.04 15.34 ? 143  TRP A HB2  1  
ATOM   1272   H HB3  . TRP A 1 87  ? -4.308  11.110  4.024   0.04 15.26 ? 143  TRP A HB3  1  
ATOM   1273   H HD1  . TRP A 1 87  ? -1.582  10.578  4.318   0.04 14.46 ? 143  TRP A HD1  1  
ATOM   1274   H HE1  . TRP A 1 87  ? -0.275  10.022  6.279   0.04 13.82 ? 143  TRP A HE1  1  
ATOM   1275   H HE3  . TRP A 1 87  ? -4.682  12.101  7.811   0.04 14.99 ? 143  TRP A HE3  1  
ATOM   1276   H HZ2  . TRP A 1 87  ? -0.554  10.219  9.034   0.04 13.59 ? 143  TRP A HZ2  1  
ATOM   1277   H HZ3  . TRP A 1 87  ? -4.073  11.872  10.049  0.04 14.57 ? 143  TRP A HZ3  1  
ATOM   1278   H HH2  . TRP A 1 87  ? -2.029  10.940  10.638  0.04 13.87 ? 143  TRP A HH2  1  
ATOM   1279   N N    . PHE A 1 88  ? -2.171  14.382  5.129   0.04 15.10 ? 144  PHE A N    1  
ATOM   1280   C CA   . PHE A 1 88  ? -1.623  15.279  6.133   0.04 14.98 ? 144  PHE A CA   1  
ATOM   1281   C C    . PHE A 1 88  ? -0.789  16.379  5.461   0.04 15.16 ? 144  PHE A C    1  
ATOM   1282   O O    . PHE A 1 88  ? 0.239   16.774  5.962   0.04 14.96 ? 144  PHE A O    1  
ATOM   1283   C CB   . PHE A 1 88  ? -0.788  14.431  7.088   0.04 14.50 ? 144  PHE A CB   1  
ATOM   1284   C CG   . PHE A 1 88  ? -0.706  14.929  8.528   0.04 14.40 ? 144  PHE A CG   1  
ATOM   1285   C CD1  . PHE A 1 88  ? -1.775  15.585  9.155   0.04 14.60 ? 144  PHE A CD1  1  
ATOM   1286   C CD2  . PHE A 1 88  ? 0.454   14.711  9.261   0.04 14.14 ? 144  PHE A CD2  1  
ATOM   1287   C CE1  . PHE A 1 88  ? -1.656  16.006  10.480  0.04 14.55 ? 144  PHE A CE1  1  
ATOM   1288   C CE2  . PHE A 1 88  ? 0.591   15.129  10.566  0.04 14.09 ? 144  PHE A CE2  1  
ATOM   1289   C CZ   . PHE A 1 88  ? -0.464  15.775  11.192  0.04 14.29 ? 144  PHE A CZ   1  
ATOM   1290   H H    . PHE A 1 88  ? -1.573  13.995  4.647   0.04 15.01 ? 144  PHE A H    1  
ATOM   1291   H HA   . PHE A 1 88  ? -2.346  15.707  6.620   0.04 15.16 ? 144  PHE A HA   1  
ATOM   1292   H HB2  . PHE A 1 88  ? -1.178  13.542  7.112   0.04 14.42 ? 144  PHE A HB2  1  
ATOM   1293   H HB3  . PHE A 1 88  ? 0.117   14.375  6.739   0.04 14.34 ? 144  PHE A HB3  1  
ATOM   1294   H HD1  . PHE A 1 88  ? -2.566  15.734  8.690   0.04 14.80 ? 144  PHE A HD1  1  
ATOM   1295   H HD2  . PHE A 1 88  ? 1.168   14.282  8.852   0.04 14.03 ? 144  PHE A HD2  1  
ATOM   1296   H HE1  . PHE A 1 88  ? -2.365  16.440  10.895  0.04 14.71 ? 144  PHE A HE1  1  
ATOM   1297   H HE2  . PHE A 1 88  ? 1.382   14.973  11.030  0.04 13.94 ? 144  PHE A HE2  1  
ATOM   1298   H HZ   . PHE A 1 88  ? -0.380  16.061  12.072  0.04 14.28 ? 144  PHE A HZ   1  
ATOM   1299   N N    . ASP A 1 89  ? -1.237  16.830  4.295   0.04 15.57 ? 145  ASP A N    1  
ATOM   1300   C CA   . ASP A 1 89  ? -0.607  17.954  3.612   0.04 15.89 ? 145  ASP A CA   1  
ATOM   1301   C C    . ASP A 1 89  ? 0.864   17.777  3.244   0.04 15.62 ? 145  ASP A C    1  
ATOM   1302   O O    . ASP A 1 89  ? 1.564   18.781  3.093   0.04 15.71 ? 145  ASP A O    1  
ATOM   1303   C CB   . ASP A 1 89  ? -0.605  19.174  4.526   0.04 16.23 ? 145  ASP A CB   1  
ATOM   1304   C CG   . ASP A 1 89  ? -1.987  19.593  5.017   0.04 16.66 ? 145  ASP A CG   1  
ATOM   1305   O OD1  . ASP A 1 89  ? -3.075  19.117  4.583   0.04 16.92 ? 145  ASP A OD1  1  
ATOM   1306   O OD2  . ASP A 1 89  ? -1.960  20.511  5.833   0.04 16.75 ? 145  ASP A OD2  1  
ATOM   1307   H H    . ASP A 1 89  ? -1.909  16.497  3.873   0.04 15.71 ? 145  ASP A H    1  
ATOM   1308   H HA   . ASP A 1 89  ? -1.107  18.169  2.811   0.04 16.14 ? 145  ASP A HA   1  
ATOM   1309   H HB2  . ASP A 1 89  ? -0.060  18.994  5.306   0.04 16.04 ? 145  ASP A HB2  1  
ATOM   1310   H HB3  . ASP A 1 89  ? -0.242  19.934  4.045   0.04 16.40 ? 145  ASP A HB3  1  
ATOM   1311   N N    . GLY A 1 90  ? 1.360   16.548  3.133   0.04 15.33 ? 146  GLY A N    1  
ATOM   1312   C CA   . GLY A 1 90  ? 2.783   16.344  2.872   0.04 15.17 ? 146  GLY A CA   1  
ATOM   1313   C C    . GLY A 1 90  ? 3.691   16.086  4.066   0.04 14.75 ? 146  GLY A C    1  
ATOM   1314   O O    . GLY A 1 90  ? 4.899   15.910  3.942   0.04 14.58 ? 146  GLY A O    1  
ATOM   1315   H H    . GLY A 1 90  ? 0.898   15.826  3.185   0.04 15.25 ? 146  GLY A H    1  
ATOM   1316   H HA2  . GLY A 1 90  ? 2.877   15.585  2.291   0.04 15.13 ? 146  GLY A HA2  1  
ATOM   1317   H HA3  . GLY A 1 90  ? 3.131   17.119  2.404   0.04 15.42 ? 146  GLY A HA3  1  
ATOM   1318   N N    . ASN A 1 91  ? 3.109   16.058  5.250   0.04 14.61 ? 147  ASN A N    1  
ATOM   1319   C CA   . ASN A 1 91  ? 3.839   15.730  6.468   0.04 14.24 ? 147  ASN A CA   1  
ATOM   1320   C C    . ASN A 1 91  ? 3.736   14.190  6.698   0.04 13.90 ? 147  ASN A C    1  
ATOM   1321   O O    . ASN A 1 91  ? 2.669   13.678  6.997   0.04 13.93 ? 147  ASN A O    1  
ATOM   1322   C CB   . ASN A 1 91  ? 3.202   16.551  7.584   0.04 14.34 ? 147  ASN A CB   1  
ATOM   1323   C CG   . ASN A 1 91  ? 3.726   16.226  8.943   0.04 14.03 ? 147  ASN A CG   1  
ATOM   1324   O OD1  . ASN A 1 91  ? 4.499   15.290  9.109   0.04 13.70 ? 147  ASN A OD1  1  
ATOM   1325   N ND2  . ASN A 1 91  ? 3.240   16.952  9.955   0.04 14.16 ? 147  ASN A ND2  1  
ATOM   1326   H H    . ASN A 1 91  ? 2.277   16.219  5.383   0.04 14.75 ? 147  ASN A H    1  
ATOM   1327   H HA   . ASN A 1 91  ? 4.772   15.978  6.385   0.04 14.20 ? 147  ASN A HA   1  
ATOM   1328   H HB2  . ASN A 1 91  ? 3.380   17.491  7.414   0.04 14.60 ? 147  ASN A HB2  1  
ATOM   1329   H HB3  . ASN A 1 91  ? 2.246   16.395  7.592   0.04 14.39 ? 147  ASN A HB3  1  
ATOM   1330   H HD21 . ASN A 1 91  ? 3.289   16.658  10.762  0.04 14.11 ? 147  ASN A HD21 1  
ATOM   1331   H HD22 . ASN A 1 91  ? 2.864   17.709  9.792   0.04 14.31 ? 147  ASN A HD22 1  
ATOM   1332   N N    . ALA A 1 92  ? 4.835   13.473  6.513   0.04 13.63 ? 148  ALA A N    1  
ATOM   1333   C CA   . ALA A 1 92  ? 4.855   11.986  6.632   0.04 13.33 ? 148  ALA A CA   1  
ATOM   1334   C C    . ALA A 1 92  ? 5.096   11.422  8.032   0.04 13.03 ? 148  ALA A C    1  
ATOM   1335   O O    . ALA A 1 92  ? 5.303   10.224  8.204   0.04 12.79 ? 148  ALA A O    1  
ATOM   1336   C CB   . ALA A 1 92  ? 5.897   11.416  5.680   0.04 13.25 ? 148  ALA A CB   1  
ATOM   1337   H H    . ALA A 1 92  ? 5.599   13.814  6.318   0.04 13.63 ? 148  ALA A H    1  
ATOM   1338   H HA   . ALA A 1 92  ? 3.993   11.652  6.334   0.04 13.41 ? 148  ALA A HA   1  
ATOM   1339   H HB1  . ALA A 1 92  ? 5.886   10.450  5.754   0.04 13.12 ? 148  ALA A HB1  1  
ATOM   1340   H HB2  . ALA A 1 92  ? 5.678   11.677  4.774   0.04 13.47 ? 148  ALA A HB2  1  
ATOM   1341   H HB3  . ALA A 1 92  ? 6.766   11.754  5.930   0.04 13.15 ? 148  ALA A HB3  1  
ATOM   1342   N N    . THR A 1 93  ? 5.050   12.305  9.013   0.04 13.06 ? 149  THR A N    1  
ATOM   1343   C CA   . THR A 1 93  ? 5.406   12.027  10.393  0.04 12.82 ? 149  THR A CA   1  
ATOM   1344   C C    . THR A 1 93  ? 4.350   11.216  11.153  0.04 12.78 ? 149  THR A C    1  
ATOM   1345   O O    . THR A 1 93  ? 4.542   10.894  12.316  0.04 12.66 ? 149  THR A O    1  
ATOM   1346   C CB   . THR A 1 93  ? 5.725   13.375  11.135  0.04 12.90 ? 149  THR A CB   1  
ATOM   1347   O OG1  . THR A 1 93  ? 4.848   14.413  10.675  0.04 13.18 ? 149  THR A OG1  1  
ATOM   1348   C CG2  . THR A 1 93  ? 7.145   13.759  10.848  0.04 12.97 ? 149  THR A CG2  1  
ATOM   1349   H H    . THR A 1 93  ? 4.805   13.122  8.895   0.04 13.25 ? 149  THR A H    1  
ATOM   1350   H HA   . THR A 1 93  ? 6.212   11.496  10.397  0.04 12.65 ? 149  THR A HA   1  
ATOM   1351   H HB   . THR A 1 93  ? 5.617   13.258  12.089  0.04 12.75 ? 149  THR A HB   1  
ATOM   1352   H HG1  . THR A 1 93  ? 4.753   15.011  11.257  0.04 13.34 ? 149  THR A HG1  1  
ATOM   1353   H HG21 . THR A 1 93  ? 7.427   14.440  11.480  0.04 13.01 ? 149  THR A HG21 1  
ATOM   1354   H HG22 . THR A 1 93  ? 7.734   12.998  10.926  0.04 12.82 ? 149  THR A HG22 1  
ATOM   1355   H HG23 . THR A 1 93  ? 7.206   14.110  9.946   0.04 13.17 ? 149  THR A HG23 1  
ATOM   1356   N N    . GLN A 1 94  ? 3.280   10.827  10.491  0.04 12.91 ? 150  GLN A N    1  
ATOM   1357   C CA   . GLN A 1 94  ? 2.314   9.929   11.114  0.04 12.87 ? 150  GLN A CA   1  
ATOM   1358   C C    . GLN A 1 94  ? 1.944   8.746   10.199  0.04 12.80 ? 150  GLN A C    1  
ATOM   1359   O O    . GLN A 1 94  ? 0.935   8.060   10.415  0.04 12.82 ? 150  GLN A O    1  
ATOM   1360   C CB   . GLN A 1 94  ? 1.088   10.676  11.617  0.04 13.17 ? 150  GLN A CB   1  
ATOM   1361   C CG   . GLN A 1 94  ? 1.511   11.707  12.664  0.04 13.27 ? 150  GLN A CG   1  
ATOM   1362   C CD   . GLN A 1 94  ? 0.390   12.480  13.260  0.04 13.52 ? 150  GLN A CD   1  
ATOM   1363   O OE1  . GLN A 1 94  ? -0.784  12.085  13.221  0.04 13.68 ? 150  GLN A OE1  1  
ATOM   1364   N NE2  . GLN A 1 94  ? 0.745   13.603  13.845  0.04 13.59 ? 150  GLN A NE2  1  
ATOM   1365   H H    . GLN A 1 94  ? 3.089   11.049  9.683   0.04 13.05 ? 150  GLN A H    1  
ATOM   1366   H HA   . GLN A 1 94  ? 2.714   9.530   11.895  0.04 12.72 ? 150  GLN A HA   1  
ATOM   1367   H HB2  . GLN A 1 94  ? 0.646   11.130  10.881  0.04 13.36 ? 150  GLN A HB2  1  
ATOM   1368   H HB3  . GLN A 1 94  ? 0.485   10.039  12.032  0.04 13.15 ? 150  GLN A HB3  1  
ATOM   1369   H HG2  . GLN A 1 94  ? 1.972   11.259  13.393  0.04 13.08 ? 150  GLN A HG2  1  
ATOM   1370   H HG3  . GLN A 1 94  ? 2.115   12.340  12.242  0.04 13.38 ? 150  GLN A HG3  1  
ATOM   1371   H HE21 . GLN A 1 94  ? 1.569   13.740  14.049  0.04 13.47 ? 150  GLN A HE21 1  
ATOM   1372   H HE22 . GLN A 1 94  ? 0.147   14.194  14.037  0.04 13.76 ? 150  GLN A HE22 1  
ATOM   1373   N N    . ASN A 1 95  ? 2.832   8.458   9.250   0.04 12.71 ? 151  ASN A N    1  
ATOM   1374   C CA   . ASN A 1 95  ? 2.614   7.361   8.326   0.04 12.68 ? 151  ASN A CA   1  
ATOM   1375   C C    . ASN A 1 95  ? 3.107   6.046   8.964   0.04 12.40 ? 151  ASN A C    1  
ATOM   1376   O O    . ASN A 1 95  ? 4.163   5.498   8.609   0.04 12.26 ? 151  ASN A O    1  
ATOM   1377   C CB   . ASN A 1 95  ? 3.278   7.634   6.989   0.04 12.79 ? 151  ASN A CB   1  
ATOM   1378   C CG   . ASN A 1 95  ? 2.508   8.628   6.132   0.04 13.14 ? 151  ASN A CG   1  
ATOM   1379   O OD1  . ASN A 1 95  ? 1.355   8.995   6.429   0.04 13.31 ? 151  ASN A OD1  1  
ATOM   1380   N ND2  . ASN A 1 95  ? 3.124   9.045   5.020   0.04 13.28 ? 151  ASN A ND2  1  
ATOM   1381   H H    . ASN A 1 95  ? 3.569   8.880   9.127   0.04 12.69 ? 151  ASN A H    1  
ATOM   1382   H HA   . ASN A 1 95  ? 1.662   7.278   8.153   0.04 12.82 ? 151  ASN A HA   1  
ATOM   1383   H HB2  . ASN A 1 95  ? 4.168   7.991   7.146   0.04 12.72 ? 151  ASN A HB2  1  
ATOM   1384   H HB3  . ASN A 1 95  ? 3.330   6.797   6.498   0.04 12.73 ? 151  ASN A HB3  1  
ATOM   1385   H HD21 . ASN A 1 95  ? 2.668   9.385   4.378   0.04 13.49 ? 151  ASN A HD21 1  
ATOM   1386   H HD22 . ASN A 1 95  ? 3.977   8.951   4.947   0.04 13.18 ? 151  ASN A HD22 1  
ATOM   1387   N N    . PHE A 1 96  ? 2.272   5.551   9.871   0.04 12.37 ? 152  PHE A N    1  
ATOM   1388   C CA   . PHE A 1 96  ? 2.579   4.412   10.717  0.04 12.16 ? 152  PHE A CA   1  
ATOM   1389   C C    . PHE A 1 96  ? 1.801   3.163   10.304  0.04 12.21 ? 152  PHE A C    1  
ATOM   1390   O O    . PHE A 1 96  ? 0.833   3.225   9.553   0.04 12.42 ? 152  PHE A O    1  
ATOM   1391   C CB   . PHE A 1 96  ? 2.127   4.682   12.155  0.04 12.15 ? 152  PHE A CB   1  
ATOM   1392   C CG   . PHE A 1 96  ? 2.648   5.970   12.772  0.04 12.17 ? 152  PHE A CG   1  
ATOM   1393   C CD1  . PHE A 1 96  ? 3.964   6.361   12.640  0.04 12.06 ? 152  PHE A CD1  1  
ATOM   1394   C CD2  . PHE A 1 96  ? 1.807   6.732   13.545  0.04 12.33 ? 152  PHE A CD2  1  
ATOM   1395   C CE1  . PHE A 1 96  ? 4.408   7.527   13.278  0.04 12.12 ? 152  PHE A CE1  1  
ATOM   1396   C CE2  . PHE A 1 96  ? 2.249   7.865   14.203  0.04 12.38 ? 152  PHE A CE2  1  
ATOM   1397   C CZ   . PHE A 1 96  ? 3.538   8.274   14.056  0.04 12.28 ? 152  PHE A CZ   1  
ATOM   1398   H H    . PHE A 1 96  ? 1.495   5.886   10.020  0.04 12.50 ? 152  PHE A H    1  
ATOM   1399   H HA   . PHE A 1 96  ? 3.523   4.219   10.700  0.04 12.04 ? 152  PHE A HA   1  
ATOM   1400   H HB2  . PHE A 1 96  ? 1.161   4.725   12.163  0.04 12.28 ? 152  PHE A HB2  1  
ATOM   1401   H HB3  . PHE A 1 96  ? 2.424   3.953   12.717  0.04 12.02 ? 152  PHE A HB3  1  
ATOM   1402   H HD1  . PHE A 1 96  ? 4.553   5.858   12.130  0.04 11.97 ? 152  PHE A HD1  1  
ATOM   1403   H HD2  . PHE A 1 96  ? 0.928   6.456   13.655  0.04 12.42 ? 152  PHE A HD2  1  
ATOM   1404   H HE1  . PHE A 1 96  ? 5.293   7.795   13.180  0.04 12.07 ? 152  PHE A HE1  1  
ATOM   1405   H HE2  . PHE A 1 96  ? 1.651   8.373   14.701  0.04 12.51 ? 152  PHE A HE2  1  
ATOM   1406   H HZ   . PHE A 1 96  ? 3.827   9.054   14.473  0.04 12.34 ? 152  PHE A HZ   1  
ATOM   1407   N N    . TRP A 1 97  ? 2.238   2.039   10.881  0.04 12.05 ? 153  TRP A N    1  
ATOM   1408   C CA   . TRP A 1 97  ? 1.483   0.789   10.949  0.04 12.11 ? 153  TRP A CA   1  
ATOM   1409   C C    . TRP A 1 97  ? 1.038   0.269   9.581   0.04 12.26 ? 153  TRP A C    1  
ATOM   1410   O O    . TRP A 1 97  ? -0.154  0.136   9.289   0.04 12.47 ? 153  TRP A O    1  
ATOM   1411   C CB   . TRP A 1 97  ? 0.260   0.893   11.914  0.04 12.24 ? 153  TRP A CB   1  
ATOM   1412   C CG   . TRP A 1 97  ? 0.642   1.314   13.338  0.04 12.12 ? 153  TRP A CG   1  
ATOM   1413   C CD1  . TRP A 1 97  ? 1.549   0.710   14.174  0.04 11.95 ? 153  TRP A CD1  1  
ATOM   1414   C CD2  . TRP A 1 97  ? 0.122   2.441   14.058  0.04 12.22 ? 153  TRP A CD2  1  
ATOM   1415   N NE1  . TRP A 1 97  ? 1.638   1.401   15.361  0.04 11.93 ? 153  TRP A NE1  1  
ATOM   1416   C CE2  . TRP A 1 97  ? 0.767   2.465   15.312  0.04 12.09 ? 153  TRP A CE2  1  
ATOM   1417   C CE3  . TRP A 1 97  ? -0.834  3.410   13.775  0.04 12.45 ? 153  TRP A CE3  1  
ATOM   1418   C CZ2  . TRP A 1 97  ? 0.523   3.479   16.257  0.04 12.17 ? 153  TRP A CZ2  1  
ATOM   1419   C CZ3  . TRP A 1 97  ? -1.080  4.404   14.708  0.04 12.52 ? 153  TRP A CZ3  1  
ATOM   1420   C CH2  . TRP A 1 97  ? -0.396  4.433   15.927  0.04 12.38 ? 153  TRP A CH2  1  
ATOM   1421   H H    . TRP A 1 97  ? 3.011   1.982   11.246  0.04 11.93 ? 153  TRP A H    1  
ATOM   1422   H HA   . TRP A 1 97  ? 2.073   0.117   11.316  0.04 11.99 ? 153  TRP A HA   1  
ATOM   1423   H HB2  . TRP A 1 97  ? -0.331  1.576   11.572  0.04 12.37 ? 153  TRP A HB2  1  
ATOM   1424   H HB3  . TRP A 1 97  ? -0.196  0.039   11.940  0.04 12.29 ? 153  TRP A HB3  1  
ATOM   1425   H HD1  . TRP A 1 97  ? 2.048   -0.043  13.963  0.04 11.88 ? 153  TRP A HD1  1  
ATOM   1426   H HE1  . TRP A 1 97  ? 2.162   1.203   16.010  0.04 11.85 ? 153  TRP A HE1  1  
ATOM   1427   H HE3  . TRP A 1 97  ? -1.257  3.426   12.948  0.04 12.56 ? 153  TRP A HE3  1  
ATOM   1428   H HZ2  . TRP A 1 97  ? 0.948   3.474   17.085  0.04 12.11 ? 153  TRP A HZ2  1  
ATOM   1429   H HZ3  . TRP A 1 97  ? -1.701  5.064   14.513  0.04 12.70 ? 153  TRP A HZ3  1  
ATOM   1430   H HH2  . TRP A 1 97  ? -0.612  5.088   16.550  0.04 12.46 ? 153  TRP A HH2  1  
ATOM   1431   N N    . ARG A 1 98  ? 2.012   -0.048  8.745   0.04 12.18 ? 154  ARG A N    1  
ATOM   1432   C CA   . ARG A 1 98  ? 1.705   -0.675  7.446   0.04 12.35 ? 154  ARG A CA   1  
ATOM   1433   C C    . ARG A 1 98  ? 2.947   -1.434  7.024   0.04 12.23 ? 154  ARG A C    1  
ATOM   1434   O O    . ARG A 1 98  ? 3.984   -1.314  7.659   0.04 12.04 ? 154  ARG A O    1  
ATOM   1435   C CB   . ARG A 1 98  ? 1.292   0.377   6.405   0.04 12.54 ? 154  ARG A CB   1  
ATOM   1436   C CG   . ARG A 1 98  ? 2.328   1.455   6.078   0.04 12.45 ? 154  ARG A CG   1  
ATOM   1437   C CD   . ARG A 1 98  ? 1.653   2.672   5.500   0.04 12.66 ? 154  ARG A CD   1  
ATOM   1438   N NE   . ARG A 1 98  ? 0.952   3.398   6.555   0.04 12.67 ? 154  ARG A NE   1  
ATOM   1439   C CZ   . ARG A 1 98  ? 0.186   4.457   6.370   0.04 12.90 ? 154  ARG A CZ   1  
ATOM   1440   N NH1  . ARG A 1 98  ? -0.043  4.927   5.153   0.04 13.17 ? 154  ARG A NH1  1  
ATOM   1441   N NH2  . ARG A 1 98  ? -0.339  5.049   7.436   0.04 12.91 ? 154  ARG A NH2  1  
ATOM   1442   H H    . ARG A 1 98  ? 2.847   0.079   8.890   0.04 12.06 ? 154  ARG A H    1  
ATOM   1443   H HA   . ARG A 1 98  ? 0.979   -1.308  7.544   0.04 12.44 ? 154  ARG A HA   1  
ATOM   1444   H HB2  . ARG A 1 98  ? 1.059   -0.082  5.584   0.04 12.67 ? 154  ARG A HB2  1  
ATOM   1445   H HB3  . ARG A 1 98  ? 0.511   0.842   6.739   0.04 12.62 ? 154  ARG A HB3  1  
ATOM   1446   H HG2  . ARG A 1 98  ? 2.792   1.706   6.894   0.04 12.30 ? 154  ARG A HG2  1  
ATOM   1447   H HG3  . ARG A 1 98  ? 2.955   1.106   5.423   0.04 12.45 ? 154  ARG A HG3  1  
ATOM   1448   H HD2  . ARG A 1 98  ? 2.323   3.257   5.119   0.04 12.65 ? 154  ARG A HD2  1  
ATOM   1449   H HD3  . ARG A 1 98  ? 1.011   2.402   4.824   0.04 12.84 ? 154  ARG A HD3  1  
ATOM   1450   H HE   . ARG A 1 98  ? 0.947   3.037   7.335   0.04 12.54 ? 154  ARG A HE   1  
ATOM   1451   H HH11 . ARG A 1 98  ? 0.309   4.540   4.472   0.04 13.18 ? 154  ARG A HH11 1  
ATOM   1452   H HH12 . ARG A 1 98  ? -0.550  5.609   5.047   0.04 13.34 ? 154  ARG A HH12 1  
ATOM   1453   H HH21 . ARG A 1 98  ? -0.181  4.726   8.214   0.04 12.76 ? 154  ARG A HH21 1  
ATOM   1454   H HH22 . ARG A 1 98  ? -0.856  5.726   7.345   0.04 13.08 ? 154  ARG A HH22 1  
ATOM   1455   N N    . SER A 1 99  ? 2.875   -2.230  5.972   0.04 12.36 ? 155  SER A N    1  
ATOM   1456   C CA   . SER A 1 99  ? 4.047   -3.026  5.590   0.04 12.28 ? 155  SER A CA   1  
ATOM   1457   C C    . SER A 1 99  ? 4.000   -3.488  4.152   0.04 12.49 ? 155  SER A C    1  
ATOM   1458   O O    . SER A 1 99  ? 2.950   -3.635  3.563   0.04 12.70 ? 155  SER A O    1  
ATOM   1459   C CB   . SER A 1 99  ? 4.176   -4.263  6.484   0.04 12.21 ? 155  SER A CB   1  
ATOM   1460   O OG   . SER A 1 99  ? 3.072   -5.136  6.299   0.04 12.39 ? 155  SER A OG   1  
ATOM   1461   H H    . SER A 1 99  ? 2.189   -2.327  5.462   0.04 12.52 ? 155  SER A H    1  
ATOM   1462   H HA   . SER A 1 99  ? 4.842   -2.494  5.703   0.04 12.18 ? 155  SER A HA   1  
ATOM   1463   H HB2  . SER A 1 99  ? 4.983   -4.747  6.248   0.04 12.19 ? 155  SER A HB2  1  
ATOM   1464   H HB3  . SER A 1 99  ? 4.217   -3.988  7.414   0.04 12.09 ? 155  SER A HB3  1  
ATOM   1465   H HG   . SER A 1 99  ? 3.333   -5.871  5.983   0.04 12.45 ? 155  SER A HG   1  
ATOM   1466   N N    . ALA A 1 100 ? 5.194   -3.775  3.633   0.04 12.45 ? 156  ALA A N    1  
ATOM   1467   C CA   . ALA A 1 100 ? 5.376   -4.377  2.287   0.04 12.66 ? 156  ALA A CA   1  
ATOM   1468   C C    . ALA A 1 100 ? 6.405   -5.479  2.373   0.04 12.61 ? 156  ALA A C    1  
ATOM   1469   O O    . ALA A 1 100 ? 7.461   -5.283  2.963   0.04 12.44 ? 156  ALA A O    1  
ATOM   1470   C CB   . ALA A 1 100 ? 5.856   -3.322  1.286   0.04 12.76 ? 156  ALA A CB   1  
ATOM   1471   H H    . ALA A 1 100 ? 5.930   -3.650  4.046   0.04 12.33 ? 156  ALA A H    1  
ATOM   1472   H HA   . ALA A 1 100 ? 4.541   -4.743  1.972   0.04 12.80 ? 156  ALA A HA   1  
ATOM   1473   H HB1  . ALA A 1 100 ? 5.859   -3.700  0.394   0.04 12.93 ? 156  ALA A HB1  1  
ATOM   1474   H HB2  . ALA A 1 100 ? 5.252   -2.562  1.317   0.04 12.80 ? 156  ALA A HB2  1  
ATOM   1475   H HB3  . ALA A 1 100 ? 6.746   -3.041  1.542   0.04 12.65 ? 156  ALA A HB3  1  
ATOM   1476   N N    . GLU A 1 101 ? 6.078   -6.642  1.794   0.04 12.80 ? 157  GLU A N    1  
ATOM   1477   C CA   . GLU A 1 101 ? 6.971   -7.817  1.796   0.04 12.82 ? 157  GLU A CA   1  
ATOM   1478   C C    . GLU A 1 101 ? 6.909   -8.602  0.509   0.04 13.11 ? 157  GLU A C    1  
ATOM   1479   O O    . GLU A 1 101 ? 5.859   -8.834  -0.011  0.04 13.29 ? 157  GLU A O    1  
ATOM   1480   C CB   . GLU A 1 101 ? 6.605   -8.850  2.899   0.04 12.71 ? 157  GLU A CB   1  
ATOM   1481   C CG   . GLU A 1 101 ? 7.797   -9.641  3.410   0.04 12.76 ? 157  GLU A CG   1  
ATOM   1482   C CD   . GLU A 1 101 ? 7.557   -10.402 4.686   0.04 12.64 ? 157  GLU A CD   1  
ATOM   1483   O OE1  . GLU A 1 101 ? 6.407   -10.418 5.220   0.04 12.59 ? 157  GLU A OE1  1  
ATOM   1484   O OE2  . GLU A 1 101 ? 8.538   -10.991 5.187   0.04 12.62 ? 157  GLU A OE2  1  
ATOM   1485   H H    . GLU A 1 101 ? 5.341   -6.777  1.382   0.04 12.94 ? 157  GLU A H    1  
ATOM   1486   H HA   . GLU A 1 101 ? 7.877   -7.529  1.933   0.04 12.73 ? 157  GLU A HA   1  
ATOM   1487   H HB2  . GLU A 1 101 ? 6.122   -8.461  3.628   0.04 12.55 ? 157  GLU A HB2  1  
ATOM   1488   H HB3  . GLU A 1 101 ? 6.021   -9.503  2.483   0.04 12.81 ? 157  GLU A HB3  1  
ATOM   1489   H HG2  . GLU A 1 101 ? 8.061   -10.277 2.728   0.04 12.95 ? 157  GLU A HG2  1  
ATOM   1490   H HG3  . GLU A 1 101 ? 8.520   -9.018  3.578   0.04 12.73 ? 157  GLU A HG3  1  
ATOM   1491   N N    . ASN A 1 102 ? 8.061   -9.084  0.063   0.04 13.17 ? 158  ASN A N    1  
ATOM   1492   C CA   . ASN A 1 102 ? 8.105   -10.218 -0.877  0.04 13.46 ? 158  ASN A CA   1  
ATOM   1493   C C    . ASN A 1 102 ? 7.492   -9.947  -2.228  0.04 13.73 ? 158  ASN A C    1  
ATOM   1494   O O    . ASN A 1 102 ? 6.766   -10.750 -2.781  0.04 13.98 ? 158  ASN A O    1  
ATOM   1495   C CB   . ASN A 1 102 ? 7.514   -11.460 -0.204  0.04 13.52 ? 158  ASN A CB   1  
ATOM   1496   C CG   . ASN A 1 102 ? 7.882   -12.750 -0.909  0.04 13.81 ? 158  ASN A CG   1  
ATOM   1497   O OD1  . ASN A 1 102 ? 8.974   -12.873 -1.454  0.04 13.88 ? 158  ASN A OD1  1  
ATOM   1498   N ND2  . ASN A 1 102 ? 7.001   -13.745 -0.833  0.04 14.00 ? 158  ASN A ND2  1  
ATOM   1499   H H    . ASN A 1 102 ? 8.833   -8.796  0.294   0.04 13.07 ? 158  ASN A H    1  
ATOM   1500   H HA   . ASN A 1 102 ? 9.036   -10.419 -1.045  0.04 13.48 ? 158  ASN A HA   1  
ATOM   1501   H HB2  . ASN A 1 102 ? 7.873   -11.514 0.688   0.04 13.35 ? 158  ASN A HB2  1  
ATOM   1502   H HB3  . ASN A 1 102 ? 6.546   -11.380 -0.170  0.04 13.56 ? 158  ASN A HB3  1  
ATOM   1503   H HD21 . ASN A 1 102 ? 7.232   -14.536 -1.071  0.04 14.18 ? 158  ASN A HD21 1  
ATOM   1504   H HD22 . ASN A 1 102 ? 6.200   -13.597 -0.558  0.04 13.98 ? 158  ASN A HD22 1  
ATOM   1505   N N    . LEU A 1 103 ? 7.831   -8.786  -2.759  0.04 13.70 ? 159  LEU A N    1  
ATOM   1506   C CA   . LEU A 1 103 ? 7.386   -8.351  -4.077  0.04 13.98 ? 159  LEU A CA   1  
ATOM   1507   C C    . LEU A 1 103 ? 8.544   -7.782  -4.861  0.04 14.07 ? 159  LEU A C    1  
ATOM   1508   O O    . LEU A 1 103 ? 9.484   -7.220  -4.295  0.04 13.86 ? 159  LEU A O    1  
ATOM   1509   C CB   . LEU A 1 103 ? 6.340   -7.242  -3.959  0.04 13.95 ? 159  LEU A CB   1  
ATOM   1510   C CG   . LEU A 1 103 ? 5.049   -7.643  -3.278  0.04 13.96 ? 159  LEU A CG   1  
ATOM   1511   C CD1  . LEU A 1 103 ? 4.417   -6.413  -2.658  0.04 13.87 ? 159  LEU A CD1  1  
ATOM   1512   C CD2  . LEU A 1 103 ? 4.141   -8.301  -4.277  0.04 14.33 ? 159  LEU A CD2  1  
ATOM   1513   H H    . LEU A 1 103 ? 8.330   -8.214  -2.367  0.04 13.55 ? 159  LEU A H    1  
ATOM   1514   H HA   . LEU A 1 103 ? 7.011   -9.092  -4.573  0.04 14.19 ? 159  LEU A HA   1  
ATOM   1515   H HB2  . LEU A 1 103 ? 6.707   -6.503  -3.451  0.04 13.75 ? 159  LEU A HB2  1  
ATOM   1516   H HB3  . LEU A 1 103 ? 6.120   -6.946  -4.858  0.04 14.15 ? 159  LEU A HB3  1  
ATOM   1517   H HG   . LEU A 1 103 ? 5.238   -8.278  -2.572  0.04 13.81 ? 159  LEU A HG   1  
ATOM   1518   H HD11 . LEU A 1 103 ? 3.494   -6.617  -2.431  0.04 13.92 ? 159  LEU A HD11 1  
ATOM   1519   H HD12 . LEU A 1 103 ? 4.913   -6.164  -1.865  0.04 13.64 ? 159  LEU A HD12 1  
ATOM   1520   H HD13 . LEU A 1 103 ? 4.445   -5.693  -3.310  0.04 14.02 ? 159  LEU A HD13 1  
ATOM   1521   H HD21 . LEU A 1 103 ? 3.382   -8.678  -3.806  0.04 14.34 ? 159  LEU A HD21 1  
ATOM   1522   H HD22 . LEU A 1 103 ? 3.842   -7.637  -4.920  0.04 14.49 ? 159  LEU A HD22 1  
ATOM   1523   H HD23 . LEU A 1 103 ? 4.622   -9.003  -4.740  0.04 14.43 ? 159  LEU A HD23 1  
ATOM   1524   N N    . ALA A 1 104 ? 8.430   -7.870  -6.180  0.04 14.41 ? 160  ALA A N    1  
ATOM   1525   C CA   . ALA A 1 104 ? 9.321   -7.117  -7.062  0.04 14.56 ? 160  ALA A CA   1  
ATOM   1526   C C    . ALA A 1 104 ? 8.503   -5.971  -7.665  0.04 14.71 ? 160  ALA A C    1  
ATOM   1527   O O    . ALA A 1 104 ? 7.293   -6.144  -7.979  0.04 14.91 ? 160  ALA A O    1  
ATOM   1528   C CB   . ALA A 1 104 ? 9.877   -7.990  -8.156  0.04 14.90 ? 160  ALA A CB   1  
ATOM   1529   H H    . ALA A 1 104 ? 7.846   -8.345  -6.585  0.04 14.58 ? 160  ALA A H    1  
ATOM   1530   H HA   . ALA A 1 104 ? 10.046  -6.752  -6.548  0.04 14.38 ? 160  ALA A HA   1  
ATOM   1531   H HB1  . ALA A 1 104 ? 10.651  -7.556  -8.541  0.04 15.00 ? 160  ALA A HB1  1  
ATOM   1532   H HB2  . ALA A 1 104 ? 10.124  -8.849  -7.785  0.04 14.84 ? 160  ALA A HB2  1  
ATOM   1533   H HB3  . ALA A 1 104 ? 9.190   -8.122  -8.826  0.04 15.10 ? 160  ALA A HB3  1  
ATOM   1534   N N    . LEU A 1 105 ? 9.120   -4.798  -7.763  0.04 14.64 ? 161  LEU A N    1  
ATOM   1535   C CA   . LEU A 1 105 ? 8.433   -3.604  -8.260  0.04 14.79 ? 161  LEU A CA   1  
ATOM   1536   C C    . LEU A 1 105 ? 9.196   -3.028  -9.450  0.04 15.10 ? 161  LEU A C    1  
ATOM   1537   O O    . LEU A 1 105 ? 10.416  -2.929  -9.431  0.04 15.06 ? 161  LEU A O    1  
ATOM   1538   C CB   . LEU A 1 105 ? 8.374   -2.531  -7.183  0.04 14.49 ? 161  LEU A CB   1  
ATOM   1539   C CG   . LEU A 1 105 ? 7.807   -2.929  -5.820  0.04 14.17 ? 161  LEU A CG   1  
ATOM   1540   C CD1  . LEU A 1 105 ? 7.791   -1.666  -4.961  0.04 13.91 ? 161  LEU A CD1  1  
ATOM   1541   C CD2  . LEU A 1 105 ? 6.414   -3.585  -5.887  0.04 14.34 ? 161  LEU A CD2  1  
ATOM   1542   H H    . LEU A 1 105 ? 9.939   -4.664  -7.549  0.04 14.52 ? 161  LEU A H    1  
ATOM   1543   H HA   . LEU A 1 105 ? 7.534   -3.824  -8.527  0.04 14.92 ? 161  LEU A HA   1  
ATOM   1544   H HB2  . LEU A 1 105 ? 9.280   -2.214  -7.041  0.04 14.39 ? 161  LEU A HB2  1  
ATOM   1545   H HB3  . LEU A 1 105 ? 7.837   -1.795  -7.515  0.04 14.62 ? 161  LEU A HB3  1  
ATOM   1546   H HG   . LEU A 1 105 ? 8.417   -3.555  -5.407  0.04 14.06 ? 161  LEU A HG   1  
ATOM   1547   H HD11 . LEU A 1 105 ? 7.436   -1.864  -4.078  0.04 13.72 ? 161  LEU A HD11 1  
ATOM   1548   H HD12 . LEU A 1 105 ? 8.706   -1.341  -4.892  0.04 13.84 ? 161  LEU A HD12 1  
ATOM   1549   H HD13 . LEU A 1 105 ? 7.241   -0.995  -5.396  0.04 14.03 ? 161  LEU A HD13 1  
ATOM   1550   H HD21 . LEU A 1 105 ? 6.048   -3.651  -4.991  0.04 14.15 ? 161  LEU A HD21 1  
ATOM   1551   H HD22 . LEU A 1 105 ? 5.833   -3.047  -6.446  0.04 14.51 ? 161  LEU A HD22 1  
ATOM   1552   H HD23 . LEU A 1 105 ? 6.507   -4.471  -6.269  0.04 14.48 ? 161  LEU A HD23 1  
ATOM   1553   N N    . ASN A 1 106 ? 8.448   -2.673  -10.482 0.04 15.46 ? 162  ASN A N    1  
ATOM   1554   C CA   . ASN A 1 106 ? 8.954   -1.997  -11.696 0.04 15.84 ? 162  ASN A CA   1  
ATOM   1555   C C    . ASN A 1 106 ? 8.208   -0.660  -11.774 0.04 15.94 ? 162  ASN A C    1  
ATOM   1556   O O    . ASN A 1 106 ? 7.181   -0.549  -12.452 0.04 16.25 ? 162  ASN A O    1  
ATOM   1557   C CB   . ASN A 1 106 ? 8.689   -2.860  -12.930 0.04 16.26 ? 162  ASN A CB   1  
ATOM   1558   C CG   . ASN A 1 106 ? 9.255   -2.257  -14.209 0.04 16.69 ? 162  ASN A CG   1  
ATOM   1559   O OD1  . ASN A 1 106 ? 10.220  -1.495  -14.190 0.04 16.66 ? 162  ASN A OD1  1  
ATOM   1560   N ND2  . ASN A 1 106 ? 8.667   -2.629  -15.334 0.04 17.13 ? 162  ASN A ND2  1  
ATOM   1561   H H    . ASN A 1 106 ? 7.605   -2.824  -10.514 0.04 15.52 ? 162  ASN A H    1  
ATOM   1562   H HA   . ASN A 1 106 ? 9.903   -1.839  -11.626 0.04 15.78 ? 162  ASN A HA   1  
ATOM   1563   H HB2  . ASN A 1 106 ? 9.117   -3.719  -12.806 0.04 16.19 ? 162  ASN A HB2  1  
ATOM   1564   H HB3  . ASN A 1 106 ? 7.738   -2.989  -13.054 0.04 16.36 ? 162  ASN A HB3  1  
ATOM   1565   H HD21 . ASN A 1 106 ? 9.089   -2.564  -16.076 0.04 17.39 ? 162  ASN A HD21 1  
ATOM   1566   H HD22 . ASN A 1 106 ? 7.873   -2.940  -15.322 0.04 17.17 ? 162  ASN A HD22 1  
ATOM   1567   N N    . PRO A 1 107 ? 8.689   0.333   -11.005 0.04 15.69 ? 163  PRO A N    1  
ATOM   1568   C CA   . PRO A 1 107 ? 7.852   1.536   -10.785 0.04 15.74 ? 163  PRO A CA   1  
ATOM   1569   C C    . PRO A 1 107 ? 7.676   2.412   -12.027 0.04 16.24 ? 163  PRO A C    1  
ATOM   1570   O O    . PRO A 1 107 ? 8.611   2.562   -12.835 0.04 16.49 ? 163  PRO A O    1  
ATOM   1571   C CB   . PRO A 1 107 ? 8.558   2.272   -9.636  0.04 15.41 ? 163  PRO A CB   1  
ATOM   1572   C CG   . PRO A 1 107 ? 9.938   1.690   -9.549  0.04 15.37 ? 163  PRO A CG   1  
ATOM   1573   C CD   . PRO A 1 107 ? 9.917   0.332   -10.188 0.04 15.40 ? 163  PRO A CD   1  
ATOM   1574   H HA   . PRO A 1 107 ? 6.976   1.262   -10.474 0.04 15.66 ? 163  PRO A HA   1  
ATOM   1575   H HB2  . PRO A 1 107 ? 8.611   3.219   -9.838  0.04 15.55 ? 163  PRO A HB2  1  
ATOM   1576   H HB3  . PRO A 1 107 ? 8.079   2.134   -8.805  0.04 15.14 ? 163  PRO A HB3  1  
ATOM   1577   H HG2  . PRO A 1 107 ? 10.552  2.273   -10.022 0.04 15.62 ? 163  PRO A HG2  1  
ATOM   1578   H HG3  . PRO A 1 107 ? 10.190  1.612   -8.617  0.04 15.10 ? 163  PRO A HG3  1  
ATOM   1579   H HD2  . PRO A 1 107 ? 10.699  0.201   -10.746 0.04 15.54 ? 163  PRO A HD2  1  
ATOM   1580   H HD3  . PRO A 1 107 ? 9.866   -0.353  -9.500  0.04 15.12 ? 163  PRO A HD3  1  
ATOM   1581   N N    . VAL A 1 108 ? 6.490   2.978   -12.179 0.04 16.41 ? 164  VAL A N    1  
ATOM   1582   C CA   . VAL A 1 108 ? 6.063   3.521   -13.485 0.04 16.95 ? 164  VAL A CA   1  
ATOM   1583   C C    . VAL A 1 108 ? 6.905   4.679   -14.057 0.04 17.18 ? 164  VAL A C    1  
ATOM   1584   O O    . VAL A 1 108 ? 7.028   4.804   -15.297 0.04 17.67 ? 164  VAL A O    1  
ATOM   1585   C CB   . VAL A 1 108 ? 4.544   3.863   -13.553 0.04 17.14 ? 164  VAL A CB   1  
ATOM   1586   C CG1  . VAL A 1 108 ? 3.706   2.593   -13.701 0.04 17.08 ? 164  VAL A CG1  1  
ATOM   1587   C CG2  . VAL A 1 108 ? 4.087   4.770   -12.409 0.04 16.93 ? 164  VAL A CG2  1  
ATOM   1588   H H    . VAL A 1 108 ? 5.908   3.049   -11.554 0.04 16.24 ? 164  VAL A H    1  
ATOM   1589   H HA   . VAL A 1 108 ? 6.186   2.798   -14.118 0.04 17.13 ? 164  VAL A HA   1  
ATOM   1590   H HB   . VAL A 1 108 ? 4.389   4.362   -14.382 0.04 17.53 ? 164  VAL A HB   1  
ATOM   1591   H HG11 . VAL A 1 108 ? 3.098   2.704   -14.448 0.04 17.31 ? 164  VAL A HG11 1  
ATOM   1592   H HG12 . VAL A 1 108 ? 4.298   1.838   -13.859 0.04 17.19 ? 164  VAL A HG12 1  
ATOM   1593   H HG13 . VAL A 1 108 ? 3.204   2.446   -12.887 0.04 16.72 ? 164  VAL A HG13 1  
ATOM   1594   H HG21 . VAL A 1 108 ? 3.145   4.625   -12.237 0.04 16.98 ? 164  VAL A HG21 1  
ATOM   1595   H HG22 . VAL A 1 108 ? 4.606   4.588   -11.610 0.04 16.56 ? 164  VAL A HG22 1  
ATOM   1596   H HG23 . VAL A 1 108 ? 4.220   5.686   -12.692 0.04 17.14 ? 164  VAL A HG23 1  
ATOM   1597   N N    . ASN A 1 109 ? 7.472   5.506   -13.172 0.04 16.88 ? 165  ASN A N    1  
ATOM   1598   C CA   . ASN A 1 109 ? 8.414   6.548   -13.595 0.04 17.11 ? 165  ASN A CA   1  
ATOM   1599   C C    . ASN A 1 109 ? 9.862   6.254   -13.220 0.04 16.91 ? 165  ASN A C    1  
ATOM   1600   O O    . ASN A 1 109 ? 10.717  7.132   -13.309 0.04 17.04 ? 165  ASN A O    1  
ATOM   1601   C CB   . ASN A 1 109 ? 7.979   7.943   -13.050 0.04 17.13 ? 165  ASN A CB   1  
ATOM   1602   C CG   . ASN A 1 109 ? 8.367   8.178   -11.610 0.04 16.61 ? 165  ASN A CG   1  
ATOM   1603   O OD1  . ASN A 1 109 ? 9.109   7.418   -10.979 0.04 16.24 ? 165  ASN A OD1  1  
ATOM   1604   N ND2  . ASN A 1 109 ? 7.869   9.294   -11.072 0.04 16.63 ? 165  ASN A ND2  1  
ATOM   1605   H H    . ASN A 1 109 ? 7.333   5.480   -12.323 0.04 16.57 ? 165  ASN A H    1  
ATOM   1606   H HA   . ASN A 1 109 ? 8.389   6.618   -14.560 0.04 17.49 ? 165  ASN A HA   1  
ATOM   1607   H HB2  . ASN A 1 109 ? 8.395   8.637   -13.583 0.04 17.40 ? 165  ASN A HB2  1  
ATOM   1608   H HB3  . ASN A 1 109 ? 7.013   8.016   -13.106 0.04 17.23 ? 165  ASN A HB3  1  
ATOM   1609   H HD21 . ASN A 1 109 ? 7.750   9.345   -10.220 0.04 16.36 ? 165  ASN A HD21 1  
ATOM   1610   H HD22 . ASN A 1 109 ? 7.664   9.957   -11.578 0.04 16.93 ? 165  ASN A HD22 1  
ATOM   1611   N N    . GLY A 1 110 ? 10.134  5.030   -12.775 0.04 16.63 ? 166  GLY A N    1  
ATOM   1612   C CA   . GLY A 1 110 ? 11.483  4.631   -12.431 0.04 16.44 ? 166  GLY A CA   1  
ATOM   1613   C C    . GLY A 1 110 ? 11.834  4.630   -10.953 0.04 15.92 ? 166  GLY A C    1  
ATOM   1614   O O    . GLY A 1 110 ? 12.901  4.133   -10.582 0.04 15.72 ? 166  GLY A O    1  
ATOM   1615   H H    . GLY A 1 110 ? 9.546   4.417   -12.665 0.04 16.56 ? 166  GLY A H    1  
ATOM   1616   H HA2  . GLY A 1 110 ? 11.640  3.735   -12.768 0.04 16.48 ? 166  GLY A HA2  1  
ATOM   1617   H HA3  . GLY A 1 110 ? 12.117  5.214   -12.878 0.04 16.65 ? 166  GLY A HA3  1  
ATOM   1618   N N    . THR A 1 111 ? 10.931  5.179   -10.127 0.04 15.74 ? 167  THR A N    1  
ATOM   1619   C CA   . THR A 1 111 ? 11.146  5.390   -8.683  0.04 15.30 ? 167  THR A CA   1  
ATOM   1620   C C    . THR A 1 111 ? 9.920   5.049   -7.866  0.04 15.07 ? 167  THR A C    1  
ATOM   1621   O O    . THR A 1 111 ? 8.887   5.678   -8.016  0.04 15.26 ? 167  THR A O    1  
ATOM   1622   C CB   . THR A 1 111 ? 11.473  6.876   -8.409  0.04 15.37 ? 167  THR A CB   1  
ATOM   1623   O OG1  . THR A 1 111 ? 12.771  7.164   -8.941  0.04 15.70 ? 167  THR A OG1  1  
ATOM   1624   C CG2  . THR A 1 111 ? 11.471  7.168   -6.895  0.04 14.96 ? 167  THR A CG2  1  
ATOM   1625   H H    . THR A 1 111 ? 10.157  5.438   -10.385 0.04 15.89 ? 167  THR A H    1  
ATOM   1626   H HA   . THR A 1 111 ? 11.881  4.850   -8.367  0.04 15.14 ? 167  THR A HA   1  
ATOM   1627   H HB   . THR A 1 111 ? 10.802  7.440   -8.826  0.04 15.50 ? 167  THR A HB   1  
ATOM   1628   H HG1  . THR A 1 111 ? 12.764  7.071   -9.775  0.04 15.95 ? 167  THR A HG1  1  
ATOM   1629   H HG21 . THR A 1 111 ? 11.712  8.096   -6.750  0.04 14.94 ? 167  THR A HG21 1  
ATOM   1630   H HG22 . THR A 1 111 ? 10.597  7.010   -6.509  0.04 14.72 ? 167  THR A HG22 1  
ATOM   1631   H HG23 . THR A 1 111 ? 12.125  6.602   -6.458  0.04 14.98 ? 167  THR A HG23 1  
ATOM   1632   N N    . ASN A 1 112 ? 10.048  4.114   -6.932  0.04 14.68 ? 168  ASN A N    1  
ATOM   1633   C CA   . ASN A 1 112 ? 8.944   3.823   -6.029  0.04 14.46 ? 168  ASN A CA   1  
ATOM   1634   C C    . ASN A 1 112 ? 9.023   4.752   -4.825  0.04 14.22 ? 168  ASN A C    1  
ATOM   1635   O O    . ASN A 1 112 ? 10.095  4.868   -4.235  0.04 14.06 ? 168  ASN A O    1  
ATOM   1636   C CB   . ASN A 1 112 ? 9.025   2.366   -5.572  0.04 14.21 ? 168  ASN A CB   1  
ATOM   1637   C CG   . ASN A 1 112 ? 7.764   1.918   -4.925  0.04 14.09 ? 168  ASN A CG   1  
ATOM   1638   O OD1  . ASN A 1 112 ? 6.816   1.550   -5.612  0.04 14.32 ? 168  ASN A OD1  1  
ATOM   1639   N ND2  . ASN A 1 112 ? 7.728   1.971   -3.609  0.04 13.76 ? 168  ASN A ND2  1  
ATOM   1640   H H    . ASN A 1 112 ? 10.755  3.654   -6.782  0.04 14.57 ? 168  ASN A H    1  
ATOM   1641   H HA   . ASN A 1 112 ? 8.098   3.961   -6.476  0.04 14.64 ? 168  ASN A HA   1  
ATOM   1642   H HB2  . ASN A 1 112 ? 9.170   1.795   -6.339  0.04 14.37 ? 168  ASN A HB2  1  
ATOM   1643   H HB3  . ASN A 1 112 ? 9.748   2.257   -4.934  0.04 14.01 ? 168  ASN A HB3  1  
ATOM   1644   H HD21 . ASN A 1 112 ? 7.014   1.757   -3.178  0.04 13.70 ? 168  ASN A HD21 1  
ATOM   1645   H HD22 . ASN A 1 112 ? 8.427   2.228   -3.177  0.04 13.61 ? 168  ASN A HD22 1  
ATOM   1646   N N    . ARG A 1 113 ? 7.892   5.333   -4.417  0.04 14.22 ? 169  ARG A N    1  
ATOM   1647   C CA   . ARG A 1 113 ? 7.855   6.193   -3.213  0.04 14.03 ? 169  ARG A CA   1  
ATOM   1648   C C    . ARG A 1 113 ? 7.281   5.455   -2.019  0.04 13.69 ? 169  ARG A C    1  
ATOM   1649   O O    . ARG A 1 113 ? 6.125   5.003   -2.038  0.04 13.73 ? 169  ARG A O    1  
ATOM   1650   C CB   . ARG A 1 113 ? 7.082   7.509   -3.426  0.04 14.31 ? 169  ARG A CB   1  
ATOM   1651   C CG   . ARG A 1 113 ? 7.231   8.455   -2.219  0.04 14.19 ? 169  ARG A CG   1  
ATOM   1652   C CD   . ARG A 1 113 ? 6.630   9.869   -2.460  0.04 14.55 ? 169  ARG A CD   1  
ATOM   1653   N NE   . ARG A 1 113 ? 7.605   10.827  -3.097  0.04 14.84 ? 169  ARG A NE   1  
ATOM   1654   C CZ   . ARG A 1 113 ? 7.425   11.491  -4.241  0.04 15.27 ? 169  ARG A CZ   1  
ATOM   1655   N NH1  . ARG A 1 113 ? 6.332   11.366  -4.985  0.04 15.49 ? 169  ARG A NH1  1  
ATOM   1656   N NH2  . ARG A 1 113 ? 8.391   12.281  -4.681  0.04 15.50 ? 169  ARG A NH2  1  
ATOM   1657   H H    . ARG A 1 113 ? 7.137   5.262   -4.814  0.04 14.35 ? 169  ARG A H    1  
ATOM   1658   H HA   . ARG A 1 113 ? 8.766   6.425   -2.978  0.04 13.97 ? 169  ARG A HA   1  
ATOM   1659   H HB2  . ARG A 1 113 ? 7.418   7.970   -4.212  0.04 14.56 ? 169  ARG A HB2  1  
ATOM   1660   H HB3  . ARG A 1 113 ? 6.137   7.318   -3.540  0.04 14.38 ? 169  ARG A HB3  1  
ATOM   1661   H HG2  . ARG A 1 113 ? 6.814   8.054   -1.442  0.04 13.97 ? 169  ARG A HG2  1  
ATOM   1662   H HG3  . ARG A 1 113 ? 8.179   8.572   -2.045  0.04 14.13 ? 169  ARG A HG3  1  
ATOM   1663   H HD2  . ARG A 1 113 ? 5.853   9.797   -3.037  0.04 14.71 ? 169  ARG A HD2  1  
ATOM   1664   H HD3  . ARG A 1 113 ? 6.370   10.244  -1.606  0.04 14.45 ? 169  ARG A HD3  1  
ATOM   1665   H HE   . ARG A 1 113 ? 8.268   11.091  -2.617  0.04 14.76 ? 169  ARG A HE   1  
ATOM   1666   H HH11 . ARG A 1 113 ? 5.692   10.854  -4.727  0.04 15.37 ? 169  ARG A HH11 1  
ATOM   1667   H HH12 . ARG A 1 113 ? 6.259   11.811  -5.713  0.04 15.79 ? 169  ARG A HH12 1  
ATOM   1668   H HH21 . ARG A 1 113 ? 9.107   12.374  -4.215  0.04 15.38 ? 169  ARG A HH21 1  
ATOM   1669   H HH22 . ARG A 1 113 ? 8.297   12.721  -5.416  0.04 15.80 ? 169  ARG A HH22 1  
ATOM   1670   N N    . TRP A 1 114 ? 8.081   5.386   -0.958  0.04 13.40 ? 170  TRP A N    1  
ATOM   1671   C CA   . TRP A 1 114 ? 7.707   4.736   0.328   0.04 13.09 ? 170  TRP A CA   1  
ATOM   1672   C C    . TRP A 1 114 ? 7.963   5.770   1.446   0.04 12.97 ? 170  TRP A C    1  
ATOM   1673   O O    . TRP A 1 114 ? 8.961   5.706   2.154   0.04 12.77 ? 170  TRP A O    1  
ATOM   1674   C CB   . TRP A 1 114 ? 8.463   3.402   0.522   0.04 12.90 ? 170  TRP A CB   1  
ATOM   1675   C CG   . TRP A 1 114 ? 8.103   2.490   1.708   0.04 12.64 ? 170  TRP A CG   1  
ATOM   1676   C CD1  . TRP A 1 114 ? 8.846   2.272   2.831   0.04 12.41 ? 170  TRP A CD1  1  
ATOM   1677   C CD2  . TRP A 1 114 ? 6.922   1.676   1.862   0.04 12.64 ? 170  TRP A CD2  1  
ATOM   1678   N NE1  . TRP A 1 114 ? 8.218   1.402   3.663   0.04 12.26 ? 170  TRP A NE1  1  
ATOM   1679   C CE2  . TRP A 1 114 ? 7.035   1.008   3.109   0.04 12.40 ? 170  TRP A CE2  1  
ATOM   1680   C CE3  . TRP A 1 114 ? 5.797   1.430   1.066   0.04 12.86 ? 170  TRP A CE3  1  
ATOM   1681   C CZ2  . TRP A 1 114 ? 6.057   0.126   3.583   0.04 12.36 ? 170  TRP A CZ2  1  
ATOM   1682   C CZ3  . TRP A 1 114 ? 4.823   0.542   1.537   0.04 12.82 ? 170  TRP A CZ3  1  
ATOM   1683   C CH2  . TRP A 1 114 ? 4.961   -0.081  2.793   0.04 12.58 ? 170  TRP A CH2  1  
ATOM   1684   H H    . TRP A 1 114 ? 8.874   5.711   -0.945  0.04 13.40 ? 170  TRP A H    1  
ATOM   1685   H HA   . TRP A 1 114 ? 6.753   4.542   0.312   0.04 13.14 ? 170  TRP A HA   1  
ATOM   1686   H HB2  . TRP A 1 114 ? 8.320   2.875   -0.282  0.04 13.03 ? 170  TRP A HB2  1  
ATOM   1687   H HB3  . TRP A 1 114 ? 9.411   3.605   0.601   0.04 12.86 ? 170  TRP A HB3  1  
ATOM   1688   H HD1  . TRP A 1 114 ? 9.667   2.680   3.003   0.04 12.38 ? 170  TRP A HD1  1  
ATOM   1689   H HE1  . TRP A 1 114 ? 8.515   1.145   4.430   0.04 12.12 ? 170  TRP A HE1  1  
ATOM   1690   H HE3  . TRP A 1 114 ? 5.695   1.851   0.245   0.04 13.04 ? 170  TRP A HE3  1  
ATOM   1691   H HZ2  . TRP A 1 114 ? 6.148   -0.301  4.405   0.04 12.23 ? 170  TRP A HZ2  1  
ATOM   1692   H HZ3  . TRP A 1 114 ? 4.063   0.383   1.028   0.04 12.99 ? 170  TRP A HZ3  1  
ATOM   1693   H HH2  . TRP A 1 114 ? 4.300   -0.665  3.084   0.04 12.58 ? 170  TRP A HH2  1  
ATOM   1694   N N    . ALA A 1 115 ? 7.057   6.742   1.547   0.04 13.12 ? 171  ALA A N    1  
ATOM   1695   C CA   . ALA A 1 115 ? 7.192   7.922   2.431   0.04 13.09 ? 171  ALA A CA   1  
ATOM   1696   C C    . ALA A 1 115 ? 6.741   7.657   3.880   0.04 12.89 ? 171  ALA A C    1  
ATOM   1697   O O    . ALA A 1 115 ? 5.768   8.247   4.358   0.04 13.02 ? 171  ALA A O    1  
ATOM   1698   C CB   . ALA A 1 115 ? 6.361   9.081   1.845   0.04 13.42 ? 171  ALA A CB   1  
ATOM   1699   H H    . ALA A 1 115 ? 6.332   6.752   1.094   0.04 13.27 ? 171  ALA A H    1  
ATOM   1700   H HA   . ALA A 1 115 ? 8.122   8.191   2.456   0.04 13.00 ? 171  ALA A HA   1  
ATOM   1701   H HB1  . ALA A 1 115 ? 6.641   9.916   2.253   0.04 13.41 ? 171  ALA A HB1  1  
ATOM   1702   H HB2  . ALA A 1 115 ? 6.500   9.123   0.887   0.04 13.55 ? 171  ALA A HB2  1  
ATOM   1703   H HB3  . ALA A 1 115 ? 5.423   8.919   2.029   0.04 13.53 ? 171  ALA A HB3  1  
ATOM   1704   N N    . VAL A 1 116 ? 7.428   6.779   4.587   0.04 12.61 ? 172  VAL A N    1  
ATOM   1705   C CA   . VAL A 1 116 ? 6.913   6.262   5.849   0.04 12.43 ? 172  VAL A CA   1  
ATOM   1706   C C    . VAL A 1 116 ? 7.626   6.795   7.045   0.04 12.30 ? 172  VAL A C    1  
ATOM   1707   O O    . VAL A 1 116 ? 8.805   7.144   6.964   0.04 12.32 ? 172  VAL A O    1  
ATOM   1708   C CB   . VAL A 1 116 ? 7.017   4.713   5.865   0.04 12.25 ? 172  VAL A CB   1  
ATOM   1709   C CG1  . VAL A 1 116 ? 6.379   4.141   4.572   0.04 12.42 ? 172  VAL A CG1  1  
ATOM   1710   C CG2  . VAL A 1 116 ? 8.468   4.247   5.955   0.04 12.16 ? 172  VAL A CG2  1  
ATOM   1711   H H    . VAL A 1 116 ? 8.198   6.466   4.366   0.04 12.55 ? 172  VAL A H    1  
ATOM   1712   H HA   . VAL A 1 116 ? 5.978   6.497   5.934   0.04 12.52 ? 172  VAL A HA   1  
ATOM   1713   H HB   . VAL A 1 116 ? 6.536   4.358   6.622   0.04 12.14 ? 172  VAL A HB   1  
ATOM   1714   H HG11 . VAL A 1 116 ? 6.120   3.215   4.708   0.04 12.33 ? 172  VAL A HG11 1  
ATOM   1715   H HG12 . VAL A 1 116 ? 5.599   4.666   4.338   0.04 12.51 ? 172  VAL A HG12 1  
ATOM   1716   H HG13 . VAL A 1 116 ? 7.040   4.201   3.863   0.04 12.54 ? 172  VAL A HG13 1  
ATOM   1717   H HG21 . VAL A 1 116 ? 8.448   3.281   6.048   0.04 12.05 ? 172  VAL A HG21 1  
ATOM   1718   H HG22 . VAL A 1 116 ? 8.945   4.487   5.148   0.04 12.28 ? 172  VAL A HG22 1  
ATOM   1719   H HG23 . VAL A 1 116 ? 8.911   4.629   6.727   0.04 12.10 ? 172  VAL A HG23 1  
ATOM   1720   N N    . SER A 1 117 ? 6.925   6.799   8.174   0.04 12.19 ? 173  SER A N    1  
ATOM   1721   C CA   . SER A 1 117 ? 7.583   6.977   9.466   0.04 12.04 ? 173  SER A CA   1  
ATOM   1722   C C    . SER A 1 117 ? 7.620   5.623   10.161  0.04 11.84 ? 173  SER A C    1  
ATOM   1723   O O    . SER A 1 117 ? 7.902   4.609   9.510   0.04 11.79 ? 173  SER A O    1  
ATOM   1724   C CB   . SER A 1 117 ? 6.972   8.122   10.277  0.04 12.14 ? 173  SER A CB   1  
ATOM   1725   O OG   . SER A 1 117 ? 7.224   9.346   9.590   0.04 12.35 ? 173  SER A OG   1  
ATOM   1726   H H    . SER A 1 117 ? 6.075   6.705   8.224   0.04 12.22 ? 173  SER A H    1  
ATOM   1727   H HA   . SER A 1 117 ? 8.510   7.216   9.312   0.04 12.04 ? 173  SER A HA   1  
ATOM   1728   H HB2  . SER A 1 117 ? 6.012   7.998   10.359  0.04 12.19 ? 173  SER A HB2  1  
ATOM   1729   H HB3  . SER A 1 117 ? 7.388   8.165   11.151  0.04 12.05 ? 173  SER A HB3  1  
ATOM   1730   H HG   . SER A 1 117 ? 7.227   9.212   8.762   0.04 12.43 ? 173  SER A HG   1  
ATOM   1731   N N    . GLN A 1 118 ? 7.461   5.581   11.482  0.04 11.75 ? 174  GLN A N    1  
ATOM   1732   C CA   . GLN A 1 118 ? 7.722   4.352   12.209  0.04 11.60 ? 174  GLN A CA   1  
ATOM   1733   C C    . GLN A 1 118 ? 6.709   3.229   11.998  0.04 11.60 ? 174  GLN A C    1  
ATOM   1734   O O    . GLN A 1 118 ? 5.560   3.457   11.592  0.04 11.72 ? 174  GLN A O    1  
ATOM   1735   C CB   . GLN A 1 118 ? 7.903   4.643   13.710  0.04 11.55 ? 174  GLN A CB   1  
ATOM   1736   C CG   . GLN A 1 118 ? 9.042   5.652   14.027  0.04 11.56 ? 174  GLN A CG   1  
ATOM   1737   C CD   . GLN A 1 118 ? 8.590   7.131   13.999  0.04 11.71 ? 174  GLN A CD   1  
ATOM   1738   O OE1  . GLN A 1 118 ? 7.499   7.471   13.587  0.04 11.82 ? 174  GLN A OE1  1  
ATOM   1739   N NE2  . GLN A 1 118 ? 9.460   7.997   14.464  0.04 11.75 ? 174  GLN A NE2  1  
ATOM   1740   H H    . GLN A 1 118 ? 7.205   6.241   11.967  0.04 11.80 ? 174  GLN A H    1  
ATOM   1741   H HA   . GLN A 1 118 ? 8.580   4.008   11.909  0.04 11.55 ? 174  GLN A HA   1  
ATOM   1742   H HB2  . GLN A 1 118 ? 7.083   5.011   14.067  0.04 11.61 ? 174  GLN A HB2  1  
ATOM   1743   H HB3  . GLN A 1 118 ? 8.092   3.807   14.155  0.04 11.47 ? 174  GLN A HB3  1  
ATOM   1744   H HG2  . GLN A 1 118 ? 9.390   5.462   14.911  0.04 11.51 ? 174  GLN A HG2  1  
ATOM   1745   H HG3  . GLN A 1 118 ? 9.750   5.553   13.374  0.04 11.56 ? 174  GLN A HG3  1  
ATOM   1746   H HE21 . GLN A 1 118 ? 10.135  7.717   14.919  0.04 11.71 ? 174  GLN A HE21 1  
ATOM   1747   H HE22 . GLN A 1 118 ? 9.359   8.839   14.308  0.04 11.83 ? 174  GLN A HE22 1  
ATOM   1748   N N    . ALA A 1 119 ? 7.155   1.990   12.280  0.04 11.50 ? 175  ALA A N    1  
ATOM   1749   C CA   . ALA A 1 119 ? 6.344   0.782   12.161  0.04 11.52 ? 175  ALA A CA   1  
ATOM   1750   C C    . ALA A 1 119 ? 5.831   0.580   10.737  0.04 11.64 ? 175  ALA A C    1  
ATOM   1751   O O    . ALA A 1 119 ? 4.669   0.258   10.531  0.04 11.74 ? 175  ALA A O    1  
ATOM   1752   C CB   . ALA A 1 119 ? 5.173   0.754   13.152  0.04 11.56 ? 175  ALA A CB   1  
ATOM   1753   H H    . ALA A 1 119 ? 7.956   1.831   12.545  0.04 11.44 ? 175  ALA A H    1  
ATOM   1754   H HA   . ALA A 1 119 ? 6.904   0.021   12.364  0.04 11.46 ? 175  ALA A HA   1  
ATOM   1755   H HB1  . ALA A 1 119 ? 4.649   -0.046  13.001  0.04 11.60 ? 175  ALA A HB1  1  
ATOM   1756   H HB2  . ALA A 1 119 ? 5.533   0.726   14.052  0.04 11.50 ? 175  ALA A HB2  1  
ATOM   1757   H HB3  . ALA A 1 119 ? 4.625   1.543   13.032  0.04 11.64 ? 175  ALA A HB3  1  
ATOM   1758   N N    . ALA A 1 120 ? 6.722   0.735   9.765   0.04 11.65 ? 176  ALA A N    1  
ATOM   1759   C CA   . ALA A 1 120 ? 6.339   0.599   8.356   0.04 11.79 ? 176  ALA A CA   1  
ATOM   1760   C C    . ALA A 1 120 ? 7.427   -0.209  7.618   0.04 11.78 ? 176  ALA A C    1  
ATOM   1761   O O    . ALA A 1 120 ? 8.152   0.310   6.729   0.04 11.85 ? 176  ALA A O    1  
ATOM   1762   C CB   . ALA A 1 120 ? 6.160   1.978   7.742   0.04 11.93 ? 176  ALA A CB   1  
ATOM   1763   H H    . ALA A 1 120 ? 7.548   0.916   9.886   0.04 11.60 ? 176  ALA A H    1  
ATOM   1764   H HA   . ALA A 1 120 ? 5.507   0.145   8.288   0.04 11.85 ? 176  ALA A HA   1  
ATOM   1765   H HB1  . ALA A 1 120 ? 5.716   1.881   6.883   0.04 12.05 ? 176  ALA A HB1  1  
ATOM   1766   H HB2  . ALA A 1 120 ? 5.626   2.526   8.340   0.04 11.92 ? 176  ALA A HB2  1  
ATOM   1767   H HB3  . ALA A 1 120 ? 7.035   2.380   7.631   0.04 11.92 ? 176  ALA A HB3  1  
ATOM   1768   N N    . PRO A 1 121 ? 7.587   -1.467  8.007   0.04 11.72 ? 177  PRO A N    1  
ATOM   1769   C CA   . PRO A 1 121 ? 8.685   -2.256  7.410   0.04 11.73 ? 177  PRO A CA   1  
ATOM   1770   C C    . PRO A 1 121 ? 8.540   -2.544  5.908   0.04 11.90 ? 177  PRO A C    1  
ATOM   1771   O O    . PRO A 1 121 ? 7.482   -2.693  5.339   0.04 12.02 ? 177  PRO A O    1  
ATOM   1772   C CB   . PRO A 1 121 ? 8.626   -3.561  8.190   0.04 11.69 ? 177  PRO A CB   1  
ATOM   1773   C CG   . PRO A 1 121 ? 7.180   -3.672  8.644   0.04 11.73 ? 177  PRO A CG   1  
ATOM   1774   C CD   . PRO A 1 121 ? 6.775   -2.258  8.949   0.04 11.69 ? 177  PRO A CD   1  
ATOM   1775   H HA   . PRO A 1 121 ? 9.533   -1.813  7.561   0.04 11.68 ? 177  PRO A HA   1  
ATOM   1776   H HB2  . PRO A 1 121 ? 8.840   -4.298  7.598   0.04 11.76 ? 177  PRO A HB2  1  
ATOM   1777   H HB3  . PRO A 1 121 ? 9.235   -3.526  8.944   0.04 11.60 ? 177  PRO A HB3  1  
ATOM   1778   H HG2  . PRO A 1 121 ? 6.643   -4.023  7.922   0.04 11.84 ? 177  PRO A HG2  1  
ATOM   1779   H HG3  . PRO A 1 121 ? 7.108   -4.230  9.432   0.04 11.69 ? 177  PRO A HG3  1  
ATOM   1780   H HD2  . PRO A 1 121 ? 5.836   -2.133  8.779   0.04 11.77 ? 177  PRO A HD2  1  
ATOM   1781   H HD3  . PRO A 1 121 ? 6.998   -2.031  9.864   0.04 11.61 ? 177  PRO A HD3  1  
ATOM   1782   N N    . PHE A 1 122 ? 9.715   -2.616  5.284   0.04 11.94 ? 178  PHE A N    1  
ATOM   1783   C CA   . PHE A 1 122 ? 9.905   -2.911  3.851   0.04 12.13 ? 178  PHE A CA   1  
ATOM   1784   C C    . PHE A 1 122 ? 10.915  -4.054  3.829   0.04 12.15 ? 178  PHE A C    1  
ATOM   1785   O O    . PHE A 1 122 ? 12.134  -3.853  4.038   0.04 12.11 ? 178  PHE A O    1  
ATOM   1786   C CB   . PHE A 1 122 ? 10.469  -1.634  3.211   0.04 12.20 ? 178  PHE A CB   1  
ATOM   1787   C CG   . PHE A 1 122 ? 10.373  -1.533  1.700   0.04 12.45 ? 178  PHE A CG   1  
ATOM   1788   C CD1  . PHE A 1 122 ? 9.252   -1.031  1.099   0.04 12.59 ? 178  PHE A CD1  1  
ATOM   1789   C CD2  . PHE A 1 122 ? 11.479  -1.832  0.879   0.04 12.57 ? 178  PHE A CD2  1  
ATOM   1790   C CE1  . PHE A 1 122 ? 9.156   -0.884  -0.277  0.04 12.86 ? 178  PHE A CE1  1  
ATOM   1791   C CE2  . PHE A 1 122 ? 11.387  -1.638  -0.496  0.04 12.83 ? 178  PHE A CE2  1  
ATOM   1792   C CZ   . PHE A 1 122 ? 10.229  -1.191  -1.064  0.04 12.97 ? 178  PHE A CZ   1  
ATOM   1793   H H    . PHE A 1 122 ? 10.460  -2.498  5.689   0.04 11.88 ? 178  PHE A H    1  
ATOM   1794   H HA   . PHE A 1 122 ? 9.076   -3.187  3.432   0.04 12.22 ? 178  PHE A HA   1  
ATOM   1795   H HB2  . PHE A 1 122 ? 9.972   -0.882  3.569   0.04 12.17 ? 178  PHE A HB2  1  
ATOM   1796   H HB3  . PHE A 1 122 ? 11.402  -1.545  3.458   0.04 12.16 ? 178  PHE A HB3  1  
ATOM   1797   H HD1  . PHE A 1 122 ? 8.512   -0.822  1.629   0.04 12.54 ? 178  PHE A HD1  1  
ATOM   1798   H HD2  . PHE A 1 122 ? 12.271  -2.135  1.254   0.04 12.51 ? 178  PHE A HD2  1  
ATOM   1799   H HE1  . PHE A 1 122 ? 8.376   -0.565  -0.665  0.04 12.98 ? 178  PHE A HE1  1  
ATOM   1800   H HE2  . PHE A 1 122 ? 12.100  -1.858  -1.042  0.04 12.93 ? 178  PHE A HE2  1  
ATOM   1801   H HZ   . PHE A 1 122 ? 10.173  -1.092  -1.988  0.04 13.17 ? 178  PHE A HZ   1  
ATOM   1802   N N    . ARG A 1 123 ? 10.400  -5.275  3.633   0.04 12.24 ? 179  ARG A N    1  
ATOM   1803   C CA   . ARG A 1 123 ? 11.208  -6.482  3.724   0.04 12.29 ? 179  ARG A CA   1  
ATOM   1804   C C    . ARG A 1 123 ? 11.166  -7.309  2.470   0.04 12.54 ? 179  ARG A C    1  
ATOM   1805   O O    . ARG A 1 123 ? 10.137  -7.508  1.871   0.04 12.65 ? 179  ARG A O    1  
ATOM   1806   C CB   . ARG A 1 123 ? 10.719  -7.393  4.853   0.04 12.21 ? 179  ARG A CB   1  
ATOM   1807   C CG   . ARG A 1 123 ? 10.915  -6.850  6.244   0.04 12.01 ? 179  ARG A CG   1  
ATOM   1808   C CD   . ARG A 1 123 ? 10.335  -7.844  7.268   0.04 12.00 ? 179  ARG A CD   1  
ATOM   1809   N NE   . ARG A 1 123 ? 10.483  -7.370  8.647   0.04 11.85 ? 179  ARG A NE   1  
ATOM   1810   C CZ   . ARG A 1 123 ? 11.510  -7.561  9.454   0.04 11.80 ? 179  ARG A CZ   1  
ATOM   1811   N NH1  . ARG A 1 123 ? 12.585  -8.259  9.065   0.04 11.90 ? 179  ARG A NH1  1  
ATOM   1812   N NH2  . ARG A 1 123 ? 11.470  -7.008  10.666  0.04 11.69 ? 179  ARG A NH2  1  
ATOM   1813   H H    . ARG A 1 123 ? 9.576   -5.419  3.442   0.04 12.30 ? 179  ARG A H    1  
ATOM   1814   H HA   . ARG A 1 123 ? 12.128  -6.249  3.899   0.04 12.26 ? 179  ARG A HA   1  
ATOM   1815   H HB2  . ARG A 1 123 ? 9.770   -7.550  4.735   0.04 12.25 ? 179  ARG A HB2  1  
ATOM   1816   H HB3  . ARG A 1 123 ? 11.200  -8.230  4.788   0.04 12.29 ? 179  ARG A HB3  1  
ATOM   1817   H HG2  . ARG A 1 123 ? 11.861  -6.736  6.406   0.04 11.99 ? 179  ARG A HG2  1  
ATOM   1818   H HG3  . ARG A 1 123 ? 10.451  -6.004  6.343   0.04 11.94 ? 179  ARG A HG3  1  
ATOM   1819   H HD2  . ARG A 1 123 ? 9.390   -7.950  7.101   0.04 12.05 ? 179  ARG A HD2  1  
ATOM   1820   H HD3  . ARG A 1 123 ? 10.787  -8.697  7.188   0.04 12.09 ? 179  ARG A HD3  1  
ATOM   1821   H HE   . ARG A 1 123 ? 9.766   -7.076  9.023   0.04 11.80 ? 179  ARG A HE   1  
ATOM   1822   H HH11 . ARG A 1 123 ? 12.619  -8.609  8.283   0.04 12.00 ? 179  ARG A HH11 1  
ATOM   1823   H HH12 . ARG A 1 123 ? 13.236  -8.368  9.609   0.04 11.90 ? 179  ARG A HH12 1  
ATOM   1824   H HH21 . ARG A 1 123 ? 10.777  -6.562  10.907  0.04 11.64 ? 179  ARG A HH21 1  
ATOM   1825   H HH22 . ARG A 1 123 ? 12.114  -7.120  11.220  0.04 11.68 ? 179  ARG A HH22 1  
ATOM   1826   N N    . ARG A 1 124 ? 12.323  -7.807  2.104   0.04 12.64 ? 180  ARG A N    1  
ATOM   1827   C CA   . ARG A 1 124 ? 12.341  -8.810  1.069   0.04 12.91 ? 180  ARG A CA   1  
ATOM   1828   C C    . ARG A 1 124 ? 11.711  -8.307  -0.210  0.04 13.07 ? 180  ARG A C    1  
ATOM   1829   O O    . ARG A 1 124 ? 10.936  -8.986  -0.856  0.04 13.26 ? 180  ARG A O    1  
ATOM   1830   C CB   . ARG A 1 124 ? 11.590  -10.014 1.580   0.04 12.99 ? 180  ARG A CB   1  
ATOM   1831   C CG   . ARG A 1 124 ? 12.258  -11.193 1.223   0.04 13.29 ? 180  ARG A CG   1  
ATOM   1832   C CD   . ARG A 1 124 ? 11.292  -12.370 1.604   0.04 13.38 ? 180  ARG A CD   1  
ATOM   1833   N NE   . ARG A 1 124 ? 11.764  -13.675 1.247   0.04 13.70 ? 180  ARG A NE   1  
ATOM   1834   C CZ   . ARG A 1 124 ? 12.975  -14.186 1.304   0.04 13.81 ? 180  ARG A CZ   1  
ATOM   1835   N NH1  . ARG A 1 124 ? 13.090  -15.424 0.866   0.04 14.12 ? 180  ARG A NH1  1  
ATOM   1836   N NH2  . ARG A 1 124 ? 14.040  -13.557 1.816   0.04 13.64 ? 180  ARG A NH2  1  
ATOM   1837   H H    . ARG A 1 124 ? 13.086  -7.594  2.428   0.04 12.59 ? 180  ARG A H    1  
ATOM   1838   H HA   . ARG A 1 124 ? 13.246  -9.060  0.871   0.04 12.99 ? 180  ARG A HA   1  
ATOM   1839   H HB2  . ARG A 1 124 ? 11.599  -9.983  2.552   0.04 12.89 ? 180  ARG A HB2  1  
ATOM   1840   H HB3  . ARG A 1 124 ? 10.672  -10.040 1.275   0.04 12.96 ? 180  ARG A HB3  1  
ATOM   1841   H HG2  . ARG A 1 124 ? 12.436  -11.179 0.274   0.04 13.41 ? 180  ARG A HG2  1  
ATOM   1842   H HG3  . ARG A 1 124 ? 13.074  -11.236 1.732   0.04 13.35 ? 180  ARG A HG3  1  
ATOM   1843   H HD2  . ARG A 1 124 ? 11.145  -12.360 2.564   0.04 13.26 ? 180  ARG A HD2  1  
ATOM   1844   H HD3  . ARG A 1 124 ? 10.444  -12.246 1.159   0.04 13.34 ? 180  ARG A HD3  1  
ATOM   1845   H HE   . ARG A 1 124 ? 11.233  -14.120 0.736   0.04 13.85 ? 180  ARG A HE   1  
ATOM   1846   H HH11 . ARG A 1 124 ? 12.406  -15.826 0.550   0.04 14.25 ? 180  ARG A HH11 1  
ATOM   1847   H HH12 . ARG A 1 124 ? 13.850  -15.823 0.895   0.04 14.22 ? 180  ARG A HH12 1  
ATOM   1848   H HH21 . ARG A 1 124 ? 13.980  -12.760 2.112   0.04 13.46 ? 180  ARG A HH21 1  
ATOM   1849   H HH22 . ARG A 1 124 ? 14.793  -13.969 1.840   0.04 13.74 ? 180  ARG A HH22 1  
ATOM   1850   N N    . MET A 1 125 ? 12.111  -7.101  -0.585  0.04 13.03 ? 181  MET A N    1  
ATOM   1851   C CA   . MET A 1 125 ? 11.599  -6.442  -1.761  0.04 13.21 ? 181  MET A CA   1  
ATOM   1852   C C    . MET A 1 125 ? 12.704  -6.378  -2.807  0.04 13.43 ? 181  MET A C    1  
ATOM   1853   O O    . MET A 1 125 ? 13.881  -6.254  -2.507  0.04 13.39 ? 181  MET A O    1  
ATOM   1854   C CB   . MET A 1 125 ? 11.163  -5.019  -1.387  0.04 13.07 ? 181  MET A CB   1  
ATOM   1855   C CG   . MET A 1 125 ? 10.027  -5.023  -0.398  0.04 12.89 ? 181  MET A CG   1  
ATOM   1856   S SD   . MET A 1 125 ? 8.391   -5.582  -0.978  0.04 13.09 ? 181  MET A SD   1  
ATOM   1857   C CE   . MET A 1 125 ? 8.025   -4.241  -2.135  0.04 13.29 ? 181  MET A CE   1  
ATOM   1858   H H    . MET A 1 125 ? 12.694  -6.639  -0.164  0.04 12.92 ? 181  MET A H    1  
ATOM   1859   H HA   . MET A 1 125 ? 10.834  -6.913  -2.110  0.04 13.32 ? 181  MET A HA   1  
ATOM   1860   H HB2  . MET A 1 125 ? 11.904  -4.539  -0.991  0.04 12.97 ? 181  MET A HB2  1  
ATOM   1861   H HB3  . MET A 1 125 ? 10.864  -4.562  -2.188  0.04 13.22 ? 181  MET A HB3  1  
ATOM   1862   H HG2  . MET A 1 125 ? 10.285  -5.590  0.341   0.04 12.78 ? 181  MET A HG2  1  
ATOM   1863   H HG3  . MET A 1 125 ? 9.910   -4.119  -0.068  0.04 12.80 ? 181  MET A HG3  1  
ATOM   1864   H HE1  . MET A 1 125 ? 7.130   -4.349  -2.497  0.04 13.43 ? 181  MET A HE1  1  
ATOM   1865   H HE2  . MET A 1 125 ? 8.089   -3.402  -1.651  0.04 13.16 ? 181  MET A HE2  1  
ATOM   1866   H HE3  . MET A 1 125 ? 8.675   -4.261  -2.853  0.04 13.40 ? 181  MET A HE3  1  
ATOM   1867   N N    . HIS A 1 126 ? 12.294  -6.448  -4.071  0.04 13.71 ? 182  HIS A N    1  
ATOM   1868   C CA   . HIS A 1 126 ? 13.204  -6.160  -5.168  0.04 13.97 ? 182  HIS A CA   1  
ATOM   1869   C C    . HIS A 1 126 ? 12.671  -4.989  -5.960  0.04 14.11 ? 182  HIS A C    1  
ATOM   1870   O O    . HIS A 1 126 ? 11.711  -5.144  -6.717  0.04 14.30 ? 182  HIS A O    1  
ATOM   1871   C CB   . HIS A 1 126 ? 13.352  -7.347  -6.119  0.04 14.29 ? 182  HIS A CB   1  
ATOM   1872   C CG   . HIS A 1 126 ? 14.365  -7.104  -7.195  0.04 14.58 ? 182  HIS A CG   1  
ATOM   1873   N ND1  . HIS A 1 126 ? 14.340  -7.759  -8.412  0.04 14.95 ? 182  HIS A ND1  1  
ATOM   1874   C CD2  . HIS A 1 126 ? 15.388  -6.225  -7.259  0.04 14.60 ? 182  HIS A CD2  1  
ATOM   1875   C CE1  . HIS A 1 126 ? 15.345  -7.316  -9.157  0.04 15.17 ? 182  HIS A CE1  1  
ATOM   1876   N NE2  . HIS A 1 126 ? 16.004  -6.389  -8.474  0.04 14.97 ? 182  HIS A NE2  1  
ATOM   1877   H H    . HIS A 1 126 ? 11.501  -6.662  -4.317  0.04 13.78 ? 182  HIS A H    1  
ATOM   1878   H HA   . HIS A 1 126 ? 14.079  -5.941  -4.827  0.04 13.90 ? 182  HIS A HA   1  
ATOM   1879   H HB2  . HIS A 1 126 ? 13.620  -8.128  -5.620  0.04 14.23 ? 182  HIS A HB2  1  
ATOM   1880   H HB3  . HIS A 1 126 ? 12.500  -7.503  -6.551  0.04 14.39 ? 182  HIS A HB3  1  
ATOM   1881   H HD2  . HIS A 1 126 ? 15.645  -5.643  -6.579  0.04 14.41 ? 182  HIS A HD2  1  
ATOM   1882   H HE1  . HIS A 1 126 ? 15.548  -7.611  -10.012 0.04 15.45 ? 182  HIS A HE1  1  
ATOM   1883   N N    . VAL A 1 127 ? 13.300  -3.817  -5.797  0.04 14.05 ? 183  VAL A N    1  
ATOM   1884   C CA   . VAL A 1 127 ? 12.884  -2.637  -6.549  0.04 14.23 ? 183  VAL A CA   1  
ATOM   1885   C C    . VAL A 1 127 ? 13.772  -2.469  -7.786  0.04 14.58 ? 183  VAL A C    1  
ATOM   1886   O O    . VAL A 1 127 ? 14.985  -2.243  -7.682  0.04 14.59 ? 183  VAL A O    1  
ATOM   1887   C CB   . VAL A 1 127 ? 12.964  -1.349  -5.697  0.04 14.03 ? 183  VAL A CB   1  
ATOM   1888   C CG1  . VAL A 1 127 ? 12.499  -0.148  -6.538  0.04 14.28 ? 183  VAL A CG1  1  
ATOM   1889   C CG2  . VAL A 1 127 ? 12.130  -1.500  -4.427  0.04 13.69 ? 183  VAL A CG2  1  
ATOM   1890   H H    . VAL A 1 127 ? 13.960  -3.688  -5.266  0.04 13.92 ? 183  VAL A H    1  
ATOM   1891   H HA   . VAL A 1 127 ? 11.966  -2.750  -6.836  0.04 14.31 ? 183  VAL A HA   1  
ATOM   1892   H HB   . VAL A 1 127 ? 13.885  -1.204  -5.427  0.04 14.01 ? 183  VAL A HB   1  
ATOM   1893   H HG11 . VAL A 1 127 ? 12.452  0.636   -5.968  0.04 14.24 ? 183  VAL A HG11 1  
ATOM   1894   H HG12 . VAL A 1 127 ? 13.141  0.004   -7.251  0.04 14.54 ? 183  VAL A HG12 1  
ATOM   1895   H HG13 . VAL A 1 127 ? 11.627  -0.338  -6.921  0.04 14.24 ? 183  VAL A HG13 1  
ATOM   1896   H HG21 . VAL A 1 127 ? 12.330  -0.766  -3.822  0.04 13.57 ? 183  VAL A HG21 1  
ATOM   1897   H HG22 . VAL A 1 127 ? 11.191  -1.477  -4.667  0.04 13.73 ? 183  VAL A HG22 1  
ATOM   1898   H HG23 . VAL A 1 127 ? 12.336  -2.345  -4.002  0.04 13.58 ? 183  VAL A HG23 1  
ATOM   1899   N N    . LYS A 1 128 ? 13.155  -2.611  -8.969  0.04 14.91 ? 184  LYS A N    1  
ATOM   1900   C CA   . LYS A 1 128 ? 13.881  -2.531  -10.252 0.04 15.31 ? 184  LYS A CA   1  
ATOM   1901   C C    . LYS A 1 128 ? 13.890  -1.069  -10.735 0.04 15.47 ? 184  LYS A C    1  
ATOM   1902   O O    . LYS A 1 128 ? 13.371  -0.729  -11.801 0.04 15.76 ? 184  LYS A O    1  
ATOM   1903   C CB   . LYS A 1 128 ? 13.264  -3.495  -11.285 0.04 15.62 ? 184  LYS A CB   1  
ATOM   1904   C CG   . LYS A 1 128 ? 13.326  -4.979  -10.839 0.04 15.47 ? 184  LYS A CG   1  
ATOM   1905   C CD   . LYS A 1 128 ? 12.879  -5.982  -11.899 0.04 15.82 ? 184  LYS A CD   1  
ATOM   1906   C CE   . LYS A 1 128 ? 11.394  -6.107  -11.996 0.04 15.98 ? 184  LYS A CE   1  
ATOM   1907   N NZ   . LYS A 1 128 ? 10.975  -7.131  -13.020 0.04 16.32 ? 184  LYS A NZ   1  
ATOM   1908   H H    . LYS A 1 128 ? 12.319  -2.761  -9.054  0.04 14.93 ? 184  LYS A H    1  
ATOM   1909   H HA   . LYS A 1 128 ? 14.801  -2.794  -10.110 0.04 15.29 ? 184  LYS A HA   1  
ATOM   1910   H HB2  . LYS A 1 128 ? 12.335  -3.264  -11.429 0.04 15.69 ? 184  LYS A HB2  1  
ATOM   1911   H HB3  . LYS A 1 128 ? 13.746  -3.418  -12.120 0.04 15.89 ? 184  LYS A HB3  1  
ATOM   1912   H HG2  . LYS A 1 128 ? 14.250  -5.191  -10.625 0.04 15.40 ? 184  LYS A HG2  1  
ATOM   1913   H HG3  . LYS A 1 128 ? 12.779  -5.096  -10.047 0.04 15.23 ? 184  LYS A HG3  1  
ATOM   1914   H HD2  . LYS A 1 128 ? 13.212  -5.708  -12.771 0.04 16.08 ? 184  LYS A HD2  1  
ATOM   1915   H HD3  . LYS A 1 128 ? 13.226  -6.859  -11.671 0.04 15.74 ? 184  LYS A HD3  1  
ATOM   1916   H HE2  . LYS A 1 128 ? 11.042  -6.367  -11.131 0.04 15.74 ? 184  LYS A HE2  1  
ATOM   1917   H HE3  . LYS A 1 128 ? 11.041  -5.245  -12.263 0.04 16.14 ? 184  LYS A HE3  1  
ATOM   1918   H HZ1  . LYS A 1 128 ? 10.935  -6.755  -13.827 0.04 16.58 ? 184  LYS A HZ1  1  
ATOM   1919   H HZ2  . LYS A 1 128 ? 11.562  -7.801  -13.044 0.04 16.40 ? 184  LYS A HZ2  1  
ATOM   1920   H HZ3  . LYS A 1 128 ? 10.172  -7.454  -12.812 0.04 16.21 ? 184  LYS A HZ3  1  
ATOM   1921   N N    . GLY A 1 129 ? 14.495  -0.230  -9.896  0.04 15.29 ? 185  GLY A N    1  
ATOM   1922   C CA   . GLY A 1 129 ? 14.525  1.214   -10.037 0.04 15.40 ? 185  GLY A CA   1  
ATOM   1923   C C    . GLY A 1 129 ? 15.013  1.819   -8.739  0.04 15.06 ? 185  GLY A C    1  
ATOM   1924   O O    . GLY A 1 129 ? 15.618  1.145   -7.896  0.04 14.81 ? 185  GLY A O    1  
ATOM   1925   H H    . GLY A 1 129 ? 14.915  -0.498  -9.196  0.04 15.12 ? 185  GLY A H    1  
ATOM   1926   H HA2  . GLY A 1 129 ? 15.122  1.470   -10.753 0.04 15.67 ? 185  GLY A HA2  1  
ATOM   1927   H HA3  . GLY A 1 129 ? 13.643  1.558   -10.234 0.04 15.44 ? 185  GLY A HA3  1  
ATOM   1928   N N    . GLY A 1 130 ? 14.728  3.100   -8.576  0.04 15.08 ? 186  GLY A N    1  
ATOM   1929   C CA   . GLY A 1 130 ? 15.072  3.796   -7.349  0.04 14.80 ? 186  GLY A CA   1  
ATOM   1930   C C    . GLY A 1 130 ? 13.960  3.700   -6.339  0.04 14.48 ? 186  GLY A C    1  
ATOM   1931   O O    . GLY A 1 130 ? 12.822  3.319   -6.640  0.04 14.49 ? 186  GLY A O    1  
ATOM   1932   H H    . GLY A 1 130 ? 14.336  3.589   -9.160  0.04 15.28 ? 186  GLY A H    1  
ATOM   1933   H HA2  . GLY A 1 130 ? 15.877  3.421   -6.964  0.04 14.69 ? 186  GLY A HA2  1  
ATOM   1934   H HA3  . GLY A 1 130 ? 15.238  4.732   -7.536  0.04 14.95 ? 186  GLY A HA3  1  
ATOM   1935   N N    . LEU A 1 131 ? 14.299  4.071   -5.097  0.04 14.20 ? 187  LEU A N    1  
ATOM   1936   C CA   . LEU A 1 131 ? 13.328  4.087   -4.018  0.04 13.90 ? 187  LEU A CA   1  
ATOM   1937   C C    . LEU A 1 131 ? 13.481  5.420   -3.294  0.04 13.92 ? 187  LEU A C    1  
ATOM   1938   O O    . LEU A 1 131 ? 14.552  5.735   -2.758  0.04 13.95 ? 187  LEU A O    1  
ATOM   1939   C CB   . LEU A 1 131 ? 13.536  2.871   -3.081  0.04 13.57 ? 187  LEU A CB   1  
ATOM   1940   C CG   . LEU A 1 131 ? 12.580  2.684   -1.901  0.04 13.28 ? 187  LEU A CG   1  
ATOM   1941   C CD1  . LEU A 1 131 ? 11.175  2.222   -2.315  0.04 13.36 ? 187  LEU A CD1  1  
ATOM   1942   C CD2  . LEU A 1 131 ? 13.215  1.749   -0.904  0.04 13.04 ? 187  LEU A CD2  1  
ATOM   1943   H H    . LEU A 1 131 ? 15.082  4.326   -4.862  0.04 14.21 ? 187  LEU A H    1  
ATOM   1944   H HA   . LEU A 1 131 ? 12.434  4.046   -4.380  0.04 13.95 ? 187  LEU A HA   1  
ATOM   1945   H HB2  . LEU A 1 131 ? 13.486  2.065   -3.617  0.04 13.62 ? 187  LEU A HB2  1  
ATOM   1946   H HB3  . LEU A 1 131 ? 14.423  2.941   -2.700  0.04 13.53 ? 187  LEU A HB3  1  
ATOM   1947   H HG   . LEU A 1 131 ? 12.482  3.547   -1.468  0.04 13.23 ? 187  LEU A HG   1  
ATOM   1948   H HD11 . LEU A 1 131 ? 10.585  2.260   -1.549  0.04 13.18 ? 187  LEU A HD11 1  
ATOM   1949   H HD12 . LEU A 1 131 ? 10.854  2.821   -3.006  0.04 13.50 ? 187  LEU A HD12 1  
ATOM   1950   H HD13 . LEU A 1 131 ? 11.218  1.317   -2.662  0.04 13.47 ? 187  LEU A HD13 1  
ATOM   1951   H HD21 . LEU A 1 131 ? 12.584  1.570   -0.191  0.04 12.86 ? 187  LEU A HD21 1  
ATOM   1952   H HD22 . LEU A 1 131 ? 13.451  0.920   -1.354  0.04 13.09 ? 187  LEU A HD22 1  
ATOM   1953   H HD23 . LEU A 1 131 ? 14.011  2.164   -0.549  0.04 13.06 ? 187  LEU A HD23 1  
ATOM   1954   N N    . ASN A 1 132 ? 12.405  6.199   -3.310  0.04 13.94 ? 188  ASN A N    1  
ATOM   1955   C CA   . ASN A 1 132 ? 12.339  7.516   -2.672  0.04 13.96 ? 188  ASN A CA   1  
ATOM   1956   C C    . ASN A 1 132 ? 11.600  7.318   -1.358  0.04 13.64 ? 188  ASN A C    1  
ATOM   1957   O O    . ASN A 1 132 ? 10.544  6.705   -1.318  0.04 13.60 ? 188  ASN A O    1  
ATOM   1958   C CB   . ASN A 1 132 ? 11.608  8.512   -3.595  0.04 14.34 ? 188  ASN A CB   1  
ATOM   1959   C CG   . ASN A 1 132 ? 11.650  9.941   -3.080  0.04 14.39 ? 188  ASN A CG   1  
ATOM   1960   O OD1  . ASN A 1 132 ? 11.861  10.168  -1.890  0.04 14.23 ? 188  ASN A OD1  1  
ATOM   1961   N ND2  . ASN A 1 132 ? 11.459  10.899  -3.969  0.04 14.62 ? 188  ASN A ND2  1  
ATOM   1962   H H    . ASN A 1 132 ? 11.670  5.978   -3.694  0.04 13.96 ? 188  ASN A H    1  
ATOM   1963   H HA   . ASN A 1 132 ? 13.230  7.856   -2.494  0.04 13.97 ? 188  ASN A HA   1  
ATOM   1964   H HB2  . ASN A 1 132 ? 12.025  8.498   -4.468  0.04 14.55 ? 188  ASN A HB2  1  
ATOM   1965   H HB3  . ASN A 1 132 ? 10.677  8.254   -3.667  0.04 14.38 ? 188  ASN A HB3  1  
ATOM   1966   H HD21 . ASN A 1 132 ? 12.136  11.313  -4.302  0.04 14.66 ? 188  ASN A HD21 1  
ATOM   1967   H HD22 . ASN A 1 132 ? 10.664  11.108  -4.215  0.04 14.74 ? 188  ASN A HD22 1  
ATOM   1968   N N    . LEU A 1 133 ? 12.181  7.792   -0.264  0.04 13.44 ? 189  LEU A N    1  
ATOM   1969   C CA   . LEU A 1 133 ? 11.584  7.670   1.049   0.04 13.16 ? 189  LEU A CA   1  
ATOM   1970   C C    . LEU A 1 133 ? 10.926  8.956   1.537   0.04 13.24 ? 189  LEU A C    1  
ATOM   1971   O O    . LEU A 1 133 ? 10.419  8.990   2.674   0.04 13.03 ? 189  LEU A O    1  
ATOM   1972   C CB   . LEU A 1 133 ? 12.667  7.209   2.034   0.04 12.93 ? 189  LEU A CB   1  
ATOM   1973   C CG   . LEU A 1 133 ? 13.426  5.938   1.593   0.04 12.89 ? 189  LEU A CG   1  
ATOM   1974   C CD1  . LEU A 1 133 ? 14.557  5.621   2.583   0.04 12.72 ? 189  LEU A CD1  1  
ATOM   1975   C CD2  . LEU A 1 133 ? 12.464  4.783   1.470   0.04 12.78 ? 189  LEU A CD2  1  
ATOM   1976   H H    . LEU A 1 133 ? 12.941  8.188   -0.263  0.04 13.48 ? 189  LEU A H    1  
ATOM   1977   H HA   . LEU A 1 133 ? 10.897  6.987   1.034   0.04 13.07 ? 189  LEU A HA   1  
ATOM   1978   H HB2  . LEU A 1 133 ? 13.328  7.912   2.118   0.04 13.02 ? 189  LEU A HB2  1  
ATOM   1979   H HB3  . LEU A 1 133 ? 12.262  7.024   2.895   0.04 12.76 ? 189  LEU A HB3  1  
ATOM   1980   H HG   . LEU A 1 133 ? 13.825  6.087   0.723   0.04 13.08 ? 189  LEU A HG   1  
ATOM   1981   H HD11 . LEU A 1 133 ? 14.950  4.768   2.340   0.04 12.73 ? 189  LEU A HD11 1  
ATOM   1982   H HD12 . LEU A 1 133 ? 15.221  6.324   2.540   0.04 12.82 ? 189  LEU A HD12 1  
ATOM   1983   H HD13 . LEU A 1 133 ? 14.189  5.572   3.476   0.04 12.55 ? 189  LEU A HD13 1  
ATOM   1984   H HD21 . LEU A 1 133 ? 12.972  3.957   1.422   0.04 12.78 ? 189  LEU A HD21 1  
ATOM   1985   H HD22 . LEU A 1 133 ? 11.879  4.763   2.242   0.04 12.61 ? 189  LEU A HD22 1  
ATOM   1986   H HD23 . LEU A 1 133 ? 11.936  4.902   0.661   0.04 12.91 ? 189  LEU A HD23 1  
ATOM   1987   N N    . ALA A 1 134 ? 10.899  9.985   0.689   0.04 13.56 ? 190  ALA A N    1  
ATOM   1988   C CA   . ALA A 1 134 ? 10.324  11.297  1.066   0.04 13.70 ? 190  ALA A CA   1  
ATOM   1989   C C    . ALA A 1 134 ? 8.960   11.538  0.416   0.04 13.94 ? 190  ALA A C    1  
ATOM   1990   O O    . ALA A 1 134 ? 8.708   11.074  -0.676  0.04 14.12 ? 190  ALA A O    1  
ATOM   1991   C CB   . ALA A 1 134 ? 11.291  12.424  0.663   0.04 13.94 ? 190  ALA A CB   1  
ATOM   1992   H H    . ALA A 1 134 ? 11.208  9.964   -0.111  0.04 13.72 ? 190  ALA A H    1  
ATOM   1993   H HA   . ALA A 1 134 ? 10.225  11.319  2.026   0.04 13.51 ? 190  ALA A HA   1  
ATOM   1994   H HB1  . ALA A 1 134 ? 10.894  13.283  0.874   0.04 14.10 ? 190  ALA A HB1  1  
ATOM   1995   H HB2  . ALA A 1 134 ? 12.123  12.306  1.149   0.04 13.79 ? 190  ALA A HB2  1  
ATOM   1996   H HB3  . ALA A 1 134 ? 11.456  12.368  -0.289  0.04 14.10 ? 190  ALA A HB3  1  
ATOM   1997   N N    . PRO A 1 135 ? 8.072   12.304  1.077   0.04 13.98 ? 191  PRO A N    1  
ATOM   1998   C CA   . PRO A 1 135 ? 6.793   12.614  0.416   0.04 14.25 ? 191  PRO A CA   1  
ATOM   1999   C C    . PRO A 1 135 ? 6.920   13.680  -0.679  0.04 14.69 ? 191  PRO A C    1  
ATOM   2000   O O    . PRO A 1 135 ? 7.944   14.388  -0.672  0.04 14.80 ? 191  PRO A O    1  
ATOM   2001   C CB   . PRO A 1 135 ? 5.911   13.107  1.575   0.04 14.21 ? 191  PRO A CB   1  
ATOM   2002   C CG   . PRO A 1 135 ? 6.893   13.690  2.582   0.04 14.05 ? 191  PRO A CG   1  
ATOM   2003   C CD   . PRO A 1 135 ? 8.180   12.900  2.420   0.04 13.79 ? 191  PRO A CD   1  
ATOM   2004   H HA   . PRO A 1 135 ? 6.403   11.815  0.035   0.04 14.20 ? 191  PRO A HA   1  
ATOM   2005   H HB2  . PRO A 1 135 ? 5.298   13.784  1.251   0.04 14.48 ? 191  PRO A HB2  1  
ATOM   2006   H HB3  . PRO A 1 135 ? 5.424   12.368  1.966   0.04 14.04 ? 191  PRO A HB3  1  
ATOM   2007   H HG2  . PRO A 1 135 ? 7.062   14.620  2.359   0.04 14.28 ? 191  PRO A HG2  1  
ATOM   2008   H HG3  . PRO A 1 135 ? 6.547   13.614  3.483   0.04 13.93 ? 191  PRO A HG3  1  
ATOM   2009   H HD2  . PRO A 1 135 ? 8.946   13.492  2.458   0.04 13.80 ? 191  PRO A HD2  1  
ATOM   2010   H HD3  . PRO A 1 135 ? 8.241   12.201  3.094   0.04 13.55 ? 191  PRO A HD3  1  
ATOM   2011   N N    . ASP A 1 136 ? 5.959   13.742  -1.613  0.04 14.98 ? 192  ASP A N    1  
ATOM   2012   C CA   . ASP A 1 136 ? 5.946   14.768  -2.668  0.04 15.46 ? 192  ASP A CA   1  
ATOM   2013   C C    . ASP A 1 136 ? 6.100   16.091  -1.919  0.04 15.65 ? 192  ASP A C    1  
ATOM   2014   O O    . ASP A 1 136 ? 5.279   16.429  -1.068  0.04 15.63 ? 192  ASP A O    1  
ATOM   2015   C CB   . ASP A 1 136 ? 4.643   14.680  -3.492  0.04 15.75 ? 192  ASP A CB   1  
ATOM   2016   C CG   . ASP A 1 136 ? 4.710   15.419  -4.887  0.04 16.25 ? 192  ASP A CG   1  
ATOM   2017   O OD1  . ASP A 1 136 ? 5.049   14.819  -5.948  0.04 16.39 ? 192  ASP A OD1  1  
ATOM   2018   O OD2  . ASP A 1 136 ? 4.363   16.620  -4.959  0.04 16.54 ? 192  ASP A OD2  1  
ATOM   2019   H H    . ASP A 1 136 ? 5.292   13.201  -1.656  0.04 14.93 ? 192  ASP A H    1  
ATOM   2020   H HA   . ASP A 1 136 ? 6.707   14.650  -3.258  0.04 15.50 ? 192  ASP A HA   1  
ATOM   2021   H HB2  . ASP A 1 136 ? 4.452   13.745  -3.666  0.04 15.59 ? 192  ASP A HB2  1  
ATOM   2022   H HB3  . ASP A 1 136 ? 3.924   15.064  -2.963  0.04 15.82 ? 192  ASP A HB3  1  
ATOM   2023   N N    . GLY A 1 137 ? 7.209   16.775  -2.181  0.04 15.87 ? 193  GLY A N    1  
ATOM   2024   C CA   . GLY A 1 137 ? 7.610   17.916  -1.393  0.04 16.03 ? 193  GLY A CA   1  
ATOM   2025   C C    . GLY A 1 137 ? 8.929   17.481  -0.801  0.04 15.78 ? 193  GLY A C    1  
ATOM   2026   O O    . GLY A 1 137 ? 9.779   17.158  -1.579  0.04 16.02 ? 193  GLY A O    1  
ATOM   2027   H H    . GLY A 1 137 ? 7.755   16.582  -2.813  0.04 15.95 ? 193  GLY A H    1  
ATOM   2028   H HA2  . GLY A 1 137 ? 7.737   18.691  -1.965  0.04 16.40 ? 193  GLY A HA2  1  
ATOM   2029   H HA3  . GLY A 1 137 ? 6.973   18.122  -0.691  0.04 15.93 ? 193  GLY A HA3  1  
ATOM   2030   N N    . TYR A 1 138 ? 9.041   17.406  0.520   0.04 15.32 ? 194  TYR A N    1  
ATOM   2031   C CA   . TYR A 1 138 ? 10.236  17.050  1.305   0.04 15.06 ? 194  TYR A CA   1  
ATOM   2032   C C    . TYR A 1 138 ? 9.841   17.497  2.705   0.04 14.92 ? 194  TYR A C    1  
ATOM   2033   O O    . TYR A 1 138 ? 10.598  18.121  3.458   0.04 14.92 ? 194  TYR A O    1  
ATOM   2034   C CB   . TYR A 1 138 ? 11.582  17.690  0.865   0.04 15.34 ? 194  TYR A CB   1  
ATOM   2035   C CG   . TYR A 1 138 ? 12.073  17.252  -0.471  0.04 15.49 ? 194  TYR A CG   1  
ATOM   2036   C CD1  . TYR A 1 138 ? 12.268  18.188  -1.471  0.04 15.99 ? 194  TYR A CD1  1  
ATOM   2037   C CD2  . TYR A 1 138 ? 12.231  15.888  -0.795  0.04 15.19 ? 194  TYR A CD2  1  
ATOM   2038   C CE1  . TYR A 1 138 ? 12.647  17.807  -2.738  0.04 16.18 ? 194  TYR A CE1  1  
ATOM   2039   C CE2  . TYR A 1 138 ? 12.617  15.494  -2.065  0.04 15.38 ? 194  TYR A CE2  1  
ATOM   2040   C CZ   . TYR A 1 138 ? 12.829  16.459  -3.023  0.04 15.88 ? 194  TYR A CZ   1  
ATOM   2041   O OH   . TYR A 1 138 ? 13.225  16.141  -4.288  0.04 16.14 ? 194  TYR A OH   1  
ATOM   2042   H H    . TYR A 1 138 ? 8.352   17.550  0.990   0.04 15.16 ? 194  TYR A H    1  
ATOM   2043   H HA   . TYR A 1 138 ? 10.338  16.085  1.316   0.04 14.80 ? 194  TYR A HA   1  
ATOM   2044   H HB2  . TYR A 1 138 ? 11.478  18.654  0.838   0.04 15.63 ? 194  TYR A HB2  1  
ATOM   2045   H HB3  . TYR A 1 138 ? 12.266  17.449  1.509   0.04 15.17 ? 194  TYR A HB3  1  
ATOM   2046   H HD1  . TYR A 1 138 ? 12.137  19.088  -1.280  0.04 16.22 ? 194  TYR A HD1  1  
ATOM   2047   H HD2  . TYR A 1 138 ? 12.088  15.239  -0.141  0.04 14.89 ? 194  TYR A HD2  1  
ATOM   2048   H HE1  . TYR A 1 138 ? 12.796  18.447  -3.398  0.04 16.53 ? 194  TYR A HE1  1  
ATOM   2049   H HE2  . TYR A 1 138 ? 12.743  14.595  -2.265  0.04 15.20 ? 194  TYR A HE2  1  
ATOM   2050   H HH   . TYR A 1 138 ? 12.700  16.485  -4.849  0.04 16.45 ? 194  TYR A HH   1  
ATOM   2051   N N    . GLY A 1 139 ? 8.584   17.210  3.003   0.04 14.83 ? 195  GLY A N    1  
ATOM   2052   C CA   . GLY A 1 139 ? 8.004   17.482  4.298   0.04 14.71 ? 195  GLY A CA   1  
ATOM   2053   C C    . GLY A 1 139 ? 8.613   16.547  5.324   0.04 14.26 ? 195  GLY A C    1  
ATOM   2054   O O    . GLY A 1 139 ? 9.408   15.658  4.985   0.04 14.04 ? 195  GLY A O    1  
ATOM   2055   H H    . GLY A 1 139 ? 8.031   16.830  2.468   0.04 14.86 ? 195  GLY A H    1  
ATOM   2056   H HA2  . GLY A 1 139 ? 8.188   18.400  4.558   0.04 14.89 ? 195  GLY A HA2  1  
ATOM   2057   H HA3  . GLY A 1 139 ? 7.045   17.354  4.265   0.04 14.77 ? 195  GLY A HA3  1  
ATOM   2058   N N    . TRP A 1 140 ? 8.283   16.785  6.583   0.04 14.16 ? 196  TRP A N    1  
ATOM   2059   C CA   . TRP A 1 140 ? 8.867   16.038  7.685   0.04 13.79 ? 196  TRP A CA   1  
ATOM   2060   C C    . TRP A 1 140 ? 8.662   14.528  7.514   0.04 13.47 ? 196  TRP A C    1  
ATOM   2061   O O    . TRP A 1 140 ? 7.558   14.067  7.211   0.04 13.50 ? 196  TRP A O    1  
ATOM   2062   C CB   . TRP A 1 140 ? 8.257   16.464  9.032   0.04 13.79 ? 196  TRP A CB   1  
ATOM   2063   C CG   . TRP A 1 140 ? 8.573   17.876  9.508   0.04 14.11 ? 196  TRP A CG   1  
ATOM   2064   C CD1  . TRP A 1 140 ? 9.553   18.706  9.055   0.04 14.44 ? 196  TRP A CD1  1  
ATOM   2065   C CD2  . TRP A 1 140 ? 7.908   18.565  10.553  0.04 14.17 ? 196  TRP A CD2  1  
ATOM   2066   N NE1  . TRP A 1 140 ? 9.505   19.915  9.745   0.04 14.69 ? 196  TRP A NE1  1  
ATOM   2067   C CE2  . TRP A 1 140 ? 8.518   19.830  10.687  0.04 14.53 ? 196  TRP A CE2  1  
ATOM   2068   C CE3  . TRP A 1 140 ? 6.846   18.244  11.384  0.04 13.99 ? 196  TRP A CE3  1  
ATOM   2069   C CZ2  . TRP A 1 140 ? 8.094   20.758  11.626  0.04 14.71 ? 196  TRP A CZ2  1  
ATOM   2070   C CZ3  . TRP A 1 140 ? 6.416   19.181  12.323  0.04 14.16 ? 196  TRP A CZ3  1  
ATOM   2071   C CH2  . TRP A 1 140 ? 7.034   20.416  12.425  0.04 14.52 ? 196  TRP A CH2  1  
ATOM   2072   H H    . TRP A 1 140 ? 7.713   17.382  6.832   0.04 14.32 ? 196  TRP A H    1  
ATOM   2073   H HA   . TRP A 1 140 ? 9.815   16.209  7.717   0.04 13.78 ? 196  TRP A HA   1  
ATOM   2074   H HB2  . TRP A 1 140 ? 7.291   16.378  8.994   0.04 13.83 ? 196  TRP A HB2  1  
ATOM   2075   H HB3  . TRP A 1 140 ? 8.603   15.866  9.712   0.04 13.57 ? 196  TRP A HB3  1  
ATOM   2076   H HD1  . TRP A 1 140 ? 10.143  18.501  8.365   0.04 14.49 ? 196  TRP A HD1  1  
ATOM   2077   H HE1  . TRP A 1 140 ? 10.035  20.579  9.630   0.04 14.93 ? 196  TRP A HE1  1  
ATOM   2078   H HE3  . TRP A 1 140 ? 6.430   17.415  11.317  0.04 13.77 ? 196  TRP A HE3  1  
ATOM   2079   H HZ2  . TRP A 1 140 ? 8.493   21.594  11.692  0.04 14.97 ? 196  TRP A HZ2  1  
ATOM   2080   H HZ3  . TRP A 1 140 ? 5.708   18.972  12.890  0.04 14.06 ? 196  TRP A HZ3  1  
ATOM   2081   H HH2  . TRP A 1 140 ? 6.733   21.024  13.062  0.04 14.64 ? 196  TRP A HH2  1  
ATOM   2082   N N    . ALA A 1 141 ? 9.719   13.773  7.712   0.04 13.21 ? 197  ALA A N    1  
ATOM   2083   C CA   . ALA A 1 141 ? 9.586   12.302  7.733   0.04 12.93 ? 197  ALA A CA   1  
ATOM   2084   C C    . ALA A 1 141 ? 10.500  11.718  8.791   0.04 12.68 ? 197  ALA A C    1  
ATOM   2085   O O    . ALA A 1 141 ? 11.611  12.204  8.990   0.04 12.73 ? 197  ALA A O    1  
ATOM   2086   C CB   . ALA A 1 141 ? 9.869   11.734  6.337   0.04 13.00 ? 197  ALA A CB   1  
ATOM   2087   H H    . ALA A 1 141 ? 10.520  14.062  7.815   0.04 13.21 ? 197  ALA A H    1  
ATOM   2088   H HA   . ALA A 1 141 ? 8.681   12.050  7.967   0.04 12.89 ? 197  ALA A HA   1  
ATOM   2089   H HB1  . ALA A 1 141 ? 9.728   10.775  6.338   0.04 12.84 ? 197  ALA A HB1  1  
ATOM   2090   H HB2  . ALA A 1 141 ? 9.260   12.159  5.711   0.04 13.19 ? 197  ALA A HB2  1  
ATOM   2091   H HB3  . ALA A 1 141 ? 10.789  11.939  6.095   0.04 13.07 ? 197  ALA A HB3  1  
ATOM   2092   N N    . SER A 1 142 ? 10.065  10.618  9.420   0.04 12.44 ? 198  SER A N    1  
ATOM   2093   C CA   . SER A 1 142 ? 10.795  9.993   10.527  0.04 12.23 ? 198  SER A CA   1  
ATOM   2094   C C    . SER A 1 142 ? 10.765  8.458   10.524  0.04 12.01 ? 198  SER A C    1  
ATOM   2095   O O    . SER A 1 142 ? 10.275  7.804   11.462  0.04 11.87 ? 198  SER A O    1  
ATOM   2096   C CB   . SER A 1 142 ? 10.261  10.539  11.836  0.04 12.23 ? 198  SER A CB   1  
ATOM   2097   O OG   . SER A 1 142 ? 10.907  9.998   12.982  0.04 12.08 ? 198  SER A OG   1  
ATOM   2098   H H    . SER A 1 142 ? 9.333   10.213  9.228   0.04 12.41 ? 198  SER A H    1  
ATOM   2099   H HA   . SER A 1 142 ? 11.730  10.253  10.461  0.04 12.27 ? 198  SER A HA   1  
ATOM   2100   H HB2  . SER A 1 142 ? 10.396  11.502  11.825  0.04 12.39 ? 198  SER A HB2  1  
ATOM   2101   H HB3  . SER A 1 142 ? 9.311   10.342  11.890  0.04 12.22 ? 198  SER A HB3  1  
ATOM   2102   H HG   . SER A 1 142 ? 10.832  9.163   12.996  0.04 11.96 ? 198  SER A HG   1  
ATOM   2103   N N    . GLY A 1 143 ? 11.332  7.886   9.463   0.04 12.03 ? 199  GLY A N    1  
ATOM   2104   C CA   . GLY A 1 143 ? 11.412  6.431   9.328   0.04 11.87 ? 199  GLY A CA   1  
ATOM   2105   C C    . GLY A 1 143 ? 12.644  5.897   10.033  0.04 11.78 ? 199  GLY A C    1  
ATOM   2106   O O    . GLY A 1 143 ? 13.223  6.568   10.870  0.04 11.81 ? 199  GLY A O    1  
ATOM   2107   H H    . GLY A 1 143 ? 11.692  8.319   8.816   0.04 12.15 ? 199  GLY A H    1  
ATOM   2108   H HA2  . GLY A 1 143 ? 10.629  6.040   9.743   0.04 11.80 ? 199  GLY A HA2  1  
ATOM   2109   H HA3  . GLY A 1 143 ? 11.432  6.177   8.395   0.04 11.93 ? 199  GLY A HA3  1  
ATOM   2110   N N    . GLY A 1 144 ? 13.057  4.669   9.739   0.04 11.72 ? 200  GLY A N    1  
ATOM   2111   C CA   . GLY A 1 144 ? 12.416  3.753   8.834   0.04 11.71 ? 200  GLY A CA   1  
ATOM   2112   C C    . GLY A 1 144 ? 13.283  2.498   8.789   0.04 11.66 ? 200  GLY A C    1  
ATOM   2113   O O    . GLY A 1 144 ? 14.352  2.421   9.420   0.04 11.64 ? 200  GLY A O    1  
ATOM   2114   H H    . GLY A 1 144 ? 13.768  4.332   10.088  0.04 11.69 ? 200  GLY A H    1  
ATOM   2115   H HA2  . GLY A 1 144 ? 11.534  3.531   9.164   0.04 11.66 ? 200  GLY A HA2  1  
ATOM   2116   H HA3  . GLY A 1 144 ? 12.340  4.134   7.956   0.04 11.82 ? 200  GLY A HA3  1  
ATOM   2117   N N    . TYR A 1 145 ? 12.801  1.477   8.082   0.04 11.67 ? 201  TYR A N    1  
ATOM   2118   C CA   . TYR A 1 145 ? 13.373  0.131   8.168   0.04 11.64 ? 201  TYR A CA   1  
ATOM   2119   C C    . TYR A 1 145 ? 13.275  -0.622  6.851   0.04 11.76 ? 201  TYR A C    1  
ATOM   2120   O O    . TYR A 1 145 ? 12.204  -0.888  6.335   0.04 11.80 ? 201  TYR A O    1  
ATOM   2121   C CB   . TYR A 1 145 ? 12.666  -0.664  9.288   0.04 11.52 ? 201  TYR A CB   1  
ATOM   2122   C CG   . TYR A 1 145 ? 13.175  -2.071  9.492   0.04 11.53 ? 201  TYR A CG   1  
ATOM   2123   C CD1  . TYR A 1 145 ? 14.176  -2.362  10.406  0.04 11.51 ? 201  TYR A CD1  1  
ATOM   2124   C CD2  . TYR A 1 145 ? 12.653  -3.113  8.763   0.04 11.60 ? 201  TYR A CD2  1  
ATOM   2125   C CE1  . TYR A 1 145 ? 14.660  -3.667  10.560  0.04 11.57 ? 201  TYR A CE1  1  
ATOM   2126   C CE2  . TYR A 1 145 ? 13.119  -4.404  8.914   0.04 11.65 ? 201  TYR A CE2  1  
ATOM   2127   C CZ   . TYR A 1 145 ? 14.112  -4.686  9.817   0.04 11.63 ? 201  TYR A CZ   1  
ATOM   2128   O OH   . TYR A 1 145 ? 14.519  -5.992  9.928   0.04 11.73 ? 201  TYR A OH   1  
ATOM   2129   H H    . TYR A 1 145 ? 12.137  1.535   7.547   0.04 11.71 ? 201  TYR A H    1  
ATOM   2130   H HA   . TYR A 1 145 ? 14.314  0.196   8.388   0.04 11.65 ? 201  TYR A HA   1  
ATOM   2131   H HB2  . TYR A 1 145 ? 12.776  -0.182  10.124  0.04 11.47 ? 201  TYR A HB2  1  
ATOM   2132   H HB3  . TYR A 1 145 ? 11.725  -0.719  9.060   0.04 11.53 ? 201  TYR A HB3  1  
ATOM   2133   H HD1  . TYR A 1 145 ? 14.545  -1.672  10.903  0.04 11.49 ? 201  TYR A HD1  1  
ATOM   2134   H HD2  . TYR A 1 145 ? 11.985  -2.939  8.145   0.04 11.63 ? 201  TYR A HD2  1  
ATOM   2135   H HE1  . TYR A 1 145 ? 15.327  -3.851  11.181  0.04 11.58 ? 201  TYR A HE1  1  
ATOM   2136   H HE2  . TYR A 1 145 ? 12.751  -5.089  8.414   0.04 11.71 ? 201  TYR A HE2  1  
ATOM   2137   H HH   . TYR A 1 145 ? 15.315  -6.030  10.193  0.04 11.77 ? 201  TYR A HH   1  
ATOM   2138   N N    . ILE A 1 146 ? 14.441  -0.957  6.299   0.04 11.86 ? 202  ILE A N    1  
ATOM   2139   C CA   . ILE A 1 146 ? 14.508  -1.869  5.158   0.04 12.00 ? 202  ILE A CA   1  
ATOM   2140   C C    . ILE A 1 146 ? 15.374  -3.045  5.537   0.04 12.03 ? 202  ILE A C    1  
ATOM   2141   O O    . ILE A 1 146 ? 16.465  -2.868  6.090   0.04 12.06 ? 202  ILE A O    1  
ATOM   2142   C CB   . ILE A 1 146 ? 15.147  -1.174  3.937   0.04 12.19 ? 202  ILE A CB   1  
ATOM   2143   C CG1  . ILE A 1 146 ? 14.192  -0.139  3.349   0.04 12.24 ? 202  ILE A CG1  1  
ATOM   2144   C CG2  . ILE A 1 146 ? 15.550  -2.219  2.875   0.04 12.38 ? 202  ILE A CG2  1  
ATOM   2145   C CD1  . ILE A 1 146 ? 14.851  0.861   2.413   0.04 12.45 ? 202  ILE A CD1  1  
ATOM   2146   H H    . ILE A 1 146 ? 15.202  -0.680  6.561   0.04 11.86 ? 202  ILE A H    1  
ATOM   2147   H HA   . ILE A 1 146 ? 13.623  -2.179  4.920   0.04 12.00 ? 202  ILE A HA   1  
ATOM   2148   H HB   . ILE A 1 146 ? 15.944  -0.718  4.244   0.04 12.20 ? 202  ILE A HB   1  
ATOM   2149   H HG12 . ILE A 1 146 ? 13.508  -0.609  2.849   0.04 12.27 ? 202  ILE A HG12 1  
ATOM   2150   H HG13 . ILE A 1 146 ? 13.780  0.354   4.076   0.04 12.13 ? 202  ILE A HG13 1  
ATOM   2151   H HG21 . ILE A 1 146 ? 15.690  -1.763  2.034   0.04 12.51 ? 202  ILE A HG21 1  
ATOM   2152   H HG22 . ILE A 1 146 ? 16.369  -2.658  3.147   0.04 12.38 ? 202  ILE A HG22 1  
ATOM   2153   H HG23 . ILE A 1 146 ? 14.837  -2.865  2.786   0.04 12.40 ? 202  ILE A HG23 1  
ATOM   2154   H HD11 . ILE A 1 146 ? 14.170  1.451   2.056   0.04 12.48 ? 202  ILE A HD11 1  
ATOM   2155   H HD12 . ILE A 1 146 ? 15.506  1.375   2.908   0.04 12.45 ? 202  ILE A HD12 1  
ATOM   2156   H HD13 . ILE A 1 146 ? 15.288  0.382   1.691   0.04 12.58 ? 202  ILE A HD13 1  
ATOM   2157   N N    . ALA A 1 147 ? 14.904  -4.250  5.218   0.04 12.07 ? 203  ALA A N    1  
ATOM   2158   C CA   . ALA A 1 147 ? 15.700  -5.458  5.391   0.04 12.16 ? 203  ALA A CA   1  
ATOM   2159   C C    . ALA A 1 147 ? 15.547  -6.417  4.240   0.04 12.35 ? 203  ALA A C    1  
ATOM   2160   O O    . ALA A 1 147 ? 14.501  -6.529  3.640   0.04 12.38 ? 203  ALA A O    1  
ATOM   2161   C CB   . ALA A 1 147 ? 15.328  -6.186  6.705   0.04 12.05 ? 203  ALA A CB   1  
ATOM   2162   H H    . ALA A 1 147 ? 14.129  -4.387  4.884   0.04 12.06 ? 203  ALA A H    1  
ATOM   2163   H HA   . ALA A 1 147 ? 16.631  -5.216  5.450   0.04 12.20 ? 203  ALA A HA   1  
ATOM   2164   H HB1  . ALA A 1 147 ? 14.434  -6.546  6.621   0.04 12.03 ? 203  ALA A HB1  1  
ATOM   2165   H HB2  . ALA A 1 147 ? 15.953  -6.901  6.864   0.04 12.13 ? 203  ALA A HB2  1  
ATOM   2166   H HB3  . ALA A 1 147 ? 15.358  -5.556  7.436   0.04 11.94 ? 203  ALA A HB3  1  
ATOM   2167   N N    . ASP A 1 148 ? 16.630  -7.115  3.955   0.04 12.51 ? 204  ASP A N    1  
ATOM   2168   C CA   . ASP A 1 148 ? 16.608  -8.259  3.032   0.04 12.74 ? 204  ASP A CA   1  
ATOM   2169   C C    . ASP A 1 148 ? 16.095  -7.853  1.669   0.04 12.86 ? 204  ASP A C    1  
ATOM   2170   O O    . ASP A 1 148 ? 15.427  -8.631  1.007   0.04 12.99 ? 204  ASP A O    1  
ATOM   2171   C CB   . ASP A 1 148 ? 15.772  -9.419  3.609   0.04 12.75 ? 204  ASP A CB   1  
ATOM   2172   C CG   . ASP A 1 148 ? 16.209  -10.777 3.093   0.04 13.03 ? 204  ASP A CG   1  
ATOM   2173   O OD1  . ASP A 1 148 ? 17.396  -10.904 2.792   0.04 13.20 ? 204  ASP A OD1  1  
ATOM   2174   O OD2  . ASP A 1 148 ? 15.406  -11.730 3.066   0.04 13.10 ? 204  ASP A OD2  1  
ATOM   2175   H H    . ASP A 1 148 ? 17.404  -6.946  4.280   0.04 12.52 ? 204  ASP A H    1  
ATOM   2176   H HA   . ASP A 1 148 ? 17.498  -8.588  2.914   0.04 12.86 ? 204  ASP A HA   1  
ATOM   2177   H HB2  . ASP A 1 148 ? 15.886  -9.422  4.572   0.04 12.65 ? 204  ASP A HB2  1  
ATOM   2178   H HB3  . ASP A 1 148 ? 14.837  -9.281  3.392   0.04 12.69 ? 204  ASP A HB3  1  
ATOM   2179   N N    . SER A 1 149 ? 16.476  -6.656  1.223   0.04 12.86 ? 205  SER A N    1  
ATOM   2180   C CA   . SER A 1 149 ? 15.952  -6.108  -0.019  0.04 13.00 ? 205  SER A CA   1  
ATOM   2181   C C    . SER A 1 149 ? 17.051  -5.735  -0.991  0.04 13.24 ? 205  SER A C    1  
ATOM   2182   O O    . SER A 1 149 ? 18.194  -5.490  -0.617  0.04 13.26 ? 205  SER A O    1  
ATOM   2183   C CB   . SER A 1 149 ? 15.113  -4.855  0.274   0.04 12.84 ? 205  SER A CB   1  
ATOM   2184   O OG   . SER A 1 149 ? 13.932  -5.191  0.999   0.04 12.67 ? 205  SER A OG   1  
ATOM   2185   H H    . SER A 1 149 ? 17.021  -6.139  1.626   0.04 12.79 ? 205  SER A H    1  
ATOM   2186   H HA   . SER A 1 149 ? 15.387  -6.762  -0.447  0.04 13.09 ? 205  SER A HA   1  
ATOM   2187   H HB2  . SER A 1 149 ? 15.637  -4.228  0.786   0.04 12.76 ? 205  SER A HB2  1  
ATOM   2188   H HB3  . SER A 1 149 ? 14.843  -4.444  -0.562  0.04 12.96 ? 205  SER A HB3  1  
ATOM   2189   H HG   . SER A 1 149 ? 14.137  -5.613  1.692   0.04 12.59 ? 205  SER A HG   1  
ATOM   2190   N N    . LYS A 1 150 ? 16.691  -5.727  -2.275  0.04 13.46 ? 206  LYS A N    1  
ATOM   2191   C CA   . LYS A 1 150 ? 17.617  -5.320  -3.338  0.04 13.73 ? 206  LYS A CA   1  
ATOM   2192   C C    . LYS A 1 150 ? 16.991  -4.136  -4.061  0.04 13.80 ? 206  LYS A C    1  
ATOM   2193   O O    . LYS A 1 150 ? 15.882  -4.274  -4.648  0.04 13.86 ? 206  LYS A O    1  
ATOM   2194   C CB   . LYS A 1 150 ? 17.867  -6.430  -4.371  0.04 14.05 ? 206  LYS A CB   1  
ATOM   2195   C CG   . LYS A 1 150 ? 18.741  -5.951  -5.553  0.04 14.36 ? 206  LYS A CG   1  
ATOM   2196   C CD   . LYS A 1 150 ? 19.220  -7.088  -6.443  0.04 14.69 ? 206  LYS A CD   1  
ATOM   2197   C CE   . LYS A 1 150 ? 20.457  -6.684  -7.292  0.04 15.02 ? 206  LYS A CE   1  
ATOM   2198   N NZ   . LYS A 1 150 ? 20.476  -6.860  -8.776  0.04 15.40 ? 206  LYS A NZ   1  
ATOM   2199   H H    . LYS A 1 150 ? 15.911  -5.933  -2.555  0.04 13.47 ? 206  LYS A H    1  
ATOM   2200   H HA   . LYS A 1 150 ? 18.465  -5.068  -2.960  0.04 13.72 ? 206  LYS A HA   1  
ATOM   2201   H HB2  . LYS A 1 150 ? 18.313  -7.179  -3.948  0.04 14.04 ? 206  LYS A HB2  1  
ATOM   2202   H HB3  . LYS A 1 150 ? 17.015  -6.716  -4.730  0.04 14.09 ? 206  LYS A HB3  1  
ATOM   2203   H HG2  . LYS A 1 150 ? 18.199  -5.365  -6.098  0.04 14.43 ? 206  LYS A HG2  1  
ATOM   2204   H HG3  . LYS A 1 150 ? 19.514  -5.474  -5.216  0.04 14.33 ? 206  LYS A HG3  1  
ATOM   2205   H HD2  . LYS A 1 150 ? 19.486  -7.829  -5.873  0.04 14.63 ? 206  LYS A HD2  1  
ATOM   2206   H HD3  . LYS A 1 150 ? 18.501  -7.367  -7.030  0.04 14.79 ? 206  LYS A HD3  1  
ATOM   2207   H HE2  . LYS A 1 150 ? 20.621  -5.739  -7.152  0.04 15.02 ? 206  LYS A HE2  1  
ATOM   2208   H HE3  . LYS A 1 150 ? 21.219  -7.185  -6.961  0.04 15.01 ? 206  LYS A HE3  1  
ATOM   2209   H HZ1  . LYS A 1 150 ? 20.915  -7.585  -9.011  0.04 15.51 ? 206  LYS A HZ1  1  
ATOM   2210   H HZ2  . LYS A 1 150 ? 19.635  -6.872  -9.077  0.04 15.38 ? 206  LYS A HZ2  1  
ATOM   2211   H HZ3  . LYS A 1 150 ? 20.889  -6.138  -9.101  0.04 15.56 ? 206  LYS A HZ3  1  
ATOM   2212   N N    . ILE A 1 151 ? 17.641  -2.969  -4.004  0.04 13.81 ? 207  ILE A N    1  
ATOM   2213   C CA   . ILE A 1 151 ? 17.181  -1.787  -4.731  0.04 13.96 ? 207  ILE A CA   1  
ATOM   2214   C C    . ILE A 1 151 ? 18.220  -1.587  -5.838  0.04 14.32 ? 207  ILE A C    1  
ATOM   2215   O O    . ILE A 1 151 ? 19.409  -1.345  -5.567  0.04 14.37 ? 207  ILE A O    1  
ATOM   2216   C CB   . ILE A 1 151 ? 17.048  -0.534  -3.799  0.04 13.75 ? 207  ILE A CB   1  
ATOM   2217   C CG1  . ILE A 1 151 ? 16.030  -0.800  -2.686  0.04 13.43 ? 207  ILE A CG1  1  
ATOM   2218   C CG2  . ILE A 1 151 ? 16.702  0.720   -4.612  0.04 13.97 ? 207  ILE A CG2  1  
ATOM   2219   C CD1  . ILE A 1 151 ? 16.667  -1.106  -1.404  0.04 13.22 ? 207  ILE A CD1  1  
ATOM   2220   H H    . ILE A 1 151 ? 18.364  -2.843  -3.559  0.04 13.77 ? 207  ILE A H    1  
ATOM   2221   H HA   . ILE A 1 151 ? 16.321  -1.948  -5.142  0.04 14.00 ? 207  ILE A HA   1  
ATOM   2222   H HB   . ILE A 1 151 ? 17.919  -0.384  -3.401  0.04 13.73 ? 207  ILE A HB   1  
ATOM   2223   H HG12 . ILE A 1 151 ? 15.475  -0.014  -2.560  0.04 13.36 ? 207  ILE A HG12 1  
ATOM   2224   H HG13 . ILE A 1 151 ? 15.477  -1.558  -2.929  0.04 13.47 ? 207  ILE A HG13 1  
ATOM   2225   H HG21 . ILE A 1 151 ? 16.829  1.497   -4.048  0.04 13.88 ? 207  ILE A HG21 1  
ATOM   2226   H HG22 . ILE A 1 151 ? 17.286  0.782   -5.386  0.04 14.21 ? 207  ILE A HG22 1  
ATOM   2227   H HG23 . ILE A 1 151 ? 15.776  0.667   -4.899  0.04 13.99 ? 207  ILE A HG23 1  
ATOM   2228   H HD11 . ILE A 1 151 ? 16.513  -0.365  -0.796  0.04 13.03 ? 207  ILE A HD11 1  
ATOM   2229   H HD12 . ILE A 1 151 ? 16.266  -1.913  -1.042  0.04 13.24 ? 207  ILE A HD12 1  
ATOM   2230   H HD13 . ILE A 1 151 ? 17.616  -1.248  -1.542  0.04 13.27 ? 207  ILE A HD13 1  
ATOM   2231   N N    . ASP A 1 152 ? 17.807  -1.772  -7.095  0.04 14.61 ? 208  ASP A N    1  
ATOM   2232   C CA   . ASP A 1 152 ? 18.770  -1.732  -8.200  0.04 15.01 ? 208  ASP A CA   1  
ATOM   2233   C C    . ASP A 1 152 ? 19.387  -0.347  -8.374  0.04 15.15 ? 208  ASP A C    1  
ATOM   2234   O O    . ASP A 1 152 ? 20.577  -0.223  -8.708  0.04 15.38 ? 208  ASP A O    1  
ATOM   2235   C CB   . ASP A 1 152 ? 18.089  -2.085  -9.520  0.04 15.33 ? 208  ASP A CB   1  
ATOM   2236   C CG   . ASP A 1 152 ? 17.632  -3.532  -9.631  0.04 15.32 ? 208  ASP A CG   1  
ATOM   2237   O OD1  . ASP A 1 152 ? 17.888  -4.386  -8.749  0.04 15.11 ? 208  ASP A OD1  1  
ATOM   2238   O OD2  . ASP A 1 152 ? 17.028  -3.818  -10.689 0.04 15.60 ? 208  ASP A OD2  1  
ATOM   2239   H H    . ASP A 1 152 ? 16.997  -1.917  -7.334  0.04 14.62 ? 208  ASP A H    1  
ATOM   2240   H HA   . ASP A 1 152 ? 19.475  -2.376  -8.036  0.04 15.02 ? 208  ASP A HA   1  
ATOM   2241   H HB2  . ASP A 1 152 ? 17.300  -1.530  -9.601  0.04 15.30 ? 208  ASP A HB2  1  
ATOM   2242   H HB3  . ASP A 1 152 ? 18.702  -1.903  -10.248 0.04 15.60 ? 208  ASP A HB3  1  
ATOM   2243   N N    . GLY A 1 153 ? 18.592  0.696   -8.172  0.04 15.06 ? 209  GLY A N    1  
ATOM   2244   C CA   . GLY A 1 153 ? 19.042  2.072   -8.321  0.04 15.22 ? 209  GLY A CA   1  
ATOM   2245   C C    . GLY A 1 153 ? 19.333  2.698   -6.971  0.04 14.92 ? 209  GLY A C    1  
ATOM   2246   O O    . GLY A 1 153 ? 19.802  2.020   -6.046  0.04 14.68 ? 209  GLY A O    1  
ATOM   2247   H H    . GLY A 1 153 ? 17.768  0.636   -7.929  0.04 14.92 ? 209  GLY A H    1  
ATOM   2248   H HA2  . GLY A 1 153 ? 19.857  2.098   -8.850  0.04 15.47 ? 209  GLY A HA2  1  
ATOM   2249   H HA3  . GLY A 1 153 ? 18.361  2.600   -8.763  0.04 15.32 ? 209  GLY A HA3  1  
ATOM   2250   N N    . GLU A 1 154 ? 19.057  3.999   -6.857  0.04 14.96 ? 210  GLU A N    1  
ATOM   2251   C CA   . GLU A 1 154 ? 19.436  4.747   -5.677  0.04 14.76 ? 210  GLU A CA   1  
ATOM   2252   C C    . GLU A 1 154 ? 18.290  4.805   -4.688  0.04 14.41 ? 210  GLU A C    1  
ATOM   2253   O O    . GLU A 1 154 ? 17.135  5.098   -5.048  0.04 14.47 ? 210  GLU A O    1  
ATOM   2254   C CB   . GLU A 1 154 ? 19.903  6.155   -6.053  0.04 15.08 ? 210  GLU A CB   1  
ATOM   2255   C CG   . GLU A 1 154 ? 20.215  7.009   -4.835  0.04 14.97 ? 210  GLU A CG   1  
ATOM   2256   C CD   . GLU A 1 154 ? 20.605  8.446   -5.209  0.04 15.35 ? 210  GLU A CD   1  
ATOM   2257   O OE1  . GLU A 1 154 ? 21.650  8.609   -5.819  0.04 15.66 ? 210  GLU A OE1  1  
ATOM   2258   O OE2  . GLU A 1 154 ? 19.853  9.414   -4.898  0.04 15.37 ? 210  GLU A OE2  1  
ATOM   2259   H H    . GLU A 1 154 ? 18.644  4.462   -7.447  0.04 15.13 ? 210  GLU A H    1  
ATOM   2260   H HA   . GLU A 1 154 ? 20.178  4.305   -5.242  0.04 14.67 ? 210  GLU A HA   1  
ATOM   2261   H HB2  . GLU A 1 154 ? 20.709  6.086   -6.594  0.04 15.33 ? 210  GLU A HB2  1  
ATOM   2262   H HB3  . GLU A 1 154 ? 19.205  6.601   -6.560  0.04 15.17 ? 210  GLU A HB3  1  
ATOM   2263   H HG2  . GLU A 1 154 ? 19.405  7.076   -4.315  0.04 14.73 ? 210  GLU A HG2  1  
ATOM   2264   H HG3  . GLU A 1 154 ? 20.921  6.601   -4.310  0.04 14.95 ? 210  GLU A HG3  1  
ATOM   2265   N N    . VAL A 1 155 ? 18.630  4.568   -3.426  0.04 14.10 ? 211  VAL A N    1  
ATOM   2266   C CA   . VAL A 1 155 ? 17.754  4.977   -2.320  0.04 13.80 ? 211  VAL A CA   1  
ATOM   2267   C C    . VAL A 1 155 ? 17.990  6.467   -2.061  0.04 13.87 ? 211  VAL A C    1  
ATOM   2268   O O    . VAL A 1 155 ? 19.113  6.964   -2.040  0.04 13.94 ? 211  VAL A O    1  
ATOM   2269   C CB   . VAL A 1 155 ? 17.967  4.140   -1.032  0.04 13.47 ? 211  VAL A CB   1  
ATOM   2270   C CG1  . VAL A 1 155 ? 16.936  4.490   0.033   0.04 13.19 ? 211  VAL A CG1  1  
ATOM   2271   C CG2  . VAL A 1 155 ? 17.871  2.660   -1.374  0.04 13.44 ? 211  VAL A CG2  1  
ATOM   2272   H H    . VAL A 1 155 ? 19.350  4.168   -3.178  0.04 14.08 ? 211  VAL A H    1  
ATOM   2273   H HA   . VAL A 1 155 ? 16.834  4.868   -2.593  0.04 13.78 ? 211  VAL A HA   1  
ATOM   2274   H HB   . VAL A 1 155 ? 18.841  4.325   -0.665  0.04 13.49 ? 211  VAL A HB   1  
ATOM   2275   H HG11 . VAL A 1 155 ? 16.948  3.795   0.714   0.04 13.01 ? 211  VAL A HG11 1  
ATOM   2276   H HG12 . VAL A 1 155 ? 17.160  5.348   0.428   0.04 13.20 ? 211  VAL A HG12 1  
ATOM   2277   H HG13 . VAL A 1 155 ? 16.059  4.531   -0.377  0.04 13.22 ? 211  VAL A HG13 1  
ATOM   2278   H HG21 . VAL A 1 155 ? 17.936  2.125   -0.566  0.04 13.25 ? 211  VAL A HG21 1  
ATOM   2279   H HG22 . VAL A 1 155 ? 17.021  2.499   -1.815  0.04 13.44 ? 211  VAL A HG22 1  
ATOM   2280   H HG23 . VAL A 1 155 ? 18.596  2.432   -1.977  0.04 13.62 ? 211  VAL A HG23 1  
ATOM   2281   N N    . GLY A 1 156 ? 16.887  7.183   -1.883  0.04 13.91 ? 212  GLY A N    1  
ATOM   2282   C CA   . GLY A 1 156 ? 16.907  8.642   -1.810  0.04 14.03 ? 212  GLY A CA   1  
ATOM   2283   C C    . GLY A 1 156 ? 16.097  9.057   -0.615  0.04 13.75 ? 212  GLY A C    1  
ATOM   2284   O O    . GLY A 1 156 ? 14.869  9.094   -0.701  0.04 13.67 ? 212  GLY A O    1  
ATOM   2285   H H    . GLY A 1 156 ? 16.111  6.838   -1.767  0.04 13.89 ? 212  GLY A H    1  
ATOM   2286   H HA2  . GLY A 1 156 ? 17.813  8.984   -1.718  0.04 14.12 ? 212  GLY A HA2  1  
ATOM   2287   H HA3  . GLY A 1 156 ? 16.511  9.029   -2.606  0.04 14.24 ? 212  GLY A HA3  1  
ATOM   2288   N N    . PRO A 1 157 ? 16.751  9.318   0.539   0.04 13.63 ? 213  PRO A N    1  
ATOM   2289   C CA   . PRO A 1 157 ? 15.915  9.641   1.701   0.04 13.42 ? 213  PRO A CA   1  
ATOM   2290   C C    . PRO A 1 157 ? 15.445  11.096  1.755   0.04 13.63 ? 213  PRO A C    1  
ATOM   2291   O O    . PRO A 1 157 ? 14.428  11.379  2.398   0.04 13.53 ? 213  PRO A O    1  
ATOM   2292   C CB   . PRO A 1 157 ? 16.828  9.296   2.895   0.04 13.29 ? 213  PRO A CB   1  
ATOM   2293   C CG   . PRO A 1 157 ? 17.945  8.386   2.298   0.04 13.32 ? 213  PRO A CG   1  
ATOM   2294   C CD   . PRO A 1 157 ? 18.120  8.929   0.923   0.04 13.61 ? 213  PRO A CD   1  
ATOM   2295   H HA   . PRO A 1 157 ? 15.138  9.063   1.740   0.04 13.25 ? 213  PRO A HA   1  
ATOM   2296   H HB2  . PRO A 1 157 ? 17.201  10.106  3.273   0.04 13.44 ? 213  PRO A HB2  1  
ATOM   2297   H HB3  . PRO A 1 157 ? 16.307  8.816   3.557   0.04 13.08 ? 213  PRO A HB3  1  
ATOM   2298   H HG2  . PRO A 1 157 ? 18.762  8.469   2.811   0.04 13.36 ? 213  PRO A HG2  1  
ATOM   2299   H HG3  . PRO A 1 157 ? 17.642  7.466   2.276   0.04 13.14 ? 213  PRO A HG3  1  
ATOM   2300   H HD2  . PRO A 1 157 ? 18.701  9.701   0.937   0.04 13.82 ? 213  PRO A HD2  1  
ATOM   2301   H HD3  . PRO A 1 157 ? 18.463  8.238   0.335   0.04 13.60 ? 213  PRO A HD3  1  
ATOM   2302   N N    . TYR A 1 158 ? 16.154  11.988  1.075   0.04 13.96 ? 214  TYR A N    1  
ATOM   2303   C CA   . TYR A 1 158 ? 15.906  13.418  1.140   0.04 14.24 ? 214  TYR A CA   1  
ATOM   2304   C C    . TYR A 1 158 ? 15.733  13.873  2.559   0.04 14.09 ? 214  TYR A C    1  
ATOM   2305   O O    . TYR A 1 158 ? 16.660  13.813  3.331   0.04 14.07 ? 214  TYR A O    1  
ATOM   2306   C CB   . TYR A 1 158 ? 14.745  13.813  0.225   0.04 14.46 ? 214  TYR A CB   1  
ATOM   2307   C CG   . TYR A 1 158 ? 14.983  13.360  -1.213  0.04 14.67 ? 214  TYR A CG   1  
ATOM   2308   C CD1  . TYR A 1 158 ? 15.812  14.083  -2.070  0.04 15.06 ? 214  TYR A CD1  1  
ATOM   2309   C CD2  . TYR A 1 158 ? 14.413  12.198  -1.688  0.04 14.52 ? 214  TYR A CD2  1  
ATOM   2310   C CE1  . TYR A 1 158 ? 16.048  13.647  -3.390  0.04 15.29 ? 214  TYR A CE1  1  
ATOM   2311   C CE2  . TYR A 1 158 ? 14.645  11.755  -2.985  0.04 14.74 ? 214  TYR A CE2  1  
ATOM   2312   C CZ   . TYR A 1 158 ? 15.453  12.483  -3.841  0.04 15.13 ? 214  TYR A CZ   1  
ATOM   2313   O OH   . TYR A 1 158 ? 15.636  12.001  -5.133  0.04 15.37 ? 214  TYR A OH   1  
ATOM   2314   H H    . TYR A 1 158 ? 16.807  11.781  0.554   0.04 14.06 ? 214  TYR A H    1  
ATOM   2315   H HA   . TYR A 1 158 ? 16.690  13.877  0.792   0.04 14.44 ? 214  TYR A HA   1  
ATOM   2316   H HB2  . TYR A 1 158 ? 13.925  13.409  0.546   0.04 14.28 ? 214  TYR A HB2  1  
ATOM   2317   H HB3  . TYR A 1 158 ? 14.658  14.779  0.220   0.04 14.67 ? 214  TYR A HB3  1  
ATOM   2318   H HD1  . TYR A 1 158 ? 16.213  14.867  -1.770  0.04 15.20 ? 214  TYR A HD1  1  
ATOM   2319   H HD2  . TYR A 1 158 ? 13.867  11.697  -1.125  0.04 14.28 ? 214  TYR A HD2  1  
ATOM   2320   H HE1  . TYR A 1 158 ? 16.595  14.142  -3.955  0.04 15.58 ? 214  TYR A HE1  1  
ATOM   2321   H HE2  . TYR A 1 158 ? 14.241  10.974  -3.285  0.04 14.65 ? 214  TYR A HE2  1  
ATOM   2322   H HH   . TYR A 1 158 ? 16.230  12.445  -5.527  0.04 15.64 ? 214  TYR A HH   1  
ATOM   2323   N N    . SER A 1 159 ? 14.518  14.249  2.923   0.04 14.03 ? 215  SER A N    1  
ATOM   2324   C CA   . SER A 1 159 ? 14.263  14.856  4.224   0.04 13.93 ? 215  SER A CA   1  
ATOM   2325   C C    . SER A 1 159 ? 14.090  13.878  5.406   0.04 13.53 ? 215  SER A C    1  
ATOM   2326   O O    . SER A 1 159 ? 14.015  14.301  6.566   0.04 13.46 ? 215  SER A O    1  
ATOM   2327   C CB   . SER A 1 159 ? 13.000  15.714  4.079   0.04 14.08 ? 215  SER A CB   1  
ATOM   2328   O OG   . SER A 1 159 ? 11.906  14.900  3.723   0.04 14.03 ? 215  SER A OG   1  
ATOM   2329   H H    . SER A 1 159 ? 13.814  14.168  2.444   0.04 14.06 ? 215  SER A H    1  
ATOM   2330   H HA   . SER A 1 159 ? 15.008  15.436  4.443   0.04 14.07 ? 215  SER A HA   1  
ATOM   2331   H HB2  . SER A 1 159 ? 12.773  16.134  4.910   0.04 13.96 ? 215  SER A HB2  1  
ATOM   2332   H HB3  . SER A 1 159 ? 13.138  16.396  3.402   0.04 14.36 ? 215  SER A HB3  1  
ATOM   2333   H HG   . SER A 1 159 ? 11.189  15.307  3.890   0.04 14.15 ? 215  SER A HG   1  
ATOM   2334   N N    . GLN A 1 160 ? 14.041  12.577  5.139   0.04 13.31 ? 216  GLN A N    1  
ATOM   2335   C CA   . GLN A 1 160 ? 14.024  11.583  6.209   0.04 12.98 ? 216  GLN A CA   1  
ATOM   2336   C C    . GLN A 1 160 ? 15.096  11.856  7.237   0.04 12.94 ? 216  GLN A C    1  
ATOM   2337   O O    . GLN A 1 160 ? 16.265  11.984  6.890   0.04 13.07 ? 216  GLN A O    1  
ATOM   2338   C CB   . GLN A 1 160 ? 14.248  10.176  5.643   0.04 12.82 ? 216  GLN A CB   1  
ATOM   2339   C CG   . GLN A 1 160 ? 13.024  9.519   4.983   0.04 12.78 ? 216  GLN A CG   1  
ATOM   2340   C CD   . GLN A 1 160 ? 11.993  9.075   5.991   0.04 12.57 ? 216  GLN A CD   1  
ATOM   2341   O OE1  . GLN A 1 160 ? 12.221  9.139   7.197   0.04 12.44 ? 216  GLN A OE1  1  
ATOM   2342   N NE2  . GLN A 1 160 ? 10.880  8.621   5.504   0.04 12.58 ? 216  GLN A NE2  1  
ATOM   2343   H H    . GLN A 1 160 ? 14.035  12.243  4.348   0.04 13.36 ? 216  GLN A H    1  
ATOM   2344   H HA   . GLN A 1 160 ? 13.164  11.600  6.658   0.04 12.90 ? 216  GLN A HA   1  
ATOM   2345   H HB2  . GLN A 1 160 ? 14.957  10.227  4.984   0.04 12.95 ? 216  GLN A HB2  1  
ATOM   2346   H HB3  . GLN A 1 160 ? 14.527  9.605   6.377   0.04 12.65 ? 216  GLN A HB3  1  
ATOM   2347   H HG2  . GLN A 1 160 ? 12.610  10.155  4.380   0.04 12.97 ? 216  GLN A HG2  1  
ATOM   2348   H HG3  . GLN A 1 160 ? 13.300  8.735   4.490   0.04 12.75 ? 216  GLN A HG3  1  
ATOM   2349   H HE21 . GLN A 1 160 ? 10.757  8.599   4.654   0.04 12.73 ? 216  GLN A HE21 1  
ATOM   2350   H HE22 . GLN A 1 160 ? 10.254  8.358   6.030   0.04 12.45 ? 216  GLN A HE22 1  
ATOM   2351   N N    . GLN A 1 161 ? 14.717  11.898  8.508   0.04 12.80 ? 217  GLN A N    1  
ATOM   2352   C CA   . GLN A 1 161 ? 15.664  12.235  9.567   0.04 12.80 ? 217  GLN A CA   1  
ATOM   2353   C C    . GLN A 1 161 ? 16.732  11.173  9.775   0.04 12.66 ? 217  GLN A C    1  
ATOM   2354   O O    . GLN A 1 161 ? 17.913  11.476  10.015  0.04 12.80 ? 217  GLN A O    1  
ATOM   2355   C CB   . GLN A 1 161 ? 14.937  12.359  10.902  0.04 12.66 ? 217  GLN A CB   1  
ATOM   2356   C CG   . GLN A 1 161 ? 13.963  13.526  11.031  0.04 12.85 ? 217  GLN A CG   1  
ATOM   2357   C CD   . GLN A 1 161 ? 13.001  13.367  12.185  0.04 12.71 ? 217  GLN A CD   1  
ATOM   2358   O OE1  . GLN A 1 161 ? 13.166  12.505  13.079  0.04 12.50 ? 217  GLN A OE1  1  
ATOM   2359   N NE2  . GLN A 1 161 ? 11.968  14.187  12.168  0.04 12.86 ? 217  GLN A NE2  1  
ATOM   2360   H H    . GLN A 1 161 ? 13.913  11.754  8.781   0.04 12.72 ? 217  GLN A H    1  
ATOM   2361   H HA   . GLN A 1 161 ? 16.095  13.077  9.363   0.04 13.00 ? 217  GLN A HA   1  
ATOM   2362   H HB2  . GLN A 1 161 ? 14.437  11.548  11.064  0.04 12.50 ? 217  GLN A HB2  1  
ATOM   2363   H HB3  . GLN A 1 161 ? 15.611  12.459  11.590  0.04 12.65 ? 217  GLN A HB3  1  
ATOM   2364   H HG2  . GLN A 1 161 ? 14.462  14.343  11.164  0.04 13.01 ? 217  GLN A HG2  1  
ATOM   2365   H HG3  . GLN A 1 161 ? 13.432  13.598  10.222  0.04 12.93 ? 217  GLN A HG3  1  
ATOM   2366   H HE21 . GLN A 1 161 ? 12.021  14.937  11.758  0.04 13.05 ? 217  GLN A HE21 1  
ATOM   2367   H HE22 . GLN A 1 161 ? 11.238  13.971  12.571  0.04 12.79 ? 217  GLN A HE22 1  
ATOM   2368   N N    . GLN A 1 162 ? 16.306  9.919   9.697   0.04 12.44 ? 218  GLN A N    1  
ATOM   2369   C CA   . GLN A 1 162 ? 17.142  8.814   10.085  0.04 12.31 ? 218  GLN A CA   1  
ATOM   2370   C C    . GLN A 1 162 ? 16.648  7.564   9.365   0.04 12.18 ? 218  GLN A C    1  
ATOM   2371   O O    . GLN A 1 162 ? 15.539  7.561   8.842   0.04 12.18 ? 218  GLN A O    1  
ATOM   2372   C CB   . GLN A 1 162 ? 17.170  8.639   11.611  0.04 12.19 ? 218  GLN A CB   1  
ATOM   2373   C CG   . GLN A 1 162 ? 15.894  8.098   12.251  0.04 12.00 ? 218  GLN A CG   1  
ATOM   2374   C CD   . GLN A 1 162 ? 14.857  9.139   12.622  0.04 12.06 ? 218  GLN A CD   1  
ATOM   2375   O OE1  . GLN A 1 162 ? 15.162  10.217  13.164  0.04 12.19 ? 218  GLN A OE1  1  
ATOM   2376   N NE2  . GLN A 1 162 ? 13.610  8.805   12.367  0.04 12.01 ? 218  GLN A NE2  1  
ATOM   2377   H H    . GLN A 1 162 ? 15.529  9.695   9.411   0.04 12.38 ? 218  GLN A H    1  
ATOM   2378   H HA   . GLN A 1 162 ? 18.047  9.005   9.784   0.04 12.44 ? 218  GLN A HA   1  
ATOM   2379   H HB2  . GLN A 1 162 ? 17.871  8.019   11.850  0.04 12.15 ? 218  GLN A HB2  1  
ATOM   2380   H HB3  . GLN A 1 162 ? 17.356  9.502   12.006  0.04 12.29 ? 218  GLN A HB3  1  
ATOM   2381   H HG2  . GLN A 1 162 ? 15.473  7.487   11.630  0.04 11.94 ? 218  GLN A HG2  1  
ATOM   2382   H HG3  . GLN A 1 162 ? 16.130  7.616   13.056  0.04 11.92 ? 218  GLN A HG3  1  
ATOM   2383   H HE21 . GLN A 1 162 ? 13.398  7.974   12.310  0.04 11.96 ? 218  GLN A HE21 1  
ATOM   2384   H HE22 . GLN A 1 162 ? 13.005  9.415   12.274  0.04 12.05 ? 218  GLN A HE22 1  
ATOM   2385   N N    . TRP A 1 163 ? 17.491  6.539   9.287   0.04 12.12 ? 219  TRP A N    1  
ATOM   2386   C CA   . TRP A 1 163 ? 17.071  5.275   8.665   0.04 12.04 ? 219  TRP A CA   1  
ATOM   2387   C C    . TRP A 1 163 ? 17.945  4.119   9.073   0.04 12.00 ? 219  TRP A C    1  
ATOM   2388   O O    . TRP A 1 163 ? 19.132  4.311   9.281   0.04 12.12 ? 219  TRP A O    1  
ATOM   2389   C CB   . TRP A 1 163 ? 17.081  5.374   7.125   0.04 12.21 ? 219  TRP A CB   1  
ATOM   2390   C CG   . TRP A 1 163 ? 16.183  4.350   6.483   0.04 12.16 ? 219  TRP A CG   1  
ATOM   2391   C CD1  . TRP A 1 163 ? 16.482  3.023   6.193   0.04 12.14 ? 219  TRP A CD1  1  
ATOM   2392   C CD2  . TRP A 1 163 ? 14.792  4.516   6.162   0.04 12.14 ? 219  TRP A CD2  1  
ATOM   2393   N NE1  . TRP A 1 163 ? 15.374  2.387   5.695   0.04 12.12 ? 219  TRP A NE1  1  
ATOM   2394   C CE2  . TRP A 1 163 ? 14.326  3.274   5.659   0.04 12.11 ? 219  TRP A CE2  1  
ATOM   2395   C CE3  . TRP A 1 163 ? 13.912  5.603   6.215   0.04 12.17 ? 219  TRP A CE3  1  
ATOM   2396   C CZ2  . TRP A 1 163 ? 13.011  3.097   5.209   0.04 12.14 ? 219  TRP A CZ2  1  
ATOM   2397   C CZ3  . TRP A 1 163 ? 12.604  5.435   5.770   0.04 12.20 ? 219  TRP A CZ3  1  
ATOM   2398   C CH2  . TRP A 1 163 ? 12.167  4.183   5.268   0.04 12.17 ? 219  TRP A CH2  1  
ATOM   2399   H H    . TRP A 1 163 ? 18.305  6.558   9.565   0.04 12.15 ? 219  TRP A H    1  
ATOM   2400   H HA   . TRP A 1 163 ? 16.165  5.078   8.947   0.04 11.93 ? 219  TRP A HA   1  
ATOM   2401   H HB2  . TRP A 1 163 ? 16.779  6.259   6.860   0.04 12.30 ? 219  TRP A HB2  1  
ATOM   2402   H HB3  . TRP A 1 163 ? 17.987  5.220   6.805   0.04 12.31 ? 219  TRP A HB3  1  
ATOM   2403   H HD1  . TRP A 1 163 ? 17.302  2.611   6.340   0.04 12.17 ? 219  TRP A HD1  1  
ATOM   2404   H HE1  . TRP A 1 163 ? 15.346  1.565   5.445   0.04 12.12 ? 219  TRP A HE1  1  
ATOM   2405   H HE3  . TRP A 1 163 ? 14.199  6.424   6.544   0.04 12.21 ? 219  TRP A HE3  1  
ATOM   2406   H HZ2  . TRP A 1 163 ? 12.721  2.278   4.873   0.04 12.14 ? 219  TRP A HZ2  1  
ATOM   2407   H HZ3  . TRP A 1 163 ? 12.010  6.149   5.808   0.04 12.25 ? 219  TRP A HZ3  1  
ATOM   2408   H HH2  . TRP A 1 163 ? 11.290  4.090   4.980   0.04 12.22 ? 219  TRP A HH2  1  
ATOM   2409   N N    . TYR A 1 164 ? 17.363  2.910   9.119   0.04 11.88 ? 220  TYR A N    1  
ATOM   2410   C CA   . TYR A 1 164 ? 18.099  1.651   9.268   0.04 11.89 ? 220  TYR A CA   1  
ATOM   2411   C C    . TYR A 1 164 ? 17.849  0.712   8.094   0.04 11.93 ? 220  TYR A C    1  
ATOM   2412   O O    . TYR A 1 164 ? 16.706  0.404   7.754   0.04 11.86 ? 220  TYR A O    1  
ATOM   2413   C CB   . TYR A 1 164 ? 17.699  0.929   10.550  0.04 11.74 ? 220  TYR A CB   1  
ATOM   2414   C CG   . TYR A 1 164 ? 18.489  -0.351  10.781  0.04 11.80 ? 220  TYR A CG   1  
ATOM   2415   C CD1  . TYR A 1 164 ? 19.879  -0.376  10.694  0.04 11.96 ? 220  TYR A CD1  1  
ATOM   2416   C CD2  . TYR A 1 164 ? 17.850  -1.545  11.036  0.04 11.73 ? 220  TYR A CD2  1  
ATOM   2417   C CE1  . TYR A 1 164 ? 20.590  -1.539  10.910  0.04 12.06 ? 220  TYR A CE1  1  
ATOM   2418   C CE2  . TYR A 1 164 ? 18.553  -2.715  11.264  0.04 11.82 ? 220  TYR A CE2  1  
ATOM   2419   C CZ   . TYR A 1 164 ? 19.925  -2.712  11.202  0.04 11.98 ? 220  TYR A CZ   1  
ATOM   2420   O OH   . TYR A 1 164 ? 20.576  -3.898  11.425  0.04 12.11 ? 220  TYR A OH   1  
ATOM   2421   H H    . TYR A 1 164 ? 16.513  2.788   9.063   0.04 11.81 ? 220  TYR A H    1  
ATOM   2422   H HA   . TYR A 1 164 ? 19.050  1.829   9.306   0.04 11.99 ? 220  TYR A HA   1  
ATOM   2423   H HB2  . TYR A 1 164 ? 17.839  1.520   11.300  0.04 11.73 ? 220  TYR A HB2  1  
ATOM   2424   H HB3  . TYR A 1 164 ? 16.758  0.702   10.485  0.04 11.66 ? 220  TYR A HB3  1  
ATOM   2425   H HD1  . TYR A 1 164 ? 20.331  0.414   10.516  0.04 12.04 ? 220  TYR A HD1  1  
ATOM   2426   H HD2  . TYR A 1 164 ? 16.918  -1.549  11.100  0.04 11.64 ? 220  TYR A HD2  1  
ATOM   2427   H HE1  . TYR A 1 164 ? 21.524  -1.529  10.860  0.04 12.19 ? 220  TYR A HE1  1  
ATOM   2428   H HE2  . TYR A 1 164 ? 18.105  -3.504  11.451  0.04 11.79 ? 220  TYR A HE2  1  
ATOM   2429   H HH   . TYR A 1 164 ? 21.405  -3.797  11.364  0.04 12.24 ? 220  TYR A HH   1  
ATOM   2430   N N    . THR A 1 165 ? 18.938  0.264   7.480   0.04 12.09 ? 221  THR A N    1  
ATOM   2431   C CA   . THR A 1 165 ? 18.892  -0.762  6.440   0.04 12.19 ? 221  THR A CA   1  
ATOM   2432   C C    . THR A 1 165 ? 19.806  -1.887  6.891   0.04 12.26 ? 221  THR A C    1  
ATOM   2433   O O    . THR A 1 165 ? 20.962  -1.644  7.274   0.04 12.37 ? 221  THR A O    1  
ATOM   2434   C CB   . THR A 1 165 ? 19.419  -0.172  5.108   0.04 12.40 ? 221  THR A CB   1  
ATOM   2435   O OG1  . THR A 1 165 ? 18.617  0.934   4.675   0.04 12.39 ? 221  THR A OG1  1  
ATOM   2436   C CG2  . THR A 1 165 ? 19.432  -1.210  3.974   0.04 12.53 ? 221  THR A CG2  1  
ATOM   2437   H H    . THR A 1 165 ? 19.730  0.534   7.651   0.04 12.17 ? 221  THR A H    1  
ATOM   2438   H HA   . THR A 1 165 ? 17.992  -1.085  6.318   0.04 12.11 ? 221  THR A HA   1  
ATOM   2439   H HB   . THR A 1 165 ? 20.332  0.130   5.243   0.04 12.51 ? 221  THR A HB   1  
ATOM   2440   H HG1  . THR A 1 165 ? 18.501  0.896   3.846   0.04 12.43 ? 221  THR A HG1  1  
ATOM   2441   H HG21 . THR A 1 165 ? 20.105  -0.966  3.327   0.04 12.70 ? 221  THR A HG21 1  
ATOM   2442   H HG22 . THR A 1 165 ? 19.642  -2.084  4.330   0.04 12.52 ? 221  THR A HG22 1  
ATOM   2443   H HG23 . THR A 1 165 ? 18.569  -1.242  3.543   0.04 12.47 ? 221  THR A HG23 1  
ATOM   2444   N N    . ARG A 1 166 ? 19.325  -3.130  6.808   0.04 12.24 ? 222  ARG A N    1  
ATOM   2445   C CA   . ARG A 1 166 ? 20.226  -4.279  6.987   0.04 12.35 ? 222  ARG A CA   1  
ATOM   2446   C C    . ARG A 1 166 ? 20.094  -5.310  5.908   0.04 12.51 ? 222  ARG A C    1  
ATOM   2447   O O    . ARG A 1 166 ? 19.036  -5.518  5.343   0.04 12.47 ? 222  ARG A O    1  
ATOM   2448   C CB   . ARG A 1 166 ? 20.113  -5.001  8.341   0.04 12.19 ? 222  ARG A CB   1  
ATOM   2449   C CG   . ARG A 1 166 ? 18.731  -5.582  8.652   0.04 12.26 ? 222  ARG A CG   1  
ATOM   2450   C CD   . ARG A 1 166 ? 18.884  -6.697  9.730   0.04 12.17 ? 222  ARG A CD   1  
ATOM   2451   N NE   . ARG A 1 166 ? 17.684  -7.493  9.826   0.04 12.10 ? 222  ARG A NE   1  
ATOM   2452   C CZ   . ARG A 1 166 ? 17.372  -8.483  8.989   0.04 12.22 ? 222  ARG A CZ   1  
ATOM   2453   N NH1  . ARG A 1 166 ? 18.214  -8.899  8.068   0.04 12.41 ? 222  ARG A NH1  1  
ATOM   2454   N NH2  . ARG A 1 166 ? 16.200  -9.087  9.103   0.04 12.17 ? 222  ARG A NH2  1  
ATOM   2455   H H    . ARG A 1 166 ? 18.506  -3.327  6.646   0.04 12.19 ? 222  ARG A H    1  
ATOM   2456   H HA   . ARG A 1 166 ? 21.131  -3.950  6.930   0.04 12.45 ? 222  ARG A HA   1  
ATOM   2457   H HB2  . ARG A 1 166 ? 20.728  -5.745  8.345   0.04 12.21 ? 222  ARG A HB2  1  
ATOM   2458   H HB3  . ARG A 1 166 ? 20.358  -4.389  9.052   0.04 12.06 ? 222  ARG A HB3  1  
ATOM   2459   H HG2  . ARG A 1 166 ? 18.150  -4.895  9.010   0.04 12.24 ? 222  ARG A HG2  1  
ATOM   2460   H HG3  . ARG A 1 166 ? 18.344  -5.954  7.848   0.04 12.42 ? 222  ARG A HG3  1  
ATOM   2461   H HD2  . ARG A 1 166 ? 19.619  -7.281  9.494   0.04 12.30 ? 222  ARG A HD2  1  
ATOM   2462   H HD3  . ARG A 1 166 ? 19.049  -6.278  10.590  0.04 12.07 ? 222  ARG A HD3  1  
ATOM   2463   H HE   . ARG A 1 166 ? 17.319  -7.530  10.602  0.04 12.01 ? 222  ARG A HE   1  
ATOM   2464   H HH11 . ARG A 1 166 ? 18.972  -8.508  7.972   0.04 12.47 ? 222  ARG A HH11 1  
ATOM   2465   H HH12 . ARG A 1 166 ? 18.000  -9.555  7.558   0.04 12.50 ? 222  ARG A HH12 1  
ATOM   2466   H HH21 . ARG A 1 166 ? 15.645  -8.854  9.710   0.04 12.06 ? 222  ARG A HH21 1  
ATOM   2467   H HH22 . ARG A 1 166 ? 16.026  -9.756  8.593   0.04 12.26 ? 222  ARG A HH22 1  
ATOM   2468   N N    . ASP A 1 167 ? 21.199  -6.003  5.696   0.04 12.73 ? 223  ASP A N    1  
ATOM   2469   C CA   . ASP A 1 167 ? 21.239  -7.245  4.927   0.04 12.93 ? 223  ASP A CA   1  
ATOM   2470   C C    . ASP A 1 167 ? 20.466  -7.067  3.630   0.04 12.99 ? 223  ASP A C    1  
ATOM   2471   O O    . ASP A 1 167 ? 19.364  -7.551  3.463   0.04 13.00 ? 223  ASP A O    1  
ATOM   2472   C CB   . ASP A 1 167 ? 20.765  -8.416  5.799   0.04 12.88 ? 223  ASP A CB   1  
ATOM   2473   C CG   . ASP A 1 167 ? 21.541  -8.511  7.099   0.04 12.88 ? 223  ASP A CG   1  
ATOM   2474   O OD1  . ASP A 1 167 ? 22.689  -8.025  7.136   0.04 13.01 ? 223  ASP A OD1  1  
ATOM   2475   O OD2  . ASP A 1 167 ? 21.003  -9.088  8.083   0.04 12.79 ? 223  ASP A OD2  1  
ATOM   2476   H H    . ASP A 1 167 ? 21.957  -5.779  6.021   0.04 12.79 ? 223  ASP A H    1  
ATOM   2477   H HA   . ASP A 1 167 ? 22.158  -7.420  4.678   0.04 13.10 ? 223  ASP A HA   1  
ATOM   2478   H HB2  . ASP A 1 167 ? 19.827  -8.290  6.013   0.04 12.72 ? 223  ASP A HB2  1  
ATOM   2479   H HB3  . ASP A 1 167 ? 20.885  -9.247  5.315   0.04 13.04 ? 223  ASP A HB3  1  
ATOM   2480   N N    . SER A 1 168 ? 21.060  -6.235  2.784   0.04 13.08 ? 224  SER A N    1  
ATOM   2481   C CA   . SER A 1 168 ? 20.408  -5.723  1.579   0.04 13.15 ? 224  SER A CA   1  
ATOM   2482   C C    . SER A 1 168 ? 21.459  -5.333  0.557   0.04 13.44 ? 224  SER A C    1  
ATOM   2483   O O    . SER A 1 168 ? 22.666  -5.441  0.800   0.04 13.59 ? 224  SER A O    1  
ATOM   2484   C CB   . SER A 1 168 ? 19.573  -4.479  1.932   0.04 12.93 ? 224  SER A CB   1  
ATOM   2485   O OG   . SER A 1 168 ? 18.407  -4.802  2.712   0.04 12.70 ? 224  SER A OG   1  
ATOM   2486   H H    . SER A 1 168 ? 21.863  -5.956  2.889   0.04 13.13 ? 224  SER A H    1  
ATOM   2487   H HA   . SER A 1 168 ? 19.833  -6.403  1.198   0.04 13.18 ? 224  SER A HA   1  
ATOM   2488   H HB2  . SER A 1 168 ? 20.123  -3.880  2.456   0.04 12.89 ? 224  SER A HB2  1  
ATOM   2489   H HB3  . SER A 1 168 ? 19.300  -4.036  1.114   0.04 13.01 ? 224  SER A HB3  1  
ATOM   2490   H HG   . SER A 1 168 ? 18.624  -4.881  3.516   0.04 12.61 ? 224  SER A HG   1  
ATOM   2491   N N    . SER A 1 169 ? 20.998  -4.906  -0.608  0.04 13.56 ? 225  SER A N    1  
ATOM   2492   C CA   . SER A 1 169 ? 21.855  -4.310  -1.625  0.04 13.88 ? 225  SER A CA   1  
ATOM   2493   C C    . SER A 1 169 ? 21.162  -3.103  -2.228  0.04 13.86 ? 225  SER A C    1  
ATOM   2494   O O    . SER A 1 169 ? 20.012  -3.204  -2.655  0.04 13.75 ? 225  SER A O    1  
ATOM   2495   C CB   . SER A 1 169 ? 22.161  -5.272  -2.778  0.04 14.16 ? 225  SER A CB   1  
ATOM   2496   O OG   . SER A 1 169 ? 22.680  -4.510  -3.872  0.04 14.49 ? 225  SER A OG   1  
ATOM   2497   H H    . SER A 1 169 ? 20.172  -4.945  -0.838  0.04 13.49 ? 225  SER A H    1  
ATOM   2498   H HA   . SER A 1 169 ? 22.688  -4.033  -1.222  0.04 13.95 ? 225  SER A HA   1  
ATOM   2499   H HB2  . SER A 1 169 ? 22.821  -5.922  -2.492  0.04 14.21 ? 225  SER A HB2  1  
ATOM   2500   H HB3  . SER A 1 169 ? 21.348  -5.711  -3.070  0.04 14.11 ? 225  SER A HB3  1  
ATOM   2501   H HG   . SER A 1 169 ? 22.802  -5.000  -4.546  0.04 14.66 ? 225  SER A HG   1  
ATOM   2502   N N    . VAL A 1 170 ? 21.875  -1.972  -2.294  0.04 14.01 ? 226  VAL A N    1  
ATOM   2503   C CA   . VAL A 1 170 ? 21.369  -0.759  -2.956  0.04 14.06 ? 226  VAL A CA   1  
ATOM   2504   C C    . VAL A 1 170 ? 22.382  -0.388  -4.027  0.04 14.46 ? 226  VAL A C    1  
ATOM   2505   O O    . VAL A 1 170 ? 23.568  -0.578  -3.826  0.04 14.64 ? 226  VAL A O    1  
ATOM   2506   C CB   . VAL A 1 170 ? 21.198  0.447   -1.980  0.04 13.84 ? 226  VAL A CB   1  
ATOM   2507   C CG1  . VAL A 1 170 ? 20.285  0.069   -0.878  0.04 13.49 ? 226  VAL A CG1  1  
ATOM   2508   C CG2  . VAL A 1 170 ? 22.550  0.959   -1.464  0.04 13.90 ? 226  VAL A CG2  1  
ATOM   2509   H H    . VAL A 1 170 ? 22.653  -1.883  -1.956  0.04 14.10 ? 226  VAL A H    1  
ATOM   2510   H HA   . VAL A 1 170 ? 20.522  -0.928  -3.388  0.04 14.03 ? 226  VAL A HA   1  
ATOM   2511   H HB   . VAL A 1 170 ? 20.774  1.174   -2.463  0.04 13.91 ? 226  VAL A HB   1  
ATOM   2512   H HG11 . VAL A 1 170 ? 20.275  0.773   -0.208  0.04 13.38 ? 226  VAL A HG11 1  
ATOM   2513   H HG12 . VAL A 1 170 ? 19.394  -0.045  -1.237  0.04 13.49 ? 226  VAL A HG12 1  
ATOM   2514   H HG13 . VAL A 1 170 ? 20.593  -0.762  -0.482  0.04 13.42 ? 226  VAL A HG13 1  
ATOM   2515   H HG21 . VAL A 1 170 ? 22.383  1.624   -0.778  0.04 13.80 ? 226  VAL A HG21 1  
ATOM   2516   H HG22 . VAL A 1 170 ? 23.049  0.221   -1.085  0.04 13.80 ? 226  VAL A HG22 1  
ATOM   2517   H HG23 . VAL A 1 170 ? 23.046  1.361   -2.195  0.04 14.15 ? 226  VAL A HG23 1  
ATOM   2518   N N    . GLY A 1 171 ? 21.928  0.142   -5.161  0.04 14.64 ? 227  GLY A N    1  
ATOM   2519   C CA   . GLY A 1 171 ? 22.867  0.688   -6.129  0.04 15.05 ? 227  GLY A CA   1  
ATOM   2520   C C    . GLY A 1 171 ? 23.594  1.905   -5.592  0.04 15.14 ? 227  GLY A C    1  
ATOM   2521   O O    . GLY A 1 171 ? 24.769  2.147   -5.881  0.04 15.51 ? 227  GLY A O    1  
ATOM   2522   H H    . GLY A 1 171 ? 21.101  0.198   -5.387  0.04 14.55 ? 227  GLY A H    1  
ATOM   2523   H HA2  . GLY A 1 171 ? 23.531  0.022   -6.359  0.04 15.19 ? 227  GLY A HA2  1  
ATOM   2524   H HA3  . GLY A 1 171 ? 22.402  0.944   -6.939  0.04 15.19 ? 227  GLY A HA3  1  
ATOM   2525   N N    . GLY A 1 172 ? 22.879  2.709   -4.838  0.04 14.83 ? 228  GLY A N    1  
ATOM   2526   C CA   . GLY A 1 172 ? 23.504  3.796   -4.144  0.04 14.91 ? 228  GLY A CA   1  
ATOM   2527   C C    . GLY A 1 172 ? 22.541  4.367   -3.156  0.04 14.52 ? 228  GLY A C    1  
ATOM   2528   O O    . GLY A 1 172 ? 21.425  3.846   -2.940  0.04 14.25 ? 228  GLY A O    1  
ATOM   2529   H H    . GLY A 1 172 ? 22.030  2.651   -4.719  0.04 14.59 ? 228  GLY A H    1  
ATOM   2530   H HA2  . GLY A 1 172 ? 24.281  3.481   -3.660  0.04 15.03 ? 228  GLY A HA2  1  
ATOM   2531   H HA3  . GLY A 1 172 ? 23.775  4.492   -4.769  0.04 15.10 ? 228  GLY A HA3  1  
ATOM   2532   N N    . TRP A 1 173 ? 22.977  5.465   -2.564  0.04 14.54 ? 229  TRP A N    1  
ATOM   2533   C CA   . TRP A 1 173 ? 22.369  5.980   -1.374  0.04 14.26 ? 229  TRP A CA   1  
ATOM   2534   C C    . TRP A 1 173 ? 22.617  7.478   -1.332  0.04 14.49 ? 229  TRP A C    1  
ATOM   2535   O O    . TRP A 1 173 ? 23.738  7.927   -1.122  0.04 14.78 ? 229  TRP A O    1  
ATOM   2536   C CB   . TRP A 1 173 ? 22.951  5.304   -0.132  0.04 14.04 ? 229  TRP A CB   1  
ATOM   2537   C CG   . TRP A 1 173 ? 22.180  5.689   1.042   0.04 13.73 ? 229  TRP A CG   1  
ATOM   2538   C CD1  . TRP A 1 173 ? 22.299  6.844   1.740   0.04 13.74 ? 229  TRP A CD1  1  
ATOM   2539   C CD2  . TRP A 1 173 ? 21.074  4.970   1.626   0.04 13.40 ? 229  TRP A CD2  1  
ATOM   2540   N NE1  . TRP A 1 173 ? 21.336  6.910   2.713   0.04 13.44 ? 229  TRP A NE1  1  
ATOM   2541   C CE2  . TRP A 1 173 ? 20.583  5.761   2.678   0.04 13.23 ? 229  TRP A CE2  1  
ATOM   2542   C CE3  . TRP A 1 173 ? 20.476  3.728   1.375   0.04 13.28 ? 229  TRP A CE3  1  
ATOM   2543   C CZ2  . TRP A 1 173 ? 19.516  5.345   3.482   0.04 12.94 ? 229  TRP A CZ2  1  
ATOM   2544   C CZ3  . TRP A 1 173 ? 19.431  3.319   2.176   0.04 12.99 ? 229  TRP A CZ3  1  
ATOM   2545   C CH2  . TRP A 1 173 ? 18.955  4.119   3.204   0.04 12.82 ? 229  TRP A CH2  1  
ATOM   2546   H H    . TRP A 1 173 ? 23.626  5.945   -2.862  0.04 14.74 ? 229  TRP A H    1  
ATOM   2547   H HA   . TRP A 1 173 ? 21.414  5.823   -1.400  0.04 14.10 ? 229  TRP A HA   1  
ATOM   2548   H HB2  . TRP A 1 173 ? 22.903  4.341   -0.227  0.04 13.97 ? 229  TRP A HB2  1  
ATOM   2549   H HB3  . TRP A 1 173 ? 23.870  5.591   -0.010  0.04 14.21 ? 229  TRP A HB3  1  
ATOM   2550   H HD1  . TRP A 1 173 ? 22.900  7.525   1.545   0.04 13.94 ? 229  TRP A HD1  1  
ATOM   2551   H HE1  . TRP A 1 173 ? 21.243  7.556   3.273   0.04 13.41 ? 229  TRP A HE1  1  
ATOM   2552   H HE3  . TRP A 1 173 ? 20.782  3.190   0.682   0.04 13.41 ? 229  TRP A HE3  1  
ATOM   2553   H HZ2  . TRP A 1 173 ? 19.203  5.867   4.186   0.04 12.84 ? 229  TRP A HZ2  1  
ATOM   2554   H HZ3  . TRP A 1 173 ? 19.018  2.499   2.013   0.04 12.93 ? 229  TRP A HZ3  1  
ATOM   2555   H HH2  . TRP A 1 173 ? 18.245  3.811   3.721   0.04 12.65 ? 229  TRP A HH2  1  
ATOM   2556   N N    . GLY A 1 174 ? 21.550  8.245   -1.474  0.04 14.41 ? 230  GLY A N    1  
ATOM   2557   C CA   . GLY A 1 174 ? 21.661  9.650   -1.870  0.04 14.71 ? 230  GLY A CA   1  
ATOM   2558   C C    . GLY A 1 174 ? 22.104  10.684  -0.839  0.04 14.74 ? 230  GLY A C    1  
ATOM   2559   O O    . GLY A 1 174 ? 22.825  11.636  -1.194  0.04 15.09 ? 230  GLY A O    1  
ATOM   2560   H H    . GLY A 1 174 ? 20.743  7.970   -1.363  0.04 14.20 ? 230  GLY A H    1  
ATOM   2561   H HA2  . GLY A 1 174 ? 22.303  9.694   -2.595  0.04 14.98 ? 230  GLY A HA2  1  
ATOM   2562   H HA3  . GLY A 1 174 ? 20.806  9.940   -2.224  0.04 14.68 ? 230  GLY A HA3  1  
ATOM   2563   N N    . ASN A 1 175 ? 21.695  10.509  0.417   0.04 14.40 ? 231  ASN A N    1  
ATOM   2564   C CA   . ASN A 1 175 ? 21.960  11.534  1.439   0.04 14.42 ? 231  ASN A CA   1  
ATOM   2565   C C    . ASN A 1 175 ? 21.619  11.080  2.844   0.04 14.04 ? 231  ASN A C    1  
ATOM   2566   O O    . ASN A 1 175 ? 20.810  10.138  3.056   0.04 13.75 ? 231  ASN A O    1  
ATOM   2567   C CB   . ASN A 1 175 ? 21.190  12.816  1.125   0.04 14.61 ? 231  ASN A CB   1  
ATOM   2568   C CG   . ASN A 1 175 ? 19.729  12.745  1.547   0.04 14.37 ? 231  ASN A CG   1  
ATOM   2569   O OD1  . ASN A 1 175 ? 18.914  12.102  0.891   0.04 14.31 ? 231  ASN A OD1  1  
ATOM   2570   N ND2  . ASN A 1 175 ? 19.405  13.389  2.650   0.04 14.28 ? 231  ASN A ND2  1  
ATOM   2571   H H    . ASN A 1 175 ? 21.275  9.817   0.711   0.04 14.17 ? 231  ASN A H    1  
ATOM   2572   H HA   . ASN A 1 175 ? 22.905  11.757  1.425   0.04 14.60 ? 231  ASN A HA   1  
ATOM   2573   H HB2  . ASN A 1 175 ? 21.593  13.544  1.624   0.04 14.66 ? 231  ASN A HB2  1  
ATOM   2574   H HB3  . ASN A 1 175 ? 21.228  13.003  0.173   0.04 14.87 ? 231  ASN A HB3  1  
ATOM   2575   H HD21 . ASN A 1 175 ? 18.595  13.660  2.771   0.04 14.18 ? 231  ASN A HD21 1  
ATOM   2576   H HD22 . ASN A 1 175 ? 19.998  13.537  3.245   0.04 14.33 ? 231  ASN A HD22 1  
ATOM   2577   N N    . GLY A 1 176 ? 22.260  11.752  3.802   0.04 14.07 ? 232  GLY A N    1  
ATOM   2578   C CA   . GLY A 1 176 ? 22.147  11.458  5.224   0.04 13.78 ? 232  GLY A CA   1  
ATOM   2579   C C    . GLY A 1 176 ? 21.922  12.710  6.067   0.04 13.88 ? 232  GLY A C    1  
ATOM   2580   O O    . GLY A 1 176 ? 22.741  13.656  6.026   0.04 14.19 ? 232  GLY A O    1  
ATOM   2581   H H    . GLY A 1 176 ? 22.782  12.415  3.637   0.04 14.28 ? 232  GLY A H    1  
ATOM   2582   H HA2  . GLY A 1 176 ? 21.410  10.849  5.380   0.04 13.56 ? 232  GLY A HA2  1  
ATOM   2583   H HA3  . GLY A 1 176 ? 22.970  11.046  5.530   0.04 13.77 ? 232  GLY A HA3  1  
ATOM   2584   N N    . VAL A 1 177 ? 20.806  12.705  6.812   0.04 13.64 ? 233  VAL A N    1  
ATOM   2585   C CA   . VAL A 1 177 ? 20.315  13.880  7.536   0.04 13.73 ? 233  VAL A CA   1  
ATOM   2586   C C    . VAL A 1 177 ? 20.874  13.868  8.963   0.04 13.66 ? 233  VAL A C    1  
ATOM   2587   O O    . VAL A 1 177 ? 21.830  14.601  9.238   0.04 13.92 ? 233  VAL A O    1  
ATOM   2588   C CB   . VAL A 1 177 ? 18.778  13.995  7.498   0.04 13.57 ? 233  VAL A CB   1  
ATOM   2589   C CG1  . VAL A 1 177 ? 18.345  15.311  8.126   0.04 13.72 ? 233  VAL A CG1  1  
ATOM   2590   C CG2  . VAL A 1 177 ? 18.318  13.960  6.031   0.04 13.71 ? 233  VAL A CG2  1  
ATOM   2591   H H    . VAL A 1 177 ? 20.317  12.011  6.931   0.04 13.44 ? 233  VAL A H    1  
ATOM   2592   H HA   . VAL A 1 177 ? 20.657  14.672  7.093   0.04 13.99 ? 233  VAL A HA   1  
ATOM   2593   H HB   . VAL A 1 177 ? 18.366  13.259  7.970   0.04 13.33 ? 233  VAL A HB   1  
ATOM   2594   H HG11 . VAL A 1 177 ? 17.381  15.389  8.082   0.04 13.65 ? 233  VAL A HG11 1  
ATOM   2595   H HG12 . VAL A 1 177 ? 18.637  15.347  9.050   0.04 13.64 ? 233  VAL A HG12 1  
ATOM   2596   H HG13 . VAL A 1 177 ? 18.758  16.031  7.623   0.04 13.98 ? 233  VAL A HG13 1  
ATOM   2597   H HG21 . VAL A 1 177 ? 17.365  13.807  5.993   0.04 13.60 ? 233  VAL A HG21 1  
ATOM   2598   H HG22 . VAL A 1 177 ? 18.517  14.825  5.638   0.04 13.96 ? 233  VAL A HG22 1  
ATOM   2599   H HG23 . VAL A 1 177 ? 18.787  13.259  5.556   0.04 13.67 ? 233  VAL A HG23 1  
ATOM   2600   N N    . TRP A 1 178 ? 20.301  13.029  9.833   0.04 13.35 ? 234  TRP A N    1  
ATOM   2601   C CA   . TRP A 1 178 ? 20.824  12.898  11.201  0.04 13.29 ? 234  TRP A CA   1  
ATOM   2602   C C    . TRP A 1 178 ? 21.460  11.552  11.555  0.04 13.12 ? 234  TRP A C    1  
ATOM   2603   O O    . TRP A 1 178 ? 22.421  11.512  12.327  0.04 13.23 ? 234  TRP A O    1  
ATOM   2604   C CB   . TRP A 1 178 ? 19.733  13.152  12.235  0.04 13.12 ? 234  TRP A CB   1  
ATOM   2605   C CG   . TRP A 1 178 ? 19.172  14.539  12.197  0.04 13.32 ? 234  TRP A CG   1  
ATOM   2606   C CD1  . TRP A 1 178 ? 19.716  15.648  11.604  0.04 13.65 ? 234  TRP A CD1  1  
ATOM   2607   C CD2  . TRP A 1 178 ? 17.918  14.939  12.739  0.04 13.22 ? 234  TRP A CD2  1  
ATOM   2608   N NE1  . TRP A 1 178 ? 18.866  16.703  11.739  0.04 13.77 ? 234  TRP A NE1  1  
ATOM   2609   C CE2  . TRP A 1 178 ? 17.763  16.306  12.446  0.04 13.51 ? 234  TRP A CE2  1  
ATOM   2610   C CE3  . TRP A 1 178 ? 16.931  14.279  13.470  0.04 12.96 ? 234  TRP A CE3  1  
ATOM   2611   C CZ2  . TRP A 1 178 ? 16.648  17.005  12.802  0.04 13.54 ? 234  TRP A CZ2  1  
ATOM   2612   C CZ3  . TRP A 1 178 ? 15.824  14.978  13.851  0.04 12.99 ? 234  TRP A CZ3  1  
ATOM   2613   C CH2  . TRP A 1 178 ? 15.688  16.349  13.504  0.04 13.28 ? 234  TRP A CH2  1  
ATOM   2614   H H    . TRP A 1 178 ? 19.615  12.550  9.661   0.04 13.20 ? 234  TRP A H    1  
ATOM   2615   H HA   . TRP A 1 178 ? 21.492  13.579  11.346  0.04 13.50 ? 234  TRP A HA   1  
ATOM   2616   H HB2  . TRP A 1 178 ? 19.000  12.537  12.075  0.04 12.94 ? 234  TRP A HB2  1  
ATOM   2617   H HB3  . TRP A 1 178 ? 20.099  12.999  13.125  0.04 13.09 ? 234  TRP A HB3  1  
ATOM   2618   H HD1  . TRP A 1 178 ? 20.527  15.672  11.147  0.04 13.80 ? 234  TRP A HD1  1  
ATOM   2619   H HE1  . TRP A 1 178 ? 19.007  17.496  11.438  0.04 14.00 ? 234  TRP A HE1  1  
ATOM   2620   H HE3  . TRP A 1 178 ? 17.009  13.377  13.669  0.04 12.79 ? 234  TRP A HE3  1  
ATOM   2621   H HZ2  . TRP A 1 178 ? 16.571  17.914  12.609  0.04 13.77 ? 234  TRP A HZ2  1  
ATOM   2622   H HZ3  . TRP A 1 178 ? 15.148  14.548  14.319  0.04 12.83 ? 234  TRP A HZ3  1  
ATOM   2623   H HH2  . TRP A 1 178 ? 14.935  16.816  13.786  0.04 13.32 ? 234  TRP A HH2  1  
ATOM   2624   N N    . ASN A 1 179 ? 20.918  10.446  11.032  0.04 12.90 ? 235  ASN A N    1  
ATOM   2625   C CA   . ASN A 1 179 ? 21.414  9.128   11.437  0.04 12.76 ? 235  ASN A CA   1  
ATOM   2626   C C    . ASN A 1 179 ? 20.988  8.047   10.437  0.04 12.63 ? 235  ASN A C    1  
ATOM   2627   O O    . ASN A 1 179 ? 19.941  7.425   10.596  0.04 12.41 ? 235  ASN A O    1  
ATOM   2628   C CB   . ASN A 1 179 ? 20.923  8.769   12.837  0.04 12.57 ? 235  ASN A CB   1  
ATOM   2629   C CG   . ASN A 1 179 ? 21.269  7.349   13.242  0.04 12.44 ? 235  ASN A CG   1  
ATOM   2630   O OD1  . ASN A 1 179 ? 22.193  6.737   12.708  0.04 12.54 ? 235  ASN A OD1  1  
ATOM   2631   N ND2  . ASN A 1 179 ? 20.477  6.794   14.140  0.04 12.24 ? 235  ASN A ND2  1  
ATOM   2632   H H    . ASN A 1 179 ? 20.270  10.436  10.469  0.04 12.85 ? 235  ASN A H    1  
ATOM   2633   H HA   . ASN A 1 179 ? 22.386  9.134   11.463  0.04 12.90 ? 235  ASN A HA   1  
ATOM   2634   H HB2  . ASN A 1 179 ? 21.315  9.373   13.484  0.04 12.68 ? 235  ASN A HB2  1  
ATOM   2635   H HB3  . ASN A 1 179 ? 19.959  8.858   12.854  0.04 12.46 ? 235  ASN A HB3  1  
ATOM   2636   H HD21 . ASN A 1 179 ? 20.421  5.938   14.187  0.04 12.19 ? 235  ASN A HD21 1  
ATOM   2637   H HD22 . ASN A 1 179 ? 20.005  7.289   14.661  0.04 12.17 ? 235  ASN A HD22 1  
ATOM   2638   N N    . MET A 1 180 ? 21.816  7.828   9.420   0.04 12.79 ? 236  MET A N    1  
ATOM   2639   C CA   . MET A 1 180 ? 21.610  6.734   8.471   0.04 12.72 ? 236  MET A CA   1  
ATOM   2640   C C    . MET A 1 180 ? 22.583  5.614   8.842   0.04 12.74 ? 236  MET A C    1  
ATOM   2641   O O    . MET A 1 180 ? 23.810  5.756   8.677   0.04 12.97 ? 236  MET A O    1  
ATOM   2642   C CB   . MET A 1 180 ? 21.829  7.223   7.042   0.04 12.94 ? 236  MET A CB   1  
ATOM   2643   C CG   . MET A 1 180 ? 20.611  7.924   6.418   0.04 12.89 ? 236  MET A CG   1  
ATOM   2644   S SD   . MET A 1 180 ? 19.757  9.084   7.554   0.04 12.88 ? 236  MET A SD   1  
ATOM   2645   C CE   . MET A 1 180 ? 18.115  9.278   6.827   0.04 12.98 ? 236  MET A CE   1  
ATOM   2646   H H    . MET A 1 180 ? 22.518  8.294   9.261   0.04 12.97 ? 236  MET A H    1  
ATOM   2647   H HA   . MET A 1 180 ? 20.701  6.406   8.531   0.04 12.55 ? 236  MET A HA   1  
ATOM   2648   H HB2  . MET A 1 180 ? 22.583  7.830   7.027   0.04 13.12 ? 236  MET A HB2  1  
ATOM   2649   H HB3  . MET A 1 180 ? 22.034  6.455   6.489   0.04 12.96 ? 236  MET A HB3  1  
ATOM   2650   H HG2  . MET A 1 180 ? 20.916  8.422   5.643   0.04 13.05 ? 236  MET A HG2  1  
ATOM   2651   H HG3  . MET A 1 180 ? 19.970  7.254   6.142   0.04 12.72 ? 236  MET A HG3  1  
ATOM   2652   H HE1  . MET A 1 180 ? 17.803  10.174  6.988   0.04 13.08 ? 236  MET A HE1  1  
ATOM   2653   H HE2  . MET A 1 180 ? 18.181  9.122   5.874   0.04 13.12 ? 236  MET A HE2  1  
ATOM   2654   H HE3  . MET A 1 180 ? 17.507  8.635   7.215   0.04 12.81 ? 236  MET A HE3  1  
ATOM   2655   N N    . THR A 1 181 ? 22.033  4.508   9.353   0.04 12.53 ? 237  THR A N    1  
ATOM   2656   C CA   . THR A 1 181 ? 22.794  3.323   9.778   0.04 12.53 ? 237  THR A CA   1  
ATOM   2657   C C    . THR A 1 181 ? 22.545  2.133   8.838   0.04 12.51 ? 237  THR A C    1  
ATOM   2658   O O    . THR A 1 181 ? 21.432  1.906   8.339   0.04 12.37 ? 237  THR A O    1  
ATOM   2659   C CB   . THR A 1 181 ? 22.476  2.911   11.230  0.04 12.36 ? 237  THR A CB   1  
ATOM   2660   O OG1  . THR A 1 181 ? 22.744  4.012   12.101  0.04 12.45 ? 237  THR A OG1  1  
ATOM   2661   C CG2  . THR A 1 181 ? 23.318  1.714   11.689  0.04 12.36 ? 237  THR A CG2  1  
ATOM   2662   H H    . THR A 1 181 ? 21.185  4.420   9.471   0.04 12.40 ? 237  THR A H    1  
ATOM   2663   H HA   . THR A 1 181 ? 23.736  3.531   9.745   0.04 12.70 ? 237  THR A HA   1  
ATOM   2664   H HB   . THR A 1 181 ? 21.541  2.660   11.286  0.04 12.21 ? 237  THR A HB   1  
ATOM   2665   H HG1  . THR A 1 181 ? 22.770  4.726   11.659  0.04 12.53 ? 237  THR A HG1  1  
ATOM   2666   H HG21 . THR A 1 181 ? 22.890  1.280   12.446  0.04 12.26 ? 237  THR A HG21 1  
ATOM   2667   H HG22 . THR A 1 181 ? 23.402  1.063   10.979  0.04 12.32 ? 237  THR A HG22 1  
ATOM   2668   H HG23 . THR A 1 181 ? 24.209  1.998   11.950  0.04 12.53 ? 237  THR A HG23 1  
ATOM   2669   N N    . PHE A 1 182 ? 23.632  1.413   8.562   0.04 12.69 ? 238  PHE A N    1  
ATOM   2670   C CA   . PHE A 1 182 ? 23.630  0.270   7.664   0.04 12.75 ? 238  PHE A CA   1  
ATOM   2671   C C    . PHE A 1 182 ? 24.370  -0.874  8.349   0.04 12.83 ? 238  PHE A C    1  
ATOM   2672   O O    . PHE A 1 182 ? 25.491  -0.672  8.851   0.04 13.01 ? 238  PHE A O    1  
ATOM   2673   C CB   . PHE A 1 182 ? 24.434  0.592   6.401   0.04 13.02 ? 238  PHE A CB   1  
ATOM   2674   C CG   . PHE A 1 182 ? 24.037  1.855   5.723   0.04 13.05 ? 238  PHE A CG   1  
ATOM   2675   C CD1  . PHE A 1 182 ? 24.635  3.054   6.068   0.04 13.15 ? 238  PHE A CD1  1  
ATOM   2676   C CD2  . PHE A 1 182 ? 23.090  1.862   4.717   0.04 13.01 ? 238  PHE A CD2  1  
ATOM   2677   C CE1  . PHE A 1 182 ? 24.284  4.240   5.456   0.04 13.21 ? 238  PHE A CE1  1  
ATOM   2678   C CE2  . PHE A 1 182 ? 22.730  3.065   4.098   0.04 13.08 ? 238  PHE A CE2  1  
ATOM   2679   C CZ   . PHE A 1 182 ? 23.325  4.254   4.472   0.04 13.18 ? 238  PHE A CZ   1  
ATOM   2680   H H    . PHE A 1 182 ? 24.403  1.581   8.888   0.04 12.81 ? 238  PHE A H    1  
ATOM   2681   H HA   . PHE A 1 182 ? 22.731  0.017   7.418   0.04 12.61 ? 238  PHE A HA   1  
ATOM   2682   H HB2  . PHE A 1 182 ? 25.367  0.663   6.644   0.04 13.18 ? 238  PHE A HB2  1  
ATOM   2683   H HB3  . PHE A 1 182 ? 24.321  -0.134  5.766   0.04 13.06 ? 238  PHE A HB3  1  
ATOM   2684   H HD1  . PHE A 1 182 ? 25.273  3.063   6.745   0.04 13.19 ? 238  PHE A HD1  1  
ATOM   2685   H HD2  . PHE A 1 182 ? 22.680  1.065   4.468   0.04 12.96 ? 238  PHE A HD2  1  
ATOM   2686   H HE1  . PHE A 1 182 ? 24.693  5.036   5.720   0.04 13.30 ? 238  PHE A HE1  1  
ATOM   2687   H HE2  . PHE A 1 182 ? 22.084  3.067   3.426   0.04 13.07 ? 238  PHE A HE2  1  
ATOM   2688   H HZ   . PHE A 1 182 ? 23.091  5.050   4.055   0.04 13.25 ? 238  PHE A HZ   1  
ATOM   2689   N N    . SER A 1 183 ? 23.829  -2.088  8.286   0.04 12.75 ? 239  SER A N    1  
ATOM   2690   C CA   . SER A 1 183 ? 24.623  -3.284  8.618   0.04 12.91 ? 239  SER A CA   1  
ATOM   2691   C C    . SER A 1 183 ? 24.405  -4.337  7.557   0.04 13.00 ? 239  SER A C    1  
ATOM   2692   O O    . SER A 1 183 ? 23.307  -4.631  7.201   0.04 12.85 ? 239  SER A O    1  
ATOM   2693   C CB   . SER A 1 183 ? 24.376  -3.846  10.030  0.04 12.80 ? 239  SER A CB   1  
ATOM   2694   O OG   . SER A 1 183 ? 23.039  -4.266  10.234  0.04 12.57 ? 239  SER A OG   1  
ATOM   2695   H H    . SER A 1 183 ? 23.023  -2.248  8.045   0.04 12.64 ? 239  SER A H    1  
ATOM   2696   H HA   . SER A 1 183 ? 25.561  -3.039  8.577   0.04 13.10 ? 239  SER A HA   1  
ATOM   2697   H HB2  . SER A 1 183 ? 24.967  -4.605  10.157  0.04 12.95 ? 239  SER A HB2  1  
ATOM   2698   H HB3  . SER A 1 183 ? 24.594  -3.152  10.673  0.04 12.76 ? 239  SER A HB3  1  
ATOM   2699   H HG   . SER A 1 183 ? 22.643  -4.336  9.499   0.04 12.54 ? 239  SER A HG   1  
ATOM   2700   N N    . GLY A 1 184 ? 25.494  -4.857  7.000   0.04 13.30 ? 240  GLY A N    1  
ATOM   2701   C CA   . GLY A 1 184 ? 25.383  -5.890  5.985   0.04 13.43 ? 240  GLY A CA   1  
ATOM   2702   C C    . GLY A 1 184 ? 24.783  -5.434  4.667   0.04 13.42 ? 240  GLY A C    1  
ATOM   2703   O O    . GLY A 1 184 ? 24.161  -6.201  3.937   0.04 13.45 ? 240  GLY A O    1  
ATOM   2704   H H    . GLY A 1 184 ? 26.295  -4.628  7.198   0.04 13.44 ? 240  GLY A H    1  
ATOM   2705   H HA2  . GLY A 1 184 ? 26.266  -6.242  5.801   0.04 13.66 ? 240  GLY A HA2  1  
ATOM   2706   H HA3  . GLY A 1 184 ? 24.843  -6.610  6.342   0.04 13.34 ? 240  GLY A HA3  1  
ATOM   2707   N N    . VAL A 1 185 ? 24.986  -4.166  4.344   0.04 13.43 ? 241  VAL A N    1  
ATOM   2708   C CA   . VAL A 1 185 ? 24.421  -3.606  3.122   0.04 13.46 ? 241  VAL A CA   1  
ATOM   2709   C C    . VAL A 1 185 ? 25.500  -3.490  2.055   0.04 13.81 ? 241  VAL A C    1  
ATOM   2710   O O    . VAL A 1 185 ? 26.489  -2.790  2.202   0.04 13.94 ? 241  VAL A O    1  
ATOM   2711   C CB   . VAL A 1 185 ? 23.730  -2.252  3.397   0.04 13.25 ? 241  VAL A CB   1  
ATOM   2712   C CG1  . VAL A 1 185 ? 23.104  -1.695  2.104   0.04 13.32 ? 241  VAL A CG1  1  
ATOM   2713   C CG2  . VAL A 1 185 ? 22.647  -2.428  4.471   0.04 12.93 ? 241  VAL A CG2  1  
ATOM   2714   H H    . VAL A 1 185 ? 25.437  -3.613  4.813   0.04 13.45 ? 241  VAL A H    1  
ATOM   2715   H HA   . VAL A 1 185 ? 23.749  -4.202  2.769   0.04 13.41 ? 241  VAL A HA   1  
ATOM   2716   H HB   . VAL A 1 185 ? 24.393  -1.630  3.723   0.04 13.32 ? 241  VAL A HB   1  
ATOM   2717   H HG11 . VAL A 1 185 ? 22.641  -0.867  2.300   0.04 13.20 ? 241  VAL A HG11 1  
ATOM   2718   H HG12 . VAL A 1 185 ? 23.805  -1.537  1.452   0.04 13.53 ? 241  VAL A HG12 1  
ATOM   2719   H HG13 . VAL A 1 185 ? 22.482  -2.350  1.760   0.04 13.29 ? 241  VAL A HG13 1  
ATOM   2720   H HG21 . VAL A 1 185 ? 22.148  -1.608  4.561   0.04 12.83 ? 241  VAL A HG21 1  
ATOM   2721   H HG22 . VAL A 1 185 ? 22.062  -3.148  4.198   0.04 12.88 ? 241  VAL A HG22 1  
ATOM   2722   H HG23 . VAL A 1 185 ? 23.066  -2.652  5.316   0.04 12.91 ? 241  VAL A HG23 1  
ATOM   2723   N N    . GLU A 1 186 ? 25.295  -4.230  0.970   0.04 14.00 ? 242  GLU A N    1  
ATOM   2724   C CA   . GLU A 1 186 ? 26.102  -4.046  -0.230  0.04 14.35 ? 242  GLU A CA   1  
ATOM   2725   C C    . GLU A 1 186 ? 25.690  -2.726  -0.889  0.04 14.33 ? 242  GLU A C    1  
ATOM   2726   O O    . GLU A 1 186 ? 24.515  -2.468  -1.118  0.04 14.12 ? 242  GLU A O    1  
ATOM   2727   C CB   . GLU A 1 186 ? 25.898  -5.227  -1.176  0.04 14.51 ? 242  GLU A CB   1  
ATOM   2728   C CG   . GLU A 1 186 ? 26.359  -6.580  -0.558  0.04 14.64 ? 242  GLU A CG   1  
ATOM   2729   C CD   . GLU A 1 186 ? 25.847  -7.863  -1.278  0.04 14.71 ? 242  GLU A CD   1  
ATOM   2730   O OE1  . GLU A 1 186 ? 26.286  -8.978  -0.920  0.04 14.83 ? 242  GLU A OE1  1  
ATOM   2731   O OE2  . GLU A 1 186 ? 25.007  -7.778  -2.176  0.04 14.68 ? 242  GLU A OE2  1  
ATOM   2732   H H    . GLU A 1 186 ? 24.695  -4.841  0.899   0.04 13.94 ? 242  GLU A H    1  
ATOM   2733   H HA   . GLU A 1 186 ? 27.038  -3.996  0.016   0.04 14.53 ? 242  GLU A HA   1  
ATOM   2734   H HB2  . GLU A 1 186 ? 24.954  -5.296  -1.385  0.04 14.33 ? 242  GLU A HB2  1  
ATOM   2735   H HB3  . GLU A 1 186 ? 26.405  -5.080  -1.988  0.04 14.75 ? 242  GLU A HB3  1  
ATOM   2736   H HG2  . GLU A 1 186 ? 27.327  -6.608  -0.584  0.04 14.90 ? 242  GLU A HG2  1  
ATOM   2737   H HG3  . GLU A 1 186 ? 26.063  -6.616  0.360   0.04 14.46 ? 242  GLU A HG3  1  
ATOM   2738   N N    . GLY A 1 187 ? 26.687  -1.907  -1.189  0.04 14.59 ? 243  GLY A N    1  
ATOM   2739   C CA   . GLY A 1 187 ? 26.449  -0.604  -1.771  0.04 14.67 ? 243  GLY A CA   1  
ATOM   2740   C C    . GLY A 1 187 ? 26.223  0.536   -0.795  0.04 14.46 ? 243  GLY A C    1  
ATOM   2741   O O    . GLY A 1 187 ? 26.046  1.683   -1.212  0.04 14.55 ? 243  GLY A O    1  
ATOM   2742   H H    . GLY A 1 187 ? 27.514  -2.094  -1.067  0.04 14.73 ? 243  GLY A H    1  
ATOM   2743   H HA2  . GLY A 1 187 ? 27.223  -0.374  -2.309  0.04 14.96 ? 243  GLY A HA2  1  
ATOM   2744   H HA3  . GLY A 1 187 ? 25.682  -0.652  -2.365  0.04 14.65 ? 243  GLY A HA3  1  
ATOM   2745   N N    . ALA A 1 188 ? 26.220  0.220   0.502   0.04 14.21 ? 244  ALA A N    1  
ATOM   2746   C CA   . ALA A 1 188 ? 26.141  1.275   1.502   0.04 14.04 ? 244  ALA A CA   1  
ATOM   2747   C C    . ALA A 1 188 ? 27.347  2.192   1.338   0.04 14.35 ? 244  ALA A C    1  
ATOM   2748   O O    . ALA A 1 188 ? 28.430  1.764   0.885   0.04 14.65 ? 244  ALA A O    1  
ATOM   2749   C CB   . ALA A 1 188 ? 26.093  0.699   2.925   0.04 13.79 ? 244  ALA A CB   1  
ATOM   2750   H H    . ALA A 1 188 ? 26.273  -0.575  0.816   0.04 14.16 ? 244  ALA A H    1  
ATOM   2751   H HA   . ALA A 1 188 ? 25.332  1.787   1.355   0.04 13.92 ? 244  ALA A HA   1  
ATOM   2752   H HB1  . ALA A 1 188 ? 26.091  1.442   3.550   0.04 13.72 ? 244  ALA A HB1  1  
ATOM   2753   H HB2  . ALA A 1 188 ? 25.284  0.177   3.034   0.04 13.60 ? 244  ALA A HB2  1  
ATOM   2754   H HB3  . ALA A 1 188 ? 26.872  0.140   3.079   0.04 13.92 ? 244  ALA A HB3  1  
ATOM   2755   N N    . PRO A 1 189 ? 27.183  3.455   1.710   0.04 14.31 ? 245  PRO A N    1  
ATOM   2756   C CA   . PRO A 1 189 ? 28.343  4.344   1.750   0.04 14.61 ? 245  PRO A CA   1  
ATOM   2757   C C    . PRO A 1 189 ? 29.249  3.975   2.910   0.04 14.64 ? 245  PRO A C    1  
ATOM   2758   O O    . PRO A 1 189 ? 28.769  3.564   3.962   0.04 14.37 ? 245  PRO A O    1  
ATOM   2759   C CB   . PRO A 1 189 ? 27.719  5.727   1.960   0.04 14.51 ? 245  PRO A CB   1  
ATOM   2760   C CG   . PRO A 1 189 ? 26.457  5.492   2.632   0.04 14.09 ? 245  PRO A CG   1  
ATOM   2761   C CD   . PRO A 1 189 ? 25.952  4.135   2.108   0.04 13.99 ? 245  PRO A CD   1  
ATOM   2762   H HA   . PRO A 1 189 ? 28.837  4.316   0.916   0.04 14.87 ? 245  PRO A HA   1  
ATOM   2763   H HB2  . PRO A 1 189 ? 28.300  6.273   2.507   0.04 14.60 ? 245  PRO A HB2  1  
ATOM   2764   H HB3  . PRO A 1 189 ? 27.577  6.142   1.095   0.04 14.65 ? 245  PRO A HB3  1  
ATOM   2765   H HG2  . PRO A 1 189 ? 26.607  5.448   3.589   0.04 13.97 ? 245  PRO A HG2  1  
ATOM   2766   H HG3  . PRO A 1 189 ? 25.836  6.203   2.408   0.04 14.04 ? 245  PRO A HG3  1  
ATOM   2767   H HD2  . PRO A 1 189 ? 25.505  3.634   2.807   0.04 13.78 ? 245  PRO A HD2  1  
ATOM   2768   H HD3  . PRO A 1 189 ? 25.385  4.257   1.333   0.04 14.00 ? 245  PRO A HD3  1  
ATOM   2769   N N    . ALA A 1 190 ? 30.554  4.103   2.722   0.04 15.02 ? 246  ALA A N    1  
ATOM   2770   C CA   . ALA A 1 190 ? 31.488  3.859   3.822   0.04 15.14 ? 246  ALA A CA   1  
ATOM   2771   C C    . ALA A 1 190 ? 31.232  4.734   5.026   0.04 14.92 ? 246  ALA A C    1  
ATOM   2772   O O    . ALA A 1 190 ? 30.843  5.872   4.896   0.04 14.82 ? 246  ALA A O    1  
ATOM   2773   C CB   . ALA A 1 190 ? 32.902  4.088   3.333   0.04 15.63 ? 246  ALA A CB   1  
ATOM   2774   H H    . ALA A 1 190 ? 30.924  4.324   1.982   0.04 15.24 ? 246  ALA A H    1  
ATOM   2775   H HA   . ALA A 1 190 ? 31.393  2.936   4.104   0.04 15.07 ? 246  ALA A HA   1  
ATOM   2776   H HB1  . ALA A 1 190 ? 33.508  4.024   4.088   0.04 15.76 ? 246  ALA A HB1  1  
ATOM   2777   H HB2  . ALA A 1 190 ? 33.123  3.425   2.661   0.04 15.77 ? 246  ALA A HB2  1  
ATOM   2778   H HB3  . ALA A 1 190 ? 32.948  4.977   2.948   0.04 15.71 ? 246  ALA A HB3  1  
ATOM   2779   N N    . GLN A 1 191 ? 31.513  4.175   6.191   0.04 14.89 ? 247  GLN A N    1  
ATOM   2780   C CA   . GLN A 1 191 ? 31.438  4.887   7.465   0.04 14.80 ? 247  GLN A CA   1  
ATOM   2781   C C    . GLN A 1 191 ? 32.024  6.307   7.374   0.04 15.09 ? 247  GLN A C    1  
ATOM   2782   O O    . GLN A 1 191 ? 33.172  6.493   6.914   0.04 15.50 ? 247  GLN A O    1  
ATOM   2783   C CB   . GLN A 1 191 ? 32.170  4.033   8.499   0.04 14.90 ? 247  GLN A CB   1  
ATOM   2784   C CG   . GLN A 1 191 ? 32.415  4.671   9.867   0.04 14.92 ? 247  GLN A CG   1  
ATOM   2785   C CD   . GLN A 1 191 ? 31.160  4.738   10.723  0.04 14.50 ? 247  GLN A CD   1  
ATOM   2786   O OE1  . GLN A 1 191 ? 30.342  3.828   10.743  0.04 14.22 ? 247  GLN A OE1  1  
ATOM   2787   N NE2  . GLN A 1 191 ? 31.061  5.813   11.503  0.04 14.51 ? 247  GLN A NE2  1  
ATOM   2788   H H    . GLN A 1 191 ? 31.754  3.356   6.276   0.04 14.93 ? 247  GLN A H    1  
ATOM   2789   H HA   . GLN A 1 191 ? 30.505  4.950   7.734   0.04 14.51 ? 247  GLN A HA   1  
ATOM   2790   H HB2  . GLN A 1 191 ? 31.658  3.225   8.644   0.04 14.71 ? 247  GLN A HB2  1  
ATOM   2791   H HB3  . GLN A 1 191 ? 33.036  3.797   8.133   0.04 15.20 ? 247  GLN A HB3  1  
ATOM   2792   H HG2  . GLN A 1 191 ? 33.062  4.132   10.345  0.04 15.05 ? 247  GLN A HG2  1  
ATOM   2793   H HG3  . GLN A 1 191 ? 32.748  5.573   9.759   0.04 15.10 ? 247  GLN A HG3  1  
ATOM   2794   H HE21 . GLN A 1 191 ? 31.729  6.345   11.572  0.04 14.75 ? 247  GLN A HE21 1  
ATOM   2795   H HE22 . GLN A 1 191 ? 30.335  5.975   11.932  0.04 14.30 ? 247  GLN A HE22 1  
ATOM   2796   N N    . SER A 1 192 ? 31.266  7.318   7.819   0.04 14.93 ? 248  SER A N    1  
ATOM   2797   C CA   . SER A 1 192 ? 31.701  8.704   7.690   0.04 15.21 ? 248  SER A CA   1  
ATOM   2798   C C    . SER A 1 192 ? 31.208  9.648   8.780   0.04 15.10 ? 248  SER A C    1  
ATOM   2799   O O    . SER A 1 192 ? 31.457  10.836  8.693   0.04 15.38 ? 248  SER A O    1  
ATOM   2800   C CB   . SER A 1 192 ? 31.286  9.279   6.326   0.04 15.27 ? 248  SER A CB   1  
ATOM   2801   O OG   . SER A 1 192 ? 29.885  9.354   6.208   0.04 14.87 ? 248  SER A OG   1  
ATOM   2802   H H    . SER A 1 192 ? 30.495  7.229   8.188   0.04 14.68 ? 248  SER A H    1  
ATOM   2803   H HA   . SER A 1 192 ? 32.669  8.723   7.730   0.04 15.51 ? 248  SER A HA   1  
ATOM   2804   H HB2  . SER A 1 192 ? 31.658  10.170  6.230   0.04 15.47 ? 248  SER A HB2  1  
ATOM   2805   H HB3  . SER A 1 192 ? 31.619  8.701   5.618   0.04 15.40 ? 248  SER A HB3  1  
ATOM   2806   H HG   . SER A 1 192 ? 29.533  9.349   6.970   0.04 14.68 ? 248  SER A HG   1  
ATOM   2807   N N    . PHE A 1 193 ? 30.518  9.138   9.801   0.04 14.73 ? 249  PHE A N    1  
ATOM   2808   C CA   . PHE A 1 193 ? 30.009  9.993   10.897  0.04 14.63 ? 249  PHE A CA   1  
ATOM   2809   C C    . PHE A 1 193 ? 31.201  10.692  11.605  0.04 15.02 ? 249  PHE A C    1  
ATOM   2810   O O    . PHE A 1 193 ? 32.230  10.067  11.844  0.04 15.25 ? 249  PHE A O    1  
ATOM   2811   C CB   . PHE A 1 193 ? 29.253  9.088   11.856  0.04 14.28 ? 249  PHE A CB   1  
ATOM   2812   C CG   . PHE A 1 193 ? 28.442  9.801   12.903  0.04 14.12 ? 249  PHE A CG   1  
ATOM   2813   C CD1  . PHE A 1 193 ? 29.055  10.290  14.040  0.04 14.31 ? 249  PHE A CD1  1  
ATOM   2814   C CD2  . PHE A 1 193 ? 27.077  9.909   12.786  0.04 13.82 ? 249  PHE A CD2  1  
ATOM   2815   C CE1  . PHE A 1 193 ? 28.315  10.936  15.007  0.04 14.20 ? 249  PHE A CE1  1  
ATOM   2816   C CE2  . PHE A 1 193 ? 26.340  10.552  13.746  0.04 13.71 ? 249  PHE A CE2  1  
ATOM   2817   C CZ   . PHE A 1 193 ? 26.968  11.029  14.883  0.04 13.90 ? 249  PHE A CZ   1  
ATOM   2818   H H    . PHE A 1 193 ? 30.335  8.306   9.892   0.04 14.56 ? 249  PHE A H    1  
ATOM   2819   H HA   . PHE A 1 193 ? 29.383  10.629  10.539  0.04 14.56 ? 249  PHE A HA   1  
ATOM   2820   H HB2  . PHE A 1 193 ? 28.656  8.528   11.338  0.04 14.08 ? 249  PHE A HB2  1  
ATOM   2821   H HB3  . PHE A 1 193 ? 29.895  8.536   12.322  0.04 14.39 ? 249  PHE A HB3  1  
ATOM   2822   H HD1  . PHE A 1 193 ? 29.976  10.216  14.135  0.04 14.54 ? 249  PHE A HD1  1  
ATOM   2823   H HD2  . PHE A 1 193 ? 26.650  9.575   12.029  0.04 13.71 ? 249  PHE A HD2  1  
ATOM   2824   H HE1  . PHE A 1 193 ? 28.737  11.267  15.766  0.04 14.35 ? 249  PHE A HE1  1  
ATOM   2825   H HE2  . PHE A 1 193 ? 25.416  10.622  13.660  0.04 13.53 ? 249  PHE A HE2  1  
ATOM   2826   H HZ   . PHE A 1 193 ? 26.471  11.470  15.535  0.04 13.85 ? 249  PHE A HZ   1  
ATOM   2827   N N    . PRO A 1 194 ? 31.096  11.981  11.962  0.04 15.14 ? 250  PRO A N    1  
ATOM   2828   C CA   . PRO A 1 194 ? 29.872  12.774  12.082  0.04 14.91 ? 250  PRO A CA   1  
ATOM   2829   C C    . PRO A 1 194 ? 29.186  13.043  10.777  0.04 14.95 ? 250  PRO A C    1  
ATOM   2830   O O    . PRO A 1 194 ? 28.029  12.704  10.707  0.04 14.72 ? 250  PRO A O    1  
ATOM   2831   C CB   . PRO A 1 194 ? 30.357  14.087  12.696  0.04 15.17 ? 250  PRO A CB   1  
ATOM   2832   C CG   . PRO A 1 194 ? 31.824  14.145  12.501  0.04 15.61 ? 250  PRO A CG   1  
ATOM   2833   C CD   . PRO A 1 194 ? 32.331  12.779  12.161  0.04 15.53 ? 250  PRO A CD   1  
ATOM   2834   H HA   . PRO A 1 194 ? 29.244  12.362  12.680  0.04 14.62 ? 250  PRO A HA   1  
ATOM   2835   H HB2  . PRO A 1 194 ? 29.931  14.821  12.231  0.04 15.21 ? 250  PRO A HB2  1  
ATOM   2836   H HB3  . PRO A 1 194 ? 30.132  14.101  13.640  0.04 15.03 ? 250  PRO A HB3  1  
ATOM   2837   H HG2  . PRO A 1 194 ? 32.021  14.767  11.783  0.04 15.80 ? 250  PRO A HG2  1  
ATOM   2838   H HG3  . PRO A 1 194 ? 32.225  14.449  13.328  0.04 15.77 ? 250  PRO A HG3  1  
ATOM   2839   H HD2  . PRO A 1 194 ? 32.857  12.807  11.349  0.04 15.81 ? 250  PRO A HD2  1  
ATOM   2840   H HD3  . PRO A 1 194 ? 32.848  12.429  12.904  0.04 15.47 ? 250  PRO A HD3  1  
ATOM   2841   N N    . GLU A 1 195 ? 29.936  13.586  9.800   0.04 15.29 ? 251  GLU A N    1  
ATOM   2842   C CA   . GLU A 1 195 ? 29.402  14.277  8.624   0.04 15.40 ? 251  GLU A CA   1  
ATOM   2843   C C    . GLU A 1 195 ? 29.922  13.669  7.283   0.04 15.55 ? 251  GLU A C    1  
ATOM   2844   O O    . GLU A 1 195 ? 31.137  13.632  7.061   0.04 15.88 ? 251  GLU A O    1  
ATOM   2845   C CB   . GLU A 1 195 ? 29.838  15.756  8.750   0.04 15.81 ? 251  GLU A CB   1  
ATOM   2846   C CG   . GLU A 1 195 ? 29.535  16.596  7.588   0.04 15.94 ? 251  GLU A CG   1  
ATOM   2847   C CD   . GLU A 1 195 ? 28.049  16.631  7.327   0.04 15.65 ? 251  GLU A CD   1  
ATOM   2848   O OE1  . GLU A 1 195 ? 27.356  17.205  8.195   0.04 15.76 ? 251  GLU A OE1  1  
ATOM   2849   O OE2  . GLU A 1 195 ? 27.583  16.084  6.280   0.04 15.35 ? 251  GLU A OE2  1  
ATOM   2850   H H    . GLU A 1 195 ? 30.793  13.576  9.813   0.04 15.48 ? 251  GLU A H    1  
ATOM   2851   H HA   . GLU A 1 195 ? 28.434  14.249  8.664   0.04 15.15 ? 251  GLU A HA   1  
ATOM   2852   H HB2  . GLU A 1 195 ? 29.384  16.146  9.511   0.04 15.75 ? 251  GLU A HB2  1  
ATOM   2853   H HB3  . GLU A 1 195 ? 30.798  15.790  8.888   0.04 16.10 ? 251  GLU A HB3  1  
ATOM   2854   H HG2  . GLU A 1 195 ? 29.830  17.504  7.770   0.04 16.28 ? 251  GLU A HG2  1  
ATOM   2855   H HG3  . GLU A 1 195 ? 29.987  16.246  6.803   0.04 15.92 ? 251  GLU A HG3  1  
ATOM   2856   N N    . PRO A 1 196 ? 29.027  13.148  6.407   0.04 15.32 ? 252  PRO A N    1  
ATOM   2857   C CA   . PRO A 1 196 ? 27.589  12.995  6.652   0.04 14.91 ? 252  PRO A CA   1  
ATOM   2858   C C    . PRO A 1 196 ? 27.379  11.807  7.582   0.04 14.57 ? 252  PRO A C    1  
ATOM   2859   O O    . PRO A 1 196 ? 28.226  10.915  7.617   0.04 14.65 ? 252  PRO A O    1  
ATOM   2860   C CB   . PRO A 1 196 ? 27.015  12.667  5.276   0.04 14.83 ? 252  PRO A CB   1  
ATOM   2861   C CG   . PRO A 1 196 ? 28.164  12.736  4.321   0.04 15.26 ? 252  PRO A CG   1  
ATOM   2862   C CD   . PRO A 1 196 ? 29.392  12.548  5.118   0.04 15.50 ? 252  PRO A CD   1  
ATOM   2863   H HA   . PRO A 1 196 ? 27.187  13.803  6.999   0.04 14.94 ? 252  PRO A HA   1  
ATOM   2864   H HB2  . PRO A 1 196 ? 26.639  11.773  5.285   0.04 14.63 ? 252  PRO A HB2  1  
ATOM   2865   H HB3  . PRO A 1 196 ? 26.339  13.307  5.040   0.04 14.75 ? 252  PRO A HB3  1  
ATOM   2866   H HG2  . PRO A 1 196 ? 28.070  12.025  3.667   0.04 15.24 ? 252  PRO A HG2  1  
ATOM   2867   H HG3  . PRO A 1 196 ? 28.175  13.603  3.883   0.04 15.44 ? 252  PRO A HG3  1  
ATOM   2868   H HD2  . PRO A 1 196 ? 29.581  11.603  5.223   0.04 15.45 ? 252  PRO A HD2  1  
ATOM   2869   H HD3  . PRO A 1 196 ? 30.141  13.010  4.711   0.04 15.83 ? 252  PRO A HD3  1  
ATOM   2870   N N    . PRO A 1 197 ? 26.263  11.794  8.323   0.04 14.23 ? 253  PRO A N    1  
ATOM   2871   C CA   . PRO A 1 197 ? 26.097  10.953  9.524   0.04 13.95 ? 253  PRO A CA   1  
ATOM   2872   C C    . PRO A 1 197 ? 25.728  9.498   9.193   0.04 13.71 ? 253  PRO A C    1  
ATOM   2873   O O    . PRO A 1 197 ? 24.673  8.992   9.615   0.04 13.41 ? 253  PRO A O    1  
ATOM   2874   C CB   . PRO A 1 197 ? 25.000  11.673  10.299  0.04 13.75 ? 253  PRO A CB   1  
ATOM   2875   C CG   . PRO A 1 197 ? 24.155  12.256  9.181   0.04 13.79 ? 253  PRO A CG   1  
ATOM   2876   C CD   . PRO A 1 197 ? 25.154  12.750  8.182   0.04 14.15 ? 253  PRO A CD   1  
ATOM   2877   H HA   . PRO A 1 197 ? 26.894  10.922  10.063  0.04 14.07 ? 253  PRO A HA   1  
ATOM   2878   H HB2  . PRO A 1 197 ? 24.500  11.055  10.847  0.04 13.52 ? 253  PRO A HB2  1  
ATOM   2879   H HB3  . PRO A 1 197 ? 25.378  12.377  10.840  0.04 13.89 ? 253  PRO A HB3  1  
ATOM   2880   H HG2  . PRO A 1 197 ? 23.596  11.563  8.795   0.04 13.60 ? 253  PRO A HG2  1  
ATOM   2881   H HG3  . PRO A 1 197 ? 23.618  12.987  9.523   0.04 13.82 ? 253  PRO A HG3  1  
ATOM   2882   H HD2  . PRO A 1 197 ? 24.796  12.715  7.283   0.04 14.14 ? 253  PRO A HD2  1  
ATOM   2883   H HD3  . PRO A 1 197 ? 25.444  13.643  8.415   0.04 14.36 ? 253  PRO A HD3  1  
ATOM   2884   N N    . TYR A 1 198 ? 26.633  8.871   8.440   0.04 13.89 ? 254  TYR A N    1  
ATOM   2885   C CA   . TYR A 1 198 ? 26.569  7.476   8.036   0.04 13.74 ? 254  TYR A CA   1  
ATOM   2886   C C    . TYR A 1 198 ? 27.340  6.570   9.013   0.04 13.74 ? 254  TYR A C    1  
ATOM   2887   O O    . TYR A 1 198 ? 28.573  6.708   9.192   0.04 14.03 ? 254  TYR A O    1  
ATOM   2888   C CB   . TYR A 1 198 ? 27.205  7.280   6.651   0.04 13.98 ? 254  TYR A CB   1  
ATOM   2889   C CG   . TYR A 1 198 ? 26.491  7.927   5.471   0.04 14.04 ? 254  TYR A CG   1  
ATOM   2890   C CD1  . TYR A 1 198 ? 25.124  8.019   5.420   0.04 13.79 ? 254  TYR A CD1  1  
ATOM   2891   C CD2  . TYR A 1 198 ? 27.216  8.424   4.402   0.04 14.40 ? 254  TYR A CD2  1  
ATOM   2892   C CE1  . TYR A 1 198 ? 24.489  8.556   4.316   0.04 13.89 ? 254  TYR A CE1  1  
ATOM   2893   C CE2  . TYR A 1 198 ? 26.588  8.967   3.303   0.04 14.50 ? 254  TYR A CE2  1  
ATOM   2894   C CZ   . TYR A 1 198 ? 25.204  9.026   3.283   0.04 14.24 ? 254  TYR A CZ   1  
ATOM   2895   O OH   . TYR A 1 198 ? 24.531  9.566   2.212   0.04 14.39 ? 254  TYR A OH   1  
ATOM   2896   H H    . TYR A 1 198 ? 27.328  9.266   8.131   0.04 14.12 ? 254  TYR A H    1  
ATOM   2897   H HA   . TYR A 1 198 ? 25.641  7.197   7.995   0.04 13.51 ? 254  TYR A HA   1  
ATOM   2898   H HB2  . TYR A 1 198 ? 28.106  7.637   6.672   0.04 14.22 ? 254  TYR A HB2  1  
ATOM   2899   H HB3  . TYR A 1 198 ? 27.250  6.329   6.473   0.04 13.88 ? 254  TYR A HB3  1  
ATOM   2900   H HD1  . TYR A 1 198 ? 24.624  7.677   6.124   0.04 13.56 ? 254  TYR A HD1  1  
ATOM   2901   H HD2  . TYR A 1 198 ? 28.146  8.367   4.413   0.04 14.60 ? 254  TYR A HD2  1  
ATOM   2902   H HE1  . TYR A 1 198 ? 23.561  8.610   4.290   0.04 13.75 ? 254  TYR A HE1  1  
ATOM   2903   H HE2  . TYR A 1 198 ? 27.088  9.294   2.592   0.04 14.77 ? 254  TYR A HE2  1  
ATOM   2904   H HH   . TYR A 1 198 ? 25.076  9.952   1.701   0.04 14.63 ? 254  TYR A HH   1  
ATOM   2905   N N    . THR A 1 199 ? 26.622  5.614   9.585   0.04 13.45 ? 255  THR A N    1  
ATOM   2906   C CA   . THR A 1 199 ? 27.153  4.589   10.469  0.04 13.44 ? 255  THR A CA   1  
ATOM   2907   C C    . THR A 1 199 ? 27.053  3.272   9.706   0.04 13.38 ? 255  THR A C    1  
ATOM   2908   O O    . THR A 1 199 ? 25.939  2.832   9.426   0.04 13.14 ? 255  THR A O    1  
ATOM   2909   C CB   . THR A 1 199 ? 26.296  4.503   11.753  0.04 13.18 ? 255  THR A CB   1  
ATOM   2910   O OG1  . THR A 1 199 ? 26.373  5.740   12.488  0.04 13.24 ? 255  THR A OG1  1  
ATOM   2911   C CG2  . THR A 1 199 ? 26.749  3.335   12.630  0.04 13.22 ? 255  THR A CG2  1  
ATOM   2912   H H    . THR A 1 199 ? 25.775  5.541   9.461   0.04 13.26 ? 255  THR A H    1  
ATOM   2913   H HA   . THR A 1 199 ? 28.075  4.761   10.697  0.04 13.65 ? 255  THR A HA   1  
ATOM   2914   H HB   . THR A 1 199 ? 25.375  4.354   11.494  0.04 12.98 ? 255  THR A HB   1  
ATOM   2915   H HG1  . THR A 1 199 ? 27.131  5.821   12.834  0.04 13.39 ? 255  THR A HG1  1  
ATOM   2916   H HG21 . THR A 1 199 ? 26.296  3.388   13.487  0.04 13.03 ? 255  THR A HG21 1  
ATOM   2917   H HG22 . THR A 1 199 ? 26.530  2.487   12.213  0.04 13.32 ? 255  THR A HG22 1  
ATOM   2918   H HG23 . THR A 1 199 ? 27.707  3.382   12.782  0.04 13.37 ? 255  THR A HG23 1  
ATOM   2919   N N    . THR A 1 200 ? 28.176  2.698   9.316   0.04 13.64 ? 256  THR A N    1  
ATOM   2920   C CA   . THR A 1 200 ? 28.189  1.591   8.380   0.04 13.68 ? 256  THR A CA   1  
ATOM   2921   C C    . THR A 1 200 ? 28.984  0.428   8.982   0.04 13.82 ? 256  THR A C    1  
ATOM   2922   O O    . THR A 1 200 ? 30.180  0.555   9.257   0.04 14.13 ? 256  THR A O    1  
ATOM   2923   C CB   . THR A 1 200 ? 28.800  2.019   7.024   0.04 13.96 ? 256  THR A CB   1  
ATOM   2924   O OG1  . THR A 1 200 ? 28.012  3.059   6.440   0.04 13.88 ? 256  THR A OG1  1  
ATOM   2925   C CG2  . THR A 1 200 ? 28.901  0.827   6.051   0.04 14.02 ? 256  THR A CG2  1  
ATOM   2926   H H    . THR A 1 200 ? 28.957  2.935   9.577   0.04 13.82 ? 256  THR A H    1  
ATOM   2927   H HA   . THR A 1 200 ? 27.281  1.292   8.217   0.04 13.47 ? 256  THR A HA   1  
ATOM   2928   H HB   . THR A 1 200 ? 29.699  2.355   7.174   0.04 14.20 ? 256  THR A HB   1  
ATOM   2929   H HG1  . THR A 1 200 ? 27.528  3.419   7.020   0.04 13.68 ? 256  THR A HG1  1  
ATOM   2930   H HG21 . THR A 1 200 ? 29.374  1.112   5.256   0.04 14.22 ? 256  THR A HG21 1  
ATOM   2931   H HG22 . THR A 1 200 ? 29.384  0.091   6.453   0.04 14.10 ? 256  THR A HG22 1  
ATOM   2932   H HG23 . THR A 1 200 ? 28.011  0.528   5.805   0.04 13.80 ? 256  THR A HG23 1  
ATOM   2933   N N    . LEU A 1 201 ? 28.313  -0.702  9.173   0.04 13.63 ? 257  LEU A N    1  
ATOM   2934   C CA   . LEU A 1 201 ? 28.919  -1.962  9.603   0.04 13.78 ? 257  LEU A CA   1  
ATOM   2935   C C    . LEU A 1 201 ? 28.900  -2.934  8.442   0.04 13.89 ? 257  LEU A C    1  
ATOM   2936   O O    . LEU A 1 201 ? 27.888  -3.064  7.744   0.04 13.69 ? 257  LEU A O    1  
ATOM   2937   C CB   . LEU A 1 201 ? 28.183  -2.560  10.808  0.04 13.54 ? 257  LEU A CB   1  
ATOM   2938   C CG   . LEU A 1 201 ? 28.279  -1.807  12.130  0.04 13.53 ? 257  LEU A CG   1  
ATOM   2939   C CD1  . LEU A 1 201 ? 27.932  -0.420  11.976  0.04 13.51 ? 257  LEU A CD1  1  
ATOM   2940   C CD2  . LEU A 1 201 ? 27.349  -2.451  13.188  0.04 13.26 ? 257  LEU A CD2  1  
ATOM   2941   H H    . LEU A 1 201 ? 27.462  -0.759  9.047   0.04 13.42 ? 257  LEU A H    1  
ATOM   2942   H HA   . LEU A 1 201 ? 29.845  -1.829  9.866   0.04 14.00 ? 257  LEU A HA   1  
ATOM   2943   H HB2  . LEU A 1 201 ? 27.240  -2.618  10.591  0.04 13.31 ? 257  LEU A HB2  1  
ATOM   2944   H HB3  . LEU A 1 201 ? 28.542  -3.446  10.971  0.04 13.63 ? 257  LEU A HB3  1  
ATOM   2945   H HG   . LEU A 1 201 ? 29.200  -1.853  12.453  0.04 13.76 ? 257  LEU A HG   1  
ATOM   2946   H HD11 . LEU A 1 201 ? 27.610  -0.075  12.829  0.04 13.49 ? 257  LEU A HD11 1  
ATOM   2947   H HD12 . LEU A 1 201 ? 28.727  0.075   11.694  0.04 13.72 ? 257  LEU A HD12 1  
ATOM   2948   H HD13 . LEU A 1 201 ? 27.232  -0.346  11.309  0.04 13.32 ? 257  LEU A HD13 1  
ATOM   2949   H HD21 . LEU A 1 201 ? 27.426  -1.972  14.025  0.04 13.29 ? 257  LEU A HD21 1  
ATOM   2950   H HD22 . LEU A 1 201 ? 26.437  -2.408  12.862  0.04 13.06 ? 257  LEU A HD22 1  
ATOM   2951   H HD23 . LEU A 1 201 ? 27.602  -3.379  13.317  0.04 13.30 ? 257  LEU A HD23 1  
ATOM   2952   N N    . GLU A 1 202 ? 30.027  -3.613  8.222   0.04 14.24 ? 258  GLU A N    1  
ATOM   2953   C CA   . GLU A 1 202 ? 30.151  -4.583  7.132   0.04 14.41 ? 258  GLU A CA   1  
ATOM   2954   C C    . GLU A 1 202 ? 29.121  -5.727  7.202   0.04 14.21 ? 258  GLU A C    1  
ATOM   2955   O O    . GLU A 1 202 ? 28.645  -6.191  6.158   0.04 14.15 ? 258  GLU A O    1  
ATOM   2956   C CB   . GLU A 1 202 ? 31.594  -5.119  7.104   0.04 14.87 ? 258  GLU A CB   1  
ATOM   2957   C CG   . GLU A 1 202 ? 31.909  -6.280  6.112   0.04 15.15 ? 258  GLU A CG   1  
ATOM   2958   C CD   . GLU A 1 202 ? 31.667  -5.951  4.617   0.04 15.26 ? 258  GLU A CD   1  
ATOM   2959   O OE1  . GLU A 1 202 ? 32.471  -6.232  3.733   0.04 15.67 ? 258  GLU A OE1  1  
ATOM   2960   O OE2  . GLU A 1 202 ? 30.581  -5.428  4.322   0.04 14.98 ? 258  GLU A OE2  1  
ATOM   2961   H H    . GLU A 1 202 ? 30.735  -3.538  8.700   0.04 14.40 ? 258  GLU A H    1  
ATOM   2962   H HA   . GLU A 1 202 ? 29.997  -4.107  6.303   0.04 14.37 ? 258  GLU A HA   1  
ATOM   2963   H HB2  . GLU A 1 202 ? 32.184  -4.381  6.873   0.04 14.99 ? 258  GLU A HB2  1  
ATOM   2964   H HB3  . GLU A 1 202 ? 31.815  -5.434  7.996   0.04 14.94 ? 258  GLU A HB3  1  
ATOM   2965   H HG2  . GLU A 1 202 ? 32.844  -6.517  6.216   0.04 15.44 ? 258  GLU A HG2  1  
ATOM   2966   H HG3  . GLU A 1 202 ? 31.355  -7.036  6.340   0.04 15.01 ? 258  GLU A HG3  1  
ATOM   2967   N N    . THR A 1 203 ? 28.748  -6.132  8.413   0.04 14.16 ? 259  THR A N    1  
ATOM   2968   C CA   . THR A 1 203 ? 27.791  -7.197  8.639   0.04 14.00 ? 259  THR A CA   1  
ATOM   2969   C C    . THR A 1 203 ? 26.910  -6.927  9.825   0.04 13.67 ? 259  THR A C    1  
ATOM   2970   O O    . THR A 1 203 ? 27.293  -6.214  10.770  0.04 13.61 ? 259  THR A O    1  
ATOM   2971   C CB   . THR A 1 203 ? 28.452  -8.563  8.910   0.04 14.33 ? 259  THR A CB   1  
ATOM   2972   O OG1  . THR A 1 203 ? 29.108  -8.567  10.192  0.04 14.50 ? 259  THR A OG1  1  
ATOM   2973   C CG2  . THR A 1 203 ? 29.456  -8.925  7.798   0.04 14.68 ? 259  THR A CG2  1  
ATOM   2974   H H    . THR A 1 203 ? 29.034  -5.779  9.143   0.04 14.25 ? 259  THR A H    1  
ATOM   2975   H HA   . THR A 1 203 ? 27.217  -7.279  7.859   0.04 13.94 ? 259  THR A HA   1  
ATOM   2976   H HB   . THR A 1 203 ? 27.763  -9.243  8.924   0.04 14.24 ? 259  THR A HB   1  
ATOM   2977   H HG1  . THR A 1 203 ? 28.538  -8.522  10.802  0.04 14.51 ? 259  THR A HG1  1  
ATOM   2978   H HG21 . THR A 1 203 ? 29.998  -9.685  8.064   0.04 14.89 ? 259  THR A HG21 1  
ATOM   2979   H HG22 . THR A 1 203 ? 28.984  -9.147  6.980   0.04 14.59 ? 259  THR A HG22 1  
ATOM   2980   H HG23 . THR A 1 203 ? 30.039  -8.174  7.629   0.04 14.81 ? 259  THR A HG23 1  
ATOM   2981   N N    . THR A 1 204 ? 25.737  -7.545  9.786   0.04 13.50 ? 260  THR A N    1  
ATOM   2982   C CA   . THR A 1 204 ? 24.893  -7.737  10.953  0.04 13.25 ? 260  THR A CA   1  
ATOM   2983   C C    . THR A 1 204 ? 25.391  -8.959  11.730  0.04 13.43 ? 260  THR A C    1  
ATOM   2984   O O    . THR A 1 204 ? 25.542  -10.029 11.151  0.04 13.58 ? 260  THR A O    1  
ATOM   2985   C CB   . THR A 1 204 ? 23.464  -7.931  10.479  0.04 12.96 ? 260  THR A CB   1  
ATOM   2986   O OG1  . THR A 1 204 ? 23.173  -6.947  9.476   0.04 12.85 ? 260  THR A OG1  1  
ATOM   2987   C CG2  . THR A 1 204 ? 22.469  -7.832  11.644  0.04 12.74 ? 260  THR A CG2  1  
ATOM   2988   H H    . THR A 1 204 ? 25.395  -7.871  9.069   0.04 13.54 ? 260  THR A H    1  
ATOM   2989   H HA   . THR A 1 204 ? 24.931  -6.943  11.502  0.04 13.18 ? 260  THR A HA   1  
ATOM   2990   H HB   . THR A 1 204 ? 23.371  -8.813  10.083  0.04 13.03 ? 260  THR A HB   1  
ATOM   2991   H HG1  . THR A 1 204 ? 22.897  -7.320  8.778   0.04 12.80 ? 260  THR A HG1  1  
ATOM   2992   H HG21 . THR A 1 204 ? 21.564  -7.722  11.315  0.04 12.58 ? 260  THR A HG21 1  
ATOM   2993   H HG22 . THR A 1 204 ? 22.512  -8.634  12.186  0.04 12.83 ? 260  THR A HG22 1  
ATOM   2994   H HG23 . THR A 1 204 ? 22.697  -7.073  12.203  0.04 12.70 ? 260  THR A HG23 1  
ATOM   2995   N N    . PRO A 1 205 ? 25.618  -8.819  13.052  0.04 13.43 ? 261  PRO A N    1  
ATOM   2996   C CA   . PRO A 1 205 ? 26.225  -9.946  13.751  0.04 13.71 ? 261  PRO A CA   1  
ATOM   2997   C C    . PRO A 1 205 ? 25.418  -11.254 13.718  0.04 13.72 ? 261  PRO A C    1  
ATOM   2998   O O    . PRO A 1 205 ? 26.016  -12.331 13.560  0.04 14.03 ? 261  PRO A O    1  
ATOM   2999   C CB   . PRO A 1 205 ? 26.417  -9.386  15.169  0.04 13.68 ? 261  PRO A CB   1  
ATOM   3000   C CG   . PRO A 1 205 ? 26.539  -7.917  15.016  0.04 13.54 ? 261  PRO A CG   1  
ATOM   3001   C CD   . PRO A 1 205 ? 25.558  -7.607  13.901  0.04 13.29 ? 261  PRO A CD   1  
ATOM   3002   H HA   . PRO A 1 205 ? 27.103  -10.128 13.370  0.04 13.95 ? 261  PRO A HA   1  
ATOM   3003   H HB2  . PRO A 1 205 ? 25.635  -9.606  15.701  0.04 13.52 ? 261  PRO A HB2  1  
ATOM   3004   H HB3  . PRO A 1 205 ? 27.228  -9.753  15.556  0.04 13.92 ? 261  PRO A HB3  1  
ATOM   3005   H HG2  . PRO A 1 205 ? 26.284  -7.475  15.840  0.04 13.44 ? 261  PRO A HG2  1  
ATOM   3006   H HG3  . PRO A 1 205 ? 27.449  -7.683  14.764  0.04 13.75 ? 261  PRO A HG3  1  
ATOM   3007   H HD2  . PRO A 1 205 ? 24.666  -7.495  14.267  0.04 13.08 ? 261  PRO A HD2  1  
ATOM   3008   H HD3  . PRO A 1 205 ? 25.845  -6.821  13.415  0.04 13.32 ? 261  PRO A HD3  1  
ATOM   3009   N N    . VAL A 1 206 ? 24.107  -11.154 13.909  0.04 13.44 ? 262  VAL A N    1  
ATOM   3010   C CA   . VAL A 1 206 ? 23.190  -12.281 13.717  0.04 13.44 ? 262  VAL A CA   1  
ATOM   3011   C C    . VAL A 1 206 ? 21.944  -11.696 13.134  0.04 13.13 ? 262  VAL A C    1  
ATOM   3012   O O    . VAL A 1 206 ? 21.540  -10.627 13.526  0.04 12.89 ? 262  VAL A O    1  
ATOM   3013   C CB   . VAL A 1 206 ? 22.871  -13.051 15.028  0.04 13.50 ? 262  VAL A CB   1  
ATOM   3014   C CG1  . VAL A 1 206 ? 22.290  -12.278 15.973  0.04 13.26 ? 262  VAL A CG1  1  
ATOM   3015   C CG2  . VAL A 1 206 ? 21.984  -14.309 14.785  0.04 13.61 ? 262  VAL A CG2  1  
ATOM   3016   H H    . VAL A 1 206 ? 23.716  -10.429 14.146  0.04 13.26 ? 262  VAL A H    1  
ATOM   3017   H HA   . VAL A 1 206 ? 23.558  -12.906 13.078  0.04 13.63 ? 262  VAL A HA   1  
ATOM   3018   H HB   . VAL A 1 206 ? 23.716  -13.363 15.410  0.04 13.72 ? 262  VAL A HB   1  
ATOM   3019   H HG11 . VAL A 1 206 ? 22.158  -12.832 16.761  0.04 13.34 ? 262  VAL A HG11 1  
ATOM   3020   H HG12 . VAL A 1 206 ? 22.901  -11.553 16.182  0.04 13.26 ? 262  VAL A HG12 1  
ATOM   3021   H HG13 . VAL A 1 206 ? 21.431  -11.940 15.659  0.04 13.05 ? 262  VAL A HG13 1  
ATOM   3022   H HG21 . VAL A 1 206 ? 21.805  -14.742 15.632  0.04 13.85 ? 262  VAL A HG21 1  
ATOM   3023   H HG22 . VAL A 1 206 ? 21.145  -14.041 14.374  0.04 13.45 ? 262  VAL A HG22 1  
ATOM   3024   H HG23 . VAL A 1 206 ? 22.457  -14.916 14.195  0.04 13.65 ? 262  VAL A HG23 1  
ATOM   3025   N N    . SER A 1 207 ? 21.374  -12.352 12.137  0.04 13.16 ? 263  SER A N    1  
ATOM   3026   C CA   . SER A 1 207 ? 20.025  -12.002 11.729  0.04 12.91 ? 263  SER A CA   1  
ATOM   3027   C C    . SER A 1 207 ? 19.292  -13.257 11.290  0.04 13.04 ? 263  SER A C    1  
ATOM   3028   O O    . SER A 1 207 ? 19.884  -14.300 11.020  0.04 13.32 ? 263  SER A O    1  
ATOM   3029   C CB   . SER A 1 207 ? 20.026  -10.946 10.622  0.04 12.79 ? 263  SER A CB   1  
ATOM   3030   O OG   . SER A 1 207 ? 20.683  -11.427 9.461   0.04 13.00 ? 263  SER A OG   1  
ATOM   3031   H H    . SER A 1 207 ? 21.731  -12.993 11.690  0.04 13.34 ? 263  SER A H    1  
ATOM   3032   H HA   . SER A 1 207 ? 19.547  -11.633 12.489  0.04 12.77 ? 263  SER A HA   1  
ATOM   3033   H HB2  . SER A 1 207 ? 19.115  -10.711 10.390  0.04 12.63 ? 263  SER A HB2  1  
ATOM   3034   H HB3  . SER A 1 207 ? 20.499  -10.162 10.941  0.04 12.74 ? 263  SER A HB3  1  
ATOM   3035   H HG   . SER A 1 207 ? 20.507  -10.922 8.814   0.04 12.94 ? 263  SER A HG   1  
ATOM   3036   N N    . ARG A 1 208 ? 17.978  -13.180 11.309  0.04 12.87 ? 264  ARG A N    1  
ATOM   3037   C CA   . ARG A 1 208 ? 17.149  -14.277 10.842  0.04 13.01 ? 264  ARG A CA   1  
ATOM   3038   C C    . ARG A 1 208 ? 15.955  -13.611 10.187  0.04 12.81 ? 264  ARG A C    1  
ATOM   3039   O O    . ARG A 1 208 ? 15.284  -12.785 10.814  0.04 12.60 ? 264  ARG A O    1  
ATOM   3040   C CB   . ARG A 1 208 ? 16.735  -15.167 12.003  0.04 13.12 ? 264  ARG A CB   1  
ATOM   3041   C CG   . ARG A 1 208 ? 16.021  -16.456 11.566  0.04 13.33 ? 264  ARG A CG   1  
ATOM   3042   C CD   . ARG A 1 208 ? 15.866  -17.429 12.735  0.04 13.52 ? 264  ARG A CD   1  
ATOM   3043   N NE   . ARG A 1 208 ? 15.000  -16.810 13.759  0.04 13.32 ? 264  ARG A NE   1  
ATOM   3044   C CZ   . ARG A 1 208 ? 15.012  -17.148 15.053  0.04 13.43 ? 264  ARG A CZ   1  
ATOM   3045   N NH1  . ARG A 1 208 ? 15.797  -18.105 15.493  0.04 13.74 ? 264  ARG A NH1  1  
ATOM   3046   N NH2  . ARG A 1 208 ? 14.210  -16.517 15.913  0.04 13.25 ? 264  ARG A NH2  1  
ATOM   3047   H H    . ARG A 1 208 ? 17.540  -12.498 11.579  0.04 12.70 ? 264  ARG A H    1  
ATOM   3048   H HA   . ARG A 1 208 ? 17.629  -14.816 10.193  0.04 13.18 ? 264  ARG A HA   1  
ATOM   3049   H HB2  . ARG A 1 208 ? 17.528  -15.413 12.504  0.04 13.26 ? 264  ARG A HB2  1  
ATOM   3050   H HB3  . ARG A 1 208 ? 16.134  -14.669 12.579  0.04 12.96 ? 264  ARG A HB3  1  
ATOM   3051   H HG2  . ARG A 1 208 ? 15.129  -16.237 11.252  0.04 13.21 ? 264  ARG A HG2  1  
ATOM   3052   H HG3  . ARG A 1 208 ? 16.523  -16.904 10.866  0.04 13.49 ? 264  ARG A HG3  1  
ATOM   3053   H HD2  . ARG A 1 208 ? 15.471  -18.264 12.439  0.04 13.67 ? 264  ARG A HD2  1  
ATOM   3054   H HD3  . ARG A 1 208 ? 16.736  -17.592 13.131  0.04 13.67 ? 264  ARG A HD3  1  
ATOM   3055   H HE   . ARG A 1 208 ? 14.314  -16.384 13.480  0.04 13.12 ? 264  ARG A HE   1  
ATOM   3056   H HH11 . ARG A 1 208 ? 16.320  -18.516 14.950  0.04 13.88 ? 264  ARG A HH11 1  
ATOM   3057   H HH12 . ARG A 1 208 ? 15.792  -18.319 16.325  0.04 13.83 ? 264  ARG A HH12 1  
ATOM   3058   H HH21 . ARG A 1 208 ? 13.689  -15.895 15.632  0.04 13.07 ? 264  ARG A HH21 1  
ATOM   3059   H HH22 . ARG A 1 208 ? 14.210  -16.742 16.743  0.04 13.34 ? 264  ARG A HH22 1  
ATOM   3060   N N    . GLU A 1 209 ? 15.698  -13.915 8.918   0.04 12.89 ? 265  GLU A N    1  
ATOM   3061   C CA   . GLU A 1 209 ? 14.659  -13.190 8.222   0.04 12.74 ? 265  GLU A CA   1  
ATOM   3062   C C    . GLU A 1 209 ? 13.294  -13.589 8.738   0.04 12.71 ? 265  GLU A C    1  
ATOM   3063   O O    . GLU A 1 209 ? 13.072  -14.732 9.213   0.04 12.88 ? 265  GLU A O    1  
ATOM   3064   C CB   . GLU A 1 209 ? 14.750  -13.342 6.710   0.04 12.88 ? 265  GLU A CB   1  
ATOM   3065   C CG   . GLU A 1 209 ? 16.100  -12.986 6.139   0.04 12.96 ? 265  GLU A CG   1  
ATOM   3066   C CD   . GLU A 1 209 ? 16.527  -11.558 6.494   0.04 12.73 ? 265  GLU A CD   1  
ATOM   3067   O OE1  . GLU A 1 209 ? 15.669  -10.695 6.758   0.04 12.52 ? 265  GLU A OE1  1  
ATOM   3068   O OE2  . GLU A 1 209 ? 17.749  -11.325 6.524   0.04 12.81 ? 265  GLU A OE2  1  
ATOM   3069   H H    . GLU A 1 209 ? 16.099  -14.520 8.462   0.04 13.06 ? 265  GLU A H    1  
ATOM   3070   H HA   . GLU A 1 209 ? 14.766  -12.248 8.419   0.04 12.57 ? 265  GLU A HA   1  
ATOM   3071   H HB2  . GLU A 1 209 ? 14.555  -14.263 6.479   0.04 13.05 ? 265  GLU A HB2  1  
ATOM   3072   H HB3  . GLU A 1 209 ? 14.099  -12.747 6.313   0.04 12.78 ? 265  GLU A HB3  1  
ATOM   3073   H HG2  . GLU A 1 209 ? 16.760  -13.593 6.499   0.04 13.08 ? 265  GLU A HG2  1  
ATOM   3074   H HG3  . GLU A 1 209 ? 16.067  -13.067 5.173   0.04 13.06 ? 265  GLU A HG3  1  
ATOM   3075   N N    . LYS A 1 210 ? 12.394  -12.621 8.706   0.04 12.52 ? 266  LYS A N    1  
ATOM   3076   C CA   . LYS A 1 210 ? 11.054  -12.806 9.259   0.04 12.50 ? 266  LYS A CA   1  
ATOM   3077   C C    . LYS A 1 210 ? 10.250  -13.854 8.476   0.04 12.73 ? 266  LYS A C    1  
ATOM   3078   O O    . LYS A 1 210 ? 10.233  -13.844 7.245   0.04 12.82 ? 266  LYS A O    1  
ATOM   3079   C CB   . LYS A 1 210 ? 10.329  -11.468 9.241   0.04 12.29 ? 266  LYS A CB   1  
ATOM   3080   C CG   . LYS A 1 210 ? 8.994   -11.490 9.955   0.04 12.28 ? 266  LYS A CG   1  
ATOM   3081   C CD   . LYS A 1 210 ? 8.155   -10.233 9.665   0.04 12.17 ? 266  LYS A CD   1  
ATOM   3082   C CE   . LYS A 1 210 ? 7.708   -10.168 8.247   0.04 12.26 ? 266  LYS A CE   1  
ATOM   3083   N NZ   . LYS A 1 210 ? 6.671   -11.192 7.831   0.04 12.48 ? 266  LYS A NZ   1  
ATOM   3084   H H    . LYS A 1 210 ? 12.525  -11.852 8.350   0.04 12.42 ? 266  LYS A H    1  
ATOM   3085   H HA   . LYS A 1 210 ? 11.149  -13.100 10.171  0.04 12.50 ? 266  LYS A HA   1  
ATOM   3086   H HB2  . LYS A 1 210 ? 10.893  -10.795 9.649   0.04 12.17 ? 266  LYS A HB2  1  
ATOM   3087   H HB3  . LYS A 1 210 ? 10.164  -11.241 8.313   0.04 12.32 ? 266  LYS A HB3  1  
ATOM   3088   H HG2  . LYS A 1 210 ? 8.486   -12.259 9.654   0.04 12.43 ? 266  LYS A HG2  1  
ATOM   3089   H HG3  . LYS A 1 210 ? 9.153   -11.536 10.909  0.04 12.22 ? 266  LYS A HG3  1  
ATOM   3090   H HD2  . LYS A 1 210 ? 7.344   -10.264 10.206  0.04 12.21 ? 266  LYS A HD2  1  
ATOM   3091   H HD3  . LYS A 1 210 ? 8.657   -9.431  9.869   0.04 12.03 ? 266  LYS A HD3  1  
ATOM   3092   H HE2  . LYS A 1 210 ? 7.285   -9.299  8.133   0.04 12.20 ? 266  LYS A HE2  1  
ATOM   3093   H HE3  . LYS A 1 210 ? 8.471   -10.226 7.654   0.04 12.25 ? 266  LYS A HE3  1  
ATOM   3094   H HZ1  . LYS A 1 210 ? 6.592   -11.189 6.951   0.04 12.55 ? 266  LYS A HZ1  1  
ATOM   3095   H HZ2  . LYS A 1 210 ? 6.922   -11.998 8.098   0.04 12.56 ? 266  LYS A HZ2  1  
ATOM   3096   H HZ3  . LYS A 1 210 ? 5.880   -11.008 8.180   0.04 12.51 ? 266  LYS A HZ3  1  
ATOM   3097   N N    . PRO A 1 211 ? 9.577   -14.794 9.187   0.04 12.87 ? 267  PRO A N    1  
ATOM   3098   C CA   . PRO A 1 211 ? 8.736   -15.741 8.455   0.04 13.12 ? 267  PRO A CA   1  
ATOM   3099   C C    . PRO A 1 211 ? 7.614   -15.033 7.682   0.04 13.08 ? 267  PRO A C    1  
ATOM   3100   O O    . PRO A 1 211 ? 7.190   -13.950 8.074   0.04 12.87 ? 267  PRO A O    1  
ATOM   3101   C CB   . PRO A 1 211 ? 8.159   -16.622 9.578   0.04 13.26 ? 267  PRO A CB   1  
ATOM   3102   C CG   . PRO A 1 211 ? 9.222   -16.552 10.656  0.04 13.15 ? 267  PRO A CG   1  
ATOM   3103   C CD   . PRO A 1 211 ? 9.652   -15.126 10.627  0.04 12.85 ? 267  PRO A CD   1  
ATOM   3104   H HA   . PRO A 1 211 ? 9.271   -16.270 7.853   0.04 13.26 ? 267  PRO A HA   1  
ATOM   3105   H HB2  . PRO A 1 211 ? 7.316   -16.259 9.891   0.04 13.21 ? 267  PRO A HB2  1  
ATOM   3106   H HB3  . PRO A 1 211 ? 8.048   -17.532 9.259   0.04 13.48 ? 267  PRO A HB3  1  
ATOM   3107   H HG2  . PRO A 1 211 ? 8.861   -16.802 11.521  0.04 13.16 ? 267  PRO A HG2  1  
ATOM   3108   H HG3  . PRO A 1 211 ? 9.964   -17.125 10.413  0.04 13.28 ? 267  PRO A HG3  1  
ATOM   3109   H HD2  . PRO A 1 211 ? 9.033   -14.576 11.128  0.04 12.72 ? 267  PRO A HD2  1  
ATOM   3110   H HD3  . PRO A 1 211 ? 10.557  -15.040 10.964  0.04 12.82 ? 267  PRO A HD3  1  
ATOM   3111   N N    . PHE A 1 212 ? 7.159   -15.653 6.604   0.04 13.32 ? 268  PHE A N    1  
ATOM   3112   C CA   . PHE A 1 212 ? 6.107   -15.087 5.754   0.04 13.35 ? 268  PHE A CA   1  
ATOM   3113   C C    . PHE A 1 212 ? 5.246   -16.169 5.103   0.04 13.69 ? 268  PHE A C    1  
ATOM   3114   O O    . PHE A 1 212 ? 5.702   -17.313 4.876   0.04 13.93 ? 268  PHE A O    1  
ATOM   3115   C CB   . PHE A 1 212 ? 6.707   -14.146 4.688   0.04 13.25 ? 268  PHE A CB   1  
ATOM   3116   C CG   . PHE A 1 212 ? 7.707   -14.825 3.783   0.04 13.43 ? 268  PHE A CG   1  
ATOM   3117   C CD1  . PHE A 1 212 ? 7.285   -15.431 2.587   0.04 13.72 ? 268  PHE A CD1  1  
ATOM   3118   C CD2  . PHE A 1 212 ? 9.044   -14.896 4.119   0.04 13.37 ? 268  PHE A CD2  1  
ATOM   3119   C CE1  . PHE A 1 212 ? 8.180   -16.055 1.759   0.04 13.92 ? 268  PHE A CE1  1  
ATOM   3120   C CE2  . PHE A 1 212 ? 9.931   -15.543 3.321   0.04 13.58 ? 268  PHE A CE2  1  
ATOM   3121   C CZ   . PHE A 1 212 ? 9.504   -16.130 2.121   0.04 13.86 ? 268  PHE A CZ   1  
ATOM   3122   H H    . PHE A 1 212 ? 7.438   -16.423 6.352   0.04 13.48 ? 268  PHE A H    1  
ATOM   3123   H HA   . PHE A 1 212 ? 5.520   -14.549 6.310   0.04 13.24 ? 268  PHE A HA   1  
ATOM   3124   H HB2  . PHE A 1 212 ? 5.986   -13.810 4.135   0.04 13.29 ? 268  PHE A HB2  1  
ATOM   3125   H HB3  . PHE A 1 212 ? 7.147   -13.417 5.152   0.04 13.05 ? 268  PHE A HB3  1  
ATOM   3126   H HD1  . PHE A 1 212 ? 6.389   -15.391 2.341   0.04 13.79 ? 268  PHE A HD1  1  
ATOM   3127   H HD2  . PHE A 1 212 ? 9.342   -14.516 4.914   0.04 13.20 ? 268  PHE A HD2  1  
ATOM   3128   H HE1  . PHE A 1 212 ? 7.887   -16.454 0.975   0.04 14.13 ? 268  PHE A HE1  1  
ATOM   3129   H HE2  . PHE A 1 212 ? 10.828  -15.574 3.560   0.04 13.56 ? 268  PHE A HE2  1  
ATOM   3130   H HZ   . PHE A 1 212 ? 10.113  -16.557 1.567   0.04 14.02 ? 268  PHE A HZ   1  
ATOM   3131   N N    . LEU A 1 213 ? 3.966   -15.839 4.855   0.04 13.76 ? 269  LEU A N    1  
ATOM   3132   C CA   . LEU A 1 213 ? 3.071   -16.720 4.112   0.04 14.12 ? 269  LEU A CA   1  
ATOM   3133   C C    . LEU A 1 213 ? 3.476   -16.814 2.640   0.04 14.29 ? 269  LEU A C    1  
ATOM   3134   O O    . LEU A 1 213 ? 4.003   -15.857 2.073   0.04 14.14 ? 269  LEU A O    1  
ATOM   3135   C CB   . LEU A 1 213 ? 1.639   -16.171 4.245   0.04 14.15 ? 269  LEU A CB   1  
ATOM   3136   C CG   . LEU A 1 213 ? 0.451   -16.990 3.745   0.04 14.55 ? 269  LEU A CG   1  
ATOM   3137   C CD1  . LEU A 1 213 ? 0.281   -18.258 4.600   0.04 14.75 ? 269  LEU A CD1  1  
ATOM   3138   C CD2  . LEU A 1 213 ? -0.878  -16.208 3.780   0.04 14.62 ? 269  LEU A CD2  1  
ATOM   3139   H H    . LEU A 1 213 ? 3.595   -15.112 5.119   0.04 13.63 ? 269  LEU A H    1  
ATOM   3140   H HA   . LEU A 1 213 ? 3.107   -17.617 4.482   0.04 14.27 ? 269  LEU A HA   1  
ATOM   3141   H HB2  . LEU A 1 213 ? 1.487   -16.012 5.190   0.04 14.04 ? 269  LEU A HB2  1  
ATOM   3142   H HB3  . LEU A 1 213 ? 1.612   -15.320 3.782   0.04 14.04 ? 269  LEU A HB3  1  
ATOM   3143   H HG   . LEU A 1 213 ? 0.615   -17.258 2.827   0.04 14.70 ? 269  LEU A HG   1  
ATOM   3144   H HD11 . LEU A 1 213 ? -0.656  -18.508 4.593   0.04 14.93 ? 269  LEU A HD11 1  
ATOM   3145   H HD12 . LEU A 1 213 ? 0.811   -18.972 4.229   0.04 14.91 ? 269  LEU A HD12 1  
ATOM   3146   H HD13 . LEU A 1 213 ? 0.555   -18.057 5.509   0.04 14.56 ? 269  LEU A HD13 1  
ATOM   3147   H HD21 . LEU A 1 213 ? -1.597  -16.801 3.516   0.04 14.90 ? 269  LEU A HD21 1  
ATOM   3148   H HD22 . LEU A 1 213 ? -1.031  -15.893 4.683   0.04 14.52 ? 269  LEU A HD22 1  
ATOM   3149   H HD23 . LEU A 1 213 ? -0.831  -15.455 3.170   0.04 14.50 ? 269  LEU A HD23 1  
ATOM   3150   N N    . TYR A 1 214 ? 3.276   -17.977 2.021   0.04 14.63 ? 270  TYR A N    1  
ATOM   3151   C CA   . TYR A 1 214 ? 3.527   -18.133 0.579   0.04 14.86 ? 270  TYR A CA   1  
ATOM   3152   C C    . TYR A 1 214 ? 2.862   -19.392 0.064   0.04 15.30 ? 270  TYR A C    1  
ATOM   3153   O O    . TYR A 1 214 ? 2.625   -20.332 0.829   0.04 15.43 ? 270  TYR A O    1  
ATOM   3154   C CB   . TYR A 1 214 ? 5.022   -18.120 0.229   0.04 14.78 ? 270  TYR A CB   1  
ATOM   3155   C CG   . TYR A 1 214 ? 5.729   -19.433 0.448   0.04 15.08 ? 270  TYR A CG   1  
ATOM   3156   C CD1  . TYR A 1 214 ? 5.874   -19.981 1.723   0.04 15.06 ? 270  TYR A CD1  1  
ATOM   3157   C CD2  . TYR A 1 214 ? 6.286   -20.125 -0.621  0.04 15.41 ? 270  TYR A CD2  1  
ATOM   3158   C CE1  . TYR A 1 214 ? 6.530   -21.196 1.915   0.04 15.38 ? 270  TYR A CE1  1  
ATOM   3159   C CE2  . TYR A 1 214 ? 6.944   -21.336 -0.455  0.04 15.73 ? 270  TYR A CE2  1  
ATOM   3160   C CZ   . TYR A 1 214 ? 7.080   -21.873 0.826   0.04 15.72 ? 270  TYR A CZ   1  
ATOM   3161   O OH   . TYR A 1 214 ? 7.732   -23.094 0.975   0.04 16.05 ? 270  TYR A OH   1  
ATOM   3162   H H    . TYR A 1 214 ? 2.993   -18.688 2.408   0.04 14.77 ? 270  TYR A H    1  
ATOM   3163   H HA   . TYR A 1 214 ? 3.119   -17.389 0.108   0.04 14.80 ? 270  TYR A HA   1  
ATOM   3164   H HB2  . TYR A 1 214 ? 5.107   -17.894 -0.706  0.04 14.80 ? 270  TYR A HB2  1  
ATOM   3165   H HB3  . TYR A 1 214 ? 5.463   -17.443 0.764   0.04 14.53 ? 270  TYR A HB3  1  
ATOM   3166   H HD1  . TYR A 1 214 ? 5.515   -19.536 2.457   0.04 14.86 ? 270  TYR A HD1  1  
ATOM   3167   H HD2  . TYR A 1 214 ? 6.204   -19.772 -1.479  0.04 15.45 ? 270  TYR A HD2  1  
ATOM   3168   H HE1  . TYR A 1 214 ? 6.611   -21.548 2.774   0.04 15.40 ? 270  TYR A HE1  1  
ATOM   3169   H HE2  . TYR A 1 214 ? 7.299   -21.775 -1.192  0.04 15.97 ? 270  TYR A HE2  1  
ATOM   3170   H HH   . TYR A 1 214 ? 7.395   -23.532 1.608   0.04 15.99 ? 270  TYR A HH   1  
ATOM   3171   N N    . LEU A 1 215 ? 2.515   -19.367 -1.221  0.04 15.56 ? 271  LEU A N    1  
ATOM   3172   C CA   . LEU A 1 215 ? 1.917   -20.500 -1.942  0.04 16.05 ? 271  LEU A CA   1  
ATOM   3173   C C    . LEU A 1 215 ? 2.896   -21.554 -2.467  0.04 16.26 ? 271  LEU A C    1  
ATOM   3174   O O    . LEU A 1 215 ? 3.957   -21.248 -2.992  0.04 16.20 ? 271  LEU A O    1  
ATOM   3175   C CB   . LEU A 1 215 ? 1.123   -19.986 -3.139  0.04 16.28 ? 271  LEU A CB   1  
ATOM   3176   C CG   . LEU A 1 215 ? -0.350  -19.612 -2.961  0.04 16.30 ? 271  LEU A CG   1  
ATOM   3177   C CD1  . LEU A 1 215 ? -0.735  -18.477 -3.896  0.04 16.42 ? 271  LEU A CD1  1  
ATOM   3178   C CD2  . LEU A 1 215 ? -1.304  -20.781 -3.151  0.04 16.72 ? 271  LEU A CD2  1  
ATOM   3179   H H    . LEU A 1 215 ? 2.612   -18.670 -1.713  0.04 15.49 ? 271  LEU A H    1  
ATOM   3180   H HA   . LEU A 1 215 ? 1.298   -20.946 -1.344  0.04 16.14 ? 271  LEU A HA   1  
ATOM   3181   H HB2  . LEU A 1 215 ? 1.569   -19.197 -3.482  0.04 16.15 ? 271  LEU A HB2  1  
ATOM   3182   H HB3  . LEU A 1 215 ? 1.159   -20.673 -3.822  0.04 16.61 ? 271  LEU A HB3  1  
ATOM   3183   H HG   . LEU A 1 215 ? -0.459  -19.289 -2.052  0.04 16.02 ? 271  LEU A HG   1  
ATOM   3184   H HD11 . LEU A 1 215 ? -1.602  -18.137 -3.626  0.04 16.37 ? 271  LEU A HD11 1  
ATOM   3185   H HD12 . LEU A 1 215 ? -0.075  -17.771 -3.824  0.04 16.22 ? 271  LEU A HD12 1  
ATOM   3186   H HD13 . LEU A 1 215 ? -0.773  -18.803 -4.808  0.04 16.75 ? 271  LEU A HD13 1  
ATOM   3187   H HD21 . LEU A 1 215 ? -2.116  -20.601 -2.650  0.04 16.85 ? 271  LEU A HD21 1  
ATOM   3188   H HD22 . LEU A 1 215 ? -1.528  -20.868 -4.082  0.04 16.98 ? 271  LEU A HD22 1  
ATOM   3189   H HD23 . LEU A 1 215 ? -0.888  -21.584 -2.804  0.04 16.61 ? 271  LEU A HD23 1  
ATOM   3190   N N    . ASP A 1 216 ? 2.525   -22.813 -2.299  0.04 16.53 ? 272  ASP A N    1  
ATOM   3191   C CA   . ASP A 1 216 ? 3.152   -23.893 -3.040  0.04 16.85 ? 272  ASP A CA   1  
ATOM   3192   C C    . ASP A 1 216 ? 2.113   -24.369 -4.024  0.04 17.35 ? 272  ASP A C    1  
ATOM   3193   O O    . ASP A 1 216 ? 1.125   -25.029 -3.654  0.04 17.63 ? 272  ASP A O    1  
ATOM   3194   C CB   . ASP A 1 216 ? 3.565   -25.036 -2.125  0.04 16.85 ? 272  ASP A CB   1  
ATOM   3195   C CG   . ASP A 1 216 ? 5.069   -25.240 -2.085  0.04 17.00 ? 272  ASP A CG   1  
ATOM   3196   O OD1  . ASP A 1 216 ? 5.712   -24.466 -1.394  0.04 16.71 ? 272  ASP A OD1  1  
ATOM   3197   O OD2  . ASP A 1 216 ? 5.609   -26.148 -2.728  0.04 17.46 ? 272  ASP A OD2  1  
ATOM   3198   H H    . ASP A 1 216 ? 1.919   -23.066 -1.745  0.04 16.55 ? 272  ASP A H    1  
ATOM   3199   H HA   . ASP A 1 216 ? 3.928   -23.582 -3.535  0.04 16.78 ? 272  ASP A HA   1  
ATOM   3200   H HB2  . ASP A 1 216 ? 3.318   -24.794 -1.218  0.04 16.53 ? 272  ASP A HB2  1  
ATOM   3201   H HB3  . ASP A 1 216 ? 3.131   -25.859 -2.384  0.04 17.10 ? 272  ASP A HB3  1  
ATOM   3202   N N    . GLY A 1 217 ? 2.352   -24.005 -5.278  0.04 17.48 ? 273  GLY A N    1  
ATOM   3203   C CA   . GLY A 1 217 ? 1.284   -23.903 -6.232  0.04 17.98 ? 273  GLY A CA   1  
ATOM   3204   C C    . GLY A 1 217 ? 0.143   -23.333 -5.430  0.04 17.97 ? 273  GLY A C    1  
ATOM   3205   O O    . GLY A 1 217 ? 0.000   -22.114 -5.301  0.04 17.81 ? 273  GLY A O    1  
ATOM   3206   H H    . GLY A 1 217 ? 3.132   -23.823 -5.593  0.04 17.30 ? 273  GLY A H    1  
ATOM   3207   H HA2  . GLY A 1 217 ? 1.518   -23.291 -6.947  0.04 18.09 ? 273  GLY A HA2  1  
ATOM   3208   H HA3  . GLY A 1 217 ? 1.052   -24.778 -6.585  0.04 18.26 ? 273  GLY A HA3  1  
ATOM   3209   N N    . ASP A 1 218 ? -0.589  -24.248 -4.801  0.04 18.21 ? 274  ASP A N    1  
ATOM   3210   C CA   . ASP A 1 218 ? -1.833  -23.963 -4.113  0.04 18.28 ? 274  ASP A CA   1  
ATOM   3211   C C    . ASP A 1 218 ? -1.865  -24.536 -2.679  0.04 18.07 ? 274  ASP A C    1  
ATOM   3212   O O    . ASP A 1 218 ? -2.927  -24.948 -2.171  0.04 18.25 ? 274  ASP A O    1  
ATOM   3213   C CB   . ASP A 1 218 ? -2.943  -24.618 -4.919  0.04 18.91 ? 274  ASP A CB   1  
ATOM   3214   C CG   . ASP A 1 218 ? -2.607  -24.721 -6.386  0.04 19.19 ? 274  ASP A CG   1  
ATOM   3215   O OD1  . ASP A 1 218 ? -2.535  -25.862 -6.882  0.04 19.18 ? 274  ASP A OD1  1  
ATOM   3216   O OD2  . ASP A 1 218 ? -2.454  -23.684 -7.054  0.04 19.49 ? 274  ASP A OD2  1  
ATOM   3217   H H    . ASP A 1 218 ? -0.370  -25.081 -4.761  0.04 18.35 ? 274  ASP A H    1  
ATOM   3218   H HA   . ASP A 1 218 ? -2.005  -23.014 -4.094  0.04 18.07 ? 274  ASP A HA   1  
ATOM   3219   H HB2  . ASP A 1 218 ? -3.082  -25.517 -4.582  0.04 19.13 ? 274  ASP A HB2  1  
ATOM   3220   H HB3  . ASP A 1 218 ? -3.754  -24.093 -4.828  0.04 18.97 ? 274  ASP A HB3  1  
ATOM   3221   N N    . ASP A 1 219 ? -0.730  -24.646 -2.026  0.04 17.75 ? 275  ASP A N    1  
ATOM   3222   C CA   . ASP A 1 219 ? -0.785  -24.922 -0.594  0.04 17.55 ? 275  ASP A CA   1  
ATOM   3223   C C    . ASP A 1 219 ? -0.265  -23.738 0.238   0.04 16.96 ? 275  ASP A C    1  
ATOM   3224   O O    . ASP A 1 219 ? 0.915   -23.409 0.177   0.04 16.70 ? 275  ASP A O    1  
ATOM   3225   C CB   . ASP A 1 219 ? -0.024  -26.211 -0.247  0.04 17.78 ? 275  ASP A CB   1  
ATOM   3226   C CG   . ASP A 1 219 ? -0.826  -27.480 -0.579  0.04 18.41 ? 275  ASP A CG   1  
ATOM   3227   O OD1  . ASP A 1 219 ? -2.065  -27.392 -0.804  0.04 18.65 ? 275  ASP A OD1  1  
ATOM   3228   O OD2  . ASP A 1 219 ? -0.194  -28.558 -0.601  0.04 18.70 ? 275  ASP A OD2  1  
ATOM   3229   H H    . ASP A 1 219 ? 0.058   -24.575 -2.361  0.04 17.65 ? 275  ASP A H    1  
ATOM   3230   H HA   . ASP A 1 219 ? -1.700  -25.061 -0.309  0.04 17.70 ? 275  ASP A HA   1  
ATOM   3231   H HB2  . ASP A 1 219 ? 0.811   -26.237 -0.741  0.04 17.70 ? 275  ASP A HB2  1  
ATOM   3232   H HB3  . ASP A 1 219 ? 0.156   -26.227 0.704   0.04 17.64 ? 275  ASP A HB3  1  
ATOM   3233   N N    . TYR A 1 220 ? -1.133  -23.111 1.033   0.04 16.76 ? 276  TYR A N    1  
ATOM   3234   C CA   . TYR A 1 220 ? -0.658  -22.114 1.977   0.04 16.24 ? 276  TYR A CA   1  
ATOM   3235   C C    . TYR A 1 220 ? 0.359   -22.818 2.854   0.04 16.14 ? 276  TYR A C    1  
ATOM   3236   O O    . TYR A 1 220 ? 0.101   -23.931 3.369   0.04 16.42 ? 276  TYR A O    1  
ATOM   3237   C CB   . TYR A 1 220 ? -1.804  -21.459 2.779   0.04 16.11 ? 276  TYR A CB   1  
ATOM   3238   C CG   . TYR A 1 220 ? -2.556  -20.445 1.935   0.04 16.13 ? 276  TYR A CG   1  
ATOM   3239   C CD1  . TYR A 1 220 ? -1.953  -19.238 1.567   0.04 15.75 ? 276  TYR A CD1  1  
ATOM   3240   C CD2  . TYR A 1 220 ? -3.841  -20.714 1.464   0.04 16.58 ? 276  TYR A CD2  1  
ATOM   3241   C CE1  . TYR A 1 220 ? -2.613  -18.330 0.777   0.04 15.82 ? 276  TYR A CE1  1  
ATOM   3242   C CE2  . TYR A 1 220 ? -4.506  -19.799 0.647   0.04 16.66 ? 276  TYR A CE2  1  
ATOM   3243   C CZ   . TYR A 1 220 ? -3.874  -18.617 0.322   0.04 16.27 ? 276  TYR A CZ   1  
ATOM   3244   O OH   . TYR A 1 220 ? -4.475  -17.686 -0.471  0.04 16.37 ? 276  TYR A OH   1  
ATOM   3245   H H    . TYR A 1 220 ? -1.984  -23.240 1.042   0.04 16.93 ? 276  TYR A H    1  
ATOM   3246   H HA   . TYR A 1 220 ? -0.198  -21.414 1.490   0.04 16.07 ? 276  TYR A HA   1  
ATOM   3247   H HB2  . TYR A 1 220 ? -2.429  -22.148 3.058   0.04 16.34 ? 276  TYR A HB2  1  
ATOM   3248   H HB3  . TYR A 1 220 ? -1.440  -20.996 3.549   0.04 15.80 ? 276  TYR A HB3  1  
ATOM   3249   H HD1  . TYR A 1 220 ? -1.093  -19.045 1.863   0.04 15.47 ? 276  TYR A HD1  1  
ATOM   3250   H HD2  . TYR A 1 220 ? -4.249  -21.519 1.684   0.04 16.86 ? 276  TYR A HD2  1  
ATOM   3251   H HE1  . TYR A 1 220 ? -2.200  -17.533 0.538   0.04 15.59 ? 276  TYR A HE1  1  
ATOM   3252   H HE2  . TYR A 1 220 ? -5.364  -19.970 0.334   0.04 16.98 ? 276  TYR A HE2  1  
ATOM   3253   H HH   . TYR A 1 220 ? -4.883  -18.067 -1.101  0.04 16.66 ? 276  TYR A HH   1  
ATOM   3254   N N    . LYS A 1 221 ? 1.552   -22.226 2.900   0.04 15.78 ? 277  LYS A N    1  
ATOM   3255   C CA   . LYS A 1 221 ? 2.594   -22.579 3.856   0.04 15.65 ? 277  LYS A CA   1  
ATOM   3256   C C    . LYS A 1 221 ? 3.123   -21.294 4.453   0.04 15.16 ? 277  LYS A C    1  
ATOM   3257   O O    . LYS A 1 221 ? 2.728   -20.197 4.058   0.04 14.96 ? 277  LYS A O    1  
ATOM   3258   C CB   . LYS A 1 221 ? 3.761   -23.260 3.175   0.04 15.89 ? 277  LYS A CB   1  
ATOM   3259   C CG   . LYS A 1 221 ? 3.391   -24.570 2.514   0.04 16.36 ? 277  LYS A CG   1  
ATOM   3260   C CD   . LYS A 1 221 ? 4.579   -25.442 2.195   0.04 16.70 ? 277  LYS A CD   1  
ATOM   3261   C CE   . LYS A 1 221 ? 4.134   -26.673 1.438   0.04 17.26 ? 277  LYS A CE   1  
ATOM   3262   N NZ   . LYS A 1 221 ? 5.302   -27.507 1.099   0.04 17.63 ? 277  LYS A NZ   1  
ATOM   3263   H H    . LYS A 1 221 ? 1.793   -21.601 2.363   0.04 15.63 ? 277  LYS A H    1  
ATOM   3264   H HA   . LYS A 1 221 ? 2.248   -23.163 4.550   0.04 15.75 ? 277  LYS A HA   1  
ATOM   3265   H HB2  . LYS A 1 221 ? 4.110   -22.666 2.492   0.04 15.71 ? 277  LYS A HB2  1  
ATOM   3266   H HB3  . LYS A 1 221 ? 4.448   -23.442 3.832   0.04 15.96 ? 277  LYS A HB3  1  
ATOM   3267   H HG2  . LYS A 1 221 ? 2.811   -25.070 3.108   0.04 16.54 ? 277  LYS A HG2  1  
ATOM   3268   H HG3  . LYS A 1 221 ? 2.923   -24.385 1.685   0.04 16.31 ? 277  LYS A HG3  1  
ATOM   3269   H HD2  . LYS A 1 221 ? 5.211   -24.957 1.641   0.04 16.61 ? 277  LYS A HD2  1  
ATOM   3270   H HD3  . LYS A 1 221 ? 4.998   -25.734 3.020   0.04 16.69 ? 277  LYS A HD3  1  
ATOM   3271   H HE2  . LYS A 1 221 ? 3.530   -27.197 1.992   0.04 17.40 ? 277  LYS A HE2  1  
ATOM   3272   H HE3  . LYS A 1 221 ? 3.693   -26.412 0.614   0.04 17.28 ? 277  LYS A HE3  1  
ATOM   3273   H HZ1  . LYS A 1 221 ? 5.033   -28.298 0.790   0.04 17.96 ? 277  LYS A HZ1  1  
ATOM   3274   H HZ2  . LYS A 1 221 ? 5.793   -27.105 0.474   0.04 17.65 ? 277  LYS A HZ2  1  
ATOM   3275   H HZ3  . LYS A 1 221 ? 5.800   -27.636 1.827   0.04 17.52 ? 277  LYS A HZ3  1  
ATOM   3276   N N    . VAL A 1 222 ? 4.050   -21.449 5.385   0.04 14.99 ? 278  VAL A N    1  
ATOM   3277   C CA   . VAL A 1 222 ? 4.818   -20.342 5.895   0.04 14.58 ? 278  VAL A CA   1  
ATOM   3278   C C    . VAL A 1 222 ? 6.300   -20.706 5.810   0.04 14.59 ? 278  VAL A C    1  
ATOM   3279   O O    . VAL A 1 222 ? 6.706   -21.762 6.300   0.04 14.81 ? 278  VAL A O    1  
ATOM   3280   C CB   . VAL A 1 222 ? 4.429   -20.061 7.349   0.04 14.40 ? 278  VAL A CB   1  
ATOM   3281   C CG1  . VAL A 1 222 ? 5.402   -19.093 8.006   0.04 14.03 ? 278  VAL A CG1  1  
ATOM   3282   C CG2  . VAL A 1 222 ? 2.987   -19.523 7.454   0.04 14.41 ? 278  VAL A CG2  1  
ATOM   3283   H H    . VAL A 1 222 ? 4.254   -22.205 5.737   0.04 15.13 ? 278  VAL A H    1  
ATOM   3284   H HA   . VAL A 1 222 ? 4.653   -19.551 5.359   0.04 14.43 ? 278  VAL A HA   1  
ATOM   3285   H HB   . VAL A 1 222 ? 4.469   -20.901 7.831   0.04 14.58 ? 278  VAL A HB   1  
ATOM   3286   H HG11 . VAL A 1 222 ? 5.038   -18.834 8.865   0.04 13.92 ? 278  VAL A HG11 1  
ATOM   3287   H HG12 . VAL A 1 222 ? 6.257   -19.531 8.134   0.04 14.07 ? 278  VAL A HG12 1  
ATOM   3288   H HG13 . VAL A 1 222 ? 5.503   -18.311 7.440   0.04 13.88 ? 278  VAL A HG13 1  
ATOM   3289   H HG21 . VAL A 1 222 ? 2.688   -19.570 8.374   0.04 14.43 ? 278  VAL A HG21 1  
ATOM   3290   H HG22 . VAL A 1 222 ? 2.974   -18.602 7.154   0.04 14.19 ? 278  VAL A HG22 1  
ATOM   3291   H HG23 . VAL A 1 222 ? 2.415   -20.064 6.888   0.04 14.64 ? 278  VAL A HG23 1  
ATOM   3292   N N    . PHE A 1 223 ? 7.102   -19.827 5.207   0.04 14.39 ? 279  PHE A N    1  
ATOM   3293   C CA   . PHE A 1 223 ? 8.534   -20.048 5.101   0.04 14.41 ? 279  PHE A CA   1  
ATOM   3294   C C    . PHE A 1 223 ? 9.171   -19.501 6.347   0.04 14.13 ? 279  PHE A C    1  
ATOM   3295   O O    . PHE A 1 223 ? 8.851   -18.377 6.752   0.04 13.82 ? 279  PHE A O    1  
ATOM   3296   C CB   . PHE A 1 223 ? 9.138   -19.374 3.866   0.04 14.38 ? 279  PHE A CB   1  
ATOM   3297   C CG   . PHE A 1 223 ? 10.541  -19.819 3.579   0.04 14.49 ? 279  PHE A CG   1  
ATOM   3298   C CD1  . PHE A 1 223 ? 10.809  -21.129 3.183   0.04 14.88 ? 279  PHE A CD1  1  
ATOM   3299   C CD2  . PHE A 1 223 ? 11.589  -18.963 3.741   0.04 14.27 ? 279  PHE A CD2  1  
ATOM   3300   C CE1  . PHE A 1 223 ? 12.093  -21.545 2.955   0.04 15.03 ? 279  PHE A CE1  1  
ATOM   3301   C CE2  . PHE A 1 223 ? 12.885  -19.380 3.489   0.04 14.42 ? 279  PHE A CE2  1  
ATOM   3302   C CZ   . PHE A 1 223 ? 13.122  -20.696 3.098   0.04 14.81 ? 279  PHE A CZ   1  
ATOM   3303   H H    . PHE A 1 223 ? 6.833   -19.098 4.851   0.04 14.28 ? 279  PHE A H    1  
ATOM   3304   H HA   . PHE A 1 223 ? 8.714   -21.000 5.050   0.04 14.66 ? 279  PHE A HA   1  
ATOM   3305   H HB2  . PHE A 1 223 ? 8.589   -19.573 3.089   0.04 14.55 ? 279  PHE A HB2  1  
ATOM   3306   H HB3  . PHE A 1 223 ? 9.162   -18.417 4.023   0.04 14.13 ? 279  PHE A HB3  1  
ATOM   3307   H HD1  . PHE A 1 223 ? 10.111  -21.732 3.080   0.04 15.06 ? 279  PHE A HD1  1  
ATOM   3308   H HD2  . PHE A 1 223 ? 11.432  -18.085 4.004   0.04 14.03 ? 279  PHE A HD2  1  
ATOM   3309   H HE1  . PHE A 1 223 ? 12.251  -22.422 2.684   0.04 15.31 ? 279  PHE A HE1  1  
ATOM   3310   H HE2  . PHE A 1 223 ? 13.589  -18.784 3.599   0.04 14.29 ? 279  PHE A HE2  1  
ATOM   3311   H HZ   . PHE A 1 223 ? 13.992  -20.987 2.927   0.04 14.94 ? 279  PHE A HZ   1  
ATOM   3312   N N    . VAL A 1 224 ? 10.077  -20.291 6.945   0.04 14.29 ? 280  VAL A N    1  
ATOM   3313   C CA   . VAL A 1 224 ? 10.763  -19.924 8.198   0.04 14.12 ? 280  VAL A CA   1  
ATOM   3314   C C    . VAL A 1 224 ? 12.290  -19.891 7.946   0.04 14.16 ? 280  VAL A C    1  
ATOM   3315   O O    . VAL A 1 224 ? 13.010  -20.852 8.228   0.04 14.46 ? 280  VAL A O    1  
ATOM   3316   C CB   . VAL A 1 224 ? 10.467  -20.930 9.318   0.04 14.34 ? 280  VAL A CB   1  
ATOM   3317   C CG1  . VAL A 1 224 ? 10.929  -20.380 10.658  0.04 14.20 ? 280  VAL A CG1  1  
ATOM   3318   C CG2  . VAL A 1 224 ? 8.998   -21.226 9.389   0.04 14.35 ? 280  VAL A CG2  1  
ATOM   3319   H H    . VAL A 1 224 ? 10.309  -21.059 6.643   0.04 14.53 ? 280  VAL A H    1  
ATOM   3320   H HA   . VAL A 1 224 ? 10.465  -19.057 8.507   0.04 13.88 ? 280  VAL A HA   1  
ATOM   3321   H HB   . VAL A 1 224 ? 10.937  -21.755 9.130   0.04 14.61 ? 280  VAL A HB   1  
ATOM   3322   H HG11 . VAL A 1 224 ? 10.813  -21.068 11.328  0.04 14.37 ? 280  VAL A HG11 1  
ATOM   3323   H HG12 . VAL A 1 224 ? 11.863  -20.125 10.605  0.04 14.24 ? 280  VAL A HG12 1  
ATOM   3324   H HG13 . VAL A 1 224 ? 10.383  -19.609 10.881  0.04 13.95 ? 280  VAL A HG13 1  
ATOM   3325   H HG21 . VAL A 1 224 ? 8.835   -21.821 10.139  0.04 14.50 ? 280  VAL A HG21 1  
ATOM   3326   H HG22 . VAL A 1 224 ? 8.515   -20.392 9.514   0.04 14.10 ? 280  VAL A HG22 1  
ATOM   3327   H HG23 . VAL A 1 224 ? 8.709   -21.660 8.573   0.04 14.47 ? 280  VAL A HG23 1  
ATOM   3328   N N    . PRO A 1 225 ? 12.790  -18.754 7.442   0.04 13.88 ? 281  PRO A N    1  
ATOM   3329   C CA   . PRO A 1 225 ? 14.210  -18.623 7.022   0.04 13.93 ? 281  PRO A CA   1  
ATOM   3330   C C    . PRO A 1 225 ? 15.233  -19.105 8.036   0.04 14.04 ? 281  PRO A C    1  
ATOM   3331   O O    . PRO A 1 225 ? 14.999  -18.930 9.232   0.04 13.90 ? 281  PRO A O    1  
ATOM   3332   C CB   . PRO A 1 225 ? 14.355  -17.107 6.789   0.04 13.58 ? 281  PRO A CB   1  
ATOM   3333   C CG   . PRO A 1 225 ? 12.977  -16.680 6.416   0.04 13.48 ? 281  PRO A CG   1  
ATOM   3334   C CD   . PRO A 1 225 ? 12.043  -17.505 7.242   0.04 13.58 ? 281  PRO A CD   1  
ATOM   3335   H HA   . PRO A 1 225 ? 14.361  -19.082 6.182   0.04 14.11 ? 281  PRO A HA   1  
ATOM   3336   H HB2  . PRO A 1 225 ? 14.637  -16.674 7.612   0.04 13.44 ? 281  PRO A HB2  1  
ATOM   3337   H HB3  . PRO A 1 225 ? 14.993  -16.929 6.080   0.04 13.62 ? 281  PRO A HB3  1  
ATOM   3338   H HG2  . PRO A 1 225 ? 12.856  -15.737 6.616   0.04 13.26 ? 281  PRO A HG2  1  
ATOM   3339   H HG3  . PRO A 1 225 ? 12.830  -16.842 5.474   0.04 13.61 ? 281  PRO A HG3  1  
ATOM   3340   H HD2  . PRO A 1 225 ? 11.873  -17.084 8.101   0.04 13.42 ? 281  PRO A HD2  1  
ATOM   3341   H HD3  . PRO A 1 225 ? 11.219  -17.669 6.758   0.04 13.64 ? 281  PRO A HD3  1  
ATOM   3342   N N    . ALA A 1 226 ? 16.360  -19.620 7.524   0.04 14.32 ? 282  ALA A N    1  
ATOM   3343   C CA   . ALA A 1 226 ? 17.503  -20.119 8.307   0.04 14.45 ? 282  ALA A CA   1  
ATOM   3344   C C    . ALA A 1 226 ? 18.438  -18.945 8.722   0.04 14.16 ? 282  ALA A C    1  
ATOM   3345   O O    . ALA A 1 226 ? 18.830  -18.122 7.876   0.04 13.99 ? 282  ALA A O    1  
ATOM   3346   C CB   . ALA A 1 226 ? 18.281  -21.169 7.480   0.04 14.83 ? 282  ALA A CB   1  
ATOM   3347   H H    . ALA A 1 226 ? 16.487  -19.697 6.677   0.04 14.45 ? 282  ALA A H    1  
ATOM   3348   H HA   . ALA A 1 226 ? 17.176  -20.562 9.105   0.04 14.52 ? 282  ALA A HA   1  
ATOM   3349   H HB1  . ALA A 1 226 ? 19.040  -21.486 7.994   0.04 14.93 ? 282  ALA A HB1  1  
ATOM   3350   H HB2  . ALA A 1 226 ? 17.694  -21.908 7.261   0.04 15.03 ? 282  ALA A HB2  1  
ATOM   3351   H HB3  . ALA A 1 226 ? 18.593  -20.737 6.673   0.04 14.78 ? 282  ALA A HB3  1  
ATOM   3352   N N    . LYS A 1 227 ? 18.757  -18.903 10.021  0.04 14.17 ? 283  LYS A N    1  
ATOM   3353   C CA   . LYS A 1 227 ? 19.583  -17.838 10.632  0.04 13.96 ? 283  LYS A CA   1  
ATOM   3354   C C    . LYS A 1 227 ? 20.933  -17.715 9.931   0.04 14.11 ? 283  LYS A C    1  
ATOM   3355   O O    . LYS A 1 227 ? 21.496  -18.712 9.403   0.04 14.40 ? 283  LYS A O    1  
ATOM   3356   C CB   . LYS A 1 227 ? 19.713  -18.065 12.145  0.04 14.03 ? 283  LYS A CB   1  
ATOM   3357   C CG   . LYS A 1 227 ? 21.073  -17.951 12.781  0.04 14.46 ? 283  LYS A CG   1  
ATOM   3358   C CD   . LYS A 1 227 ? 21.008  -17.836 14.357  0.04 14.60 ? 283  LYS A CD   1  
ATOM   3359   C CE   . LYS A 1 227 ? 22.197  -18.575 15.067  0.04 15.08 ? 283  LYS A CE   1  
ATOM   3360   N NZ   . LYS A 1 227 ? 22.264  -20.084 15.099  0.04 15.46 ? 283  LYS A NZ   1  
ATOM   3361   H H    . LYS A 1 227 ? 18.504  -19.497 10.587  0.04 14.31 ? 283  LYS A H    1  
ATOM   3362   H HA   . LYS A 1 227 ? 19.135  -16.987 10.520  0.04 13.70 ? 283  LYS A HA   1  
ATOM   3363   H HB2  . LYS A 1 227 ? 19.134  -17.426 12.593  0.04 13.89 ? 283  LYS A HB2  1  
ATOM   3364   H HB3  . LYS A 1 227 ? 19.403  -18.965 12.331  0.04 13.96 ? 283  LYS A HB3  1  
ATOM   3365   H HG2  . LYS A 1 227 ? 21.574  -18.754 12.572  0.04 14.62 ? 283  LYS A HG2  1  
ATOM   3366   H HG3  . LYS A 1 227 ? 21.540  -17.173 12.439  0.04 14.55 ? 283  LYS A HG3  1  
ATOM   3367   H HD2  . LYS A 1 227 ? 21.057  -16.904 14.606  0.04 14.43 ? 283  LYS A HD2  1  
ATOM   3368   H HD3  . LYS A 1 227 ? 20.176  -18.216 14.674  0.04 14.57 ? 283  LYS A HD3  1  
ATOM   3369   H HE2  . LYS A 1 227 ? 23.009  -18.287 14.626  0.04 15.16 ? 283  LYS A HE2  1  
ATOM   3370   H HE3  . LYS A 1 227 ? 22.231  -18.289 15.994  0.04 15.11 ? 283  LYS A HE3  1  
ATOM   3371   H HZ1  . LYS A 1 227 ? 23.038  -20.353 14.751  0.04 15.75 ? 283  LYS A HZ1  1  
ATOM   3372   H HZ2  . LYS A 1 227 ? 22.213  -20.373 15.939  0.04 15.46 ? 283  LYS A HZ2  1  
ATOM   3373   H HZ3  . LYS A 1 227 ? 21.599  -20.437 14.623  0.04 15.44 ? 283  LYS A HZ3  1  
ATOM   3374   N N    . ARG A 1 228 ? 21.405  -16.473 9.888   0.04 13.94 ? 284  ARG A N    1  
ATOM   3375   C CA   . ARG A 1 228 ? 22.615  -16.091 9.165   0.04 14.15 ? 284  ARG A CA   1  
ATOM   3376   C C    . ARG A 1 228 ? 23.578  -15.318 10.063  0.04 14.13 ? 284  ARG A C    1  
ATOM   3377   O O    . ARG A 1 228 ? 23.335  -14.143 10.366  0.04 13.86 ? 284  ARG A O    1  
ATOM   3378   C CB   . ARG A 1 228 ? 22.239  -15.191 7.964   0.04 14.01 ? 284  ARG A CB   1  
ATOM   3379   C CG   . ARG A 1 228 ? 21.928  -15.919 6.685   0.04 14.07 ? 284  ARG A CG   1  
ATOM   3380   C CD   . ARG A 1 228 ? 22.098  -14.975 5.501   0.04 14.03 ? 284  ARG A CD   1  
ATOM   3381   N NE   . ARG A 1 228 ? 21.114  -13.890 5.519   0.04 13.68 ? 284  ARG A NE   1  
ATOM   3382   C CZ   . ARG A 1 228 ? 21.188  -12.816 4.722   0.04 13.61 ? 284  ARG A CZ   1  
ATOM   3383   N NH1  . ARG A 1 228 ? 22.243  -12.673 3.917   0.04 13.85 ? 284  ARG A NH1  1  
ATOM   3384   N NH2  . ARG A 1 228 ? 20.255  -11.877 4.753   0.04 13.35 ? 284  ARG A NH2  1  
ATOM   3385   H H    . ARG A 1 228 ? 21.028  -15.806 10.275  0.04 13.72 ? 284  ARG A H    1  
ATOM   3386   H HA   . ARG A 1 228 ? 23.063  -16.879 8.826   0.04 14.42 ? 284  ARG A HA   1  
ATOM   3387   H HB2  . ARG A 1 228 ? 21.442  -14.692 8.200   0.04 13.75 ? 284  ARG A HB2  1  
ATOM   3388   H HB3  . ARG A 1 228 ? 22.967  -14.578 7.789   0.04 14.15 ? 284  ARG A HB3  1  
ATOM   3389   H HG2  . ARG A 1 228 ? 22.542  -16.665 6.578   0.04 14.33 ? 284  ARG A HG2  1  
ATOM   3390   H HG3  . ARG A 1 228 ? 21.012  -16.236 6.698   0.04 13.91 ? 284  ARG A HG3  1  
ATOM   3391   H HD2  . ARG A 1 228 ? 22.987  -14.586 5.534   0.04 14.09 ? 284  ARG A HD2  1  
ATOM   3392   H HD3  . ARG A 1 228 ? 21.993  -15.471 4.675   0.04 14.20 ? 284  ARG A HD3  1  
ATOM   3393   H HE   . ARG A 1 228 ? 20.705  -13.771 6.266   0.04 13.52 ? 284  ARG A HE   1  
ATOM   3394   H HH11 . ARG A 1 228 ? 22.854  -13.273 3.885   0.04 14.05 ? 284  ARG A HH11 1  
ATOM   3395   H HH12 . ARG A 1 228 ? 22.302  -11.980 3.416   0.04 13.83 ? 284  ARG A HH12 1  
ATOM   3396   H HH21 . ARG A 1 228 ? 19.575  -11.955 5.276   0.04 13.21 ? 284  ARG A HH21 1  
ATOM   3397   H HH22 . ARG A 1 228 ? 20.332  -11.184 4.252   0.04 13.33 ? 284  ARG A HH22 1  
ATOM   3398   N N    . THR A 1 229 ? 24.715  -15.909 10.402  0.04 14.44 ? 285  THR A N    1  
ATOM   3399   C CA   . THR A 1 229 ? 25.671  -15.220 11.245  0.04 14.49 ? 285  THR A CA   1  
ATOM   3400   C C    . THR A 1 229 ? 26.648  -14.353 10.388  0.04 14.54 ? 285  THR A C    1  
ATOM   3401   O O    . THR A 1 229 ? 27.110  -14.758 9.324   0.04 14.68 ? 285  THR A O    1  
ATOM   3402   C CB   . THR A 1 229 ? 26.300  -16.207 12.296  0.04 14.89 ? 285  THR A CB   1  
ATOM   3403   O OG1  . THR A 1 229 ? 26.021  -17.544 11.945  0.04 15.20 ? 285  THR A OG1  1  
ATOM   3404   C CG2  . THR A 1 229 ? 25.599  -16.066 13.611  0.04 14.83 ? 285  THR A CG2  1  
ATOM   3405   H H    . THR A 1 229 ? 24.955  -16.699 10.158  0.04 14.66 ? 285  THR A H    1  
ATOM   3406   H HA   . THR A 1 229 ? 25.173  -14.582 11.778  0.04 14.26 ? 285  THR A HA   1  
ATOM   3407   H HB   . THR A 1 229 ? 27.256  -16.063 12.404  0.04 15.00 ? 285  THR A HB   1  
ATOM   3408   H HG1  . THR A 1 229 ? 26.660  -18.041 12.172  0.04 15.46 ? 285  THR A HG1  1  
ATOM   3409   H HG21 . THR A 1 229 ? 26.141  -16.450 14.319  0.04 15.07 ? 285  THR A HG21 1  
ATOM   3410   H HG22 . THR A 1 229 ? 25.415  -15.135 13.811  0.04 14.56 ? 285  THR A HG22 1  
ATOM   3411   H HG23 . THR A 1 229 ? 24.760  -16.554 13.569  0.04 14.87 ? 285  THR A HG23 1  
ATOM   3412   N N    . ASN A 1 230 ? 26.866  -13.123 10.843  0.04 14.44 ? 286  ASN A N    1  
ATOM   3413   C CA   . ASN A 1 230 ? 27.638  -12.127 10.095  0.04 14.49 ? 286  ASN A CA   1  
ATOM   3414   C C    . ASN A 1 230 ? 27.022  -11.857 8.698   0.04 14.38 ? 286  ASN A C    1  
ATOM   3415   O O    . ASN A 1 230 ? 27.687  -11.817 7.681   0.04 14.64 ? 286  ASN A O    1  
ATOM   3416   C CB   . ASN A 1 230 ? 29.116  -12.477 10.005  0.04 14.94 ? 286  ASN A CB   1  
ATOM   3417   C CG   . ASN A 1 230 ? 29.904  -12.017 11.229  0.04 15.09 ? 286  ASN A CG   1  
ATOM   3418   O OD1  . ASN A 1 230 ? 29.849  -10.862 11.644  0.04 14.88 ? 286  ASN A OD1  1  
ATOM   3419   N ND2  . ASN A 1 230 ? 30.674  -12.925 11.786  0.04 15.46 ? 286  ASN A ND2  1  
ATOM   3420   H H    . ASN A 1 230 ? 26.556  -12.822 11.587  0.04 14.35 ? 286  ASN A H    1  
ATOM   3421   H HA   . ASN A 1 230 ? 27.588  -11.293 10.586  0.04 14.33 ? 286  ASN A HA   1  
ATOM   3422   H HB2  . ASN A 1 230 ? 29.218  -13.438 9.912   0.04 15.12 ? 286  ASN A HB2  1  
ATOM   3423   H HB3  . ASN A 1 230 ? 29.499  -12.035 9.235   0.04 14.99 ? 286  ASN A HB3  1  
ATOM   3424   H HD21 . ASN A 1 230 ? 31.160  -12.725 12.464  0.04 15.57 ? 286  ASN A HD21 1  
ATOM   3425   H HD22 . ASN A 1 230 ? 30.688  -13.724 11.466  0.04 15.62 ? 286  ASN A HD22 1  
ATOM   3426   N N    . ALA A 1 231 ? 25.720  -11.671 8.692   0.04 14.02 ? 287  ALA A N    1  
ATOM   3427   C CA   . ALA A 1 231 ? 24.983  -11.504 7.452   0.04 13.89 ? 287  ALA A CA   1  
ATOM   3428   C C    . ALA A 1 231 ? 25.459  -10.300 6.631   0.04 13.86 ? 287  ALA A C    1  
ATOM   3429   O O    . ALA A 1 231 ? 25.750  -9.226  7.172   0.04 13.72 ? 287  ALA A O    1  
ATOM   3430   C CB   . ALA A 1 231 ? 23.502  -11.366 7.780   0.04 13.56 ? 287  ALA A CB   1  
ATOM   3431   H H    . ALA A 1 231 ? 25.232  -11.642 9.399   0.04 13.85 ? 287  ALA A H    1  
ATOM   3432   H HA   . ALA A 1 231 ? 25.104  -12.296 6.909   0.04 14.08 ? 287  ALA A HA   1  
ATOM   3433   H HB1  . ALA A 1 231 ? 22.985  -11.435 6.962   0.04 13.53 ? 287  ALA A HB1  1  
ATOM   3434   H HB2  . ALA A 1 231 ? 23.255  -12.079 8.385   0.04 13.60 ? 287  ALA A HB2  1  
ATOM   3435   H HB3  . ALA A 1 231 ? 23.351  -10.506 8.204   0.04 13.38 ? 287  ALA A HB3  1  
ATOM   3436   N N    . ARG A 1 232 ? 25.481  -10.476 5.308   0.04 14.00 ? 288  ARG A N    1  
ATOM   3437   C CA   . ARG A 1 232 ? 25.654  -9.352  4.392   0.04 14.00 ? 288  ARG A CA   1  
ATOM   3438   C C    . ARG A 1 232 ? 24.899  -9.645  3.121   0.04 14.03 ? 288  ARG A C    1  
ATOM   3439   O O    . ARG A 1 232 ? 24.958  -10.762 2.612   0.04 14.23 ? 288  ARG A O    1  
ATOM   3440   C CB   . ARG A 1 232 ? 27.133  -9.079  4.094   0.04 14.33 ? 288  ARG A CB   1  
ATOM   3441   C CG   . ARG A 1 232 ? 27.401  -7.891  3.153   0.04 14.38 ? 288  ARG A CG   1  
ATOM   3442   C CD   . ARG A 1 232 ? 28.893  -7.592  2.986   0.04 14.73 ? 288  ARG A CD   1  
ATOM   3443   N NE   . ARG A 1 232 ? 29.184  -6.533  2.008   0.04 14.86 ? 288  ARG A NE   1  
ATOM   3444   C CZ   . ARG A 1 232 ? 29.043  -5.228  2.204   0.04 14.72 ? 288  ARG A CZ   1  
ATOM   3445   N NH1  . ARG A 1 232 ? 28.633  -4.757  3.380   0.04 14.45 ? 288  ARG A NH1  1  
ATOM   3446   N NH2  . ARG A 1 232 ? 29.337  -4.395  1.211   0.04 14.89 ? 288  ARG A NH2  1  
ATOM   3447   H H    . ARG A 1 232 ? 25.414  -11.238 4.917   0.04 14.12 ? 288  ARG A H    1  
ATOM   3448   H HA   . ARG A 1 232 ? 25.283  -8.550  4.789   0.04 13.79 ? 288  ARG A HA   1  
ATOM   3449   H HB2  . ARG A 1 232 ? 27.585  -8.898  4.932   0.04 14.34 ? 288  ARG A HB2  1  
ATOM   3450   H HB3  . ARG A 1 232 ? 27.513  -9.878  3.690   0.04 14.56 ? 288  ARG A HB3  1  
ATOM   3451   H HG2  . ARG A 1 232 ? 27.033  -8.084  2.278   0.04 14.44 ? 288  ARG A HG2  1  
ATOM   3452   H HG3  . ARG A 1 232 ? 26.987  -7.102  3.533   0.04 14.16 ? 288  ARG A HG3  1  
ATOM   3453   H HD2  . ARG A 1 232 ? 29.258  -7.342  3.846   0.04 14.67 ? 288  ARG A HD2  1  
ATOM   3454   H HD3  . ARG A 1 232 ? 29.330  -8.394  2.661   0.04 14.96 ? 288  ARG A HD3  1  
ATOM   3455   H HE   . ARG A 1 232 ? 29.347  -6.787  1.204   0.04 15.11 ? 288  ARG A HE   1  
ATOM   3456   H HH11 . ARG A 1 232 ? 28.441  -5.301  4.016   0.04 14.35 ? 288  ARG A HH11 1  
ATOM   3457   H HH12 . ARG A 1 232 ? 28.545  -3.910  3.502   0.04 14.38 ? 288  ARG A HH12 1  
ATOM   3458   H HH21 . ARG A 1 232 ? 29.608  -4.708  0.462   0.04 15.08 ? 288  ARG A HH21 1  
ATOM   3459   H HH22 . ARG A 1 232 ? 29.263  -3.545  1.319   0.04 14.83 ? 288  ARG A HH22 1  
ATOM   3460   N N    . GLY A 1 233 ? 24.198  -8.635  2.604   0.04 13.86 ? 289  GLY A N    1  
ATOM   3461   C CA   . GLY A 1 233 ? 23.410  -8.809  1.392   0.04 13.91 ? 289  GLY A CA   1  
ATOM   3462   C C    . GLY A 1 233 ? 22.138  -9.613  1.630   0.04 13.74 ? 289  GLY A C    1  
ATOM   3463   O O    . GLY A 1 233 ? 21.854  -10.014 2.735   0.04 13.58 ? 289  GLY A O    1  
ATOM   3464   H H    . GLY A 1 233 ? 24.160  -7.845  2.942   0.04 13.74 ? 289  GLY A H    1  
ATOM   3465   H HA2  . GLY A 1 233 ? 23.173  -7.944  1.031   0.04 13.83 ? 289  GLY A HA2  1  
ATOM   3466   H HA3  . GLY A 1 233 ? 23.934  -9.283  0.731   0.04 14.15 ? 289  GLY A HA3  1  
ATOM   3467   N N    . THR A 1 234 ? 21.405  -9.878  0.551   0.04 13.83 ? 290  THR A N    1  
ATOM   3468   C CA   . THR A 1 234 ? 20.118  -10.522 0.693   0.04 13.70 ? 290  THR A CA   1  
ATOM   3469   C C    . THR A 1 234 ? 20.254  -12.038 0.872   0.04 13.89 ? 290  THR A C    1  
ATOM   3470   O O    . THR A 1 234 ? 21.264  -12.653 0.488   0.04 14.17 ? 290  THR A O    1  
ATOM   3471   C CB   . THR A 1 234 ? 19.223  -10.248 -0.540  0.04 13.77 ? 290  THR A CB   1  
ATOM   3472   O OG1  . THR A 1 234 ? 19.805  -10.798 -1.734  0.04 14.12 ? 290  THR A OG1  1  
ATOM   3473   C CG2  . THR A 1 234 ? 18.958  -8.763  -0.712  0.04 13.65 ? 290  THR A CG2  1  
ATOM   3474   H H    . THR A 1 234 ? 21.629  -9.698  -0.256  0.04 13.99 ? 290  THR A H    1  
ATOM   3475   H HA   . THR A 1 234 ? 19.667  -10.168 1.470   0.04 13.48 ? 290  THR A HA   1  
ATOM   3476   H HB   . THR A 1 234 ? 18.365  -10.675 -0.383  0.04 13.67 ? 290  THR A HB   1  
ATOM   3477   H HG1  . THR A 1 234 ? 20.574  -10.486 -1.863  0.04 14.22 ? 290  THR A HG1  1  
ATOM   3478   H HG21 . THR A 1 234 ? 18.300  -8.629  -1.414  0.04 13.70 ? 290  THR A HG21 1  
ATOM   3479   H HG22 . THR A 1 234 ? 18.636  -8.371  0.113   0.04 13.43 ? 290  THR A HG22 1  
ATOM   3480   H HG23 . THR A 1 234 ? 19.779  -8.314  -0.969  0.04 13.77 ? 290  THR A HG23 1  
ATOM   3481   N N    . SER A 1 235 ? 19.193  -12.622 1.408   0.04 13.76 ? 291  SER A N    1  
ATOM   3482   C CA   . SER A 1 235 ? 19.096  -14.052 1.640   0.04 13.93 ? 291  SER A CA   1  
ATOM   3483   C C    . SER A 1 235 ? 18.654  -14.847 0.414   0.04 14.21 ? 291  SER A C    1  
ATOM   3484   O O    . SER A 1 235 ? 18.847  -16.085 0.349   0.04 14.45 ? 291  SER A O    1  
ATOM   3485   C CB   . SER A 1 235 ? 18.064  -14.298 2.713   0.04 13.69 ? 291  SER A CB   1  
ATOM   3486   O OG   . SER A 1 235 ? 16.760  -14.251 2.177   0.04 13.56 ? 291  SER A OG   1  
ATOM   3487   H H    . SER A 1 235 ? 18.503  -12.188 1.677   0.04 13.59 ? 291  SER A H    1  
ATOM   3488   H HA   . SER A 1 235 ? 19.948  -14.404 1.945   0.04 14.07 ? 291  SER A HA   1  
ATOM   3489   H HB2  . SER A 1 235 ? 18.215  -15.182 3.082   0.04 13.82 ? 291  SER A HB2  1  
ATOM   3490   H HB3  . SER A 1 235 ? 18.157  -13.628 3.408   0.04 13.53 ? 291  SER A HB3  1  
ATOM   3491   H HG   . SER A 1 235 ? 16.694  -13.599 1.652   0.04 13.42 ? 291  SER A HG   1  
ATOM   3492   N N    . TRP A 1 236 ? 18.078  -14.132 -0.553  0.04 14.22 ? 292  TRP A N    1  
ATOM   3493   C CA   . TRP A 1 236 ? 17.354  -14.725 -1.692  0.04 14.46 ? 292  TRP A CA   1  
ATOM   3494   C C    . TRP A 1 236 ? 17.949  -14.396 -3.080  0.04 14.76 ? 292  TRP A C    1  
ATOM   3495   O O    . TRP A 1 236 ? 17.503  -14.964 -4.098  0.04 15.04 ? 292  TRP A O    1  
ATOM   3496   C CB   . TRP A 1 236 ? 15.886  -14.278 -1.649  0.04 14.25 ? 292  TRP A CB   1  
ATOM   3497   C CG   . TRP A 1 236 ? 15.774  -12.785 -1.547  0.04 13.99 ? 292  TRP A CG   1  
ATOM   3498   C CD1  . TRP A 1 236 ? 15.611  -12.037 -0.397  0.04 13.66 ? 292  TRP A CD1  1  
ATOM   3499   C CD2  . TRP A 1 236 ? 15.842  -11.834 -2.624  0.04 14.09 ? 292  TRP A CD2  1  
ATOM   3500   N NE1  . TRP A 1 236 ? 15.588  -10.695 -0.705  0.04 13.55 ? 292  TRP A NE1  1  
ATOM   3501   C CE2  . TRP A 1 236 ? 15.688  -10.545 -2.061  0.04 13.81 ? 292  TRP A CE2  1  
ATOM   3502   C CE3  . TRP A 1 236 ? 15.969  -11.947 -4.010  0.04 14.41 ? 292  TRP A CE3  1  
ATOM   3503   C CZ2  . TRP A 1 236 ? 15.713  -9.389  -2.841  0.04 13.86 ? 292  TRP A CZ2  1  
ATOM   3504   C CZ3  . TRP A 1 236 ? 15.984  -10.804 -4.779  0.04 14.46 ? 292  TRP A CZ3  1  
ATOM   3505   C CH2  . TRP A 1 236 ? 15.842  -9.543  -4.195  0.04 14.19 ? 292  TRP A CH2  1  
ATOM   3506   H H    . TRP A 1 236 ? 18.087  -13.275 -0.569  0.04 14.12 ? 292  TRP A H    1  
ATOM   3507   H HA   . TRP A 1 236 ? 17.362  -15.688 -1.599  0.04 14.61 ? 292  TRP A HA   1  
ATOM   3508   H HB2  . TRP A 1 236 ? 15.440  -14.562 -2.461  0.04 14.43 ? 292  TRP A HB2  1  
ATOM   3509   H HB3  . TRP A 1 236 ? 15.456  -14.679 -0.880  0.04 14.15 ? 292  TRP A HB3  1  
ATOM   3510   H HD1  . TRP A 1 236 ? 15.562  -12.386 0.462   0.04 13.55 ? 292  TRP A HD1  1  
ATOM   3511   H HE1  . TRP A 1 236 ? 15.484  -10.055 -0.136  0.04 13.37 ? 292  TRP A HE1  1  
ATOM   3512   H HE3  . TRP A 1 236 ? 16.058  -12.787 -4.403  0.04 14.62 ? 292  TRP A HE3  1  
ATOM   3513   H HZ2  . TRP A 1 236 ? 15.623  -8.547  -2.455  0.04 13.70 ? 292  TRP A HZ2  1  
ATOM   3514   H HZ3  . TRP A 1 236 ? 16.070  -10.876 -5.700  0.04 14.70 ? 292  TRP A HZ3  1  
ATOM   3515   H HH2  . TRP A 1 236 ? 15.859  -8.786  -4.735  0.04 14.26 ? 292  TRP A HH2  1  
ATOM   3516   N N    . GLY A 1 237 ? 18.950  -13.526 -3.143  0.04 14.74 ? 293  GLY A N    1  
ATOM   3517   C CA   . GLY A 1 237 ? 19.568  -13.266 -4.444  0.04 15.06 ? 293  GLY A CA   1  
ATOM   3518   C C    . GLY A 1 237 ? 20.142  -14.508 -5.149  0.04 15.50 ? 293  GLY A C    1  
ATOM   3519   O O    . GLY A 1 237 ? 20.072  -14.592 -6.391  0.04 15.80 ? 293  GLY A O    1  
ATOM   3520   H H    . GLY A 1 237 ? 19.283  -13.096 -2.482  0.04 14.56 ? 293  GLY A H    1  
ATOM   3521   H HA2  . GLY A 1 237 ? 18.902  -12.872 -5.029  0.04 15.06 ? 293  GLY A HA2  1  
ATOM   3522   H HA3  . GLY A 1 237 ? 20.288  -12.626 -4.336  0.04 15.03 ? 293  GLY A HA3  1  
ATOM   3523   N N    . ASN A 1 238 ? 20.734  -15.422 -4.356  0.04 15.57 ? 294  ASN A N    1  
ATOM   3524   C CA   . ASN A 1 238 ? 21.324  -16.697 -4.786  0.04 16.01 ? 294  ASN A CA   1  
ATOM   3525   C C    . ASN A 1 238 ? 20.258  -17.826 -4.645  0.04 16.11 ? 294  ASN A C    1  
ATOM   3526   O O    . ASN A 1 238 ? 20.518  -18.867 -4.034  0.04 16.43 ? 294  ASN A O    1  
ATOM   3527   C CB   . ASN A 1 238 ? 22.570  -17.084 -3.939  0.04 16.06 ? 294  ASN A CB   1  
ATOM   3528   C CG   . ASN A 1 238 ? 23.674  -15.968 -3.858  0.04 16.29 ? 294  ASN A CG   1  
ATOM   3529   O OD1  . ASN A 1 238 ? 24.005  -15.308 -4.848  0.04 16.61 ? 294  ASN A OD1  1  
ATOM   3530   N ND2  . ASN A 1 238 ? 24.282  -15.820 -2.663  0.04 16.16 ? 294  ASN A ND2  1  
ATOM   3531   H H    . ASN A 1 238 ? 20.797  -15.311 -3.500  0.04 15.38 ? 294  ASN A H    1  
ATOM   3532   H HA   . ASN A 1 238 ? 21.594  -16.638 -5.719  0.04 16.23 ? 294  ASN A HA   1  
ATOM   3533   H HB2  . ASN A 1 238 ? 22.290  -17.294 -3.033  0.04 15.77 ? 294  ASN A HB2  1  
ATOM   3534   H HB3  . ASN A 1 238 ? 22.980  -17.866 -4.342  0.04 16.27 ? 294  ASN A HB3  1  
ATOM   3535   H HD21 . ASN A 1 238 ? 24.396  -15.042 -2.320  0.04 16.22 ? 294  ASN A HD21 1  
ATOM   3536   H HD22 . ASN A 1 238 ? 24.565  -16.517 -2.240  0.04 16.03 ? 294  ASN A HD22 1  
ATOM   3537   N N    . GLY A 1 239 ? 19.103  -17.615 -5.275  0.04 15.87 ? 295  GLY A N    1  
ATOM   3538   C CA   . GLY A 1 239 ? 17.849  -18.208 -4.843  0.04 15.93 ? 295  GLY A CA   1  
ATOM   3539   C C    . GLY A 1 239 ? 17.739  -18.659 -3.369  0.04 15.88 ? 295  GLY A C    1  
ATOM   3540   O O    . GLY A 1 239 ? 18.190  -17.996 -2.425  0.04 15.88 ? 295  GLY A O    1  
ATOM   3541   H H    . GLY A 1 239 ? 19.024  -17.137 -5.988  0.04 15.68 ? 295  GLY A H    1  
ATOM   3542   H HA2  . GLY A 1 239 ? 17.133  -17.587 -5.036  0.04 15.74 ? 295  GLY A HA2  1  
ATOM   3543   H HA3  . GLY A 1 239 ? 17.700  -18.999 -5.388  0.04 16.24 ? 295  GLY A HA3  1  
ATOM   3544   N N    . THR A 1 240 ? 17.213  -19.880 -3.273  0.04 15.89 ? 296  THR A N    1  
ATOM   3545   C CA   . THR A 1 240 ? 16.641  -20.546 -2.101  0.04 15.98 ? 296  THR A CA   1  
ATOM   3546   C C    . THR A 1 240 ? 17.403  -20.243 -0.870  0.04 15.68 ? 296  THR A C    1  
ATOM   3547   O O    . THR A 1 240 ? 18.520  -20.656 -0.764  0.04 15.85 ? 296  THR A O    1  
ATOM   3548   C CB   . THR A 1 240 ? 16.671  -22.173 -2.216  0.04 16.51 ? 296  THR A CB   1  
ATOM   3549   O OG1  . THR A 1 240 ? 17.515  -22.779 -1.205  0.04 16.60 ? 296  THR A OG1  1  
ATOM   3550   C CG2  . THR A 1 240 ? 17.138  -22.653 -3.593  0.04 16.80 ? 296  THR A CG2  1  
ATOM   3551   H H    . THR A 1 240 ? 17.186  -20.381 -3.968  0.04 15.91 ? 296  THR A H    1  
ATOM   3552   H HA   . THR A 1 240 ? 15.721  -20.273 -2.005  0.04 15.93 ? 296  THR A HA   1  
ATOM   3553   H HB   . THR A 1 240 ? 15.769  -22.507 -2.097  0.04 16.66 ? 296  THR A HB   1  
ATOM   3554   H HG1  . THR A 1 240 ? 18.320  -22.795 -1.460  0.04 16.55 ? 296  THR A HG1  1  
ATOM   3555   H HG21 . THR A 1 240 ? 17.166  -23.621 -3.631  0.04 17.15 ? 296  THR A HG21 1  
ATOM   3556   H HG22 . THR A 1 240 ? 16.529  -22.322 -4.269  0.04 16.73 ? 296  THR A HG22 1  
ATOM   3557   H HG23 . THR A 1 240 ? 18.029  -22.308 -3.775  0.04 16.75 ? 296  THR A HG23 1  
ATOM   3558   N N    . PRO A 1 241 ? 16.782  -19.562 0.097   0.04 15.26 ? 297  PRO A N    1  
ATOM   3559   C CA   . PRO A 1 241 ? 17.498  -19.430 1.355   0.04 15.02 ? 297  PRO A CA   1  
ATOM   3560   C C    . PRO A 1 241 ? 17.342  -20.780 2.056   0.04 15.19 ? 297  PRO A C    1  
ATOM   3561   O O    . PRO A 1 241 ? 16.373  -21.492 1.730   0.04 15.31 ? 297  PRO A O    1  
ATOM   3562   C CB   . PRO A 1 241 ? 16.728  -18.287 2.035   0.04 14.60 ? 297  PRO A CB   1  
ATOM   3563   C CG   . PRO A 1 241 ? 15.321  -18.388 1.453   0.04 14.70 ? 297  PRO A CG   1  
ATOM   3564   C CD   . PRO A 1 241 ? 15.408  -19.010 0.121   0.04 15.02 ? 297  PRO A CD   1  
ATOM   3565   H HA   . PRO A 1 241 ? 18.431  -19.198 1.239   0.04 15.02 ? 297  PRO A HA   1  
ATOM   3566   H HB2  . PRO A 1 241 ? 16.697  -18.406 2.988   0.04 14.53 ? 297  PRO A HB2  1  
ATOM   3567   H HB3  . PRO A 1 241 ? 17.106  -17.435 1.780   0.04 14.43 ? 297  PRO A HB3  1  
ATOM   3568   H HG2  . PRO A 1 241 ? 14.779  -18.974 1.977   0.04 14.80 ? 297  PRO A HG2  1  
ATOM   3569   H HG3  . PRO A 1 241 ? 14.913  -17.516 1.357   0.04 14.50 ? 297  PRO A HG3  1  
ATOM   3570   H HD2  . PRO A 1 241 ? 14.759  -19.721 -0.001  0.04 15.18 ? 297  PRO A HD2  1  
ATOM   3571   H HD3  . PRO A 1 241 ? 15.309  -18.340 -0.576  0.04 14.95 ? 297  PRO A HD3  1  
ATOM   3572   N N    . GLU A 1 242 ? 18.279  -21.174 2.911   0.04 15.22 ? 298  GLU A N    1  
ATOM   3573   C CA   . GLU A 1 242 ? 18.058  -22.293 3.804   0.04 15.42 ? 298  GLU A CA   1  
ATOM   3574   C C    . GLU A 1 242 ? 16.942  -21.821 4.686   0.04 15.15 ? 298  GLU A C    1  
ATOM   3575   O O    . GLU A 1 242 ? 16.768  -20.603 4.915   0.04 14.77 ? 298  GLU A O    1  
ATOM   3576   C CB   . GLU A 1 242 ? 19.317  -22.551 4.611   0.04 15.55 ? 298  GLU A CB   1  
ATOM   3577   C CG   . GLU A 1 242 ? 19.396  -23.826 5.421   0.04 15.87 ? 298  GLU A CG   1  
ATOM   3578   C CD   . GLU A 1 242 ? 20.824  -24.013 5.839   0.04 16.18 ? 298  GLU A CD   1  
ATOM   3579   O OE1  . GLU A 1 242 ? 21.601  -24.627 5.048   0.04 16.43 ? 298  GLU A OE1  1  
ATOM   3580   O OE2  . GLU A 1 242 ? 21.160  -23.452 6.923   0.04 16.25 ? 298  GLU A OE2  1  
ATOM   3581   H H    . GLU A 1 242 ? 19.051  -20.804 2.993   0.04 15.16 ? 298  GLU A H    1  
ATOM   3582   H HA   . GLU A 1 242 ? 17.794  -23.093 3.322   0.04 15.70 ? 298  GLU A HA   1  
ATOM   3583   H HB2  . GLU A 1 242 ? 20.047  -22.586 3.970   0.04 15.72 ? 298  GLU A HB2  1  
ATOM   3584   H HB3  . GLU A 1 242 ? 19.460  -21.801 5.200   0.04 15.28 ? 298  GLU A HB3  1  
ATOM   3585   H HG2  . GLU A 1 242 ? 18.851  -23.750 6.219   0.04 15.68 ? 298  GLU A HG2  1  
ATOM   3586   H HG3  . GLU A 1 242 ? 19.119  -24.584 4.882   0.04 16.08 ? 298  GLU A HG3  1  
ATOM   3587   N N    . GLY A 1 243 ? 16.184  -22.788 5.153   0.04 15.38 ? 299  GLY A N    1  
ATOM   3588   C CA   . GLY A 1 243 ? 14.912  -22.528 5.798   0.04 15.19 ? 299  GLY A CA   1  
ATOM   3589   C C    . GLY A 1 243 ? 14.031  -23.761 5.569   0.04 15.52 ? 299  GLY A C    1  
ATOM   3590   O O    . GLY A 1 243 ? 14.302  -24.535 4.635   0.04 15.93 ? 299  GLY A O    1  
ATOM   3591   H H    . GLY A 1 243 ? 16.376  -23.623 5.097   0.04 15.66 ? 299  GLY A H    1  
ATOM   3592   H HA2  . GLY A 1 243 ? 15.038  -22.388 6.750   0.04 15.11 ? 299  GLY A HA2  1  
ATOM   3593   H HA3  . GLY A 1 243 ? 14.500  -21.743 5.409   0.04 14.94 ? 299  GLY A HA3  1  
ATOM   3594   N N    . GLU A 1 244 ? 13.023  -23.948 6.444   0.04 15.36 ? 300  GLU A N    1  
ATOM   3595   C CA   . GLU A 1 244 ? 12.003  -25.037 6.415   0.04 15.65 ? 300  GLU A CA   1  
ATOM   3596   C C    . GLU A 1 244 ? 10.657  -24.328 6.265   0.04 15.49 ? 300  GLU A C    1  
ATOM   3597   O O    . GLU A 1 244 ? 10.545  -23.123 6.539   0.04 15.11 ? 300  GLU A O    1  
ATOM   3598   C CB   . GLU A 1 244 ? 12.004  -25.933 7.728   0.04 15.74 ? 300  GLU A CB   1  
ATOM   3599   C CG   . GLU A 1 244 ? 11.113  -27.370 7.818   0.04 16.17 ? 300  GLU A CG   1  
ATOM   3600   C CD   . GLU A 1 244 ? 10.370  -27.660 9.228   0.04 16.31 ? 300  GLU A CD   1  
ATOM   3601   O OE1  . GLU A 1 244 ? 10.074  -26.693 9.971   0.04 16.09 ? 300  GLU A OE1  1  
ATOM   3602   O OE2  . GLU A 1 244 ? 10.053  -28.817 9.602   0.04 16.67 ? 300  GLU A OE2  1  
ATOM   3603   H H    . GLU A 1 244 ? 12.903  -23.409 7.105   0.04 15.10 ? 300  GLU A H    1  
ATOM   3604   H HA   . GLU A 1 244 ? 12.149  -25.608 5.642   0.04 15.95 ? 300  GLU A HA   1  
ATOM   3605   H HB2  . GLU A 1 244 ? 12.929  -26.192 7.867   0.04 15.49 ? 300  GLU A HB2  1  
ATOM   3606   H HB3  . GLU A 1 244 ? 11.715  -25.381 8.471   0.04 15.76 ? 300  GLU A HB3  1  
ATOM   3607   H HG2  . GLU A 1 244 ? 10.428  -27.360 7.132   0.04 16.43 ? 300  GLU A HG2  1  
ATOM   3608   H HG3  . GLU A 1 244 ? 11.721  -28.110 7.652   0.04 16.16 ? 300  GLU A HG3  1  
ATOM   3609   N N    . SER A 1 245 ? 9.623   -25.055 5.841   0.04 15.81 ? 301  SER A N    1  
ATOM   3610   C CA   . SER A 1 245 ? 8.370   -24.413 5.409   0.04 15.75 ? 301  SER A CA   1  
ATOM   3611   C C    . SER A 1 245 ? 7.063   -24.874 5.989   0.04 15.96 ? 301  SER A C    1  
ATOM   3612   O O    . SER A 1 245 ? 6.304   -25.480 5.275   0.04 16.40 ? 301  SER A O    1  
ATOM   3613   C CB   . SER A 1 245 ? 8.200   -24.671 3.908   0.04 15.98 ? 301  SER A CB   1  
ATOM   3614   O OG   . SER A 1 245 ? 9.044   -23.877 3.126   0.04 15.78 ? 301  SER A OG   1  
ATOM   3615   H H    . SER A 1 245 ? 9.615   -25.914 5.789   0.04 16.10 ? 301  SER A H    1  
ATOM   3616   H HA   . SER A 1 245 ? 8.428   -23.455 5.546   0.04 15.44 ? 301  SER A HA   1  
ATOM   3617   H HB2  . SER A 1 245 ? 8.403   -25.604 3.732   0.04 16.31 ? 301  SER A HB2  1  
ATOM   3618   H HB3  . SER A 1 245 ? 7.299   -24.466 3.620   0.04 15.96 ? 301  SER A HB3  1  
ATOM   3619   H HG   . SER A 1 245 ? 9.839   -24.145 3.186   0.04 15.82 ? 301  SER A HG   1  
ATOM   3620   N N    . LEU A 1 246 ? 6.680   -24.493 7.181   0.04 15.68 ? 302  LEU A N    1  
ATOM   3621   C CA   . LEU A 1 246 ? 5.501   -25.141 7.781   0.04 15.86 ? 302  LEU A CA   1  
ATOM   3622   C C    . LEU A 1 246 ? 4.241   -25.141 6.840   0.04 15.97 ? 302  LEU A C    1  
ATOM   3623   O O    . LEU A 1 246 ? 4.004   -24.168 6.127   0.04 15.67 ? 302  LEU A O    1  
ATOM   3624   C CB   . LEU A 1 246 ? 5.239   -24.489 9.138   0.04 15.55 ? 302  LEU A CB   1  
ATOM   3625   C CG   . LEU A 1 246 ? 6.542   -24.444 9.988   0.04 15.38 ? 302  LEU A CG   1  
ATOM   3626   C CD1  . LEU A 1 246 ? 6.423   -23.550 11.196  0.04 14.98 ? 302  LEU A CD1  1  
ATOM   3627   C CD2  . LEU A 1 246 ? 7.058   -25.860 10.399  0.04 15.76 ? 302  LEU A CD2  1  
ATOM   3628   H H    . LEU A 1 246 ? 7.042   -23.863 7.635   0.04 15.39 ? 302  LEU A H    1  
ATOM   3629   H HA   . LEU A 1 246 ? 5.734   -26.068 7.945   0.04 16.15 ? 302  LEU A HA   1  
ATOM   3630   H HB2  . LEU A 1 246 ? 4.928   -23.582 9.001   0.04 15.30 ? 302  LEU A HB2  1  
ATOM   3631   H HB3  . LEU A 1 246 ? 4.564   -24.993 9.617   0.04 15.73 ? 302  LEU A HB3  1  
ATOM   3632   H HG   . LEU A 1 246 ? 7.248   -24.042 9.465   0.04 15.30 ? 302  LEU A HG   1  
ATOM   3633   H HD11 . LEU A 1 246 ? 7.302   -23.412 11.582  0.04 14.98 ? 302  LEU A HD11 1  
ATOM   3634   H HD12 . LEU A 1 246 ? 6.038   -22.700 10.931  0.04 14.73 ? 302  LEU A HD12 1  
ATOM   3635   H HD13 . LEU A 1 246 ? 5.849   -23.977 11.829  0.04 15.01 ? 302  LEU A HD13 1  
ATOM   3636   H HD21 . LEU A 1 246 ? 7.666   -25.780 11.150  0.04 15.69 ? 302  LEU A HD21 1  
ATOM   3637   H HD22 . LEU A 1 246 ? 6.301   -26.413 10.648  0.04 16.04 ? 302  LEU A HD22 1  
ATOM   3638   H HD23 . LEU A 1 246 ? 7.519   -26.260 9.643   0.04 15.85 ? 302  LEU A HD23 1  
ATOM   3639   N N    . PRO A 1 247 ? 3.489   -26.254 6.750   0.04 16.43 ? 303  PRO A N    1  
ATOM   3640   C CA   . PRO A 1 247 ? 2.228   -26.094 5.991   0.04 16.62 ? 303  PRO A CA   1  
ATOM   3641   C C    . PRO A 1 247 ? 1.175   -25.417 6.872   0.04 16.42 ? 303  PRO A C    1  
ATOM   3642   O O    . PRO A 1 247 ? 1.284   -25.494 8.093   0.04 16.37 ? 303  PRO A O    1  
ATOM   3643   C CB   . PRO A 1 247 ? 1.849   -27.526 5.642   0.04 17.18 ? 303  PRO A CB   1  
ATOM   3644   C CG   . PRO A 1 247 ? 2.435   -28.363 6.752   0.04 17.31 ? 303  PRO A CG   1  
ATOM   3645   C CD   . PRO A 1 247 ? 3.679   -27.634 7.237   0.04 16.84 ? 303  PRO A CD   1  
ATOM   3646   H HA   . PRO A 1 247 ? 2.350   -25.594 5.172   0.04 16.59 ? 303  PRO A HA   1  
ATOM   3647   H HB2  . PRO A 1 247 ? 0.884   -27.606 5.627   0.04 17.22 ? 303  PRO A HB2  1  
ATOM   3648   H HB3  . PRO A 1 247 ? 2.226   -27.769 4.783   0.04 17.41 ? 303  PRO A HB3  1  
ATOM   3649   H HG2  . PRO A 1 247 ? 1.800   -28.493 7.463   0.04 17.59 ? 303  PRO A HG2  1  
ATOM   3650   H HG3  . PRO A 1 247 ? 2.697   -29.215 6.365   0.04 17.44 ? 303  PRO A HG3  1  
ATOM   3651   H HD2  . PRO A 1 247 ? 3.726   -27.647 8.206   0.04 16.83 ? 303  PRO A HD2  1  
ATOM   3652   H HD3  . PRO A 1 247 ? 4.474   -28.022 6.842   0.04 16.86 ? 303  PRO A HD3  1  
ATOM   3653   N N    . LEU A 1 248 ? 0.165   -24.767 6.296   0.04 16.36 ? 304  LEU A N    1  
ATOM   3654   C CA   . LEU A 1 248 ? -0.757  -24.005 7.148   0.04 16.21 ? 304  LEU A CA   1  
ATOM   3655   C C    . LEU A 1 248 ? -1.710  -24.878 8.021   0.04 16.54 ? 304  LEU A C    1  
ATOM   3656   O O    . LEU A 1 248 ? -2.251  -24.438 9.012   0.04 16.39 ? 304  LEU A O    1  
ATOM   3657   C CB   . LEU A 1 248 ? -1.481  -22.949 6.324   0.04 16.25 ? 304  LEU A CB   1  
ATOM   3658   C CG   . LEU A 1 248 ? -2.546  -22.129 7.042   0.04 16.16 ? 304  LEU A CG   1  
ATOM   3659   C CD1  . LEU A 1 248 ? -2.204  -20.631 7.096   0.04 15.64 ? 304  LEU A CD1  1  
ATOM   3660   C CD2  . LEU A 1 248 ? -3.853  -22.397 6.318   0.04 16.43 ? 304  LEU A CD2  1  
ATOM   3661   H H    . LEU A 1 248 ? -0.011  -24.756 5.456   0.04 16.42 ? 304  LEU A H    1  
ATOM   3662   H HA   . LEU A 1 248 ? -0.212  -23.503 7.775   0.04 15.89 ? 304  LEU A HA   1  
ATOM   3663   H HB2  . LEU A 1 248 ? -0.823  -22.323 5.990   0.04 16.04 ? 304  LEU A HB2  1  
ATOM   3664   H HB3  . LEU A 1 248 ? -1.909  -23.399 5.578   0.04 16.59 ? 304  LEU A HB3  1  
ATOM   3665   H HG   . LEU A 1 248 ? -2.651  -22.428 7.954   0.04 16.32 ? 304  LEU A HG   1  
ATOM   3666   H HD11 . LEU A 1 248 ? -2.766  -20.202 7.761   0.04 15.62 ? 304  LEU A HD11 1  
ATOM   3667   H HD12 . LEU A 1 248 ? -1.270  -20.532 7.347   0.04 15.51 ? 304  LEU A HD12 1  
ATOM   3668   H HD13 . LEU A 1 248 ? -2.355  -20.232 6.223   0.04 15.49 ? 304  LEU A HD13 1  
ATOM   3669   H HD21 . LEU A 1 248 ? -4.525  -21.775 6.643   0.04 16.27 ? 304  LEU A HD21 1  
ATOM   3670   H HD22 . LEU A 1 248 ? -3.722  -22.273 5.363   0.04 16.44 ? 304  LEU A HD22 1  
ATOM   3671   H HD23 . LEU A 1 248 ? -4.120  -23.305 6.485   0.04 16.77 ? 304  LEU A HD23 1  
ATOM   3672   N N    . ASP A 1 249 ? -1.890  -26.128 7.648   0.04 17.03 ? 305  ASP A N    1  
ATOM   3673   C CA   . ASP A 1 249 ? -2.490  -27.116 8.526   0.04 17.43 ? 305  ASP A CA   1  
ATOM   3674   C C    . ASP A 1 249 ? -1.875  -27.223 9.942   0.04 17.35 ? 305  ASP A C    1  
ATOM   3675   O O    . ASP A 1 249 ? -2.540  -27.672 10.886  0.04 17.65 ? 305  ASP A O    1  
ATOM   3676   C CB   . ASP A 1 249 ? -2.431  -28.467 7.826   0.04 17.99 ? 305  ASP A CB   1  
ATOM   3677   C CG   . ASP A 1 249 ? -1.387  -28.493 6.710   0.04 17.98 ? 305  ASP A CG   1  
ATOM   3678   O OD1  . ASP A 1 249 ? -0.432  -29.320 6.811   0.04 17.82 ? 305  ASP A OD1  1  
ATOM   3679   O OD2  . ASP A 1 249 ? -1.555  -27.694 5.716   0.04 18.18 ? 305  ASP A OD2  1  
ATOM   3680   H H    . ASP A 1 249 ? -1.706  -26.383 6.858   0.04 17.15 ? 305  ASP A H    1  
ATOM   3681   H HA   . ASP A 1 249 ? -3.425  -26.888 8.649   0.04 17.48 ? 305  ASP A HA   1  
ATOM   3682   H HB2  . ASP A 1 249 ? -2.240  -29.156 8.473   0.04 18.26 ? 305  ASP A HB2  1  
ATOM   3683   H HB3  . ASP A 1 249 ? -3.295  -28.629 7.417   0.04 18.12 ? 305  ASP A HB3  1  
ATOM   3684   N N    . GLN A 1 250 ? -0.619  -26.817 10.083  0.04 16.97 ? 306  GLN A N    1  
ATOM   3685   C CA   . GLN A 1 250 ? 0.003   -26.801 11.405  0.04 16.84 ? 306  GLN A CA   1  
ATOM   3686   C C    . GLN A 1 250 ? -0.111  -25.432 12.111  0.04 16.39 ? 306  GLN A C    1  
ATOM   3687   O O    . GLN A 1 250 ? 0.552   -25.218 13.132  0.04 16.23 ? 306  GLN A O    1  
ATOM   3688   C CB   . GLN A 1 250 ? 1.463   -27.292 11.327  0.04 16.78 ? 306  GLN A CB   1  
ATOM   3689   C CG   . GLN A 1 250 ? 1.739   -28.654 10.596  0.04 17.29 ? 306  GLN A CG   1  
ATOM   3690   C CD   . GLN A 1 250 ? 0.667   -29.742 10.706  0.04 17.75 ? 306  GLN A CD   1  
ATOM   3691   O OE1  . GLN A 1 250 ? 0.156   -30.081 11.793  0.04 17.84 ? 306  GLN A OE1  1  
ATOM   3692   N NE2  . GLN A 1 250 ? 0.378   -30.372 9.571   0.04 18.09 ? 306  GLN A NE2  1  
ATOM   3693   H H    . GLN A 1 250 ? -0.112  -26.558 9.442   0.04 16.81 ? 306  GLN A H    1  
ATOM   3694   H HA   . GLN A 1 250 ? -0.458  -27.444 11.963  0.04 17.13 ? 306  GLN A HA   1  
ATOM   3695   H HB2  . GLN A 1 250 ? 1.984   -26.617 10.865  0.04 16.53 ? 306  GLN A HB2  1  
ATOM   3696   H HB3  . GLN A 1 250 ? 1.798   -27.388 12.231  0.04 16.69 ? 306  GLN A HB3  1  
ATOM   3697   H HG2  . GLN A 1 250 ? 1.864   -28.458 9.657   0.04 17.35 ? 306  GLN A HG2  1  
ATOM   3698   H HG3  . GLN A 1 250 ? 2.562   -29.034 10.942  0.04 17.29 ? 306  GLN A HG3  1  
ATOM   3699   H HE21 . GLN A 1 250 ? 0.565   -30.016 8.815   0.04 18.02 ? 306  GLN A HE21 1  
ATOM   3700   H HE22 . GLN A 1 250 ? -0.017  -31.135 9.617   0.04 18.40 ? 306  GLN A HE22 1  
ATOM   3701   N N    . PHE A 1 251 ? -0.934  -24.516 11.577  0.04 16.22 ? 307  PHE A N    1  
ATOM   3702   C CA   . PHE A 1 251 ? -1.261  -23.235 12.247  0.04 15.86 ? 307  PHE A CA   1  
ATOM   3703   C C    . PHE A 1 251 ? -2.724  -23.175 12.700  0.04 16.10 ? 307  PHE A C    1  
ATOM   3704   O O    . PHE A 1 251 ? -3.597  -23.516 11.927  0.04 16.40 ? 307  PHE A O    1  
ATOM   3705   C CB   . PHE A 1 251 ? -1.069  -22.024 11.310  0.04 15.48 ? 307  PHE A CB   1  
ATOM   3706   C CG   . PHE A 1 251 ? 0.365   -21.656 11.069  0.04 15.16 ? 307  PHE A CG   1  
ATOM   3707   C CD1  . PHE A 1 251 ? 1.154   -22.424 10.256  0.04 15.30 ? 307  PHE A CD1  1  
ATOM   3708   C CD2  . PHE A 1 251 ? 0.899   -20.505 11.637  0.04 14.74 ? 307  PHE A CD2  1  
ATOM   3709   C CE1  . PHE A 1 251 ? 2.456   -22.082 10.039  0.04 15.05 ? 307  PHE A CE1  1  
ATOM   3710   C CE2  . PHE A 1 251 ? 2.204   -20.169 11.442  0.04 14.49 ? 307  PHE A CE2  1  
ATOM   3711   C CZ   . PHE A 1 251 ? 2.990   -20.954 10.652  0.04 14.65 ? 307  PHE A CZ   1  
ATOM   3712   H H    . PHE A 1 251 ? -1.326  -24.611 10.817  0.04 16.34 ? 307  PHE A H    1  
ATOM   3713   H HA   . PHE A 1 251 ? -0.702  -23.110 13.026  0.04 15.72 ? 307  PHE A HA   1  
ATOM   3714   H HB2  . PHE A 1 251 ? -1.474  -22.221 10.448  0.04 15.63 ? 307  PHE A HB2  1  
ATOM   3715   H HB3  . PHE A 1 251 ? -1.508  -21.255 11.707  0.04 15.32 ? 307  PHE A HB3  1  
ATOM   3716   H HD1  . PHE A 1 251 ? 0.805   -23.190 9.862   0.04 15.60 ? 307  PHE A HD1  1  
ATOM   3717   H HD2  . PHE A 1 251 ? 0.370   -19.982 12.197  0.04 14.66 ? 307  PHE A HD2  1  
ATOM   3718   H HE1  . PHE A 1 251 ? 2.992   -22.615 9.500   0.04 15.17 ? 307  PHE A HE1  1  
ATOM   3719   H HE2  . PHE A 1 251 ? 2.555   -19.408 11.840  0.04 14.25 ? 307  PHE A HE2  1  
ATOM   3720   H HZ   . PHE A 1 251 ? 3.875   -20.715 10.495  0.04 14.50 ? 307  PHE A HZ   1  
ATOM   3721   N N    . TYR A 1 252 ? -2.969  -22.693 13.922  0.04 15.98 ? 308  TYR A N    1  
ATOM   3722   C CA   . TYR A 1 252 ? -4.309  -22.221 14.306  0.04 16.10 ? 308  TYR A CA   1  
ATOM   3723   C C    . TYR A 1 252 ? -4.489  -20.883 13.624  0.04 15.75 ? 308  TYR A C    1  
ATOM   3724   O O    . TYR A 1 252 ? -3.598  -20.037 13.656  0.04 15.34 ? 308  TYR A O    1  
ATOM   3725   C CB   . TYR A 1 252 ? -4.444  -22.050 15.833  0.04 16.12 ? 308  TYR A CB   1  
ATOM   3726   C CG   . TYR A 1 252 ? -5.766  -21.438 16.359  0.04 16.29 ? 308  TYR A CG   1  
ATOM   3727   C CD1  . TYR A 1 252 ? -6.974  -21.530 15.667  0.04 16.77 ? 308  TYR A CD1  1  
ATOM   3728   C CD2  . TYR A 1 252 ? -5.768  -20.726 17.548  0.04 16.02 ? 308  TYR A CD2  1  
ATOM   3729   C CE1  . TYR A 1 252 ? -8.153  -20.963 16.199  0.04 16.98 ? 308  TYR A CE1  1  
ATOM   3730   C CE2  . TYR A 1 252 ? -6.907  -20.168 18.065  0.04 16.21 ? 308  TYR A CE2  1  
ATOM   3731   C CZ   . TYR A 1 252 ? -8.096  -20.269 17.391  0.04 16.68 ? 308  TYR A CZ   1  
ATOM   3732   O OH   . TYR A 1 252 ? -9.225  -19.677 17.962  0.04 16.90 ? 308  TYR A OH   1  
ATOM   3733   H H    . TYR A 1 252 ? -2.383  -22.625 14.540  0.04 15.85 ? 308  TYR A H    1  
ATOM   3734   H HA   . TYR A 1 252 ? -4.985  -22.836 13.989  0.04 16.43 ? 308  TYR A HA   1  
ATOM   3735   H HB2  . TYR A 1 252 ? -4.346  -22.924 16.240  0.04 16.36 ? 308  TYR A HB2  1  
ATOM   3736   H HB3  . TYR A 1 252 ? -3.729  -21.478 16.142  0.04 15.81 ? 308  TYR A HB3  1  
ATOM   3737   H HD1  . TYR A 1 252 ? -7.013  -22.001 14.865  0.04 16.99 ? 308  TYR A HD1  1  
ATOM   3738   H HD2  . TYR A 1 252 ? -4.975  -20.643 18.027  0.04 15.71 ? 308  TYR A HD2  1  
ATOM   3739   H HE1  . TYR A 1 252 ? -8.957  -21.034 15.738  0.04 17.33 ? 308  TYR A HE1  1  
ATOM   3740   H HE2  . TYR A 1 252 ? -6.868  -19.704 18.870  0.04 16.04 ? 308  TYR A HE2  1  
ATOM   3741   H HH   . TYR A 1 252 ? -9.793  -19.507 17.367  0.04 17.23 ? 308  TYR A HH   1  
ATOM   3742   N N    . VAL A 1 253 ? -5.636  -20.709 12.986  0.04 15.94 ? 309  VAL A N    1  
ATOM   3743   C CA   . VAL A 1 253 ? -5.933  -19.495 12.261  0.04 15.68 ? 309  VAL A CA   1  
ATOM   3744   C C    . VAL A 1 253 ? -6.784  -18.645 13.185  0.04 15.74 ? 309  VAL A C    1  
ATOM   3745   O O    . VAL A 1 253 ? -7.959  -18.959 13.431  0.04 16.15 ? 309  VAL A O    1  
ATOM   3746   C CB   . VAL A 1 253 ? -6.622  -19.853 10.937  0.04 15.87 ? 309  VAL A CB   1  
ATOM   3747   C CG1  . VAL A 1 253 ? -7.080  -18.600 10.220  0.04 15.62 ? 309  VAL A CG1  1  
ATOM   3748   C CG2  . VAL A 1 253 ? -5.694  -20.730 10.035  0.04 15.82 ? 309  VAL A CG2  1  
ATOM   3749   H H    . VAL A 1 253 ? -6.268  -21.293 12.960  0.04 16.25 ? 309  VAL A H    1  
ATOM   3750   H HA   . VAL A 1 253 ? -5.112  -19.018 12.063  0.04 15.36 ? 309  VAL A HA   1  
ATOM   3751   H HB   . VAL A 1 253 ? -7.409  -20.381 11.144  0.04 16.20 ? 309  VAL A HB   1  
ATOM   3752   H HG11 . VAL A 1 253 ? -7.317  -18.827 9.309   0.04 15.82 ? 309  VAL A HG11 1  
ATOM   3753   H HG12 . VAL A 1 253 ? -7.848  -18.235 10.687  0.04 15.61 ? 309  VAL A HG12 1  
ATOM   3754   H HG13 . VAL A 1 253 ? -6.362  -17.951 10.223  0.04 15.33 ? 309  VAL A HG13 1  
ATOM   3755   H HG21 . VAL A 1 253 ? -6.099  -20.819 9.158   0.04 16.04 ? 309  VAL A HG21 1  
ATOM   3756   H HG22 . VAL A 1 253 ? -4.828  -20.300 9.955   0.04 15.51 ? 309  VAL A HG22 1  
ATOM   3757   H HG23 . VAL A 1 253 ? -5.593  -21.604 10.445  0.04 15.92 ? 309  VAL A HG23 1  
ATOM   3758   N N    . VAL A 1 254 ? -6.157  -17.627 13.789  0.04 15.37 ? 310  VAL A N    1  
ATOM   3759   C CA   . VAL A 1 254 ? -6.797  -16.717 14.766  0.04 15.39 ? 310  VAL A CA   1  
ATOM   3760   C C    . VAL A 1 254 ? -7.752  -15.783 14.010  0.04 15.33 ? 310  VAL A C    1  
ATOM   3761   O O    . VAL A 1 254 ? -7.351  -15.145 13.044  0.04 15.03 ? 310  VAL A O    1  
ATOM   3762   C CB   . VAL A 1 254 ? -5.755  -15.884 15.577  0.04 15.08 ? 310  VAL A CB   1  
ATOM   3763   C CG1  . VAL A 1 254 ? -6.479  -14.834 16.423  0.04 15.29 ? 310  VAL A CG1  1  
ATOM   3764   C CG2  . VAL A 1 254 ? -4.944  -16.738 16.493  0.04 15.04 ? 310  VAL A CG2  1  
ATOM   3765   H H    . VAL A 1 254 ? -5.334  -17.431 13.634  0.04 15.11 ? 310  VAL A H    1  
ATOM   3766   H HA   . VAL A 1 254 ? -7.313  -17.232 15.403  0.04 15.70 ? 310  VAL A HA   1  
ATOM   3767   H HB   . VAL A 1 254 ? -5.155  -15.448 14.972  0.04 14.80 ? 310  VAL A HB   1  
ATOM   3768   H HG11 . VAL A 1 254 ? -5.889  -14.519 17.124  0.04 15.07 ? 310  VAL A HG11 1  
ATOM   3769   H HG12 . VAL A 1 254 ? -6.739  -14.095 15.852  0.04 15.42 ? 310  VAL A HG12 1  
ATOM   3770   H HG13 . VAL A 1 254 ? -7.264  -15.240 16.815  0.04 15.53 ? 310  VAL A HG13 1  
ATOM   3771   H HG21 . VAL A 1 254 ? -4.529  -16.174 17.166  0.04 14.76 ? 310  VAL A HG21 1  
ATOM   3772   H HG22 . VAL A 1 254 ? -5.525  -17.391 16.915  0.04 15.26 ? 310  VAL A HG22 1  
ATOM   3773   H HG23 . VAL A 1 254 ? -4.257  -17.185 15.974  0.04 15.08 ? 310  VAL A HG23 1  
ATOM   3774   N N    . LYS A 1 255 ? -9.009  -15.743 14.449  0.04 15.65 ? 311  LYS A N    1  
ATOM   3775   C CA   . LYS A 1 255 ? -9.999  -14.722 14.044  0.04 15.66 ? 311  LYS A CA   1  
ATOM   3776   C C    . LYS A 1 255 ? -10.771 -14.155 15.234  0.04 15.77 ? 311  LYS A C    1  
ATOM   3777   O O    . LYS A 1 255 ? -10.693 -14.710 16.342  0.04 15.88 ? 311  LYS A O    1  
ATOM   3778   C CB   . LYS A 1 255 ? -10.987 -15.332 13.059  0.04 16.06 ? 311  LYS A CB   1  
ATOM   3779   C CG   . LYS A 1 255 ? -10.386 -15.414 11.671  0.04 15.90 ? 311  LYS A CG   1  
ATOM   3780   C CD   . LYS A 1 255 ? -11.293 -16.006 10.625  0.04 16.33 ? 311  LYS A CD   1  
ATOM   3781   C CE   . LYS A 1 255 ? -10.665 -17.296 10.098  0.04 16.52 ? 311  LYS A CE   1  
ATOM   3782   N NZ   . LYS A 1 255 ? -11.350 -17.956 8.945   0.04 16.90 ? 311  LYS A NZ   1  
ATOM   3783   H H    . LYS A 1 255 ? -9.328  -16.322 14.996  0.04 15.90 ? 311  LYS A H    1  
ATOM   3784   H HA   . LYS A 1 255 ? -9.538  -13.988 13.610  0.04 15.37 ? 311  LYS A HA   1  
ATOM   3785   H HB2  . LYS A 1 255 ? -11.209 -16.232 13.345  0.04 16.29 ? 311  LYS A HB2  1  
ATOM   3786   H HB3  . LYS A 1 255 ? -11.791 -14.793 13.024  0.04 16.25 ? 311  LYS A HB3  1  
ATOM   3787   H HG2  . LYS A 1 255 ? -10.160 -14.508 11.393  0.04 15.75 ? 311  LYS A HG2  1  
ATOM   3788   H HG3  . LYS A 1 255 ? -9.582  -15.954 11.705  0.04 15.70 ? 311  LYS A HG3  1  
ATOM   3789   H HD2  . LYS A 1 255 ? -12.161 -16.198 11.013  0.04 16.62 ? 311  LYS A HD2  1  
ATOM   3790   H HD3  . LYS A 1 255 ? -11.372 -15.387 9.881   0.04 16.24 ? 311  LYS A HD3  1  
ATOM   3791   H HE2  . LYS A 1 255 ? -9.745  -17.146 9.853   0.04 16.24 ? 311  LYS A HE2  1  
ATOM   3792   H HE3  . LYS A 1 255 ? -10.693 -17.931 10.831  0.04 16.69 ? 311  LYS A HE3  1  
ATOM   3793   H HZ1  . LYS A 1 255 ? -11.559 -18.796 9.167   0.04 17.12 ? 311  LYS A HZ1  1  
ATOM   3794   H HZ2  . LYS A 1 255 ? -12.096 -17.525 8.732   0.04 17.09 ? 311  LYS A HZ2  1  
ATOM   3795   H HZ3  . LYS A 1 255 ? -10.798 -17.975 8.244   0.04 16.74 ? 311  LYS A HZ3  1  
ATOM   3796   N N    . PRO A 1 256 ? -11.541 -13.047 15.030  0.04 15.76 ? 312  PRO A N    1  
ATOM   3797   C CA   . PRO A 1 256 ? -12.492 -12.733 16.128  0.04 16.00 ? 312  PRO A CA   1  
ATOM   3798   C C    . PRO A 1 256 ? -13.414 -13.901 16.459  0.04 16.51 ? 312  PRO A C    1  
ATOM   3799   O O    . PRO A 1 256 ? -13.900 -14.664 15.591  0.04 16.87 ? 312  PRO A O    1  
ATOM   3800   C CB   . PRO A 1 256 ? -13.316 -11.555 15.590  0.04 16.07 ? 312  PRO A CB   1  
ATOM   3801   C CG   . PRO A 1 256 ? -12.550 -11.024 14.388  0.04 15.66 ? 312  PRO A CG   1  
ATOM   3802   C CD   . PRO A 1 256 ? -11.760 -12.200 13.839  0.04 15.64 ? 312  PRO A CD   1  
ATOM   3803   H HA   . PRO A 1 256 ? -12.016 -12.455 16.928  0.04 15.80 ? 312  PRO A HA   1  
ATOM   3804   H HB2  . PRO A 1 256 ? -14.195 -11.861 15.322  0.04 16.39 ? 312  PRO A HB2  1  
ATOM   3805   H HB3  . PRO A 1 256 ? -13.386 -10.875 16.279  0.04 16.06 ? 312  PRO A HB3  1  
ATOM   3806   H HG2  . PRO A 1 256 ? -13.169 -10.692 13.720  0.04 15.75 ? 312  PRO A HG2  1  
ATOM   3807   H HG3  . PRO A 1 256 ? -11.957 -10.315 14.682  0.04 15.38 ? 312  PRO A HG3  1  
ATOM   3808   H HD2  . PRO A 1 256 ? -12.284 -12.681 13.182  0.04 15.88 ? 312  PRO A HD2  1  
ATOM   3809   H HD3  . PRO A 1 256 ? -10.912 -11.899 13.477  0.04 15.34 ? 312  PRO A HD3  1  
ATOM   3810   N N    . GLY A 1 257 ? -13.636 -14.035 17.769  0.04 16.56 ? 313  GLY A N    1  
ATOM   3811   C CA   . GLY A 1 257 ? -14.258 -15.204 18.364  0.04 17.03 ? 313  GLY A CA   1  
ATOM   3812   C C    . GLY A 1 257 ? -13.256 -15.919 19.262  0.04 16.98 ? 313  GLY A C    1  
ATOM   3813   O O    . GLY A 1 257 ? -13.594 -16.380 20.348  0.04 17.32 ? 313  GLY A O    1  
ATOM   3814   H H    . GLY A 1 257 ? -13.430 -13.429 18.348  0.04 16.33 ? 313  GLY A H    1  
ATOM   3815   H HA2  . GLY A 1 257 ? -15.004 -14.906 18.906  0.04 17.16 ? 313  GLY A HA2  1  
ATOM   3816   H HA3  . GLY A 1 257 ? -14.584 -15.810 17.683  0.04 17.32 ? 313  GLY A HA3  1  
ATOM   3817   N N    . ALA A 1 258 ? -12.001 -15.996 18.828  0.04 16.59 ? 314  ALA A N    1  
ATOM   3818   C CA   . ALA A 1 258 ? -11.012 -16.727 19.611  0.04 16.51 ? 314  ALA A CA   1  
ATOM   3819   C C    . ALA A 1 258 ? -10.691 -16.116 20.966  0.04 16.41 ? 314  ALA A C    1  
ATOM   3820   O O    . ALA A 1 258 ? -10.444 -14.922 21.097  0.04 16.24 ? 314  ALA A O    1  
ATOM   3821   C CB   . ALA A 1 258 ? -9.779  -16.884 18.845  0.04 16.08 ? 314  ALA A CB   1  
ATOM   3822   H H    . ALA A 1 258 ? -11.709 -15.652 18.096  0.04 16.40 ? 314  ALA A H    1  
ATOM   3823   H HA   . ALA A 1 258 ? -11.352 -17.617 19.777  0.04 16.82 ? 314  ALA A HA   1  
ATOM   3824   H HB1  . ALA A 1 258 ? -9.193  -17.493 19.320  0.04 16.15 ? 314  ALA A HB1  1  
ATOM   3825   H HB2  . ALA A 1 258 ? -9.993  -17.244 17.967  0.04 16.08 ? 314  ALA A HB2  1  
ATOM   3826   H HB3  . ALA A 1 258 ? -9.360  -16.012 18.753  0.04 15.78 ? 314  ALA A HB3  1  
ATOM   3827   N N    . THR A 1 259 ? -10.612 -16.984 21.966  0.04 16.49 ? 315  THR A N    1  
ATOM   3828   C CA   . THR A 1 259 ? -10.249 -16.570 23.313  0.04 16.47 ? 315  THR A CA   1  
ATOM   3829   C C    . THR A 1 259 ? -8.757  -16.827 23.607  0.04 16.30 ? 315  THR A C    1  
ATOM   3830   O O    . THR A 1 259 ? -8.055  -17.544 22.869  0.04 16.33 ? 315  THR A O    1  
ATOM   3831   C CB   . THR A 1 259 ? -11.157 -17.246 24.374  0.04 17.00 ? 315  THR A CB   1  
ATOM   3832   O OG1  . THR A 1 259 ? -10.714 -18.589 24.609  0.04 17.40 ? 315  THR A OG1  1  
ATOM   3833   C CG2  . THR A 1 259 ? -12.660 -17.231 23.928  0.04 17.15 ? 315  THR A CG2  1  
ATOM   3834   H H    . THR A 1 259 ? -10.754 -17.827 21.882  0.04 16.58 ? 315  THR A H    1  
ATOM   3835   H HA   . THR A 1 259 ? -10.397 -15.616 23.398  0.04 16.24 ? 315  THR A HA   1  
ATOM   3836   H HB   . THR A 1 259 ? -11.091 -16.741 25.200  0.04 17.02 ? 315  THR A HB   1  
ATOM   3837   H HG1  . THR A 1 259 ? -9.994  -18.584 25.031  0.04 17.52 ? 315  THR A HG1  1  
ATOM   3838   H HG21 . THR A 1 259 ? -13.221 -16.991 24.683  0.04 17.49 ? 315  THR A HG21 1  
ATOM   3839   H HG22 . THR A 1 259 ? -12.790 -16.572 23.227  0.04 16.87 ? 315  THR A HG22 1  
ATOM   3840   H HG23 . THR A 1 259 ? -12.935 -18.098 23.592  0.04 17.22 ? 315  THR A HG23 1  
ATOM   3841   N N    . ALA A 1 260 ? -8.251  -16.216 24.665  0.04 16.15 ? 316  ALA A N    1  
ATOM   3842   C CA   . ALA A 1 260 ? -6.875  -16.491 25.065  0.04 15.94 ? 316  ALA A CA   1  
ATOM   3843   C C    . ALA A 1 260 ? -6.700  -17.973 25.442  0.04 16.34 ? 316  ALA A C    1  
ATOM   3844   O O    . ALA A 1 260 ? -5.721  -18.615 25.086  0.04 16.28 ? 316  ALA A O    1  
ATOM   3845   C CB   . ALA A 1 260 ? -6.455  -15.592 26.229  0.04 15.79 ? 316  ALA A CB   1  
ATOM   3846   H H    . ALA A 1 260 ? -8.667  -15.650 25.156  0.04 16.19 ? 316  ALA A H    1  
ATOM   3847   H HA   . ALA A 1 260 ? -6.297  -16.293 24.314  0.04 15.68 ? 316  ALA A HA   1  
ATOM   3848   H HB1  . ALA A 1 260 ? -5.598  -15.903 26.559  0.04 15.93 ? 316  ALA A HB1  1  
ATOM   3849   H HB2  . ALA A 1 260 ? -6.375  -14.681 25.909  0.04 15.45 ? 316  ALA A HB2  1  
ATOM   3850   H HB3  . ALA A 1 260 ? -7.118  -15.644 26.936  0.04 15.91 ? 316  ALA A HB3  1  
ATOM   3851   N N    . GLU A 1 261 ? -7.665  -18.500 26.173  0.04 16.81 ? 317  GLU A N    1  
ATOM   3852   C CA   . GLU A 1 261 ? -7.728  -19.924 26.476  0.04 17.28 ? 317  GLU A CA   1  
ATOM   3853   C C    . GLU A 1 261 ? -7.571  -20.813 25.231  0.04 17.27 ? 317  GLU A C    1  
ATOM   3854   O O    . GLU A 1 261 ? -6.856  -21.822 25.249  0.04 17.36 ? 317  GLU A O    1  
ATOM   3855   C CB   . GLU A 1 261 ? -9.072  -20.216 27.185  0.04 17.80 ? 317  GLU A CB   1  
ATOM   3856   C CG   . GLU A 1 261 ? -9.330  -21.670 27.437  0.04 18.34 ? 317  GLU A CG   1  
ATOM   3857   C CD   . GLU A 1 261 ? -8.494  -22.217 28.533  0.04 18.30 ? 317  GLU A CD   1  
ATOM   3858   O OE1  . GLU A 1 261 ? -7.819  -21.437 29.207  0.04 17.90 ? 317  GLU A OE1  1  
ATOM   3859   O OE2  . GLU A 1 261 ? -8.528  -23.444 28.699  0.04 18.71 ? 317  GLU A OE2  1  
ATOM   3860   H H    . GLU A 1 261 ? -8.312  -18.048 26.516  0.04 16.88 ? 317  GLU A H    1  
ATOM   3861   H HA   . GLU A 1 261 ? -7.003  -20.138 27.087  0.04 17.29 ? 317  GLU A HA   1  
ATOM   3862   H HB2  . GLU A 1 261 ? -9.093  -19.751 28.036  0.04 17.75 ? 317  GLU A HB2  1  
ATOM   3863   H HB3  . GLU A 1 261 ? -9.792  -19.886 26.626  0.04 17.88 ? 317  GLU A HB3  1  
ATOM   3864   H HG2  . GLU A 1 261 ? -10.257 -21.808 27.673  0.04 18.69 ? 317  GLU A HG2  1  
ATOM   3865   H HG3  . GLU A 1 261 ? -9.112  -22.180 26.650  0.04 18.41 ? 317  GLU A HG3  1  
ATOM   3866   N N    . THR A 1 262 ? -8.247  -20.441 24.154  0.04 17.19 ? 318  THR A N    1  
ATOM   3867   C CA   . THR A 1 262 ? -8.236  -21.246 22.925  0.04 17.26 ? 318  THR A CA   1  
ATOM   3868   C C    . THR A 1 262 ? -6.879  -21.135 22.243  0.04 16.81 ? 318  THR A C    1  
ATOM   3869   O O    . THR A 1 262 ? -6.334  -22.130 21.761  0.04 16.94 ? 318  THR A O    1  
ATOM   3870   C CB   . THR A 1 262 ? -9.380  -20.840 22.001  0.04 17.37 ? 318  THR A CB   1  
ATOM   3871   O OG1  . THR A 1 262 ? -10.635 -21.219 22.608  0.04 17.86 ? 318  THR A OG1  1  
ATOM   3872   C CG2  . THR A 1 262 ? -9.287  -21.512 20.631  0.04 17.50 ? 318  THR A CG2  1  
ATOM   3873   H H    . THR A 1 262 ? -8.707  -19.719 24.096  0.04 17.12 ? 318  THR A H    1  
ATOM   3874   H HA   . THR A 1 262 ? -8.362  -22.180 23.157  0.04 17.59 ? 318  THR A HA   1  
ATOM   3875   H HB   . THR A 1 262 ? -9.356  -19.881 21.863  0.04 17.06 ? 318  THR A HB   1  
ATOM   3876   H HG1  . THR A 1 262 ? -10.528 -21.904 23.079  0.04 18.08 ? 318  THR A HG1  1  
ATOM   3877   H HG21 . THR A 1 262 ? -9.994  -21.182 20.056  0.04 17.63 ? 318  THR A HG21 1  
ATOM   3878   H HG22 . THR A 1 262 ? -8.435  -21.327 20.208  0.04 17.19 ? 318  THR A HG22 1  
ATOM   3879   H HG23 . THR A 1 262 ? -9.389  -22.472 20.732  0.04 17.81 ? 318  THR A HG23 1  
ATOM   3880   N N    . ILE A 1 263 ? -6.330  -19.928 22.206  0.04 16.33 ? 319  ILE A N    1  
ATOM   3881   C CA   . ILE A 1 263 ? -5.068  -19.708 21.520  0.04 15.91 ? 319  ILE A CA   1  
ATOM   3882   C C    . ILE A 1 263 ? -3.932  -20.446 22.249  0.04 16.00 ? 319  ILE A C    1  
ATOM   3883   O O    . ILE A 1 263 ? -2.999  -20.981 21.602  0.04 15.97 ? 319  ILE A O    1  
ATOM   3884   C CB   . ILE A 1 263 ? -4.746  -18.192 21.393  0.04 15.45 ? 319  ILE A CB   1  
ATOM   3885   C CG1  . ILE A 1 263 ? -5.705  -17.513 20.411  0.04 15.39 ? 319  ILE A CG1  1  
ATOM   3886   C CG2  . ILE A 1 263 ? -3.327  -18.010 20.952  0.04 15.06 ? 319  ILE A CG2  1  
ATOM   3887   C CD1  . ILE A 1 263 ? -5.823  -15.987 20.586  0.04 15.07 ? 319  ILE A CD1  1  
ATOM   3888   H H    . ILE A 1 263 ? -6.667  -19.231 22.578  0.04 16.26 ? 319  ILE A H    1  
ATOM   3889   H HA   . ILE A 1 263 ? -5.145  -20.079 20.628  0.04 15.92 ? 319  ILE A HA   1  
ATOM   3890   H HB   . ILE A 1 263 ? -4.853  -17.783 22.268  0.04 15.49 ? 319  ILE A HB   1  
ATOM   3891   H HG12 . ILE A 1 263 ? -5.386  -17.682 19.509  0.04 15.30 ? 319  ILE A HG12 1  
ATOM   3892   H HG13 . ILE A 1 263 ? -6.593  -17.892 20.522  0.04 15.69 ? 319  ILE A HG13 1  
ATOM   3893   H HG21 . ILE A 1 263 ? -3.198  -17.088 20.686  0.04 14.81 ? 319  ILE A HG21 1  
ATOM   3894   H HG22 . ILE A 1 263 ? -2.724  -18.231 21.679  0.04 15.14 ? 319  ILE A HG22 1  
ATOM   3895   H HG23 . ILE A 1 263 ? -3.170  -18.595 20.196  0.04 15.02 ? 319  ILE A HG23 1  
ATOM   3896   H HD11 . ILE A 1 263 ? -6.556  -15.656 20.043  0.04 15.03 ? 319  ILE A HD11 1  
ATOM   3897   H HD12 . ILE A 1 263 ? -5.993  -15.791 21.521  0.04 15.21 ? 319  ILE A HD12 1  
ATOM   3898   H HD13 . ILE A 1 263 ? -4.989  -15.573 20.310  0.04 14.80 ? 319  ILE A HD13 1  
ATOM   3899   N N    . ASN A 1 264 ? -4.010  -20.454 23.584  0.04 16.14 ? 320  ASN A N    1  
ATOM   3900   C CA   . ASN A 1 264 ? -3.055  -21.160 24.418  0.04 16.24 ? 320  ASN A CA   1  
ATOM   3901   C C    . ASN A 1 264 ? -3.115  -22.667 24.262  0.04 16.71 ? 320  ASN A C    1  
ATOM   3902   O O    . ASN A 1 264 ? -2.084  -23.320 24.242  0.04 16.72 ? 320  ASN A O    1  
ATOM   3903   C CB   . ASN A 1 264 ? -3.262  -20.752 25.876  0.04 16.30 ? 320  ASN A CB   1  
ATOM   3904   C CG   . ASN A 1 264 ? -2.760  -19.354 26.142  0.04 15.81 ? 320  ASN A CG   1  
ATOM   3905   O OD1  . ASN A 1 264 ? -2.016  -18.811 25.352  0.04 15.42 ? 320  ASN A OD1  1  
ATOM   3906   N ND2  . ASN A 1 264 ? -3.156  -18.772 27.250  0.04 15.86 ? 320  ASN A ND2  1  
ATOM   3907   H H    . ASN A 1 264 ? -4.619  -20.048 24.032  0.04 16.20 ? 320  ASN A H    1  
ATOM   3908   H HA   . ASN A 1 264 ? -2.157  -20.897 24.151  0.04 15.97 ? 320  ASN A HA   1  
ATOM   3909   H HB2  . ASN A 1 264 ? -4.211  -20.775 26.078  0.04 16.54 ? 320  ASN A HB2  1  
ATOM   3910   H HB3  . ASN A 1 264 ? -2.783  -21.364 26.458  0.04 16.43 ? 320  ASN A HB3  1  
ATOM   3911   H HD21 . ASN A 1 264 ? -3.118  -17.917 27.326  0.04 15.73 ? 320  ASN A HD21 1  
ATOM   3912   H HD22 . ASN A 1 264 ? -3.462  -19.249 27.895  0.04 16.04 ? 320  ASN A HD22 1  
ATOM   3913   N N    . ALA A 1 265 ? -4.327  -23.183 24.162  0.04 17.11 ? 321  ALA A N    1  
ATOM   3914   C CA   . ALA A 1 265 ? -4.541  -24.627 24.010  0.04 17.59 ? 321  ALA A CA   1  
ATOM   3915   C C    . ALA A 1 265 ? -4.046  -25.133 22.654  0.04 17.42 ? 321  ALA A C    1  
ATOM   3916   O O    . ALA A 1 265 ? -3.701  -26.315 22.549  0.04 17.64 ? 321  ALA A O    1  
ATOM   3917   C CB   . ALA A 1 265 ? -6.002  -24.974 24.219  0.04 18.04 ? 321  ALA A CB   1  
ATOM   3918   H H    . ALA A 1 265 ? -5.051  -22.720 24.177  0.04 17.14 ? 321  ALA A H    1  
ATOM   3919   H HA   . ALA A 1 265 ? -4.031  -25.090 24.692  0.04 17.77 ? 321  ALA A HA   1  
ATOM   3920   H HB1  . ALA A 1 265 ? -6.102  -25.937 24.199  0.04 18.38 ? 321  ALA A HB1  1  
ATOM   3921   H HB2  . ALA A 1 265 ? -6.282  -24.631 25.081  0.04 18.16 ? 321  ALA A HB2  1  
ATOM   3922   H HB3  . ALA A 1 265 ? -6.530  -24.570 23.514  0.04 17.89 ? 321  ALA A HB3  1  
ATOM   3923   N N    . ALA A 1 266 ? -4.031  -24.259 21.635  0.04 17.08 ? 322  ALA A N    1  
ATOM   3924   C CA   . ALA A 1 266 ? -3.390  -24.581 20.350  0.04 16.93 ? 322  ALA A CA   1  
ATOM   3925   C C    . ALA A 1 266 ? -1.844  -24.709 20.422  0.04 16.72 ? 322  ALA A C    1  
ATOM   3926   O O    . ALA A 1 266 ? -1.304  -25.714 19.991  0.04 16.91 ? 322  ALA A O    1  
ATOM   3927   C CB   . ALA A 1 266 ? -3.808  -23.575 19.257  0.04 16.55 ? 322  ALA A CB   1  
ATOM   3928   H H    . ALA A 1 266 ? -4.383  -23.475 21.666  0.04 16.96 ? 322  ALA A H    1  
ATOM   3929   H HA   . ALA A 1 266 ? -3.722  -25.445 20.065  0.04 17.25 ? 322  ALA A HA   1  
ATOM   3930   H HB1  . ALA A 1 266 ? -3.282  -23.739 18.460  0.04 16.47 ? 322  ALA A HB1  1  
ATOM   3931   H HB2  . ALA A 1 266 ? -4.748  -23.692 19.060  0.04 16.72 ? 322  ALA A HB2  1  
ATOM   3932   H HB3  . ALA A 1 266 ? -3.637  -22.673 19.576  0.04 16.24 ? 322  ALA A HB3  1  
ATOM   3933   N N    . VAL A 1 267 ? -1.131  -23.708 20.948  0.04 16.37 ? 323  VAL A N    1  
ATOM   3934   C CA   . VAL A 1 267 ? 0.347   -23.781 21.042  0.04 16.22 ? 323  VAL A CA   1  
ATOM   3935   C C    . VAL A 1 267 ? 0.803   -25.000 21.898  0.04 16.73 ? 323  VAL A C    1  
ATOM   3936   O O    . VAL A 1 267 ? 1.778   -25.698 21.579  0.04 16.79 ? 323  VAL A O    1  
ATOM   3937   C CB   . VAL A 1 267 ? 0.971   -22.456 21.565  0.04 15.90 ? 323  VAL A CB   1  
ATOM   3938   C CG1  . VAL A 1 267 ? 2.488   -22.497 21.438  0.04 15.72 ? 323  VAL A CG1  1  
ATOM   3939   C CG2  . VAL A 1 267 ? 0.401   -21.259 20.796  0.04 15.50 ? 323  VAL A CG2  1  
ATOM   3940   H H    . VAL A 1 267 ? -1.470  -22.981 21.256  0.04 16.23 ? 323  VAL A H    1  
ATOM   3941   H HA   . VAL A 1 267 ? 0.694   -23.915 20.151  0.04 16.05 ? 323  VAL A HA   1  
ATOM   3942   H HB   . VAL A 1 267 ? 0.750   -22.352 22.503  0.04 16.11 ? 323  VAL A HB   1  
ATOM   3943   H HG11 . VAL A 1 267 ? 2.854   -21.635 21.693  0.04 15.50 ? 323  VAL A HG11 1  
ATOM   3944   H HG12 . VAL A 1 267 ? 2.845   -23.186 22.015  0.04 16.00 ? 323  VAL A HG12 1  
ATOM   3945   H HG13 . VAL A 1 267 ? 2.724   -22.679 20.515  0.04 15.57 ? 323  VAL A HG13 1  
ATOM   3946   H HG21 . VAL A 1 267 ? 0.936   -20.473 20.981  0.04 15.29 ? 323  VAL A HG21 1  
ATOM   3947   H HG22 . VAL A 1 267 ? 0.407   -21.449 19.849  0.04 15.36 ? 323  VAL A HG22 1  
ATOM   3948   H HG23 . VAL A 1 267 ? -0.509  -21.104 21.093  0.04 15.65 ? 323  VAL A HG23 1  
ATOM   3949   N N    . ASP A 1 268 ? 0.081   -25.196 22.990  0.04 17.13 ? 324  ASP A N    1  
ATOM   3950   C CA   . ASP A 1 268 ? 0.120   -26.392 23.851  0.04 17.66 ? 324  ASP A CA   1  
ATOM   3951   C C    . ASP A 1 268 ? -0.093  -27.694 23.075  0.04 18.05 ? 324  ASP A C    1  
ATOM   3952   O O    . ASP A 1 268 ? 0.693   -28.633 23.272  0.04 18.35 ? 324  ASP A O    1  
ATOM   3953   C CB   . ASP A 1 268 ? -1.035  -26.287 24.839  0.04 18.00 ? 324  ASP A CB   1  
ATOM   3954   C CG   . ASP A 1 268 ? -0.712  -26.815 26.217  0.04 17.80 ? 324  ASP A CG   1  
ATOM   3955   O OD1  . ASP A 1 268 ? -0.164  -25.986 26.991  0.04 17.42 ? 324  ASP A OD1  1  
ATOM   3956   O OD2  . ASP A 1 268 ? -1.084  -27.978 26.522  0.04 18.06 ? 324  ASP A OD2  1  
ATOM   3957   H H    . ASP A 1 268 ? -0.486  -24.617 23.265  0.04 17.13 ? 324  ASP A H    1  
ATOM   3958   H HA   . ASP A 1 268 ? 0.957   -26.439 24.334  0.04 17.59 ? 324  ASP A HA   1  
ATOM   3959   H HB2  . ASP A 1 268 ? -1.300  -25.368 24.928  0.04 18.00 ? 324  ASP A HB2  1  
ATOM   3960   H HB3  . ASP A 1 268 ? -1.781  -26.813 24.509  0.04 18.41 ? 324  ASP A HB3  1  
ATOM   3961   N N    . GLN A 1 269 ? -1.171  -27.739 22.262  0.04 18.11 ? 325  GLN A N    1  
ATOM   3962   C CA   . GLN A 1 269 ? -1.576  -28.914 21.462  0.04 18.45 ? 325  GLN A CA   1  
ATOM   3963   C C    . GLN A 1 269 ? -0.545  -29.200 20.348  0.04 18.21 ? 325  GLN A C    1  
ATOM   3964   O O    . GLN A 1 269 ? -0.473  -30.336 19.835  0.04 18.54 ? 325  GLN A O    1  
ATOM   3965   C CB   . GLN A 1 269 ? -2.998  -28.729 20.837  0.04 18.53 ? 325  GLN A CB   1  
ATOM   3966   C CG   . GLN A 1 269 ? -4.254  -29.099 21.722  0.04 18.83 ? 325  GLN A CG   1  
ATOM   3967   C CD   . GLN A 1 269 ? -5.593  -28.619 21.129  0.04 19.31 ? 325  GLN A CD   1  
ATOM   3968   O OE1  . GLN A 1 269 ? -5.682  -28.307 19.961  0.04 19.50 ? 325  GLN A OE1  1  
ATOM   3969   N NE2  . GLN A 1 269 ? -6.641  -28.632 21.943  0.04 19.57 ? 325  GLN A NE2  1  
ATOM   3970   H H    . GLN A 1 269 ? -1.703  -27.073 22.161  0.04 17.99 ? 325  GLN A H    1  
ATOM   3971   H HA   . GLN A 1 269 ? -1.608  -29.687 22.048  0.04 18.86 ? 325  GLN A HA   1  
ATOM   3972   H HB2  . GLN A 1 269 ? -3.099  -27.802 20.579  0.04 18.15 ? 325  GLN A HB2  1  
ATOM   3973   H HB3  . GLN A 1 269 ? -3.044  -29.285 20.042  0.04 18.80 ? 325  GLN A HB3  1  
ATOM   3974   H HG2  . GLN A 1 269 ? -4.305  -30.067 21.783  0.04 19.06 ? 325  GLN A HG2  1  
ATOM   3975   H HG3  . GLN A 1 269 ? -4.163  -28.723 22.611  0.04 18.53 ? 325  GLN A HG3  1  
ATOM   3976   H HE21 . GLN A 1 269 ? -6.554  -28.408 22.767  0.04 19.56 ? 325  GLN A HE21 1  
ATOM   3977   H HE22 . GLN A 1 269 ? -7.415  -28.871 21.640  0.04 19.76 ? 325  GLN A HE22 1  
ATOM   3978   N N    . GLY A 1 270 ? 0.243   -28.182 19.988  0.04 17.70 ? 326  GLY A N    1  
ATOM   3979   C CA   . GLY A 1 270 ? 1.293   -28.309 18.986  0.04 17.49 ? 326  GLY A CA   1  
ATOM   3980   C C    . GLY A 1 270 ? 1.128   -27.500 17.703  0.04 17.10 ? 326  GLY A C    1  
ATOM   3981   O O    . GLY A 1 270 ? 1.828   -27.755 16.715  0.04 16.99 ? 326  GLY A O    1  
ATOM   3982   H H    . GLY A 1 270 ? 0.182   -27.391 20.320  0.04 17.48 ? 326  GLY A H    1  
ATOM   3983   H HA2  . GLY A 1 270 ? 2.130   -28.028 19.385  0.04 17.32 ? 326  GLY A HA2  1  
ATOM   3984   H HA3  . GLY A 1 270 ? 1.388   -29.240 18.730  0.04 17.82 ? 326  GLY A HA3  1  
ATOM   3985   N N    . LEU A 1 271 ? 0.258   -26.494 17.720  0.04 16.90 ? 327  LEU A N    1  
ATOM   3986   C CA   . LEU A 1 271 ? 0.063   -25.630 16.536  0.04 16.54 ? 327  LEU A CA   1  
ATOM   3987   C C    . LEU A 1 271 ? 0.820   -24.314 16.642  0.04 15.99 ? 327  LEU A C    1  
ATOM   3988   O O    . LEU A 1 271 ? 1.056   -23.808 17.732  0.04 15.86 ? 327  LEU A O    1  
ATOM   3989   C CB   . LEU A 1 271 ? -1.426  -25.343 16.322  0.04 16.67 ? 327  LEU A CB   1  
ATOM   3990   C CG   . LEU A 1 271 ? -2.315  -26.490 15.832  0.04 17.24 ? 327  LEU A CG   1  
ATOM   3991   C CD1  . LEU A 1 271 ? -3.743  -26.008 15.826  0.04 17.40 ? 327  LEU A CD1  1  
ATOM   3992   C CD2  . LEU A 1 271 ? -1.912  -27.018 14.434  0.04 17.33 ? 327  LEU A CD2  1  
ATOM   3993   H H    . LEU A 1 271 ? -0.223  -26.279 18.397  0.04 16.99 ? 327  LEU A H    1  
ATOM   3994   H HA   . LEU A 1 271 ? 0.387   -26.080 15.744  0.04 16.62 ? 327  LEU A HA   1  
ATOM   3995   H HB2  . LEU A 1 271 ? -1.790  -25.033 17.167  0.04 16.64 ? 327  LEU A HB2  1  
ATOM   3996   H HB3  . LEU A 1 271 ? -1.507  -24.631 15.668  0.04 16.44 ? 327  LEU A HB3  1  
ATOM   3997   H HG   . LEU A 1 271 ? -2.244  -27.223 16.464  0.04 17.49 ? 327  LEU A HG   1  
ATOM   3998   H HD11 . LEU A 1 271 ? -4.335  -26.773 15.777  0.04 17.80 ? 327  LEU A HD11 1  
ATOM   3999   H HD12 . LEU A 1 271 ? -3.907  -25.523 16.650  0.04 17.29 ? 327  LEU A HD12 1  
ATOM   4000   H HD13 . LEU A 1 271 ? -3.886  -25.425 15.064  0.04 17.23 ? 327  LEU A HD13 1  
ATOM   4001   H HD21 . LEU A 1 271 ? -2.380  -27.851 14.266  0.04 17.70 ? 327  LEU A HD21 1  
ATOM   4002   H HD22 . LEU A 1 271 ? -2.165  -26.358 13.768  0.04 17.08 ? 327  LEU A HD22 1  
ATOM   4003   H HD23 . LEU A 1 271 ? -0.955  -27.173 14.399  0.04 17.29 ? 327  LEU A HD23 1  
ATOM   4004   N N    . HIS A 1 272 ? 1.210   -23.790 15.488  0.04 15.72 ? 328  HIS A N    1  
ATOM   4005   C CA   . HIS A 1 272 ? 1.704   -22.414 15.381  0.04 15.22 ? 328  HIS A CA   1  
ATOM   4006   C C    . HIS A 1 272 ? 0.496   -21.482 15.347  0.04 15.10 ? 328  HIS A C    1  
ATOM   4007   O O    . HIS A 1 272 ? -0.647  -21.939 15.391  0.04 15.40 ? 328  HIS A O    1  
ATOM   4008   C CB   . HIS A 1 272 ? 2.565   -22.296 14.123  0.04 15.06 ? 328  HIS A CB   1  
ATOM   4009   C CG   . HIS A 1 272 ? 3.751   -23.213 14.117  0.04 15.24 ? 328  HIS A CG   1  
ATOM   4010   N ND1  . HIS A 1 272 ? 4.903   -22.944 14.831  0.04 15.05 ? 328  HIS A ND1  1  
ATOM   4011   C CD2  . HIS A 1 272 ? 3.957   -24.406 13.508  0.04 15.66 ? 328  HIS A CD2  1  
ATOM   4012   C CE1  . HIS A 1 272 ? 5.768   -23.928 14.652  0.04 15.33 ? 328  HIS A CE1  1  
ATOM   4013   N NE2  . HIS A 1 272 ? 5.221   -24.831 13.853  0.04 15.70 ? 328  HIS A NE2  1  
ATOM   4014   H H    . HIS A 1 272 ? 1.196   -24.215 14.743  0.04 15.84 ? 328  HIS A H    1  
ATOM   4015   H HA   . HIS A 1 272 ? 2.244   -22.173 16.149  0.04 15.11 ? 328  HIS A HA   1  
ATOM   4016   H HB2  . HIS A 1 272 ? 2.019   -22.533 13.356  0.04 15.17 ? 328  HIS A HB2  1  
ATOM   4017   H HB3  . HIS A 1 272 ? 2.883   -21.385 14.032  0.04 14.75 ? 328  HIS A HB3  1  
ATOM   4018   H HD2  . HIS A 1 272 ? 3.360   -24.852 12.955  0.04 15.89 ? 328  HIS A HD2  1  
ATOM   4019   H HE1  . HIS A 1 272 ? 6.620   -23.982 15.020  0.04 15.30 ? 328  HIS A HE1  1  
ATOM   4020   N N    . LEU A 1 273 ? 0.737   -20.171 15.322  0.04 14.69 ? 329  LEU A N    1  
ATOM   4021   C CA   . LEU A 1 273 ? -0.345  -19.169 15.352  0.04 14.58 ? 329  LEU A CA   1  
ATOM   4022   C C    . LEU A 1 273 ? -0.255  -18.257 14.146  0.04 14.33 ? 329  LEU A C    1  
ATOM   4023   O O    . LEU A 1 273 ? 0.797   -17.677 13.879  0.04 14.04 ? 329  LEU A O    1  
ATOM   4024   C CB   . LEU A 1 273 ? -0.252  -18.301 16.633  0.04 14.36 ? 329  LEU A CB   1  
ATOM   4025   C CG   . LEU A 1 273 ? -0.385  -19.110 17.935  0.04 14.60 ? 329  LEU A CG   1  
ATOM   4026   C CD1  . LEU A 1 273 ? -0.151  -18.208 19.134  0.04 14.38 ? 329  LEU A CD1  1  
ATOM   4027   C CD2  . LEU A 1 273 ? -1.722  -19.804 18.044  0.04 15.03 ? 329  LEU A CD2  1  
ATOM   4028   H H    . LEU A 1 273 ? 1.522   -19.828 15.282  0.04 14.50 ? 329  LEU A H    1  
ATOM   4029   H HA   . LEU A 1 273 ? -1.209  -19.600 15.343  0.04 14.83 ? 329  LEU A HA   1  
ATOM   4030   H HB2  . LEU A 1 273 ? 0.609   -17.859 16.643  0.04 14.13 ? 329  LEU A HB2  1  
ATOM   4031   H HB3  . LEU A 1 273 ? -0.960  -17.644 16.626  0.04 14.30 ? 329  LEU A HB3  1  
ATOM   4032   H HG   . LEU A 1 273 ? 0.299   -19.793 17.933  0.04 14.64 ? 329  LEU A HG   1  
ATOM   4033   H HD11 . LEU A 1 273 ? -0.102  -18.737 19.946  0.04 14.54 ? 329  LEU A HD11 1  
ATOM   4034   H HD12 . LEU A 1 273 ? 0.681   -17.727 19.000  0.04 14.12 ? 329  LEU A HD12 1  
ATOM   4035   H HD13 . LEU A 1 273 ? -0.883  -17.574 19.203  0.04 14.37 ? 329  LEU A HD13 1  
ATOM   4036   H HD21 . LEU A 1 273 ? -1.865  -20.073 18.966  0.04 15.19 ? 329  LEU A HD21 1  
ATOM   4037   H HD22 . LEU A 1 273 ? -2.417  -19.196 17.757  0.04 15.01 ? 329  LEU A HD22 1  
ATOM   4038   H HD23 . LEU A 1 273 ? -1.721  -20.588 17.472  0.04 15.18 ? 329  LEU A HD23 1  
ATOM   4039   N N    . LEU A 1 274 ? -1.355  -18.122 13.414  0.04 14.47 ? 330  LEU A N    1  
ATOM   4040   C CA   . LEU A 1 274 ? -1.455  -17.133 12.345  0.04 14.29 ? 330  LEU A CA   1  
ATOM   4041   C C    . LEU A 1 274 ? -2.603  -16.215 12.707  0.04 14.29 ? 330  LEU A C    1  
ATOM   4042   O O    . LEU A 1 274 ? -3.773  -16.626 12.622  0.04 14.60 ? 330  LEU A O    1  
ATOM   4043   C CB   . LEU A 1 274 ? -1.737  -17.785 10.987  0.04 14.57 ? 330  LEU A CB   1  
ATOM   4044   C CG   . LEU A 1 274 ? -1.812  -16.784 9.824   0.04 14.44 ? 330  LEU A CG   1  
ATOM   4045   C CD1  . LEU A 1 274 ? -0.452  -16.169 9.569   0.04 14.08 ? 330  LEU A CD1  1  
ATOM   4046   C CD2  . LEU A 1 274 ? -2.320  -17.455 8.573   0.04 14.77 ? 330  LEU A CD2  1  
ATOM   4047   H H    . LEU A 1 274 ? -2.067  -18.587 13.526  0.04 14.70 ? 330  LEU A H    1  
ATOM   4048   H HA   . LEU A 1 274 ? -0.638  -16.620 12.291  0.04 14.05 ? 330  LEU A HA   1  
ATOM   4049   H HB2  . LEU A 1 274 ? -1.025  -18.413 10.796  0.04 14.63 ? 330  LEU A HB2  1  
ATOM   4050   H HB3  . LEU A 1 274 ? -2.586  -18.250 11.027  0.04 14.82 ? 330  LEU A HB3  1  
ATOM   4051   H HG   . LEU A 1 274 ? -2.429  -16.068 10.036  0.04 14.41 ? 330  LEU A HG   1  
ATOM   4052   H HD11 . LEU A 1 274 ? -0.511  -15.610 8.779   0.04 14.03 ? 330  LEU A HD11 1  
ATOM   4053   H HD12 . LEU A 1 274 ? -0.192  -15.631 10.330  0.04 13.88 ? 330  LEU A HD12 1  
ATOM   4054   H HD13 . LEU A 1 274 ? 0.199   -16.874 9.426   0.04 14.12 ? 330  LEU A HD13 1  
ATOM   4055   H HD21 . LEU A 1 274 ? -2.458  -16.774 7.894   0.04 14.69 ? 330  LEU A HD21 1  
ATOM   4056   H HD22 . LEU A 1 274 ? -1.662  -18.099 8.260   0.04 14.83 ? 330  LEU A HD22 1  
ATOM   4057   H HD23 . LEU A 1 274 ? -3.159  -17.903 8.770   0.04 15.02 ? 330  LEU A HD23 1  
ATOM   4058   N N    . PHE A 1 275 ? -2.274  -14.987 13.121  0.04 13.96 ? 331  PHE A N    1  
ATOM   4059   C CA   . PHE A 1 275 ? -3.282  -13.990 13.432  0.04 13.97 ? 331  PHE A CA   1  
ATOM   4060   C C    . PHE A 1 275 ? -3.761  -13.283 12.166  0.04 13.96 ? 331  PHE A C    1  
ATOM   4061   O O    . PHE A 1 275 ? -3.056  -12.445 11.610  0.04 13.69 ? 331  PHE A O    1  
ATOM   4062   C CB   . PHE A 1 275 ? -2.774  -12.947 14.428  0.04 13.69 ? 331  PHE A CB   1  
ATOM   4063   C CG   . PHE A 1 275 ? -2.427  -13.506 15.800  0.04 13.73 ? 331  PHE A CG   1  
ATOM   4064   C CD1  . PHE A 1 275 ? -1.236  -14.189 16.028  0.04 13.62 ? 331  PHE A CD1  1  
ATOM   4065   C CD2  . PHE A 1 275 ? -3.309  -13.330 16.864  0.04 13.93 ? 331  PHE A CD2  1  
ATOM   4066   C CE1  . PHE A 1 275 ? -0.941  -14.701 17.287  0.04 13.72 ? 331  PHE A CE1  1  
ATOM   4067   C CE2  . PHE A 1 275 ? -3.011  -13.853 18.107  0.04 14.02 ? 331  PHE A CE2  1  
ATOM   4068   C CZ   . PHE A 1 275 ? -1.827  -14.533 18.311  0.04 13.91 ? 331  PHE A CZ   1  
ATOM   4069   H H    . PHE A 1 275 ? -1.470  -14.705 13.214  0.04 13.76 ? 331  PHE A H    1  
ATOM   4070   H HA   . PHE A 1 275 ? -4.049  -14.425 13.805  0.04 14.21 ? 331  PHE A HA   1  
ATOM   4071   H HB2  . PHE A 1 275 ? -1.979  -12.534 14.061  0.04 13.46 ? 331  PHE A HB2  1  
ATOM   4072   H HB3  . PHE A 1 275 ? -3.469  -12.282 14.543  0.04 13.72 ? 331  PHE A HB3  1  
ATOM   4073   H HD1  . PHE A 1 275 ? -0.630  -14.312 15.334  0.04 13.51 ? 331  PHE A HD1  1  
ATOM   4074   H HD2  . PHE A 1 275 ? -4.113  -12.885 16.731  0.04 14.04 ? 331  PHE A HD2  1  
ATOM   4075   H HE1  . PHE A 1 275 ? -0.145  -15.157 17.437  0.04 13.67 ? 331  PHE A HE1  1  
ATOM   4076   H HE2  . PHE A 1 275 ? -3.600  -13.735 18.811  0.04 14.18 ? 331  PHE A HE2  1  
ATOM   4077   H HZ   . PHE A 1 275 ? -1.624  -14.867 19.155  0.04 14.00 ? 331  PHE A HZ   1  
ATOM   4078   N N    . THR A 1 276 ? -4.977  -13.586 11.742  0.04 14.28 ? 332  THR A N    1  
ATOM   4079   C CA   . THR A 1 276 ? -5.538  -12.894 10.592  0.04 14.35 ? 332  THR A CA   1  
ATOM   4080   C C    . THR A 1 276 ? -5.892  -11.453 11.020  0.04 14.18 ? 332  THR A C    1  
ATOM   4081   O O    . THR A 1 276 ? -5.965  -11.144 12.210  0.04 14.11 ? 332  THR A O    1  
ATOM   4082   C CB   . THR A 1 276 ? -6.742  -13.659 10.001  0.04 14.80 ? 332  THR A CB   1  
ATOM   4083   O OG1  . THR A 1 276 ? -7.792  -13.805 10.964  0.04 14.98 ? 332  THR A OG1  1  
ATOM   4084   C CG2  . THR A 1 276 ? -6.304  -15.073 9.481   0.04 15.04 ? 332  THR A CG2  1  
ATOM   4085   H H    . THR A 1 276 ? -5.497  -14.175 12.093  0.04 14.50 ? 332  THR A H    1  
ATOM   4086   H HA   . THR A 1 276 ? -4.856  -12.847 9.906   0.04 14.25 ? 332  THR A HA   1  
ATOM   4087   H HB   . THR A 1 276 ? -7.084  -13.165 9.240   0.04 14.87 ? 332  THR A HB   1  
ATOM   4088   H HG1  . THR A 1 276 ? -7.686  -13.276 11.608  0.04 14.87 ? 332  THR A HG1  1  
ATOM   4089   H HG21 . THR A 1 276 ? -6.989  -15.447 8.909   0.04 15.32 ? 332  THR A HG21 1  
ATOM   4090   H HG22 . THR A 1 276 ? -5.475  -15.002 8.981   0.04 14.88 ? 332  THR A HG22 1  
ATOM   4091   H HG23 . THR A 1 276 ? -6.163  -15.666 10.234  0.04 15.08 ? 332  THR A HG23 1  
ATOM   4092   N N    . PRO A 1 277 ? -6.074  -10.541 10.063  0.04 14.16 ? 333  PRO A N    1  
ATOM   4093   C CA   . PRO A 1 277 ? -6.236  -9.122  10.428  0.04 14.00 ? 333  PRO A CA   1  
ATOM   4094   C C    . PRO A 1 277 ? -7.498  -8.833  11.254  0.04 14.25 ? 333  PRO A C    1  
ATOM   4095   O O    . PRO A 1 277 ? -8.628  -9.171  10.916  0.04 14.61 ? 333  PRO A O    1  
ATOM   4096   C CB   . PRO A 1 277 ? -6.283  -8.395  9.060   0.04 14.04 ? 333  PRO A CB   1  
ATOM   4097   C CG   . PRO A 1 277 ? -5.681  -9.406  8.073   0.04 14.11 ? 333  PRO A CG   1  
ATOM   4098   C CD   . PRO A 1 277 ? -6.103  -10.756 8.605   0.04 14.33 ? 333  PRO A CD   1  
ATOM   4099   H HA   . PRO A 1 277 ? -5.471  -8.813  10.931  0.04 13.76 ? 333  PRO A HA   1  
ATOM   4100   H HB2  . PRO A 1 277 ? -7.199  -8.183  8.817   0.04 14.27 ? 333  PRO A HB2  1  
ATOM   4101   H HB3  . PRO A 1 277 ? -5.741  -7.595  9.098   0.04 13.83 ? 333  PRO A HB3  1  
ATOM   4102   H HG2  . PRO A 1 277 ? -6.040  -9.253  7.183   0.04 14.28 ? 333  PRO A HG2  1  
ATOM   4103   H HG3  . PRO A 1 277 ? -4.717  -9.324  8.074   0.04 13.88 ? 333  PRO A HG3  1  
ATOM   4104   H HD2  . PRO A 1 277 ? -7.001  -10.978 8.311   0.04 14.61 ? 333  PRO A HD2  1  
ATOM   4105   H HD3  . PRO A 1 277 ? -5.463  -11.435 8.354   0.04 14.30 ? 333  PRO A HD3  1  
ATOM   4106   N N    . GLY A 1 278 ? -7.245  -8.177  12.384  0.04 14.08 ? 334  GLY A N    1  
ATOM   4107   C CA   . GLY A 1 278 ? -8.287  -7.875  13.341  0.04 14.31 ? 334  GLY A CA   1  
ATOM   4108   C C    . GLY A 1 278 ? -7.699  -7.314  14.612  0.04 14.09 ? 334  GLY A C    1  
ATOM   4109   O O    . GLY A 1 278 ? -6.500  -7.269  14.775  0.04 13.77 ? 334  GLY A O    1  
ATOM   4110   H H    . GLY A 1 278 ? -6.468  -7.903  12.616  0.04 13.85 ? 334  GLY A H    1  
ATOM   4111   H HA2  . GLY A 1 278 ? -8.909  -7.229  12.974  0.04 14.41 ? 334  GLY A HA2  1  
ATOM   4112   H HA3  . GLY A 1 278 ? -8.769  -8.689  13.552  0.04 14.55 ? 334  GLY A HA3  1  
ATOM   4113   N N    . VAL A 1 279 ? -8.596  -6.861  15.463  0.04 14.32 ? 335  VAL A N    1  
ATOM   4114   C CA   . VAL A 1 279 ? -8.294  -6.406  16.811  0.04 14.20 ? 335  VAL A CA   1  
ATOM   4115   C C    . VAL A 1 279 ? -8.892  -7.436  17.776  0.04 14.44 ? 335  VAL A C    1  
ATOM   4116   O O    . VAL A 1 279 ? -10.109 -7.667  17.812  0.04 14.79 ? 335  VAL A O    1  
ATOM   4117   C CB   . VAL A 1 279 ? -8.804  -4.941  17.019  0.04 14.29 ? 335  VAL A CB   1  
ATOM   4118   C CG1  . VAL A 1 279 ? -8.611  -4.415  18.457  0.04 14.16 ? 335  VAL A CG1  1  
ATOM   4119   C CG2  . VAL A 1 279 ? -8.099  -4.007  16.026  0.04 14.14 ? 335  VAL A CG2  1  
ATOM   4120   H H    . VAL A 1 279 ? -9.434  -6.804  15.275  0.04 14.57 ? 335  VAL A H    1  
ATOM   4121   H HA   . VAL A 1 279 ? -7.333  -6.407  16.934  0.04 13.93 ? 335  VAL A HA   1  
ATOM   4122   H HB   . VAL A 1 279 ? -9.753  -4.914  16.831  0.04 14.58 ? 335  VAL A HB   1  
ATOM   4123   H HG11 . VAL A 1 279 ? -8.354  -3.479  18.422  0.04 14.24 ? 335  VAL A HG11 1  
ATOM   4124   H HG12 . VAL A 1 279 ? -9.444  -4.508  18.944  0.04 14.30 ? 335  VAL A HG12 1  
ATOM   4125   H HG13 . VAL A 1 279 ? -7.908  -4.922  18.892  0.04 13.89 ? 335  VAL A HG13 1  
ATOM   4126   H HG21 . VAL A 1 279 ? -8.418  -3.100  16.166  0.04 14.19 ? 335  VAL A HG21 1  
ATOM   4127   H HG22 . VAL A 1 279 ? -7.145  -4.052  16.174  0.04 13.87 ? 335  VAL A HG22 1  
ATOM   4128   H HG23 . VAL A 1 279 ? -8.309  -4.293  15.120  0.04 14.29 ? 335  VAL A HG23 1  
ATOM   4129   N N    . TYR A 1 280 ? -8.015  -8.029  18.572  0.04 14.29 ? 336  TYR A N    1  
ATOM   4130   C CA   . TYR A 1 280 ? -8.315  -9.088  19.519  0.04 14.49 ? 336  TYR A CA   1  
ATOM   4131   C C    . TYR A 1 280 ? -8.113  -8.543  20.921  0.04 14.47 ? 336  TYR A C    1  
ATOM   4132   O O    . TYR A 1 280 ? -7.183  -7.787  21.160  0.04 14.18 ? 336  TYR A O    1  
ATOM   4133   C CB   . TYR A 1 280 ? -7.407  -10.292 19.212  0.04 14.33 ? 336  TYR A CB   1  
ATOM   4134   C CG   . TYR A 1 280 ? -7.532  -10.710 17.762  0.04 14.38 ? 336  TYR A CG   1  
ATOM   4135   C CD1  . TYR A 1 280 ? -6.542  -10.436 16.802  0.04 14.12 ? 336  TYR A CD1  1  
ATOM   4136   C CD2  . TYR A 1 280 ? -8.663  -11.381 17.356  0.04 14.71 ? 336  TYR A CD2  1  
ATOM   4137   C CE1  . TYR A 1 280 ? -6.730  -10.827 15.458  0.04 14.21 ? 336  TYR A CE1  1  
ATOM   4138   C CE2  . TYR A 1 280 ? -8.849  -11.752 16.050  0.04 14.80 ? 336  TYR A CE2  1  
ATOM   4139   C CZ   . TYR A 1 280 ? -7.887  -11.488 15.107  0.04 14.54 ? 336  TYR A CZ   1  
ATOM   4140   O OH   . TYR A 1 280 ? -8.119  -11.893 13.814  0.04 14.66 ? 336  TYR A OH   1  
ATOM   4141   H H    . TYR A 1 280 ? -7.176  -7.831  18.572  0.04 14.09 ? 336  TYR A H    1  
ATOM   4142   H HA   . TYR A 1 280 ? -9.246  -9.364  19.446  0.04 14.78 ? 336  TYR A HA   1  
ATOM   4143   H HB2  . TYR A 1 280 ? -6.481  -10.065 19.395  0.04 14.07 ? 336  TYR A HB2  1  
ATOM   4144   H HB3  . TYR A 1 280 ? -7.684  -11.044 19.753  0.04 14.50 ? 336  TYR A HB3  1  
ATOM   4145   H HD1  . TYR A 1 280 ? -5.768  -9.985  17.041  0.04 13.92 ? 336  TYR A HD1  1  
ATOM   4146   H HD2  . TYR A 1 280 ? -9.328  -11.558 17.981  0.04 14.91 ? 336  TYR A HD2  1  
ATOM   4147   H HE1  . TYR A 1 280 ? -6.080  -10.647 14.818  0.04 14.07 ? 336  TYR A HE1  1  
ATOM   4148   H HE2  . TYR A 1 280 ? -9.619  -12.197 15.808  0.04 15.04 ? 336  TYR A HE2  1  
ATOM   4149   H HH   . TYR A 1 280 ? -7.454  -11.714 13.331  0.04 14.53 ? 336  TYR A HH   1  
ATOM   4150   N N    . HIS A 1 281 ? -9.068  -8.841  21.792  0.04 14.82 ? 337  HIS A N    1  
ATOM   4151   C CA   . HIS A 1 281 ? -8.984  -8.513  23.212  0.04 14.88 ? 337  HIS A CA   1  
ATOM   4152   C C    . HIS A 1 281 ? -8.814  -9.859  23.926  0.04 15.01 ? 337  HIS A C    1  
ATOM   4153   O O    . HIS A 1 281 ? -9.477  -10.844 23.559  0.04 15.31 ? 337  HIS A O    1  
ATOM   4154   C CB   . HIS A 1 281 ? -10.284 -7.817  23.676  0.04 15.25 ? 337  HIS A CB   1  
ATOM   4155   C CG   . HIS A 1 281 ? -10.370 -6.362  23.312  0.04 15.16 ? 337  HIS A CG   1  
ATOM   4156   N ND1  . HIS A 1 281 ? -10.034 -5.357  24.196  0.04 15.08 ? 337  HIS A ND1  1  
ATOM   4157   C CD2  . HIS A 1 281 ? -10.788 -5.738  22.177  0.04 15.18 ? 337  HIS A CD2  1  
ATOM   4158   C CE1  . HIS A 1 281 ? -10.188 -4.181  23.607  0.04 15.05 ? 337  HIS A CE1  1  
ATOM   4159   N NE2  . HIS A 1 281 ? -10.666 -4.384  22.387  0.04 15.12 ? 337  HIS A NE2  1  
ATOM   4160   H H    . HIS A 1 281 ? -9.794  -9.246  21.577  0.04 15.04 ? 337  HIS A H    1  
ATOM   4161   H HA   . HIS A 1 281 ? -8.235  -7.942  23.392  0.04 14.63 ? 337  HIS A HA   1  
ATOM   4162   H HB2  . HIS A 1 281 ? -11.030 -8.269  23.256  0.04 15.50 ? 337  HIS A HB2  1  
ATOM   4163   H HB3  . HIS A 1 281 ? -10.347 -7.882  24.639  0.04 15.33 ? 337  HIS A HB3  1  
ATOM   4164   H HD2  . HIS A 1 281 ? -11.090 -6.147  21.398  0.04 15.25 ? 337  HIS A HD2  1  
ATOM   4165   H HE1  . HIS A 1 281 ? -10.031 -3.352  23.990  0.04 15.02 ? 337  HIS A HE1  1  
ATOM   4166   N N    . VAL A 1 282 ? -7.974  -9.889  24.963  0.04 14.84 ? 338  VAL A N    1  
ATOM   4167   C CA   . VAL A 1 282 ? -7.670  -11.105 25.732  0.04 15.03 ? 338  VAL A CA   1  
ATOM   4168   C C    . VAL A 1 282 ? -7.717  -10.840 27.262  0.04 15.27 ? 338  VAL A C    1  
ATOM   4169   O O    . VAL A 1 282 ? -7.289  -9.788  27.723  0.04 15.10 ? 338  VAL A O    1  
ATOM   4170   C CB   . VAL A 1 282 ? -6.293  -11.695 25.344  0.04 14.74 ? 338  VAL A CB   1  
ATOM   4171   C CG1  . VAL A 1 282 ? -6.306  -12.142 23.910  0.04 14.61 ? 338  VAL A CG1  1  
ATOM   4172   C CG2  . VAL A 1 282 ? -5.154  -10.727 25.581  0.04 14.37 ? 338  VAL A CG2  1  
ATOM   4173   H H    . VAL A 1 282 ? -7.569  -9.197  25.265  0.04 14.63 ? 338  VAL A H    1  
ATOM   4174   H HA   . VAL A 1 282 ? -8.339  -11.775 25.529  0.04 15.27 ? 338  VAL A HA   1  
ATOM   4175   H HB   . VAL A 1 282 ? -6.129  -12.477 25.899  0.04 14.91 ? 338  VAL A HB   1  
ATOM   4176   H HG11 . VAL A 1 282 ? -5.439  -12.516 23.685  0.04 14.48 ? 338  VAL A HG11 1  
ATOM   4177   H HG12 . VAL A 1 282 ? -6.993  -12.814 23.794  0.04 14.86 ? 338  VAL A HG12 1  
ATOM   4178   H HG13 . VAL A 1 282 ? -6.489  -11.372 23.347  0.04 14.44 ? 338  VAL A HG13 1  
ATOM   4179   H HG21 . VAL A 1 282 ? -4.317  -11.144 25.320  0.04 14.25 ? 338  VAL A HG21 1  
ATOM   4180   H HG22 . VAL A 1 282 ? -5.316  -9.933  25.042  0.04 14.19 ? 338  VAL A HG22 1  
ATOM   4181   H HG23 . VAL A 1 282 ? -5.122  -10.493 26.520  0.04 14.47 ? 338  VAL A HG23 1  
ATOM   4182   N N    . ASP A 1 283 ? -8.260  -11.778 28.041  0.04 15.70 ? 339  ASP A N    1  
ATOM   4183   C CA   . ASP A 1 283 ? -8.330  -11.633 29.528  0.04 16.00 ? 339  ASP A CA   1  
ATOM   4184   C C    . ASP A 1 283 ? -7.253  -12.410 30.313  0.04 16.00 ? 339  ASP A C    1  
ATOM   4185   O O    . ASP A 1 283 ? -7.311  -12.534 31.562  0.04 16.26 ? 339  ASP A O    1  
ATOM   4186   C CB   . ASP A 1 283 ? -9.693  -12.092 30.028  0.04 16.52 ? 339  ASP A CB   1  
ATOM   4187   C CG   . ASP A 1 283 ? -10.039 -13.416 29.531  0.04 16.85 ? 339  ASP A CG   1  
ATOM   4188   O OD1  . ASP A 1 283 ? -11.064 -13.985 29.987  0.04 17.12 ? 339  ASP A OD1  1  
ATOM   4189   O OD2  . ASP A 1 283 ? -9.287  -13.925 28.672  0.04 16.90 ? 339  ASP A OD2  1  
ATOM   4190   H H    . ASP A 1 283 ? -8.607  -12.502 27.742  0.04 15.85 ? 339  ASP A H    1  
ATOM   4191   H HA   . ASP A 1 283 ? -8.239  -10.694 29.757  0.04 15.89 ? 339  ASP A HA   1  
ATOM   4192   H HB2  . ASP A 1 283 ? -9.683  -12.139 30.996  0.04 16.70 ? 339  ASP A HB2  1  
ATOM   4193   H HB3  . ASP A 1 283 ? -10.383 -11.476 29.734  0.04 16.52 ? 339  ASP A HB3  1  
ATOM   4194   N N    . GLN A 1 284 ? -6.291  -12.961 29.577  0.04 15.73 ? 340  GLN A N    1  
ATOM   4195   C CA   . GLN A 1 284 ? -5.066  -13.487 30.144  0.04 15.76 ? 340  GLN A CA   1  
ATOM   4196   C C    . GLN A 1 284 ? -4.025  -13.536 29.048  0.04 15.33 ? 340  GLN A C    1  
ATOM   4197   O O    . GLN A 1 284 ? -4.367  -13.493 27.868  0.04 15.14 ? 340  GLN A O    1  
ATOM   4198   C CB   . GLN A 1 284 ? -5.260  -14.879 30.745  0.04 16.22 ? 340  GLN A CB   1  
ATOM   4199   C CG   . GLN A 1 284 ? -5.430  -15.934 29.724  0.04 16.30 ? 340  GLN A CG   1  
ATOM   4200   C CD   . GLN A 1 284 ? -5.895  -17.243 30.334  0.04 16.83 ? 340  GLN A CD   1  
ATOM   4201   O OE1  . GLN A 1 284 ? -5.099  -18.083 30.742  0.04 16.85 ? 340  GLN A OE1  1  
ATOM   4202   N NE2  . GLN A 1 284 ? -7.197  -17.400 30.408  0.04 17.27 ? 340  GLN A NE2  1  
ATOM   4203   H H    . GLN A 1 284 ? -6.335  -13.046 28.724  0.04 15.53 ? 340  GLN A H    1  
ATOM   4204   H HA   . GLN A 1 284 ? -4.753  -12.889 30.842  0.04 15.77 ? 340  GLN A HA   1  
ATOM   4205   H HB2  . GLN A 1 284 ? -4.482  -15.112 31.275  0.04 16.22 ? 340  GLN A HB2  1  
ATOM   4206   H HB3  . GLN A 1 284 ? -6.062  -14.885 31.297  0.04 16.52 ? 340  GLN A HB3  1  
ATOM   4207   H HG2  . GLN A 1 284 ? -6.100  -15.641 29.086  0.04 16.29 ? 340  GLN A HG2  1  
ATOM   4208   H HG3  . GLN A 1 284 ? -4.590  -16.073 29.257  0.04 16.05 ? 340  GLN A HG3  1  
ATOM   4209   H HE21 . GLN A 1 284 ? -7.704  -16.707 30.443  0.04 17.26 ? 340  GLN A HE21 1  
ATOM   4210   H HE22 . GLN A 1 284 ? -7.540  -18.189 30.415  0.04 17.59 ? 340  GLN A HE22 1  
ATOM   4211   N N    . PRO A 1 285 ? -2.747  -13.626 29.425  0.04 15.22 ? 341  PRO A N    1  
ATOM   4212   C CA   . PRO A 1 285 ? -1.732  -13.586 28.383  0.04 14.83 ? 341  PRO A CA   1  
ATOM   4213   C C    . PRO A 1 285 ? -1.868  -14.712 27.377  0.04 14.89 ? 341  PRO A C    1  
ATOM   4214   O O    . PRO A 1 285 ? -2.283  -15.836 27.720  0.04 15.26 ? 341  PRO A O    1  
ATOM   4215   C CB   . PRO A 1 285 ? -0.431  -13.796 29.159  0.04 14.83 ? 341  PRO A CB   1  
ATOM   4216   C CG   . PRO A 1 285 ? -0.722  -13.384 30.526  0.04 14.98 ? 341  PRO A CG   1  
ATOM   4217   C CD   . PRO A 1 285 ? -2.145  -13.726 30.764  0.04 15.37 ? 341  PRO A CD   1  
ATOM   4218   H HA   . PRO A 1 285 ? -1.719  -12.741 27.917  0.04 14.59 ? 341  PRO A HA   1  
ATOM   4219   H HB2  . PRO A 1 285 ? -0.203  -14.737 29.140  0.04 15.05 ? 341  PRO A HB2  1  
ATOM   4220   H HB3  . PRO A 1 285 ? 0.276   -13.266 28.765  0.04 14.56 ? 341  PRO A HB3  1  
ATOM   4221   H HG2  . PRO A 1 285 ? -0.151  -13.881 31.131  0.04 15.06 ? 341  PRO A HG2  1  
ATOM   4222   H HG3  . PRO A 1 285 ? -0.577  -12.432 30.628  0.04 14.78 ? 341  PRO A HG3  1  
ATOM   4223   H HD2  . PRO A 1 285 ? -2.213  -14.636 31.099  0.04 15.62 ? 341  PRO A HD2  1  
ATOM   4224   H HD3  . PRO A 1 285 ? -2.546  -13.093 31.376  0.04 15.47 ? 341  PRO A HD3  1  
ATOM   4225   N N    . ILE A 1 286 ? -1.506  -14.388 26.145  0.04 14.56 ? 342  ILE A N    1  
ATOM   4226   C CA   . ILE A 1 286 ? -1.180  -15.394 25.124  0.04 14.60 ? 342  ILE A CA   1  
ATOM   4227   C C    . ILE A 1 286 ? 0.213   -15.886 25.440  0.04 14.61 ? 342  ILE A C    1  
ATOM   4228   O O    . ILE A 1 286 ? 1.170   -15.103 25.445  0.04 14.33 ? 342  ILE A O    1  
ATOM   4229   C CB   . ILE A 1 286 ? -1.210  -14.784 23.693  0.04 14.28 ? 342  ILE A CB   1  
ATOM   4230   C CG1  . ILE A 1 286 ? -2.630  -14.346 23.356  0.04 14.31 ? 342  ILE A CG1  1  
ATOM   4231   C CG2  . ILE A 1 286 ? -0.675  -15.775 22.649  0.04 14.36 ? 342  ILE A CG2  1  
ATOM   4232   C CD1  . ILE A 1 286 ? -2.708  -13.370 22.179  0.04 13.95 ? 342  ILE A CD1  1  
ATOM   4233   H H    . ILE A 1 286 ? -1.435  -13.580 25.865  0.04 14.33 ? 342  ILE A H    1  
ATOM   4234   H HA   . ILE A 1 286 ? -1.802  -16.130 25.170  0.04 14.87 ? 342  ILE A HA   1  
ATOM   4235   H HB   . ILE A 1 286 ? -0.642  -13.999 23.679  0.04 14.04 ? 342  ILE A HB   1  
ATOM   4236   H HG12 . ILE A 1 286 ? -3.175  -15.119 23.154  0.04 14.53 ? 342  ILE A HG12 1  
ATOM   4237   H HG13 . ILE A 1 286 ? -2.993  -13.891 24.134  0.04 14.36 ? 342  ILE A HG13 1  
ATOM   4238   H HG21 . ILE A 1 286 ? -0.943  -15.497 21.762  0.04 14.22 ? 342  ILE A HG21 1  
ATOM   4239   H HG22 . ILE A 1 286 ? 0.292   -15.806 22.708  0.04 14.27 ? 342  ILE A HG22 1  
ATOM   4240   H HG23 . ILE A 1 286 ? -1.044  -16.651 22.843  0.04 14.64 ? 342  ILE A HG23 1  
ATOM   4241   H HD11 . ILE A 1 286 ? -3.603  -12.999 22.127  0.04 14.01 ? 342  ILE A HD11 1  
ATOM   4242   H HD12 . ILE A 1 286 ? -2.058  -12.663 22.325  0.04 13.75 ? 342  ILE A HD12 1  
ATOM   4243   H HD13 . ILE A 1 286 ? -2.503  -13.833 21.352  0.04 13.90 ? 342  ILE A HD13 1  
ATOM   4244   N N    . GLU A 1 287 ? 0.328   -17.187 25.698  0.04 14.98 ? 343  GLU A N    1  
ATOM   4245   C CA   . GLU A 1 287 ? 1.575   -17.755 26.204  0.04 15.07 ? 343  GLU A CA   1  
ATOM   4246   C C    . GLU A 1 287 ? 2.116   -18.741 25.227  0.04 15.06 ? 343  GLU A C    1  
ATOM   4247   O O    . GLU A 1 287 ? 1.427   -19.675 24.805  0.04 15.32 ? 343  GLU A O    1  
ATOM   4248   C CB   . GLU A 1 287 ? 1.367   -18.440 27.541  0.04 15.55 ? 343  GLU A CB   1  
ATOM   4249   C CG   . GLU A 1 287 ? 1.146   -17.481 28.655  0.04 15.70 ? 343  GLU A CG   1  
ATOM   4250   C CD   . GLU A 1 287 ? 0.808   -18.184 29.928  0.04 15.99 ? 343  GLU A CD   1  
ATOM   4251   O OE1  . GLU A 1 287 ? 0.966   -19.436 29.933  0.04 16.45 ? 343  GLU A OE1  1  
ATOM   4252   O OE2  . GLU A 1 287 ? 0.334   -17.541 30.925  0.04 15.77 ? 343  GLU A OE2  1  
ATOM   4253   H H    . GLU A 1 287 ? -0.296  -17.763 25.575  0.04 15.20 ? 343  GLU A H    1  
ATOM   4254   H HA   . GLU A 1 287 ? 2.233   -17.061 26.311  0.04 14.87 ? 343  GLU A HA   1  
ATOM   4255   H HB2  . GLU A 1 287 ? 0.601   -19.032 27.484  0.04 15.78 ? 343  GLU A HB2  1  
ATOM   4256   H HB3  . GLU A 1 287 ? 2.164   -18.952 27.756  0.04 15.58 ? 343  GLU A HB3  1  
ATOM   4257   H HG2  . GLU A 1 287 ? 1.960   -16.975 28.797  0.04 15.43 ? 343  GLU A HG2  1  
ATOM   4258   H HG3  . GLU A 1 287 ? 0.414   -16.888 28.422  0.04 15.91 ? 343  GLU A HG3  1  
ATOM   4259   N N    . ILE A 1 288 ? 3.372   -18.515 24.887  0.04 14.78 ? 344  ILE A N    1  
ATOM   4260   C CA   . ILE A 1 288 ? 4.041   -19.317 23.877  0.04 14.83 ? 344  ILE A CA   1  
ATOM   4261   C C    . ILE A 1 288 ? 5.187   -20.035 24.582  0.04 15.01 ? 344  ILE A C    1  
ATOM   4262   O O    . ILE A 1 288 ? 6.259   -19.461 24.855  0.04 14.78 ? 344  ILE A O    1  
ATOM   4263   C CB   . ILE A 1 288 ? 4.511   -18.437 22.703  0.04 14.44 ? 344  ILE A CB   1  
ATOM   4264   C CG1  . ILE A 1 288 ? 3.312   -17.729 22.065  0.04 14.27 ? 344  ILE A CG1  1  
ATOM   4265   C CG2  . ILE A 1 288 ? 5.231   -19.282 21.644  0.04 14.58 ? 344  ILE A CG2  1  
ATOM   4266   C CD1  . ILE A 1 288 ? 3.742   -16.717 21.033  0.04 13.88 ? 344  ILE A CD1  1  
ATOM   4267   H H    . ILE A 1 288 ? 3.871   -17.909 25.235  0.04 14.58 ? 344  ILE A H    1  
ATOM   4268   H HA   . ILE A 1 288 ? 3.427   -19.981 23.534  0.04 15.05 ? 344  ILE A HA   1  
ATOM   4269   H HB   . ILE A 1 288 ? 5.121   -17.757 23.024  0.04 14.25 ? 344  ILE A HB   1  
ATOM   4270   H HG12 . ILE A 1 288 ? 2.752   -18.386 21.631  0.04 14.45 ? 344  ILE A HG12 1  
ATOM   4271   H HG13 . ILE A 1 288 ? 2.803   -17.272 22.752  0.04 14.25 ? 344  ILE A HG13 1  
ATOM   4272   H HG21 . ILE A 1 288 ? 5.702   -18.708 21.026  0.04 14.39 ? 344  ILE A HG21 1  
ATOM   4273   H HG22 . ILE A 1 288 ? 5.859   -19.876 22.078  0.04 14.61 ? 344  ILE A HG22 1  
ATOM   4274   H HG23 . ILE A 1 288 ? 4.565   -19.795 21.168  0.04 14.85 ? 344  ILE A HG23 1  
ATOM   4275   H HD11 . ILE A 1 288 ? 2.970   -16.479 20.496  0.04 13.79 ? 344  ILE A HD11 1  
ATOM   4276   H HD12 . ILE A 1 288 ? 4.084   -15.931 21.484  0.04 13.73 ? 344  ILE A HD12 1  
ATOM   4277   H HD13 . ILE A 1 288 ? 4.424   -17.106 20.471  0.04 13.92 ? 344  ILE A HD13 1  
ATOM   4278   N N    . ASP A 1 289 ? 4.953   -21.311 24.899  0.04 15.45 ? 345  ASP A N    1  
ATOM   4279   C CA   . ASP A 1 289 ? 5.911   -22.069 25.687  0.04 15.71 ? 345  ASP A CA   1  
ATOM   4280   C C    . ASP A 1 289 ? 6.130   -23.447 25.079  0.04 16.00 ? 345  ASP A C    1  
ATOM   4281   O O    . ASP A 1 289 ? 6.175   -24.468 25.775  0.04 16.43 ? 345  ASP A O    1  
ATOM   4282   C CB   . ASP A 1 289 ? 5.467   -22.148 27.147  0.04 16.07 ? 345  ASP A CB   1  
ATOM   4283   C CG   . ASP A 1 289 ? 6.591   -22.552 28.063  0.04 16.28 ? 345  ASP A CG   1  
ATOM   4284   O OD1  . ASP A 1 289 ? 6.334   -23.155 29.130  0.04 16.75 ? 345  ASP A OD1  1  
ATOM   4285   O OD2  . ASP A 1 289 ? 7.751   -22.286 27.692  0.04 16.01 ? 345  ASP A OD2  1  
ATOM   4286   H H    . ASP A 1 289 ? 4.258   -21.755 24.663  0.04 15.63 ? 345  ASP A H    1  
ATOM   4287   H HA   . ASP A 1 289 ? 6.766   -21.615 25.648  0.04 15.50 ? 345  ASP A HA   1  
ATOM   4288   H HB2  . ASP A 1 289 ? 5.157   -21.273 27.431  0.04 15.91 ? 345  ASP A HB2  1  
ATOM   4289   H HB3  . ASP A 1 289 ? 4.758   -22.805 27.235  0.04 16.36 ? 345  ASP A HB3  1  
ATOM   4290   N N    . ARG A 1 290 ? 6.237   -23.446 23.759  0.04 15.79 ? 346  ARG A N    1  
ATOM   4291   C CA   . ARG A 1 290 ? 6.706   -24.591 22.995  0.04 16.05 ? 346  ARG A CA   1  
ATOM   4292   C C    . ARG A 1 290 ? 7.819   -24.023 22.119  0.04 15.72 ? 346  ARG A C    1  
ATOM   4293   O O    . ARG A 1 290 ? 7.651   -22.984 21.449  0.04 15.32 ? 346  ARG A O    1  
ATOM   4294   C CB   . ARG A 1 290 ? 5.583   -25.205 22.127  0.04 16.19 ? 346  ARG A CB   1  
ATOM   4295   C CG   . ARG A 1 290 ? 5.911   -26.569 21.512  0.04 16.53 ? 346  ARG A CG   1  
ATOM   4296   C CD   . ARG A 1 290 ? 4.761   -27.167 20.635  0.04 16.63 ? 346  ARG A CD   1  
ATOM   4297   N NE   . ARG A 1 290 ? 4.732   -26.638 19.266  0.04 16.26 ? 346  ARG A NE   1  
ATOM   4298   C CZ   . ARG A 1 290 ? 3.960   -25.631 18.826  0.04 16.05 ? 346  ARG A CZ   1  
ATOM   4299   N NH1  . ARG A 1 290 ? 4.037   -25.247 17.548  0.04 15.79 ? 346  ARG A NH1  1  
ATOM   4300   N NH2  . ARG A 1 290 ? 3.100   -25.032 19.632  0.04 16.17 ? 346  ARG A NH2  1  
ATOM   4301   H H    . ARG A 1 290 ? 6.049   -22.767 23.269  0.04 15.51 ? 346  ARG A H    1  
ATOM   4302   H HA   . ARG A 1 290 ? 7.067   -25.265 23.585  0.04 16.36 ? 346  ARG A HA   1  
ATOM   4303   H HB2  . ARG A 1 290 ? 4.790   -25.319 22.678  0.04 16.38 ? 346  ARG A HB2  1  
ATOM   4304   H HB3  . ARG A 1 290 ? 5.387   -24.595 21.400  0.04 15.90 ? 346  ARG A HB3  1  
ATOM   4305   H HG2  . ARG A 1 290 ? 6.708   -26.496 20.963  0.04 16.39 ? 346  ARG A HG2  1  
ATOM   4306   H HG3  . ARG A 1 290 ? 6.058   -27.197 22.235  0.04 16.88 ? 346  ARG A HG3  1  
ATOM   4307   H HD2  . ARG A 1 290 ? 4.908   -28.121 20.553  0.04 16.98 ? 346  ARG A HD2  1  
ATOM   4308   H HD3  . ARG A 1 290 ? 3.910   -26.998 21.064  0.04 16.63 ? 346  ARG A HD3  1  
ATOM   4309   H HE   . ARG A 1 290 ? 5.361   -26.899 18.740  0.04 16.19 ? 346  ARG A HE   1  
ATOM   4310   H HH11 . ARG A 1 290 ? 4.587   -25.635 17.016  0.04 15.73 ? 346  ARG A HH11 1  
ATOM   4311   H HH12 . ARG A 1 290 ? 3.535   -24.611 17.259  0.04 15.67 ? 346  ARG A HH12 1  
ATOM   4312   H HH21 . ARG A 1 290 ? 3.042   -25.270 20.458  0.04 16.37 ? 346  ARG A HH21 1  
ATOM   4313   H HH22 . ARG A 1 290 ? 2.607   -24.396 19.335  0.04 16.05 ? 346  ARG A HH22 1  
ATOM   4314   N N    . ALA A 1 291 ? 8.952   -24.711 22.095  0.04 15.95 ? 347  ALA A N    1  
ATOM   4315   C CA   . ALA A 1 291 ? 10.062  -24.294 21.261  0.04 15.71 ? 347  ALA A CA   1  
ATOM   4316   C C    . ALA A 1 291 ? 9.678   -24.221 19.782  0.04 15.55 ? 347  ALA A C    1  
ATOM   4317   O O    . ALA A 1 291 ? 8.898   -25.009 19.289  0.04 15.78 ? 347  ALA A O    1  
ATOM   4318   C CB   . ALA A 1 291 ? 11.221  -25.237 21.421  0.04 16.08 ? 347  ALA A CB   1  
ATOM   4319   H H    . ALA A 1 291 ? 9.093   -25.424 22.550  0.04 16.26 ? 347  ALA A H    1  
ATOM   4320   H HA   . ALA A 1 291 ? 10.339  -23.410 21.545  0.04 15.44 ? 347  ALA A HA   1  
ATOM   4321   H HB1  . ALA A 1 291 ? 11.982  -24.904 20.922  0.04 15.93 ? 347  ALA A HB1  1  
ATOM   4322   H HB2  . ALA A 1 291 ? 11.437  -25.314 22.363  0.04 16.20 ? 347  ALA A HB2  1  
ATOM   4323   H HB3  . ALA A 1 291 ? 10.954  -26.099 21.069  0.04 16.36 ? 347  ALA A HB3  1  
ATOM   4324   N N    . ASN A 1 292 ? 10.247  -23.232 19.097  0.04 15.16 ? 348  ASN A N    1  
ATOM   4325   C CA   . ASN A 1 292 ? 10.101  -23.086 17.655  0.04 15.01 ? 348  ASN A CA   1  
ATOM   4326   C C    . ASN A 1 292 ? 8.725   -22.677 17.178  0.04 14.85 ? 348  ASN A C    1  
ATOM   4327   O O    . ASN A 1 292 ? 8.405   -22.791 16.008  0.04 14.80 ? 348  ASN A O    1  
ATOM   4328   C CB   . ASN A 1 292 ? 10.627  -24.326 16.937  0.04 15.40 ? 348  ASN A CB   1  
ATOM   4329   C CG   . ASN A 1 292 ? 12.101  -24.204 16.647  0.04 15.48 ? 348  ASN A CG   1  
ATOM   4330   O OD1  . ASN A 1 292 ? 12.533  -23.204 16.052  0.04 15.16 ? 348  ASN A OD1  1  
ATOM   4331   N ND2  . ASN A 1 292 ? 12.893  -25.146 17.157  0.04 15.93 ? 348  ASN A ND2  1  
ATOM   4332   H H    . ASN A 1 292 ? 10.716  -22.615 19.455  0.04 14.99 ? 348  ASN A H    1  
ATOM   4333   H HA   . ASN A 1 292 ? 10.679  -22.364 17.387  0.04 14.78 ? 348  ASN A HA   1  
ATOM   4334   H HB2  . ASN A 1 292 ? 10.505  -25.112 17.486  0.04 15.69 ? 348  ASN A HB2  1  
ATOM   4335   H HB3  . ASN A 1 292 ? 10.168  -24.442 16.092  0.04 15.35 ? 348  ASN A HB3  1  
ATOM   4336   H HD21 . ASN A 1 292 ? 13.749  -25.076 17.091  0.04 16.02 ? 348  ASN A HD21 1  
ATOM   4337   H HD22 . ASN A 1 292 ? 12.549  -25.830 17.556  0.04 16.16 ? 348  ASN A HD22 1  
ATOM   4338   N N    . THR A 1 293 ? 7.918   -22.161 18.083  0.04 14.79 ? 349  THR A N    1  
ATOM   4339   C CA   . THR A 1 293 ? 6.578   -21.726 17.730  0.04 14.69 ? 349  THR A CA   1  
ATOM   4340   C C    . THR A 1 293 ? 6.654   -20.420 16.933  0.04 14.26 ? 349  THR A C    1  
ATOM   4341   O O    . THR A 1 293 ? 7.304   -19.467 17.376  0.04 13.99 ? 349  THR A O    1  
ATOM   4342   C CB   . THR A 1 293 ? 5.728   -21.416 18.974  0.04 14.73 ? 349  THR A CB   1  
ATOM   4343   O OG1  . THR A 1 293 ? 5.567   -22.584 19.790  0.04 15.16 ? 349  THR A OG1  1  
ATOM   4344   C CG2  . THR A 1 293 ? 4.332   -20.981 18.589  0.04 14.68 ? 349  THR A CG2  1  
ATOM   4345   H H    . THR A 1 293 ? 8.123   -22.051 18.910  0.04 14.84 ? 349  THR A H    1  
ATOM   4346   H HA   . THR A 1 293 ? 6.134   -22.395 17.189  0.04 14.88 ? 349  THR A HA   1  
ATOM   4347   H HB   . THR A 1 293 ? 6.149   -20.710 19.487  0.04 14.53 ? 349  THR A HB   1  
ATOM   4348   H HG1  . THR A 1 293 ? 5.252   -23.205 19.332  0.04 15.33 ? 349  THR A HG1  1  
ATOM   4349   H HG21 . THR A 1 293 ? 3.873   -21.699 18.134  0.04 14.96 ? 349  THR A HG21 1  
ATOM   4350   H HG22 . THR A 1 293 ? 3.834   -20.762 19.387  0.04 14.61 ? 349  THR A HG22 1  
ATOM   4351   H HG23 . THR A 1 293 ? 4.345   -20.211 18.010  0.04 14.49 ? 349  THR A HG23 1  
ATOM   4352   N N    . VAL A 1 294 ? 5.990   -20.387 15.781  0.04 14.24 ? 350  VAL A N    1  
ATOM   4353   C CA   . VAL A 1 294 ? 5.860   -19.158 14.993  0.04 13.90 ? 350  VAL A CA   1  
ATOM   4354   C C    . VAL A 1 294 ? 4.511   -18.557 15.305  0.04 13.84 ? 350  VAL A C    1  
ATOM   4355   O O    . VAL A 1 294 ? 3.500   -19.256 15.171  0.04 14.10 ? 350  VAL A O    1  
ATOM   4356   C CB   . VAL A 1 294 ? 5.925   -19.504 13.493  0.04 13.98 ? 350  VAL A CB   1  
ATOM   4357   C CG1  . VAL A 1 294 ? 5.925   -18.235 12.621  0.04 13.67 ? 350  VAL A CG1  1  
ATOM   4358   C CG2  . VAL A 1 294 ? 7.207   -20.279 13.189  0.04 14.08 ? 350  VAL A CG2  1  
ATOM   4359   H H    . VAL A 1 294 ? 5.606   -21.052 15.429  0.04 14.45 ? 350  VAL A H    1  
ATOM   4360   H HA   . VAL A 1 294 ? 6.556   -18.519 15.210  0.04 13.70 ? 350  VAL A HA   1  
ATOM   4361   H HB   . VAL A 1 294 ? 5.166   -20.046 13.256  0.04 14.19 ? 350  VAL A HB   1  
ATOM   4362   H HG11 . VAL A 1 294 ? 5.402   -18.406 11.821  0.04 13.76 ? 350  VAL A HG11 1  
ATOM   4363   H HG12 . VAL A 1 294 ? 5.537   -17.500 13.121  0.04 13.61 ? 350  VAL A HG12 1  
ATOM   4364   H HG13 . VAL A 1 294 ? 6.835   -18.021 12.375  0.04 13.49 ? 350  VAL A HG13 1  
ATOM   4365   H HG21 . VAL A 1 294 ? 7.193   -20.549 12.258  0.04 14.11 ? 350  VAL A HG21 1  
ATOM   4366   H HG22 . VAL A 1 294 ? 7.967   -19.698 13.343  0.04 13.89 ? 350  VAL A HG22 1  
ATOM   4367   H HG23 . VAL A 1 294 ? 7.269   -21.059 13.763  0.04 14.32 ? 350  VAL A HG23 1  
ATOM   4368   N N    . ALA A 1 295 ? 4.490   -17.287 15.729  0.04 13.52 ? 351  ALA A N    1  
ATOM   4369   C CA   . ALA A 1 295 ? 3.246   -16.524 15.853  0.04 13.47 ? 351  ALA A CA   1  
ATOM   4370   C C    . ALA A 1 295 ? 3.346   -15.341 14.886  0.04 13.19 ? 351  ALA A C    1  
ATOM   4371   O O    . ALA A 1 295 ? 4.029   -14.339 15.158  0.04 12.93 ? 351  ALA A O    1  
ATOM   4372   C CB   . ALA A 1 295 ? 3.019   -16.052 17.279  0.04 13.42 ? 351  ALA A CB   1  
ATOM   4373   H H    . ALA A 1 295 ? 5.191   -16.840 15.932  0.04 13.35 ? 351  ALA A H    1  
ATOM   4374   H HA   . ALA A 1 295 ? 2.496   -17.071 15.587  0.04 13.66 ? 351  ALA A HA   1  
ATOM   4375   H HB1  . ALA A 1 295 ? 2.291   -15.413 17.275  0.04 13.37 ? 351  ALA A HB1  1  
ATOM   4376   H HB2  . ALA A 1 295 ? 2.783   -16.804 17.844  0.04 13.63 ? 351  ALA A HB2  1  
ATOM   4377   H HB3  . ALA A 1 295 ? 3.831   -15.630 17.599  0.04 13.25 ? 351  ALA A HB3  1  
ATOM   4378   N N    . LEU A 1 296 ? 2.712   -15.529 13.726  0.04 13.29 ? 352  LEU A N    1  
ATOM   4379   C CA   . LEU A 1 296 ? 2.810   -14.613 12.576  0.04 13.10 ? 352  LEU A CA   1  
ATOM   4380   C C    . LEU A 1 296 ? 1.526   -13.853 12.352  0.04 13.14 ? 352  LEU A C    1  
ATOM   4381   O O    . LEU A 1 296 ? 0.446   -14.440 12.253  0.04 13.40 ? 352  LEU A O    1  
ATOM   4382   C CB   . LEU A 1 296 ? 3.103   -15.406 11.308  0.04 13.26 ? 352  LEU A CB   1  
ATOM   4383   C CG   . LEU A 1 296 ? 3.041   -14.683 9.949   0.04 13.17 ? 352  LEU A CG   1  
ATOM   4384   C CD1  . LEU A 1 296 ? 4.233   -13.732 9.742   0.04 12.85 ? 352  LEU A CD1  1  
ATOM   4385   C CD2  . LEU A 1 296 ? 3.026   -15.703 8.836   0.04 13.37 ? 352  LEU A CD2  1  
ATOM   4386   H H    . LEU A 1 296 ? 2.199   -16.202 13.572  0.04 13.49 ? 352  LEU A H    1  
ATOM   4387   H HA   . LEU A 1 296 ? 3.528   -13.983 12.733  0.04 12.90 ? 352  LEU A HA   1  
ATOM   4388   H HB2  . LEU A 1 296 ? 3.988   -15.793 11.382  0.04 13.25 ? 352  LEU A HB2  1  
ATOM   4389   H HB3  . LEU A 1 296 ? 2.443   -16.117 11.263  0.04 13.48 ? 352  LEU A HB3  1  
ATOM   4390   H HG   . LEU A 1 296 ? 2.214   -14.186 9.881   0.04 13.24 ? 352  LEU A HG   1  
ATOM   4391   H HD11 . LEU A 1 296 ? 4.086   -13.221 8.931   0.04 12.83 ? 352  LEU A HD11 1  
ATOM   4392   H HD12 . LEU A 1 296 ? 4.296   -13.134 10.506  0.04 12.75 ? 352  LEU A HD12 1  
ATOM   4393   H HD13 . LEU A 1 296 ? 5.047   -14.252 9.664   0.04 12.80 ? 352  LEU A HD13 1  
ATOM   4394   H HD21 . LEU A 1 296 ? 3.141   -15.252 7.983   0.04 13.36 ? 352  LEU A HD21 1  
ATOM   4395   H HD22 . LEU A 1 296 ? 3.755   -16.326 8.977   0.04 13.32 ? 352  LEU A HD22 1  
ATOM   4396   H HD23 . LEU A 1 296 ? 2.181   -16.178 8.852   0.04 13.59 ? 352  LEU A HD23 1  
ATOM   4397   N N    . GLY A 1 297 ? 1.650   -12.520 12.251  0.04 12.91 ? 353  GLY A N    1  
ATOM   4398   C CA   . GLY A 1 297 ? 0.507   -11.647 12.062  0.04 12.97 ? 353  GLY A CA   1  
ATOM   4399   C C    . GLY A 1 297 ? 0.418   -11.097 10.658  0.04 12.95 ? 353  GLY A C    1  
ATOM   4400   O O    . GLY A 1 297 ? 1.423   -10.852 9.986   0.04 12.78 ? 353  GLY A O    1  
ATOM   4401   H H    . GLY A 1 297 ? 2.403   -12.105 12.264  0.04 12.74 ? 353  GLY A H    1  
ATOM   4402   H HA2  . GLY A 1 297 ? -0.314  -12.130 12.242  0.04 13.18 ? 353  GLY A HA2  1  
ATOM   4403   H HA3  . GLY A 1 297 ? 0.559   -10.905 12.686  0.04 12.86 ? 353  GLY A HA3  1  
ATOM   4404   N N    . LEU A 1 298 ? -0.832  -10.919 10.259  0.04 13.16 ? 354  LEU A N    1  
ATOM   4405   C CA   . LEU A 1 298 ? -1.237  -10.393 8.976   0.04 13.20 ? 354  LEU A CA   1  
ATOM   4406   C C    . LEU A 1 298 ? -1.948  -9.070  9.211   0.04 13.18 ? 354  LEU A C    1  
ATOM   4407   O O    . LEU A 1 298 ? -2.696  -8.919  10.172  0.04 13.26 ? 354  LEU A O    1  
ATOM   4408   C CB   . LEU A 1 298 ? -2.203  -11.385 8.275   0.04 13.53 ? 354  LEU A CB   1  
ATOM   4409   C CG   . LEU A 1 298 ? -1.709  -12.819 8.042   0.04 13.68 ? 354  LEU A CG   1  
ATOM   4410   C CD1  . LEU A 1 298 ? -2.776  -13.677 7.368   0.04 14.05 ? 354  LEU A CD1  1  
ATOM   4411   C CD2  . LEU A 1 298 ? -0.485  -12.781 7.216   0.04 13.47 ? 354  LEU A CD2  1  
ATOM   4412   H H    . LEU A 1 298 ? -1.503  -11.103 10.760  0.04 13.30 ? 354  LEU A H    1  
ATOM   4413   H HA   . LEU A 1 298 ? -0.460  -10.248 8.408   0.04 13.05 ? 354  LEU A HA   1  
ATOM   4414   H HB2  . LEU A 1 298 ? -3.014  -11.448 8.802   0.04 13.69 ? 354  LEU A HB2  1  
ATOM   4415   H HB3  . LEU A 1 298 ? -2.422  -11.022 7.404   0.04 13.55 ? 354  LEU A HB3  1  
ATOM   4416   H HG   . LEU A 1 298 ? -1.495  -13.224 8.897   0.04 13.72 ? 354  LEU A HG   1  
ATOM   4417   H HD11 . LEU A 1 298 ? -2.458  -14.590 7.299   0.04 14.14 ? 354  LEU A HD11 1  
ATOM   4418   H HD12 . LEU A 1 298 ? -3.586  -13.652 7.902   0.04 14.22 ? 354  LEU A HD12 1  
ATOM   4419   H HD13 . LEU A 1 298 ? -2.949  -13.327 6.480   0.04 14.05 ? 354  LEU A HD13 1  
ATOM   4420   H HD21 . LEU A 1 298 ? -0.252  -13.692 6.975   0.04 13.59 ? 354  LEU A HD21 1  
ATOM   4421   H HD22 . LEU A 1 298 ? -0.660  -12.257 6.418   0.04 13.43 ? 354  LEU A HD22 1  
ATOM   4422   H HD23 . LEU A 1 298 ? 0.237   -12.376 7.727   0.04 13.27 ? 354  LEU A HD23 1  
ATOM   4423   N N    . GLY A 1 299 ? -1.794  -8.104  8.305   0.04 13.12 ? 355  GLY A N    1  
ATOM   4424   C CA   . GLY A 1 299 ? -2.656  -6.925  8.318   0.04 13.19 ? 355  GLY A CA   1  
ATOM   4425   C C    . GLY A 1 299 ? -2.625  -6.092  9.594   0.04 13.04 ? 355  GLY A C    1  
ATOM   4426   O O    . GLY A 1 299 ? -3.658  -5.538  9.993   0.04 13.20 ? 355  GLY A O    1  
ATOM   4427   H H    . GLY A 1 299 ? -1.209  -8.114  7.677   0.04 13.07 ? 355  GLY A H    1  
ATOM   4428   H HA2  . GLY A 1 299 ? -2.442  -6.352  7.566   0.04 13.17 ? 355  GLY A HA2  1  
ATOM   4429   H HA3  . GLY A 1 299 ? -3.566  -7.227  8.200   0.04 13.42 ? 355  GLY A HA3  1  
ATOM   4430   N N    . LEU A 1 300 ? -1.473  -6.047  10.264  0.04 12.77 ? 356  LEU A N    1  
ATOM   4431   C CA   . LEU A 1 300 ? -1.320  -5.331  11.535  0.04 12.62 ? 356  LEU A CA   1  
ATOM   4432   C C    . LEU A 1 300 ? -2.337  -5.827  12.581  0.04 12.78 ? 356  LEU A C    1  
ATOM   4433   O O    . LEU A 1 300 ? -2.899  -5.067  13.345  0.04 12.80 ? 356  LEU A O    1  
ATOM   4434   C CB   . LEU A 1 300 ? -1.371  -3.794  11.326  0.04 12.61 ? 356  LEU A CB   1  
ATOM   4435   C CG   . LEU A 1 300 ? -0.051  -3.138  10.825  0.04 12.37 ? 356  LEU A CG   1  
ATOM   4436   C CD1  . LEU A 1 300 ? 1.090   -3.145  11.881  0.04 12.20 ? 356  LEU A CD1  1  
ATOM   4437   C CD2  . LEU A 1 300 ? 0.473   -3.768  9.508   0.04 12.27 ? 356  LEU A CD2  1  
ATOM   4438   H H    . LEU A 1 300 ? -0.752  -6.424  9.992   0.04 12.68 ? 356  LEU A H    1  
ATOM   4439   H HA   . LEU A 1 300 ? -0.447  -5.538  11.893  0.04 12.46 ? 356  LEU A HA   1  
ATOM   4440   H HB2  . LEU A 1 300 ? -2.052  -3.608  10.661  0.04 12.75 ? 356  LEU A HB2  1  
ATOM   4441   H HB3  . LEU A 1 300 ? -1.615  -3.362  12.157  0.04 12.67 ? 356  LEU A HB3  1  
ATOM   4442   H HG   . LEU A 1 300 ? -0.251  -2.213  10.631  0.04 12.42 ? 356  LEU A HG   1  
ATOM   4443   H HD11 . LEU A 1 300 ? 1.937   -3.039  11.422  0.04 12.06 ? 356  LEU A HD11 1  
ATOM   4444   H HD12 . LEU A 1 300 ? 0.964   -2.407  12.497  0.04 12.25 ? 356  LEU A HD12 1  
ATOM   4445   H HD13 . LEU A 1 300 ? 1.079   -3.984  12.365  0.04 12.21 ? 356  LEU A HD13 1  
ATOM   4446   H HD21 . LEU A 1 300 ? 1.280   -3.302  9.241   0.04 12.14 ? 356  LEU A HD21 1  
ATOM   4447   H HD22 . LEU A 1 300 ? 0.682   -4.701  9.669   0.04 12.25 ? 356  LEU A HD22 1  
ATOM   4448   H HD23 . LEU A 1 300 ? -0.204  -3.696  8.818   0.04 12.40 ? 356  LEU A HD23 1  
ATOM   4449   N N    . ALA A 1 301 ? -2.475  -7.141  12.633  0.04 12.91 ? 357  ALA A N    1  
ATOM   4450   C CA   . ALA A 1 301 ? -3.185  -7.832  13.704  0.04 13.09 ? 357  ALA A CA   1  
ATOM   4451   C C    . ALA A 1 301 ? -2.754  -7.276  15.057  0.04 12.93 ? 357  ALA A C    1  
ATOM   4452   O O    . ALA A 1 301 ? -1.588  -7.148  15.328  0.04 12.69 ? 357  ALA A O    1  
ATOM   4453   C CB   . ALA A 1 301 ? -2.878  -9.328  13.633  0.04 13.21 ? 357  ALA A CB   1  
ATOM   4454   H H    . ALA A 1 301 ? -2.164  -7.675  12.038  0.04 12.93 ? 357  ALA A H    1  
ATOM   4455   H HA   . ALA A 1 301 ? -4.136  -7.700  13.602  0.04 13.27 ? 357  ALA A HA   1  
ATOM   4456   H HB1  . ALA A 1 301 ? -3.109  -9.732  14.482  0.04 13.37 ? 357  ALA A HB1  1  
ATOM   4457   H HB2  . ALA A 1 301 ? -3.390  -9.733  12.920  0.04 13.32 ? 357  ALA A HB2  1  
ATOM   4458   H HB3  . ALA A 1 301 ? -1.928  -9.435  13.463  0.04 13.05 ? 357  ALA A HB3  1  
ATOM   4459   N N    . THR A 1 302 ? -3.764  -6.975  15.873  0.04 13.10 ? 358  THR A N    1  
ATOM   4460   C CA   . THR A 1 302 ? -3.574  -6.227  17.104  0.04 13.01 ? 358  THR A CA   1  
ATOM   4461   C C    . THR A 1 302 ? -4.164  -6.924  18.308  0.04 13.22 ? 358  THR A C    1  
ATOM   4462   O O    . THR A 1 302 ? -5.345  -7.239  18.290  0.04 13.50 ? 358  THR A O    1  
ATOM   4463   C CB   . THR A 1 302 ? -4.259  -4.845  16.985  0.04 13.07 ? 358  THR A CB   1  
ATOM   4464   O OG1  . THR A 1 302 ? -3.591  -4.069  15.981  0.04 12.89 ? 358  THR A OG1  1  
ATOM   4465   C CG2  . THR A 1 302 ? -4.163  -4.037  18.291  0.04 13.03 ? 358  THR A CG2  1  
ATOM   4466   H H    . THR A 1 302 ? -4.576  -7.187  15.711  0.04 13.30 ? 358  THR A H    1  
ATOM   4467   H HA   . THR A 1 302 ? -2.634  -6.101  17.240  0.04 12.81 ? 358  THR A HA   1  
ATOM   4468   H HB   . THR A 1 302 ? -5.185  -4.964  16.746  0.04 13.28 ? 358  THR A HB   1  
ATOM   4469   H HG1  . THR A 1 302 ? -3.759  -4.397  15.229  0.04 12.96 ? 358  THR A HG1  1  
ATOM   4470   H HG21 . THR A 1 302 ? -4.484  -3.137  18.124  0.04 13.06 ? 358  THR A HG21 1  
ATOM   4471   H HG22 . THR A 1 302 ? -4.711  -4.446  18.984  0.04 13.19 ? 358  THR A HG22 1  
ATOM   4472   H HG23 . THR A 1 302 ? -3.244  -3.986  18.592  0.04 12.84 ? 358  THR A HG23 1  
ATOM   4473   N N    . ILE A 1 303 ? -3.376  -7.058  19.373  0.04 13.10 ? 359  ILE A N    1  
ATOM   4474   C CA   . ILE A 1 303 ? -3.821  -7.695  20.610  0.04 13.32 ? 359  ILE A CA   1  
ATOM   4475   C C    . ILE A 1 303 ? -3.920  -6.623  21.703  0.04 13.32 ? 359  ILE A C    1  
ATOM   4476   O O    . ILE A 1 303 ? -2.992  -5.861  21.890  0.04 13.08 ? 359  ILE A O    1  
ATOM   4477   C CB   . ILE A 1 303 ? -2.872  -8.816  21.025  0.04 13.26 ? 359  ILE A CB   1  
ATOM   4478   C CG1  . ILE A 1 303 ? -2.753  -9.854  19.898  0.04 13.28 ? 359  ILE A CG1  1  
ATOM   4479   C CG2  . ILE A 1 303 ? -3.395  -9.531  22.284  0.04 13.54 ? 359  ILE A CG2  1  
ATOM   4480   C CD1  . ILE A 1 303 ? -1.540  -10.738 20.082  0.04 13.04 ? 359  ILE A CD1  1  
ATOM   4481   H H    . ILE A 1 303 ? -2.561  -6.790  19.403  0.04 12.92 ? 359  ILE A H    1  
ATOM   4482   H HA   . ILE A 1 303 ? -4.702  -8.076  20.491  0.04 13.54 ? 359  ILE A HA   1  
ATOM   4483   H HB   . ILE A 1 303 ? -1.997  -8.450  21.214  0.04 13.07 ? 359  ILE A HB   1  
ATOM   4484   H HG12 . ILE A 1 303 ? -3.538  -10.425 19.895  0.04 13.49 ? 359  ILE A HG12 1  
ATOM   4485   H HG13 . ILE A 1 303 ? -2.679  -9.401  19.047  0.04 13.28 ? 359  ILE A HG13 1  
ATOM   4486   H HG21 . ILE A 1 303 ? -2.929  -9.174  23.056  0.04 13.47 ? 359  ILE A HG21 1  
ATOM   4487   H HG22 . ILE A 1 303 ? -4.344  -9.363  22.377  0.04 13.73 ? 359  ILE A HG22 1  
ATOM   4488   H HG23 . ILE A 1 303 ? -3.226  -10.482 22.200  0.04 13.62 ? 359  ILE A HG23 1  
ATOM   4489   H HD11 . ILE A 1 303 ? -1.751  -11.643 19.803  0.04 13.11 ? 359  ILE A HD11 1  
ATOM   4490   H HD12 . ILE A 1 303 ? -0.817  -10.392 19.532  0.04 12.86 ? 359  ILE A HD12 1  
ATOM   4491   H HD13 . ILE A 1 303 ? -1.282  -10.730 21.016  0.04 13.03 ? 359  ILE A HD13 1  
ATOM   4492   N N    . ILE A 1 304 ? -5.081  -6.547  22.352  0.04 13.62 ? 360  ILE A N    1  
ATOM   4493   C CA   . ILE A 1 304 ? -5.300  -5.638  23.467  0.04 13.69 ? 360  ILE A CA   1  
ATOM   4494   C C    . ILE A 1 304 ? -5.497  -6.493  24.702  0.04 13.93 ? 360  ILE A C    1  
ATOM   4495   O O    . ILE A 1 304 ? -6.459  -7.268  24.778  0.04 14.24 ? 360  ILE A O    1  
ATOM   4496   C CB   . ILE A 1 304 ? -6.558  -4.777  23.295  0.04 13.91 ? 360  ILE A CB   1  
ATOM   4497   C CG1  . ILE A 1 304 ? -6.401  -3.831  22.082  0.04 13.73 ? 360  ILE A CG1  1  
ATOM   4498   C CG2  . ILE A 1 304 ? -6.840  -4.018  24.608  0.04 14.05 ? 360  ILE A CG2  1  
ATOM   4499   C CD1  . ILE A 1 304 ? -7.681  -3.020  21.797  0.04 14.01 ? 360  ILE A CD1  1  
ATOM   4500   H H    . ILE A 1 304 ? -5.763  -7.026  22.160  0.04 13.80 ? 360  ILE A H    1  
ATOM   4501   H HA   . ILE A 1 304 ? -4.536  -5.058  23.576  0.04 13.49 ? 360  ILE A HA   1  
ATOM   4502   H HB   . ILE A 1 304 ? -7.305  -5.366  23.112  0.04 14.13 ? 360  ILE A HB   1  
ATOM   4503   H HG12 . ILE A 1 304 ? -5.688  -3.207  22.261  0.04 13.56 ? 360  ILE A HG12 1  
ATOM   4504   H HG13 . ILE A 1 304 ? -6.187  -4.361  21.300  0.04 13.63 ? 360  ILE A HG13 1  
ATOM   4505   H HG21 . ILE A 1 304 ? -7.567  -3.393  24.480  0.04 14.17 ? 360  ILE A HG21 1  
ATOM   4506   H HG22 . ILE A 1 304 ? -7.091  -4.652  25.293  0.04 14.24 ? 360  ILE A HG22 1  
ATOM   4507   H HG23 . ILE A 1 304 ? -6.039  -3.545  24.879  0.04 13.86 ? 360  ILE A HG23 1  
ATOM   4508   H HD11 . ILE A 1 304 ? -7.508  -2.389  21.081  0.04 13.90 ? 360  ILE A HD11 1  
ATOM   4509   H HD12 . ILE A 1 304 ? -8.390  -3.626  21.531  0.04 14.18 ? 360  ILE A HD12 1  
ATOM   4510   H HD13 . ILE A 1 304 ? -7.942  -2.540  22.597  0.04 14.15 ? 360  ILE A HD13 1  
ATOM   4511   N N    . PRO A 1 305 ? -4.635  -6.327  25.713  0.04 13.83 ? 361  PRO A N    1  
ATOM   4512   C CA   . PRO A 1 305 ? -4.884  -7.046  26.962  0.04 14.10 ? 361  PRO A CA   1  
ATOM   4513   C C    . PRO A 1 305 ? -5.933  -6.323  27.825  0.04 14.36 ? 361  PRO A C    1  
ATOM   4514   O O    . PRO A 1 305 ? -5.868  -5.124  28.060  0.04 14.24 ? 361  PRO A O    1  
ATOM   4515   C CB   . PRO A 1 305 ? -3.514  -7.030  27.632  0.04 13.89 ? 361  PRO A CB   1  
ATOM   4516   C CG   . PRO A 1 305 ? -2.867  -5.742  27.109  0.04 13.58 ? 361  PRO A CG   1  
ATOM   4517   C CD   . PRO A 1 305 ? -3.397  -5.537  25.723  0.04 13.51 ? 361  PRO A CD   1  
ATOM   4518   H HA   . PRO A 1 305 ? -5.163  -7.954  26.785  0.04 14.25 ? 361  PRO A HA   1  
ATOM   4519   H HB2  . PRO A 1 305 ? -3.620  -7.001  28.594  0.04 14.05 ? 361  PRO A HB2  1  
ATOM   4520   H HB3  . PRO A 1 305 ? -3.009  -7.807  27.358  0.04 13.83 ? 361  PRO A HB3  1  
ATOM   4521   H HG2  . PRO A 1 305 ? -3.125  -4.998  27.678  0.04 13.65 ? 361  PRO A HG2  1  
ATOM   4522   H HG3  . PRO A 1 305 ? -1.899  -5.834  27.085  0.04 13.40 ? 361  PRO A HG3  1  
ATOM   4523   H HD2  . PRO A 1 305 ? -3.590  -4.604  25.562  0.04 13.49 ? 361  PRO A HD2  1  
ATOM   4524   H HD3  . PRO A 1 305 ? -2.770  -5.883  25.071  0.04 13.33 ? 361  PRO A HD3  1  
ATOM   4525   N N    . ASP A 1 306 ? -6.924  -7.061  28.264  0.04 14.74 ? 362  ASP A N    1  
ATOM   4526   C CA   . ASP A 1 306 ? -7.946  -6.531  29.170  0.04 15.08 ? 362  ASP A CA   1  
ATOM   4527   C C    . ASP A 1 306 ? -7.459  -6.755  30.617  0.04 15.25 ? 362  ASP A C    1  
ATOM   4528   O O    . ASP A 1 306 ? -6.483  -7.461  30.855  0.04 15.14 ? 362  ASP A O    1  
ATOM   4529   C CB   . ASP A 1 306 ? -9.310  -7.233  28.951  0.04 15.47 ? 362  ASP A CB   1  
ATOM   4530   C CG   . ASP A 1 306 ? -9.839  -7.124  27.511  0.04 15.41 ? 362  ASP A CG   1  
ATOM   4531   O OD1  . ASP A 1 306 ? -9.484  -6.160  26.820  0.04 15.10 ? 362  ASP A OD1  1  
ATOM   4532   O OD2  . ASP A 1 306 ? -10.682 -7.972  27.125  0.04 15.74 ? 362  ASP A OD2  1  
ATOM   4533   H H    . ASP A 1 306 ? -7.031  -7.884  28.052  0.04 14.83 ? 362  ASP A H    1  
ATOM   4534   H HA   . ASP A 1 306 ? -8.055  -5.581  29.035  0.04 14.99 ? 362  ASP A HA   1  
ATOM   4535   H HB2  . ASP A 1 306 ? -9.230  -8.174  29.176  0.04 15.53 ? 362  ASP A HB2  1  
ATOM   4536   H HB3  . ASP A 1 306 ? -9.972  -6.820  29.526  0.04 15.74 ? 362  ASP A HB3  1  
ATOM   4537   N N    . ASN A 1 307 ? -8.139  -6.111  31.549  0.04 15.53 ? 363  ASN A N    1  
ATOM   4538   C CA   . ASN A 1 307 ? -7.937  -6.349  32.980  0.04 15.80 ? 363  ASN A CA   1  
ATOM   4539   C C    . ASN A 1 307 ? -6.490  -6.242  33.488  0.04 15.55 ? 363  ASN A C    1  
ATOM   4540   O O    . ASN A 1 307 ? -6.126  -6.891  34.480  0.04 15.75 ? 363  ASN A O    1  
ATOM   4541   C CB   . ASN A 1 307 ? -8.458  -7.733  33.396  0.04 16.17 ? 363  ASN A CB   1  
ATOM   4542   C CG   . ASN A 1 307 ? -9.684  -8.183  32.637  0.04 16.50 ? 363  ASN A CG   1  
ATOM   4543   O OD1  . ASN A 1 307 ? -10.767 -7.631  32.783  0.04 16.57 ? 363  ASN A OD1  1  
ATOM   4544   N ND2  . ASN A 1 307 ? -9.519  -9.253  31.855  0.04 16.75 ? 363  ASN A ND2  1  
ATOM   4545   H H    . ASN A 1 307 ? -8.738  -5.526  31.375  0.04 15.60 ? 363  ASN A H    1  
ATOM   4546   H HA   . ASN A 1 307 ? -8.456  -5.692  33.469  0.04 15.98 ? 363  ASN A HA   1  
ATOM   4547   H HB2  . ASN A 1 307 ? -7.762  -8.393  33.244  0.04 16.03 ? 363  ASN A HB2  1  
ATOM   4548   H HB3  . ASN A 1 307 ? -8.691  -7.701  34.335  0.04 16.39 ? 363  ASN A HB3  1  
ATOM   4549   H HD21 . ASN A 1 307 ? -10.106 -9.436  31.256  0.04 17.08 ? 363  ASN A HD21 1  
ATOM   4550   H HD22 . ASN A 1 307 ? -8.834  -9.758  31.953  0.04 16.61 ? 363  ASN A HD22 1  
ATOM   4551   N N    . GLY A 1 308 ? -5.655  -5.482  32.801  0.04 15.14 ? 364  GLY A N    1  
ATOM   4552   C CA   . GLY A 1 308 ? -4.291  -5.274  33.241  0.04 14.92 ? 364  GLY A CA   1  
ATOM   4553   C C    . GLY A 1 308 ? -3.335  -6.435  33.042  0.04 14.80 ? 364  GLY A C    1  
ATOM   4554   O O    . GLY A 1 308 ? -2.237  -6.432  33.590  0.04 14.71 ? 364  GLY A O    1  
ATOM   4555   H H    . GLY A 1 308 ? -5.845  -5.082  32.067  0.04 15.00 ? 364  GLY A H    1  
ATOM   4556   H HA2  . GLY A 1 308 ? -3.926  -4.523  32.751  0.04 14.68 ? 364  GLY A HA2  1  
ATOM   4557   H HA3  . GLY A 1 308 ? -4.296  -5.041  34.181  0.04 15.10 ? 364  GLY A HA3  1  
ATOM   4558   N N    . VAL A 1 309 ? -3.735  -7.409  32.237  0.04 14.83 ? 365  VAL A N    1  
ATOM   4559   C CA   . VAL A 1 309 ? -2.884  -8.563  32.013  0.04 14.76 ? 365  VAL A CA   1  
ATOM   4560   C C    . VAL A 1 309 ? -1.728  -8.239  31.071  0.04 14.33 ? 365  VAL A C    1  
ATOM   4561   O O    . VAL A 1 309 ? -1.746  -7.253  30.344  0.04 14.08 ? 365  VAL A O    1  
ATOM   4562   C CB   . VAL A 1 309 ? -3.678  -9.813  31.497  0.04 15.00 ? 365  VAL A CB   1  
ATOM   4563   C CG1  . VAL A 1 309 ? -4.895  -10.069 32.332  0.04 15.48 ? 365  VAL A CG1  1  
ATOM   4564   C CG2  . VAL A 1 309 ? -4.096  -9.641  30.024  0.04 14.80 ? 365  VAL A CG2  1  
ATOM   4565   H H    . VAL A 1 309 ? -4.478  -7.421  31.814  0.04 14.91 ? 365  VAL A H    1  
ATOM   4566   H HA   . VAL A 1 309 ? -2.499  -8.818  32.869  0.04 14.90 ? 365  VAL A HA   1  
ATOM   4567   H HB   . VAL A 1 309 ? -3.106  -10.591 31.555  0.04 15.00 ? 365  VAL A HB   1  
ATOM   4568   H HG11 . VAL A 1 309 ? -5.321  -10.884 32.023  0.04 15.67 ? 365  VAL A HG11 1  
ATOM   4569   H HG12 . VAL A 1 309 ? -4.627  -10.165 33.261  0.04 15.57 ? 365  VAL A HG12 1  
ATOM   4570   H HG13 . VAL A 1 309 ? -5.503  -9.320  32.232  0.04 15.52 ? 365  VAL A HG13 1  
ATOM   4571   H HG21 . VAL A 1 309 ? -4.608  -10.418 29.758  0.04 14.99 ? 365  VAL A HG21 1  
ATOM   4572   H HG22 . VAL A 1 309 ? -4.638  -8.848  29.927  0.04 14.78 ? 365  VAL A HG22 1  
ATOM   4573   H HG23 . VAL A 1 309 ? -3.303  -9.571  29.473  0.04 14.54 ? 365  VAL A HG23 1  
ATOM   4574   N N    . THR A 1 310 ? -0.716  -9.086  31.080  0.04 14.29 ? 366  THR A N    1  
ATOM   4575   C CA   . THR A 1 310 ? 0.314   -9.107  30.068  0.04 13.94 ? 366  THR A CA   1  
ATOM   4576   C C    . THR A 1 310 ? -0.306  -9.726  28.784  0.04 13.89 ? 366  THR A C    1  
ATOM   4577   O O    . THR A 1 310 ? -1.007  -10.716 28.859  0.04 14.15 ? 366  THR A O    1  
ATOM   4578   C CB   . THR A 1 310 ? 1.523   -9.949  30.572  0.04 14.00 ? 366  THR A CB   1  
ATOM   4579   O OG1  . THR A 1 310 ? 2.060   -9.352  31.767  0.04 14.13 ? 366  THR A OG1  1  
ATOM   4580   C CG2  . THR A 1 310 ? 2.619   -10.139 29.514  0.04 13.69 ? 366  THR A CG2  1  
ATOM   4581   H H    . THR A 1 310 ? -0.605  -9.679  31.686  0.04 14.48 ? 366  THR A H    1  
ATOM   4582   H HA   . THR A 1 310 ? 0.611   -8.206  29.874  0.04 13.75 ? 366  THR A HA   1  
ATOM   4583   H HB   . THR A 1 310 ? 1.185   -10.833 30.795  0.04 14.21 ? 366  THR A HB   1  
ATOM   4584   H HG1  . THR A 1 310 ? 2.357   -8.588  31.592  0.04 13.96 ? 366  THR A HG1  1  
ATOM   4585   H HG21 . THR A 1 310 ? 3.371   -10.605 29.909  0.04 13.69 ? 366  THR A HG21 1  
ATOM   4586   H HG22 . THR A 1 310 ? 2.283   -10.672 28.774  0.04 13.73 ? 366  THR A HG22 1  
ATOM   4587   H HG23 . THR A 1 310 ? 2.918   -9.282  29.173  0.04 13.48 ? 366  THR A HG23 1  
ATOM   4588   N N    . ALA A 1 311 ? -0.087  -9.105  27.623  0.04 13.58 ? 367  ALA A N    1  
ATOM   4589   C CA   . ALA A 1 311 ? -0.636  -9.598  26.367  0.04 13.56 ? 367  ALA A CA   1  
ATOM   4590   C C    . ALA A 1 311 ? 0.057   -10.880 25.888  0.04 13.58 ? 367  ALA A C    1  
ATOM   4591   O O    . ALA A 1 311 ? -0.590  -11.792 25.397  0.04 13.76 ? 367  ALA A O    1  
ATOM   4592   C CB   . ALA A 1 311 ? -0.513  -8.524  25.298  0.04 13.25 ? 367  ALA A CB   1  
ATOM   4593   H H    . ALA A 1 311 ? 0.391   -8.400  27.536  0.04 13.41 ? 367  ALA A H    1  
ATOM   4594   H HA   . ALA A 1 311 ? -1.577  -9.796  26.490  0.04 13.75 ? 367  ALA A HA   1  
ATOM   4595   H HB1  . ALA A 1 311 ? -1.033  -8.766  24.518  0.04 13.27 ? 367  ALA A HB1  1  
ATOM   4596   H HB2  . ALA A 1 311 ? -0.834  -7.690  25.668  0.04 13.25 ? 367  ALA A HB2  1  
ATOM   4597   H HB3  . ALA A 1 311 ? 0.425   -8.444  25.070  0.04 13.08 ? 367  ALA A HB3  1  
ATOM   4598   N N    . LEU A 1 312 ? 1.388   -10.895 25.993  0.04 13.43 ? 368  LEU A N    1  
ATOM   4599   C CA   . LEU A 1 312 ? 2.219   -11.952 25.432  0.04 13.46 ? 368  LEU A CA   1  
ATOM   4600   C C    . LEU A 1 312 ? 3.329   -12.368 26.391  0.04 13.51 ? 368  LEU A C    1  
ATOM   4601   O O    . LEU A 1 312 ? 4.158   -11.544 26.729  0.04 13.35 ? 368  LEU A O    1  
ATOM   4602   C CB   . LEU A 1 312 ? 2.895   -11.425 24.174  0.04 13.20 ? 368  LEU A CB   1  
ATOM   4603   C CG   . LEU A 1 312 ? 3.958   -12.367 23.646  0.04 13.27 ? 368  LEU A CG   1  
ATOM   4604   C CD1  . LEU A 1 312 ? 3.385   -13.781 23.586  0.04 13.63 ? 368  LEU A CD1  1  
ATOM   4605   C CD2  . LEU A 1 312 ? 4.422   -11.903 22.289  0.04 13.07 ? 368  LEU A CD2  1  
ATOM   4606   H H    . LEU A 1 312 ? 1.841   -10.283 26.385  0.04 13.33 ? 368  LEU A H    1  
ATOM   4607   H HA   . LEU A 1 312 ? 1.670   -12.716 25.213  0.04 13.68 ? 368  LEU A HA   1  
ATOM   4608   H HB2  . LEU A 1 312 ? 2.238   -11.288 23.469  0.04 13.18 ? 368  LEU A HB2  1  
ATOM   4609   H HB3  . LEU A 1 312 ? 3.325   -10.582 24.396  0.04 13.02 ? 368  LEU A HB3  1  
ATOM   4610   H HG   . LEU A 1 312 ? 4.725   -12.368 24.238  0.04 13.24 ? 368  LEU A HG   1  
ATOM   4611   H HD11 . LEU A 1 312 ? 3.819   -14.261 22.863  0.04 13.69 ? 368  LEU A HD11 1  
ATOM   4612   H HD12 . LEU A 1 312 ? 3.541   -14.233 24.430  0.04 13.78 ? 368  LEU A HD12 1  
ATOM   4613   H HD13 . LEU A 1 312 ? 2.433   -13.719 23.412  0.04 13.67 ? 368  LEU A HD13 1  
ATOM   4614   H HD21 . LEU A 1 312 ? 5.023   -12.568 21.918  0.04 13.11 ? 368  LEU A HD21 1  
ATOM   4615   H HD22 . LEU A 1 312 ? 3.660   -11.781 21.705  0.04 13.13 ? 368  LEU A HD22 1  
ATOM   4616   H HD23 . LEU A 1 312 ? 4.889   -11.058 22.399  0.04 12.86 ? 368  LEU A HD23 1  
ATOM   4617   N N    . LYS A 1 313 ? 3.333   -13.637 26.807  0.04 13.79 ? 369  LYS A N    1  
ATOM   4618   C CA   . LYS A 1 313 ? 4.416   -14.231 27.636  0.04 13.92 ? 369  LYS A CA   1  
ATOM   4619   C C    . LYS A 1 313 ? 5.069   -15.383 26.824  0.04 14.01 ? 369  LYS A C    1  
ATOM   4620   O O    . LYS A 1 313 ? 4.417   -16.375 26.534  0.04 14.22 ? 369  LYS A O    1  
ATOM   4621   C CB   . LYS A 1 313 ? 3.911   -14.735 29.032  0.04 14.29 ? 369  LYS A CB   1  
ATOM   4622   C CG   . LYS A 1 313 ? 3.803   -13.657 30.195  0.04 14.27 ? 369  LYS A CG   1  
ATOM   4623   C CD   . LYS A 1 313 ? 3.329   -14.198 31.624  0.04 14.69 ? 369  LYS A CD   1  
ATOM   4624   C CE   . LYS A 1 313 ? 2.936   -12.952 32.628  0.04 14.70 ? 369  LYS A CE   1  
ATOM   4625   N NZ   . LYS A 1 313 ? 2.179   -13.046 34.013  0.04 15.15 ? 369  LYS A NZ   1  
ATOM   4626   H H    . LYS A 1 313 ? 2.695   -14.182 26.639  0.04 13.93 ? 369  LYS A H    1  
ATOM   4627   H HA   . LYS A 1 313 ? 5.108   -13.572 27.796  0.04 13.76 ? 369  LYS A HA   1  
ATOM   4628   H HB2  . LYS A 1 313 ? 3.030   -15.115 28.913  0.04 14.47 ? 369  LYS A HB2  1  
ATOM   4629   H HB3  . LYS A 1 313 ? 4.516   -15.424 29.341  0.04 14.43 ? 369  LYS A HB3  1  
ATOM   4630   H HG2  . LYS A 1 313 ? 4.676   -13.251 30.316  0.04 14.17 ? 369  LYS A HG2  1  
ATOM   4631   H HG3  . LYS A 1 313 ? 3.166   -12.980 29.925  0.04 14.12 ? 369  LYS A HG3  1  
ATOM   4632   H HD2  . LYS A 1 313 ? 2.540   -14.750 31.507  0.04 14.81 ? 369  LYS A HD2  1  
ATOM   4633   H HD3  . LYS A 1 313 ? 4.040   -14.723 32.024  0.04 14.87 ? 369  LYS A HD3  1  
ATOM   4634   H HE2  . LYS A 1 313 ? 3.764   -12.483 32.820  0.04 14.56 ? 369  LYS A HE2  1  
ATOM   4635   H HE3  . LYS A 1 313 ? 2.375   -12.360 32.096  0.04 14.59 ? 369  LYS A HE3  1  
ATOM   4636   H HZ1  . LYS A 1 313 ? 1.993   -12.228 34.306  0.04 15.18 ? 369  LYS A HZ1  1  
ATOM   4637   H HZ2  . LYS A 1 313 ? 1.416   -13.496 33.925  0.04 15.28 ? 369  LYS A HZ2  1  
ATOM   4638   H HZ3  . LYS A 1 313 ? 2.696   -13.465 34.604  0.04 15.31 ? 369  LYS A HZ3  1  
ATOM   4639   N N    . VAL A 1 314 ? 6.322   -15.215 26.409  0.04 13.88 ? 370  VAL A N    1  
ATOM   4640   C CA   . VAL A 1 314 ? 7.080   -16.315 25.774  0.04 14.01 ? 370  VAL A CA   1  
ATOM   4641   C C    . VAL A 1 314 ? 7.890   -17.015 26.851  0.04 14.32 ? 370  VAL A C    1  
ATOM   4642   O O    . VAL A 1 314 ? 8.539   -16.378 27.687  0.04 14.30 ? 370  VAL A O    1  
ATOM   4643   C CB   . VAL A 1 314 ? 8.025   -15.815 24.665  0.04 13.72 ? 370  VAL A CB   1  
ATOM   4644   C CG1  . VAL A 1 314 ? 8.746   -16.969 24.021  0.04 13.90 ? 370  VAL A CG1  1  
ATOM   4645   C CG2  . VAL A 1 314 ? 7.269   -15.036 23.620  0.04 13.43 ? 370  VAL A CG2  1  
ATOM   4646   H H    . VAL A 1 314 ? 6.762   -14.487 26.482  0.04 13.74 ? 370  VAL A H    1  
ATOM   4647   H HA   . VAL A 1 314 ? 6.470   -16.960 25.390  0.04 14.14 ? 370  VAL A HA   1  
ATOM   4648   H HB   . VAL A 1 314 ? 8.686   -15.219 25.048  0.04 13.63 ? 370  VAL A HB   1  
ATOM   4649   H HG11 . VAL A 1 314 ? 9.023   -16.718 23.129  0.04 13.72 ? 370  VAL A HG11 1  
ATOM   4650   H HG12 . VAL A 1 314 ? 9.522   -17.198 24.551  0.04 14.09 ? 370  VAL A HG12 1  
ATOM   4651   H HG13 . VAL A 1 314 ? 8.140   -17.721 23.982  0.04 14.03 ? 370  VAL A HG13 1  
ATOM   4652   H HG21 . VAL A 1 314 ? 7.921   -14.611 23.042  0.04 13.23 ? 370  VAL A HG21 1  
ATOM   4653   H HG22 . VAL A 1 314 ? 6.721   -15.648 23.103  0.04 13.50 ? 370  VAL A HG22 1  
ATOM   4654   H HG23 . VAL A 1 314 ? 6.709   -14.362 24.040  0.04 13.40 ? 370  VAL A HG23 1  
ATOM   4655   N N    . GLY A 1 315 ? 7.837   -18.342 26.842  0.04 14.67 ? 371  GLY A N    1  
ATOM   4656   C CA   . GLY A 1 315 ? 8.540   -19.119 27.842  0.04 15.03 ? 371  GLY A CA   1  
ATOM   4657   C C    . GLY A 1 315 ? 10.043  -19.197 27.586  0.04 15.00 ? 371  GLY A C    1  
ATOM   4658   O O    . GLY A 1 315 ? 10.574  -18.564 26.677  0.04 14.69 ? 371  GLY A O    1  
ATOM   4659   H H    . GLY A 1 315 ? 7.414   -18.806 26.257  0.04 14.71 ? 371  GLY A H    1  
ATOM   4660   H HA2  . GLY A 1 315 ? 8.397   -18.739 28.721  0.04 15.09 ? 371  GLY A HA2  1  
ATOM   4661   H HA3  . GLY A 1 315 ? 8.189   -20.012 27.851  0.04 15.29 ? 371  GLY A HA3  1  
ATOM   4662   N N    . ASP A 1 316 ? 10.711  -20.022 28.396  0.04 15.39 ? 372  ASP A N    1  
ATOM   4663   C CA   . ASP A 1 316 ? 12.170  -20.131 28.360  0.04 15.47 ? 372  ASP A CA   1  
ATOM   4664   C C    . ASP A 1 316 ? 12.661  -21.178 27.375  0.04 15.64 ? 372  ASP A C    1  
ATOM   4665   O O    . ASP A 1 316 ? 13.488  -22.026 27.694  0.04 16.08 ? 372  ASP A O    1  
ATOM   4666   C CB   . ASP A 1 316 ? 12.680  -20.407 29.777  0.04 15.86 ? 372  ASP A CB   1  
ATOM   4667   C CG   . ASP A 1 316 ? 12.328  -19.284 30.723  0.04 15.71 ? 372  ASP A CG   1  
ATOM   4668   O OD1  . ASP A 1 316 ? 12.894  -18.218 30.538  0.04 15.30 ? 372  ASP A OD1  1  
ATOM   4669   O OD2  . ASP A 1 316 ? 11.505  -19.474 31.644  0.04 16.05 ? 372  ASP A OD2  1  
ATOM   4670   H H    . ASP A 1 316 ? 10.340  -20.528 28.975  0.04 15.64 ? 372  ASP A H    1  
ATOM   4671   H HA   . ASP A 1 316 ? 12.530  -19.276 28.086  0.04 15.18 ? 372  ASP A HA   1  
ATOM   4672   H HB2  . ASP A 1 316 ? 12.270  -21.217 30.111  0.04 16.16 ? 372  ASP A HB2  1  
ATOM   4673   H HB3  . ASP A 1 316 ? 13.643  -20.500 29.758  0.04 15.94 ? 372  ASP A HB3  1  
ATOM   4674   N N    . VAL A 1 317 ? 12.167  -21.029 26.158  0.04 15.33 ? 373  VAL A N    1  
ATOM   4675   C CA   . VAL A 1 317 ? 12.342  -21.994 25.077  0.04 15.47 ? 373  VAL A CA   1  
ATOM   4676   C C    . VAL A 1 317 ? 13.107  -21.396 23.900  0.04 15.15 ? 373  VAL A C    1  
ATOM   4677   O O    . VAL A 1 317 ? 13.128  -20.178 23.699  0.04 14.76 ? 373  VAL A O    1  
ATOM   4678   C CB   . VAL A 1 317 ? 10.976  -22.553 24.596  0.04 15.56 ? 373  VAL A CB   1  
ATOM   4679   C CG1  . VAL A 1 317 ? 10.418  -23.553 25.591  0.04 15.92 ? 373  VAL A CG1  1  
ATOM   4680   C CG2  . VAL A 1 317 ? 9.939   -21.481 24.360  0.04 15.13 ? 373  VAL A CG2  1  
ATOM   4681   H H    . VAL A 1 317 ? 11.717  -20.338 25.922  0.04 15.05 ? 373  VAL A H    1  
ATOM   4682   H HA   . VAL A 1 317 ? 12.864  -22.737 25.410  0.04 15.78 ? 373  VAL A HA   1  
ATOM   4683   H HB   . VAL A 1 317 ? 11.105  -23.009 23.749  0.04 15.70 ? 373  VAL A HB   1  
ATOM   4684   H HG11 . VAL A 1 317 ? 9.481   -23.705 25.398  0.04 16.10 ? 373  VAL A HG11 1  
ATOM   4685   H HG12 . VAL A 1 317 ? 10.910  -24.386 25.515  0.04 16.17 ? 373  VAL A HG12 1  
ATOM   4686   H HG13 . VAL A 1 317 ? 10.517  -23.187 26.482  0.04 15.77 ? 373  VAL A HG13 1  
ATOM   4687   H HG21 . VAL A 1 317 ? 9.162   -21.898 23.964  0.04 15.20 ? 373  VAL A HG21 1  
ATOM   4688   H HG22 . VAL A 1 317 ? 9.696   -21.095 25.215  0.04 15.07 ? 373  VAL A HG22 1  
ATOM   4689   H HG23 . VAL A 1 317 ? 10.289  -20.799 23.766  0.04 14.87 ? 373  VAL A HG23 1  
ATOM   4690   N N    . ASP A 1 318 ? 13.749  -22.271 23.136  0.04 15.37 ? 374  ASP A N    1  
ATOM   4691   C CA   . ASP A 1 318 ? 14.451  -21.876 21.916  0.04 15.14 ? 374  ASP A CA   1  
ATOM   4692   C C    . ASP A 1 318 ? 13.463  -21.517 20.804  0.04 14.86 ? 374  ASP A C    1  
ATOM   4693   O O    . ASP A 1 318 ? 12.341  -22.020 20.744  0.04 14.97 ? 374  ASP A O    1  
ATOM   4694   C CB   . ASP A 1 318 ? 15.236  -23.055 21.340  0.04 15.52 ? 374  ASP A CB   1  
ATOM   4695   C CG   . ASP A 1 318 ? 16.407  -23.519 22.188  0.04 15.87 ? 374  ASP A CG   1  
ATOM   4696   O OD1  . ASP A 1 318 ? 16.617  -23.108 23.362  0.04 15.77 ? 374  ASP A OD1  1  
ATOM   4697   O OD2  . ASP A 1 318 ? 17.125  -24.352 21.627  0.04 16.30 ? 374  ASP A OD2  1  
ATOM   4698   H H    . ASP A 1 318 ? 13.791  -23.109 23.305  0.04 15.67 ? 374  ASP A H    1  
ATOM   4699   H HA   . ASP A 1 318 ? 15.047  -21.133 22.086  0.04 14.97 ? 374  ASP A HA   1  
ATOM   4700   H HB2  . ASP A 1 318 ? 14.629  -23.804 21.240  0.04 15.71 ? 374  ASP A HB2  1  
ATOM   4701   H HB3  . ASP A 1 318 ? 15.594  -22.802 20.475  0.04 15.37 ? 374  ASP A HB3  1  
ATOM   4702   N N    . GLY A 1 319 ? 13.907  -20.674 19.884  0.04 14.54 ? 375  GLY A N    1  
ATOM   4703   C CA   . GLY A 1 319 ? 13.345  -20.621 18.541  0.04 14.39 ? 375  GLY A CA   1  
ATOM   4704   C C    . GLY A 1 319 ? 11.987  -20.003 18.309  0.04 14.15 ? 375  GLY A C    1  
ATOM   4705   O O    . GLY A 1 319 ? 11.426  -20.194 17.234  0.04 14.13 ? 375  GLY A O    1  
ATOM   4706   H H    . GLY A 1 319 ? 14.559  -20.130 19.998  0.04 14.42 ? 375  GLY A H    1  
ATOM   4707   H HA2  . GLY A 1 319 ? 13.972  -20.168 17.964  0.04 14.25 ? 375  GLY A HA2  1  
ATOM   4708   H HA3  . GLY A 1 319 ? 13.282  -21.538 18.227  0.04 14.64 ? 375  GLY A HA3  1  
ATOM   4709   N N    . VAL A 1 320 ? 11.423  -19.286 19.269  0.04 14.01 ? 376  VAL A N    1  
ATOM   4710   C CA   . VAL A 1 320 ? 10.088  -18.735 19.050  0.04 13.83 ? 376  VAL A CA   1  
ATOM   4711   C C    . VAL A 1 320 ? 10.243  -17.523 18.146  0.04 13.46 ? 376  VAL A C    1  
ATOM   4712   O O    . VAL A 1 320 ? 11.252  -16.839 18.226  0.04 13.29 ? 376  VAL A O    1  
ATOM   4713   C CB   . VAL A 1 320 ? 9.398   -18.377 20.386  0.04 13.85 ? 376  VAL A CB   1  
ATOM   4714   C CG1  . VAL A 1 320 ? 8.150   -17.511 20.161  0.04 13.63 ? 376  VAL A CG1  1  
ATOM   4715   C CG2  . VAL A 1 320 ? 9.022   -19.638 21.131  0.04 14.25 ? 376  VAL A CG2  1  
ATOM   4716   H H    . VAL A 1 320 ? 11.771  -19.110 20.034  0.04 14.03 ? 376  VAL A H    1  
ATOM   4717   H HA   . VAL A 1 320 ? 9.539   -19.381 18.583  0.04 13.97 ? 376  VAL A HA   1  
ATOM   4718   H HB   . VAL A 1 320 ? 10.013  -17.875 20.940  0.04 13.77 ? 376  VAL A HB   1  
ATOM   4719   H HG11 . VAL A 1 320 ? 7.586   -17.576 20.942  0.04 13.73 ? 376  VAL A HG11 1  
ATOM   4720   H HG12 . VAL A 1 320 ? 8.417   -16.590 20.013  0.04 13.39 ? 376  VAL A HG12 1  
ATOM   4721   H HG13 . VAL A 1 320 ? 7.679   -17.846 19.386  0.04 13.67 ? 376  VAL A HG13 1  
ATOM   4722   H HG21 . VAL A 1 320 ? 8.906   -19.414 22.067  0.04 14.31 ? 376  VAL A HG21 1  
ATOM   4723   H HG22 . VAL A 1 320 ? 8.200   -19.989 20.763  0.04 14.31 ? 376  VAL A HG22 1  
ATOM   4724   H HG23 . VAL A 1 320 ? 9.730   -20.290 21.032  0.04 14.43 ? 376  VAL A HG23 1  
ATOM   4725   N N    . LYS A 1 321 ? 9.281   -17.312 17.261  0.04 13.39 ? 377  LYS A N    1  
ATOM   4726   C CA   . LYS A 1 321 ? 9.326   -16.244 16.245  0.04 13.10 ? 377  LYS A CA   1  
ATOM   4727   C C    . LYS A 1 321 ? 8.029   -15.467 16.317  0.04 12.96 ? 377  LYS A C    1  
ATOM   4728   O O    . LYS A 1 321 ? 7.013   -15.913 15.789  0.04 13.09 ? 377  LYS A O    1  
ATOM   4729   C CB   . LYS A 1 321 ? 9.466   -16.863 14.852  0.04 13.21 ? 377  LYS A CB   1  
ATOM   4730   C CG   . LYS A 1 321 ? 10.871  -17.381 14.557  0.04 13.42 ? 377  LYS A CG   1  
ATOM   4731   C CD   . LYS A 1 321 ? 10.869  -18.769 13.882  0.04 13.63 ? 377  LYS A CD   1  
ATOM   4732   C CE   . LYS A 1 321 ? 12.256  -19.412 13.827  0.04 13.92 ? 377  LYS A CE   1  
ATOM   4733   N NZ   . LYS A 1 321 ? 12.159  -20.776 14.470  0.04 14.24 ? 377  LYS A NZ   1  
ATOM   4734   H H    . LYS A 1 321 ? 8.566   -17.779 17.217  0.04 13.54 ? 377  LYS A H    1  
ATOM   4735   H HA   . LYS A 1 321 ? 10.069  -15.652 16.412  0.04 12.97 ? 377  LYS A HA   1  
ATOM   4736   H HB2  . LYS A 1 321 ? 8.855   -17.611 14.774  0.04 13.35 ? 377  LYS A HB2  1  
ATOM   4737   H HB3  . LYS A 1 321 ? 9.251   -16.189 14.188  0.04 13.04 ? 377  LYS A HB3  1  
ATOM   4738   H HG2  . LYS A 1 321 ? 11.295  -16.762 13.945  0.04 13.29 ? 377  LYS A HG2  1  
ATOM   4739   H HG3  . LYS A 1 321 ? 11.376  -17.432 15.382  0.04 13.59 ? 377  LYS A HG3  1  
ATOM   4740   H HD2  . LYS A 1 321 ? 10.285  -19.363 14.373  0.04 13.76 ? 377  LYS A HD2  1  
ATOM   4741   H HD3  . LYS A 1 321 ? 10.545  -18.672 12.972  0.04 13.50 ? 377  LYS A HD3  1  
ATOM   4742   H HE2  . LYS A 1 321 ? 12.533  -19.513 12.906  0.04 14.02 ? 377  LYS A HE2  1  
ATOM   4743   H HE3  . LYS A 1 321 ? 12.892  -18.876 14.323  0.04 13.83 ? 377  LYS A HE3  1  
ATOM   4744   H HZ1  . LYS A 1 321 ? 12.905  -20.973 14.906  0.04 14.32 ? 377  LYS A HZ1  1  
ATOM   4745   H HZ2  . LYS A 1 321 ? 11.480  -20.793 15.042  0.04 14.19 ? 377  LYS A HZ2  1  
ATOM   4746   H HZ3  . LYS A 1 321 ? 12.014  -21.392 13.846  0.04 14.44 ? 377  LYS A HZ3  1  
ATOM   4747   N N    . VAL A 1 322 ? 8.072   -14.290 16.934  0.04 12.75 ? 378  VAL A N    1  
ATOM   4748   C CA   . VAL A 1 322 ? 6.903   -13.413 17.076  0.04 12.63 ? 378  VAL A CA   1  
ATOM   4749   C C    . VAL A 1 322 ? 7.091   -12.396 15.977  0.04 12.40 ? 378  VAL A C    1  
ATOM   4750   O O    . VAL A 1 322 ? 8.171   -11.827 15.869  0.04 12.25 ? 378  VAL A O    1  
ATOM   4751   C CB   . VAL A 1 322 ? 6.910   -12.678 18.434  0.04 12.59 ? 378  VAL A CB   1  
ATOM   4752   C CG1  . VAL A 1 322 ? 5.631   -11.850 18.678  0.04 12.53 ? 378  VAL A CG1  1  
ATOM   4753   C CG2  . VAL A 1 322 ? 7.165   -13.648 19.569  0.04 12.87 ? 378  VAL A CG2  1  
ATOM   4754   H H    . VAL A 1 322 ? 8.791   -13.952 17.257  0.04 12.68 ? 378  VAL A H    1  
ATOM   4755   H HA   . VAL A 1 322 ? 6.072   -13.893 16.943  0.04 12.76 ? 378  VAL A HA   1  
ATOM   4756   H HB   . VAL A 1 322 ? 7.650   -12.048 18.430  0.04 12.47 ? 378  VAL A HB   1  
ATOM   4757   H HG11 . VAL A 1 322 ? 5.760   -11.321 19.479  0.04 12.56 ? 378  VAL A HG11 1  
ATOM   4758   H HG12 . VAL A 1 322 ? 5.488   -11.268 17.915  0.04 12.36 ? 378  VAL A HG12 1  
ATOM   4759   H HG13 . VAL A 1 322 ? 4.876   -12.448 18.791  0.04 12.65 ? 378  VAL A HG13 1  
ATOM   4760   H HG21 . VAL A 1 322 ? 6.872   -13.256 20.402  0.04 12.90 ? 378  VAL A HG21 1  
ATOM   4761   H HG22 . VAL A 1 322 ? 6.675   -14.467 19.397  0.04 13.02 ? 378  VAL A HG22 1  
ATOM   4762   H HG23 . VAL A 1 322 ? 8.118   -13.837 19.606  0.04 12.90 ? 378  VAL A HG23 1  
ATOM   4763   N N    . ALA A 1 323 ? 6.107   -12.224 15.101  0.04 12.41 ? 379  ALA A N    1  
ATOM   4764   C CA   . ALA A 1 323 ? 6.342   -11.389 13.917  0.04 12.26 ? 379  ALA A CA   1  
ATOM   4765   C C    . ALA A 1 323 ? 5.091   -10.756 13.365  0.04 12.25 ? 379  ALA A C    1  
ATOM   4766   O O    . ALA A 1 323 ? 4.200   -11.475 12.910  0.04 12.42 ? 379  ALA A O    1  
ATOM   4767   C CB   . ALA A 1 323 ? 7.006   -12.199 12.813  0.04 12.38 ? 379  ALA A CB   1  
ATOM   4768   H H    . ALA A 1 323 ? 5.323   -12.566 15.151  0.04 12.52 ? 379  ALA A H    1  
ATOM   4769   H HA   . ALA A 1 323 ? 6.945   -10.695 14.179  0.04 12.13 ? 379  ALA A HA   1  
ATOM   4770   H HB1  . ALA A 1 323 ? 7.408   -11.575 12.189  0.04 12.32 ? 379  ALA A HB1  1  
ATOM   4771   H HB2  . ALA A 1 323 ? 7.690   -12.771 13.202  0.04 12.39 ? 379  ALA A HB2  1  
ATOM   4772   H HB3  . ALA A 1 323 ? 6.345   -12.742 12.361  0.04 12.55 ? 379  ALA A HB3  1  
ATOM   4773   N N    . GLY A 1 324 ? 5.019   -9.415  13.366  0.04 12.08 ? 380  GLY A N    1  
ATOM   4774   C CA   . GLY A 1 324 ? 3.905   -8.699  12.743  0.04 12.12 ? 380  GLY A CA   1  
ATOM   4775   C C    . GLY A 1 324 ? 2.683   -8.395  13.583  0.04 12.20 ? 380  GLY A C    1  
ATOM   4776   O O    . GLY A 1 324 ? 1.560   -8.447  13.080  0.04 12.37 ? 380  GLY A O    1  
ATOM   4777   H H    . GLY A 1 324 ? 5.600   -8.902  13.736  0.04 11.97 ? 380  GLY A H    1  
ATOM   4778   H HA2  . GLY A 1 324 ? 4.237   -7.861  12.388  0.04 12.01 ? 380  GLY A HA2  1  
ATOM   4779   H HA3  . GLY A 1 324 ? 3.595   -9.238  11.997  0.04 12.23 ? 380  GLY A HA3  1  
ATOM   4780   N N    . LEU A 1 325 ? 2.914   -8.111  14.861  0.04 12.13 ? 381  LEU A N    1  
ATOM   4781   C CA   . LEU A 1 325 ? 1.830   -7.888  15.816  0.04 12.24 ? 381  LEU A CA   1  
ATOM   4782   C C    . LEU A 1 325 ? 1.976   -6.525  16.437  0.04 12.10 ? 381  LEU A C    1  
ATOM   4783   O O    . LEU A 1 325 ? 3.072   -6.177  16.903  0.04 11.94 ? 381  LEU A O    1  
ATOM   4784   C CB   . LEU A 1 325 ? 1.941   -8.887  16.967  0.04 12.38 ? 381  LEU A CB   1  
ATOM   4785   C CG   . LEU A 1 325 ? 1.585   -10.335 16.651  0.04 12.59 ? 381  LEU A CG   1  
ATOM   4786   C CD1  . LEU A 1 325 ? 2.161   -11.230 17.765  0.04 12.73 ? 381  LEU A CD1  1  
ATOM   4787   C CD2  . LEU A 1 325 ? 0.074   -10.458 16.532  0.04 12.81 ? 381  LEU A CD2  1  
ATOM   4788   H H    . LEU A 1 325 ? 3.694   -8.018  15.200  0.04 12.03 ? 381  LEU A H    1  
ATOM   4789   H HA   . LEU A 1 325 ? 0.966   -7.972  15.398  0.04 12.35 ? 381  LEU A HA   1  
ATOM   4790   H HB2  . LEU A 1 325 ? 2.861   -8.880  17.279  0.04 12.29 ? 381  LEU A HB2  1  
ATOM   4791   H HB3  . LEU A 1 325 ? 1.361   -8.588  17.683  0.04 12.47 ? 381  LEU A HB3  1  
ATOM   4792   H HG   . LEU A 1 325 ? 1.978   -10.587 15.800  0.04 12.52 ? 381  LEU A HG   1  
ATOM   4793   H HD11 . LEU A 1 325 ? 1.877   -12.145 17.617  0.04 12.87 ? 381  LEU A HD11 1  
ATOM   4794   H HD12 . LEU A 1 325 ? 3.130   -11.176 17.720  0.04 12.61 ? 381  LEU A HD12 1  
ATOM   4795   H HD13 . LEU A 1 325 ? 1.850   -10.927 18.630  0.04 12.81 ? 381  LEU A HD13 1  
ATOM   4796   H HD21 . LEU A 1 325 ? -0.178  -11.392 16.464  0.04 12.93 ? 381  LEU A HD21 1  
ATOM   4797   H HD22 . LEU A 1 325 ? -0.319  -10.063 17.323  0.04 12.91 ? 381  LEU A HD22 1  
ATOM   4798   H HD23 . LEU A 1 325 ? -0.226  -9.984  15.741  0.04 12.74 ? 381  LEU A HD23 1  
ATOM   4799   N N    . LEU A 1 326 ? 0.839   -5.813  16.520  0.04 12.21 ? 382  LEU A N    1  
ATOM   4800   C CA   . LEU A 1 326 ? 0.701   -4.585  17.320  0.04 12.16 ? 382  LEU A CA   1  
ATOM   4801   C C    . LEU A 1 326 ? 0.045   -4.935  18.650  0.04 12.31 ? 382  LEU A C    1  
ATOM   4802   O O    . LEU A 1 326 ? -1.082  -5.421  18.654  0.04 12.53 ? 382  LEU A O    1  
ATOM   4803   C CB   . LEU A 1 326 ? -0.171  -3.548  16.579  0.04 12.23 ? 382  LEU A CB   1  
ATOM   4804   C CG   . LEU A 1 326 ? -0.563  -2.249  17.323  0.04 12.28 ? 382  LEU A CG   1  
ATOM   4805   C CD1  . LEU A 1 326 ? 0.643   -1.511  17.908  0.04 12.09 ? 382  LEU A CD1  1  
ATOM   4806   C CD2  . LEU A 1 326 ? -1.340  -1.312  16.430  0.04 12.41 ? 382  LEU A CD2  1  
ATOM   4807   H H    . LEU A 1 326 ? 0.120   -6.029  16.111  0.04 12.34 ? 382  LEU A H    1  
ATOM   4808   H HA   . LEU A 1 326 ? 1.580   -4.218  17.474  0.04 12.01 ? 382  LEU A HA   1  
ATOM   4809   H HB2  . LEU A 1 326 ? 0.309   -3.282  15.780  0.04 12.14 ? 382  LEU A HB2  1  
ATOM   4810   H HB3  . LEU A 1 326 ? -0.998  -3.978  16.319  0.04 12.38 ? 382  LEU A HB3  1  
ATOM   4811   H HG   . LEU A 1 326 ? -1.132  -2.482  18.069  0.04 12.39 ? 382  LEU A HG   1  
ATOM   4812   H HD11 . LEU A 1 326 ? 0.326   -0.835  18.524  0.04 12.16 ? 382  LEU A HD11 1  
ATOM   4813   H HD12 . LEU A 1 326 ? 1.188   -2.153  18.381  0.04 12.02 ? 382  LEU A HD12 1  
ATOM   4814   H HD13 . LEU A 1 326 ? 1.158   -1.093  17.202  0.04 12.01 ? 382  LEU A HD13 1  
ATOM   4815   H HD21 . LEU A 1 326 ? -0.885  -0.458  16.402  0.04 12.34 ? 382  LEU A HD21 1  
ATOM   4816   H HD22 . LEU A 1 326 ? -1.386  -1.682  15.537  0.04 12.44 ? 382  LEU A HD22 1  
ATOM   4817   H HD23 . LEU A 1 326 ? -2.231  -1.209  16.789  0.04 12.57 ? 382  LEU A HD23 1  
ATOM   4818   N N    . VAL A 1 327 ? 0.716   -4.635  19.759  0.04 12.24 ? 383  VAL A N    1  
ATOM   4819   C CA   . VAL A 1 327 ? 0.192   -4.819  21.113  0.04 12.41 ? 383  VAL A CA   1  
ATOM   4820   C C    . VAL A 1 327 ? -0.234  -3.453  21.616  0.04 12.42 ? 383  VAL A C    1  
ATOM   4821   O O    . VAL A 1 327 ? 0.594   -2.610  21.763  0.04 12.27 ? 383  VAL A O    1  
ATOM   4822   C CB   . VAL A 1 327 ? 1.287   -5.421  22.017  0.04 12.38 ? 383  VAL A CB   1  
ATOM   4823   C CG1  . VAL A 1 327 ? 0.776   -5.648  23.426  0.04 12.59 ? 383  VAL A CG1  1  
ATOM   4824   C CG2  . VAL A 1 327 ? 1.772   -6.751  21.413  0.04 12.40 ? 383  VAL A CG2  1  
ATOM   4825   H H    . VAL A 1 327 ? 1.506   -4.300  19.758  0.04 12.11 ? 383  VAL A H    1  
ATOM   4826   H HA   . VAL A 1 327 ? -0.575  -5.410  21.109  0.04 12.57 ? 383  VAL A HA   1  
ATOM   4827   H HB   . VAL A 1 327 ? 2.042   -4.814  22.053  0.04 12.24 ? 383  VAL A HB   1  
ATOM   4828   H HG11 . VAL A 1 327 ? 1.533   -5.686  24.030  0.04 12.59 ? 383  VAL A HG11 1  
ATOM   4829   H HG12 . VAL A 1 327 ? 0.169   -4.943  23.696  0.04 12.60 ? 383  VAL A HG12 1  
ATOM   4830   H HG13 . VAL A 1 327 ? 0.304   -6.495  23.441  0.04 12.75 ? 383  VAL A HG13 1  
ATOM   4831   H HG21 . VAL A 1 327 ? 2.571   -7.027  21.893  0.04 12.40 ? 383  VAL A HG21 1  
ATOM   4832   H HG22 . VAL A 1 327 ? 1.079   -7.422  21.526  0.04 12.57 ? 383  VAL A HG22 1  
ATOM   4833   H HG23 . VAL A 1 327 ? 1.970   -6.632  20.472  0.04 12.29 ? 383  VAL A HG23 1  
ATOM   4834   N N    . ASP A 1 328 ? -1.539  -3.265  21.829  0.04 12.65 ? 384  ASP A N    1  
ATOM   4835   C CA   . ASP A 1 328 ? -2.151  -1.959  22.132  0.04 12.73 ? 384  ASP A CA   1  
ATOM   4836   C C    . ASP A 1 328 ? -2.689  -2.008  23.565  0.04 12.95 ? 384  ASP A C    1  
ATOM   4837   O O    . ASP A 1 328 ? -3.609  -2.771  23.876  0.04 13.19 ? 384  ASP A O    1  
ATOM   4838   C CB   . ASP A 1 328 ? -3.279  -1.750  21.092  0.04 12.88 ? 384  ASP A CB   1  
ATOM   4839   C CG   . ASP A 1 328 ? -3.910  -0.353  21.111  0.04 12.97 ? 384  ASP A CG   1  
ATOM   4840   O OD1  . ASP A 1 328 ? -3.229  0.594   21.536  0.04 12.87 ? 384  ASP A OD1  1  
ATOM   4841   O OD2  . ASP A 1 328 ? -5.082  -0.221  20.642  0.04 13.18 ? 384  ASP A OD2  1  
ATOM   4842   H H    . ASP A 1 328 ? -2.112  -3.898  21.812  0.04 12.79 ? 384  ASP A H    1  
ATOM   4843   H HA   . ASP A 1 328 ? -1.498  -1.248  22.064  0.04 12.59 ? 384  ASP A HA   1  
ATOM   4844   H HB2  . ASP A 1 328 ? -2.907  -1.901  20.210  0.04 12.77 ? 384  ASP A HB2  1  
ATOM   4845   H HB3  . ASP A 1 328 ? -3.981  -2.394  21.261  0.04 13.06 ? 384  ASP A HB3  1  
ATOM   4846   N N    . ALA A 1 329 ? -2.108  -1.192  24.455  0.04 12.91 ? 385  ALA A N    1  
ATOM   4847   C CA   . ALA A 1 329 ? -2.513  -1.202  25.852  0.04 13.14 ? 385  ALA A CA   1  
ATOM   4848   C C    . ALA A 1 329 ? -3.979  -0.914  26.064  0.04 13.45 ? 385  ALA A C    1  
ATOM   4849   O O    . ALA A 1 329 ? -4.587  -0.076  25.402  0.04 13.49 ? 385  ALA A O    1  
ATOM   4850   C CB   . ALA A 1 329 ? -1.675  -0.239  26.675  0.04 13.07 ? 385  ALA A CB   1  
ATOM   4851   H H    . ALA A 1 329 ? -1.480  -0.637  24.266  0.04 12.77 ? 385  ALA A H    1  
ATOM   4852   H HA   . ALA A 1 329 ? -2.352  -2.086  26.213  0.04 13.18 ? 385  ALA A HA   1  
ATOM   4853   H HB1  . ALA A 1 329 ? -1.851  -0.388  27.615  0.04 13.22 ? 385  ALA A HB1  1  
ATOM   4854   H HB2  . ALA A 1 329 ? -0.740  -0.419  26.491  0.04 12.89 ? 385  ALA A HB2  1  
ATOM   4855   H HB3  . ALA A 1 329 ? -1.885  0.674   26.425  0.04 13.07 ? 385  ALA A HB3  1  
ATOM   4856   N N    . GLY A 1 330 ? -4.519  -1.613  27.037  0.04 13.71 ? 386  GLY A N    1  
ATOM   4857   C CA   . GLY A 1 330 ? -5.821  -1.283  27.530  0.04 14.06 ? 386  GLY A CA   1  
ATOM   4858   C C    . GLY A 1 330 ? -5.756  -0.151  28.537  0.04 14.16 ? 386  GLY A C    1  
ATOM   4859   O O    . GLY A 1 330 ? -4.700  0.192   29.053  0.04 13.99 ? 386  GLY A O    1  
ATOM   4860   H H    . GLY A 1 330 ? -4.138  -2.273  27.426  0.04 13.70 ? 386  GLY A H    1  
ATOM   4861   H HA2  . GLY A 1 330 ? -6.385  -1.062  26.776  0.04 14.09 ? 386  GLY A HA2  1  
ATOM   4862   H HA3  . GLY A 1 330 ? -6.175  -2.057  27.985  0.04 14.23 ? 386  GLY A HA3  1  
ATOM   4863   N N    . PRO A 1 331 ? -6.911  0.431   28.851  0.04 14.49 ? 387  PRO A N    1  
ATOM   4864   C CA   . PRO A 1 331 ? -7.126  1.463   29.869  0.04 14.63 ? 387  PRO A CA   1  
ATOM   4865   C C    . PRO A 1 331 ? -6.583  1.090   31.238  0.04 14.74 ? 387  PRO A C    1  
ATOM   4866   O O    . PRO A 1 331 ? -6.097  1.916   31.996  0.04 14.72 ? 387  PRO A O    1  
ATOM   4867   C CB   . PRO A 1 331 ? -8.652  1.548   29.947  0.04 15.02 ? 387  PRO A CB   1  
ATOM   4868   C CG   . PRO A 1 331 ? -9.165  0.802   28.736  0.04 15.13 ? 387  PRO A CG   1  
ATOM   4869   C CD   . PRO A 1 331 ? -8.069  0.292   27.953  0.04 14.75 ? 387  PRO A CD   1  
ATOM   4870   H HA   . PRO A 1 331 ? -6.765  2.314   29.587  0.04 14.45 ? 387  PRO A HA   1  
ATOM   4871   H HB2  . PRO A 1 331 ? -8.953  1.109   30.759  0.04 15.25 ? 387  PRO A HB2  1  
ATOM   4872   H HB3  . PRO A 1 331 ? -8.923  2.477   29.933  0.04 14.98 ? 387  PRO A HB3  1  
ATOM   4873   H HG2  . PRO A 1 331 ? -9.695  0.050   29.036  0.04 15.31 ? 387  PRO A HG2  1  
ATOM   4874   H HG3  . PRO A 1 331 ? -9.702  1.404   28.198  0.04 15.31 ? 387  PRO A HG3  1  
ATOM   4875   H HD2  . PRO A 1 331 ? -8.242  -0.636  27.745  0.04 14.82 ? 387  PRO A HD2  1  
ATOM   4876   H HD3  . PRO A 1 331 ? -7.940  0.821   27.147  0.04 14.65 ? 387  PRO A HD3  1  
ATOM   4877   N N    . VAL A 1 332 ? -6.732  -0.172  31.576  0.04 14.88 ? 388  VAL A N    1  
ATOM   4878   C CA   . VAL A 1 332 ? -6.269  -0.662  32.873  0.04 15.02 ? 388  VAL A CA   1  
ATOM   4879   C C    . VAL A 1 332 ? -4.784  -0.950  32.749  0.04 14.67 ? 388  VAL A C    1  
ATOM   4880   O O    . VAL A 1 332 ? -4.351  -1.701  31.888  0.04 14.44 ? 388  VAL A O    1  
ATOM   4881   C CB   . VAL A 1 332 ? -7.017  -1.921  33.264  0.04 15.30 ? 388  VAL A CB   1  
ATOM   4882   C CG1  . VAL A 1 332 ? -6.449  -2.539  34.554  0.04 15.45 ? 388  VAL A CG1  1  
ATOM   4883   C CG2  . VAL A 1 332 ? -8.490  -1.587  33.454  0.04 15.71 ? 388  VAL A CG2  1  
ATOM   4884   H H    . VAL A 1 332 ? -7.091  -0.773  31.080  0.04 14.92 ? 388  VAL A H    1  
ATOM   4885   H HA   . VAL A 1 332 ? -6.405  0.008   33.559  0.04 15.18 ? 388  VAL A HA   1  
ATOM   4886   H HB   . VAL A 1 332 ? -6.936  -2.580  32.560  0.04 15.16 ? 388  VAL A HB   1  
ATOM   4887   H HG11 . VAL A 1 332 ? -7.042  -3.241  34.859  0.04 15.72 ? 388  VAL A HG11 1  
ATOM   4888   H HG12 . VAL A 1 332 ? -5.570  -2.900  34.367  0.04 15.23 ? 388  VAL A HG12 1  
ATOM   4889   H HG13 . VAL A 1 332 ? -6.396  -1.851  35.233  0.04 15.53 ? 388  VAL A HG13 1  
ATOM   4890   H HG21 . VAL A 1 332 ? -8.954  -2.369  33.795  0.04 15.90 ? 388  VAL A HG21 1  
ATOM   4891   H HG22 . VAL A 1 332 ? -8.559  -0.861  34.095  0.04 15.90 ? 388  VAL A HG22 1  
ATOM   4892   H HG23 . VAL A 1 332 ? -8.872  -1.312  32.605  0.04 15.64 ? 388  VAL A HG23 1  
ATOM   4893   N N    . ASN A 1 333 ? -3.991  -0.382  33.641  0.04 14.67 ? 389  ASN A N    1  
ATOM   4894   C CA   . ASN A 1 333 ? -2.544  -0.549  33.569  0.04 14.38 ? 389  ASN A CA   1  
ATOM   4895   C C    . ASN A 1 333 ? -2.139  -1.998  33.596  0.04 14.36 ? 389  ASN A C    1  
ATOM   4896   O O    . ASN A 1 333 ? -2.517  -2.735  34.496  0.04 14.65 ? 389  ASN A O    1  
ATOM   4897   C CB   . ASN A 1 333 ? -1.874  0.159   34.751  0.04 14.50 ? 389  ASN A CB   1  
ATOM   4898   C CG   . ASN A 1 333 ? -0.381  0.259   34.591  0.04 14.22 ? 389  ASN A CG   1  
ATOM   4899   O OD1  . ASN A 1 333 ? 0.128   1.003   33.769  0.04 13.96 ? 389  ASN A OD1  1  
ATOM   4900   N ND2  . ASN A 1 333 ? 0.335   -0.498  35.395  0.04 14.33 ? 389  ASN A ND2  1  
ATOM   4901   H H    . ASN A 1 333 ? -4.256  0.115   34.286  0.04 14.86 ? 389  ASN A H    1  
ATOM   4902   H HA   . ASN A 1 333 ? -2.218  -0.148  32.756  0.04 14.15 ? 389  ASN A HA   1  
ATOM   4903   H HB2  . ASN A 1 333 ? -2.219  1.061   34.816  0.04 14.57 ? 389  ASN A HB2  1  
ATOM   4904   H HB3  . ASN A 1 333 ? -2.051  -0.330  35.562  0.04 14.73 ? 389  ASN A HB3  1  
ATOM   4905   H HD21 . ASN A 1 333 ? 0.643   -0.170  36.127  0.04 14.41 ? 389  ASN A HD21 1  
ATOM   4906   H HD22 . ASN A 1 333 ? 0.491   -1.316  35.189  0.04 14.35 ? 389  ASN A HD22 1  
ATOM   4907   N N    . SER A 1 334 ? -1.309  -2.375  32.621  0.04 14.03 ? 390  SER A N    1  
ATOM   4908   C CA   . SER A 1 334 ? -0.656  -3.680  32.636  0.04 13.99 ? 390  SER A CA   1  
ATOM   4909   C C    . SER A 1 334 ? 0.732   -3.472  33.204  0.04 13.88 ? 390  SER A C    1  
ATOM   4910   O O    . SER A 1 334 ? 1.364   -2.497  32.929  0.04 13.63 ? 390  SER A O    1  
ATOM   4911   C CB   . SER A 1 334 ? -0.572  -4.263  31.235  0.04 13.75 ? 390  SER A CB   1  
ATOM   4912   O OG   . SER A 1 334 ? -1.851  -4.563  30.726  0.04 13.90 ? 390  SER A OG   1  
ATOM   4913   H H    . SER A 1 334 ? -1.097  -1.883  31.957  0.04 13.84 ? 390  SER A H    1  
ATOM   4914   H HA   . SER A 1 334 ? -1.129  -4.294  33.214  0.04 14.23 ? 390  SER A HA   1  
ATOM   4915   H HB2  . SER A 1 334 ? -0.149  -3.621  30.651  0.04 13.54 ? 390  SER A HB2  1  
ATOM   4916   H HB3  . SER A 1 334 ? -0.042  -5.073  31.273  0.04 13.72 ? 390  SER A HB3  1  
ATOM   4917   H HG   . SER A 1 334 ? -2.089  -3.977  30.186  0.04 13.93 ? 390  SER A HG   1  
ATOM   4918   N N    . GLU A 1 335 ? 1.191   -4.380  34.039  0.04 14.10 ? 391  GLU A N    1  
ATOM   4919   C CA   . GLU A 1 335 ? 2.509   -4.262  34.617  0.04 14.06 ? 391  GLU A CA   1  
ATOM   4920   C C    . GLU A 1 335 ? 3.539   -4.474  33.537  0.04 13.73 ? 391  GLU A C    1  
ATOM   4921   O O    . GLU A 1 335 ? 4.570   -3.808  33.508  0.04 13.59 ? 391  GLU A O    1  
ATOM   4922   C CB   . GLU A 1 335 ? 2.674   -5.299  35.718  0.04 14.36 ? 391  GLU A CB   1  
ATOM   4923   C CG   . GLU A 1 335 ? 4.067   -5.378  36.305  0.04 14.38 ? 391  GLU A CG   1  
ATOM   4924   C CD   . GLU A 1 335 ? 4.101   -6.275  37.546  0.04 14.79 ? 391  GLU A CD   1  
ATOM   4925   O OE1  . GLU A 1 335 ? 3.023   -6.797  37.947  0.04 15.04 ? 391  GLU A OE1  1  
ATOM   4926   O OE2  . GLU A 1 335 ? 5.192   -6.399  38.159  0.04 14.89 ? 391  GLU A OE2  1  
ATOM   4927   H H    . GLU A 1 335 ? 0.753   -5.068  34.301  0.04 14.30 ? 391  GLU A H    1  
ATOM   4928   H HA   . GLU A 1 335 ? 2.624   -3.384  35.006  0.04 14.09 ? 391  GLU A HA   1  
ATOM   4929   H HB2  . GLU A 1 335 ? 2.049   -5.129  36.439  0.04 14.60 ? 391  GLU A HB2  1  
ATOM   4930   H HB3  . GLU A 1 335 ? 2.482   -6.162  35.314  0.04 14.33 ? 391  GLU A HB3  1  
ATOM   4931   H HG2  . GLU A 1 335 ? 4.676   -5.751  35.650  0.04 14.25 ? 391  GLU A HG2  1  
ATOM   4932   H HG3  . GLU A 1 335 ? 4.357   -4.489  36.565  0.04 14.29 ? 391  GLU A HG3  1  
ATOM   4933   N N    . THR A 1 336 ? 3.262   -5.408  32.633  0.04 13.65 ? 392  THR A N    1  
ATOM   4934   C CA   . THR A 1 336 ? 4.089   -5.606  31.445  0.04 13.36 ? 392  THR A CA   1  
ATOM   4935   C C    . THR A 1 336 ? 3.144   -5.870  30.292  0.04 13.26 ? 392  THR A C    1  
ATOM   4936   O O    . THR A 1 336 ? 2.018   -6.333  30.519  0.04 13.47 ? 392  THR A O    1  
ATOM   4937   C CB   . THR A 1 336 ? 5.064   -6.789  31.531  0.04 13.44 ? 392  THR A CB   1  
ATOM   4938   O OG1  . THR A 1 336 ? 4.307   -8.001  31.657  0.04 13.68 ? 392  THR A OG1  1  
ATOM   4939   C CG2  . THR A 1 336 ? 6.062   -6.636  32.687  0.04 13.60 ? 392  THR A CG2  1  
ATOM   4940   H H    . THR A 1 336 ? 2.585   -5.930  32.674  0.04 13.78 ? 392  THR A H    1  
ATOM   4941   H HA   . THR A 1 336 ? 4.590   -4.807  31.274  0.04 13.21 ? 392  THR A HA   1  
ATOM   4942   H HB   . THR A 1 336 ? 5.575   -6.833  30.707  0.04 13.25 ? 392  THR A HB   1  
ATOM   4943   H HG1  . THR A 1 336 ? 3.928   -8.028  32.406  0.04 13.86 ? 392  THR A HG1  1  
ATOM   4944   H HG21 . THR A 1 336 ? 6.646   -7.407  32.726  0.04 13.73 ? 392  THR A HG21 1  
ATOM   4945   H HG22 . THR A 1 336 ? 6.606   -5.848  32.543  0.04 13.44 ? 392  THR A HG22 1  
ATOM   4946   H HG23 . THR A 1 336 ? 5.591   -6.555  33.528  0.04 13.76 ? 392  THR A HG23 1  
ATOM   4947   N N    . LEU A 1 337 ? 3.544   -5.534  29.070  0.04 12.98 ? 393  LEU A N    1  
ATOM   4948   C CA   . LEU A 1 337 ? 2.736   -5.880  27.888  0.04 12.90 ? 393  LEU A CA   1  
ATOM   4949   C C    . LEU A 1 337 ? 3.242   -7.143  27.174  0.04 12.87 ? 393  LEU A C    1  
ATOM   4950   O O    . LEU A 1 337 ? 2.462   -7.954  26.710  0.04 12.98 ? 393  LEU A O    1  
ATOM   4951   C CB   . LEU A 1 337 ? 2.601   -4.693  26.920  0.04 12.67 ? 393  LEU A CB   1  
ATOM   4952   C CG   . LEU A 1 337 ? 1.790   -3.530  27.484  0.04 12.75 ? 393  LEU A CG   1  
ATOM   4953   C CD1  . LEU A 1 337 ? 1.979   -2.256  26.709  0.04 12.55 ? 393  LEU A CD1  1  
ATOM   4954   C CD2  . LEU A 1 337 ? 0.286   -3.839  27.504  0.04 12.99 ? 393  LEU A CD2  1  
ATOM   4955   H H    . LEU A 1 337 ? 4.270   -5.122  28.896  0.04 12.84 ? 393  LEU A H    1  
ATOM   4956   H HA   . LEU A 1 337 ? 1.837   -6.086  28.184  0.04 13.07 ? 393  LEU A HA   1  
ATOM   4957   H HB2  . LEU A 1 337 ? 3.482   -4.353  26.696  0.04 12.52 ? 393  LEU A HB2  1  
ATOM   4958   H HB3  . LEU A 1 337 ? 2.162   -4.992  26.113  0.04 12.64 ? 393  LEU A HB3  1  
ATOM   4959   H HG   . LEU A 1 337 ? 2.083   -3.371  28.390  0.04 12.83 ? 393  LEU A HG   1  
ATOM   4960   H HD11 . LEU A 1 337 ? 1.545   -1.531  27.186  0.04 12.64 ? 393  LEU A HD11 1  
ATOM   4961   H HD12 . LEU A 1 337 ? 2.933   -2.082  26.618  0.04 12.43 ? 393  LEU A HD12 1  
ATOM   4962   H HD13 . LEU A 1 337 ? 1.580   -2.366  25.833  0.04 12.48 ? 393  LEU A HD13 1  
ATOM   4963   H HD21 . LEU A 1 337 ? -0.195  -3.049  27.790  0.04 13.06 ? 393  LEU A HD21 1  
ATOM   4964   H HD22 . LEU A 1 337 ? -0.003  -4.090  26.613  0.04 12.93 ? 393  LEU A HD22 1  
ATOM   4965   H HD23 . LEU A 1 337 ? 0.119   -4.567  28.123  0.04 13.14 ? 393  LEU A HD23 1  
ATOM   4966   N N    . VAL A 1 338 ? 4.565   -7.278  27.089  0.04 12.75 ? 394  VAL A N    1  
ATOM   4967   C CA   . VAL A 1 338 ? 5.234   -8.390  26.400  0.04 12.75 ? 394  VAL A CA   1  
ATOM   4968   C C    . VAL A 1 338 ? 6.410   -8.831  27.273  0.04 12.86 ? 394  VAL A C    1  
ATOM   4969   O O    . VAL A 1 338 ? 7.233   -7.993  27.638  0.04 12.76 ? 394  VAL A O    1  
ATOM   4970   C CB   . VAL A 1 338 ? 5.755   -7.946  25.003  0.04 12.49 ? 394  VAL A CB   1  
ATOM   4971   C CG1  . VAL A 1 338 ? 6.624   -9.032  24.364  0.04 12.54 ? 394  VAL A CG1  1  
ATOM   4972   C CG2  . VAL A 1 338 ? 4.595   -7.534  24.082  0.04 12.40 ? 394  VAL A CG2  1  
ATOM   4973   H H    . VAL A 1 338 ? 5.111   -6.719  27.442  0.04 12.68 ? 394  VAL A H    1  
ATOM   4974   H HA   . VAL A 1 338 ? 4.622   -9.131  26.283  0.04 12.89 ? 394  VAL A HA   1  
ATOM   4975   H HB   . VAL A 1 338 ? 6.316   -7.164  25.120  0.04 12.38 ? 394  VAL A HB   1  
ATOM   4976   H HG11 . VAL A 1 338 ? 6.391   -9.115  23.424  0.04 12.41 ? 394  VAL A HG11 1  
ATOM   4977   H HG12 . VAL A 1 338 ? 7.557   -8.782  24.447  0.04 12.57 ? 394  VAL A HG12 1  
ATOM   4978   H HG13 . VAL A 1 338 ? 6.464   -9.878  24.814  0.04 12.70 ? 394  VAL A HG13 1  
ATOM   4979   H HG21 . VAL A 1 338 ? 4.952   -7.253  23.224  0.04 12.27 ? 394  VAL A HG21 1  
ATOM   4980   H HG22 . VAL A 1 338 ? 4.008   -8.296  23.961  0.04 12.54 ? 394  VAL A HG22 1  
ATOM   4981   H HG23 . VAL A 1 338 ? 4.110   -6.801  24.490  0.04 12.37 ? 394  VAL A HG23 1  
ATOM   4982   N N    . GLU A 1 339 ? 6.469   -10.110 27.642  0.04 13.10 ? 395  GLU A N    1  
ATOM   4983   C CA   . GLU A 1 339 ? 7.644   -10.681 28.324  0.04 13.28 ? 395  GLU A CA   1  
ATOM   4984   C C    . GLU A 1 339 ? 8.226   -11.833 27.557  0.04 13.32 ? 395  GLU A C    1  
ATOM   4985   O O    . GLU A 1 339 ? 7.537   -12.821 27.303  0.04 13.48 ? 395  GLU A O    1  
ATOM   4986   C CB   . GLU A 1 339 ? 7.337   -11.214 29.737  0.04 13.63 ? 395  GLU A CB   1  
ATOM   4987   C CG   . GLU A 1 339 ? 7.008   -10.137 30.721  0.04 13.65 ? 395  GLU A CG   1  
ATOM   4988   C CD   . GLU A 1 339 ? 6.489   -10.672 32.068  0.04 14.03 ? 395  GLU A CD   1  
ATOM   4989   O OE1  . GLU A 1 339 ? 6.926   -11.756 32.560  0.04 14.32 ? 395  GLU A OE1  1  
ATOM   4990   O OE2  . GLU A 1 339 ? 5.647   -9.969  32.678  0.04 14.08 ? 395  GLU A OE2  1  
ATOM   4991   H H    . GLU A 1 339 ? 5.840   -10.671 27.505  0.04 13.20 ? 395  GLU A H    1  
ATOM   4992   H HA   . GLU A 1 339 ? 8.343   -10.013 28.395  0.04 13.18 ? 395  GLU A HA   1  
ATOM   4993   H HB2  . GLU A 1 339 ? 6.595   -11.836 29.698  0.04 13.76 ? 395  GLU A HB2  1  
ATOM   4994   H HB3  . GLU A 1 339 ? 8.129   -11.668 30.068  0.04 13.76 ? 395  GLU A HB3  1  
ATOM   4995   H HG2  . GLU A 1 339 ? 7.812   -9.620  30.896  0.04 13.54 ? 395  GLU A HG2  1  
ATOM   4996   H HG3  . GLU A 1 339 ? 6.331   -9.560  30.332  0.04 13.54 ? 395  GLU A HG3  1  
ATOM   4997   N N    . VAL A 1 340 ? 9.507   -11.702 27.227  0.04 13.22 ? 396  VAL A N    1  
ATOM   4998   C CA   . VAL A 1 340 ? 10.235  -12.761 26.531  0.04 13.30 ? 396  VAL A CA   1  
ATOM   4999   C C    . VAL A 1 340 ? 11.106  -13.482 27.534  0.04 13.61 ? 396  VAL A C    1  
ATOM   5000   O O    . VAL A 1 340 ? 12.132  -12.971 27.994  0.04 13.60 ? 396  VAL A O    1  
ATOM   5001   C CB   . VAL A 1 340 ? 11.123  -12.194 25.432  0.04 13.03 ? 396  VAL A CB   1  
ATOM   5002   C CG1  . VAL A 1 340 ? 11.731  -13.370 24.649  0.04 13.14 ? 396  VAL A CG1  1  
ATOM   5003   C CG2  . VAL A 1 340 ? 10.352  -11.334 24.499  0.04 12.74 ? 396  VAL A CG2  1  
ATOM   5004   H H    . VAL A 1 340 ? 9.984   -11.011 27.393  0.04 13.13 ? 396  VAL A H    1  
ATOM   5005   H HA   . VAL A 1 340 ? 9.612   -13.380 26.127  0.04 13.37 ? 396  VAL A HA   1  
ATOM   5006   H HB   . VAL A 1 340 ? 11.839  -11.668 25.815  0.04 13.01 ? 396  VAL A HB   1  
ATOM   5007   H HG11 . VAL A 1 340 ? 11.698  -13.163 23.701  0.04 12.97 ? 396  VAL A HG11 1  
ATOM   5008   H HG12 . VAL A 1 340 ? 12.646  -13.508 24.936  0.04 13.29 ? 396  VAL A HG12 1  
ATOM   5009   H HG13 . VAL A 1 340 ? 11.207  -14.164 24.823  0.04 13.25 ? 396  VAL A HG13 1  
ATOM   5010   H HG21 . VAL A 1 340 ? 10.972  -10.897 23.889  0.04 12.60 ? 396  VAL A HG21 1  
ATOM   5011   H HG22 . VAL A 1 340 ? 9.744   -11.894 23.991  0.04 12.78 ? 396  VAL A HG22 1  
ATOM   5012   H HG23 . VAL A 1 340 ? 9.855   -10.661 24.995  0.04 12.70 ? 396  VAL A HG23 1  
ATOM   5013   N N    . GLY A 1 341 ? 10.689  -14.687 27.888  0.04 13.93 ? 397  GLY A N    1  
ATOM   5014   C CA   . GLY A 1 341 ? 11.372  -15.452 28.902  0.04 14.30 ? 397  GLY A CA   1  
ATOM   5015   C C    . GLY A 1 341 ? 10.789  -15.039 30.220  0.04 14.50 ? 397  GLY A C    1  
ATOM   5016   O O    . GLY A 1 341 ? 10.045  -14.052 30.267  0.04 14.30 ? 397  GLY A O    1  
ATOM   5017   H H    . GLY A 1 341 ? 10.010  -15.083 27.546  0.04 13.96 ? 397  GLY A H    1  
ATOM   5018   H HA2  . GLY A 1 341 ? 11.218  -16.403 28.771  0.04 14.50 ? 397  GLY A HA2  1  
ATOM   5019   H HA3  . GLY A 1 341 ? 12.323  -15.284 28.898  0.04 14.29 ? 397  GLY A HA3  1  
ATOM   5020   N N    . SER A 1 342 ? 11.171  -15.760 31.267  0.04 14.92 ? 398  SER A N    1  
ATOM   5021   C CA   . SER A 1 342 ? 10.651  -15.554 32.602  0.04 15.19 ? 398  SER A CA   1  
ATOM   5022   C C    . SER A 1 342 ? 11.635  -14.748 33.427  0.04 15.10 ? 398  SER A C    1  
ATOM   5023   O O    . SER A 1 342 ? 12.823  -14.676 33.117  0.04 14.95 ? 398  SER A O    1  
ATOM   5024   C CB   . SER A 1 342 ? 10.404  -16.917 33.273  0.04 15.71 ? 398  SER A CB   1  
ATOM   5025   O OG   . SER A 1 342 ? 11.611  -17.666 33.327  0.04 15.90 ? 398  SER A OG   1  
ATOM   5026   H H    . SER A 1 342 ? 11.755  -16.387 31.228  0.04 15.09 ? 398  SER A H    1  
ATOM   5027   H HA   . SER A 1 342 ? 9.811   -15.071 32.553  0.04 15.13 ? 398  SER A HA   1  
ATOM   5028   H HB2  . SER A 1 342 ? 10.092  -16.771 34.179  0.04 15.90 ? 398  SER A HB2  1  
ATOM   5029   H HB3  . SER A 1 342 ? 9.742   -17.410 32.767  0.04 15.77 ? 398  SER A HB3  1  
ATOM   5030   H HG   . SER A 1 342 ? 11.444  -18.488 33.285  0.04 16.11 ? 398  SER A HG   1  
ATOM   5031   N N    . ASP A 1 343 ? 11.153  -14.114 34.498  0.04 15.24 ? 399  ASP A N    1  
ATOM   5032   C CA   . ASP A 1 343 ? 12.099  -13.455 35.390  0.04 15.25 ? 399  ASP A CA   1  
ATOM   5033   C C    . ASP A 1 343 ? 13.089  -14.400 36.079  0.04 15.62 ? 399  ASP A C    1  
ATOM   5034   O O    . ASP A 1 343 ? 12.707  -15.380 36.662  0.04 16.03 ? 399  ASP A O    1  
ATOM   5035   C CB   . ASP A 1 343 ? 11.365  -12.623 36.437  0.04 15.39 ? 399  ASP A CB   1  
ATOM   5036   C CG   . ASP A 1 343 ? 12.301  -11.641 37.165  0.04 15.50 ? 399  ASP A CG   1  
ATOM   5037   O OD1  . ASP A 1 343 ? 12.904  -10.743 36.497  0.04 15.20 ? 399  ASP A OD1  1  
ATOM   5038   O OD2  . ASP A 1 343 ? 12.407  -11.785 38.413  0.04 15.92 ? 399  ASP A OD2  1  
ATOM   5039   H H    . ASP A 1 343 ? 10.324  -14.042 34.705  0.04 15.33 ? 399  ASP A H    1  
ATOM   5040   H HA   . ASP A 1 343 ? 12.628  -12.834 34.864  0.04 14.97 ? 399  ASP A HA   1  
ATOM   5041   H HB2  . ASP A 1 343 ? 10.661  -12.117 36.001  0.04 15.16 ? 399  ASP A HB2  1  
ATOM   5042   H HB3  . ASP A 1 343 ? 10.975  -13.216 37.097  0.04 15.67 ? 399  ASP A HB3  1  
ATOM   5043   N N    . GLY A 1 344 ? 14.372  -14.082 36.013  0.04 15.53 ? 400  GLY A N    1  
ATOM   5044   C CA   . GLY A 1 344 ? 15.394  -14.974 36.536  0.04 15.91 ? 400  GLY A CA   1  
ATOM   5045   C C    . GLY A 1 344 ? 15.777  -16.035 35.511  0.04 15.99 ? 400  GLY A C    1  
ATOM   5046   O O    . GLY A 1 344 ? 16.533  -16.961 35.828  0.04 16.39 ? 400  GLY A O    1  
ATOM   5047   H H    . GLY A 1 344 ? 14.678  -13.358 35.666  0.04 15.27 ? 400  GLY A H    1  
ATOM   5048   H HA2  . GLY A 1 344 ? 16.191  -14.459 36.741  0.04 15.84 ? 400  GLY A HA2  1  
ATOM   5049   H HA3  . GLY A 1 344 ? 15.087  -15.405 37.348  0.04 16.23 ? 400  GLY A HA3  1  
ATOM   5050   N N    . ALA A 1 345 ? 15.275  -15.872 34.284  0.04 15.62 ? 401  ALA A N    1  
ATOM   5051   C CA   . ALA A 1 345 ? 15.649  -16.765 33.155  0.04 15.65 ? 401  ALA A CA   1  
ATOM   5052   C C    . ALA A 1 345 ? 17.158  -16.860 33.090  0.04 15.81 ? 401  ALA A C    1  
ATOM   5053   O O    . ALA A 1 345 ? 17.822  -15.841 33.222  0.04 15.53 ? 401  ALA A O    1  
ATOM   5054   C CB   . ALA A 1 345 ? 15.132  -16.215 31.808  0.04 15.18 ? 401  ALA A CB   1  
ATOM   5055   H H    . ALA A 1 345 ? 14.717  -15.254 34.074  0.04 15.36 ? 401  ALA A H    1  
ATOM   5056   H HA   . ALA A 1 345 ? 15.281  -17.651 33.292  0.04 15.89 ? 401  ALA A HA   1  
ATOM   5057   H HB1  . ALA A 1 345 ? 15.393  -16.820 31.100  0.04 15.22 ? 401  ALA A HB1  1  
ATOM   5058   H HB2  . ALA A 1 345 ? 14.168  -16.149 31.830  0.04 15.08 ? 401  ALA A HB2  1  
ATOM   5059   H HB3  . ALA A 1 345 ? 15.524  -15.344 31.652  0.04 14.97 ? 401  ALA A HB3  1  
ATOM   5060   N N    . SER A 1 346 ? 17.697  -18.059 32.813  0.04 16.29 ? 402  SER A N    1  
ATOM   5061   C CA   . SER A 1 346 ? 19.120  -18.304 32.996  0.04 16.48 ? 402  SER A CA   1  
ATOM   5062   C C    . SER A 1 346 ? 19.951  -19.128 31.936  0.04 16.61 ? 402  SER A C    1  
ATOM   5063   O O    . SER A 1 346 ? 21.205  -19.121 31.930  0.04 16.92 ? 402  SER A O    1  
ATOM   5064   C CB   . SER A 1 346 ? 19.269  -18.927 34.398  0.04 17.00 ? 402  SER A CB   1  
ATOM   5065   O OG   . SER A 1 346 ? 18.444  -20.103 34.643  0.04 17.46 ? 402  SER A OG   1  
ATOM   5066   H H    . SER A 1 346 ? 17.256  -18.730 32.515  0.04 16.52 ? 402  SER A H    1  
ATOM   5067   H HA   . SER A 1 346 ? 19.564  -17.446 33.035  0.04 16.23 ? 402  SER A HA   1  
ATOM   5068   H HB2  . SER A 1 346 ? 20.202  -19.134 34.549  0.04 16.95 ? 402  SER A HB2  1  
ATOM   5069   H HB3  . SER A 1 346 ? 18.997  -18.245 35.033  0.04 17.09 ? 402  SER A HB3  1  
ATOM   5070   H HG   . SER A 1 346 ? 18.540  -20.365 35.427  0.04 17.72 ? 402  SER A HG   1  
ATOM   5071   N N    . GLY A 1 347 ? 19.279  -19.856 31.078  0.04 16.41 ? 403  GLY A N    1  
ATOM   5072   C CA   . GLY A 1 347 ? 19.981  -20.685 30.113  0.04 16.51 ? 403  GLY A CA   1  
ATOM   5073   C C    . GLY A 1 347 ? 20.202  -19.948 28.795  0.04 16.16 ? 403  GLY A C    1  
ATOM   5074   O O    . GLY A 1 347 ? 19.644  -18.907 28.553  0.04 15.74 ? 403  GLY A O    1  
ATOM   5075   H H    . GLY A 1 347 ? 18.417  -19.880 31.032  0.04 16.26 ? 403  GLY A H    1  
ATOM   5076   H HA2  . GLY A 1 347 ? 20.840  -20.957 30.458  0.04 16.88 ? 403  GLY A HA2  1  
ATOM   5077   H HA3  . GLY A 1 347 ? 19.456  -21.474 29.933  0.04 16.49 ? 403  GLY A HA3  1  
ATOM   5078   N N    . ASP A 1 348 ? 21.011  -20.516 27.911  0.04 16.34 ? 404  ASP A N    1  
ATOM   5079   C CA   . ASP A 1 348 ? 21.225  -19.856 26.636  0.04 16.01 ? 404  ASP A CA   1  
ATOM   5080   C C    . ASP A 1 348 ? 20.489  -20.481 25.485  0.04 15.79 ? 404  ASP A C    1  
ATOM   5081   O O    . ASP A 1 348 ? 20.126  -21.656 25.530  0.04 15.99 ? 404  ASP A O    1  
ATOM   5082   C CB   . ASP A 1 348 ? 22.698  -19.824 26.346  0.04 16.31 ? 404  ASP A CB   1  
ATOM   5083   C CG   . ASP A 1 348 ? 23.474  -19.528 27.563  0.04 16.47 ? 404  ASP A CG   1  
ATOM   5084   O OD1  . ASP A 1 348 ? 23.404  -20.393 28.439  0.04 16.27 ? 404  ASP A OD1  1  
ATOM   5085   O OD2  . ASP A 1 348 ? 24.105  -18.450 27.690  0.04 16.82 ? 404  ASP A OD2  1  
ATOM   5086   H H    . ASP A 1 348 ? 21.447  -21.246 28.027  0.04 16.67 ? 404  ASP A H    1  
ATOM   5087   H HA   . ASP A 1 348 ? 20.943  -18.934 26.687  0.04 15.73 ? 404  ASP A HA   1  
ATOM   5088   H HB2  . ASP A 1 348 ? 22.960  -20.701 26.022  0.04 16.64 ? 404  ASP A HB2  1  
ATOM   5089   H HB3  . ASP A 1 348 ? 22.890  -19.150 25.679  0.04 16.10 ? 404  ASP A HB3  1  
ATOM   5090   N N    . HIS A 1 349 ? 20.298  -19.652 24.461  0.04 15.41 ? 405  HIS A N    1  
ATOM   5091   C CA   . HIS A 1 349 ? 19.607  -20.044 23.237  0.04 15.23 ? 405  HIS A CA   1  
ATOM   5092   C C    . HIS A 1 349 ? 20.390  -19.599 22.009  0.04 15.08 ? 405  HIS A C    1  
ATOM   5093   O O    . HIS A 1 349 ? 19.823  -19.072 21.061  0.04 14.74 ? 405  HIS A O    1  
ATOM   5094   C CB   . HIS A 1 349 ? 18.191  -19.472 23.203  0.04 14.85 ? 405  HIS A CB   1  
ATOM   5095   C CG   . HIS A 1 349 ? 17.425  -19.622 24.482  0.04 15.00 ? 405  HIS A CG   1  
ATOM   5096   N ND1  . HIS A 1 349 ? 16.729  -20.770 24.800  0.04 15.30 ? 405  HIS A ND1  1  
ATOM   5097   C CD2  . HIS A 1 349 ? 17.235  -18.766 25.521  0.04 14.93 ? 405  HIS A CD2  1  
ATOM   5098   C CE1  . HIS A 1 349 ? 16.150  -20.619 25.981  0.04 15.40 ? 405  HIS A CE1  1  
ATOM   5099   N NE2  . HIS A 1 349 ? 16.441  -19.409 26.444  0.04 15.18 ? 405  HIS A NE2  1  
ATOM   5100   H H    . HIS A 1 349 ? 20.573  -18.841 24.456  0.04 15.27 ? 405  HIS A H    1  
ATOM   5101   H HA   . HIS A 1 349 ? 19.549  -21.013 23.210  0.04 15.49 ? 405  HIS A HA   1  
ATOM   5102   H HB2  . HIS A 1 349 ? 18.227  -18.522 22.998  0.04 14.59 ? 405  HIS A HB2  1  
ATOM   5103   H HB3  . HIS A 1 349 ? 17.698  -19.932 22.503  0.04 14.79 ? 405  HIS A HB3  1  
ATOM   5104   H HD2  . HIS A 1 349 ? 17.581  -17.904 25.592  0.04 14.77 ? 405  HIS A HD2  1  
ATOM   5105   H HE1  . HIS A 1 349 ? 15.631  -21.262 26.408  0.04 15.62 ? 405  HIS A HE1  1  
ATOM   5106   N N    . ALA A 1 350 ? 21.694  -19.809 22.019  0.04 15.36 ? 406  ALA A N    1  
ATOM   5107   C CA   . ALA A 1 350 ? 22.561  -19.232 20.990  0.04 15.24 ? 406  ALA A CA   1  
ATOM   5108   C C    . ALA A 1 350 ? 22.295  -19.812 19.603  0.04 15.25 ? 406  ALA A C    1  
ATOM   5109   O O    . ALA A 1 350 ? 22.249  -19.093 18.617  0.04 14.97 ? 406  ALA A O    1  
ATOM   5110   C CB   . ALA A 1 350 ? 24.024  -19.396 21.380  0.04 15.59 ? 406  ALA A CB   1  
ATOM   5111   H H    . ALA A 1 350 ? 22.111  -20.277 22.605  0.04 15.65 ? 406  ALA A H    1  
ATOM   5112   H HA   . ALA A 1 350 ? 22.372  -18.283 20.939  0.04 14.93 ? 406  ALA A HA   1  
ATOM   5113   H HB1  . ALA A 1 350 ? 24.572  -19.362 20.582  0.04 15.52 ? 406  ALA A HB1  1  
ATOM   5114   H HB2  . ALA A 1 350 ? 24.283  -18.685 21.988  0.04 15.57 ? 406  ALA A HB2  1  
ATOM   5115   H HB3  . ALA A 1 350 ? 24.140  -20.258 21.815  0.04 15.93 ? 406  ALA A HB3  1  
ATOM   5116   N N    . ALA A 1 351 ? 22.141  -21.122 19.506  0.04 15.62 ? 407  ALA A N    1  
ATOM   5117   C CA   . ALA A 1 351 ? 21.974  -21.729 18.205  0.04 15.68 ? 407  ALA A CA   1  
ATOM   5118   C C    . ALA A 1 351 ? 20.650  -21.373 17.558  0.04 15.31 ? 407  ALA A C    1  
ATOM   5119   O O    . ALA A 1 351 ? 20.557  -21.229 16.344  0.04 15.21 ? 407  ALA A O    1  
ATOM   5120   C CB   . ALA A 1 351 ? 22.122  -23.284 18.308  0.04 16.21 ? 407  ALA A CB   1  
ATOM   5121   H H    . ALA A 1 351 ? 22.153  -21.671 20.160  0.04 15.85 ? 407  ALA A H    1  
ATOM   5122   H HA   . ALA A 1 351 ? 22.691  -21.411 17.634  0.04 15.67 ? 407  ALA A HA   1  
ATOM   5123   H HB1  . ALA A 1 351 ? 21.981  -23.678 17.436  0.04 16.26 ? 407  ALA A HB1  1  
ATOM   5124   H HB2  . ALA A 1 351 ? 23.012  -23.491 18.628  0.04 16.47 ? 407  ALA A HB2  1  
ATOM   5125   H HB3  . ALA A 1 351 ? 21.463  -23.616 18.932  0.04 16.26 ? 407  ALA A HB3  1  
ATOM   5126   N N    . ASN A 1 352 ? 19.610  -21.233 18.368  0.04 15.16 ? 408  ASN A N    1  
ATOM   5127   C CA   . ASN A 1 352 ? 18.239  -21.079 17.889  0.04 14.90 ? 408  ASN A CA   1  
ATOM   5128   C C    . ASN A 1 352 ? 17.501  -20.085 18.794  0.04 14.59 ? 408  ASN A C    1  
ATOM   5129   O O    . ASN A 1 352 ? 16.697  -20.480 19.644  0.04 14.69 ? 408  ASN A O    1  
ATOM   5130   C CB   . ASN A 1 352 ? 17.539  -22.464 17.835  0.04 15.25 ? 408  ASN A CB   1  
ATOM   5131   C CG   . ASN A 1 352 ? 16.179  -22.432 17.131  0.04 15.06 ? 408  ASN A CG   1  
ATOM   5132   O OD1  . ASN A 1 352 ? 15.334  -23.329 17.279  0.04 15.28 ? 408  ASN A OD1  1  
ATOM   5133   N ND2  . ASN A 1 352 ? 15.943  -21.416 16.435  0.04 14.69 ? 408  ASN A ND2  1  
ATOM   5134   H H    . ASN A 1 352 ? 19.673  -21.230 19.222  0.04 15.23 ? 408  ASN A H    1  
ATOM   5135   H HA   . ASN A 1 352 ? 18.260  -20.706 16.995  0.04 14.74 ? 408  ASN A HA   1  
ATOM   5136   H HB2  . ASN A 1 352 ? 18.105  -23.088 17.354  0.04 15.48 ? 408  ASN A HB2  1  
ATOM   5137   H HB3  . ASN A 1 352 ? 17.405  -22.796 18.739  0.04 15.41 ? 408  ASN A HB3  1  
ATOM   5138   H HD21 . ASN A 1 352 ? 15.712  -21.497 15.625  0.04 14.67 ? 408  ASN A HD21 1  
ATOM   5139   H HD22 . ASN A 1 352 ? 15.896  -20.723 16.871  0.04 14.49 ? 408  ASN A HD22 1  
ATOM   5140   N N    . PRO A 1 353 ? 17.807  -18.791 18.646  0.04 14.25 ? 409  PRO A N    1  
ATOM   5141   C CA   . PRO A 1 353 ? 17.243  -17.775 19.536  0.04 14.01 ? 409  PRO A CA   1  
ATOM   5142   C C    . PRO A 1 353 ? 15.772  -17.547 19.321  0.04 13.78 ? 409  PRO A C    1  
ATOM   5143   O O    . PRO A 1 353 ? 15.230  -17.928 18.281  0.04 13.75 ? 409  PRO A O    1  
ATOM   5144   C CB   . PRO A 1 353 ? 18.029  -16.495 19.180  0.04 13.77 ? 409  PRO A CB   1  
ATOM   5145   C CG   . PRO A 1 353 ? 18.804  -16.804 17.969  0.04 13.76 ? 409  PRO A CG   1  
ATOM   5146   C CD   . PRO A 1 353 ? 18.939  -18.287 17.855  0.04 14.15 ? 409  PRO A CD   1  
ATOM   5147   H HA   . PRO A 1 353 ? 17.404  -18.025 20.456  0.04 14.19 ? 409  PRO A HA   1  
ATOM   5148   H HB2  . PRO A 1 353 ? 17.414  -15.768 19.019  0.04 13.54 ? 409  PRO A HB2  1  
ATOM   5149   H HB3  . PRO A 1 353 ? 18.626  -16.280 19.912  0.04 13.92 ? 409  PRO A HB3  1  
ATOM   5150   H HG2  . PRO A 1 353 ? 18.328  -16.461 17.197  0.04 13.57 ? 409  PRO A HG2  1  
ATOM   5151   H HG3  . PRO A 1 353 ? 19.682  -16.405 18.047  0.04 13.74 ? 409  PRO A HG3  1  
ATOM   5152   H HD2  . PRO A 1 353 ? 18.866  -18.558 16.929  0.04 14.15 ? 409  PRO A HD2  1  
ATOM   5153   H HD3  . PRO A 1 353 ? 19.769  -18.591 18.249  0.04 14.35 ? 409  PRO A HD3  1  
ATOM   5154   N N    . THR A 1 354 ? 15.112  -16.939 20.299  0.04 13.66 ? 410  THR A N    1  
ATOM   5155   C CA   . THR A 1 354 ? 13.804  -16.321 20.076  0.04 13.42 ? 410  THR A CA   1  
ATOM   5156   C C    . THR A 1 354 ? 13.991  -14.947 19.453  0.04 13.07 ? 410  THR A C    1  
ATOM   5157   O O    . THR A 1 354 ? 14.941  -14.238 19.787  0.04 13.01 ? 410  THR A O    1  
ATOM   5158   C CB   . THR A 1 354 ? 13.023  -16.252 21.400  0.04 13.50 ? 410  THR A CB   1  
ATOM   5159   O OG1  . THR A 1 354 ? 12.646  -17.594 21.718  0.04 13.85 ? 410  THR A OG1  1  
ATOM   5160   C CG2  . THR A 1 354 ? 11.767  -15.328 21.344  0.04 13.25 ? 410  THR A CG2  1  
ATOM   5161   H H    . THR A 1 354 ? 15.398  -16.856 21.102  0.04 13.72 ? 410  THR A H    1  
ATOM   5162   H HA   . THR A 1 354 ? 13.309  -16.863 19.447  0.04 13.47 ? 410  THR A HA   1  
ATOM   5163   H HB   . THR A 1 354 ? 13.613  -15.914 22.092  0.04 13.53 ? 410  THR A HB   1  
ATOM   5164   H HG1  . THR A 1 354 ? 11.896  -17.610 22.095  0.04 13.87 ? 410  THR A HG1  1  
ATOM   5165   H HG21 . THR A 1 354 ? 11.358  -15.267 22.218  0.04 13.33 ? 410  THR A HG21 1  
ATOM   5166   H HG22 . THR A 1 354 ? 12.006  -14.434 21.060  0.04 13.04 ? 410  THR A HG22 1  
ATOM   5167   H HG23 . THR A 1 354 ? 11.115  -15.685 20.722  0.04 13.25 ? 410  THR A HG23 1  
ATOM   5168   N N    . SER A 1 355 ? 13.066  -14.591 18.553  0.04 12.88 ? 411  SER A N    1  
ATOM   5169   C CA   . SER A 1 355 ? 13.018  -13.232 17.983  0.04 12.59 ? 411  SER A CA   1  
ATOM   5170   C C    . SER A 1 355 ? 11.655  -12.568 18.098  0.04 12.43 ? 411  SER A C    1  
ATOM   5171   O O    . SER A 1 355 ? 10.613  -13.230 18.058  0.04 12.54 ? 411  SER A O    1  
ATOM   5172   C CB   . SER A 1 355 ? 13.411  -13.219 16.494  0.04 12.55 ? 411  SER A CB   1  
ATOM   5173   O OG   . SER A 1 355 ? 12.711  -14.204 15.724  0.04 12.66 ? 411  SER A OG   1  
ATOM   5174   H H    . SER A 1 355 ? 12.445  -15.106 18.271  0.04 12.94 ? 411  SER A H    1  
ATOM   5175   H HA   . SER A 1 355 ? 13.640  -12.682 18.472  0.04 12.54 ? 411  SER A HA   1  
ATOM   5176   H HB2  . SER A 1 355 ? 13.199  -12.341 16.131  0.04 12.38 ? 411  SER A HB2  1  
ATOM   5177   H HB3  . SER A 1 355 ? 14.364  -13.381 16.415  0.04 12.66 ? 411  SER A HB3  1  
ATOM   5178   H HG   . SER A 1 355 ? 12.737  -14.004 14.910  0.04 12.55 ? 411  SER A HG   1  
ATOM   5179   N N    . LEU A 1 356 ? 11.694  -11.235 18.229  0.04 12.21 ? 412  LEU A N    1  
ATOM   5180   C CA   . LEU A 1 356 ? 10.552  -10.376 17.927  0.04 12.06 ? 412  LEU A CA   1  
ATOM   5181   C C    . LEU A 1 356 ? 10.881  -9.581  16.679  0.04 11.90 ? 412  LEU A C    1  
ATOM   5182   O O    . LEU A 1 356 ? 11.981  -9.026  16.555  0.04 11.84 ? 412  LEU A O    1  
ATOM   5183   C CB   . LEU A 1 356 ? 10.206  -9.363  19.045  0.04 11.99 ? 412  LEU A CB   1  
ATOM   5184   C CG   . LEU A 1 356 ? 9.781   -9.723  20.484  0.04 12.16 ? 412  LEU A CG   1  
ATOM   5185   C CD1  . LEU A 1 356 ? 9.070   -8.540  21.110  0.04 12.08 ? 412  LEU A CD1  1  
ATOM   5186   C CD2  . LEU A 1 356 ? 8.887   -10.890 20.537  0.04 12.37 ? 412  LEU A CD2  1  
ATOM   5187   H H    . LEU A 1 356 ? 12.388  -10.800 18.483  0.04 12.16 ? 412  LEU A H    1  
ATOM   5188   H HA   . LEU A 1 356 ? 9.772   -10.921 17.741  0.04 12.14 ? 412  LEU A HA   1  
ATOM   5189   H HB2  . LEU A 1 356 ? 10.955  -8.775  19.098  0.04 11.89 ? 412  LEU A HB2  1  
ATOM   5190   H HB3  . LEU A 1 356 ? 9.464   -8.853  18.686  0.04 11.95 ? 412  LEU A HB3  1  
ATOM   5191   H HG   . LEU A 1 356 ? 10.572  -9.917  21.008  0.04 12.21 ? 412  LEU A HG   1  
ATOM   5192   H HD11 . LEU A 1 356 ? 8.500   -8.870  21.821  0.04 12.17 ? 412  LEU A HD11 1  
ATOM   5193   H HD12 . LEU A 1 356 ? 9.746   -7.952  21.479  0.04 11.94 ? 412  LEU A HD12 1  
ATOM   5194   H HD13 . LEU A 1 356 ? 8.540   -8.079  20.442  0.04 12.11 ? 412  LEU A HD13 1  
ATOM   5195   H HD21 . LEU A 1 356 ? 8.871   -11.224 21.448  0.04 12.48 ? 412  LEU A HD21 1  
ATOM   5196   H HD22 . LEU A 1 356 ? 7.992   -10.624 20.266  0.04 12.33 ? 412  LEU A HD22 1  
ATOM   5197   H HD23 . LEU A 1 356 ? 9.223   -11.577 19.942  0.04 12.46 ? 412  LEU A HD23 1  
ATOM   5198   N N    . GLN A 1 357 ? 9.971   -9.595  15.718  0.04 11.88 ? 413  GLN A N    1  
ATOM   5199   C CA   . GLN A 1 357 ? 10.173  -8.896  14.447  0.04 11.78 ? 413  GLN A CA   1  
ATOM   5200   C C    . GLN A 1 357 ? 8.930   -8.148  14.042  0.04 11.72 ? 413  GLN A C    1  
ATOM   5201   O O    . GLN A 1 357 ? 7.852   -8.725  14.004  0.04 11.82 ? 413  GLN A O    1  
ATOM   5202   C CB   . GLN A 1 357 ? 10.552  -9.893  13.338  0.04 11.91 ? 413  GLN A CB   1  
ATOM   5203   C CG   . GLN A 1 357 ? 11.942  -10.421 13.507  0.04 12.00 ? 413  GLN A CG   1  
ATOM   5204   C CD   . GLN A 1 357 ? 12.283  -11.481 12.485  0.04 12.16 ? 413  GLN A CD   1  
ATOM   5205   O OE1  . GLN A 1 357 ? 11.682  -12.562 12.439  0.04 12.35 ? 413  GLN A OE1  1  
ATOM   5206   N NE2  . GLN A 1 357 ? 13.279  -11.174 11.644  0.04 12.13 ? 413  GLN A NE2  1  
ATOM   5207   H H    . GLN A 1 357 ? 9.217   -10.000 15.765  0.04 11.95 ? 413  GLN A H    1  
ATOM   5208   H HA   . GLN A 1 357 ? 10.905  -8.272  14.544  0.04 11.71 ? 413  GLN A HA   1  
ATOM   5209   H HB2  . GLN A 1 357 ? 9.947   -10.646 13.366  0.04 12.02 ? 413  GLN A HB2  1  
ATOM   5210   H HB3  . GLN A 1 357 ? 10.486  -9.458  12.478  0.04 11.87 ? 413  GLN A HB3  1  
ATOM   5211   H HG2  . GLN A 1 357 ? 12.558  -9.683  13.407  0.04 11.92 ? 413  GLN A HG2  1  
ATOM   5212   H HG3  . GLN A 1 357 ? 12.021  -10.817 14.387  0.04 12.07 ? 413  GLN A HG3  1  
ATOM   5213   H HE21 . GLN A 1 357 ? 13.700  -10.432 11.727  0.04 12.04 ? 413  GLN A HE21 1  
ATOM   5214   H HE22 . GLN A 1 357 ? 13.494  -11.728 11.024  0.04 12.22 ? 413  GLN A HE22 1  
ATOM   5215   N N    . ASP A 1 358 ? 9.043   -6.852  13.744  0.04 11.60 ? 414  ASP A N    1  
ATOM   5216   C CA   . ASP A 1 358 ? 7.838   -6.073  13.443  0.04 11.58 ? 414  ASP A CA   1  
ATOM   5217   C C    . ASP A 1 358 ? 6.804   -6.321  14.540  0.04 11.64 ? 414  ASP A C    1  
ATOM   5218   O O    . ASP A 1 358 ? 5.645   -6.548  14.270  0.04 11.73 ? 414  ASP A O    1  
ATOM   5219   C CB   . ASP A 1 358 ? 7.238   -6.410  12.067  0.04 11.68 ? 414  ASP A CB   1  
ATOM   5220   C CG   . ASP A 1 358 ? 8.206   -6.181  10.925  0.04 11.67 ? 414  ASP A CG   1  
ATOM   5221   O OD1  . ASP A 1 358 ? 9.176   -5.422  11.067  0.04 11.57 ? 414  ASP A OD1  1  
ATOM   5222   O OD2  . ASP A 1 358 ? 7.987   -6.807  9.846   0.04 11.79 ? 414  ASP A OD2  1  
ATOM   5223   H H    . ASP A 1 358 ? 9.784   -6.422  13.701  0.04 11.54 ? 414  ASP A H    1  
ATOM   5224   H HA   . ASP A 1 358 ? 8.056   -5.128  13.445  0.04 11.51 ? 414  ASP A HA   1  
ATOM   5225   H HB2  . ASP A 1 358 ? 6.952   -7.334  12.047  0.04 11.77 ? 414  ASP A HB2  1  
ATOM   5226   H HB3  . ASP A 1 358 ? 6.472   -5.833  11.934  0.04 11.69 ? 414  ASP A HB3  1  
ATOM   5227   N N    . VAL A 1 359 ? 7.259   -6.231  15.799  0.04 11.60 ? 415  VAL A N    1  
ATOM   5228   C CA   . VAL A 1 359 ? 6.349   -6.150  16.951  0.04 11.66 ? 415  VAL A CA   1  
ATOM   5229   C C    . VAL A 1 359 ? 6.308   -4.667  17.360  0.04 11.57 ? 415  VAL A C    1  
ATOM   5230   O O    . VAL A 1 359 ? 7.333   -3.993  17.537  0.04 11.48 ? 415  VAL A O    1  
ATOM   5231   C CB   . VAL A 1 359 ? 6.680   -7.125  18.096  0.04 11.75 ? 415  VAL A CB   1  
ATOM   5232   C CG1  . VAL A 1 359 ? 5.560   -7.120  19.182  0.04 11.83 ? 415  VAL A CG1  1  
ATOM   5233   C CG2  . VAL A 1 359 ? 6.854   -8.519  17.513  0.04 11.90 ? 415  VAL A CG2  1  
ATOM   5234   H H    . VAL A 1 359 ? 8.089   -6.192  16.009  0.04 11.56 ? 415  VAL A H    1  
ATOM   5235   H HA   . VAL A 1 359 ? 5.454   -6.375  16.660  0.04 11.74 ? 415  VAL A HA   1  
ATOM   5236   H HB   . VAL A 1 359 ? 7.516   -6.871  18.519  0.04 11.70 ? 415  VAL A HB   1  
ATOM   5237   H HG11 . VAL A 1 359 ? 5.644   -7.914  19.735  0.04 11.93 ? 415  VAL A HG11 1  
ATOM   5238   H HG12 . VAL A 1 359 ? 5.655   -6.323  19.725  0.04 11.76 ? 415  VAL A HG12 1  
ATOM   5239   H HG13 . VAL A 1 359 ? 4.701   -7.119  18.732  0.04 11.89 ? 415  VAL A HG13 1  
ATOM   5240   H HG21 . VAL A 1 359 ? 6.943   -9.151  18.245  0.04 11.98 ? 415  VAL A HG21 1  
ATOM   5241   H HG22 . VAL A 1 359 ? 6.085   -8.740  16.969  0.04 11.97 ? 415  VAL A HG22 1  
ATOM   5242   H HG23 . VAL A 1 359 ? 7.656   -8.537  16.968  0.04 11.87 ? 415  VAL A HG23 1  
ATOM   5243   N N    . PHE A 1 360 ? 5.094   -4.165  17.405  0.04 11.63 ? 416  PHE A N    1  
ATOM   5244   C CA   . PHE A 1 360 ? 4.838   -2.747  17.718  0.04 11.59 ? 416  PHE A CA   1  
ATOM   5245   C C    . PHE A 1 360 ? 3.997   -2.667  18.958  0.04 11.70 ? 416  PHE A C    1  
ATOM   5246   O O    . PHE A 1 360 ? 3.030   -3.418  19.101  0.04 11.84 ? 416  PHE A O    1  
ATOM   5247   C CB   . PHE A 1 360 ? 4.117   -2.080  16.560  0.04 11.62 ? 416  PHE A CB   1  
ATOM   5248   C CG   . PHE A 1 360 ? 4.724   -2.391  15.232  0.04 11.56 ? 416  PHE A CG   1  
ATOM   5249   C CD1  . PHE A 1 360 ? 6.092   -2.321  15.032  0.04 11.45 ? 416  PHE A CD1  1  
ATOM   5250   C CD2  . PHE A 1 360 ? 3.932   -2.797  14.173  0.04 11.64 ? 416  PHE A CD2  1  
ATOM   5251   C CE1  . PHE A 1 360 ? 6.663   -2.669  13.830  0.04 11.42 ? 416  PHE A CE1  1  
ATOM   5252   C CE2  . PHE A 1 360 ? 4.494   -3.127  12.959  0.04 11.62 ? 416  PHE A CE2  1  
ATOM   5253   C CZ   . PHE A 1 360 ? 5.852   -3.075  12.776  0.04 11.51 ? 416  PHE A CZ   1  
ATOM   5254   H H    . PHE A 1 360 ? 4.380   -4.610  17.256  0.04 11.71 ? 416  PHE A H    1  
ATOM   5255   H HA   . PHE A 1 360 ? 5.672   -2.284  17.886  0.04 11.51 ? 416  PHE A HA   1  
ATOM   5256   H HB2  . PHE A 1 360 ? 3.203   -2.408  16.547  0.04 11.72 ? 416  PHE A HB2  1  
ATOM   5257   H HB3  . PHE A 1 360 ? 4.114   -1.117  16.682  0.04 11.62 ? 416  PHE A HB3  1  
ATOM   5258   H HD1  . PHE A 1 360 ? 6.636   -2.073  15.741  0.04 11.41 ? 416  PHE A HD1  1  
ATOM   5259   H HD2  . PHE A 1 360 ? 3.009   -2.856  14.290  0.04 11.74 ? 416  PHE A HD2  1  
ATOM   5260   H HE1  . PHE A 1 360 ? 7.583   -2.612  13.719  0.04 11.37 ? 416  PHE A HE1  1  
ATOM   5261   H HE2  . PHE A 1 360 ? 3.940   -3.397  12.260  0.04 11.70 ? 416  PHE A HE2  1  
ATOM   5262   H HZ   . PHE A 1 360 ? 6.222   -3.281  11.952  0.04 11.51 ? 416  PHE A HZ   1  
ATOM   5263   N N    . VAL A 1 361 ? 4.393   -1.784  19.870  0.04 11.68 ? 417  VAL A N    1  
ATOM   5264   C CA   . VAL A 1 361 ? 3.599   -1.480  21.074  0.04 11.82 ? 417  VAL A CA   1  
ATOM   5265   C C    . VAL A 1 361 ? 3.057   -0.052  21.032  0.04 11.86 ? 417  VAL A C    1  
ATOM   5266   O O    . VAL A 1 361 ? 3.778   0.861   20.655  0.04 11.77 ? 417  VAL A O    1  
ATOM   5267   C CB   . VAL A 1 361 ? 4.413   -1.681  22.379  0.04 11.83 ? 417  VAL A CB   1  
ATOM   5268   C CG1  . VAL A 1 361 ? 3.595   -1.203  23.596  0.04 12.01 ? 417  VAL A CG1  1  
ATOM   5269   C CG2  . VAL A 1 361 ? 4.768   -3.103  22.576  0.04 11.82 ? 417  VAL A CG2  1  
ATOM   5270   H H    . VAL A 1 361 ? 5.130   -1.351  19.836  0.04 11.61 ? 417  VAL A H    1  
ATOM   5271   H HA   . VAL A 1 361 ? 2.847   -2.085  21.115  0.04 11.92 ? 417  VAL A HA   1  
ATOM   5272   H HB   . VAL A 1 361 ? 5.235   -1.176  22.327  0.04 11.75 ? 417  VAL A HB   1  
ATOM   5273   H HG11 . VAL A 1 361 ? 4.117   -1.316  24.403  0.04 12.07 ? 417  VAL A HG11 1  
ATOM   5274   H HG12 . VAL A 1 361 ? 3.373   -0.266  23.485  0.04 12.01 ? 417  VAL A HG12 1  
ATOM   5275   H HG13 . VAL A 1 361 ? 2.787   -1.733  23.656  0.04 12.09 ? 417  VAL A HG13 1  
ATOM   5276   H HG21 . VAL A 1 361 ? 5.345   -3.185  23.351  0.04 11.86 ? 417  VAL A HG21 1  
ATOM   5277   H HG22 . VAL A 1 361 ? 3.955   -3.611  22.724  0.04 11.91 ? 417  VAL A HG22 1  
ATOM   5278   H HG23 . VAL A 1 361 ? 5.224   -3.433  21.785  0.04 11.72 ? 417  VAL A HG23 1  
ATOM   5279   N N    . ARG A 1 362 ? 1.786   0.121   21.407  0.04 12.03 ? 418  ARG A N    1  
ATOM   5280   C CA   . ARG A 1 362 ? 1.170   1.443   21.521  0.04 12.14 ? 418  ARG A CA   1  
ATOM   5281   C C    . ARG A 1 362 ? 0.552   1.585   22.887  0.04 12.33 ? 418  ARG A C    1  
ATOM   5282   O O    . ARG A 1 362 ? -0.096  0.634   23.360  0.04 12.46 ? 418  ARG A O    1  
ATOM   5283   C CB   . ARG A 1 362 ? 0.109   1.670   20.437  0.04 12.24 ? 418  ARG A CB   1  
ATOM   5284   C CG   . ARG A 1 362 ? -0.717  2.949   20.661  0.04 12.43 ? 418  ARG A CG   1  
ATOM   5285   C CD   . ARG A 1 362 ? -1.574  3.294   19.431  0.04 12.53 ? 418  ARG A CD   1  
ATOM   5286   N NE   . ARG A 1 362 ? -2.640  2.312   19.303  0.04 12.71 ? 418  ARG A NE   1  
ATOM   5287   C CZ   . ARG A 1 362 ? -3.307  2.080   18.170  0.04 12.80 ? 418  ARG A CZ   1  
ATOM   5288   N NH1  . ARG A 1 362 ? -3.006  2.752   17.068  0.04 12.72 ? 418  ARG A NH1  1  
ATOM   5289   N NH2  . ARG A 1 362 ? -4.314  1.220   18.148  0.04 13.02 ? 418  ARG A NH2  1  
ATOM   5290   H H    . ARG A 1 362 ? 1.256   -0.517  21.611  0.04 12.12 ? 418  ARG A H    1  
ATOM   5291   H HA   . ARG A 1 362 ? 1.853   2.126   21.437  0.04 12.06 ? 418  ARG A HA   1  
ATOM   5292   H HB2  . ARG A 1 362 ? 0.569   1.763   19.590  0.04 12.13 ? 418  ARG A HB2  1  
ATOM   5293   H HB3  . ARG A 1 362 ? -0.486  0.908   20.400  0.04 12.31 ? 418  ARG A HB3  1  
ATOM   5294   H HG2  . ARG A 1 362 ? -1.326  2.808   21.397  0.04 12.57 ? 418  ARG A HG2  1  
ATOM   5295   H HG3  . ARG A 1 362 ? -0.130  3.693   20.851  0.04 12.38 ? 418  ARG A HG3  1  
ATOM   5296   H HD2  . ARG A 1 362 ? -1.965  4.170   19.555  0.04 12.63 ? 418  ARG A HD2  1  
ATOM   5297   H HD3  . ARG A 1 362 ? -1.024  3.278   18.631  0.04 12.40 ? 418  ARG A HD3  1  
ATOM   5298   H HE   . ARG A 1 362 ? -2.764  1.769   19.951  0.04 12.79 ? 418  ARG A HE   1  
ATOM   5299   H HH11 . ARG A 1 362 ? -2.370  3.327   17.068  0.04 12.61 ? 418  ARG A HH11 1  
ATOM   5300   H HH12 . ARG A 1 362 ? -3.439  2.597   16.344  0.04 12.80 ? 418  ARG A HH12 1  
ATOM   5301   H HH21 . ARG A 1 362 ? -4.517  0.780   18.855  0.04 13.09 ? 418  ARG A HH21 1  
ATOM   5302   H HH22 . ARG A 1 362 ? -4.729  1.065   17.410  0.04 13.10 ? 418  ARG A HH22 1  
ATOM   5303   N N    . ILE A 1 363 ? 0.785   2.747   23.519  0.04 12.38 ? 419  ILE A N    1  
ATOM   5304   C CA   . ILE A 1 363 ? 0.136   3.080   24.778  0.04 12.59 ? 419  ILE A CA   1  
ATOM   5305   C C    . ILE A 1 363 ? -0.661  4.366   24.598  0.04 12.76 ? 419  ILE A C    1  
ATOM   5306   O O    . ILE A 1 363 ? -0.097  5.459   24.598  0.04 12.73 ? 419  ILE A O    1  
ATOM   5307   C CB   . ILE A 1 363 ? 1.119   3.258   25.930  0.04 12.57 ? 419  ILE A CB   1  
ATOM   5308   C CG1  . ILE A 1 363 ? 2.112   2.078   25.988  0.04 12.43 ? 419  ILE A CG1  1  
ATOM   5309   C CG2  . ILE A 1 363 ? 0.315   3.426   27.244  0.04 12.84 ? 419  ILE A CG2  1  
ATOM   5310   C CD1  . ILE A 1 363 ? 3.483   2.361   25.465  0.04 12.17 ? 419  ILE A CD1  1  
ATOM   5311   H H    . ILE A 1 363 ? 1.331   3.344   23.241  0.04 12.30 ? 419  ILE A H    1  
ATOM   5312   H HA   . ILE A 1 363 ? -0.483  2.375   25.022  0.04 12.69 ? 419  ILE A HA   1  
ATOM   5313   H HB   . ILE A 1 363 ? 1.623   4.070   25.780  0.04 12.50 ? 419  ILE A HB   1  
ATOM   5314   H HG12 . ILE A 1 363 ? 2.201   1.771   26.902  0.04 12.48 ? 419  ILE A HG12 1  
ATOM   5315   H HG13 . ILE A 1 363 ? 1.750   1.349   25.460  0.04 12.48 ? 419  ILE A HG13 1  
ATOM   5316   H HG21 . ILE A 1 363 ? 0.925   3.468   27.997  0.04 12.86 ? 419  ILE A HG21 1  
ATOM   5317   H HG22 . ILE A 1 363 ? -0.191  4.247   27.181  0.04 12.95 ? 419  ILE A HG22 1  
ATOM   5318   H HG23 . ILE A 1 363 ? -0.280  2.670   27.342  0.04 12.92 ? 419  ILE A HG23 1  
ATOM   5319   H HD11 . ILE A 1 363 ? 3.994   1.540   25.456  0.04 12.12 ? 419  ILE A HD11 1  
ATOM   5320   H HD12 . ILE A 1 363 ? 3.422   2.712   24.560  0.04 12.13 ? 419  ILE A HD12 1  
ATOM   5321   H HD13 . ILE A 1 363 ? 3.911   3.008   26.049  0.04 12.14 ? 419  ILE A HD13 1  
ATOM   5322   N N    . GLY A 1 364 ? -1.985  4.244   24.456  0.04 12.98 ? 420  GLY A N    1  
ATOM   5323   C CA   . GLY A 1 364 ? -2.819  5.409   24.180  0.04 13.18 ? 420  GLY A CA   1  
ATOM   5324   C C    . GLY A 1 364 ? -3.080  5.698   22.722  0.04 13.09 ? 420  GLY A C    1  
ATOM   5325   O O    . GLY A 1 364 ? -2.560  5.041   21.841  0.04 12.87 ? 420  GLY A O    1  
ATOM   5326   H H    . GLY A 1 364 ? -2.414  3.502   24.500  0.04 13.04 ? 420  GLY A H    1  
ATOM   5327   H HA2  . GLY A 1 364 ? -3.680  5.296   24.617  0.04 13.38 ? 420  GLY A HA2  1  
ATOM   5328   H HA3  . GLY A 1 364 ? -2.403  6.194   24.559  0.04 13.22 ? 420  GLY A HA3  1  
ATOM   5329   N N    . GLY A 1 365 ? -3.869  6.734   22.469  0.04 13.29 ? 421  GLY A N    1  
ATOM   5330   C CA   . GLY A 1 365 ? -4.107  7.206   21.113  0.04 13.23 ? 421  GLY A CA   1  
ATOM   5331   C C    . GLY A 1 365 ? -5.437  6.763   20.511  0.04 13.43 ? 421  GLY A C    1  
ATOM   5332   O O    . GLY A 1 365 ? -5.953  7.415   19.606  0.04 13.60 ? 421  GLY A O    1  
ATOM   5333   H H    . GLY A 1 365 ? -4.267  7.197   23.075  0.04 13.48 ? 421  GLY A H    1  
ATOM   5334   H HA2  . GLY A 1 365 ? -4.078  8.174   21.112  0.04 13.32 ? 421  GLY A HA2  1  
ATOM   5335   H HA3  . GLY A 1 365 ? -3.399  6.888   20.535  0.04 13.02 ? 421  GLY A HA3  1  
ATOM   5336   N N    . ALA A 1 366 ? -5.984  5.650   20.980  0.04 13.44 ? 422  ALA A N    1  
ATOM   5337   C CA   . ALA A 1 366 ? -7.316  5.219   20.549  0.04 13.72 ? 422  ALA A CA   1  
ATOM   5338   C C    . ALA A 1 366 ? -8.234  5.194   21.760  0.04 14.02 ? 422  ALA A C    1  
ATOM   5339   O O    . ALA A 1 366 ? -9.165  4.405   21.808  0.04 14.16 ? 422  ALA A O    1  
ATOM   5340   C CB   . ALA A 1 366 ? -7.261  3.879   19.957  0.04 13.57 ? 422  ALA A CB   1  
ATOM   5341   H H    . ALA A 1 366 ? -5.618  5.138   21.560  0.04 13.32 ? 422  ALA A H    1  
ATOM   5342   H HA   . ALA A 1 366 ? -7.682  5.823   19.886  0.04 13.85 ? 422  ALA A HA   1  
ATOM   5343   H HB1  . ALA A 1 366 ? -8.142  3.639   19.618  0.04 13.73 ? 422  ALA A HB1  1  
ATOM   5344   H HB2  . ALA A 1 366 ? -6.614  3.875   19.233  0.04 13.34 ? 422  ALA A HB2  1  
ATOM   5345   H HB3  . ALA A 1 366 ? -6.992  3.255   20.649  0.04 13.57 ? 422  ALA A HB3  1  
ATOM   5346   N N    . GLY A 1 367 ? -7.980  6.089   22.708  0.04 14.16 ? 423  GLY A N    1  
ATOM   5347   C CA   . GLY A 1 367 ? -8.531  5.929   24.029  0.04 14.43 ? 423  GLY A CA   1  
ATOM   5348   C C    . GLY A 1 367 ? -7.375  5.686   24.968  0.04 14.25 ? 423  GLY A C    1  
ATOM   5349   O O    . GLY A 1 367 ? -6.237  5.436   24.522  0.04 13.92 ? 423  GLY A O    1  
ATOM   5350   H H    . GLY A 1 367 ? -7.503  6.793   22.607  0.04 14.13 ? 423  GLY A H    1  
ATOM   5351   H HA2  . GLY A 1 367 ? -8.989  6.744   24.289  0.04 14.67 ? 423  GLY A HA2  1  
ATOM   5352   H HA3  . GLY A 1 367 ? -9.153  5.186   24.064  0.04 14.52 ? 423  GLY A HA3  1  
ATOM   5353   N N    . PRO A 1 368 ? -7.606  5.878   26.262  0.04 14.51 ? 424  PRO A N    1  
ATOM   5354   C CA   . PRO A 1 368 ? -6.508  5.728   27.228  0.04 14.38 ? 424  PRO A CA   1  
ATOM   5355   C C    . PRO A 1 368 ? -5.896  4.337   27.198  0.04 14.13 ? 424  PRO A C    1  
ATOM   5356   O O    . PRO A 1 368 ? -6.582  3.348   26.930  0.04 14.24 ? 424  PRO A O    1  
ATOM   5357   C CB   . PRO A 1 368 ? -7.178  5.983   28.576  0.04 14.77 ? 424  PRO A CB   1  
ATOM   5358   C CG   . PRO A 1 368 ? -8.628  5.775   28.345  0.04 15.08 ? 424  PRO A CG   1  
ATOM   5359   C CD   . PRO A 1 368 ? -8.868  6.233   26.933  0.04 14.96 ? 424  PRO A CD   1  
ATOM   5360   H HA   . PRO A 1 368 ? -5.820  6.392   27.076  0.04 14.26 ? 424  PRO A HA   1  
ATOM   5361   H HB2  . PRO A 1 368 ? -6.847  5.354   29.235  0.04 14.76 ? 424  PRO A HB2  1  
ATOM   5362   H HB3  . PRO A 1 368 ? -7.008  6.897   28.855  0.04 14.87 ? 424  PRO A HB3  1  
ATOM   5363   H HG2  . PRO A 1 368 ? -8.850  4.836   28.448  0.04 15.07 ? 424  PRO A HG2  1  
ATOM   5364   H HG3  . PRO A 1 368 ? -9.129  6.318   28.974  0.04 15.37 ? 424  PRO A HG3  1  
ATOM   5365   H HD2  . PRO A 1 368 ? -9.610  5.750   26.542  0.04 15.05 ? 424  PRO A HD2  1  
ATOM   5366   H HD3  . PRO A 1 368 ? -9.012  7.191   26.908  0.04 15.08 ? 424  PRO A HD3  1  
ATOM   5367   N N    . GLY A 1 369 ? -4.589  4.295   27.456  0.04 13.84 ? 425  GLY A N    1  
ATOM   5368   C CA   . GLY A 1 369 ? -3.843  3.064   27.583  0.04 13.66 ? 425  GLY A CA   1  
ATOM   5369   C C    . GLY A 1 369 ? -2.739  3.311   28.565  0.04 13.58 ? 425  GLY A C    1  
ATOM   5370   O O    . GLY A 1 369 ? -2.283  4.440   28.691  0.04 13.55 ? 425  GLY A O    1  
ATOM   5371   H H    . GLY A 1 369 ? -4.111  4.996   27.580  0.04 13.78 ? 425  GLY A H    1  
ATOM   5372   H HA2  . GLY A 1 369 ? -4.420  2.369   27.932  0.04 13.81 ? 425  GLY A HA2  1  
ATOM   5373   H HA3  . GLY A 1 369 ? -3.454  2.780   26.741  0.04 13.46 ? 425  GLY A HA3  1  
ATOM   5374   N N    . LYS A 1 370 ? -2.360  2.265   29.274  0.04 13.59 ? 426  LYS A N    1  
ATOM   5375   C CA   . LYS A 1 370 ? -1.334  2.376   30.304  0.04 13.58 ? 426  LYS A CA   1  
ATOM   5376   C C    . LYS A 1 370 ? -0.625  1.059   30.516  0.04 13.46 ? 426  LYS A C    1  
ATOM   5377   O O    . LYS A 1 370 ? -1.251  -0.003  30.539  0.04 13.56 ? 426  LYS A O    1  
ATOM   5378   C CB   . LYS A 1 370 ? -1.919  2.866   31.629  0.04 13.94 ? 426  LYS A CB   1  
ATOM   5379   C CG   . LYS A 1 370 ? -2.322  4.369   31.600  0.04 14.14 ? 426  LYS A CG   1  
ATOM   5380   C CD   . LYS A 1 370 ? -2.549  4.889   33.035  0.04 14.56 ? 426  LYS A CD   1  
ATOM   5381   C CE   . LYS A 1 370 ? -3.924  5.431   33.178  0.04 14.88 ? 426  LYS A CE   1  
ATOM   5382   N NZ   . LYS A 1 370 ? -4.083  5.471   34.643  0.04 15.28 ? 426  LYS A NZ   1  
ATOM   5383   H H    . LYS A 1 370 ? -2.676  1.475   29.173  0.04 13.62 ? 426  LYS A H    1  
ATOM   5384   H HA   . LYS A 1 370 ? -0.674  3.020   30.005  0.04 13.45 ? 426  LYS A HA   1  
ATOM   5385   H HB2  . LYS A 1 370 ? -2.702  2.338   31.846  0.04 14.08 ? 426  LYS A HB2  1  
ATOM   5386   H HB3  . LYS A 1 370 ? -1.244  2.750   32.316  0.04 13.94 ? 426  LYS A HB3  1  
ATOM   5387   H HG2  . LYS A 1 370 ? -1.616  4.881   31.187  0.04 14.07 ? 426  LYS A HG2  1  
ATOM   5388   H HG3  . LYS A 1 370 ? -3.147  4.474   31.103  0.04 14.12 ? 426  LYS A HG3  1  
ATOM   5389   H HD2  . LYS A 1 370 ? -2.480  4.149   33.651  0.04 14.66 ? 426  LYS A HD2  1  
ATOM   5390   H HD3  . LYS A 1 370 ? -1.900  5.567   33.263  0.04 14.58 ? 426  LYS A HD3  1  
ATOM   5391   H HE2  . LYS A 1 370 ? -4.001  6.327   32.813  0.04 14.82 ? 426  LYS A HE2  1  
ATOM   5392   H HE3  . LYS A 1 370 ? -4.577  4.820   32.796  0.04 14.91 ? 426  LYS A HE3  1  
ATOM   5393   H HZ1  . LYS A 1 370 ? -4.668  6.101   34.873  0.04 15.48 ? 426  LYS A HZ1  1  
ATOM   5394   H HZ2  . LYS A 1 370 ? -4.362  4.675   34.926  0.04 15.28 ? 426  LYS A HZ2  1  
ATOM   5395   H HZ3  . LYS A 1 370 ? -3.295  5.647   35.021  0.04 15.34 ? 426  LYS A HZ3  1  
ATOM   5396   N N    . ALA A 1 371 ? 0.699   1.170   30.688  0.04 13.29 ? 427  ALA A N    1  
ATOM   5397   C CA   . ALA A 1 371 ? 1.542   0.050   31.070  0.04 13.26 ? 427  ALA A CA   1  
ATOM   5398   C C    . ALA A 1 371 ? 2.756   0.545   31.821  0.04 13.23 ? 427  ALA A C    1  
ATOM   5399   O O    . ALA A 1 371 ? 3.269   1.613   31.520  0.04 13.09 ? 427  ALA A O    1  
ATOM   5400   C CB   . ALA A 1 371 ? 1.984   -0.713  29.835  0.04 13.01 ? 427  ALA A CB   1  
ATOM   5401   H H    . ALA A 1 371 ? 1.126   1.903   30.597  0.04 13.22 ? 427  ALA A H    1  
ATOM   5402   H HA   . ALA A 1 371 ? 1.019   -0.536  31.634  0.04 13.45 ? 427  ALA A HA   1  
ATOM   5403   H HB1  . ALA A 1 371 ? 2.445   -1.518  30.112  0.04 13.02 ? 427  ALA A HB1  1  
ATOM   5404   H HB2  . ALA A 1 371 ? 1.193   -0.942  29.325  0.04 13.06 ? 427  ALA A HB2  1  
ATOM   5405   H HB3  . ALA A 1 371 ? 2.580   -0.158  29.307  0.04 12.84 ? 427  ALA A HB3  1  
ATOM   5406   N N    . THR A 1 372 ? 3.238   -0.243  32.782  0.04 13.38 ? 428  THR A N    1  
ATOM   5407   C CA   . THR A 1 372 ? 4.416   0.129   33.567  0.04 13.42 ? 428  THR A CA   1  
ATOM   5408   C C    . THR A 1 372 ? 5.676   -0.074  32.722  0.04 13.16 ? 428  THR A C    1  
ATOM   5409   O O    . THR A 1 372 ? 6.461   0.858   32.501  0.04 13.06 ? 428  THR A O    1  
ATOM   5410   C CB   . THR A 1 372 ? 4.459   -0.691  34.870  0.04 13.73 ? 428  THR A CB   1  
ATOM   5411   O OG1  . THR A 1 372 ? 3.251   -0.461  35.622  0.04 14.01 ? 428  THR A OG1  1  
ATOM   5412   C CG2  . THR A 1 372 ? 5.654   -0.333  35.733  0.04 13.80 ? 428  THR A CG2  1  
ATOM   5413   H H    . THR A 1 372 ? 2.911   -1.006  32.983  0.04 13.49 ? 428  THR A H    1  
ATOM   5414   H HA   . THR A 1 372 ? 4.370   1.064   33.810  0.04 13.46 ? 428  THR A HA   1  
ATOM   5415   H HB   . THR A 1 372 ? 4.523   -1.629  34.636  0.04 13.72 ? 428  THR A HB   1  
ATOM   5416   H HG1  . THR A 1 372 ? 3.232   0.331   35.888  0.04 14.03 ? 428  THR A HG1  1  
ATOM   5417   H HG21 . THR A 1 372 ? 5.860   -1.086  36.308  0.04 14.05 ? 428  THR A HG21 1  
ATOM   5418   H HG22 . THR A 1 372 ? 6.431   -0.141  35.189  0.04 13.68 ? 428  THR A HG22 1  
ATOM   5419   H HG23 . THR A 1 372 ? 5.445   0.438   36.285  0.04 13.77 ? 428  THR A HG23 1  
ATOM   5420   N N    . THR A 1 373 ? 5.869   -1.295  32.232  0.04 13.09 ? 429  THR A N    1  
ATOM   5421   C CA   . THR A 1 373 ? 6.944   -1.576  31.283  0.04 12.88 ? 429  THR A CA   1  
ATOM   5422   C C    . THR A 1 373 ? 6.325   -2.254  30.063  0.04 12.71 ? 429  THR A C    1  
ATOM   5423   O O    . THR A 1 373 ? 5.442   -3.101  30.201  0.04 12.83 ? 429  THR A O    1  
ATOM   5424   C CB   . THR A 1 373 ? 8.002   -2.468  31.838  0.04 13.05 ? 429  THR A CB   1  
ATOM   5425   O OG1  . THR A 1 373 ? 8.235   -2.138  33.214  0.04 13.24 ? 429  THR A OG1  1  
ATOM   5426   C CG2  . THR A 1 373 ? 9.273   -2.295  31.007  0.04 12.88 ? 429  THR A CG2  1  
ATOM   5427   H H    . THR A 1 373 ? 5.398   -1.977  32.444  0.04 13.17 ? 429  THR A H    1  
ATOM   5428   H HA   . THR A 1 373 ? 7.367   -0.757  31.004  0.04 12.78 ? 429  THR A HA   1  
ATOM   5429   H HB   . THR A 1 373 ? 7.710   -3.392  31.768  0.04 13.17 ? 429  THR A HB   1  
ATOM   5430   H HG1  . THR A 1 373 ? 9.023   -1.868  33.318  0.04 13.19 ? 429  THR A HG1  1  
ATOM   5431   H HG21 . THR A 1 373 ? 9.813   -3.099  31.068  0.04 13.01 ? 429  THR A HG21 1  
ATOM   5432   H HG22 . THR A 1 373 ? 9.027   -2.157  30.080  0.04 12.79 ? 429  THR A HG22 1  
ATOM   5433   H HG23 . THR A 1 373 ? 9.789   -1.534  31.317  0.04 12.75 ? 429  THR A HG23 1  
ATOM   5434   N N    . SER A 1 374 ? 6.740   -1.883  28.865  0.04 12.48 ? 430  SER A N    1  
ATOM   5435   C CA   . SER A 1 374 ? 6.083   -2.454  27.695  0.04 12.35 ? 430  SER A CA   1  
ATOM   5436   C C    . SER A 1 374 ? 6.663   -3.790  27.221  0.04 12.33 ? 430  SER A C    1  
ATOM   5437   O O    . SER A 1 374 ? 5.933   -4.766  27.074  0.04 12.43 ? 430  SER A O    1  
ATOM   5438   C CB   . SER A 1 374 ? 5.975   -1.421  26.582  0.04 12.15 ? 430  SER A CB   1  
ATOM   5439   O OG   . SER A 1 374 ? 5.008   -0.446  26.958  0.04 12.23 ? 430  SER A OG   1  
ATOM   5440   H H    . SER A 1 374 ? 7.387   -1.346  28.704  0.04 12.40 ? 430  SER A H    1  
ATOM   5441   H HA   . SER A 1 374 ? 5.161   -2.642  27.936  0.04 12.46 ? 430  SER A HA   1  
ATOM   5442   H HB2  . SER A 1 374 ? 6.836   -0.992  26.463  0.04 12.08 ? 430  SER A HB2  1  
ATOM   5443   H HB3  . SER A 1 374 ? 5.685   -1.854  25.762  0.04 12.08 ? 430  SER A HB3  1  
ATOM   5444   H HG   . SER A 1 374 ? 5.198   -0.119  27.709  0.04 12.33 ? 430  SER A HG   1  
ATOM   5445   N N    . ILE A 1 375 ? 7.982   -3.850  27.046  0.04 12.25 ? 431  ILE A N    1  
ATOM   5446   C CA   . ILE A 1 375 ? 8.642   -5.110  26.689  0.04 12.28 ? 431  ILE A CA   1  
ATOM   5447   C C    . ILE A 1 375 ? 9.768   -5.415  27.678  0.04 12.44 ? 431  ILE A C    1  
ATOM   5448   O O    . ILE A 1 375 ? 10.676  -4.607  27.846  0.04 12.40 ? 431  ILE A O    1  
ATOM   5449   C CB   . ILE A 1 375 ? 9.181   -5.118  25.252  0.04 12.08 ? 431  ILE A CB   1  
ATOM   5450   C CG1  . ILE A 1 375 ? 8.116   -4.679  24.231  0.04 11.95 ? 431  ILE A CG1  1  
ATOM   5451   C CG2  . ILE A 1 375 ? 9.760   -6.525  24.940  0.04 12.17 ? 431  ILE A CG2  1  
ATOM   5452   C CD1  . ILE A 1 375 ? 8.545   -4.749  22.684  0.04 11.80 ? 431  ILE A CD1  1  
ATOM   5453   H H    . ILE A 1 375 ? 8.510   -3.190  27.149  0.04 12.20 ? 431  ILE A H    1  
ATOM   5454   H HA   . ILE A 1 375 ? 7.995   -5.829  26.748  0.04 12.37 ? 431  ILE A HA   1  
ATOM   5455   H HB   . ILE A 1 375 ? 9.904   -4.472  25.201  0.04 12.02 ? 431  ILE A HB   1  
ATOM   5456   H HG12 . ILE A 1 375 ? 7.314   -5.210  24.357  0.04 12.03 ? 431  ILE A HG12 1  
ATOM   5457   H HG13 . ILE A 1 375 ? 7.907   -3.746  24.412  0.04 11.90 ? 431  ILE A HG13 1  
ATOM   5458   H HG21 . ILE A 1 375 ? 9.855   -6.646  23.987  0.04 12.07 ? 431  ILE A HG21 1  
ATOM   5459   H HG22 . ILE A 1 375 ? 10.624  -6.620  25.368  0.04 12.29 ? 431  ILE A HG22 1  
ATOM   5460   H HG23 . ILE A 1 375 ? 9.154   -7.190  25.298  0.04 12.25 ? 431  ILE A HG23 1  
ATOM   5461   H HD11 . ILE A 1 375 ? 7.790   -4.496  22.131  0.04 11.75 ? 431  ILE A HD11 1  
ATOM   5462   H HD12 . ILE A 1 375 ? 9.282   -4.137  22.531  0.04 11.73 ? 431  ILE A HD12 1  
ATOM   5463   H HD13 . ILE A 1 375 ? 8.813   -5.655  22.461  0.04 11.86 ? 431  ILE A HD13 1  
ATOM   5464   N N    . VAL A 1 376 ? 9.669   -6.554  28.348  0.04 12.65 ? 432  VAL A N    1  
ATOM   5465   C CA   . VAL A 1 376 ? 10.757  -7.095  29.172  0.04 12.86 ? 432  VAL A CA   1  
ATOM   5466   C C    . VAL A 1 376 ? 11.377  -8.279  28.437  0.04 12.90 ? 432  VAL A C    1  
ATOM   5467   O O    . VAL A 1 376 ? 10.685  -9.274  28.144  0.04 12.97 ? 432  VAL A O    1  
ATOM   5468   C CB   . VAL A 1 376 ? 10.316  -7.542  30.567  0.04 13.16 ? 432  VAL A CB   1  
ATOM   5469   C CG1  . VAL A 1 376 ? 11.482  -8.192  31.337  0.04 13.42 ? 432  VAL A CG1  1  
ATOM   5470   C CG2  . VAL A 1 376 ? 9.787   -6.359  31.360  0.04 13.15 ? 432  VAL A CG2  1  
ATOM   5471   H H    . VAL A 1 376 ? 8.966   -7.042  28.347  0.04 12.70 ? 432  VAL A H    1  
ATOM   5472   H HA   . VAL A 1 376 ? 11.447  -6.426  29.283  0.04 12.82 ? 432  VAL A HA   1  
ATOM   5473   H HB   . VAL A 1 376 ? 9.600   -8.195  30.485  0.04 13.23 ? 432  VAL A HB   1  
ATOM   5474   H HG11 . VAL A 1 376 ? 11.211  -8.311  32.259  0.04 13.62 ? 432  VAL A HG11 1  
ATOM   5475   H HG12 . VAL A 1 376 ? 11.684  -9.058  30.950  0.04 13.45 ? 432  VAL A HG12 1  
ATOM   5476   H HG13 . VAL A 1 376 ? 12.261  -7.618  31.284  0.04 13.36 ? 432  VAL A HG13 1  
ATOM   5477   H HG21 . VAL A 1 376 ? 10.344  -6.241  32.143  0.04 13.27 ? 432  VAL A HG21 1  
ATOM   5478   H HG22 . VAL A 1 376 ? 9.823   -5.567  30.802  0.04 12.96 ? 432  VAL A HG22 1  
ATOM   5479   H HG23 . VAL A 1 376 ? 8.869   -6.536  31.622  0.04 13.27 ? 432  VAL A HG23 1  
ATOM   5480   N N    . VAL A 1 377 ? 12.669  -8.176  28.127  0.04 12.89 ? 433  VAL A N    1  
ATOM   5481   C CA   . VAL A 1 377 ? 13.369  -9.269  27.439  0.04 12.97 ? 433  VAL A CA   1  
ATOM   5482   C C    . VAL A 1 377 ? 14.316  -9.929  28.439  0.04 13.29 ? 433  VAL A C    1  
ATOM   5483   O O    . VAL A 1 377 ? 15.416  -9.437  28.702  0.04 13.35 ? 433  VAL A O    1  
ATOM   5484   C CB   . VAL A 1 377 ? 14.124  -8.787  26.210  0.04 12.76 ? 433  VAL A CB   1  
ATOM   5485   C CG1  . VAL A 1 377 ? 14.878  -9.970  25.574  0.04 12.88 ? 433  VAL A CG1  1  
ATOM   5486   C CG2  . VAL A 1 377 ? 13.151  -8.129  25.215  0.04 12.48 ? 433  VAL A CG2  1  
ATOM   5487   H H    . VAL A 1 377 ? 13.165  -7.506  28.303  0.04 12.85 ? 433  VAL A H    1  
ATOM   5488   H HA   . VAL A 1 377 ? 12.737  -9.935  27.141  0.04 12.99 ? 433  VAL A HA   1  
ATOM   5489   H HB   . VAL A 1 377 ? 14.783  -8.128  26.474  0.04 12.76 ? 433  VAL A HB   1  
ATOM   5490   H HG11 . VAL A 1 377 ? 15.308  -9.664  24.759  0.04 12.83 ? 433  VAL A HG11 1  
ATOM   5491   H HG12 . VAL A 1 377 ? 15.542  -10.318 26.188  0.04 13.10 ? 433  VAL A HG12 1  
ATOM   5492   H HG13 . VAL A 1 377 ? 14.238  -10.668 25.371  0.04 12.82 ? 433  VAL A HG13 1  
ATOM   5493   H HG21 . VAL A 1 377 ? 13.244  -8.544  24.343  0.04 12.38 ? 433  VAL A HG21 1  
ATOM   5494   H HG22 . VAL A 1 377 ? 12.246  -8.269  25.546  0.04 12.50 ? 433  VAL A HG22 1  
ATOM   5495   H HG23 . VAL A 1 377 ? 13.339  -7.182  25.158  0.04 12.41 ? 433  VAL A HG23 1  
ATOM   5496   N N    . ASN A 1 378 ? 13.863  -11.065 28.981  0.04 13.55 ? 434  ASN A N    1  
ATOM   5497   C CA   . ASN A 1 378 ? 14.613  -11.867 29.942  0.04 13.92 ? 434  ASN A CA   1  
ATOM   5498   C C    . ASN A 1 378 ? 15.507  -12.933 29.260  0.04 14.06 ? 434  ASN A C    1  
ATOM   5499   O O    . ASN A 1 378 ? 16.593  -13.210 29.732  0.04 14.31 ? 434  ASN A O    1  
ATOM   5500   C CB   . ASN A 1 378 ? 13.668  -12.616 30.912  0.04 14.19 ? 434  ASN A CB   1  
ATOM   5501   C CG   . ASN A 1 378 ? 12.905  -11.690 31.826  0.04 14.15 ? 434  ASN A CG   1  
ATOM   5502   O OD1  . ASN A 1 378 ? 13.483  -11.132 32.764  0.04 14.17 ? 434  ASN A OD1  1  
ATOM   5503   N ND2  . ASN A 1 378 ? 11.591  -11.566 31.595  0.04 14.14 ? 434  ASN A ND2  1  
ATOM   5504   H H    . ASN A 1 378 ? 13.097  -11.399 28.795  0.04 13.53 ? 434  ASN A H    1  
ATOM   5505   H HA   . ASN A 1 378 ? 15.179  -11.282 30.468  0.04 13.96 ? 434  ASN A HA   1  
ATOM   5506   H HB2  . ASN A 1 378 ? 13.036  -13.155 30.420  0.04 14.16 ? 434  ASN A HB2  1  
ATOM   5507   H HB3  . ASN A 1 378 ? 14.216  -13.181 31.480  0.04 14.46 ? 434  ASN A HB3  1  
ATOM   5508   H HD21 . ASN A 1 378 ? 11.116  -11.011 32.045  0.04 14.29 ? 434  ASN A HD21 1  
ATOM   5509   H HD22 . ASN A 1 378 ? 11.221  -12.049 30.988  0.04 14.00 ? 434  ASN A HD22 1  
ATOM   5510   N N    . SER A 1 379 ? 15.029  -13.528 28.168  0.04 13.94 ? 435  SER A N    1  
ATOM   5511   C CA   . SER A 1 379 ? 15.738  -14.614 27.477  0.04 14.13 ? 435  SER A CA   1  
ATOM   5512   C C    . SER A 1 379 ? 17.083  -14.223 26.887  0.04 14.04 ? 435  SER A C    1  
ATOM   5513   O O    . SER A 1 379 ? 17.160  -13.298 26.074  0.04 13.72 ? 435  SER A O    1  
ATOM   5514   C CB   . SER A 1 379 ? 14.914  -15.153 26.300  0.04 14.09 ? 435  SER A CB   1  
ATOM   5515   O OG   . SER A 1 379 ? 13.638  -15.599 26.715  0.04 14.33 ? 435  SER A OG   1  
ATOM   5516   H H    . SER A 1 379 ? 14.281  -13.313 27.802  0.04 13.77 ? 435  SER A H    1  
ATOM   5517   H HA   . SER A 1 379 ? 15.887  -15.349 28.098  0.04 14.42 ? 435  SER A HA   1  
ATOM   5518   H HB2  . SER A 1 379 ? 14.788  -14.438 25.662  0.04 13.83 ? 435  SER A HB2  1  
ATOM   5519   H HB3  . SER A 1 379 ? 15.392  -15.889 25.890  0.04 14.20 ? 435  SER A HB3  1  
ATOM   5520   H HG   . SER A 1 379 ? 13.173  -15.787 26.043  0.04 14.21 ? 435  SER A HG   1  
ATOM   5521   N N    . ASN A 1 380 ? 18.124  -14.956 27.261  0.04 14.38 ? 436  ASN A N    1  
ATOM   5522   C CA   . ASN A 1 380 ? 19.424  -14.762 26.625  0.04 14.39 ? 436  ASN A CA   1  
ATOM   5523   C C    . ASN A 1 380 ? 19.347  -15.026 25.131  0.04 14.22 ? 436  ASN A C    1  
ATOM   5524   O O    . ASN A 1 380 ? 18.604  -15.884 24.672  0.04 14.24 ? 436  ASN A O    1  
ATOM   5525   C CB   . ASN A 1 380 ? 20.479  -15.661 27.263  0.04 14.86 ? 436  ASN A CB   1  
ATOM   5526   C CG   . ASN A 1 380 ? 20.684  -15.381 28.741  0.04 15.10 ? 436  ASN A CG   1  
ATOM   5527   O OD1  . ASN A 1 380 ? 20.519  -14.278 29.216  0.04 14.91 ? 436  ASN A OD1  1  
ATOM   5528   N ND2  . ASN A 1 380 ? 20.956  -16.423 29.486  0.04 15.56 ? 436  ASN A ND2  1  
ATOM   5529   H H    . ASN A 1 380 ? 18.109  -15.559 27.869  0.04 14.62 ? 436  ASN A H    1  
ATOM   5530   H HA   . ASN A 1 380 ? 19.699  -13.842 26.758  0.04 14.25 ? 436  ASN A HA   1  
ATOM   5531   H HB2  . ASN A 1 380 ? 20.206  -16.582 27.160  0.04 15.03 ? 436  ASN A HB2  1  
ATOM   5532   H HB3  . ASN A 1 380 ? 21.326  -15.525 26.813  0.04 14.89 ? 436  ASN A HB3  1  
ATOM   5533   H HD21 . ASN A 1 380 ? 20.665  -16.452 30.296  0.04 15.67 ? 436  ASN A HD21 1  
ATOM   5534   H HD22 . ASN A 1 380 ? 21.413  -17.078 29.167  0.04 15.75 ? 436  ASN A HD22 1  
ATOM   5535   N N    . ASP A 1 381 ? 20.121  -14.248 24.371  0.04 14.07 ? 437  ASP A N    1  
ATOM   5536   C CA   . ASP A 1 381 ? 20.282  -14.412 22.911  0.04 13.95 ? 437  ASP A CA   1  
ATOM   5537   C C    . ASP A 1 381 ? 19.129  -13.917 22.077  0.04 13.59 ? 437  ASP A C    1  
ATOM   5538   O O    . ASP A 1 381 ? 19.133  -14.041 20.872  0.04 13.52 ? 437  ASP A O    1  
ATOM   5539   C CB   . ASP A 1 381 ? 20.669  -15.873 22.547  0.04 14.30 ? 437  ASP A CB   1  
ATOM   5540   C CG   . ASP A 1 381 ? 21.929  -16.280 23.218  0.04 14.71 ? 437  ASP A CG   1  
ATOM   5541   O OD1  . ASP A 1 381 ? 22.993  -15.681 22.860  0.04 14.79 ? 437  ASP A OD1  1  
ATOM   5542   O OD2  . ASP A 1 381 ? 21.873  -17.128 24.147  0.04 15.01 ? 437  ASP A OD2  1  
ATOM   5543   H H    . ASP A 1 381 ? 20.573  -13.591 24.687  0.04 14.06 ? 437  ASP A H    1  
ATOM   5544   H HA   . ASP A 1 381 ? 21.042  -13.873 22.652  0.04 13.92 ? 437  ASP A HA   1  
ATOM   5545   H HB2  . ASP A 1 381 ? 19.961  -16.477 22.807  0.04 14.34 ? 437  ASP A HB2  1  
ATOM   5546   H HB3  . ASP A 1 381 ? 20.813  -15.941 21.592  0.04 14.25 ? 437  ASP A HB3  1  
ATOM   5547   N N    . THR A 1 382 ? 18.101  -13.372 22.708  0.04 13.40 ? 438  THR A N    1  
ATOM   5548   C CA   . THR A 1 382 ? 16.979  -12.868 21.943  0.04 13.10 ? 438  THR A CA   1  
ATOM   5549   C C    . THR A 1 382 ? 17.444  -11.844 20.905  0.04 12.85 ? 438  THR A C    1  
ATOM   5550   O O    . THR A 1 382 ? 18.317  -11.001 21.172  0.04 12.82 ? 438  THR A O    1  
ATOM   5551   C CB   . THR A 1 382 ? 15.906  -12.255 22.891  0.04 13.00 ? 438  THR A CB   1  
ATOM   5552   O OG1  . THR A 1 382 ? 15.444  -13.293 23.754  0.04 13.28 ? 438  THR A OG1  1  
ATOM   5553   C CG2  . THR A 1 382 ? 14.717  -11.742 22.156  0.04 12.74 ? 438  THR A CG2  1  
ATOM   5554   H H    . THR A 1 382 ? 18.016  -13.310 23.557  0.04 13.47 ? 438  THR A H    1  
ATOM   5555   H HA   . THR A 1 382 ? 16.573  -13.600 21.466  0.04 13.15 ? 438  THR A HA   1  
ATOM   5556   H HB   . THR A 1 382 ? 16.293  -11.540 23.416  0.04 12.97 ? 438  THR A HB   1  
ATOM   5557   H HG1  . THR A 1 382 ? 16.079  -13.572 24.229  0.04 13.43 ? 438  THR A HG1  1  
ATOM   5558   H HG21 . THR A 1 382 ? 13.987  -11.614 22.782  0.04 12.74 ? 438  THR A HG21 1  
ATOM   5559   H HG22 . THR A 1 382 ? 14.907  -10.897 21.713  0.04 12.57 ? 438  THR A HG22 1  
ATOM   5560   H HG23 . THR A 1 382 ? 14.451  -12.395 21.493  0.04 12.78 ? 438  THR A HG23 1  
ATOM   5561   N N    . ILE A 1 383 ? 16.829  -11.931 19.730  0.04 12.68 ? 439  ILE A N    1  
ATOM   5562   C CA   . ILE A 1 383 ? 16.995  -10.933 18.678  0.04 12.47 ? 439  ILE A CA   1  
ATOM   5563   C C    . ILE A 1 383 ? 15.743  -10.077 18.594  0.04 12.23 ? 439  ILE A C    1  
ATOM   5564   O O    . ILE A 1 383 ? 14.627  -10.602 18.433  0.04 12.23 ? 439  ILE A O    1  
ATOM   5565   C CB   . ILE A 1 383 ? 17.256  -11.602 17.303  0.04 12.54 ? 439  ILE A CB   1  
ATOM   5566   C CG1  . ILE A 1 383 ? 18.515  -12.467 17.362  0.04 12.80 ? 439  ILE A CG1  1  
ATOM   5567   C CG2  . ILE A 1 383 ? 17.405  -10.508 16.211  0.04 12.33 ? 439  ILE A CG2  1  
ATOM   5568   C CD1  . ILE A 1 383 ? 18.806  -13.216 16.100  0.04 12.91 ? 439  ILE A CD1  1  
ATOM   5569   H H    . ILE A 1 383 ? 16.304  -12.567 19.509  0.04 12.71 ? 439  ILE A H    1  
ATOM   5570   H HA   . ILE A 1 383 ? 17.747  -10.364 18.892  0.04 12.46 ? 439  ILE A HA   1  
ATOM   5571   H HB   . ILE A 1 383 ? 16.505  -12.170 17.082  0.04 12.58 ? 439  ILE A HB   1  
ATOM   5572   H HG12 . ILE A 1 383 ? 19.277  -11.906 17.563  0.04 12.78 ? 439  ILE A HG12 1  
ATOM   5573   H HG13 . ILE A 1 383 ? 18.405  -13.131 18.062  0.04 12.96 ? 439  ILE A HG13 1  
ATOM   5574   H HG21 . ILE A 1 383 ? 17.469  -10.944 15.348  0.04 12.40 ? 439  ILE A HG21 1  
ATOM   5575   H HG22 . ILE A 1 383 ? 16.631  -9.929  16.213  0.04 12.19 ? 439  ILE A HG22 1  
ATOM   5576   H HG23 . ILE A 1 383 ? 18.212  -10.006 16.385  0.04 12.32 ? 439  ILE A HG23 1  
ATOM   5577   H HD11 . ILE A 1 383 ? 19.583  -13.780 16.240  0.04 13.13 ? 439  ILE A HD11 1  
ATOM   5578   H HD12 . ILE A 1 383 ? 18.034  -13.755 15.872  0.04 12.86 ? 439  ILE A HD12 1  
ATOM   5579   H HD13 . ILE A 1 383 ? 18.980  -12.581 15.387  0.04 12.83 ? 439  ILE A HD13 1  
ATOM   5580   N N    . ILE A 1 384 ? 15.911  -8.752  18.676  0.04 12.07 ? 440  ILE A N    1  
ATOM   5581   C CA   . ILE A 1 384 ? 14.817  -7.812  18.508  0.04 11.87 ? 440  ILE A CA   1  
ATOM   5582   C C    . ILE A 1 384 ? 15.129  -7.072  17.214  0.04 11.77 ? 440  ILE A C    1  
ATOM   5583   O O    . ILE A 1 384 ? 15.999  -6.200  17.166  0.04 11.75 ? 440  ILE A O    1  
ATOM   5584   C CB   . ILE A 1 384 ? 14.694  -6.859  19.700  0.04 11.81 ? 440  ILE A CB   1  
ATOM   5585   C CG1  . ILE A 1 384 ? 14.153  -7.632  20.893  0.04 11.95 ? 440  ILE A CG1  1  
ATOM   5586   C CG2  . ILE A 1 384 ? 13.746  -5.745  19.406  0.04 11.64 ? 440  ILE A CG2  1  
ATOM   5587   C CD1  . ILE A 1 384 ? 12.832  -8.365  20.610  0.04 11.95 ? 440  ILE A CD1  1  
ATOM   5588   H H    . ILE A 1 384 ? 16.667  -8.370  18.821  0.04 12.09 ? 440  ILE A H    1  
ATOM   5589   H HA   . ILE A 1 384 ? 13.983  -8.273  18.364  0.04 11.87 ? 440  ILE A HA   1  
ATOM   5590   H HB   . ILE A 1 384 ? 15.564  -6.496  19.919  0.04 11.84 ? 440  ILE A HB   1  
ATOM   5591   H HG12 . ILE A 1 384 ? 14.817  -8.278  21.178  0.04 12.09 ? 440  ILE A HG12 1  
ATOM   5592   H HG13 . ILE A 1 384 ? 13.985  -6.996  21.602  0.04 11.94 ? 440  ILE A HG13 1  
ATOM   5593   H HG21 . ILE A 1 384 ? 13.570  -5.263  20.231  0.04 11.64 ? 440  ILE A HG21 1  
ATOM   5594   H HG22 . ILE A 1 384 ? 14.150  -5.148  18.756  0.04 11.58 ? 440  ILE A HG22 1  
ATOM   5595   H HG23 . ILE A 1 384 ? 12.922  -6.101  19.046  0.04 11.63 ? 440  ILE A HG23 1  
ATOM   5596   H HD11 . ILE A 1 384 ? 12.483  -8.689  21.459  0.04 12.08 ? 440  ILE A HD11 1  
ATOM   5597   H HD12 . ILE A 1 384 ? 12.208  -7.733  20.217  0.04 11.85 ? 440  ILE A HD12 1  
ATOM   5598   H HD13 . ILE A 1 384 ? 12.980  -9.119  20.007  0.04 11.97 ? 440  ILE A HD13 1  
ATOM   5599   N N    . ASP A 1 385 ? 14.467  -7.494  16.140  0.04 11.75 ? 441  ASP A N    1  
ATOM   5600   C CA   . ASP A 1 385 ? 14.763  -7.019  14.781  0.04 11.70 ? 441  ASP A CA   1  
ATOM   5601   C C    . ASP A 1 385 ? 13.562  -6.264  14.249  0.04 11.57 ? 441  ASP A C    1  
ATOM   5602   O O    . ASP A 1 385 ? 12.631  -6.839  13.690  0.04 11.60 ? 441  ASP A O    1  
ATOM   5603   C CB   . ASP A 1 385 ? 15.156  -8.209  13.884  0.04 11.85 ? 441  ASP A CB   1  
ATOM   5604   C CG   . ASP A 1 385 ? 15.291  -7.822  12.434  0.04 11.84 ? 441  ASP A CG   1  
ATOM   5605   O OD1  . ASP A 1 385 ? 15.911  -6.760  12.173  0.04 11.79 ? 441  ASP A OD1  1  
ATOM   5606   O OD2  . ASP A 1 385 ? 14.785  -8.578  11.557  0.04 11.92 ? 441  ASP A OD2  1  
ATOM   5607   H H    . ASP A 1 385 ? 13.834  -8.073  16.167  0.04 11.78 ? 441  ASP A H    1  
ATOM   5608   H HA   . ASP A 1 385 ? 15.518  -6.410  14.800  0.04 11.69 ? 441  ASP A HA   1  
ATOM   5609   H HB2  . ASP A 1 385 ? 16.010  -8.559  14.176  0.04 11.95 ? 441  ASP A HB2  1  
ATOM   5610   H HB3  . ASP A 1 385 ? 14.477  -8.894  13.957  0.04 11.89 ? 441  ASP A HB3  1  
ATOM   5611   N N    . HIS A 1 386 ? 13.622  -4.949  14.427  0.04 11.48 ? 442  HIS A N    1  
ATOM   5612   C CA   . HIS A 1 386 ? 12.526  -3.980  14.174  0.04 11.39 ? 442  HIS A CA   1  
ATOM   5613   C C    . HIS A 1 386 ? 11.385  -3.975  15.164  0.04 11.36 ? 442  HIS A C    1  
ATOM   5614   O O    . HIS A 1 386 ? 10.509  -4.833  15.131  0.04 11.41 ? 442  HIS A O    1  
ATOM   5615   C CB   . HIS A 1 386 ? 11.919  -4.068  12.793  0.04 11.41 ? 442  HIS A CB   1  
ATOM   5616   C CG   . HIS A 1 386 ? 11.173  -2.825  12.427  0.04 11.36 ? 442  HIS A CG   1  
ATOM   5617   N ND1  . HIS A 1 386 ? 10.101  -2.797  11.557  0.04 11.41 ? 442  HIS A ND1  1  
ATOM   5618   C CD2  . HIS A 1 386 ? 11.348  -1.541  12.851  0.04 11.32 ? 442  HIS A CD2  1  
ATOM   5619   C CE1  . HIS A 1 386 ? 9.680   -1.541  11.438  0.04 11.39 ? 442  HIS A CE1  1  
ATOM   5620   N NE2  . HIS A 1 386 ? 10.414  -0.760  12.217  0.04 11.34 ? 442  HIS A NE2  1  
ATOM   5621   H H    . HIS A 1 386 ? 14.332  -4.558  14.709  0.04 11.48 ? 442  HIS A H    1  
ATOM   5622   H HA   . HIS A 1 386 ? 12.920  -3.104  14.239  0.04 11.36 ? 442  HIS A HA   1  
ATOM   5623   H HB2  . HIS A 1 386 ? 12.636  -4.196  12.157  0.04 11.45 ? 442  HIS A HB2  1  
ATOM   5624   H HB3  . HIS A 1 386 ? 11.313  -4.824  12.754  0.04 11.45 ? 442  HIS A HB3  1  
ATOM   5625   H HD2  . HIS A 1 386 ? 12.003  -1.244  13.443  0.04 11.30 ? 442  HIS A HD2  1  
ATOM   5626   H HE1  . HIS A 1 386 ? 8.965   -1.259  10.915  0.04 11.44 ? 442  HIS A HE1  1  
ATOM   5627   N N    . THR A 1 387 ? 11.459  -3.031  16.085  0.04 11.32 ? 443  THR A N    1  
ATOM   5628   C CA   . THR A 1 387 ? 10.351  -2.769  16.980  0.04 11.33 ? 443  THR A CA   1  
ATOM   5629   C C    . THR A 1 387 ? 10.132  -1.272  17.060  0.04 11.29 ? 443  THR A C    1  
ATOM   5630   O O    . THR A 1 387 ? 11.044  -0.511  16.909  0.04 11.27 ? 443  THR A O    1  
ATOM   5631   C CB   . THR A 1 387 ? 10.559  -3.357  18.391  0.04 11.39 ? 443  THR A CB   1  
ATOM   5632   O OG1  . THR A 1 387 ? 9.351   -3.164  19.128  0.04 11.43 ? 443  THR A OG1  1  
ATOM   5633   C CG2  . THR A 1 387 ? 11.675  -2.707  19.148  0.04 11.40 ? 443  THR A CG2  1  
ATOM   5634   H H    . THR A 1 387 ? 12.134  -2.523  16.208  0.04 11.31 ? 443  THR A H    1  
ATOM   5635   H HA   . THR A 1 387 ? 9.542   -3.151  16.622  0.04 11.35 ? 443  THR A HA   1  
ATOM   5636   H HB   . THR A 1 387 ? 10.742  -4.310  18.321  0.04 11.44 ? 443  THR A HB   1  
ATOM   5637   H HG1  . THR A 1 387 ? 9.148   -2.349  19.113  0.04 11.40 ? 443  THR A HG1  1  
ATOM   5638   H HG21 . THR A 1 387 ? 11.796  -3.152  19.999  0.04 11.47 ? 443  THR A HG21 1  
ATOM   5639   H HG22 . THR A 1 387 ? 12.504  -2.770  18.649  0.04 11.41 ? 443  THR A HG22 1  
ATOM   5640   H HG23 . THR A 1 387 ? 11.468  -1.772  19.303  0.04 11.37 ? 443  THR A HG23 1  
ATOM   5641   N N    . TRP A 1 388 ? 8.886   -0.914  17.294  0.04 11.31 ? 444  TRP A N    1  
ATOM   5642   C CA   . TRP A 1 388 ? 8.499   0.454   17.669  0.04 11.33 ? 444  TRP A CA   1  
ATOM   5643   C C    . TRP A 1 388 ? 7.646   0.339   18.899  0.04 11.40 ? 444  TRP A C    1  
ATOM   5644   O O    . TRP A 1 388 ? 6.543   -0.222  18.852  0.04 11.46 ? 444  TRP A O    1  
ATOM   5645   C CB   . TRP A 1 388 ? 7.716   1.151   16.574  0.04 11.36 ? 444  TRP A CB   1  
ATOM   5646   C CG   . TRP A 1 388 ? 7.411   2.616   16.849  0.04 11.42 ? 444  TRP A CG   1  
ATOM   5647   C CD1  . TRP A 1 388 ? 8.188   3.525   17.498  0.04 11.43 ? 444  TRP A CD1  1  
ATOM   5648   C CD2  . TRP A 1 388 ? 6.232   3.316   16.439  0.04 11.52 ? 444  TRP A CD2  1  
ATOM   5649   N NE1  . TRP A 1 388 ? 7.593   4.770   17.466  0.04 11.53 ? 444  TRP A NE1  1  
ATOM   5650   C CE2  . TRP A 1 388 ? 6.388   4.669   16.807  0.04 11.59 ? 444  TRP A CE2  1  
ATOM   5651   C CE3  . TRP A 1 388 ? 5.090   2.940   15.735  0.04 11.60 ? 444  TRP A CE3  1  
ATOM   5652   C CZ2  . TRP A 1 388 ? 5.424   5.632   16.530  0.04 11.74 ? 444  TRP A CZ2  1  
ATOM   5653   C CZ3  . TRP A 1 388 ? 4.122   3.907   15.457  0.04 11.75 ? 444  TRP A CZ3  1  
ATOM   5654   C CH2  . TRP A 1 388 ? 4.295   5.244   15.877  0.04 11.82 ? 444  TRP A CH2  1  
ATOM   5655   H H    . TRP A 1 388 ? 8.227   -1.457  17.278  0.04 11.34 ? 444  TRP A H    1  
ATOM   5656   H HA   . TRP A 1 388 ? 9.286   0.974   17.857  0.04 11.32 ? 444  TRP A HA   1  
ATOM   5657   H HB2  . TRP A 1 388 ? 8.232   1.120   15.757  0.04 11.33 ? 444  TRP A HB2  1  
ATOM   5658   H HB3  . TRP A 1 388 ? 6.875   0.688   16.438  0.04 11.39 ? 444  TRP A HB3  1  
ATOM   5659   H HD1  . TRP A 1 388 ? 9.025   3.349   17.861  0.04 11.40 ? 444  TRP A HD1  1  
ATOM   5660   H HE1  . TRP A 1 388 ? 7.906   5.489   17.811  0.04 11.57 ? 444  TRP A HE1  1  
ATOM   5661   H HE3  . TRP A 1 388 ? 5.000   2.061   15.447  0.04 11.58 ? 444  TRP A HE3  1  
ATOM   5662   H HZ2  . TRP A 1 388 ? 5.528   6.509   16.824  0.04 11.81 ? 444  TRP A HZ2  1  
ATOM   5663   H HZ3  . TRP A 1 388 ? 3.349   3.677   14.996  0.04 11.83 ? 444  TRP A HZ3  1  
ATOM   5664   H HH2  . TRP A 1 388 ? 3.633   5.870   15.688  0.04 11.95 ? 444  TRP A HH2  1  
ATOM   5665   N N    . VAL A 1 389 ? 8.146   0.914   20.004  0.04 11.43 ? 445  VAL A N    1  
ATOM   5666   C CA   . VAL A 1 389 ? 7.468   0.862   21.296  0.04 11.53 ? 445  VAL A CA   1  
ATOM   5667   C C    . VAL A 1 389 ? 7.176   2.316   21.606  0.04 11.59 ? 445  VAL A C    1  
ATOM   5668   O O    . VAL A 1 389 ? 8.075   3.096   21.861  0.04 11.59 ? 445  VAL A O    1  
ATOM   5669   C CB   . VAL A 1 389 ? 8.348   0.146   22.336  0.04 11.57 ? 445  VAL A CB   1  
ATOM   5670   C CG1  . VAL A 1 389 ? 7.762   0.261   23.708  0.04 11.71 ? 445  VAL A CG1  1  
ATOM   5671   C CG2  . VAL A 1 389 ? 8.478   -1.312  21.955  0.04 11.55 ? 445  VAL A CG2  1  
ATOM   5672   H H    . VAL A 1 389 ? 8.881   1.351   20.023  0.04 11.41 ? 445  VAL A H    1  
ATOM   5673   H HA   . VAL A 1 389 ? 6.626   0.385   21.224  0.04 11.57 ? 445  VAL A HA   1  
ATOM   5674   H HB   . VAL A 1 389 ? 9.231   0.539   22.338  0.04 11.55 ? 445  VAL A HB   1  
ATOM   5675   H HG11 . VAL A 1 389 ? 8.174   -0.398  24.291  0.04 11.76 ? 445  VAL A HG11 1  
ATOM   5676   H HG12 . VAL A 1 389 ? 7.928   1.155   24.037  0.04 11.74 ? 445  VAL A HG12 1  
ATOM   5677   H HG13 . VAL A 1 389 ? 6.806   0.097   23.656  0.04 11.75 ? 445  VAL A HG13 1  
ATOM   5678   H HG21 . VAL A 1 389 ? 9.056   -1.762  22.592  0.04 11.62 ? 445  VAL A HG21 1  
ATOM   5679   H HG22 . VAL A 1 389 ? 7.588   -1.697  21.969  0.04 11.55 ? 445  VAL A HG22 1  
ATOM   5680   H HG23 . VAL A 1 389 ? 8.854   -1.362  21.060  0.04 11.48 ? 445  VAL A HG23 1  
ATOM   5681   N N    . TRP A 1 390 ? 5.886   2.648   21.573  0.04 11.68 ? 446  TRP A N    1  
ATOM   5682   C CA   . TRP A 1 390 ? 5.429   4.038   21.447  0.04 11.77 ? 446  TRP A CA   1  
ATOM   5683   C C    . TRP A 1 390 ? 4.370   4.378   22.451  0.04 11.94 ? 446  TRP A C    1  
ATOM   5684   O O    . TRP A 1 390 ? 3.238   3.945   22.348  0.04 12.02 ? 446  TRP A O    1  
ATOM   5685   C CB   . TRP A 1 390 ? 4.860   4.237   20.044  0.04 11.75 ? 446  TRP A CB   1  
ATOM   5686   C CG   . TRP A 1 390 ? 4.403   5.622   19.644  0.04 11.88 ? 446  TRP A CG   1  
ATOM   5687   C CD1  . TRP A 1 390 ? 5.184   6.690   19.359  0.04 11.89 ? 446  TRP A CD1  1  
ATOM   5688   C CD2  . TRP A 1 390 ? 3.053   6.021   19.376  0.04 12.04 ? 446  TRP A CD2  1  
ATOM   5689   N NE1  . TRP A 1 390 ? 4.414   7.745   18.928  0.04 12.05 ? 446  TRP A NE1  1  
ATOM   5690   C CE2  . TRP A 1 390 ? 3.092   7.369   18.945  0.04 12.16 ? 446  TRP A CE2  1  
ATOM   5691   C CE3  . TRP A 1 390 ? 1.819   5.384   19.451  0.04 12.15 ? 446  TRP A CE3  1  
ATOM   5692   C CZ2  . TRP A 1 390 ? 1.951   8.043   18.559  0.04 12.36 ? 446  TRP A CZ2  1  
ATOM   5693   C CZ3  . TRP A 1 390 ? 0.694   6.071   19.107  0.04 12.35 ? 446  TRP A CZ3  1  
ATOM   5694   C CH2  . TRP A 1 390 ? 0.763   7.388   18.654  0.04 12.46 ? 446  TRP A CH2  1  
ATOM   5695   H H    . TRP A 1 390 ? 5.249   2.084   21.612  0.04 11.72 ? 446  TRP A H    1  
ATOM   5696   H HA   . TRP A 1 390 ? 6.166   4.655   21.560  0.04 11.76 ? 446  TRP A HA   1  
ATOM   5697   H HB2  . TRP A 1 390 ? 5.524   3.961   19.397  0.04 11.66 ? 446  TRP A HB2  1  
ATOM   5698   H HB3  . TRP A 1 390 ? 4.086   3.662   19.953  0.04 11.79 ? 446  TRP A HB3  1  
ATOM   5699   H HD1  . TRP A 1 390 ? 6.110   6.697   19.431  0.04 11.82 ? 446  TRP A HD1  1  
ATOM   5700   H HE1  . TRP A 1 390 ? 4.709   8.517   18.705  0.04 12.11 ? 446  TRP A HE1  1  
ATOM   5701   H HE3  . TRP A 1 390 ? 1.763   4.495   19.716  0.04 12.10 ? 446  TRP A HE3  1  
ATOM   5702   H HZ2  . TRP A 1 390 ? 1.985   8.938   18.295  0.04 12.47 ? 446  TRP A HZ2  1  
ATOM   5703   H HZ3  . TRP A 1 390 ? -0.134  5.648   19.155  0.04 12.45 ? 446  TRP A HZ3  1  
ATOM   5704   H HH2  . TRP A 1 390 ? -0.025  7.838   18.449  0.04 12.63 ? 446  TRP A HH2  1  
ATOM   5705   N N    . ARG A 1 391 ? 4.736   5.239   23.408  0.04 12.04 ? 447  ARG A N    1  
ATOM   5706   C CA   . ARG A 1 391 ? 3.723   5.920   24.211  0.04 12.25 ? 447  ARG A CA   1  
ATOM   5707   C C    . ARG A 1 391 ? 3.175   7.062   23.367  0.04 12.35 ? 447  ARG A C    1  
ATOM   5708   O O    . ARG A 1 391 ? 3.944   7.902   22.902  0.04 12.32 ? 447  ARG A O    1  
ATOM   5709   C CB   . ARG A 1 391 ? 4.320   6.421   25.526  0.04 12.36 ? 447  ARG A CB   1  
ATOM   5710   C CG   . ARG A 1 391 ? 3.351   7.341   26.274  0.04 12.62 ? 447  ARG A CG   1  
ATOM   5711   C CD   . ARG A 1 391 ? 3.820   7.734   27.670  0.04 12.78 ? 447  ARG A CD   1  
ATOM   5712   N NE   . ARG A 1 391 ? 2.921   8.714   28.263  0.04 13.06 ? 447  ARG A NE   1  
ATOM   5713   C CZ   . ARG A 1 391 ? 3.075   10.028  28.198  0.04 13.19 ? 447  ARG A CZ   1  
ATOM   5714   N NH1  . ARG A 1 391 ? 4.136   10.606  27.660  0.04 13.10 ? 447  ARG A NH1  1  
ATOM   5715   N NH2  . ARG A 1 391 ? 2.145   10.795  28.685  0.04 13.47 ? 447  ARG A NH2  1  
ATOM   5716   H H    . ARG A 1 391 ? 5.542   5.455   23.588  0.04 12.00 ? 447  ARG A H    1  
ATOM   5717   H HA   . ARG A 1 391 ? 2.997   5.315   24.413  0.04 12.30 ? 447  ARG A HA   1  
ATOM   5718   H HB2  . ARG A 1 391 ? 4.513   5.655   26.083  0.04 12.35 ? 447  ARG A HB2  1  
ATOM   5719   H HB3  . ARG A 1 391 ? 5.137   6.907   25.344  0.04 12.31 ? 447  ARG A HB3  1  
ATOM   5720   H HG2  . ARG A 1 391 ? 3.253   8.165   25.769  0.04 12.66 ? 447  ARG A HG2  1  
ATOM   5721   H HG3  . ARG A 1 391 ? 2.489   6.906   26.352  0.04 12.69 ? 447  ARG A HG3  1  
ATOM   5722   H HD2  . ARG A 1 391 ? 3.832   6.948   28.239  0.04 12.78 ? 447  ARG A HD2  1  
ATOM   5723   H HD3  . ARG A 1 391 ? 4.707   8.111   27.620  0.04 12.73 ? 447  ARG A HD3  1  
ATOM   5724   H HE   . ARG A 1 391 ? 2.144   8.437   28.505  0.04 13.15 ? 447  ARG A HE   1  
ATOM   5725   H HH11 . ARG A 1 391 ? 4.759   10.135  27.305  0.04 12.94 ? 447  ARG A HH11 1  
ATOM   5726   H HH12 . ARG A 1 391 ? 4.188   11.462  27.657  0.04 13.22 ? 447  ARG A HH12 1  
ATOM   5727   H HH21 . ARG A 1 391 ? 1.458   10.444  29.061  0.04 13.55 ? 447  ARG A HH21 1  
ATOM   5728   H HH22 . ARG A 1 391 ? 2.257   11.646  28.681  0.04 13.58 ? 447  ARG A HH22 1  
ATOM   5729   N N    . ALA A 1 392 ? 1.860   7.081   23.136  0.04 12.49 ? 448  ALA A N    1  
ATOM   5730   C CA   . ALA A 1 392 ? 1.282   8.033   22.199  0.04 12.60 ? 448  ALA A CA   1  
ATOM   5731   C C    . ALA A 1 392 ? 1.619   9.470   22.636  0.04 12.78 ? 448  ALA A C    1  
ATOM   5732   O O    . ALA A 1 392 ? 1.725   9.776   23.833  0.04 12.96 ? 448  ALA A O    1  
ATOM   5733   C CB   . ALA A 1 392 ? -0.234  7.851   22.131  0.04 12.78 ? 448  ALA A CB   1  
ATOM   5734   H H    . ALA A 1 392 ? 1.293   6.555   23.506  0.04 12.55 ? 448  ALA A H    1  
ATOM   5735   H HA   . ALA A 1 392 ? 1.640   7.879   21.320  0.04 12.48 ? 448  ALA A HA   1  
ATOM   5736   H HB1  . ALA A 1 392 ? -0.594  8.453   21.464  0.04 12.88 ? 448  ALA A HB1  1  
ATOM   5737   H HB2  . ALA A 1 392 ? -0.428  6.932   21.891  0.04 12.69 ? 448  ALA A HB2  1  
ATOM   5738   H HB3  . ALA A 1 392 ? -0.605  8.053   22.999  0.04 12.92 ? 448  ALA A HB3  1  
ATOM   5739   N N    . ASP A 1 393 ? 1.808   10.331  21.639  0.04 12.78 ? 449  ASP A N    1  
ATOM   5740   C CA   . ASP A 1 393 ? 1.951   11.796  21.831  0.04 12.99 ? 449  ASP A CA   1  
ATOM   5741   C C    . ASP A 1 393 ? 0.757   12.578  21.285  0.04 13.28 ? 449  ASP A C    1  
ATOM   5742   O O    . ASP A 1 393 ? 0.675   13.800  21.439  0.04 13.53 ? 449  ASP A O    1  
ATOM   5743   C CB   . ASP A 1 393 ? 3.211   12.269  21.124  0.04 12.89 ? 449  ASP A CB   1  
ATOM   5744   C CG   . ASP A 1 393 ? 3.163   11.984  19.654  0.04 12.82 ? 449  ASP A CG   1  
ATOM   5745   O OD1  . ASP A 1 393 ? 3.471   10.814  19.289  0.04 12.58 ? 449  ASP A OD1  1  
ATOM   5746   O OD2  . ASP A 1 393 ? 2.800   12.893  18.859  0.04 13.02 ? 449  ASP A OD2  1  
ATOM   5747   H H    . ASP A 1 393 ? 1.848   10.089  20.819  0.04 12.67 ? 449  ASP A H    1  
ATOM   5748   H HA   . ASP A 1 393 ? 2.044   11.984  22.775  0.04 13.05 ? 449  ASP A HA   1  
ATOM   5749   H HB2  . ASP A 1 393 ? 3.299   13.223  21.247  0.04 13.06 ? 449  ASP A HB2  1  
ATOM   5750   H HB3  . ASP A 1 393 ? 3.976   11.819  21.512  0.04 12.74 ? 449  ASP A HB3  1  
ATOM   5751   N N    . HIS A 1 394 ? -0.139  11.879  20.606  0.04 13.27 ? 450  HIS A N    1  
ATOM   5752   C CA   . HIS A 1 394 ? -1.305  12.488  19.989  0.04 13.56 ? 450  HIS A CA   1  
ATOM   5753   C C    . HIS A 1 394 ? -2.429  11.468  19.828  0.04 13.57 ? 450  HIS A C    1  
ATOM   5754   O O    . HIS A 1 394 ? -2.210  10.257  19.923  0.04 13.33 ? 450  HIS A O    1  
ATOM   5755   C CB   . HIS A 1 394 ? -0.909  13.149  18.635  0.04 13.59 ? 450  HIS A CB   1  
ATOM   5756   C CG   . HIS A 1 394 ? -0.475  12.169  17.582  0.04 13.33 ? 450  HIS A CG   1  
ATOM   5757   N ND1  . HIS A 1 394 ? 0.845   11.779  17.419  0.04 13.06 ? 450  HIS A ND1  1  
ATOM   5758   C CD2  . HIS A 1 394 ? -1.186  11.493  16.652  0.04 13.35 ? 450  HIS A CD2  1  
ATOM   5759   C CE1  . HIS A 1 394 ? 0.911   10.873  16.448  0.04 12.90 ? 450  HIS A CE1  1  
ATOM   5760   N NE2  . HIS A 1 394 ? -0.307  10.684  15.966  0.04 13.07 ? 450  HIS A NE2  1  
ATOM   5761   H H    . HIS A 1 394 ? -0.096  11.031  20.495  0.04 13.11 ? 450  HIS A H    1  
ATOM   5762   H HA   . HIS A 1 394 ? -1.649  13.190  20.572  0.04 13.77 ? 450  HIS A HA   1  
ATOM   5763   H HB2  . HIS A 1 394 ? -1.673  13.633  18.293  0.04 13.82 ? 450  HIS A HB2  1  
ATOM   5764   H HB3  . HIS A 1 394 ? -0.178  13.762  18.795  0.04 13.60 ? 450  HIS A HB3  1  
ATOM   5765   H HD2  . HIS A 1 394 ? -2.106  11.547  16.519  0.04 13.53 ? 450  HIS A HD2  1  
ATOM   5766   H HE1  . HIS A 1 394 ? 1.682   10.459  16.140  0.04 12.73 ? 450  HIS A HE1  1  
ATOM   5767   N N    . GLY A 1 395 ? -3.650  11.953  19.629  0.04 13.89 ? 451  GLY A N    1  
ATOM   5768   C CA   . GLY A 1 395 ? -4.805  11.091  19.662  0.04 14.00 ? 451  GLY A CA   1  
ATOM   5769   C C    . GLY A 1 395 ? -5.656  11.431  20.860  0.04 14.24 ? 451  GLY A C    1  
ATOM   5770   O O    . GLY A 1 395 ? -5.485  12.479  21.517  0.04 14.36 ? 451  GLY A O    1  
ATOM   5771   H H    . GLY A 1 395 ? -3.831  12.781  19.490  0.04 14.08 ? 451  GLY A H    1  
ATOM   5772   H HA2  . GLY A 1 395 ? -5.328  11.196  18.852  0.04 14.17 ? 451  GLY A HA2  1  
ATOM   5773   H HA3  . GLY A 1 395 ? -4.538  10.165  19.736  0.04 13.80 ? 451  GLY A HA3  1  
ATOM   5774   N N    . GLU A 1 396 ? -6.567  10.520  21.186  0.04 14.31 ? 452  GLU A N    1  
ATOM   5775   C CA   . GLU A 1 396 ? -7.402  10.708  22.371  0.04 14.60 ? 452  GLU A CA   1  
ATOM   5776   C C    . GLU A 1 396 ? -6.859  9.794   23.455  0.04 14.44 ? 452  GLU A C    1  
ATOM   5777   O O    . GLU A 1 396 ? -6.300  8.751   23.157  0.04 14.13 ? 452  GLU A O    1  
ATOM   5778   C CB   . GLU A 1 396 ? -8.881  10.416  22.058  0.04 14.83 ? 452  GLU A CB   1  
ATOM   5779   C CG   . GLU A 1 396 ? -9.514  11.473  21.129  0.04 15.23 ? 452  GLU A CG   1  
ATOM   5780   C CD   . GLU A 1 396 ? -9.835  12.754  21.826  0.04 15.57 ? 452  GLU A CD   1  
ATOM   5781   O OE1  . GLU A 1 396 ? -10.844 12.770  22.549  0.04 15.60 ? 452  GLU A OE1  1  
ATOM   5782   O OE2  . GLU A 1 396 ? -9.107  13.740  21.641  0.04 15.82 ? 452  GLU A OE2  1  
ATOM   5783   H H    . GLU A 1 396 ? -6.722  9.798   20.751  0.04 14.20 ? 452  GLU A H    1  
ATOM   5784   H HA   . GLU A 1 396 ? -7.347  11.620  22.684  0.04 14.81 ? 452  GLU A HA   1  
ATOM   5785   H HB2  . GLU A 1 396 ? -8.928  9.560   21.602  0.04 14.65 ? 452  GLU A HB2  1  
ATOM   5786   H HB3  . GLU A 1 396 ? -9.394  10.371  22.879  0.04 14.93 ? 452  GLU A HB3  1  
ATOM   5787   H HG2  . GLU A 1 396 ? -8.892  11.668  20.420  0.04 15.16 ? 452  GLU A HG2  1  
ATOM   5788   H HG3  . GLU A 1 396 ? -10.334 11.121  20.736  0.04 15.39 ? 452  GLU A HG3  1  
ATOM   5789   N N    . GLY A 1 397 ? -7.047  10.157  24.718  0.04 14.68 ? 453  GLY A N    1  
ATOM   5790   C CA   . GLY A 1 397 ? -6.363  9.435   25.792  0.04 14.60 ? 453  GLY A CA   1  
ATOM   5791   C C    . GLY A 1 397 ? -4.835  9.543   25.731  0.04 14.30 ? 453  GLY A C    1  
ATOM   5792   O O    . GLY A 1 397 ? -4.149  8.521   25.826  0.04 14.10 ? 453  GLY A O    1  
ATOM   5793   H H    . GLY A 1 397 ? -7.552  10.797  24.976  0.04 14.91 ? 453  GLY A H    1  
ATOM   5794   H HA2  . GLY A 1 397 ? -6.659  9.791   26.647  0.04 14.86 ? 453  GLY A HA2  1  
ATOM   5795   H HA3  . GLY A 1 397 ? -6.606  8.495   25.752  0.04 14.53 ? 453  GLY A HA3  1  
ATOM   5796   N N    . VAL A 1 398 ? -4.322  10.765  25.526  0.04 14.33 ? 454  VAL A N    1  
ATOM   5797   C CA   . VAL A 1 398 ? -2.916  11.137  25.740  0.04 14.09 ? 454  VAL A CA   1  
ATOM   5798   C C    . VAL A 1 398 ? -2.816  12.263  26.796  0.04 14.34 ? 454  VAL A C    1  
ATOM   5799   O O    . VAL A 1 398 ? -3.642  13.197  26.831  0.04 14.68 ? 454  VAL A O    1  
ATOM   5800   C CB   . VAL A 1 398 ? -2.207  11.602  24.409  0.04 13.90 ? 454  VAL A CB   1  
ATOM   5801   C CG1  . VAL A 1 398 ? -0.645  11.796  24.554  0.04 13.68 ? 454  VAL A CG1  1  
ATOM   5802   C CG2  . VAL A 1 398 ? -2.515  10.606  23.253  0.04 13.70 ? 454  VAL A CG2  1  
ATOM   5803   H H    . VAL A 1 398 ? -4.797  11.422  25.239  0.04 14.51 ? 454  VAL A H    1  
ATOM   5804   H HA   . VAL A 1 398 ? -2.441  10.366  26.076  0.04 13.92 ? 454  VAL A HA   1  
ATOM   5805   H HB   . VAL A 1 398 ? -2.577  12.461  24.148  0.04 14.08 ? 454  VAL A HB   1  
ATOM   5806   H HG11 . VAL A 1 398 ? -0.324  12.240  23.753  0.04 13.57 ? 454  VAL A HG11 1  
ATOM   5807   H HG12 . VAL A 1 398 ? -0.469  12.352  25.333  0.04 13.83 ? 454  VAL A HG12 1  
ATOM   5808   H HG13 . VAL A 1 398 ? -0.211  10.934  24.648  0.04 13.52 ? 454  VAL A HG13 1  
ATOM   5809   H HG21 . VAL A 1 398 ? -1.749  10.570  22.660  0.04 13.56 ? 454  VAL A HG21 1  
ATOM   5810   H HG22 . VAL A 1 398 ? -2.688  9.730   23.634  0.04 13.56 ? 454  VAL A HG22 1  
ATOM   5811   H HG23 . VAL A 1 398 ? -3.295  10.910  22.767  0.04 13.88 ? 454  VAL A HG23 1  
ATOM   5812   N N    . GLY A 1 399 ? -1.852  12.113  27.702  0.04 14.20 ? 455  GLY A N    1  
ATOM   5813   C CA   . GLY A 1 399 ? -1.581  13.099  28.726  0.04 14.45 ? 455  GLY A CA   1  
ATOM   5814   C C    . GLY A 1 399 ? -0.618  12.480  29.689  0.04 14.30 ? 455  GLY A C    1  
ATOM   5815   O O    . GLY A 1 399 ? -0.540  11.240  29.801  0.04 14.07 ? 455  GLY A O    1  
ATOM   5816   H H    . GLY A 1 399 ? -1.325  11.436  27.742  0.04 13.98 ? 455  GLY A H    1  
ATOM   5817   H HA2  . GLY A 1 399 ? -1.178  13.892  28.342  0.04 14.50 ? 455  GLY A HA2  1  
ATOM   5818   H HA3  . GLY A 1 399 ? -2.401  13.336  29.192  0.04 14.70 ? 455  GLY A HA3  1  
ATOM   5819   N N    . TRP A 1 400 ? 0.116   13.329  30.402  0.04 14.48 ? 456  TRP A N    1  
ATOM   5820   C CA   . TRP A 1 400 ? 1.146   12.875  31.302  0.04 14.38 ? 456  TRP A CA   1  
ATOM   5821   C C    . TRP A 1 400 ? 0.675   11.743  32.249  0.04 14.46 ? 456  TRP A C    1  
ATOM   5822   O O    . TRP A 1 400 ? 1.367   10.739  32.375  0.04 14.30 ? 456  TRP A O    1  
ATOM   5823   C CB   . TRP A 1 400 ? 1.669   14.067  32.099  0.04 14.64 ? 456  TRP A CB   1  
ATOM   5824   C CG   . TRP A 1 400 ? 2.903   13.770  32.892  0.04 14.60 ? 456  TRP A CG   1  
ATOM   5825   C CD1  . TRP A 1 400 ? 3.003   13.788  34.240  0.04 14.88 ? 456  TRP A CD1  1  
ATOM   5826   C CD2  . TRP A 1 400 ? 4.205   13.395  32.401  0.04 14.31 ? 456  TRP A CD2  1  
ATOM   5827   N NE1  . TRP A 1 400 ? 4.270   13.456  34.635  0.04 14.80 ? 456  TRP A NE1  1  
ATOM   5828   C CE2  . TRP A 1 400 ? 5.036   13.212  33.533  0.04 14.45 ? 456  TRP A CE2  1  
ATOM   5829   C CE3  . TRP A 1 400 ? 4.750   13.216  31.134  0.04 14.00 ? 456  TRP A CE3  1  
ATOM   5830   C CZ2  . TRP A 1 400 ? 6.381   12.831  33.432  0.04 14.28 ? 456  TRP A CZ2  1  
ATOM   5831   C CZ3  . TRP A 1 400 ? 6.084   12.854  31.036  0.04 13.82 ? 456  TRP A CZ3  1  
ATOM   5832   C CH2  . TRP A 1 400 ? 6.884   12.661  32.176  0.04 13.97 ? 456  TRP A CH2  1  
ATOM   5833   H H    . TRP A 1 400 ? 0.038   14.184  30.366  0.04 14.69 ? 456  TRP A H    1  
ATOM   5834   H HA   . TRP A 1 400 ? 1.884   12.532  30.775  0.04 14.13 ? 456  TRP A HA   1  
ATOM   5835   H HB2  . TRP A 1 400 ? 1.869   14.792  31.484  0.04 14.62 ? 456  TRP A HB2  1  
ATOM   5836   H HB3  . TRP A 1 400 ? 0.974   14.336  32.717  0.04 14.90 ? 456  TRP A HB3  1  
ATOM   5837   H HD1  . TRP A 1 400 ? 2.308   13.992  34.822  0.04 15.12 ? 456  TRP A HD1  1  
ATOM   5838   H HE1  . TRP A 1 400 ? 4.537   13.405  35.451  0.04 14.95 ? 456  TRP A HE1  1  
ATOM   5839   H HE3  . TRP A 1 400 ? 4.233   13.329  30.369  0.04 13.92 ? 456  TRP A HE3  1  
ATOM   5840   H HZ2  . TRP A 1 400 ? 6.913   12.715  34.185  0.04 14.40 ? 456  TRP A HZ2  1  
ATOM   5841   H HZ3  . TRP A 1 400 ? 6.459   12.717  30.195  0.04 13.63 ? 456  TRP A HZ3  1  
ATOM   5842   H HH2  . TRP A 1 400 ? 7.778   12.419  32.073  0.04 13.87 ? 456  TRP A HH2  1  
ATOM   5843   N N    . GLU A 1 401 ? -0.517  11.871  32.859  0.04 14.75 ? 457  GLU A N    1  
ATOM   5844   C CA   . GLU A 1 401 ? -1.183  10.744  33.566  0.04 14.88 ? 457  GLU A CA   1  
ATOM   5845   C C    . GLU A 1 401 ? -2.101  9.848   32.674  0.04 14.71 ? 457  GLU A C    1  
ATOM   5846   O O    . GLU A 1 401 ? -2.165  8.617   32.830  0.04 14.59 ? 457  GLU A O    1  
ATOM   5847   C CB   . GLU A 1 401 ? -2.063  11.198  34.752  0.04 15.35 ? 457  GLU A CB   1  
ATOM   5848   C CG   . GLU A 1 401 ? -2.986  9.989   35.144  0.04 15.61 ? 457  GLU A CG   1  
ATOM   5849   C CD   . GLU A 1 401 ? -3.676  10.088  36.460  0.04 16.09 ? 457  GLU A CD   1  
ATOM   5850   O OE1  . GLU A 1 401 ? -4.900  9.766   36.481  0.04 16.25 ? 457  GLU A OE1  1  
ATOM   5851   O OE2  . GLU A 1 401 ? -3.030  10.541  37.456  0.04 16.34 ? 457  GLU A OE2  1  
ATOM   5852   H H    . GLU A 1 401 ? -0.972  12.598  32.872  0.04 14.91 ? 457  GLU A H    1  
ATOM   5853   H HA   . GLU A 1 401 ? -0.490  10.180  33.939  0.04 14.79 ? 457  GLU A HA   1  
ATOM   5854   H HB2  . GLU A 1 401 ? -1.508  11.459  35.506  0.04 15.44 ? 457  GLU A HB2  1  
ATOM   5855   H HB3  . GLU A 1 401 ? -2.619  11.939  34.472  0.04 15.46 ? 457  GLU A HB3  1  
ATOM   5856   H HG2  . GLU A 1 401 ? -3.701  9.898   34.489  0.04 15.64 ? 457  GLU A HG2  1  
ATOM   5857   H HG3  . GLU A 1 401 ? -2.451  9.185   35.167  0.04 15.44 ? 457  GLU A HG3  1  
ATOM   5858   N N    . THR A 1 402 ? -2.854  10.485  31.801  0.04 14.73 ? 458  THR A N    1  
ATOM   5859   C CA   . THR A 1 402 ? -3.902  9.834   31.032  0.04 14.71 ? 458  THR A CA   1  
ATOM   5860   C C    . THR A 1 402 ? -3.370  8.582   30.308  0.04 14.33 ? 458  THR A C    1  
ATOM   5861   O O    . THR A 1 402 ? -4.031  7.548   30.328  0.04 14.35 ? 458  THR A O    1  
ATOM   5862   C CB   . THR A 1 402 ? -4.590  10.866  30.112  0.04 14.90 ? 458  THR A CB   1  
ATOM   5863   O OG1  . THR A 1 402 ? -5.295  11.830  30.930  0.04 15.34 ? 458  THR A OG1  1  
ATOM   5864   C CG2  . THR A 1 402 ? -5.575  10.229  29.139  0.04 14.83 ? 458  THR A CG2  1  
ATOM   5865   H H    . THR A 1 402 ? -2.783  11.328  31.636  0.04 14.77 ? 458  THR A H    1  
ATOM   5866   H HA   . THR A 1 402 ? -4.581  9.523   31.650  0.04 14.89 ? 458  THR A HA   1  
ATOM   5867   H HB   . THR A 1 402 ? -3.906  11.321  29.597  0.04 14.82 ? 458  THR A HB   1  
ATOM   5868   H HG1  . THR A 1 402 ? -4.754  12.242  31.418  0.04 15.41 ? 458  THR A HG1  1  
ATOM   5869   H HG21 . THR A 1 402 ? -6.000  10.927  28.615  0.04 14.62 ? 458  THR A HG21 1  
ATOM   5870   H HG22 . THR A 1 402 ? -5.117  9.625   28.538  0.04 14.79 ? 458  THR A HG22 1  
ATOM   5871   H HG23 . THR A 1 402 ? -6.257  9.740   29.625  0.04 15.09 ? 458  THR A HG23 1  
ATOM   5872   N N    . ASN A 1 403 ? -2.168  8.660   29.742  0.04 14.04 ? 459  ASN A N    1  
ATOM   5873   C CA   . ASN A 1 403 ? -1.529  7.470   29.164  0.04 13.70 ? 459  ASN A CA   1  
ATOM   5874   C C    . ASN A 1 403 ? -0.113  7.294   29.694  0.04 13.52 ? 459  ASN A C    1  
ATOM   5875   O O    . ASN A 1 403 ? 0.829   6.995   28.961  0.04 13.25 ? 459  ASN A O    1  
ATOM   5876   C CB   . ASN A 1 403 ? -1.598  7.429   27.627  0.04 13.52 ? 459  ASN A CB   1  
ATOM   5877   C CG   . ASN A 1 403 ? -0.723  8.459   26.948  0.04 13.37 ? 459  ASN A CG   1  
ATOM   5878   O OD1  . ASN A 1 403 ? -0.555  9.580   27.438  0.04 13.50 ? 459  ASN A OD1  1  
ATOM   5879   N ND2  . ASN A 1 403 ? -0.187  8.089   25.797  0.04 13.13 ? 459  ASN A ND2  1  
ATOM   5880   H H    . ASN A 1 403 ? -1.693  9.371   29.698  0.04 14.04 ? 459  ASN A H    1  
ATOM   5881   H HA   . ASN A 1 403 ? -2.020  6.697   29.472  0.04 13.75 ? 459  ASN A HA   1  
ATOM   5882   H HB2  . ASN A 1 403 ? -1.337  6.552   27.319  0.04 13.36 ? 459  ASN A HB2  1  
ATOM   5883   H HB3  . ASN A 1 403 ? -2.513  7.611   27.365  0.04 13.68 ? 459  ASN A HB3  1  
ATOM   5884   H HD21 . ASN A 1 403 ? 0.636   8.268   25.632  0.04 13.00 ? 459  ASN A HD21 1  
ATOM   5885   H HD22 . ASN A 1 403 ? -0.657  7.661   25.220  0.04 13.11 ? 459  ASN A HD22 1  
ATOM   5886   N N    . ARG A 1 404 ? 0.028   7.421   31.004  0.04 13.72 ? 460  ARG A N    1  
ATOM   5887   C CA   . ARG A 1 404 ? 1.323   7.202   31.633  0.04 13.63 ? 460  ARG A CA   1  
ATOM   5888   C C    . ARG A 1 404 ? 1.868   5.832   31.281  0.04 13.39 ? 460  ARG A C    1  
ATOM   5889   O O    . ARG A 1 404 ? 1.174   4.817   31.361  0.04 13.43 ? 460  ARG A O    1  
ATOM   5890   C CB   . ARG A 1 404 ? 1.245   7.326   33.158  0.04 13.93 ? 460  ARG A CB   1  
ATOM   5891   C CG   . ARG A 1 404 ? 2.612   7.205   33.857  0.04 13.90 ? 460  ARG A CG   1  
ATOM   5892   C CD   . ARG A 1 404 ? 2.488   6.811   35.347  0.04 14.25 ? 460  ARG A CD   1  
ATOM   5893   N NE   . ARG A 1 404 ? 3.721   6.773   36.142  0.04 14.32 ? 460  ARG A NE   1  
ATOM   5894   C CZ   . ARG A 1 404 ? 3.776   6.794   37.488  0.04 14.54 ? 460  ARG A CZ   1  
ATOM   5895   N NH1  . ARG A 1 404 ? 4.961   6.722   38.154  0.04 14.62 ? 460  ARG A NH1  1  
ATOM   5896   N NH2  . ARG A 1 404 ? 2.659   6.907   38.206  0.04 14.71 ? 460  ARG A NH2  1  
ATOM   5897   H H    . ARG A 1 404 ? -0.601  7.626   31.547  0.04 13.93 ? 460  ARG A H    1  
ATOM   5898   H HA   . ARG A 1 404 ? 1.948   7.868   31.306  0.04 13.55 ? 460  ARG A HA   1  
ATOM   5899   H HB2  . ARG A 1 404 ? 0.889   8.198   33.381  0.04 14.08 ? 460  ARG A HB2  1  
ATOM   5900   H HB3  . ARG A 1 404 ? 0.662   6.627   33.496  0.04 14.05 ? 460  ARG A HB3  1  
ATOM   5901   H HG2  . ARG A 1 404 ? 3.158   6.539   33.414  0.04 13.83 ? 460  ARG A HG2  1  
ATOM   5902   H HG3  . ARG A 1 404 ? 3.052   8.069   33.806  0.04 13.76 ? 460  ARG A HG3  1  
ATOM   5903   H HD2  . ARG A 1 404 ? 1.848   7.394   35.790  0.04 14.35 ? 460  ARG A HD2  1  
ATOM   5904   H HD3  . ARG A 1 404 ? 2.149   5.902   35.357  0.04 14.41 ? 460  ARG A HD3  1  
ATOM   5905   H HE   . ARG A 1 404 ? 4.473   6.830   35.719  0.04 14.21 ? 460  ARG A HE   1  
ATOM   5906   H HH11 . ARG A 1 404 ? 5.699   6.659   37.721  0.04 14.53 ? 460  ARG A HH11 1  
ATOM   5907   H HH12 . ARG A 1 404 ? 4.977   6.753   39.011  0.04 14.78 ? 460  ARG A HH12 1  
ATOM   5908   H HH21 . ARG A 1 404 ? 1.889   6.946   37.827  0.04 14.69 ? 460  ARG A HH21 1  
ATOM   5909   H HH22 . ARG A 1 404 ? 2.715   6.924   39.064  0.04 14.88 ? 460  ARG A HH22 1  
ATOM   5910   N N    . ALA A 1 405 ? 3.141   5.820   30.899  0.04 13.18 ? 461  ALA A N    1  
ATOM   5911   C CA   . ALA A 1 405 ? 3.876   4.576   30.673  0.04 12.99 ? 461  ALA A CA   1  
ATOM   5912   C C    . ALA A 1 405 ? 5.328   4.852   31.025  0.04 12.94 ? 461  ALA A C    1  
ATOM   5913   O O    . ALA A 1 405 ? 6.012   5.572   30.292  0.04 12.81 ? 461  ALA A O    1  
ATOM   5914   C CB   . ALA A 1 405 ? 3.728   4.090   29.205  0.04 12.74 ? 461  ALA A CB   1  
ATOM   5915   H H    . ALA A 1 405 ? 3.607   6.525   30.775  0.04 13.16 ? 461  ALA A H    1  
ATOM   5916   H HA   . ALA A 1 405 ? 3.530   3.907   31.278  0.04 13.10 ? 461  ALA A HA   1  
ATOM   5917   H HB1  . ALA A 1 405 ? 4.234   3.272   29.098  0.04 12.64 ? 461  ALA A HB1  1  
ATOM   5918   H HB2  . ALA A 1 405 ? 2.795   3.923   29.017  0.04 12.81 ? 461  ALA A HB2  1  
ATOM   5919   H HB3  . ALA A 1 405 ? 4.077   4.766   28.606  0.04 12.66 ? 461  ALA A HB3  1  
ATOM   5920   N N    . ASP A 1 406 ? 5.791   4.347   32.158  0.04 13.10 ? 462  ASP A N    1  
ATOM   5921   C CA   . ASP A 1 406 ? 7.079   4.761   32.661  0.04 13.14 ? 462  ASP A CA   1  
ATOM   5922   C C    . ASP A 1 406 ? 8.223   4.229   31.828  0.04 12.91 ? 462  ASP A C    1  
ATOM   5923   O O    . ASP A 1 406 ? 9.153   4.961   31.528  0.04 12.88 ? 462  ASP A O    1  
ATOM   5924   C CB   . ASP A 1 406 ? 7.278   4.380   34.140  0.04 13.42 ? 462  ASP A CB   1  
ATOM   5925   C CG   . ASP A 1 406 ? 6.558   5.334   35.134  0.04 13.71 ? 462  ASP A CG   1  
ATOM   5926   O OD1  . ASP A 1 406 ? 6.190   6.466   34.753  0.04 13.71 ? 462  ASP A OD1  1  
ATOM   5927   O OD2  . ASP A 1 406 ? 6.481   4.923   36.341  0.04 13.99 ? 462  ASP A OD2  1  
ATOM   5928   H H    . ASP A 1 406 ? 5.384   3.768   32.640  0.04 13.20 ? 462  ASP A H    1  
ATOM   5929   H HA   . ASP A 1 406 ? 7.122   5.731   32.619  0.04 13.18 ? 462  ASP A HA   1  
ATOM   5930   H HB2  . ASP A 1 406 ? 6.962   3.475   34.293  0.04 13.44 ? 462  ASP A HB2  1  
ATOM   5931   H HB3  . ASP A 1 406 ? 8.231   4.438   34.319  0.04 13.44 ? 462  ASP A HB3  1  
ATOM   5932   N N    . TYR A 1 407 ? 8.204   2.940   31.472  0.04 12.80 ? 463  TYR A N    1  
ATOM   5933   C CA   . TYR A 1 407 ? 9.391   2.258   30.919  0.04 12.66 ? 463  TYR A CA   1  
ATOM   5934   C C    . TYR A 1 407 ? 9.017   1.574   29.594  0.04 12.43 ? 463  TYR A C    1  
ATOM   5935   O O    . TYR A 1 407 ? 7.982   0.897   29.505  0.04 12.45 ? 463  TYR A O    1  
ATOM   5936   C CB   . TYR A 1 407 ? 9.900   1.215   31.928  0.04 12.83 ? 463  TYR A CB   1  
ATOM   5937   C CG   . TYR A 1 407 ? 10.274  1.812   33.264  0.04 13.11 ? 463  TYR A CG   1  
ATOM   5938   C CD1  . TYR A 1 407 ? 11.546  2.311   33.481  0.04 13.18 ? 463  TYR A CD1  1  
ATOM   5939   C CD2  . TYR A 1 407 ? 9.359   1.876   34.301  0.04 13.34 ? 463  TYR A CD2  1  
ATOM   5940   C CE1  . TYR A 1 407 ? 11.916  2.881   34.694  0.04 13.48 ? 463  TYR A CE1  1  
ATOM   5941   C CE2  . TYR A 1 407 ? 9.733   2.427   35.569  0.04 13.63 ? 463  TYR A CE2  1  
ATOM   5942   C CZ   . TYR A 1 407 ? 11.007  2.951   35.726  0.04 13.70 ? 463  TYR A CZ   1  
ATOM   5943   O OH   . TYR A 1 407 ? 11.372  3.481   36.958  0.04 14.03 ? 463  TYR A OH   1  
ATOM   5944   H H    . TYR A 1 407 ? 7.516   2.435   31.535  0.04 12.82 ? 463  TYR A H    1  
ATOM   5945   H HA   . TYR A 1 407 ? 10.095  2.894   30.747  0.04 12.63 ? 463  TYR A HA   1  
ATOM   5946   H HB2  . TYR A 1 407 ? 9.181   0.583   32.083  0.04 12.85 ? 463  TYR A HB2  1  
ATOM   5947   H HB3  . TYR A 1 407 ? 10.674  0.759   31.567  0.04 12.77 ? 463  TYR A HB3  1  
ATOM   5948   H HD1  . TYR A 1 407 ? 12.167  2.284   32.786  0.04 13.05 ? 463  TYR A HD1  1  
ATOM   5949   H HD2  . TYR A 1 407 ? 8.503   1.538   34.184  0.04 13.32 ? 463  TYR A HD2  1  
ATOM   5950   H HE1  . TYR A 1 407 ? 12.779  3.206   34.809  0.04 13.54 ? 463  TYR A HE1  1  
ATOM   5951   H HE2  . TYR A 1 407 ? 9.121   2.483   36.267  0.04 13.81 ? 463  TYR A HE2  1  
ATOM   5952   H HH   . TYR A 1 407 ? 10.729  3.428   37.493  0.04 14.14 ? 463  TYR A HH   1  
ATOM   5953   N N    . GLY A 1 408 ? 9.854   1.749   28.582  0.04 12.26 ? 464  GLY A N    1  
ATOM   5954   C CA   . GLY A 1 408 ? 9.544   1.155   27.279  0.04 12.08 ? 464  GLY A CA   1  
ATOM   5955   C C    . GLY A 1 408 ? 10.006  -0.278  27.123  0.04 12.07 ? 464  GLY A C    1  
ATOM   5956   O O    . GLY A 1 408 ? 9.209   -1.186  27.074  0.04 12.11 ? 464  GLY A O    1  
ATOM   5957   H H    . GLY A 1 408 ? 10.585  2.187   28.620  0.04 12.28 ? 464  GLY A H    1  
ATOM   5958   H HA2  . GLY A 1 408 ? 8.583   1.172   27.147  0.04 12.07 ? 464  GLY A HA2  1  
ATOM   5959   H HA3  . GLY A 1 408 ? 9.960   1.681   26.578  0.04 11.98 ? 464  GLY A HA3  1  
ATOM   5960   N N    . VAL A 1 409 ? 11.326  -0.462  27.075  0.04 12.06 ? 465  VAL A N    1  
ATOM   5961   C CA   . VAL A 1 409 ? 11.971  -1.775  26.950  0.04 12.09 ? 465  VAL A CA   1  
ATOM   5962   C C    . VAL A 1 409 ? 12.981  -1.918  28.048  0.04 12.29 ? 465  VAL A C    1  
ATOM   5963   O O    . VAL A 1 409 ? 13.788  -1.008  28.292  0.04 12.34 ? 465  VAL A O    1  
ATOM   5964   C CB   . VAL A 1 409 ? 12.697  -1.916  25.581  0.04 11.94 ? 465  VAL A CB   1  
ATOM   5965   C CG1  . VAL A 1 409 ? 13.412  -3.249  25.462  0.04 12.01 ? 465  VAL A CG1  1  
ATOM   5966   C CG2  . VAL A 1 409 ? 11.725  -1.708  24.430  0.04 11.77 ? 465  VAL A CG2  1  
ATOM   5967   H H    . VAL A 1 409 ? 11.889  0.183   27.117  0.04 12.05 ? 465  VAL A H    1  
ATOM   5968   H HA   . VAL A 1 409 ? 11.307  -2.470  27.023  0.04 12.12 ? 465  VAL A HA   1  
ATOM   5969   H HB   . VAL A 1 409 ? 13.370  -1.223  25.507  0.04 11.93 ? 465  VAL A HB   1  
ATOM   5970   H HG11 . VAL A 1 409 ? 14.006  -3.214  24.696  0.04 11.95 ? 465  VAL A HG11 1  
ATOM   5971   H HG12 . VAL A 1 409 ? 13.931  -3.427  26.261  0.04 12.15 ? 465  VAL A HG12 1  
ATOM   5972   H HG13 . VAL A 1 409 ? 12.759  -3.952  25.323  0.04 12.01 ? 465  VAL A HG13 1  
ATOM   5973   H HG21 . VAL A 1 409 ? 12.200  -1.817  23.592  0.04 11.70 ? 465  VAL A HG21 1  
ATOM   5974   H HG22 . VAL A 1 409 ? 11.013  -2.368  24.482  0.04 11.79 ? 465  VAL A HG22 1  
ATOM   5975   H HG23 . VAL A 1 409 ? 11.362  -0.811  24.483  0.04 11.75 ? 465  VAL A HG23 1  
ATOM   5976   N N    . HIS A 1 410 ? 12.947  -3.066  28.710  0.04 12.45 ? 466  HIS A N    1  
ATOM   5977   C CA   . HIS A 1 410 ? 13.941  -3.443  29.681  0.04 12.70 ? 466  HIS A CA   1  
ATOM   5978   C C    . HIS A 1 410 ? 14.548  -4.741  29.165  0.04 12.78 ? 466  HIS A C    1  
ATOM   5979   O O    . HIS A 1 410 ? 13.839  -5.749  29.010  0.04 12.86 ? 466  HIS A O    1  
ATOM   5980   C CB   . HIS A 1 410 ? 13.296  -3.634  31.042  0.04 12.90 ? 466  HIS A CB   1  
ATOM   5981   C CG   . HIS A 1 410 ? 14.241  -3.475  32.178  0.04 13.18 ? 466  HIS A CG   1  
ATOM   5982   N ND1  . HIS A 1 410 ? 13.836  -3.042  33.415  0.04 13.40 ? 466  HIS A ND1  1  
ATOM   5983   C CD2  . HIS A 1 410 ? 15.588  -3.601  32.245  0.04 13.32 ? 466  HIS A CD2  1  
ATOM   5984   C CE1  . HIS A 1 410 ? 14.879  -2.982  34.226  0.04 13.66 ? 466  HIS A CE1  1  
ATOM   5985   N NE2  . HIS A 1 410 ? 15.963  -3.294  33.537  0.04 13.62 ? 466  HIS A NE2  1  
ATOM   5986   H H    . HIS A 1 410 ? 12.339  -3.662  28.605  0.04 12.44 ? 466  HIS A H    1  
ATOM   5987   H HA   . HIS A 1 410 ? 14.641  -2.777  29.737  0.04 12.71 ? 466  HIS A HA   1  
ATOM   5988   H HB2  . HIS A 1 410 ? 12.583  -2.988  31.161  0.04 12.84 ? 466  HIS A HB2  1  
ATOM   5989   H HB3  . HIS A 1 410 ? 12.932  -4.535  31.084  0.04 12.95 ? 466  HIS A HB3  1  
ATOM   5990   H HD2  . HIS A 1 410 ? 16.153  -3.866  31.556  0.04 13.25 ? 466  HIS A HD2  1  
ATOM   5991   H HE1  . HIS A 1 410 ? 14.863  -2.729  35.118  0.04 13.85 ? 466  HIS A HE1  1  
ATOM   5992   N N    . VAL A 1 411 ? 15.851  -4.717  28.876  0.04 12.82 ? 467  VAL A N    1  
ATOM   5993   C CA   . VAL A 1 411 ? 16.549  -5.911  28.406  0.04 12.94 ? 467  VAL A CA   1  
ATOM   5994   C C    . VAL A 1 411 ? 17.358  -6.439  29.589  0.04 13.29 ? 467  VAL A C    1  
ATOM   5995   O O    . VAL A 1 411 ? 18.299  -5.807  30.054  0.04 13.42 ? 467  VAL A O    1  
ATOM   5996   C CB   . VAL A 1 411 ? 17.498  -5.612  27.226  0.04 12.83 ? 467  VAL A CB   1  
ATOM   5997   C CG1  . VAL A 1 411 ? 18.280  -6.890  26.912  0.04 12.98 ? 467  VAL A CG1  1  
ATOM   5998   C CG2  . VAL A 1 411 ? 16.773  -5.128  25.947  0.04 12.52 ? 467  VAL A CG2  1  
ATOM   5999   H H    . VAL A 1 411 ? 16.356  -4.031  28.952  0.04 12.79 ? 467  VAL A H    1  
ATOM   6000   H HA   . VAL A 1 411 ? 15.919  -6.588  28.129  0.04 12.92 ? 467  VAL A HA   1  
ATOM   6001   H HB   . VAL A 1 411 ? 18.115  -4.916  27.494  0.04 12.89 ? 467  VAL A HB   1  
ATOM   6002   H HG11 . VAL A 1 411 ? 18.814  -6.734  26.116  0.04 12.99 ? 467  VAL A HG11 1  
ATOM   6003   H HG12 . VAL A 1 411 ? 18.860  -7.124  27.652  0.04 13.19 ? 467  VAL A HG12 1  
ATOM   6004   H HG13 . VAL A 1 411 ? 17.648  -7.605  26.748  0.04 12.88 ? 467  VAL A HG13 1  
ATOM   6005   H HG21 . VAL A 1 411 ? 17.433  -4.967  25.255  0.04 12.47 ? 467  VAL A HG21 1  
ATOM   6006   H HG22 . VAL A 1 411 ? 16.150  -5.807  25.649  0.04 12.47 ? 467  VAL A HG22 1  
ATOM   6007   H HG23 . VAL A 1 411 ? 16.302  -4.300  26.140  0.04 12.45 ? 467  VAL A HG23 1  
ATOM   6008   N N    . LYS A 1 412 ? 16.995  -7.620  30.087  0.04 13.49 ? 468  LYS A N    1  
ATOM   6009   C CA   . LYS A 1 412 ? 17.737  -8.238  31.198  0.04 13.88 ? 468  LYS A CA   1  
ATOM   6010   C C    . LYS A 1 412 ? 18.526  -9.466  30.797  0.04 14.08 ? 468  LYS A C    1  
ATOM   6011   O O    . LYS A 1 412 ? 19.467  -9.825  31.444  0.04 14.42 ? 468  LYS A O    1  
ATOM   6012   C CB   . LYS A 1 412 ? 16.789  -8.571  32.332  0.04 14.06 ? 468  LYS A CB   1  
ATOM   6013   C CG   . LYS A 1 412 ? 16.272  -7.304  32.962  0.04 14.00 ? 468  LYS A CG   1  
ATOM   6014   C CD   . LYS A 1 412 ? 14.813  -7.276  33.109  0.04 14.11 ? 468  LYS A CD   1  
ATOM   6015   C CE   . LYS A 1 412 ? 14.388  -8.076  34.298  0.04 14.55 ? 468  LYS A CE   1  
ATOM   6016   N NZ   . LYS A 1 412 ? 12.906  -8.280  34.522  0.04 14.57 ? 468  LYS A NZ   1  
ATOM   6017   H H    . LYS A 1 412 ? 16.323  -8.068  29.811  0.04 13.42 ? 468  LYS A H    1  
ATOM   6018   H HA   . LYS A 1 412 ? 18.386  -7.609  31.546  0.04 13.95 ? 468  LYS A HA   1  
ATOM   6019   H HB2  . LYS A 1 412 ? 16.040  -9.081  31.987  0.04 13.98 ? 468  LYS A HB2  1  
ATOM   6020   H HB3  . LYS A 1 412 ? 17.262  -9.080  33.007  0.04 14.34 ? 468  LYS A HB3  1  
ATOM   6021   H HG2  . LYS A 1 412 ? 16.670  -7.217  33.843  0.04 14.17 ? 468  LYS A HG2  1  
ATOM   6022   H HG3  . LYS A 1 412 ? 16.534  -6.549  32.416  0.04 13.75 ? 468  LYS A HG3  1  
ATOM   6023   H HD2  . LYS A 1 412 ? 14.526  -6.359  33.258  0.04 13.97 ? 468  LYS A HD2  1  
ATOM   6024   H HD3  . LYS A 1 412 ? 14.396  -7.640  32.310  0.04 14.05 ? 468  LYS A HD3  1  
ATOM   6025   H HE2  . LYS A 1 412 ? 14.812  -8.946  34.247  0.04 14.73 ? 468  LYS A HE2  1  
ATOM   6026   H HE3  . LYS A 1 412 ? 14.715  -7.604  35.080  0.04 14.64 ? 468  LYS A HE3  1  
ATOM   6027   H HZ1  . LYS A 1 412 ? 12.770  -9.047  34.961  0.04 14.83 ? 468  LYS A HZ1  1  
ATOM   6028   H HZ2  . LYS A 1 412 ? 12.583  -7.609  35.011  0.04 14.46 ? 468  LYS A HZ2  1  
ATOM   6029   H HZ3  . LYS A 1 412 ? 12.484  -8.316  33.742  0.04 14.44 ? 468  LYS A HZ3  1  
ATOM   6030   N N    . GLY A 1 413 ? 18.173  -10.064 29.671  0.04 13.91 ? 469  GLY A N    1  
ATOM   6031   C CA   . GLY A 1 413 ? 18.962  -11.167 29.156  0.04 14.10 ? 469  GLY A CA   1  
ATOM   6032   C C    . GLY A 1 413 ? 20.353  -10.761 28.706  0.04 14.10 ? 469  GLY A C    1  
ATOM   6033   O O    . GLY A 1 413 ? 20.641  -9.591  28.423  0.04 13.90 ? 469  GLY A O    1  
ATOM   6034   H H    . GLY A 1 413 ? 17.496  -9.838  29.185  0.04 13.70 ? 469  GLY A H    1  
ATOM   6035   H HA2  . GLY A 1 413 ? 19.037  -11.855 29.832  0.04 14.37 ? 469  GLY A HA2  1  
ATOM   6036   H HA3  . GLY A 1 413 ? 18.518  -11.539 28.381  0.04 13.97 ? 469  GLY A HA3  1  
ATOM   6037   N N    . ASP A 1 414 ? 21.193  -11.778 28.595  0.04 14.37 ? 470  ASP A N    1  
ATOM   6038   C CA   . ASP A 1 414 ? 22.559  -11.618 28.142  0.04 14.48 ? 470  ASP A CA   1  
ATOM   6039   C C    . ASP A 1 414 ? 22.612  -11.895 26.638  0.04 14.31 ? 470  ASP A C    1  
ATOM   6040   O O    . ASP A 1 414 ? 21.793  -12.644 26.110  0.04 14.25 ? 470  ASP A O    1  
ATOM   6041   C CB   . ASP A 1 414 ? 23.488  -12.550 28.967  0.04 14.99 ? 470  ASP A CB   1  
ATOM   6042   C CG   . ASP A 1 414 ? 23.313  -12.358 30.478  0.04 15.21 ? 470  ASP A CG   1  
ATOM   6043   O OD1  . ASP A 1 414 ? 23.599  -11.268 30.962  0.04 15.05 ? 470  ASP A OD1  1  
ATOM   6044   O OD2  . ASP A 1 414 ? 22.859  -13.283 31.201  0.04 15.56 ? 470  ASP A OD2  1  
ATOM   6045   H H    . ASP A 1 414 ? 20.984  -12.589 28.775  0.04 14.51 ? 470  ASP A H    1  
ATOM   6046   H HA   . ASP A 1 414 ? 22.844  -10.705 28.295  0.04 14.38 ? 470  ASP A HA   1  
ATOM   6047   H HB2  . ASP A 1 414 ? 23.297  -13.472 28.736  0.04 15.11 ? 470  ASP A HB2  1  
ATOM   6048   H HB3  . ASP A 1 414 ? 24.414  -12.353 28.758  0.04 15.09 ? 470  ASP A HB3  1  
ATOM   6049   N N    . ASN A 1 415 ? 23.578  -11.272 25.953  0.04 14.27 ? 471  ASN A N    1  
ATOM   6050   C CA   . ASN A 1 415 ? 23.780  -11.470 24.511  0.04 14.16 ? 471  ASN A CA   1  
ATOM   6051   C C    . ASN A 1 415 ? 22.548  -11.169 23.653  0.04 13.77 ? 471  ASN A C    1  
ATOM   6052   O O    . ASN A 1 415 ? 22.330  -11.809 22.611  0.04 13.74 ? 471  ASN A O    1  
ATOM   6053   C CB   . ASN A 1 415 ? 24.345  -12.890 24.249  0.04 14.50 ? 471  ASN A CB   1  
ATOM   6054   C CG   . ASN A 1 415 ? 25.422  -13.310 25.298  0.04 14.95 ? 471  ASN A CG   1  
ATOM   6055   O OD1  . ASN A 1 415 ? 26.432  -12.634 25.480  0.04 15.02 ? 471  ASN A OD1  1  
ATOM   6056   N ND2  . ASN A 1 415 ? 25.172  -14.411 26.012  0.04 15.29 ? 471  ASN A ND2  1  
ATOM   6057   H H    . ASN A 1 415 ? 24.144  -10.738 26.310  0.04 14.32 ? 471  ASN A H    1  
ATOM   6058   H HA   . ASN A 1 415 ? 24.460  -10.843 24.217  0.04 14.17 ? 471  ASN A HA   1  
ATOM   6059   H HB2  . ASN A 1 415 ? 23.624  -13.534 24.295  0.04 14.54 ? 471  ASN A HB2  1  
ATOM   6060   H HB3  . ASN A 1 415 ? 24.751  -12.915 23.371  0.04 14.43 ? 471  ASN A HB3  1  
ATOM   6061   H HD21 . ASN A 1 415 ? 25.774  -14.722 26.539  0.04 15.59 ? 471  ASN A HD21 1  
ATOM   6062   H HD22 . ASN A 1 415 ? 24.405  -14.799 25.952  0.04 15.24 ? 471  ASN A HD22 1  
ATOM   6063   N N    . VAL A 1 416 ? 21.744  -10.193 24.079  0.04 13.51 ? 472  VAL A N    1  
ATOM   6064   C CA   . VAL A 1 416 ? 20.593  -9.744  23.296  0.04 13.17 ? 472  VAL A CA   1  
ATOM   6065   C C    . VAL A 1 416 ? 21.032  -8.748  22.244  0.04 12.95 ? 472  VAL A C    1  
ATOM   6066   O O    . VAL A 1 416 ? 21.871  -7.909  22.493  0.04 12.93 ? 472  VAL A O    1  
ATOM   6067   C CB   . VAL A 1 416 ? 19.540  -9.110  24.203  0.04 13.07 ? 472  VAL A CB   1  
ATOM   6068   C CG1  . VAL A 1 416 ? 18.456  -8.408  23.377  0.04 12.75 ? 472  VAL A CG1  1  
ATOM   6069   C CG2  . VAL A 1 416 ? 18.917  -10.172 25.149  0.04 13.30 ? 472  VAL A CG2  1  
ATOM   6070   H H    . VAL A 1 416 ? 21.842  -9.769  24.819  0.04 13.55 ? 472  VAL A H    1  
ATOM   6071   H HA   . VAL A 1 416 ? 20.181  -10.488 22.837  0.04 13.17 ? 472  VAL A HA   1  
ATOM   6072   H HB   . VAL A 1 416 ? 19.977  -8.447  24.754  0.04 13.13 ? 472  VAL A HB   1  
ATOM   6073   H HG11 . VAL A 1 416 ? 17.696  -8.228  23.950  0.04 12.73 ? 472  VAL A HG11 1  
ATOM   6074   H HG12 . VAL A 1 416 ? 18.794  -7.574  23.011  0.04 12.63 ? 472  VAL A HG12 1  
ATOM   6075   H HG13 . VAL A 1 416 ? 18.183  -8.999  22.660  0.04 12.70 ? 472  VAL A HG13 1  
ATOM   6076   H HG21 . VAL A 1 416 ? 18.468  -9.730  25.887  0.04 13.25 ? 472  VAL A HG21 1  
ATOM   6077   H HG22 . VAL A 1 416 ? 18.281  -10.701 24.645  0.04 13.28 ? 472  VAL A HG22 1  
ATOM   6078   H HG23 . VAL A 1 416 ? 19.627  -10.740 25.487  0.04 13.53 ? 472  VAL A HG23 1  
ATOM   6079   N N    . LEU A 1 417 ? 20.459  -8.887  21.061  0.04 12.82 ? 473  LEU A N    1  
ATOM   6080   C CA   . LEU A 1 417 ? 20.778  -8.058  19.899  0.04 12.65 ? 473  LEU A CA   1  
ATOM   6081   C C    . LEU A 1 417 ? 19.498  -7.322  19.499  0.04 12.35 ? 473  LEU A C    1  
ATOM   6082   O O    . LEU A 1 417 ? 18.474  -7.947  19.186  0.04 12.29 ? 473  LEU A O    1  
ATOM   6083   C CB   . LEU A 1 417 ? 21.226  -8.934  18.725  0.04 12.74 ? 473  LEU A CB   1  
ATOM   6084   C CG   . LEU A 1 417 ? 21.436  -8.177  17.409  0.04 12.58 ? 473  LEU A CG   1  
ATOM   6085   C CD1  . LEU A 1 417 ? 22.583  -7.228  17.501  0.04 12.69 ? 473  LEU A CD1  1  
ATOM   6086   C CD2  . LEU A 1 417 ? 21.704  -9.154  16.285  0.04 12.66 ? 473  LEU A CD2  1  
ATOM   6087   H H    . LEU A 1 417 ? 19.853  -9.469  20.902  0.04 12.86 ? 473  LEU A H    1  
ATOM   6088   H HA   . LEU A 1 417 ? 21.484  -7.435  20.105  0.04 12.69 ? 473  LEU A HA   1  
ATOM   6089   H HB2  . LEU A 1 417 ? 22.060  -9.369  18.952  0.04 12.94 ? 473  LEU A HB2  1  
ATOM   6090   H HB3  . LEU A 1 417 ? 20.537  -9.592  18.572  0.04 12.73 ? 473  LEU A HB3  1  
ATOM   6091   H HG   . LEU A 1 417 ? 20.640  -7.675  17.179  0.04 12.40 ? 473  LEU A HG   1  
ATOM   6092   H HD11 . LEU A 1 417 ? 22.744  -6.839  16.627  0.04 12.61 ? 473  LEU A HD11 1  
ATOM   6093   H HD12 . LEU A 1 417 ? 22.370  -6.526  18.137  0.04 12.65 ? 473  LEU A HD12 1  
ATOM   6094   H HD13 . LEU A 1 417 ? 23.366  -7.720  17.792  0.04 12.89 ? 473  LEU A HD13 1  
ATOM   6095   H HD21 . LEU A 1 417 ? 21.726  -8.659  15.449  0.04 12.56 ? 473  LEU A HD21 1  
ATOM   6096   H HD22 . LEU A 1 417 ? 22.565  -9.561  16.447  0.04 12.86 ? 473  LEU A HD22 1  
ATOM   6097   H HD23 . LEU A 1 417 ? 20.999  -9.822  16.272  0.04 12.63 ? 473  LEU A HD23 1  
ATOM   6098   N N    . ALA A 1 418 ? 19.554  -5.982  19.466  0.04 12.22 ? 474  ALA A N    1  
ATOM   6099   C CA   . ALA A 1 418 ? 18.511  -5.151  18.840  0.04 11.98 ? 474  ALA A CA   1  
ATOM   6100   C C    . ALA A 1 418 ? 19.028  -4.522  17.540  0.04 11.92 ? 474  ALA A C    1  
ATOM   6101   O O    . ALA A 1 418 ? 20.049  -3.817  17.512  0.04 11.99 ? 474  ALA A O    1  
ATOM   6102   C CB   . ALA A 1 418 ? 18.031  -4.035  19.786  0.04 11.91 ? 474  ALA A CB   1  
ATOM   6103   H H    . ALA A 1 418 ? 20.192  -5.529  19.804  0.04 12.28 ? 474  ALA A H    1  
ATOM   6104   H HA   . ALA A 1 418 ? 17.741  -5.691  18.639  0.04 11.93 ? 474  ALA A HA   1  
ATOM   6105   H HB1  . ALA A 1 418 ? 17.149  -4.265  20.121  0.04 11.78 ? 474  ALA A HB1  1  
ATOM   6106   H HB2  . ALA A 1 418 ? 18.656  -3.935  20.519  0.04 11.99 ? 474  ALA A HB2  1  
ATOM   6107   H HB3  . ALA A 1 418 ? 17.970  -3.207  19.288  0.04 11.94 ? 474  ALA A HB3  1  
ATOM   6108   N N    . THR A 1 419 ? 18.312  -4.790  16.451  0.04 11.84 ? 475  THR A N    1  
ATOM   6109   C CA   . THR A 1 419 ? 18.596  -4.172  15.147  0.04 11.80 ? 475  THR A CA   1  
ATOM   6110   C C    . THR A 1 419 ? 17.358  -3.423  14.682  0.04 11.63 ? 475  THR A C    1  
ATOM   6111   O O    . THR A 1 419 ? 16.340  -3.993  14.297  0.04 11.58 ? 475  THR A O    1  
ATOM   6112   C CB   . THR A 1 419 ? 19.044  -5.215  14.094  0.04 11.92 ? 475  THR A CB   1  
ATOM   6113   O OG1  . THR A 1 419 ? 18.006  -6.172  13.826  0.04 11.90 ? 475  THR A OG1  1  
ATOM   6114   C CG2  . THR A 1 419 ? 20.317  -5.927  14.546  0.04 12.14 ? 475  THR A CG2  1  
ATOM   6115   H H    . THR A 1 419 ? 17.628  -5.299  16.439  0.04 11.81 ? 475  THR A H    1  
ATOM   6116   H HA   . THR A 1 419 ? 19.309  -3.528  15.248  0.04 11.85 ? 475  THR A HA   1  
ATOM   6117   H HB   . THR A 1 419 ? 19.229  -4.750  13.265  0.04 11.91 ? 475  THR A HB   1  
ATOM   6118   H HG1  . THR A 1 419 ? 18.338  -6.882  13.528  0.04 12.01 ? 475  THR A HG1  1  
ATOM   6119   H HG21 . THR A 1 419 ? 20.533  -6.638  13.921  0.04 12.23 ? 475  THR A HG21 1  
ATOM   6120   H HG22 . THR A 1 419 ? 21.054  -5.299  14.567  0.04 12.18 ? 475  THR A HG22 1  
ATOM   6121   H HG23 . THR A 1 419 ? 20.204  -6.310  15.425  0.04 12.17 ? 475  THR A HG23 1  
ATOM   6122   N N    . GLY A 1 420 ? 17.432  -2.092  14.709  0.04 11.59 ? 476  GLY A N    1  
ATOM   6123   C CA   . GLY A 1 420 ? 16.291  -1.279  14.342  0.04 11.48 ? 476  GLY A CA   1  
ATOM   6124   C C    . GLY A 1 420 ? 15.365  -1.039  15.514  0.04 11.41 ? 476  GLY A C    1  
ATOM   6125   O O    . GLY A 1 420 ? 14.207  -1.480  15.509  0.04 11.35 ? 476  GLY A O    1  
ATOM   6126   H H    . GLY A 1 420 ? 18.131  -1.650  14.929  0.04 11.65 ? 476  GLY A H    1  
ATOM   6127   H HA2  . GLY A 1 420 ? 16.609  -0.425  14.014  0.04 11.50 ? 476  GLY A HA2  1  
ATOM   6128   H HA3  . GLY A 1 420 ? 15.789  -1.714  13.640  0.04 11.46 ? 476  GLY A HA3  1  
ATOM   6129   N N    . LEU A 1 421 ? 15.895  -0.363  16.539  0.04 11.44 ? 477  LEU A N    1  
ATOM   6130   C CA   . LEU A 1 421 ? 15.180  -0.156  17.784  0.04 11.42 ? 477  LEU A CA   1  
ATOM   6131   C C    . LEU A 1 421 ? 14.596  1.249   17.826  0.04 11.40 ? 477  LEU A C    1  
ATOM   6132   O O    . LEU A 1 421 ? 15.351  2.202   17.792  0.04 11.47 ? 477  LEU A O    1  
ATOM   6133   C CB   . LEU A 1 421 ? 16.150  -0.368  18.952  0.04 11.53 ? 477  LEU A CB   1  
ATOM   6134   C CG   . LEU A 1 421 ? 15.574  -0.305  20.364  0.04 11.57 ? 477  LEU A CG   1  
ATOM   6135   C CD1  . LEU A 1 421 ? 14.363  -1.229  20.470  0.04 11.55 ? 477  LEU A CD1  1  
ATOM   6136   C CD2  . LEU A 1 421 ? 16.648  -0.663  21.402  0.04 11.74 ? 477  LEU A CD2  1  
ATOM   6137   H H    . LEU A 1 421 ? 16.687  -0.034  16.542  0.04 11.50 ? 477  LEU A H    1  
ATOM   6138   H HA   . LEU A 1 421 ? 14.465  -0.804  17.854  0.04 11.39 ? 477  LEU A HA   1  
ATOM   6139   H HB2  . LEU A 1 421 ? 16.549  -1.248  18.865  0.04 11.57 ? 477  LEU A HB2  1  
ATOM   6140   H HB3  . LEU A 1 421 ? 16.852  0.299   18.894  0.04 11.58 ? 477  LEU A HB3  1  
ATOM   6141   H HG   . LEU A 1 421 ? 15.274  0.601   20.524  0.04 11.54 ? 477  LEU A HG   1  
ATOM   6142   H HD11 . LEU A 1 421 ? 14.073  -1.264  21.394  0.04 11.61 ? 477  LEU A HD11 1  
ATOM   6143   H HD12 . LEU A 1 421 ? 13.650  -0.890  19.911  0.04 11.47 ? 477  LEU A HD12 1  
ATOM   6144   H HD13 . LEU A 1 421 ? 14.627  -2.111  20.168  0.04 11.57 ? 477  LEU A HD13 1  
ATOM   6145   H HD21 . LEU A 1 421 ? 16.252  -0.647  22.287  0.04 11.77 ? 477  LEU A HD21 1  
ATOM   6146   H HD22 . LEU A 1 421 ? 16.996  -1.546  21.204  0.04 11.79 ? 477  LEU A HD22 1  
ATOM   6147   H HD23 . LEU A 1 421 ? 17.361  -0.010  21.350  0.04 11.78 ? 477  LEU A HD23 1  
ATOM   6148   N N    . PHE A 1 422 ? 13.272  1.369   17.911  0.04 11.35 ? 478  PHE A N    1  
ATOM   6149   C CA   . PHE A 1 422 ? 12.582  2.664   17.920  0.04 11.36 ? 478  PHE A CA   1  
ATOM   6150   C C    . PHE A 1 422 ? 11.703  2.720   19.164  0.04 11.39 ? 478  PHE A C    1  
ATOM   6151   O O    . PHE A 1 422 ? 10.779  1.920   19.305  0.04 11.36 ? 478  PHE A O    1  
ATOM   6152   C CB   . PHE A 1 422 ? 11.674  2.800   16.693  0.04 11.33 ? 478  PHE A CB   1  
ATOM   6153   C CG   . PHE A 1 422 ? 12.381  2.759   15.338  0.04 11.34 ? 478  PHE A CG   1  
ATOM   6154   C CD1  . PHE A 1 422 ? 12.791  1.557   14.799  0.04 11.32 ? 478  PHE A CD1  1  
ATOM   6155   C CD2  . PHE A 1 422 ? 12.520  3.910   14.567  0.04 11.41 ? 478  PHE A CD2  1  
ATOM   6156   C CE1  . PHE A 1 422 ? 13.392  1.508   13.552  0.04 11.35 ? 478  PHE A CE1  1  
ATOM   6157   C CE2  . PHE A 1 422 ? 13.090  3.865   13.319  0.04 11.45 ? 478  PHE A CE2  1  
ATOM   6158   C CZ   . PHE A 1 422 ? 13.510  2.656   12.799  0.04 11.42 ? 478  PHE A CZ   1  
ATOM   6159   H H    . PHE A 1 422 ? 12.740  0.700   17.982  0.04 11.32 ? 478  PHE A H    1  
ATOM   6160   H HA   . PHE A 1 422 ? 13.207  3.402   17.938  0.04 11.41 ? 478  PHE A HA   1  
ATOM   6161   H HB2  . PHE A 1 422 ? 11.066  2.046   16.720  0.04 11.30 ? 478  PHE A HB2  1  
ATOM   6162   H HB3  . PHE A 1 422 ? 11.177  3.630   16.744  0.04 11.37 ? 478  PHE A HB3  1  
ATOM   6163   H HD1  . PHE A 1 422 ? 12.695  0.774   15.288  0.04 11.30 ? 478  PHE A HD1  1  
ATOM   6164   H HD2  . PHE A 1 422 ? 12.225  4.726   14.893  0.04 11.45 ? 478  PHE A HD2  1  
ATOM   6165   H HE1  . PHE A 1 422 ? 13.670  0.693   13.211  0.04 11.36 ? 478  PHE A HE1  1  
ATOM   6166   H HE2  . PHE A 1 422 ? 13.192  4.648   12.828  0.04 11.52 ? 478  PHE A HE2  1  
ATOM   6167   H HZ   . PHE A 1 422 ? 13.928  2.617   11.971  0.04 11.47 ? 478  PHE A HZ   1  
ATOM   6168   N N    . VAL A 1 423 ? 11.989  3.631   20.086  0.04 11.47 ? 479  VAL A N    1  
ATOM   6169   C CA   . VAL A 1 423 ? 11.232  3.678   21.343  0.04 11.53 ? 479  VAL A CA   1  
ATOM   6170   C C    . VAL A 1 423 ? 11.043  5.132   21.755  0.04 11.64 ? 479  VAL A C    1  
ATOM   6171   O O    . VAL A 1 423 ? 12.020  5.887   21.812  0.04 11.70 ? 479  VAL A O    1  
ATOM   6172   C CB   . VAL A 1 423 ? 11.900  2.921   22.505  0.04 11.60 ? 479  VAL A CB   1  
ATOM   6173   C CG1  . VAL A 1 423 ? 10.878  2.713   23.609  0.04 11.70 ? 479  VAL A CG1  1  
ATOM   6174   C CG2  . VAL A 1 423 ? 12.425  1.564   22.057  0.04 11.54 ? 479  VAL A CG2  1  
ATOM   6175   H H    . VAL A 1 423 ? 12.613  4.213   20.019  0.04 11.51 ? 479  VAL A H    1  
ATOM   6176   H HA   . VAL A 1 423 ? 10.358  3.295   21.207  0.04 11.51 ? 479  VAL A HA   1  
ATOM   6177   H HB   . VAL A 1 423 ? 12.636  3.427   22.861  0.04 11.65 ? 479  VAL A HB   1  
ATOM   6178   H HG11 . VAL A 1 423 ? 11.244  2.098   24.264  0.04 11.76 ? 479  VAL A HG11 1  
ATOM   6179   H HG12 . VAL A 1 423 ? 10.683  3.567   24.034  0.04 11.76 ? 479  VAL A HG12 1  
ATOM   6180   H HG13 . VAL A 1 423 ? 10.068  2.342   23.229  0.04 11.67 ? 479  VAL A HG13 1  
ATOM   6181   H HG21 . VAL A 1 423 ? 12.954  1.184   22.773  0.04 11.61 ? 479  VAL A HG21 1  
ATOM   6182   H HG22 . VAL A 1 423 ? 11.670  0.986   21.875  0.04 11.51 ? 479  VAL A HG22 1  
ATOM   6183   H HG23 . VAL A 1 423 ? 12.977  1.663   21.268  0.04 11.49 ? 479  VAL A HG23 1  
ATOM   6184   N N    . GLU A 1 424 ? 9.803   5.511   22.033  0.04 11.69 ? 480  GLU A N    1  
ATOM   6185   C CA   . GLU A 1 424 ? 9.463   6.949   22.187  0.04 11.83 ? 480  GLU A CA   1  
ATOM   6186   C C    . GLU A 1 424 ? 8.448   7.277   23.241  0.04 11.96 ? 480  GLU A C    1  
ATOM   6187   O O    . GLU A 1 424 ? 7.419   6.613   23.350  0.04 11.95 ? 480  GLU A O    1  
ATOM   6188   C CB   . GLU A 1 424 ? 8.897   7.515   20.880  0.04 11.82 ? 480  GLU A CB   1  
ATOM   6189   C CG   . GLU A 1 424 ? 9.750   7.249   19.640  0.04 11.71 ? 480  GLU A CG   1  
ATOM   6190   C CD   . GLU A 1 424 ? 9.186   8.006   18.467  0.04 11.77 ? 480  GLU A CD   1  
ATOM   6191   O OE1  . GLU A 1 424 ? 8.102   7.592   17.957  0.04 11.75 ? 480  GLU A OE1  1  
ATOM   6192   O OE2  . GLU A 1 424 ? 9.754   9.085   18.075  0.04 11.88 ? 480  GLU A OE2  1  
ATOM   6193   H H    . GLU A 1 424 ? 9.144   4.978   22.139  0.04 11.68 ? 480  GLU A H    1  
ATOM   6194   H HA   . GLU A 1 424 ? 10.264  7.448   22.403  0.04 11.88 ? 480  GLU A HA   1  
ATOM   6195   H HB2  . GLU A 1 424 ? 8.021   7.140   20.712  0.04 11.82 ? 480  GLU A HB2  1  
ATOM   6196   H HB3  . GLU A 1 424 ? 8.813   8.478   20.967  0.04 11.93 ? 480  GLU A HB3  1  
ATOM   6197   H HG2  . GLU A 1 424 ? 10.673  7.507   19.788  0.04 11.73 ? 480  GLU A HG2  1  
ATOM   6198   H HG3  . GLU A 1 424 ? 9.703   6.303   19.435  0.04 11.62 ? 480  GLU A HG3  1  
ATOM   6199   N N    . HIS A 1 425 ? 8.761   8.380   23.953  0.04 12.13 ? 481  HIS A N    1  
ATOM   6200   C CA   . HIS A 1 425 ? 7.862   9.191   24.779  0.04 12.32 ? 481  HIS A CA   1  
ATOM   6201   C C    . HIS A 1 425 ? 7.506   8.663   26.183  0.04 12.43 ? 481  HIS A C    1  
ATOM   6202   O O    . HIS A 1 425 ? 6.573   9.195   26.785  0.04 12.61 ? 481  HIS A O    1  
ATOM   6203   C CB   . HIS A 1 425 ? 6.589   9.607   24.050  0.04 12.36 ? 481  HIS A CB   1  
ATOM   6204   C CG   . HIS A 1 425 ? 6.776   10.000  22.621  0.04 12.32 ? 481  HIS A CG   1  
ATOM   6205   N ND1  . HIS A 1 425 ? 7.646   10.991  22.185  0.04 12.42 ? 481  HIS A ND1  1  
ATOM   6206   C CD2  . HIS A 1 425 ? 6.203   9.485   21.507  0.04 12.23 ? 481  HIS A CD2  1  
ATOM   6207   C CE1  . HIS A 1 425 ? 7.568   11.075  20.868  0.04 12.39 ? 481  HIS A CE1  1  
ATOM   6208   N NE2  . HIS A 1 425 ? 6.720   10.163  20.429  0.04 12.27 ? 481  HIS A NE2  1  
ATOM   6209   H H    . HIS A 1 425 ? 9.555   8.699   23.961  0.04 12.15 ? 481  HIS A H    1  
ATOM   6210   H HA   . HIS A 1 425 ? 8.336   10.020  24.945  0.04 12.43 ? 481  HIS A HA   1  
ATOM   6211   H HB2  . HIS A 1 425 ? 5.959   8.873   24.065  0.04 12.28 ? 481  HIS A HB2  1  
ATOM   6212   H HB3  . HIS A 1 425 ? 6.208   10.368  24.520  0.04 12.52 ? 481  HIS A HB3  1  
ATOM   6213   H HD2  . HIS A 1 425 ? 5.580   8.803   21.488  0.04 12.18 ? 481  HIS A HD2  1  
ATOM   6214   H HE1  . HIS A 1 425 ? 8.058   11.661  20.340  0.04 12.46 ? 481  HIS A HE1  1  
ATOM   6215   N N    . PHE A 1 426 ? 8.268   7.713   26.719  0.04 12.36 ? 482  PHE A N    1  
ATOM   6216   C CA   . PHE A 1 426 ? 7.992   7.142   28.030  0.04 12.48 ? 482  PHE A CA   1  
ATOM   6217   C C    . PHE A 1 426 ? 8.244   8.153   29.133  0.04 12.73 ? 482  PHE A C    1  
ATOM   6218   O O    . PHE A 1 426 ? 9.072   9.055   28.988  0.04 12.78 ? 482  PHE A O    1  
ATOM   6219   C CB   . PHE A 1 426 ? 8.767   5.808   28.195  0.04 12.38 ? 482  PHE A CB   1  
ATOM   6220   C CG   . PHE A 1 426 ? 8.202   4.770   27.289  0.04 12.21 ? 482  PHE A CG   1  
ATOM   6221   C CD1  . PHE A 1 426 ? 7.151   3.967   27.701  0.04 12.28 ? 482  PHE A CD1  1  
ATOM   6222   C CD2  . PHE A 1 426 ? 8.583   4.718   25.968  0.04 12.03 ? 482  PHE A CD2  1  
ATOM   6223   C CE1  . PHE A 1 426 ? 6.556   3.091   26.800  0.04 12.17 ? 482  PHE A CE1  1  
ATOM   6224   C CE2  . PHE A 1 426 ? 7.951   3.884   25.070  0.04 11.92 ? 482  PHE A CE2  1  
ATOM   6225   C CZ   . PHE A 1 426 ? 6.917   3.102   25.482  0.04 11.99 ? 482  PHE A CZ   1  
ATOM   6226   H H    . PHE A 1 426 ? 8.975   7.391   26.349  0.04 12.26 ? 482  PHE A H    1  
ATOM   6227   H HA   . PHE A 1 426 ? 7.051   6.914   28.069  0.04 12.51 ? 482  PHE A HA   1  
ATOM   6228   H HB2  . PHE A 1 426 ? 9.698   5.948   27.969  0.04 12.33 ? 482  PHE A HB2  1  
ATOM   6229   H HB3  . PHE A 1 426 ? 8.689   5.508   29.113  0.04 12.50 ? 482  PHE A HB3  1  
ATOM   6230   H HD1  . PHE A 1 426 ? 6.864   4.000   28.582  0.04 12.42 ? 482  PHE A HD1  1  
ATOM   6231   H HD2  . PHE A 1 426 ? 9.245   5.293   25.656  0.04 12.01 ? 482  PHE A HD2  1  
ATOM   6232   H HE1  . PHE A 1 426 ? 5.856   2.549   27.079  0.04 12.24 ? 482  PHE A HE1  1  
ATOM   6233   H HE2  . PHE A 1 426 ? 8.233   3.852   24.184  0.04 11.81 ? 482  PHE A HE2  1  
ATOM   6234   H HZ   . PHE A 1 426 ? 6.543   2.490   24.892  0.04 11.93 ? 482  PHE A HZ   1  
ATOM   6235   N N    . ASN A 1 427 ? 7.485   8.045   30.217  0.04 12.91 ? 483  ASN A N    1  
ATOM   6236   C CA   . ASN A 1 427 ? 7.654   9.026   31.309  0.04 13.19 ? 483  ASN A CA   1  
ATOM   6237   C C    . ASN A 1 427 ? 9.029   8.953   31.973  0.04 13.27 ? 483  ASN A C    1  
ATOM   6238   O O    . ASN A 1 427 ? 9.490   9.971   32.502  0.04 13.47 ? 483  ASN A O    1  
ATOM   6239   C CB   . ASN A 1 427 ? 6.528   8.907   32.375  0.04 13.42 ? 483  ASN A CB   1  
ATOM   6240   C CG   . ASN A 1 427 ? 5.122   9.102   31.821  0.04 13.45 ? 483  ASN A CG   1  
ATOM   6241   O OD1  . ASN A 1 427 ? 4.663   8.350   30.976  0.04 13.26 ? 483  ASN A OD1  1  
ATOM   6242   N ND2  . ASN A 1 427 ? 4.400   10.079  32.371  0.04 13.73 ? 483  ASN A ND2  1  
ATOM   6243   H H    . ASN A 1 427 ? 6.872   7.464   30.340  0.04 12.91 ? 483  ASN A H    1  
ATOM   6244   H HA   . ASN A 1 427 ? 7.579   9.907   30.912  0.04 13.24 ? 483  ASN A HA   1  
ATOM   6245   H HB2  . ASN A 1 427 ? 6.562   8.030   32.783  0.04 13.38 ? 483  ASN A HB2  1  
ATOM   6246   H HB3  . ASN A 1 427 ? 6.670   9.585   33.051  0.04 13.61 ? 483  ASN A HB3  1  
ATOM   6247   H HD21 . ASN A 1 427 ? 3.604   10.243  32.086  0.04 13.78 ? 483  ASN A HD21 1  
ATOM   6248   H HD22 . ASN A 1 427 ? 4.724   10.533  33.026  0.04 13.88 ? 483  ASN A HD22 1  
ATOM   6249   N N    . LYS A 1 428 ? 9.656   7.767   31.977  0.04 13.15 ? 484  LYS A N    1  
ATOM   6250   C CA   . LYS A 1 428 ? 10.996  7.552   32.551  0.04 13.24 ? 484  LYS A CA   1  
ATOM   6251   C C    . LYS A 1 428 ? 12.009  7.027   31.508  0.04 13.01 ? 484  LYS A C    1  
ATOM   6252   O O    . LYS A 1 428 ? 12.229  7.673   30.471  0.04 12.88 ? 484  LYS A O    1  
ATOM   6253   C CB   . LYS A 1 428 ? 10.927  6.637   33.769  0.04 13.42 ? 484  LYS A CB   1  
ATOM   6254   C CG   . LYS A 1 428 ? 10.174  7.213   34.920  0.04 13.70 ? 484  LYS A CG   1  
ATOM   6255   C CD   . LYS A 1 428 ? 10.589  6.485   36.204  0.04 13.96 ? 484  LYS A CD   1  
ATOM   6256   C CE   . LYS A 1 428 ? 9.556   6.656   37.237  0.04 14.23 ? 484  LYS A CE   1  
ATOM   6257   N NZ   . LYS A 1 428 ? 9.063   8.000   37.171  0.04 14.39 ? 484  LYS A NZ   1  
ATOM   6258   H H    . LYS A 1 428 ? 9.318   7.055   31.637  0.04 13.03 ? 484  LYS A H    1  
ATOM   6259   H HA   . LYS A 1 428 ? 11.337  8.398   32.868  0.04 13.38 ? 484  LYS A HA   1  
ATOM   6260   H HB2  . LYS A 1 428 ? 10.497  5.801   33.524  0.04 13.31 ? 484  LYS A HB2  1  
ATOM   6261   H HB3  . LYS A 1 428 ? 11.826  6.466   34.091  0.04 13.52 ? 484  LYS A HB3  1  
ATOM   6262   H HG2  . LYS A 1 428 ? 10.377  8.159   35.012  0.04 13.82 ? 484  LYS A HG2  1  
ATOM   6263   H HG3  . LYS A 1 428 ? 9.223   7.086   34.775  0.04 13.64 ? 484  LYS A HG3  1  
ATOM   6264   H HD2  . LYS A 1 428 ? 10.664  5.545   36.005  0.04 13.85 ? 484  LYS A HD2  1  
ATOM   6265   H HD3  . LYS A 1 428 ? 11.431  6.816   36.541  0.04 14.08 ? 484  LYS A HD3  1  
ATOM   6266   H HE2  . LYS A 1 428 ? 8.807   6.069   37.040  0.04 14.14 ? 484  LYS A HE2  1  
ATOM   6267   H HE3  . LYS A 1 428 ? 9.907   6.485   38.129  0.04 14.42 ? 484  LYS A HE3  1  
ATOM   6268   H HZ1  . LYS A 1 428 ? 8.557   8.172   37.885  0.04 14.54 ? 484  LYS A HZ1  1  
ATOM   6269   H HZ2  . LYS A 1 428 ? 9.741   8.578   37.150  0.04 14.53 ? 484  LYS A HZ2  1  
ATOM   6270   H HZ3  . LYS A 1 428 ? 8.568   8.112   36.439  0.04 14.24 ? 484  LYS A HZ3  1  
ATOM   6271   N N    . TYR A 1 429 ? 12.664  5.901   31.807  0.04 13.01 ? 485  TYR A N    1  
ATOM   6272   C CA   . TYR A 1 429 ? 13.656  5.351   30.885  0.04 12.84 ? 485  TYR A CA   1  
ATOM   6273   C C    . TYR A 1 429 ? 12.973  4.681   29.682  0.04 12.57 ? 485  TYR A C    1  
ATOM   6274   O O    . TYR A 1 429 ? 12.252  3.665   29.836  0.04 12.54 ? 485  TYR A O    1  
ATOM   6275   C CB   . TYR A 1 429 ? 14.568  4.335   31.585  0.04 12.95 ? 485  TYR A CB   1  
ATOM   6276   C CG   . TYR A 1 429 ? 15.491  4.857   32.664  0.04 13.25 ? 485  TYR A CG   1  
ATOM   6277   C CD1  . TYR A 1 429 ? 16.494  5.778   32.377  0.04 13.38 ? 485  TYR A CD1  1  
ATOM   6278   C CD2  . TYR A 1 429 ? 15.421  4.378   33.962  0.04 13.46 ? 485  TYR A CD2  1  
ATOM   6279   C CE1  . TYR A 1 429 ? 17.383  6.223   33.365  0.04 13.70 ? 485  TYR A CE1  1  
ATOM   6280   C CE2  . TYR A 1 429 ? 16.300  4.802   34.938  0.04 13.77 ? 485  TYR A CE2  1  
ATOM   6281   C CZ   . TYR A 1 429 ? 17.270  5.737   34.639  0.04 13.90 ? 485  TYR A CZ   1  
ATOM   6282   O OH   . TYR A 1 429 ? 18.146  6.171   35.615  0.04 14.25 ? 485  TYR A OH   1  
ATOM   6283   H H    . TYR A 1 429 ? 12.560  5.435   32.518  0.04 13.12 ? 485  TYR A H    1  
ATOM   6284   H HA   . TYR A 1 429 ? 14.217  6.068   30.555  0.04 12.84 ? 485  TYR A HA   1  
ATOM   6285   H HB2  . TYR A 1 429 ? 14.017  3.648   31.986  0.04 12.93 ? 485  TYR A HB2  1  
ATOM   6286   H HB3  . TYR A 1 429 ? 15.131  3.933   30.904  0.04 12.86 ? 485  TYR A HB3  1  
ATOM   6287   H HD1  . TYR A 1 429 ? 16.576  6.107   31.513  0.04 13.27 ? 485  TYR A HD1  1  
ATOM   6288   H HD2  . TYR A 1 429 ? 14.777  3.748   34.182  0.04 13.40 ? 485  TYR A HD2  1  
ATOM   6289   H HE1  . TYR A 1 429 ? 18.041  6.842   33.158  0.04 13.81 ? 485  TYR A HE1  1  
ATOM   6290   H HE2  . TYR A 1 429 ? 16.223  4.483   35.804  0.04 13.92 ? 485  TYR A HE2  1  
ATOM   6291   H HH   . TYR A 1 429 ? 17.805  6.801   36.050  0.04 14.33 ? 485  TYR A HH   1  
ATOM   6292   N N    . ASP A 1 430 ? 13.194  5.189   28.481  0.04 12.42 ? 486  ASP A N    1  
ATOM   6293   C CA   . ASP A 1 430 ? 12.635  4.534   27.299  0.04 12.19 ? 486  ASP A CA   1  
ATOM   6294   C C    . ASP A 1 430 ? 13.224  3.132   27.156  0.04 12.14 ? 486  ASP A C    1  
ATOM   6295   O O    . ASP A 1 430 ? 12.476  2.163   26.974  0.04 12.07 ? 486  ASP A O    1  
ATOM   6296   C CB   . ASP A 1 430 ? 12.840  5.383   26.065  0.04 12.09 ? 486  ASP A CB   1  
ATOM   6297   C CG   . ASP A 1 430 ? 12.431  6.835   26.285  0.04 12.21 ? 486  ASP A CG   1  
ATOM   6298   O OD1  . ASP A 1 430 ? 13.231  7.572   26.908  0.04 12.39 ? 486  ASP A OD1  1  
ATOM   6299   O OD2  . ASP A 1 430 ? 11.317  7.200   25.839  0.04 12.16 ? 486  ASP A OD2  1  
ATOM   6300   H H    . ASP A 1 430 ? 13.631  5.907   28.323  0.04 12.45 ? 486  ASP A H    1  
ATOM   6301   H HA   . ASP A 1 430 ? 11.679  4.449   27.426  0.04 12.19 ? 486  ASP A HA   1  
ATOM   6302   H HB2  . ASP A 1 430 ? 13.784  5.368   25.834  0.04 12.10 ? 486  ASP A HB2  1  
ATOM   6303   H HB3  . ASP A 1 430 ? 12.313  5.023   25.337  0.04 11.97 ? 486  ASP A HB3  1  
ATOM   6304   N N    . VAL A 1 431 ? 14.552  3.027   27.229  0.04 12.21 ? 487  VAL A N    1  
ATOM   6305   C CA   . VAL A 1 431 ? 15.247  1.737   27.186  0.04 12.23 ? 487  VAL A CA   1  
ATOM   6306   C C    . VAL A 1 431 ? 16.186  1.634   28.372  0.04 12.48 ? 487  VAL A C    1  
ATOM   6307   O O    . VAL A 1 431 ? 16.943  2.587   28.653  0.04 12.60 ? 487  VAL A O    1  
ATOM   6308   C CB   . VAL A 1 431 ? 16.045  1.560   25.866  0.04 12.12 ? 487  VAL A CB   1  
ATOM   6309   C CG1  . VAL A 1 431 ? 16.863  0.280   25.873  0.04 12.19 ? 487  VAL A CG1  1  
ATOM   6310   C CG2  . VAL A 1 431 ? 15.089  1.578   24.666  0.04 11.90 ? 487  VAL A CG2  1  
ATOM   6311   H H    . VAL A 1 431 ? 15.079  3.697   27.293  0.04 12.27 ? 487  VAL A H    1  
ATOM   6312   H HA   . VAL A 1 431 ? 14.604  1.017   27.260  0.04 12.20 ? 487  VAL A HA   1  
ATOM   6313   H HB   . VAL A 1 431 ? 16.667  2.294   25.779  0.04 12.17 ? 487  VAL A HB   1  
ATOM   6314   H HG11 . VAL A 1 431 ? 16.901  -0.067  24.969  0.04 12.13 ? 487  VAL A HG11 1  
ATOM   6315   H HG12 . VAL A 1 431 ? 17.758  0.456   26.201  0.04 12.35 ? 487  VAL A HG12 1  
ATOM   6316   H HG13 . VAL A 1 431 ? 16.423  -0.364  26.448  0.04 12.17 ? 487  VAL A HG13 1  
ATOM   6317   H HG21 . VAL A 1 431 ? 15.612  1.539   23.851  0.04 11.85 ? 487  VAL A HG21 1  
ATOM   6318   H HG22 . VAL A 1 431 ? 14.510  0.806   24.727  0.04 11.87 ? 487  VAL A HG22 1  
ATOM   6319   H HG23 . VAL A 1 431 ? 14.566  2.394   24.684  0.04 11.89 ? 487  VAL A HG23 1  
ATOM   6320   N N    . GLN A 1 432 ? 16.170  0.478   29.027  0.04 12.59 ? 488  GLN A N    1  
ATOM   6321   C CA   . GLN A 1 432 ? 17.110  0.159   30.084  0.04 12.87 ? 488  GLN A CA   1  
ATOM   6322   C C    . GLN A 1 432 ? 17.714  -1.202  29.762  0.04 12.92 ? 488  GLN A C    1  
ATOM   6323   O O    . GLN A 1 432 ? 17.004  -2.122  29.331  0.04 12.83 ? 488  GLN A O    1  
ATOM   6324   C CB   . GLN A 1 432 ? 16.410  0.120   31.460  0.04 13.06 ? 488  GLN A CB   1  
ATOM   6325   C CG   . GLN A 1 432 ? 17.353  -0.165  32.614  0.04 13.40 ? 488  GLN A CG   1  
ATOM   6326   C CD   . GLN A 1 432 ? 16.663  -0.463  33.951  0.04 13.63 ? 488  GLN A CD   1  
ATOM   6327   O OE1  . GLN A 1 432 ? 15.425  -0.370  34.111  0.04 13.56 ? 488  GLN A OE1  1  
ATOM   6328   N NE2  . GLN A 1 432 ? 17.494  -0.810  34.950  0.04 13.95 ? 488  GLN A NE2  1  
ATOM   6329   H H    . GLN A 1 432 ? 15.607  -0.153  28.871  0.04 12.53 ? 488  GLN A H    1  
ATOM   6330   H HA   . GLN A 1 432 ? 17.828  0.812   30.108  0.04 12.94 ? 488  GLN A HA   1  
ATOM   6331   H HB2  . GLN A 1 432 ? 15.980  0.975   31.622  0.04 13.05 ? 488  GLN A HB2  1  
ATOM   6332   H HB3  . GLN A 1 432 ? 15.737  -0.578  31.444  0.04 13.01 ? 488  GLN A HB3  1  
ATOM   6333   H HG2  . GLN A 1 432 ? 17.888  -0.941  32.388  0.04 13.44 ? 488  GLN A HG2  1  
ATOM   6334   H HG3  . GLN A 1 432 ? 17.931  0.599   32.749  0.04 13.46 ? 488  GLN A HG3  1  
ATOM   6335   H HE21 . GLN A 1 432 ? 18.340  -0.725  34.848  0.04 14.01 ? 488  GLN A HE21 1  
ATOM   6336   H HE22 . GLN A 1 432 ? 17.178  -1.121  35.686  0.04 14.12 ? 488  GLN A HE22 1  
ATOM   6337   N N    . TRP A 1 433 ? 19.030  -1.316  29.926  0.04 13.09 ? 489  TRP A N    1  
ATOM   6338   C CA   . TRP A 1 433 ? 19.773  -2.540  29.634  0.04 13.20 ? 489  TRP A CA   1  
ATOM   6339   C C    . TRP A 1 433 ? 20.553  -2.934  30.866  0.04 13.57 ? 489  TRP A C    1  
ATOM   6340   O O    . TRP A 1 433 ? 21.431  -2.192  31.335  0.04 13.78 ? 489  TRP A O    1  
ATOM   6341   C CB   . TRP A 1 433 ? 20.695  -2.312  28.427  0.04 13.11 ? 489  TRP A CB   1  
ATOM   6342   C CG   . TRP A 1 433 ? 20.863  -3.512  27.529  0.04 13.07 ? 489  TRP A CG   1  
ATOM   6343   C CD1  . TRP A 1 433 ? 21.487  -4.687  27.844  0.04 13.31 ? 489  TRP A CD1  1  
ATOM   6344   C CD2  . TRP A 1 433 ? 20.418  -3.639  26.186  0.04 12.81 ? 489  TRP A CD2  1  
ATOM   6345   N NE1  . TRP A 1 433 ? 21.457  -5.530  26.776  0.04 13.22 ? 489  TRP A NE1  1  
ATOM   6346   C CE2  . TRP A 1 433 ? 20.798  -4.916  25.742  0.04 12.91 ? 489  TRP A CE2  1  
ATOM   6347   C CE3  . TRP A 1 433 ? 19.732  -2.805  25.320  0.04 12.54 ? 489  TRP A CE3  1  
ATOM   6348   C CZ2  . TRP A 1 433 ? 20.522  -5.364  24.465  0.04 12.75 ? 489  TRP A CZ2  1  
ATOM   6349   C CZ3  . TRP A 1 433 ? 19.450  -3.242  24.076  0.04 12.38 ? 489  TRP A CZ3  1  
ATOM   6350   C CH2  . TRP A 1 433 ? 19.857  -4.503  23.635  0.04 12.48 ? 489  TRP A CH2  1  
ATOM   6351   H H    . TRP A 1 433 ? 19.528  -0.687  30.221  0.04 13.16 ? 489  TRP A H    1  
ATOM   6352   H HA   . TRP A 1 433 ? 19.163  -3.262  29.425  0.04 13.11 ? 489  TRP A HA   1  
ATOM   6353   H HB2  . TRP A 1 433 ? 20.338  -1.597  27.882  0.04 12.93 ? 489  TRP A HB2  1  
ATOM   6354   H HB3  . TRP A 1 433 ? 21.571  -2.071  28.760  0.04 13.29 ? 489  TRP A HB3  1  
ATOM   6355   H HD1  . TRP A 1 433 ? 21.883  -4.874  28.666  0.04 13.53 ? 489  TRP A HD1  1  
ATOM   6356   H HE1  . TRP A 1 433 ? 21.794  -6.314  26.758  0.04 13.35 ? 489  TRP A HE1  1  
ATOM   6357   H HE3  . TRP A 1 433 ? 19.469  -1.957  25.595  0.04 12.50 ? 489  TRP A HE3  1  
ATOM   6358   H HZ2  . TRP A 1 433 ? 20.788  -6.211  24.183  0.04 12.84 ? 489  TRP A HZ2  1  
ATOM   6359   H HZ3  . TRP A 1 433 ? 19.000  -2.682  23.489  0.04 12.23 ? 489  TRP A HZ3  1  
ATOM   6360   H HH2  . TRP A 1 433 ? 19.639  -4.772  22.773  0.04 12.39 ? 489  TRP A HH2  1  
ATOM   6361   N N    . SER A 1 434 ? 20.195  -4.105  31.400  0.04 13.69 ? 490  SER A N    1  
ATOM   6362   C CA   . SER A 1 434 ? 20.733  -4.633  32.618  0.04 14.07 ? 490  SER A CA   1  
ATOM   6363   C C    . SER A 1 434 ? 21.531  -5.897  32.359  0.04 14.29 ? 490  SER A C    1  
ATOM   6364   O O    . SER A 1 434 ? 22.323  -6.306  33.176  0.04 14.65 ? 490  SER A O    1  
ATOM   6365   C CB   . SER A 1 434 ? 19.595  -4.971  33.600  0.04 14.13 ? 490  SER A CB   1  
ATOM   6366   O OG   . SER A 1 434 ? 18.894  -3.772  33.968  0.04 14.10 ? 490  SER A OG   1  
ATOM   6367   H H    . SER A 1 434 ? 19.599  -4.612  31.047  0.04 13.57 ? 490  SER A H    1  
ATOM   6368   H HA   . SER A 1 434 ? 21.310  -3.971  33.032  0.04 14.19 ? 490  SER A HA   1  
ATOM   6369   H HB2  . SER A 1 434 ? 18.983  -5.602  33.196  0.04 13.95 ? 490  SER A HB2  1  
ATOM   6370   H HB3  . SER A 1 434 ? 19.999  -5.374  34.378  0.04 14.40 ? 490  SER A HB3  1  
ATOM   6371   H HG   . SER A 1 434 ? 18.567  -3.410  33.302  0.04 13.90 ? 490  SER A HG   1  
ATOM   6372   N N    . GLY A 1 435 ? 21.266  -6.551  31.235  0.04 14.09 ? 491  GLY A N    1  
ATOM   6373   C CA   . GLY A 1 435 ? 22.003  -7.753  30.873  0.04 14.29 ? 491  GLY A CA   1  
ATOM   6374   C C    . GLY A 1 435 ? 23.380  -7.494  30.272  0.04 14.38 ? 491  GLY A C    1  
ATOM   6375   O O    . GLY A 1 435 ? 23.683  -6.368  29.859  0.04 14.22 ? 491  GLY A O    1  
ATOM   6376   H H    . GLY A 1 435 ? 20.670  -6.316  30.666  0.04 13.85 ? 491  GLY A H    1  
ATOM   6377   H HA2  . GLY A 1 435 ? 22.099  -8.307  31.659  0.04 14.55 ? 491  GLY A HA2  1  
ATOM   6378   H HA3  . GLY A 1 435 ? 21.491  -8.247  30.221  0.04 14.14 ? 491  GLY A HA3  1  
ATOM   6379   N N    . GLU A 1 436 ? 24.187  -8.545  30.199  0.04 14.66 ? 492  GLU A N    1  
ATOM   6380   C CA   . GLU A 1 436 ? 25.566  -8.485  29.684  0.04 14.85 ? 492  GLU A CA   1  
ATOM   6381   C C    . GLU A 1 436 ? 25.646  -8.711  28.164  0.04 14.60 ? 492  GLU A C    1  
ATOM   6382   O O    . GLU A 1 436 ? 24.723  -9.245  27.534  0.04 14.42 ? 492  GLU A O    1  
ATOM   6383   C CB   . GLU A 1 436 ? 26.473  -9.487  30.438  0.04 15.35 ? 492  GLU A CB   1  
ATOM   6384   C CG   . GLU A 1 436 ? 26.647  -9.140  31.908  0.04 15.68 ? 492  GLU A CG   1  
ATOM   6385   C CD   . GLU A 1 436 ? 27.459  -7.870  32.130  0.04 15.80 ? 492  GLU A CD   1  
ATOM   6386   O OE1  . GLU A 1 436 ? 28.330  -7.557  31.283  0.04 15.60 ? 492  GLU A OE1  1  
ATOM   6387   O OE2  . GLU A 1 436 ? 27.268  -7.226  33.193  0.04 16.15 ? 492  GLU A OE2  1  
ATOM   6388   H H    . GLU A 1 436 ? 23.966  -9.333  30.468  0.04 14.78 ? 492  GLU A H    1  
ATOM   6389   H HA   . GLU A 1 436 ? 25.925  -7.607  29.874  0.04 14.86 ? 492  GLU A HA   1  
ATOM   6390   H HB2  . GLU A 1 436 ? 26.077  -10.369 30.381  0.04 15.38 ? 492  GLU A HB2  1  
ATOM   6391   H HB3  . GLU A 1 436 ? 27.354  -9.504  30.031  0.04 15.47 ? 492  GLU A HB3  1  
ATOM   6392   H HG2  . GLU A 1 436 ? 25.772  -9.016  32.312  0.04 15.54 ? 492  GLU A HG2  1  
ATOM   6393   H HG3  . GLU A 1 436 ? 27.114  -9.872  32.346  0.04 16.00 ? 492  GLU A HG3  1  
ATOM   6394   N N    . ASN A 1 437 ? 26.776  -8.289  27.587  0.04 14.65 ? 493  ASN A N    1  
ATOM   6395   C CA   . ASN A 1 437 ? 27.101  -8.444  26.163  0.04 14.53 ? 493  ASN A CA   1  
ATOM   6396   C C    . ASN A 1 437 ? 25.964  -8.057  25.184  0.04 14.09 ? 493  ASN A C    1  
ATOM   6397   O O    . ASN A 1 437 ? 25.805  -8.697  24.138  0.04 14.01 ? 493  ASN A O    1  
ATOM   6398   C CB   . ASN A 1 437 ? 27.673  -9.865  25.899  0.04 14.84 ? 493  ASN A CB   1  
ATOM   6399   C CG   . ASN A 1 437 ? 28.560  -9.985  24.593  0.04 14.86 ? 493  ASN A CG   1  
ATOM   6400   O OD1  . ASN A 1 437 ? 29.306  -9.054  24.152  0.04 14.83 ? 493  ASN A OD1  1  
ATOM   6401   N ND2  . ASN A 1 437 ? 28.482  -11.168 23.985  0.04 14.96 ? 493  ASN A ND2  1  
ATOM   6402   H H    . ASN A 1 437 ? 27.393  -7.894  28.025  0.04 14.78 ? 493  ASN A H    1  
ATOM   6403   H HA   . ASN A 1 437 ? 27.819  -7.825  25.978  0.04 14.58 ? 493  ASN A HA   1  
ATOM   6404   H HB2  . ASN A 1 437 ? 28.229  -10.137 26.648  0.04 15.14 ? 493  ASN A HB2  1  
ATOM   6405   H HB3  . ASN A 1 437 ? 26.918  -10.462 25.819  0.04 14.76 ? 493  ASN A HB3  1  
ATOM   6406   H HD21 . ASN A 1 437 ? 28.419  -11.215 23.127  0.04 14.88 ? 493  ASN A HD21 1  
ATOM   6407   H HD22 . ASN A 1 437 ? 28.475  -11.889 24.458  0.04 15.12 ? 493  ASN A HD22 1  
ATOM   6408   N N    . GLY A 1 438 ? 25.183  -7.014  25.510  0.04 13.83 ? 494  GLY A N    1  
ATOM   6409   C CA   . GLY A 1 438 ? 24.189  -6.483  24.584  0.04 13.45 ? 494  GLY A CA   1  
ATOM   6410   C C    . GLY A 1 438 ? 24.759  -5.695  23.434  0.04 13.37 ? 494  GLY A C    1  
ATOM   6411   O O    . GLY A 1 438 ? 25.842  -5.127  23.515  0.04 13.56 ? 494  GLY A O    1  
ATOM   6412   H H    . GLY A 1 438 ? 25.204  -6.605  26.260  0.04 13.89 ? 494  GLY A H    1  
ATOM   6413   H HA2  . GLY A 1 438 ? 23.677  -7.210  24.209  0.04 13.38 ? 494  GLY A HA2  1  
ATOM   6414   H HA3  . GLY A 1 438 ? 23.569  -5.909  25.056  0.04 13.32 ? 494  GLY A HA3  1  
ATOM   6415   N N    . LYS A 1 439 ? 24.001  -5.668  22.352  0.04 13.11 ? 495  LYS A N    1  
ATOM   6416   C CA   . LYS A 1 439 ? 24.394  -4.942  21.155  0.04 13.00 ? 495  LYS A CA   1  
ATOM   6417   C C    . LYS A 1 439 ? 23.150  -4.358  20.495  0.04 12.67 ? 495  LYS A C    1  
ATOM   6418   O O    . LYS A 1 439 ? 22.153  -5.076  20.305  0.04 12.53 ? 495  LYS A O    1  
ATOM   6419   C CB   . LYS A 1 439 ? 25.172  -5.887  20.226  0.04 13.09 ? 495  LYS A CB   1  
ATOM   6420   C CG   . LYS A 1 439 ? 26.601  -6.187  20.707  0.04 13.46 ? 495  LYS A CG   1  
ATOM   6421   C CD   . LYS A 1 439 ? 27.274  -7.132  19.761  0.04 13.59 ? 495  LYS A CD   1  
ATOM   6422   C CE   . LYS A 1 439 ? 28.480  -7.833  20.394  0.04 13.90 ? 495  LYS A CE   1  
ATOM   6423   N NZ   . LYS A 1 439 ? 29.026  -8.798  19.350  0.04 14.06 ? 495  LYS A NZ   1  
ATOM   6424   H H    . LYS A 1 439 ? 23.249  -6.073  22.284  0.04 13.01 ? 495  LYS A H    1  
ATOM   6425   H HA   . LYS A 1 439 ? 24.986  -4.233  21.408  0.04 13.11 ? 495  LYS A HA   1  
ATOM   6426   H HB2  . LYS A 1 439 ? 24.693  -6.723  20.163  0.04 13.00 ? 495  LYS A HB2  1  
ATOM   6427   H HB3  . LYS A 1 439 ? 25.236  -5.483  19.347  0.04 13.03 ? 495  LYS A HB3  1  
ATOM   6428   H HG2  . LYS A 1 439 ? 27.111  -5.364  20.742  0.04 13.58 ? 495  LYS A HG2  1  
ATOM   6429   H HG3  . LYS A 1 439 ? 26.582  -6.608  21.577  0.04 13.54 ? 495  LYS A HG3  1  
ATOM   6430   H HD2  . LYS A 1 439 ? 26.649  -7.811  19.468  0.04 13.69 ? 495  LYS A HD2  1  
ATOM   6431   H HD3  . LYS A 1 439 ? 27.589  -6.626  18.996  0.04 13.40 ? 495  LYS A HD3  1  
ATOM   6432   H HE2  . LYS A 1 439 ? 29.155  -7.173  20.608  0.04 13.83 ? 495  LYS A HE2  1  
ATOM   6433   H HE3  . LYS A 1 439 ? 28.214  -8.325  21.187  0.04 14.11 ? 495  LYS A HE3  1  
ATOM   6434   H HZ1  . LYS A 1 439 ? 29.293  -9.551  19.742  0.04 14.33 ? 495  LYS A HZ1  1  
ATOM   6435   H HZ2  . LYS A 1 439 ? 28.393  -8.992  18.762  0.04 13.98 ? 495  LYS A HZ2  1  
ATOM   6436   H HZ3  . LYS A 1 439 ? 29.714  -8.434  18.920  0.04 14.01 ? 495  LYS A HZ3  1  
ATOM   6437   N N    . THR A 1 440 ? 23.187  -3.031  20.243  0.04 12.60 ? 496  THR A N    1  
ATOM   6438   C CA   . THR A 1 440 ? 22.130  -2.303  19.510  0.04 12.34 ? 496  THR A CA   1  
ATOM   6439   C C    . THR A 1 440 ? 22.733  -1.657  18.270  0.04 12.37 ? 496  THR A C    1  
ATOM   6440   O O    . THR A 1 440 ? 23.681  -0.882  18.344  0.04 12.54 ? 496  THR A O    1  
ATOM   6441   C CB   . THR A 1 440 ? 21.409  -1.197  20.361  0.04 12.24 ? 496  THR A CB   1  
ATOM   6442   O OG1  . THR A 1 440 ? 20.623  -1.831  21.373  0.04 12.22 ? 496  THR A OG1  1  
ATOM   6443   C CG2  . THR A 1 440 ? 20.477  -0.347  19.488  0.04 12.02 ? 496  THR A CG2  1  
ATOM   6444   H H    . THR A 1 440 ? 23.827  -2.526  20.501  0.04 12.71 ? 496  THR A H    1  
ATOM   6445   H HA   . THR A 1 440 ? 21.452  -2.920  19.214  0.04 12.24 ? 496  THR A HA   1  
ATOM   6446   H HB   . THR A 1 440 ? 22.070  -0.621  20.770  0.04 12.35 ? 496  THR A HB   1  
ATOM   6447   H HG1  . THR A 1 440 ? 21.019  -2.510  21.661  0.04 12.34 ? 496  THR A HG1  1  
ATOM   6448   H HG21 . THR A 1 440 ? 19.966  0.260   20.046  0.04 11.96 ? 496  THR A HG21 1  
ATOM   6449   H HG22 . THR A 1 440 ? 20.984  0.174   18.845  0.04 12.06 ? 496  THR A HG22 1  
ATOM   6450   H HG23 . THR A 1 440 ? 19.860  -0.918  19.003  0.04 11.93 ? 496  THR A HG23 1  
ATOM   6451   N N    . ILE A 1 441 ? 22.153  -1.980  17.128  0.04 12.23 ? 497  ILE A N    1  
ATOM   6452   C CA   . ILE A 1 441 ? 22.515  -1.353  15.868  0.04 12.24 ? 497  ILE A CA   1  
ATOM   6453   C C    . ILE A 1 441 ? 21.272  -0.622  15.394  0.04 12.03 ? 497  ILE A C    1  
ATOM   6454   O O    . ILE A 1 441 ? 20.253  -1.229  15.075  0.04 11.89 ? 497  ILE A O    1  
ATOM   6455   C CB   . ILE A 1 441 ? 22.986  -2.396  14.830  0.04 12.33 ? 497  ILE A CB   1  
ATOM   6456   C CG1  . ILE A 1 441 ? 24.257  -3.109  15.307  0.04 12.58 ? 497  ILE A CG1  1  
ATOM   6457   C CG2  . ILE A 1 441 ? 23.264  -1.721  13.488  0.04 12.38 ? 497  ILE A CG2  1  
ATOM   6458   C CD1  . ILE A 1 441 ? 24.554  -4.397  14.553  0.04 12.69 ? 497  ILE A CD1  1  
ATOM   6459   H H    . ILE A 1 441 ? 21.528  -2.557  17.056  0.04 12.14 ? 497  ILE A H    1  
ATOM   6460   H HA   . ILE A 1 441 ? 23.228  -0.716  16.009  0.04 12.36 ? 497  ILE A HA   1  
ATOM   6461   H HB   . ILE A 1 441 ? 22.274  -3.043  14.708  0.04 12.22 ? 497  ILE A HB   1  
ATOM   6462   H HG12 . ILE A 1 441 ? 25.016  -2.526  15.150  0.04 12.71 ? 497  ILE A HG12 1  
ATOM   6463   H HG13 . ILE A 1 441 ? 24.199  -3.321  16.250  0.04 12.58 ? 497  ILE A HG13 1  
ATOM   6464   H HG21 . ILE A 1 441 ? 23.615  -2.392  12.882  0.04 12.46 ? 497  ILE A HG21 1  
ATOM   6465   H HG22 . ILE A 1 441 ? 22.440  -1.366  13.126  0.04 12.24 ? 497  ILE A HG22 1  
ATOM   6466   H HG23 . ILE A 1 441 ? 23.915  -1.013  13.602  0.04 12.49 ? 497  ILE A HG23 1  
ATOM   6467   H HD11 . ILE A 1 441 ? 25.366  -4.785  14.917  0.04 12.90 ? 497  ILE A HD11 1  
ATOM   6468   H HD12 . ILE A 1 441 ? 23.817  -5.017  14.667  0.04 12.65 ? 497  ILE A HD12 1  
ATOM   6469   H HD13 . ILE A 1 441 ? 24.682  -4.192  13.615  0.04 12.64 ? 497  ILE A HD13 1  
ATOM   6470   N N    . PHE A 1 442 ? 21.384  0.718   15.428  0.04 12.05 ? 498  PHE A N    1  
ATOM   6471   C CA   . PHE A 1 442 ? 20.323  1.704   15.184  0.04 11.92 ? 498  PHE A CA   1  
ATOM   6472   C C    . PHE A 1 442 ? 19.320  1.876   16.335  0.04 11.80 ? 498  PHE A C    1  
ATOM   6473   O O    . PHE A 1 442 ? 18.587  0.953   16.698  0.04 11.70 ? 498  PHE A O    1  
ATOM   6474   C CB   . PHE A 1 442 ? 19.571  1.520   13.861  0.04 11.83 ? 498  PHE A CB   1  
ATOM   6475   C CG   . PHE A 1 442 ? 18.566  2.649   13.606  0.04 11.75 ? 498  PHE A CG   1  
ATOM   6476   C CD1  . PHE A 1 442 ? 18.916  3.778   12.863  0.04 11.86 ? 498  PHE A CD1  1  
ATOM   6477   C CD2  . PHE A 1 442 ? 17.290  2.585   14.147  0.04 11.61 ? 498  PHE A CD2  1  
ATOM   6478   C CE1  . PHE A 1 442 ? 17.985  4.798   12.684  0.04 11.83 ? 498  PHE A CE1  1  
ATOM   6479   C CE2  . PHE A 1 442 ? 16.390  3.593   13.974  0.04 11.58 ? 498  PHE A CE2  1  
ATOM   6480   C CZ   . PHE A 1 442 ? 16.715  4.681   13.217  0.04 11.70 ? 498  PHE A CZ   1  
ATOM   6481   H H    . PHE A 1 442 ? 22.129  1.106   15.604  0.04 12.17 ? 498  PHE A H    1  
ATOM   6482   H HA   . PHE A 1 442 ? 20.753  2.559   15.097  0.04 12.00 ? 498  PHE A HA   1  
ATOM   6483   H HB2  . PHE A 1 442 ? 20.215  1.503   13.139  0.04 11.92 ? 498  PHE A HB2  1  
ATOM   6484   H HB3  . PHE A 1 442 ? 19.077  0.689   13.893  0.04 11.75 ? 498  PHE A HB3  1  
ATOM   6485   H HD1  . PHE A 1 442 ? 19.767  3.849   12.496  0.04 11.98 ? 498  PHE A HD1  1  
ATOM   6486   H HD2  . PHE A 1 442 ? 17.049  1.842   14.655  0.04 11.56 ? 498  PHE A HD2  1  
ATOM   6487   H HE1  . PHE A 1 442 ? 18.206  5.545   12.180  0.04 11.93 ? 498  PHE A HE1  1  
ATOM   6488   H HE2  . PHE A 1 442 ? 15.532  3.520   14.327  0.04 11.51 ? 498  PHE A HE2  1  
ATOM   6489   H HZ   . PHE A 1 442 ? 16.095  5.361   13.095  0.04 11.70 ? 498  PHE A HZ   1  
ATOM   6490   N N    . TYR A 1 443 ? 19.279  3.108   16.858  0.04 11.84 ? 499  TYR A N    1  
ATOM   6491   C CA   . TYR A 1 443 ? 18.288  3.504   17.840  0.04 11.76 ? 499  TYR A CA   1  
ATOM   6492   C C    . TYR A 1 443 ? 17.725  4.869   17.490  0.04 11.77 ? 499  TYR A C    1  
ATOM   6493   O O    . TYR A 1 443 ? 18.447  5.794   17.160  0.04 11.91 ? 499  TYR A O    1  
ATOM   6494   C CB   . TYR A 1 443 ? 18.903  3.548   19.262  0.04 11.89 ? 499  TYR A CB   1  
ATOM   6495   C CG   . TYR A 1 443 ? 17.931  3.914   20.375  0.04 11.85 ? 499  TYR A CG   1  
ATOM   6496   C CD1  . TYR A 1 443 ? 16.813  3.168   20.591  0.04 11.72 ? 499  TYR A CD1  1  
ATOM   6497   C CD2  . TYR A 1 443 ? 18.181  5.000   21.243  0.04 11.99 ? 499  TYR A CD2  1  
ATOM   6498   C CE1  . TYR A 1 443 ? 15.929  3.471   21.617  0.04 11.73 ? 499  TYR A CE1  1  
ATOM   6499   C CE2  . TYR A 1 443 ? 17.333  5.308   22.285  0.04 12.00 ? 499  TYR A CE2  1  
ATOM   6500   C CZ   . TYR A 1 443 ? 16.205  4.541   22.489  0.04 11.87 ? 499  TYR A CZ   1  
ATOM   6501   O OH   . TYR A 1 443 ? 15.280  4.782   23.496  0.04 11.90 ? 499  TYR A OH   1  
ATOM   6502   H H    . TYR A 1 443 ? 19.812  3.741   16.643  0.04 11.93 ? 499  TYR A H    1  
ATOM   6503   H HA   . TYR A 1 443 ? 17.569  2.865   17.840  0.04 11.67 ? 499  TYR A HA   1  
ATOM   6504   H HB2  . TYR A 1 443 ? 19.293  2.696   19.477  0.04 11.92 ? 499  TYR A HB2  1  
ATOM   6505   H HB3  . TYR A 1 443 ? 19.589  4.227   19.268  0.04 12.00 ? 499  TYR A HB3  1  
ATOM   6506   H HD1  . TYR A 1 443 ? 16.635  2.449   20.028  0.04 11.65 ? 499  TYR A HD1  1  
ATOM   6507   H HD2  . TYR A 1 443 ? 18.951  5.507   21.127  0.04 12.11 ? 499  TYR A HD2  1  
ATOM   6508   H HE1  . TYR A 1 443 ? 15.176  2.953   21.746  0.04 11.66 ? 499  TYR A HE1  1  
ATOM   6509   H HE2  . TYR A 1 443 ? 17.523  6.029   22.844  0.04 12.11 ? 499  TYR A HE2  1  
ATOM   6510   H HH   . TYR A 1 443 ? 15.681  4.805   24.232  0.04 12.00 ? 499  TYR A HH   1  
ATOM   6511   N N    . GLN A 1 444 ? 16.411  4.974   17.582  0.04 11.66 ? 500  GLN A N    1  
ATOM   6512   C CA   . GLN A 1 444 ? 15.682  6.229   17.422  0.04 11.71 ? 500  GLN A CA   1  
ATOM   6513   C C    . GLN A 1 444 ? 14.761  6.417   18.607  0.04 11.69 ? 500  GLN A C    1  
ATOM   6514   O O    . GLN A 1 444 ? 13.907  5.568   18.868  0.04 11.59 ? 500  GLN A O    1  
ATOM   6515   C CB   . GLN A 1 444 ? 14.858  6.224   16.125  0.04 11.67 ? 500  GLN A CB   1  
ATOM   6516   C CG   . GLN A 1 444 ? 14.065  7.513   15.889  0.04 11.78 ? 500  GLN A CG   1  
ATOM   6517   C CD   . GLN A 1 444 ? 12.749  7.572   16.615  0.04 11.74 ? 500  GLN A CD   1  
ATOM   6518   O OE1  . GLN A 1 444 ? 12.039  6.565   16.734  0.04 11.64 ? 500  GLN A OE1  1  
ATOM   6519   N NE2  . GLN A 1 444 ? 12.429  8.748   17.154  0.04 11.84 ? 500  GLN A NE2  1  
ATOM   6520   H H    . GLN A 1 444 ? 15.893  4.304   17.728  0.04 11.58 ? 500  GLN A H    1  
ATOM   6521   H HA   . GLN A 1 444 ? 16.289  6.986   17.395  0.04 11.82 ? 500  GLN A HA   1  
ATOM   6522   H HB2  . GLN A 1 444 ? 15.448  6.094   15.368  0.04 11.70 ? 500  GLN A HB2  1  
ATOM   6523   H HB3  . GLN A 1 444 ? 14.225  5.492   16.182  0.04 11.58 ? 500  GLN A HB3  1  
ATOM   6524   H HG2  . GLN A 1 444 ? 14.584  8.285   16.157  0.04 11.87 ? 500  GLN A HG2  1  
ATOM   6525   H HG3  . GLN A 1 444 ? 13.876  7.555   14.939  0.04 11.84 ? 500  GLN A HG3  1  
ATOM   6526   H HE21 . GLN A 1 444 ? 13.035  9.334   17.300  0.04 11.89 ? 500  GLN A HE21 1  
ATOM   6527   H HE22 . GLN A 1 444 ? 11.608  8.917   17.364  0.04 11.87 ? 500  GLN A HE22 1  
ATOM   6528   N N    . ASN A 1 445 ? 14.949  7.527   19.333  0.04 11.83 ? 501  ASN A N    1  
ATOM   6529   C CA   . ASN A 1 445 ? 14.065  7.899   20.430  0.04 11.87 ? 501  ASN A CA   1  
ATOM   6530   C C    . ASN A 1 445 ? 13.622  9.336   20.295  0.04 12.02 ? 501  ASN A C    1  
ATOM   6531   O O    . ASN A 1 445 ? 14.369  10.161  19.759  0.04 12.14 ? 501  ASN A O    1  
ATOM   6532   C CB   . ASN A 1 445 ? 14.828  7.781   21.747  0.04 11.97 ? 501  ASN A CB   1  
ATOM   6533   C CG   . ASN A 1 445 ? 14.154  8.539   22.871  0.04 12.10 ? 501  ASN A CG   1  
ATOM   6534   O OD1  . ASN A 1 445 ? 14.461  9.703   23.165  0.04 12.27 ? 501  ASN A OD1  1  
ATOM   6535   N ND2  . ASN A 1 445 ? 13.188  7.884   23.508  0.04 12.04 ? 501  ASN A ND2  1  
ATOM   6536   H H    . ASN A 1 445 ? 15.583  8.085   19.209  0.04 11.92 ? 501  ASN A H    1  
ATOM   6537   H HA   . ASN A 1 445 ? 13.286  7.330   20.462  0.04 11.79 ? 501  ASN A HA   1  
ATOM   6538   H HB2  . ASN A 1 445 ? 14.895  6.852   22.008  0.04 11.91 ? 501  ASN A HB2  1  
ATOM   6539   H HB3  . ASN A 1 445 ? 15.712  8.152   21.614  0.04 12.06 ? 501  ASN A HB3  1  
ATOM   6540   H HD21 . ASN A 1 445 ? 12.885  8.185   24.249  0.04 12.12 ? 501  ASN A HD21 1  
ATOM   6541   H HD22 . ASN A 1 445 ? 12.872  7.160   23.177  0.04 11.94 ? 501  ASN A HD22 1  
ATOM   6542   N N    . ALA A 1 446 ? 12.429  9.643   20.808  0.04 12.04 ? 502  ALA A N    1  
ATOM   6543   C CA   . ALA A 1 446 ? 12.060  11.024  21.154  0.04 12.24 ? 502  ALA A CA   1  
ATOM   6544   C C    . ALA A 1 446 ? 11.506  10.918  22.537  0.04 12.31 ? 502  ALA A C    1  
ATOM   6545   O O    . ALA A 1 446 ? 10.809  9.954   22.882  0.04 12.20 ? 502  ALA A O    1  
ATOM   6546   C CB   . ALA A 1 446 ? 11.047  11.602  20.195  0.04 12.27 ? 502  ALA A CB   1  
ATOM   6547   H H    . ALA A 1 446 ? 11.813  9.074   20.973  0.04 11.97 ? 502  ALA A H    1  
ATOM   6548   H HA   . ALA A 1 446 ? 12.847  11.581  21.164  0.04 12.35 ? 502  ALA A HA   1  
ATOM   6549   H HB1  . ALA A 1 446 ? 10.777  12.481  20.511  0.04 12.43 ? 502  ALA A HB1  1  
ATOM   6550   H HB2  . ALA A 1 446 ? 11.456  11.681  19.321  0.04 12.21 ? 502  ALA A HB2  1  
ATOM   6551   H HB3  . ALA A 1 446 ? 10.279  11.008  20.159  0.04 12.21 ? 502  ALA A HB3  1  
ATOM   6552   N N    . LYS A 1 447 ? 11.874  11.883  23.359  0.04 12.53 ? 503  LYS A N    1  
ATOM   6553   C CA   . LYS A 1 447 ? 11.357  11.977  24.687  0.04 12.66 ? 503  LYS A CA   1  
ATOM   6554   C C    . LYS A 1 447 ? 9.851   12.278  24.680  0.04 12.80 ? 503  LYS A C    1  
ATOM   6555   O O    . LYS A 1 447 ? 9.193   12.435  23.672  0.04 12.98 ? 503  LYS A O    1  
ATOM   6556   C CB   . LYS A 1 447 ? 12.222  12.958  25.521  0.04 12.88 ? 503  LYS A CB   1  
ATOM   6557   C CG   . LYS A 1 447 ? 13.709  12.443  25.728  0.04 12.85 ? 503  LYS A CG   1  
ATOM   6558   C CD   . LYS A 1 447 ? 13.818  11.124  26.507  0.04 12.75 ? 503  LYS A CD   1  
ATOM   6559   C CE   . LYS A 1 447 ? 13.192  11.242  27.878  0.04 12.90 ? 503  LYS A CE   1  
ATOM   6560   N NZ   . LYS A 1 447 ? 13.077  9.970   28.640  0.04 12.83 ? 503  LYS A NZ   1  
ATOM   6561   H H    . LYS A 1 447 ? 12.443  12.495  23.160  0.04 12.62 ? 503  LYS A H    1  
ATOM   6562   H HA   . LYS A 1 447 ? 11.461  11.104  25.088  0.04 12.56 ? 503  LYS A HA   1  
ATOM   6563   H HB2  . LYS A 1 447 ? 12.270  13.810  25.060  0.04 12.98 ? 503  LYS A HB2  1  
ATOM   6564   H HB3  . LYS A 1 447 ? 11.818  13.095  26.391  0.04 13.00 ? 503  LYS A HB3  1  
ATOM   6565   H HG2  . LYS A 1 447 ? 14.128  12.333  24.866  0.04 12.76 ? 503  LYS A HG2  1  
ATOM   6566   H HG3  . LYS A 1 447 ? 14.197  13.102  26.238  0.04 13.04 ? 503  LYS A HG3  1  
ATOM   6567   H HD2  . LYS A 1 447 ? 13.355  10.437  26.004  0.04 12.58 ? 503  LYS A HD2  1  
ATOM   6568   H HD3  . LYS A 1 447 ? 14.747  10.872  26.618  0.04 12.79 ? 503  LYS A HD3  1  
ATOM   6569   H HE2  . LYS A 1 447 ? 13.712  11.861  28.413  0.04 13.09 ? 503  LYS A HE2  1  
ATOM   6570   H HE3  . LYS A 1 447 ? 12.290  11.576  27.772  0.04 12.88 ? 503  LYS A HE3  1  
ATOM   6571   H HZ1  . LYS A 1 447 ? 12.518  9.421   28.219  0.04 12.69 ? 503  LYS A HZ1  1  
ATOM   6572   H HZ2  . LYS A 1 447 ? 13.870  9.573   28.703  0.04 12.83 ? 503  LYS A HZ2  1  
ATOM   6573   H HZ3  . LYS A 1 447 ? 12.766  10.128  29.456  0.04 12.96 ? 503  LYS A HZ3  1  
ATOM   6574   N N    . ALA A 1 448 ? 9.348   12.282  25.902  0.04 12.79 ? 504  ALA A N    1  
ATOM   6575   C CA   . ALA A 1 448 ? 7.980   12.645  26.197  0.04 12.95 ? 504  ALA A CA   1  
ATOM   6576   C C    . ALA A 1 448 ? 7.910   14.126  25.956  0.04 13.20 ? 504  ALA A C    1  
ATOM   6577   O O    . ALA A 1 448 ? 8.801   14.851  26.378  0.04 13.39 ? 504  ALA A O    1  
ATOM   6578   C CB   . ALA A 1 448 ? 7.626   12.327  27.696  0.04 13.07 ? 504  ALA A CB   1  
ATOM   6579   H H    . ALA A 1 448 ? 9.811   12.087  26.595  0.04 12.72 ? 504  ALA A H    1  
ATOM   6580   H HA   . ALA A 1 448 ? 7.372   12.199  25.592  0.04 12.85 ? 504  ALA A HA   1  
ATOM   6581   H HB1  . ALA A 1 448 ? 6.719   12.625  27.877  0.04 13.19 ? 504  ALA A HB1  1  
ATOM   6582   H HB2  . ALA A 1 448 ? 7.690   11.370  27.838  0.04 12.93 ? 504  ALA A HB2  1  
ATOM   6583   H HB3  . ALA A 1 448 ? 8.241   12.783  28.292  0.04 13.19 ? 504  ALA A HB3  1  
ATOM   6584   N N    . TYR A 1 449 ? 6.827   14.557  25.323  0.04 13.25 ? 505  TYR A N    1  
ATOM   6585   C CA   . TYR A 1 449 ? 6.619   15.984  25.054  0.04 13.53 ? 505  TYR A CA   1  
ATOM   6586   C C    . TYR A 1 449 ? 5.849   16.717  26.184  0.04 13.85 ? 505  TYR A C    1  
ATOM   6587   O O    . TYR A 1 449 ? 5.818   17.961  26.196  0.04 14.14 ? 505  TYR A O    1  
ATOM   6588   C CB   . TYR A 1 449 ? 5.874   16.210  23.727  0.04 13.56 ? 505  TYR A CB   1  
ATOM   6589   C CG   . TYR A 1 449 ? 6.340   15.449  22.514  0.04 13.34 ? 505  TYR A CG   1  
ATOM   6590   C CD1  . TYR A 1 449 ? 7.668   15.059  22.347  0.04 13.11 ? 505  TYR A CD1  1  
ATOM   6591   C CD2  . TYR A 1 449 ? 5.453   15.166  21.513  0.04 13.40 ? 505  TYR A CD2  1  
ATOM   6592   C CE1  . TYR A 1 449 ? 8.077   14.388  21.199  0.04 12.94 ? 505  TYR A CE1  1  
ATOM   6593   C CE2  . TYR A 1 449 ? 5.834   14.527  20.386  0.04 13.25 ? 505  TYR A CE2  1  
ATOM   6594   C CZ   . TYR A 1 449 ? 7.153   14.143  20.207  0.04 13.02 ? 505  TYR A CZ   1  
ATOM   6595   O OH   . TYR A 1 449 ? 7.563   13.472  19.061  0.04 12.91 ? 505  TYR A OH   1  
ATOM   6596   H H    . TYR A 1 449 ? 6.201   14.055  25.031  0.04 13.16 ? 505  TYR A H    1  
ATOM   6597   H HA   . TYR A 1 449 ? 7.488   16.405  24.956  0.04 13.55 ? 505  TYR A HA   1  
ATOM   6598   H HB2  . TYR A 1 449 ? 4.937   16.003  23.867  0.04 13.59 ? 505  TYR A HB2  1  
ATOM   6599   H HB3  . TYR A 1 449 ? 5.963   17.146  23.504  0.04 13.78 ? 505  TYR A HB3  1  
ATOM   6600   H HD1  . TYR A 1 449 ? 8.286   15.250  23.008  0.04 13.09 ? 505  TYR A HD1  1  
ATOM   6601   H HD2  . TYR A 1 449 ? 4.565   15.434  21.608  0.04 13.59 ? 505  TYR A HD2  1  
ATOM   6602   H HE1  . TYR A 1 449 ? 8.965   14.142  21.089  0.04 12.81 ? 505  TYR A HE1  1  
ATOM   6603   H HE2  . TYR A 1 449 ? 5.200   14.353  19.726  0.04 13.33 ? 505  TYR A HE2  1  
ATOM   6604   H HH   . TYR A 1 449 ? 8.379   13.583  18.934  0.04 12.78 ? 505  TYR A HH   1  
ATOM   6605   N N    . ASP A 1 450 ? 5.225   15.986  27.118  0.04 13.84 ? 506  ASP A N    1  
ATOM   6606   C CA   . ASP A 1 450 ? 4.326   16.605  28.122  0.04 14.14 ? 506  ASP A CA   1  
ATOM   6607   C C    . ASP A 1 450 ? 4.743   16.494  29.575  0.04 14.28 ? 506  ASP A C    1  
ATOM   6608   O O    . ASP A 1 450 ? 3.894   16.572  30.454  0.04 14.53 ? 506  ASP A O    1  
ATOM   6609   C CB   . ASP A 1 450 ? 2.913   16.042  28.011  0.04 14.08 ? 506  ASP A CB   1  
ATOM   6610   C CG   . ASP A 1 450 ? 2.893   14.786  27.360  0.04 13.72 ? 506  ASP A CG   1  
ATOM   6611   O OD1  . ASP A 1 450 ? 3.404   13.805  27.977  0.04 13.58 ? 506  ASP A OD1  1  
ATOM   6612   O OD2  . ASP A 1 450 ? 2.379   14.812  26.209  0.04 13.60 ? 506  ASP A OD2  1  
ATOM   6613   H H    . ASP A 1 450 ? 5.300   15.134  27.198  0.04 13.66 ? 506  ASP A H    1  
ATOM   6614   H HA   . ASP A 1 450 ? 4.246   17.552  27.929  0.04 14.34 ? 506  ASP A HA   1  
ATOM   6615   H HB2  . ASP A 1 450 ? 2.504   15.901  28.875  0.04 14.24 ? 506  ASP A HB2  1  
ATOM   6616   H HB3  . ASP A 1 450 ? 2.359   16.654  27.500  0.04 14.16 ? 506  ASP A HB3  1  
ATOM   6617   N N    . ALA A 1 451 ? 6.019   16.379  29.866  0.04 14.17 ? 507  ALA A N    1  
ATOM   6618   C CA   . ALA A 1 451 ? 6.441   16.622  31.242  0.04 14.36 ? 507  ALA A CA   1  
ATOM   6619   C C    . ALA A 1 451 ? 5.930   18.026  31.636  0.04 14.77 ? 507  ALA A C    1  
ATOM   6620   O O    . ALA A 1 451 ? 6.159   19.013  30.915  0.04 14.89 ? 507  ALA A O    1  
ATOM   6621   C CB   . ALA A 1 451 ? 7.944   16.514  31.377  0.04 14.25 ? 507  ALA A CB   1  
ATOM   6622   H H    . ALA A 1 451 ? 6.644   16.169  29.313  0.04 13.99 ? 507  ALA A H    1  
ATOM   6623   H HA   . ALA A 1 451 ? 6.042   15.961  31.825  0.04 14.34 ? 507  ALA A HA   1  
ATOM   6624   H HB1  . ALA A 1 451 ? 8.187   16.569  32.314  0.04 14.39 ? 507  ALA A HB1  1  
ATOM   6625   H HB2  . ALA A 1 451 ? 8.224   15.656  31.024  0.04 14.00 ? 507  ALA A HB2  1  
ATOM   6626   H HB3  . ALA A 1 451 ? 8.370   17.227  30.878  0.04 14.32 ? 507  ALA A HB3  1  
ATOM   6627   N N    . PRO A 1 452 ? 5.170   18.134  32.752  0.04 15.04 ? 508  PRO A N    1  
ATOM   6628   C CA   . PRO A 1 452 ? 4.643   19.480  32.982  0.04 15.46 ? 508  PRO A CA   1  
ATOM   6629   C C    . PRO A 1 452 ? 5.708   20.438  33.516  0.04 15.71 ? 508  PRO A C    1  
ATOM   6630   O O    . PRO A 1 452 ? 5.556   21.657  33.417  0.04 15.98 ? 508  PRO A O    1  
ATOM   6631   C CB   . PRO A 1 452 ? 3.474   19.273  33.959  0.04 15.68 ? 508  PRO A CB   1  
ATOM   6632   C CG   . PRO A 1 452 ? 3.494   17.889  34.415  0.04 15.43 ? 508  PRO A CG   1  
ATOM   6633   C CD   . PRO A 1 452 ? 4.455   17.103  33.535  0.04 15.00 ? 508  PRO A CD   1  
ATOM   6634   H HA   . PRO A 1 452 ? 4.280   19.844  32.158  0.04 15.47 ? 508  PRO A HA   1  
ATOM   6635   H HB2  . PRO A 1 452 ? 3.598   19.867  34.719  0.04 15.98 ? 508  PRO A HB2  1  
ATOM   6636   H HB3  . PRO A 1 452 ? 2.638   19.477  33.508  0.04 15.70 ? 508  PRO A HB3  1  
ATOM   6637   H HG2  . PRO A 1 452 ? 3.789   17.860  35.337  0.04 15.54 ? 508  PRO A HG2  1  
ATOM   6638   H HG3  . PRO A 1 452 ? 2.596   17.522  34.345  0.04 15.48 ? 508  PRO A HG3  1  
ATOM   6639   H HD2  . PRO A 1 452 ? 5.089   16.626  34.094  0.04 14.87 ? 508  PRO A HD2  1  
ATOM   6640   H HD3  . PRO A 1 452 ? 3.983   16.491  32.951  0.04 14.86 ? 508  PRO A HD3  1  
ATOM   6641   N N    . ASP A 1 453 ? 6.783   19.870  34.040  0.04 15.68 ? 509  ASP A N    1  
ATOM   6642   C CA   . ASP A 1 453 ? 7.885   20.657  34.556  0.04 15.95 ? 509  ASP A CA   1  
ATOM   6643   C C    . ASP A 1 453 ? 9.094   19.792  34.836  0.04 15.76 ? 509  ASP A C    1  
ATOM   6644   O O    . ASP A 1 453 ? 9.092   18.581  34.608  0.04 15.43 ? 509  ASP A O    1  
ATOM   6645   C CB   . ASP A 1 453 ? 7.462   21.496  35.759  0.04 16.45 ? 509  ASP A CB   1  
ATOM   6646   C CG   . ASP A 1 453 ? 6.646   20.732  36.755  0.04 16.52 ? 509  ASP A CG   1  
ATOM   6647   O OD1  . ASP A 1 453 ? 5.557   21.282  37.122  0.04 16.94 ? 509  ASP A OD1  1  
ATOM   6648   O OD2  . ASP A 1 453 ? 7.109   19.655  37.203  0.04 16.21 ? 509  ASP A OD2  1  
ATOM   6649   H H    . ASP A 1 453 ? 6.902   19.021  34.109  0.04 15.51 ? 509  ASP A H    1  
ATOM   6650   H HA   . ASP A 1 453 ? 8.154   21.291  33.870  0.04 15.97 ? 509  ASP A HA   1  
ATOM   6651   H HB2  . ASP A 1 453 ? 8.256   21.812  36.218  0.04 16.64 ? 509  ASP A HB2  1  
ATOM   6652   H HB3  . ASP A 1 453 ? 6.935   22.245  35.445  0.04 16.58 ? 509  ASP A HB3  1  
ATOM   6653   N N    . GLN A 1 454 ? 10.175  20.464  35.220  0.04 16.00 ? 510  GLN A N    1  
ATOM   6654   C CA   . GLN A 1 454 ? 11.431  19.817  35.550  0.04 15.88 ? 510  GLN A CA   1  
ATOM   6655   C C    . GLN A 1 454 ? 11.277  18.784  36.677  0.04 15.85 ? 510  GLN A C    1  
ATOM   6656   O O    . GLN A 1 454 ? 11.784  17.672  36.569  0.04 15.57 ? 510  GLN A O    1  
ATOM   6657   C CB   . GLN A 1 454 ? 12.458  20.880  35.922  0.04 16.24 ? 510  GLN A CB   1  
ATOM   6658   C CG   . GLN A 1 454 ? 13.880  20.389  35.840  0.04 16.15 ? 510  GLN A CG   1  
ATOM   6659   C CD   . GLN A 1 454 ? 14.281  20.084  34.401  0.04 15.80 ? 510  GLN A CD   1  
ATOM   6660   O OE1  . GLN A 1 454 ? 14.215  20.968  33.534  0.04 15.86 ? 510  GLN A OE1  1  
ATOM   6661   N NE2  . GLN A 1 454 ? 14.655  18.834  34.125  0.04 15.47 ? 510  GLN A NE2  1  
ATOM   6662   H H    . GLN A 1 454 ? 10.195  21.322  35.301  0.04 16.26 ? 510  GLN A H    1  
ATOM   6663   H HA   . GLN A 1 454 ? 11.753  19.344  34.770  0.04 15.60 ? 510  GLN A HA   1  
ATOM   6664   H HB2  . GLN A 1 454 ? 12.358  21.639  35.325  0.04 16.31 ? 510  GLN A HB2  1  
ATOM   6665   H HB3  . GLN A 1 454 ? 12.294  21.164  36.838  0.04 16.52 ? 510  GLN A HB3  1  
ATOM   6666   H HG2  . GLN A 1 454 ? 14.471  21.080  36.172  0.04 16.43 ? 510  GLN A HG2  1  
ATOM   6667   H HG3  . GLN A 1 454 ? 13.974  19.587  36.377  0.04 16.06 ? 510  GLN A HG3  1  
ATOM   6668   H HE21 . GLN A 1 454 ? 14.960  18.332  34.747  0.04 15.50 ? 510  GLN A HE21 1  
ATOM   6669   H HE22 . GLN A 1 454 ? 14.608  18.541  33.320  0.04 15.24 ? 510  GLN A HE22 1  
ATOM   6670   N N    . ALA A 1 455 ? 10.512  19.123  37.704  0.04 16.16 ? 511  ALA A N    1  
ATOM   6671   C CA   . ALA A 1 455 ? 10.305  18.201  38.823  0.04 16.22 ? 511  ALA A CA   1  
ATOM   6672   C C    . ALA A 1 455 ? 9.683   16.882  38.399  0.04 15.84 ? 511  ALA A C    1  
ATOM   6673   O O    . ALA A 1 455 ? 9.990   15.832  38.977  0.04 15.81 ? 511  ALA A O    1  
ATOM   6674   C CB   . ALA A 1 455 ? 9.444   18.862  39.853  0.04 16.65 ? 511  ALA A CB   1  
ATOM   6675   H H    . ALA A 1 455 ? 10.101  19.873  37.785  0.04 16.36 ? 511  ALA A H    1  
ATOM   6676   H HA   . ALA A 1 455 ? 11.164  18.003  39.226  0.04 16.28 ? 511  ALA A HA   1  
ATOM   6677   H HB1  . ALA A 1 455 ? 9.275   18.232  40.573  0.04 16.68 ? 511  ALA A HB1  1  
ATOM   6678   H HB2  . ALA A 1 455 ? 9.914   19.638  40.194  0.04 16.92 ? 511  ALA A HB2  1  
ATOM   6679   H HB3  . ALA A 1 455 ? 8.610   19.135  39.439  0.04 16.65 ? 511  ALA A HB3  1  
ATOM   6680   N N    . ALA A 1 456 ? 8.814   16.925  37.396  0.04 15.59 ? 512  ALA A N    1  
ATOM   6681   C CA   . ALA A 1 456 ? 8.126   15.709  36.916  0.04 15.27 ? 512  ALA A CA   1  
ATOM   6682   C C    . ALA A 1 456 ? 9.107   14.611  36.536  0.04 14.90 ? 512  ALA A C    1  
ATOM   6683   O O    . ALA A 1 456 ? 8.755   13.447  36.597  0.04 14.65 ? 512  ALA A O    1  
ATOM   6684   C CB   . ALA A 1 456 ? 7.169   16.039  35.744  0.04 15.20 ? 512  ALA A CB   1  
ATOM   6685   H H    . ALA A 1 456 ? 8.600   17.637  36.969  0.04 15.63 ? 512  ALA A H    1  
ATOM   6686   H HA   . ALA A 1 456 ? 7.579   15.360  37.635  0.04 15.38 ? 512  ALA A HA   1  
ATOM   6687   H HB1  . ALA A 1 456 ? 6.701   15.234  35.469  0.04 15.15 ? 512  ALA A HB1  1  
ATOM   6688   H HB2  . ALA A 1 456 ? 6.529   16.701  36.042  0.04 15.45 ? 512  ALA A HB2  1  
ATOM   6689   H HB3  . ALA A 1 456 ? 7.686   16.389  35.002  0.04 14.99 ? 512  ALA A HB3  1  
ATOM   6690   N N    . ILE A 1 457 ? 10.325  14.997  36.128  0.04 14.88 ? 513  ILE A N    1  
ATOM   6691   C CA   . ILE A 1 457 ? 11.309  14.055  35.551  0.04 14.60 ? 513  ILE A CA   1  
ATOM   6692   C C    . ILE A 1 457 ? 12.691  14.041  36.244  0.04 14.81 ? 513  ILE A C    1  
ATOM   6693   O O    . ILE A 1 457 ? 13.640  13.494  35.704  0.04 14.69 ? 513  ILE A O    1  
ATOM   6694   C CB   . ILE A 1 457 ? 11.465  14.263  34.020  0.04 14.37 ? 513  ILE A CB   1  
ATOM   6695   C CG1  . ILE A 1 457 ? 11.739  15.731  33.685  0.04 14.61 ? 513  ILE A CG1  1  
ATOM   6696   C CG2  . ILE A 1 457 ? 10.229  13.750  33.296  0.04 14.26 ? 513  ILE A CG2  1  
ATOM   6697   C CD1  . ILE A 1 457 ? 12.185  16.042  32.251  0.04 14.43 ? 513  ILE A CD1  1  
ATOM   6698   H H    . ILE A 1 457 ? 10.605  15.808  36.172  0.04 15.06 ? 513  ILE A H    1  
ATOM   6699   H HA   . ILE A 1 457 ? 10.957  13.157  35.658  0.04 14.44 ? 513  ILE A HA   1  
ATOM   6700   H HB   . ILE A 1 457 ? 12.223  13.736  33.711  0.04 14.17 ? 513  ILE A HB   1  
ATOM   6701   H HG12 . ILE A 1 457 ? 10.925  16.234  33.850  0.04 14.81 ? 513  ILE A HG12 1  
ATOM   6702   H HG13 . ILE A 1 457 ? 12.437  16.051  34.279  0.04 14.72 ? 513  ILE A HG13 1  
ATOM   6703   H HG21 . ILE A 1 457 ? 10.316  13.929  32.346  0.04 14.05 ? 513  ILE A HG21 1  
ATOM   6704   H HG22 . ILE A 1 457 ? 10.150  12.795  33.445  0.04 14.23 ? 513  ILE A HG22 1  
ATOM   6705   H HG23 . ILE A 1 457 ? 9.449   14.204  33.649  0.04 14.45 ? 513  ILE A HG23 1  
ATOM   6706   H HD11 . ILE A 1 457 ? 12.455  16.970  32.205  0.04 14.62 ? 513  ILE A HD11 1  
ATOM   6707   H HD12 . ILE A 1 457 ? 12.935  15.478  32.017  0.04 14.24 ? 513  ILE A HD12 1  
ATOM   6708   H HD13 . ILE A 1 457 ? 11.438  15.891  31.652  0.04 14.34 ? 513  ILE A HD13 1  
ATOM   6709   N N    . GLN A 1 458 ? 12.801  14.654  37.426  0.04 15.19 ? 514  GLN A N    1  
ATOM   6710   C CA   . GLN A 1 458 ? 13.999  14.516  38.268  0.04 15.45 ? 514  GLN A CA   1  
ATOM   6711   C C    . GLN A 1 458 ? 14.185  13.010  38.496  0.04 15.31 ? 514  GLN A C    1  
ATOM   6712   O O    . GLN A 1 458 ? 13.243  12.290  38.839  0.04 15.27 ? 514  GLN A O    1  
ATOM   6713   C CB   . GLN A 1 458 ? 13.894  15.309  39.581  0.04 15.91 ? 514  GLN A CB   1  
ATOM   6714   C CG   . GLN A 1 458 ? 15.224  15.746  40.255  0.04 16.23 ? 514  GLN A CG   1  
ATOM   6715   C CD   . GLN A 1 458 ? 16.262  16.510  39.354  0.04 16.27 ? 514  GLN A CD   1  
ATOM   6716   O OE1  . GLN A 1 458 ? 16.000  17.597  38.791  0.04 16.28 ? 514  GLN A OE1  1  
ATOM   6717   N NE2  . GLN A 1 458 ? 17.467  15.947  39.273  0.04 16.33 ? 514  GLN A NE2  1  
ATOM   6718   H H    . GLN A 1 458 ? 12.191  15.155  37.766  0.04 15.31 ? 514  GLN A H    1  
ATOM   6719   H HA   . GLN A 1 458 ? 14.772  14.846  37.785  0.04 15.45 ? 514  GLN A HA   1  
ATOM   6720   H HB2  . GLN A 1 458 ? 13.362  16.105  39.425  0.04 15.99 ? 514  GLN A HB2  1  
ATOM   6721   H HB3  . GLN A 1 458 ? 13.438  14.751  40.231  0.04 15.95 ? 514  GLN A HB3  1  
ATOM   6722   H HG2  . GLN A 1 458 ? 15.012  16.336  40.999  0.04 16.53 ? 514  GLN A HG2  1  
ATOM   6723   H HG3  . GLN A 1 458 ? 15.667  14.953  40.593  0.04 16.16 ? 514  GLN A HG3  1  
ATOM   6724   H HE21 . GLN A 1 458 ? 17.555  15.101  39.406  0.04 16.37 ? 514  GLN A HE21 1  
ATOM   6725   H HE22 . GLN A 1 458 ? 18.154  16.426  39.084  0.04 16.35 ? 514  GLN A HE22 1  
ATOM   6726   N N    . ASN A 1 459 ? 15.408  12.560  38.269  0.04 15.26 ? 515  ASN A N    1  
ATOM   6727   C CA   . ASN A 1 459 ? 15.756  11.143  38.251  0.04 15.15 ? 515  ASN A CA   1  
ATOM   6728   C C    . ASN A 1 459 ? 16.828  11.061  39.310  0.04 15.53 ? 515  ASN A C    1  
ATOM   6729   O O    . ASN A 1 459 ? 18.023  11.202  39.028  0.04 15.56 ? 515  ASN A O    1  
ATOM   6730   C CB   . ASN A 1 459 ? 16.277  10.793  36.864  0.04 14.80 ? 515  ASN A CB   1  
ATOM   6731   C CG   . ASN A 1 459 ? 17.186  9.548   36.817  0.04 14.70 ? 515  ASN A CG   1  
ATOM   6732   O OD1  . ASN A 1 459 ? 17.304  8.734   37.777  0.04 14.84 ? 515  ASN A OD1  1  
ATOM   6733   N ND2  . ASN A 1 459 ? 17.843  9.391   35.662  0.04 14.50 ? 515  ASN A ND2  1  
ATOM   6734   H H    . ASN A 1 459 ? 16.082  13.074  38.124  0.04 15.31 ? 515  ASN A H    1  
ATOM   6735   H HA   . ASN A 1 459 ? 14.997  10.589  38.483  0.04 15.12 ? 515  ASN A HA   1  
ATOM   6736   H HB2  . ASN A 1 459 ? 15.518  10.634  36.279  0.04 14.58 ? 515  ASN A HB2  1  
ATOM   6737   H HB3  . ASN A 1 459 ? 16.785  11.546  36.534  0.04 14.86 ? 515  ASN A HB3  1  
ATOM   6738   H HD21 . ASN A 1 459 ? 18.417  8.757   35.581  0.04 14.42 ? 515  ASN A HD21 1  
ATOM   6739   H HD22 . ASN A 1 459 ? 17.698  9.929   35.008  0.04 14.46 ? 515  ASN A HD22 1  
ATOM   6740   N N    . GLY A 1 460 ? 16.432  10.894  40.559  0.04 15.87 ? 516  GLY A N    1  
ATOM   6741   C CA   . GLY A 1 460 ? 17.425  11.026  41.610  0.04 16.30 ? 516  GLY A CA   1  
ATOM   6742   C C    . GLY A 1 460 ? 18.051  12.423  41.519  0.04 16.51 ? 516  GLY A C    1  
ATOM   6743   O O    . GLY A 1 460 ? 17.336  13.414  41.688  0.04 16.57 ? 516  GLY A O    1  
ATOM   6744   H H    . GLY A 1 460 ? 15.631  10.723  40.820  0.04 15.89 ? 516  GLY A H    1  
ATOM   6745   H HA2  . GLY A 1 460 ? 17.011  10.900  42.477  0.04 16.52 ? 516  GLY A HA2  1  
ATOM   6746   H HA3  . GLY A 1 460 ? 18.122  10.361  41.491  0.04 16.26 ? 516  GLY A HA3  1  
ATOM   6747   N N    . ASP A 1 461 ? 19.342  12.533  41.176  0.04 16.67 ? 517  ASP A N    1  
ATOM   6748   C CA   . ASP A 1 461 ? 19.970  13.855  40.966  0.04 16.84 ? 517  ASP A CA   1  
ATOM   6749   C C    . ASP A 1 461 ? 20.467  14.114  39.545  0.04 16.46 ? 517  ASP A C    1  
ATOM   6750   O O    . ASP A 1 461 ? 21.350  14.969  39.312  0.04 16.60 ? 517  ASP A O    1  
ATOM   6751   C CB   . ASP A 1 461 ? 21.127  14.023  41.916  0.04 17.30 ? 517  ASP A CB   1  
ATOM   6752   C CG   . ASP A 1 461 ? 21.913  12.800  42.009  0.04 17.30 ? 517  ASP A CG   1  
ATOM   6753   O OD1  . ASP A 1 461 ? 22.193  12.252  40.916  0.04 17.04 ? 517  ASP A OD1  1  
ATOM   6754   O OD2  . ASP A 1 461 ? 22.201  12.385  43.165  0.04 17.61 ? 517  ASP A OD2  1  
ATOM   6755   H H    . ASP A 1 461 ? 19.870  11.866  41.051  0.04 16.70 ? 517  ASP A H    1  
ATOM   6756   H HA   . ASP A 1 461 ? 19.337  14.559  41.178  0.04 16.94 ? 517  ASP A HA   1  
ATOM   6757   H HB2  . ASP A 1 461 ? 21.717  14.729  41.617  0.04 17.37 ? 517  ASP A HB2  1  
ATOM   6758   H HB3  . ASP A 1 461 ? 20.797  14.227  42.810  0.04 17.60 ? 517  ASP A HB3  1  
ATOM   6759   N N    . ILE A 1 462 ? 19.894  13.359  38.607  0.04 16.03 ? 518  ILE A N    1  
ATOM   6760   C CA   . ILE A 1 462 ? 20.029  13.609  37.177  0.04 15.68 ? 518  ILE A CA   1  
ATOM   6761   C C    . ILE A 1 462 ? 18.766  14.338  36.757  0.04 15.49 ? 518  ILE A C    1  
ATOM   6762   O O    . ILE A 1 462 ? 17.654  14.050  37.264  0.04 15.36 ? 518  ILE A O    1  
ATOM   6763   C CB   . ILE A 1 462 ? 20.162  12.278  36.392  0.04 15.34 ? 518  ILE A CB   1  
ATOM   6764   C CG1  . ILE A 1 462 ? 21.407  11.491  36.888  0.04 15.58 ? 518  ILE A CG1  1  
ATOM   6765   C CG2  . ILE A 1 462 ? 20.213  12.478  34.852  0.04 15.00 ? 518  ILE A CG2  1  
ATOM   6766   C CD1  . ILE A 1 462 ? 21.477  10.033  36.417  0.04 15.33 ? 518  ILE A CD1  1  
ATOM   6767   H H    . ILE A 1 462 ? 19.404  12.675  38.785  0.04 15.95 ? 518  ILE A H    1  
ATOM   6768   H HA   . ILE A 1 462 ? 20.801  14.169  36.998  0.04 15.82 ? 518  ILE A HA   1  
ATOM   6769   H HB   . ILE A 1 462 ? 19.373  11.749  36.589  0.04 15.21 ? 518  ILE A HB   1  
ATOM   6770   H HG12 . ILE A 1 462 ? 22.212  11.946  36.593  0.04 15.76 ? 518  ILE A HG12 1  
ATOM   6771   H HG13 . ILE A 1 462 ? 21.387  11.482  37.856  0.04 15.77 ? 518  ILE A HG13 1  
ATOM   6772   H HG21 . ILE A 1 462 ? 20.700  11.747  34.447  0.04 14.83 ? 518  ILE A HG21 1  
ATOM   6773   H HG22 . ILE A 1 462 ? 19.310  12.506  34.500  0.04 14.85 ? 518  ILE A HG22 1  
ATOM   6774   H HG23 . ILE A 1 462 ? 20.671  13.315  34.664  0.04 15.15 ? 518  ILE A HG23 1  
ATOM   6775   H HD11 . ILE A 1 462 ? 22.363  9.692   36.620  0.04 15.53 ? 518  ILE A HD11 1  
ATOM   6776   H HD12 . ILE A 1 462 ? 20.805  9.513   36.893  0.04 15.21 ? 518  ILE A HD12 1  
ATOM   6777   H HD13 . ILE A 1 462 ? 21.318  9.978   35.460  0.04 15.11 ? 518  ILE A HD13 1  
ATOM   6778   N N    . LYS A 1 463 ? 18.908  15.295  35.834  0.04 15.48 ? 519  LYS A N    1  
ATOM   6779   C CA   . LYS A 1 463 ? 17.746  15.924  35.221  0.04 15.33 ? 519  LYS A CA   1  
ATOM   6780   C C    . LYS A 1 463 ? 17.186  15.071  34.062  0.04 14.88 ? 519  LYS A C    1  
ATOM   6781   O O    . LYS A 1 463 ? 17.811  14.940  33.030  0.04 14.74 ? 519  LYS A O    1  
ATOM   6782   C CB   . LYS A 1 463 ? 18.086  17.353  34.751  0.04 15.54 ? 519  LYS A CB   1  
ATOM   6783   C CG   . LYS A 1 463 ? 18.245  18.342  35.919  0.04 16.02 ? 519  LYS A CG   1  
ATOM   6784   C CD   . LYS A 1 463 ? 18.192  19.839  35.503  0.04 16.18 ? 519  LYS A CD   1  
ATOM   6785   C CE   . LYS A 1 463 ? 18.559  20.824  36.655  0.04 16.68 ? 519  LYS A CE   1  
ATOM   6786   N NZ   . LYS A 1 463 ? 19.237  21.948  35.982  0.04 16.72 ? 519  LYS A NZ   1  
ATOM   6787   H H    . LYS A 1 463 ? 19.664  15.594  35.555  0.04 15.59 ? 519  LYS A H    1  
ATOM   6788   H HA   . LYS A 1 463 ? 17.040  16.005  35.880  0.04 15.41 ? 519  LYS A HA   1  
ATOM   6789   H HB2  . LYS A 1 463 ? 18.926  17.325  34.269  0.04 15.55 ? 519  LYS A HB2  1  
ATOM   6790   H HB3  . LYS A 1 463 ? 17.379  17.677  34.174  0.04 15.39 ? 519  LYS A HB3  1  
ATOM   6791   H HG2  . LYS A 1 463 ? 17.515  18.198  36.544  0.04 16.05 ? 519  LYS A HG2  1  
ATOM   6792   H HG3  . LYS A 1 463 ? 19.094  18.185  36.359  0.04 16.21 ? 519  LYS A HG3  1  
ATOM   6793   H HD2  . LYS A 1 463 ? 18.810  19.975  34.772  0.04 16.00 ? 519  LYS A HD2  1  
ATOM   6794   H HD3  . LYS A 1 463 ? 17.292  20.054  35.221  0.04 16.15 ? 519  LYS A HD3  1  
ATOM   6795   H HE2  . LYS A 1 463 ? 17.761  21.151  37.097  0.04 16.90 ? 519  LYS A HE2  1  
ATOM   6796   H HE3  . LYS A 1 463 ? 19.178  20.424  37.284  0.04 16.77 ? 519  LYS A HE3  1  
ATOM   6797   H HZ1  . LYS A 1 463 ? 19.520  22.549  36.576  0.04 17.03 ? 519  LYS A HZ1  1  
ATOM   6798   H HZ2  . LYS A 1 463 ? 19.940  21.634  35.527  0.04 16.53 ? 519  LYS A HZ2  1  
ATOM   6799   H HZ3  . LYS A 1 463 ? 18.681  22.339  35.407  0.04 16.66 ? 519  LYS A HZ3  1  
ATOM   6800   N N    . GLY A 1 464 ? 15.996  14.509  34.228  0.04 14.68 ? 520  GLY A N    1  
ATOM   6801   C CA   . GLY A 1 464 ? 15.433  13.631  33.210  0.04 14.29 ? 520  GLY A CA   1  
ATOM   6802   C C    . GLY A 1 464 ? 15.933  12.206  33.345  0.04 14.14 ? 520  GLY A C    1  
ATOM   6803   O O    . GLY A 1 464 ? 16.867  11.922  34.106  0.04 14.34 ? 520  GLY A O    1  
ATOM   6804   H H    . GLY A 1 464 ? 15.494  14.612  34.917  0.04 14.79 ? 520  GLY A H    1  
ATOM   6805   H HA2  . GLY A 1 464 ? 14.468  13.624  33.286  0.04 14.22 ? 520  GLY A HA2  1  
ATOM   6806   H HA3  . GLY A 1 464 ? 15.667  13.957  32.330  0.04 14.20 ? 520  GLY A HA3  1  
ATOM   6807   N N    . TYR A 1 465 ? 15.306  11.333  32.564  0.04 13.82 ? 521  TYR A N    1  
ATOM   6808   C CA   . TYR A 1 465 ? 15.659  9.916   32.467  0.04 13.64 ? 521  TYR A CA   1  
ATOM   6809   C C    . TYR A 1 465 ? 16.216  9.659   31.094  0.04 13.40 ? 521  TYR A C    1  
ATOM   6810   O O    . TYR A 1 465 ? 15.590  10.019  30.072  0.04 13.22 ? 521  TYR A O    1  
ATOM   6811   C CB   . TYR A 1 465 ? 14.405  9.067   32.654  0.04 13.50 ? 521  TYR A CB   1  
ATOM   6812   C CG   . TYR A 1 465 ? 13.853  9.044   34.059  0.04 13.76 ? 521  TYR A CG   1  
ATOM   6813   C CD1  . TYR A 1 465 ? 12.937  9.996   34.459  0.04 13.94 ? 521  TYR A CD1  1  
ATOM   6814   C CD2  . TYR A 1 465 ? 14.254  8.077   34.981  0.04 13.86 ? 521  TYR A CD2  1  
ATOM   6815   C CE1  . TYR A 1 465 ? 12.402  9.989   35.734  0.04 14.20 ? 521  TYR A CE1  1  
ATOM   6816   C CE2  . TYR A 1 465 ? 13.745  8.079   36.273  0.04 14.14 ? 521  TYR A CE2  1  
ATOM   6817   C CZ   . TYR A 1 465 ? 12.821  9.035   36.639  0.04 14.30 ? 521  TYR A CZ   1  
ATOM   6818   O OH   . TYR A 1 465 ? 12.254  9.047   37.881  0.04 14.60 ? 521  TYR A OH   1  
ATOM   6819   H H    . TYR A 1 465 ? 14.652  11.550  32.051  0.04 13.71 ? 521  TYR A H    1  
ATOM   6820   H HA   . TYR A 1 465 ? 16.321  9.675   33.132  0.04 13.80 ? 521  TYR A HA   1  
ATOM   6821   H HB2  . TYR A 1 465 ? 13.704  9.412   32.081  0.04 13.41 ? 521  TYR A HB2  1  
ATOM   6822   H HB3  . TYR A 1 465 ? 14.603  8.148   32.403  0.04 13.36 ? 521  TYR A HB3  1  
ATOM   6823   H HD1  . TYR A 1 465 ? 12.653  10.638  33.853  0.04 13.89 ? 521  TYR A HD1  1  
ATOM   6824   H HD2  . TYR A 1 465 ? 14.880  7.440   34.733  0.04 13.78 ? 521  TYR A HD2  1  
ATOM   6825   H HE1  . TYR A 1 465 ? 11.780  10.631  35.989  0.04 14.34 ? 521  TYR A HE1  1  
ATOM   6826   H HE2  . TYR A 1 465 ? 14.010  7.425   36.884  0.04 14.23 ? 521  TYR A HE2  1  
ATOM   6827   H HH   . TYR A 1 465 ? 12.557  8.415   38.340  0.04 14.65 ? 521  TYR A HH   1  
ATOM   6828   N N    . ALA A 1 466 ? 17.403  9.066   31.019  0.04 13.43 ? 522  ALA A N    1  
ATOM   6829   C CA   . ALA A 1 466 ? 17.973  8.753   29.705  0.04 13.24 ? 522  ALA A CA   1  
ATOM   6830   C C    . ALA A 1 466 ? 16.980  8.015   28.782  0.04 12.93 ? 522  ALA A C    1  
ATOM   6831   O O    . ALA A 1 466 ? 16.183  7.181   29.227  0.04 12.86 ? 522  ALA A O    1  
ATOM   6832   C CB   . ALA A 1 466 ? 19.219  7.929   29.841  0.04 13.33 ? 522  ALA A CB   1  
ATOM   6833   H H    . ALA A 1 466 ? 17.892  8.837   31.688  0.04 13.58 ? 522  ALA A H    1  
ATOM   6834   H HA   . ALA A 1 466 ? 18.226  9.588   29.274  0.04 13.29 ? 522  ALA A HA   1  
ATOM   6835   H HB1  . ALA A 1 466 ? 19.583  7.776   28.959  0.04 13.24 ? 522  ALA A HB1  1  
ATOM   6836   H HB2  . ALA A 1 466 ? 19.853  8.410   30.393  0.04 13.55 ? 522  ALA A HB2  1  
ATOM   6837   H HB3  . ALA A 1 466 ? 18.999  7.082   30.256  0.04 13.28 ? 522  ALA A HB3  1  
ATOM   6838   N N    . ALA A 1 467 ? 17.095  8.280   27.487  0.04 12.77 ? 523  ALA A N    1  
ATOM   6839   C CA   . ALA A 1 467 ? 16.433  7.493   26.451  0.04 12.50 ? 523  ALA A CA   1  
ATOM   6840   C C    . ALA A 1 467 ? 16.951  6.070   26.412  0.04 12.43 ? 523  ALA A C    1  
ATOM   6841   O O    . ALA A 1 467 ? 16.248  5.177   25.933  0.04 12.25 ? 523  ALA A O    1  
ATOM   6842   C CB   . ALA A 1 467 ? 16.657  8.134   25.101  0.04 12.41 ? 523  ALA A CB   1  
ATOM   6843   H H    . ALA A 1 467 ? 17.575  8.918   27.175  0.04 12.83 ? 523  ALA A H    1  
ATOM   6844   H HA   . ALA A 1 467 ? 15.490  7.470   26.631  0.04 12.47 ? 523  ALA A HA   1  
ATOM   6845   H HB1  . ALA A 1 467 ? 16.265  7.568   24.414  0.04 12.26 ? 523  ALA A HB1  1  
ATOM   6846   H HB2  . ALA A 1 467 ? 16.237  9.007   25.092  0.04 12.46 ? 523  ALA A HB2  1  
ATOM   6847   H HB3  . ALA A 1 467 ? 17.609  8.216   24.943  0.04 12.49 ? 523  ALA A HB3  1  
ATOM   6848   N N    . TYR A 1 468 ? 18.209  5.892   26.819  0.04 12.59 ? 524  TYR A N    1  
ATOM   6849   C CA   . TYR A 1 468 ? 18.883  4.615   26.699  0.04 12.59 ? 524  TYR A CA   1  
ATOM   6850   C C    . TYR A 1 468 ? 19.929  4.541   27.798  0.04 12.88 ? 524  TYR A C    1  
ATOM   6851   O O    . TYR A 1 468 ? 20.958  5.228   27.754  0.04 13.06 ? 524  TYR A O    1  
ATOM   6852   C CB   . TYR A 1 468 ? 19.479  4.472   25.305  0.04 12.52 ? 524  TYR A CB   1  
ATOM   6853   C CG   . TYR A 1 468 ? 20.087  3.141   24.903  0.04 12.48 ? 524  TYR A CG   1  
ATOM   6854   C CD1  . TYR A 1 468 ? 21.368  2.774   25.336  0.04 12.70 ? 524  TYR A CD1  1  
ATOM   6855   C CD2  . TYR A 1 468 ? 19.452  2.300   23.988  0.04 12.26 ? 524  TYR A CD2  1  
ATOM   6856   C CE1  . TYR A 1 468 ? 21.954  1.592   24.904  0.04 12.70 ? 524  TYR A CE1  1  
ATOM   6857   C CE2  . TYR A 1 468 ? 20.016  1.123   23.585  0.04 12.26 ? 524  TYR A CE2  1  
ATOM   6858   C CZ   . TYR A 1 468 ? 21.287  0.784   24.005  0.04 12.47 ? 524  TYR A CZ   1  
ATOM   6859   O OH   . TYR A 1 468 ? 21.869  -0.380  23.529  0.04 12.50 ? 524  TYR A OH   1  
ATOM   6860   H H    . TYR A 1 468 ? 18.692  6.507   27.165  0.04 12.73 ? 524  TYR A H    1  
ATOM   6861   H HA   . TYR A 1 468 ? 18.238  3.904   26.831  0.04 12.50 ? 524  TYR A HA   1  
ATOM   6862   H HB2  . TYR A 1 468 ? 18.779  4.672   24.667  0.04 12.38 ? 524  TYR A HB2  1  
ATOM   6863   H HB3  . TYR A 1 468 ? 20.179  5.132   25.204  0.04 12.66 ? 524  TYR A HB3  1  
ATOM   6864   H HD1  . TYR A 1 468 ? 21.829  3.323   25.921  0.04 12.87 ? 524  TYR A HD1  1  
ATOM   6865   H HD2  . TYR A 1 468 ? 18.608  2.530   23.675  0.04 12.14 ? 524  TYR A HD2  1  
ATOM   6866   H HE1  . TYR A 1 468 ? 22.804  1.352   25.189  0.04 12.87 ? 524  TYR A HE1  1  
ATOM   6867   H HE2  . TYR A 1 468 ? 19.577  0.587   22.967  0.04 12.13 ? 524  TYR A HE2  1  
ATOM   6868   H HH   . TYR A 1 468 ? 22.600  -0.201  23.159  0.04 12.54 ? 524  TYR A HH   1  
ATOM   6869   N N    . LYS A 1 469 ? 19.610  3.734   28.797  0.04 12.95 ? 525  LYS A N    1  
ATOM   6870   C CA   . LYS A 1 469 ? 20.438  3.533   29.970  0.04 13.26 ? 525  LYS A CA   1  
ATOM   6871   C C    . LYS A 1 469 ? 21.044  2.151   30.013  0.04 13.34 ? 525  LYS A C    1  
ATOM   6872   O O    . LYS A 1 469 ? 20.364  1.151   29.888  0.04 13.23 ? 525  LYS A O    1  
ATOM   6873   C CB   . LYS A 1 469 ? 19.591  3.697   31.238  0.04 13.36 ? 525  LYS A CB   1  
ATOM   6874   C CG   . LYS A 1 469 ? 20.198  3.045   32.502  0.04 13.68 ? 525  LYS A CG   1  
ATOM   6875   C CD   . LYS A 1 469 ? 19.346  3.217   33.709  0.04 13.89 ? 525  LYS A CD   1  
ATOM   6876   C CE   . LYS A 1 469 ? 20.163  3.127   34.986  0.04 14.27 ? 525  LYS A CE   1  
ATOM   6877   N NZ   . LYS A 1 469 ? 20.819  4.435   35.289  0.04 14.58 ? 525  LYS A NZ   1  
ATOM   6878   H H    . LYS A 1 469 ? 18.879  3.281   28.822  0.04 12.84 ? 525  LYS A H    1  
ATOM   6879   H HA   . LYS A 1 469 ? 21.157  4.178   29.970  0.04 13.39 ? 525  LYS A HA   1  
ATOM   6880   H HB2  . LYS A 1 469 ? 19.461  4.640   31.415  0.04 13.39 ? 525  LYS A HB2  1  
ATOM   6881   H HB3  . LYS A 1 469 ? 18.728  3.286   31.076  0.04 13.20 ? 525  LYS A HB3  1  
ATOM   6882   H HG2  . LYS A 1 469 ? 20.286  2.085   32.378  0.04 13.65 ? 525  LYS A HG2  1  
ATOM   6883   H HG3  . LYS A 1 469 ? 21.066  3.441   32.678  0.04 13.82 ? 525  LYS A HG3  1  
ATOM   6884   H HD2  . LYS A 1 469 ? 18.958  4.098   33.673  0.04 13.91 ? 525  LYS A HD2  1  
ATOM   6885   H HD3  . LYS A 1 469 ? 18.650  2.542   33.730  0.04 13.78 ? 525  LYS A HD3  1  
ATOM   6886   H HE2  . LYS A 1 469 ? 19.587  2.899   35.732  0.04 14.36 ? 525  LYS A HE2  1  
ATOM   6887   H HE3  . LYS A 1 469 ? 20.854  2.451   34.890  0.04 14.28 ? 525  LYS A HE3  1  
ATOM   6888   H HZ1  . LYS A 1 469 ? 20.471  4.782   36.034  0.04 14.80 ? 525  LYS A HZ1  1  
ATOM   6889   H HZ2  . LYS A 1 469 ? 21.696  4.322   35.408  0.04 14.63 ? 525  LYS A HZ2  1  
ATOM   6890   H HZ3  . LYS A 1 469 ? 20.691  5.009   34.619  0.04 14.52 ? 525  LYS A HZ3  1  
ATOM   6891   N N    . VAL A 1 470 ? 22.339  2.104   30.260  0.04 13.57 ? 526  VAL A N    1  
ATOM   6892   C CA   . VAL A 1 470 ? 23.013  0.860   30.607  0.04 13.76 ? 526  VAL A CA   1  
ATOM   6893   C C    . VAL A 1 470 ? 23.274  0.997   32.096  0.04 14.11 ? 526  VAL A C    1  
ATOM   6894   O O    . VAL A 1 470 ? 24.028  1.888   32.523  0.04 14.33 ? 526  VAL A O    1  
ATOM   6895   C CB   . VAL A 1 470 ? 24.302  0.708   29.795  0.04 13.86 ? 526  VAL A CB   1  
ATOM   6896   C CG1  . VAL A 1 470 ? 25.175  -0.425  30.349  0.04 14.07 ? 526  VAL A CG1  1  
ATOM   6897   C CG2  . VAL A 1 470 ? 23.969  0.532   28.293  0.04 13.54 ? 526  VAL A CG2  1  
ATOM   6898   H H    . VAL A 1 470 ? 22.858  2.784   30.250  0.04 13.65 ? 526  VAL A H    1  
ATOM   6899   H HA   . VAL A 1 470 ? 22.447  0.088   30.461  0.04 13.64 ? 526  VAL A HA   1  
ATOM   6900   H HB   . VAL A 1 470 ? 24.808  1.534   29.867  0.04 14.03 ? 526  VAL A HB   1  
ATOM   6901   H HG11 . VAL A 1 470 ? 25.919  -0.581  29.744  0.04 14.21 ? 526  VAL A HG11 1  
ATOM   6902   H HG12 . VAL A 1 470 ? 25.513  -0.156  31.221  0.04 14.26 ? 526  VAL A HG12 1  
ATOM   6903   H HG13 . VAL A 1 470 ? 24.641  -1.229  30.431  0.04 13.90 ? 526  VAL A HG13 1  
ATOM   6904   H HG21 . VAL A 1 470 ? 24.767  0.241   27.826  0.04 13.64 ? 526  VAL A HG21 1  
ATOM   6905   H HG22 . VAL A 1 470 ? 23.264  -0.131  28.200  0.04 13.40 ? 526  VAL A HG22 1  
ATOM   6906   H HG23 . VAL A 1 470 ? 23.666  1.377   27.930  0.04 13.43 ? 526  VAL A HG23 1  
ATOM   6907   N N    . ASP A 1 471 ? 22.621  0.145   32.883  0.04 14.21 ? 527  ASP A N    1  
ATOM   6908   C CA   . ASP A 1 471 ? 22.866  0.058   34.326  0.04 14.58 ? 527  ASP A CA   1  
ATOM   6909   C C    . ASP A 1 471 ? 24.387  0.089   34.578  0.04 14.94 ? 527  ASP A C    1  
ATOM   6910   O O    . ASP A 1 471 ? 25.152  -0.499  33.817  0.04 14.97 ? 527  ASP A O    1  
ATOM   6911   C CB   . ASP A 1 471 ? 22.226  -1.233  34.873  0.04 14.68 ? 527  ASP A CB   1  
ATOM   6912   C CG   . ASP A 1 471 ? 20.692  -1.197  34.886  0.04 14.50 ? 527  ASP A CG   1  
ATOM   6913   O OD1  . ASP A 1 471 ? 20.118  -2.186  35.415  0.04 14.59 ? 527  ASP A OD1  1  
ATOM   6914   O OD2  . ASP A 1 471 ? 20.059  -0.210  34.415  0.04 14.32 ? 527  ASP A OD2  1  
ATOM   6915   H H    . ASP A 1 471 ? 22.033  -0.413  32.605  0.04 14.09 ? 527  ASP A H    1  
ATOM   6916   H HA   . ASP A 1 471 ? 22.461  0.816   34.772  0.04 14.56 ? 527  ASP A HA   1  
ATOM   6917   H HB2  . ASP A 1 471 ? 22.498  -1.982  34.321  0.04 14.59 ? 527  ASP A HB2  1  
ATOM   6918   H HB3  . ASP A 1 471 ? 22.530  -1.375  35.785  0.04 14.98 ? 527  ASP A HB3  1  
ATOM   6919   N N    . ASP A 1 472 ? 24.855  0.786   35.626  0.04 15.26 ? 528  ASP A N    1  
ATOM   6920   C CA   . ASP A 1 472 ? 26.308  0.976   35.771  0.04 15.67 ? 528  ASP A CA   1  
ATOM   6921   C C    . ASP A 1 472 ? 27.041  -0.331  36.213  0.04 15.97 ? 528  ASP A C    1  
ATOM   6922   O O    . ASP A 1 472 ? 28.257  -0.377  36.165  0.04 16.22 ? 528  ASP A O    1  
ATOM   6923   C CB   . ASP A 1 472 ? 26.647  2.158   36.703  0.04 16.00 ? 528  ASP A CB   1  
ATOM   6924   C CG   . ASP A 1 472 ? 25.951  3.498   36.284  0.04 15.79 ? 528  ASP A CG   1  
ATOM   6925   O OD1  . ASP A 1 472 ? 26.451  4.327   35.462  0.04 15.58 ? 528  ASP A OD1  1  
ATOM   6926   O OD2  . ASP A 1 472 ? 24.880  3.777   36.846  0.04 15.90 ? 528  ASP A OD2  1  
ATOM   6927   H H    . ASP A 1 472 ? 24.382  1.149   36.243  0.04 15.26 ? 528  ASP A H    1  
ATOM   6928   H HA   . ASP A 1 472 ? 26.664  1.211   34.901  0.04 15.59 ? 528  ASP A HA   1  
ATOM   6929   H HB2  . ASP A 1 472 ? 26.339  1.929   37.596  0.04 16.10 ? 528  ASP A HB2  1  
ATOM   6930   H HB3  . ASP A 1 472 ? 27.609  2.297   36.727  0.04 16.30 ? 528  ASP A HB3  1  
ATOM   6931   N N    . SER A 1 473 ? 26.298  -1.360  36.639  0.04 15.96 ? 529  SER A N    1  
ATOM   6932   C CA   . SER A 1 473 ? 26.840  -2.702  36.923  0.04 16.26 ? 529  SER A CA   1  
ATOM   6933   C C    . SER A 1 473 ? 27.137  -3.577  35.679  0.04 16.10 ? 529  SER A C    1  
ATOM   6934   O O    . SER A 1 473 ? 27.707  -4.674  35.769  0.04 16.43 ? 529  SER A O    1  
ATOM   6935   C CB   . SER A 1 473 ? 25.893  -3.487  37.849  0.04 16.26 ? 529  SER A CB   1  
ATOM   6936   O OG   . SER A 1 473 ? 24.647  -3.785  37.234  0.04 15.79 ? 529  SER A OG   1  
ATOM   6937   H H    . SER A 1 473 ? 25.454  -1.305  36.793  0.04 15.82 ? 529  SER A H    1  
ATOM   6938   H HA   . SER A 1 473 ? 27.683  -2.589  37.389  0.04 16.62 ? 529  SER A HA   1  
ATOM   6939   H HB2  . SER A 1 473 ? 26.328  -4.325  38.082  0.04 16.50 ? 529  SER A HB2  1  
ATOM   6940   H HB3  . SER A 1 473 ? 25.743  -2.968  38.653  0.04 16.38 ? 529  SER A HB3  1  
ATOM   6941   H HG   . SER A 1 473 ? 24.140  -4.167  37.782  0.04 15.77 ? 529  SER A HG   1  
ATOM   6942   N N    . VAL A 1 474 ? 26.727  -3.125  34.509  0.04 15.65 ? 530  VAL A N    1  
ATOM   6943   C CA   . VAL A 1 474 ? 27.082  -3.880  33.310  0.04 15.48 ? 530  VAL A CA   1  
ATOM   6944   C C    . VAL A 1 474 ? 28.601  -3.744  33.081  0.04 15.76 ? 530  VAL A C    1  
ATOM   6945   O O    . VAL A 1 474 ? 29.194  -2.733  33.492  0.04 15.85 ? 530  VAL A O    1  
ATOM   6946   C CB   . VAL A 1 474 ? 26.259  -3.384  32.090  0.04 14.96 ? 530  VAL A CB   1  
ATOM   6947   C CG1  . VAL A 1 474 ? 26.725  -3.997  30.780  0.04 14.82 ? 530  VAL A CG1  1  
ATOM   6948   C CG2  . VAL A 1 474 ? 24.769  -3.642  32.347  0.04 14.71 ? 530  VAL A CG2  1  
ATOM   6949   H H    . VAL A 1 474 ? 26.256  -2.419  34.384  0.04 15.45 ? 530  VAL A H    1  
ATOM   6950   H HA   . VAL A 1 474 ? 26.877  -4.815  33.447  0.04 15.54 ? 530  VAL A HA   1  
ATOM   6951   H HB   . VAL A 1 474 ? 26.381  -2.426  32.011  0.04 14.91 ? 530  VAL A HB   1  
ATOM   6952   H HG11 . VAL A 1 474 ? 26.193  -3.632  30.057  0.04 14.52 ? 530  VAL A HG11 1  
ATOM   6953   H HG12 . VAL A 1 474 ? 27.656  -3.781  30.629  0.04 14.90 ? 530  VAL A HG12 1  
ATOM   6954   H HG13 . VAL A 1 474 ? 26.606  -4.961  30.817  0.04 14.98 ? 530  VAL A HG13 1  
ATOM   6955   H HG21 . VAL A 1 474 ? 24.251  -3.292  31.606  0.04 14.42 ? 530  VAL A HG21 1  
ATOM   6956   H HG22 . VAL A 1 474 ? 24.634  -4.600  32.432  0.04 14.75 ? 530  VAL A HG22 1  
ATOM   6957   H HG23 . VAL A 1 474 ? 24.504  -3.203  33.170  0.04 14.85 ? 530  VAL A HG23 1  
ATOM   6958   N N    . THR A 1 475 ? 29.204  -4.744  32.429  0.04 15.93 ? 531  THR A N    1  
ATOM   6959   C CA   . THR A 1 475 ? 30.630  -4.746  32.075  0.04 16.25 ? 531  THR A CA   1  
ATOM   6960   C C    . THR A 1 475 ? 30.829  -4.621  30.549  0.04 15.97 ? 531  THR A C    1  
ATOM   6961   O O    . THR A 1 475 ? 31.870  -4.146  30.062  0.04 16.14 ? 531  THR A O    1  
ATOM   6962   C CB   . THR A 1 475 ? 31.325  -6.076  32.588  0.04 16.74 ? 531  THR A CB   1  
ATOM   6963   O OG1  . THR A 1 475 ? 31.148  -6.204  34.005  0.04 17.04 ? 531  THR A OG1  1  
ATOM   6964   C CG2  . THR A 1 475 ? 32.803  -6.095  32.318  0.04 17.14 ? 531  THR A CG2  1  
ATOM   6965   H H    . THR A 1 475 ? 28.796  -5.450  32.172  0.04 15.89 ? 531  THR A H    1  
ATOM   6966   H HA   . THR A 1 475 ? 31.069  -3.993  32.502  0.04 16.40 ? 531  THR A HA   1  
ATOM   6967   H HB   . THR A 1 475 ? 30.942  -6.849  32.139  0.04 16.63 ? 531  THR A HB   1  
ATOM   6968   H HG1  . THR A 1 475 ? 30.327  -6.188  34.194  0.04 16.84 ? 531  THR A HG1  1  
ATOM   6969   H HG21 . THR A 1 475 ? 33.194  -6.883  32.729  0.04 17.47 ? 531  THR A HG21 1  
ATOM   6970   H HG22 . THR A 1 475 ? 32.976  -6.128  31.361  0.04 16.98 ? 531  THR A HG22 1  
ATOM   6971   H HG23 . THR A 1 475 ? 33.216  -5.301  32.697  0.04 17.27 ? 531  THR A HG23 1  
ATOM   6972   N N    . THR A 1 476 ? 29.833  -5.072  29.794  0.04 15.60 ? 532  THR A N    1  
ATOM   6973   C CA   . THR A 1 476 ? 29.993  -5.426  28.397  0.04 15.41 ? 532  THR A CA   1  
ATOM   6974   C C    . THR A 1 476 ? 28.753  -4.927  27.655  0.04 14.88 ? 532  THR A C    1  
ATOM   6975   O O    . THR A 1 476 ? 27.669  -5.387  27.937  0.04 14.70 ? 532  THR A O    1  
ATOM   6976   C CB   . THR A 1 476 ? 30.089  -7.017  28.294  0.04 15.61 ? 532  THR A CB   1  
ATOM   6977   O OG1  . THR A 1 476 ? 31.134  -7.464  29.184  0.04 16.15 ? 532  THR A OG1  1  
ATOM   6978   C CG2  . THR A 1 476 ? 30.394  -7.450  26.927  0.04 15.42 ? 532  THR A CG2  1  
ATOM   6979   H H    . THR A 1 476 ? 29.029  -5.180  30.075  0.04 15.46 ? 532  THR A H    1  
ATOM   6980   H HA   . THR A 1 476 ? 30.784  -5.022  28.017  0.04 15.52 ? 532  THR A HA   1  
ATOM   6981   H HB   . THR A 1 476 ? 29.246  -7.424  28.529  0.04 15.54 ? 532  THR A HB   1  
ATOM   6982   H HG1  . THR A 1 476 ? 31.845  -7.034  29.039  0.04 16.31 ? 532  THR A HG1  1  
ATOM   6983   H HG21 . THR A 1 476 ? 30.467  -8.413  26.887  0.04 15.55 ? 532  THR A HG21 1  
ATOM   6984   H HG22 . THR A 1 476 ? 29.706  -7.141  26.323  0.04 15.08 ? 532  THR A HG22 1  
ATOM   6985   H HG23 . THR A 1 476 ? 31.240  -7.066  26.642  0.04 15.55 ? 532  THR A HG23 1  
ATOM   6986   N N    . HIS A 1 477 ? 28.904  -3.944  26.764  0.04 14.69 ? 533  HIS A N    1  
ATOM   6987   C CA   . HIS A 1 477 ? 27.791  -3.436  25.941  0.04 14.24 ? 533  HIS A CA   1  
ATOM   6988   C C    . HIS A 1 477 ? 28.310  -2.675  24.738  0.04 14.17 ? 533  HIS A C    1  
ATOM   6989   O O    . HIS A 1 477 ? 29.344  -2.031  24.845  0.04 14.44 ? 533  HIS A O    1  
ATOM   6990   C CB   . HIS A 1 477 ? 26.910  -2.444  26.730  0.04 14.08 ? 533  HIS A CB   1  
ATOM   6991   C CG   . HIS A 1 477 ? 25.612  -2.132  26.061  0.04 13.67 ? 533  HIS A CG   1  
ATOM   6992   N ND1  . HIS A 1 477 ? 24.491  -2.917  26.228  0.04 13.51 ? 533  HIS A ND1  1  
ATOM   6993   C CD2  . HIS A 1 477 ? 25.265  -1.155  25.185  0.04 13.42 ? 533  HIS A CD2  1  
ATOM   6994   C CE1  . HIS A 1 477 ? 23.511  -2.435  25.475  0.04 13.18 ? 533  HIS A CE1  1  
ATOM   6995   N NE2  . HIS A 1 477 ? 23.942  -1.346  24.858  0.04 13.12 ? 533  HIS A NE2  1  
ATOM   6996   H H    . HIS A 1 477 ? 29.652  -3.550  26.614  0.04 14.84 ? 533  HIS A H    1  
ATOM   6997   H HA   . HIS A 1 477 ? 27.244  -4.174  25.639  0.04 14.11 ? 533  HIS A HA   1  
ATOM   6998   H HB2  . HIS A 1 477 ? 26.707  -2.819  27.601  0.04 14.20 ? 533  HIS A HB2  1  
ATOM   6999   H HB3  . HIS A 1 477 ? 27.396  -1.614  26.835  0.04 14.17 ? 533  HIS A HB3  1  
ATOM   7000   H HD2  . HIS A 1 477 ? 25.813  -0.467  24.882  0.04 13.48 ? 533  HIS A HD2  1  
ATOM   7001   H HE1  . HIS A 1 477 ? 22.649  -2.773  25.429  0.04 13.04 ? 533  HIS A HE1  1  
ATOM   7002   N N    . GLU A 1 478 ? 27.571  -2.704  23.636  0.04 13.85 ? 534  GLU A N    1  
ATOM   7003   C CA   . GLU A 1 478 ? 27.927  -1.863  22.504  0.04 13.80 ? 534  GLU A CA   1  
ATOM   7004   C C    . GLU A 1 478 ? 26.751  -1.407  21.679  0.04 13.41 ? 534  GLU A C    1  
ATOM   7005   O O    . GLU A 1 478 ? 25.834  -2.191  21.379  0.04 13.20 ? 534  GLU A O    1  
ATOM   7006   C CB   . GLU A 1 478 ? 28.930  -2.559  21.624  0.04 14.02 ? 534  GLU A CB   1  
ATOM   7007   C CG   . GLU A 1 478 ? 29.536  -1.624  20.613  0.04 14.13 ? 534  GLU A CG   1  
ATOM   7008   C CD   . GLU A 1 478 ? 30.840  -2.115  20.091  0.04 14.50 ? 534  GLU A CD   1  
ATOM   7009   O OE1  . GLU A 1 478 ? 31.148  -3.333  20.218  0.04 14.62 ? 534  GLU A OE1  1  
ATOM   7010   O OE2  . GLU A 1 478 ? 31.547  -1.256  19.551  0.04 14.70 ? 534  GLU A OE2  1  
ATOM   7011   H H    . GLU A 1 478 ? 26.864  -3.175  23.518  0.04 13.67 ? 534  GLU A H    1  
ATOM   7012   H HA   . GLU A 1 478 ? 28.362  -1.081  22.850  0.04 13.92 ? 534  GLU A HA   1  
ATOM   7013   H HB2  . GLU A 1 478 ? 29.644  -2.918  22.174  0.04 14.27 ? 534  GLU A HB2  1  
ATOM   7014   H HB3  . GLU A 1 478 ? 28.492  -3.277  21.144  0.04 13.88 ? 534  GLU A HB3  1  
ATOM   7015   H HG2  . GLU A 1 478 ? 28.926  -1.506  19.868  0.04 13.92 ? 534  GLU A HG2  1  
ATOM   7016   H HG3  . GLU A 1 478 ? 29.698  -0.771  21.048  0.04 14.21 ? 534  GLU A HG3  1  
ATOM   7017   N N    . GLY A 1 479 ? 26.777  -0.128  21.295  0.04 13.35 ? 535  GLY A N    1  
ATOM   7018   C CA   . GLY A 1 479 ? 25.763  0.420   20.399  0.04 13.04 ? 535  GLY A CA   1  
ATOM   7019   C C    . GLY A 1 479 ? 26.305  1.294   19.287  0.04 13.10 ? 535  GLY A C    1  
ATOM   7020   O O    . GLY A 1 479 ? 27.381  1.882   19.392  0.04 13.35 ? 535  GLY A O    1  
ATOM   7021   H H    . GLY A 1 479 ? 27.369  0.436   21.550  0.04 13.51 ? 535  GLY A H    1  
ATOM   7022   H HA2  . GLY A 1 479 ? 25.290  -0.305  19.976  0.04 12.92 ? 535  GLY A HA2  1  
ATOM   7023   H HA3  . GLY A 1 479 ? 25.115  0.939   20.900  0.04 12.94 ? 535  GLY A HA3  1  
ATOM   7024   N N    . TRP A 1 480 ? 25.547  1.338   18.194  0.04 12.90 ? 536  TRP A N    1  
ATOM   7025   C CA   . TRP A 1 480 ? 25.937  2.025   16.967  0.04 12.97 ? 536  TRP A CA   1  
ATOM   7026   C C    . TRP A 1 480 ? 24.758  2.805   16.393  0.04 12.72 ? 536  TRP A C    1  
ATOM   7027   O O    . TRP A 1 480 ? 23.686  2.238   16.176  0.04 12.50 ? 536  TRP A O    1  
ATOM   7028   C CB   . TRP A 1 480 ? 26.279  1.003   15.910  0.04 13.06 ? 536  TRP A CB   1  
ATOM   7029   C CG   . TRP A 1 480 ? 27.535  0.205   16.051  0.04 13.35 ? 536  TRP A CG   1  
ATOM   7030   C CD1  . TRP A 1 480 ? 28.732  0.491   15.468  0.04 13.66 ? 536  TRP A CD1  1  
ATOM   7031   C CD2  . TRP A 1 480 ? 27.712  -1.053  16.734  0.04 13.40 ? 536  TRP A CD2  1  
ATOM   7032   N NE1  . TRP A 1 480 ? 29.630  -0.495  15.725  0.04 13.91 ? 536  TRP A NE1  1  
ATOM   7033   C CE2  . TRP A 1 480 ? 29.039  -1.465  16.493  0.04 13.76 ? 536  TRP A CE2  1  
ATOM   7034   C CE3  . TRP A 1 480 ? 26.877  -1.879  17.481  0.04 13.23 ? 536  TRP A CE3  1  
ATOM   7035   C CZ2  . TRP A 1 480 ? 29.567  -2.650  17.001  0.04 13.94 ? 536  TRP A CZ2  1  
ATOM   7036   C CZ3  . TRP A 1 480 ? 27.397  -3.065  17.991  0.04 13.41 ? 536  TRP A CZ3  1  
ATOM   7037   C CH2  . TRP A 1 480 ? 28.727  -3.444  17.731  0.04 13.76 ? 536  TRP A CH2  1  
ATOM   7038   H H    . TRP A 1 480 ? 24.771  0.981   18.139  0.04 12.74 ? 536  TRP A H    1  
ATOM   7039   H HA   . TRP A 1 480 ? 26.696  2.610   17.115  0.04 13.14 ? 536  TRP A HA   1  
ATOM   7040   H HB2  . TRP A 1 480 ? 25.543  0.371   15.856  0.04 12.89 ? 536  TRP A HB2  1  
ATOM   7041   H HB3  . TRP A 1 480 ? 26.336  1.474   15.067  0.04 13.11 ? 536  TRP A HB3  1  
ATOM   7042   H HD1  . TRP A 1 480 ? 28.906  1.242   14.946  0.04 13.73 ? 536  TRP A HD1  1  
ATOM   7043   H HE1  . TRP A 1 480 ? 30.448  -0.503  15.457  0.04 14.14 ? 536  TRP A HE1  1  
ATOM   7044   H HE3  . TRP A 1 480 ? 25.987  -1.654  17.629  0.04 13.02 ? 536  TRP A HE3  1  
ATOM   7045   H HZ2  . TRP A 1 480 ? 30.455  -2.882  16.851  0.04 14.20 ? 536  TRP A HZ2  1  
ATOM   7046   H HZ3  . TRP A 1 480 ? 26.850  -3.625  18.492  0.04 13.32 ? 536  TRP A HZ3  1  
ATOM   7047   H HH2  . TRP A 1 480 ? 29.051  -4.226  18.109  0.04 13.90 ? 536  TRP A HH2  1  
ATOM   7048   N N    . GLY A 1 481 ? 24.958  4.091   16.111  0.04 12.80 ? 537  GLY A N    1  
ATOM   7049   C CA   . GLY A 1 481 ? 24.001  4.838   15.314  0.04 12.65 ? 537  GLY A CA   1  
ATOM   7050   C C    . GLY A 1 481 ? 22.739  5.133   16.089  0.04 12.44 ? 537  GLY A C    1  
ATOM   7051   O O    . GLY A 1 481 ? 21.651  4.635   15.769  0.04 12.23 ? 537  GLY A O    1  
ATOM   7052   H H    . GLY A 1 481 ? 25.626  4.549   16.384  0.04 12.96 ? 537  GLY A H    1  
ATOM   7053   H HA2  . GLY A 1 481 ? 24.391  5.678   15.030  0.04 12.78 ? 537  GLY A HA2  1  
ATOM   7054   H HA3  . GLY A 1 481 ? 23.764  4.319   14.528  0.04 12.57 ? 537  GLY A HA3  1  
ATOM   7055   N N    . MET A 1 482 ? 22.863  5.987   17.106  0.04 12.54 ? 538  MET A N    1  
ATOM   7056   C CA   . MET A 1 482 ? 21.788  6.141   18.085  0.04 12.39 ? 538  MET A CA   1  
ATOM   7057   C C    . MET A 1 482 ? 21.482  7.597   18.354  0.04 12.49 ? 538  MET A C    1  
ATOM   7058   O O    . MET A 1 482 ? 22.389  8.406   18.567  0.04 12.72 ? 538  MET A O    1  
ATOM   7059   C CB   . MET A 1 482 ? 22.164  5.454   19.415  0.04 12.45 ? 538  MET A CB   1  
ATOM   7060   C CG   . MET A 1 482 ? 22.708  4.019   19.278  0.04 12.46 ? 538  MET A CG   1  
ATOM   7061   S SD   . MET A 1 482 ? 23.249  3.321   20.876  0.04 12.64 ? 538  MET A SD   1  
ATOM   7062   C CE   . MET A 1 482 ? 21.673  2.976   21.553  0.04 12.41 ? 538  MET A CE   1  
ATOM   7063   H H    . MET A 1 482 ? 23.548  6.478   17.253  0.04 12.70 ? 538  MET A H    1  
ATOM   7064   H HA   . MET A 1 482 ? 20.985  5.717   17.759  0.04 12.23 ? 538  MET A HA   1  
ATOM   7065   H HB2  . MET A 1 482 ? 22.861  5.973   19.840  0.04 12.63 ? 538  MET A HB2  1  
ATOM   7066   H HB3  . MET A 1 482 ? 21.382  5.419   19.987  0.04 12.35 ? 538  MET A HB3  1  
ATOM   7067   H HG2  . MET A 1 482 ? 22.017  3.446   18.915  0.04 12.30 ? 538  MET A HG2  1  
ATOM   7068   H HG3  . MET A 1 482 ? 23.477  4.020   18.688  0.04 12.56 ? 538  MET A HG3  1  
ATOM   7069   H HE1  . MET A 1 482 ? 21.564  3.446   22.393  0.04 12.50 ? 538  MET A HE1  1  
ATOM   7070   H HE2  . MET A 1 482 ? 21.003  3.271   20.917  0.04 12.32 ? 538  MET A HE2  1  
ATOM   7071   H HE3  . MET A 1 482 ? 21.603  2.020   21.684  0.04 12.31 ? 538  MET A HE3  1  
ATOM   7072   N N    . GLY A 1 483 ? 20.189  7.908   18.350  0.04 12.34 ? 539  GLY A N    1  
ATOM   7073   C CA   . GLY A 1 483 ? 19.732  9.283   18.531  0.04 12.44 ? 539  GLY A CA   1  
ATOM   7074   C C    . GLY A 1 483 ? 18.538  9.433   19.435  0.04 12.35 ? 539  GLY A C    1  
ATOM   7075   O O    . GLY A 1 483 ? 17.628  8.578   19.471  0.04 12.15 ? 539  GLY A O    1  
ATOM   7076   H H    . GLY A 1 483 ? 19.550  7.344   18.252  0.04 12.19 ? 539  GLY A H    1  
ATOM   7077   H HA2  . GLY A 1 483 ? 20.444  9.797   18.925  0.04 12.61 ? 539  GLY A HA2  1  
ATOM   7078   H HA3  . GLY A 1 483 ? 19.502  9.665   17.672  0.04 12.45 ? 539  GLY A HA3  1  
ATOM   7079   N N    . SER A 1 484 ? 18.539  10.539  20.184  0.04 12.52 ? 540  SER A N    1  
ATOM   7080   C CA   . SER A 1 484 ? 17.417  10.914  21.039  0.04 12.51 ? 540  SER A CA   1  
ATOM   7081   C C    . SER A 1 484 ? 17.057  12.360  20.790  0.04 12.69 ? 540  SER A C    1  
ATOM   7082   O O    . SER A 1 484 ? 17.939  13.195  20.762  0.04 12.91 ? 540  SER A O    1  
ATOM   7083   C CB   . SER A 1 484 ? 17.793  10.729  22.514  0.04 12.61 ? 540  SER A CB   1  
ATOM   7084   O OG   . SER A 1 484 ? 16.741  11.194  23.353  0.04 12.65 ? 540  SER A OG   1  
ATOM   7085   H H    . SER A 1 484 ? 19.188  11.092  20.216  0.04 12.68 ? 540  SER A H    1  
ATOM   7086   H HA   . SER A 1 484 ? 16.656  10.357  20.835  0.04 12.35 ? 540  SER A HA   1  
ATOM   7087   H HB2  . SER A 1 484 ? 17.960  9.789   22.679  0.04 12.51 ? 540  SER A HB2  1  
ATOM   7088   H HB3  . SER A 1 484 ? 18.592  11.243  22.701  0.04 12.77 ? 540  SER A HB3  1  
ATOM   7089   H HG   . SER A 1 484 ? 16.002  10.976  23.028  0.04 12.55 ? 540  SER A HG   1  
ATOM   7090   N N    . TYR A 1 485 ? 15.774  12.632  20.585  0.04 12.63 ? 541  TYR A N    1  
ATOM   7091   C CA   . TYR A 1 485 ? 15.293  13.986  20.244  0.04 12.82 ? 541  TYR A CA   1  
ATOM   7092   C C    . TYR A 1 485 ? 14.305  14.463  21.311  0.04 12.91 ? 541  TYR A C    1  
ATOM   7093   O O    . TYR A 1 485 ? 13.613  13.662  21.911  0.04 12.76 ? 541  TYR A O    1  
ATOM   7094   C CB   . TYR A 1 485 ? 14.595  13.985  18.890  0.04 12.74 ? 541  TYR A CB   1  
ATOM   7095   C CG   . TYR A 1 485 ? 15.216  13.085  17.856  0.04 12.60 ? 541  TYR A CG   1  
ATOM   7096   C CD1  . TYR A 1 485 ? 16.590  12.966  17.723  0.04 12.68 ? 541  TYR A CD1  1  
ATOM   7097   C CD2  . TYR A 1 485 ? 14.425  12.365  16.986  0.04 12.43 ? 541  TYR A CD2  1  
ATOM   7098   C CE1  . TYR A 1 485 ? 17.160  12.109  16.831  0.04 12.58 ? 541  TYR A CE1  1  
ATOM   7099   C CE2  . TYR A 1 485 ? 14.993  11.503  16.081  0.04 12.32 ? 541  TYR A CE2  1  
ATOM   7100   C CZ   . TYR A 1 485 ? 16.358  11.408  15.973  0.04 12.40 ? 541  TYR A CZ   1  
ATOM   7101   O OH   . TYR A 1 485 ? 16.965  10.556  15.054  0.04 12.33 ? 541  TYR A OH   1  
ATOM   7102   H H    . TYR A 1 485 ? 15.149  12.050  20.637  0.04 12.49 ? 541  TYR A H    1  
ATOM   7103   H HA   . TYR A 1 485 ? 16.031  14.600  20.204  0.04 12.99 ? 541  TYR A HA   1  
ATOM   7104   H HB2  . TYR A 1 485 ? 13.684  13.693  19.031  0.04 12.65 ? 541  TYR A HB2  1  
ATOM   7105   H HB3  . TYR A 1 485 ? 14.590  14.896  18.545  0.04 12.92 ? 541  TYR A HB3  1  
ATOM   7106   H HD1  . TYR A 1 485 ? 17.147  13.433  18.305  0.04 12.82 ? 541  TYR A HD1  1  
ATOM   7107   H HD2  . TYR A 1 485 ? 13.504  12.419  17.057  0.04 12.40 ? 541  TYR A HD2  1  
ATOM   7108   H HE1  . TYR A 1 485 ? 18.086  12.046  16.764  0.04 12.66 ? 541  TYR A HE1  1  
ATOM   7109   H HE2  . TYR A 1 485 ? 14.447  11.024  15.499  0.04 12.23 ? 541  TYR A HE2  1  
ATOM   7110   H HH   . TYR A 1 485 ? 16.931  9.766   15.337  0.04 12.26 ? 541  TYR A HH   1  
ATOM   7111   N N    . CYS A 1 486 ? 14.263  15.772  21.569  0.04 13.19 ? 542  CYS A N    1  
ATOM   7112   C CA   . CYS A 1 486 ? 13.320  16.326  22.538  0.04 13.33 ? 542  CYS A CA   1  
ATOM   7113   C C    . CYS A 1 486 ? 12.437  17.389  21.897  0.04 13.51 ? 542  CYS A C    1  
ATOM   7114   O O    . CYS A 1 486 ? 12.815  18.041  20.949  0.04 13.64 ? 542  CYS A O    1  
ATOM   7115   C CB   . CYS A 1 486 ? 14.011  16.859  23.808  0.04 13.56 ? 542  CYS A CB   1  
ATOM   7116   S SG   . CYS A 1 486 ? 14.901  18.450  23.635  0.04 13.96 ? 542  CYS A SG   1  
ATOM   7117   H H    . CYS A 1 486 ? 14.763  16.353  21.184  0.04 13.32 ? 542  CYS A H    1  
ATOM   7118   H HA   . CYS A 1 486 ? 12.728  15.615  22.825  0.04 13.18 ? 542  CYS A HA   1  
ATOM   7119   H HB2  . CYS A 1 486 ? 13.327  16.994  24.483  0.04 13.62 ? 542  CYS A HB2  1  
ATOM   7120   H HB3  . CYS A 1 486 ? 14.642  16.194  24.123  0.04 13.47 ? 542  CYS A HB3  1  
ATOM   7121   H HG   . CYS A 1 486 ? 16.058  18.405  23.320  0.04 13.99 ? 542  CYS A HG   1  
ATOM   7122   N N    . TYR A 1 487 ? 11.222  17.497  22.423  0.04 13.55 ? 543  TYR A N    1  
ATOM   7123   C CA   . TYR A 1 487 ? 10.209  18.457  22.008  0.04 13.77 ? 543  TYR A CA   1  
ATOM   7124   C C    . TYR A 1 487 ? 9.307   18.699  23.202  0.04 13.89 ? 543  TYR A C    1  
ATOM   7125   O O    . TYR A 1 487 ? 8.135   18.314  23.209  0.04 13.79 ? 543  TYR A O    1  
ATOM   7126   C CB   . TYR A 1 487 ? 9.401   17.959  20.802  0.04 13.61 ? 543  TYR A CB   1  
ATOM   7127   C CG   . TYR A 1 487 ? 8.441   18.928  20.166  0.04 13.88 ? 543  TYR A CG   1  
ATOM   7128   C CD1  . TYR A 1 487 ? 8.891   20.117  19.602  0.04 14.17 ? 543  TYR A CD1  1  
ATOM   7129   C CD2  . TYR A 1 487 ? 7.070   18.659  20.113  0.04 13.89 ? 543  TYR A CD2  1  
ATOM   7130   C CE1  . TYR A 1 487 ? 8.024   21.020  18.993  0.04 14.47 ? 543  TYR A CE1  1  
ATOM   7131   C CE2  . TYR A 1 487 ? 6.203   19.555  19.470  0.04 14.19 ? 543  TYR A CE2  1  
ATOM   7132   C CZ   . TYR A 1 487 ? 6.693   20.741  18.942  0.04 14.48 ? 543  TYR A CZ   1  
ATOM   7133   O OH   . TYR A 1 487 ? 5.878   21.633  18.316  0.04 14.82 ? 543  TYR A OH   1  
ATOM   7134   H H    . TYR A 1 487 ? 10.959  16.993  23.062  0.04 13.47 ? 543  TYR A H    1  
ATOM   7135   H HA   . TYR A 1 487 ? 10.635  19.298  21.764  0.04 13.98 ? 543  TYR A HA   1  
ATOM   7136   H HB2  . TYR A 1 487 ? 10.023  17.697  20.109  0.04 13.51 ? 543  TYR A HB2  1  
ATOM   7137   H HB3  . TYR A 1 487 ? 8.893   17.181  21.087  0.04 13.46 ? 543  TYR A HB3  1  
ATOM   7138   H HD1  . TYR A 1 487 ? 9.803   20.309  19.632  0.04 14.19 ? 543  TYR A HD1  1  
ATOM   7139   H HD2  . TYR A 1 487 ? 6.742   17.868  20.464  0.04 13.73 ? 543  TYR A HD2  1  
ATOM   7140   H HE1  . TYR A 1 487 ? 8.344   21.807  18.617  0.04 14.68 ? 543  TYR A HE1  1  
ATOM   7141   H HE2  . TYR A 1 487 ? 5.292   19.380  19.437  0.04 14.22 ? 543  TYR A HE2  1  
ATOM   7142   H HH   . TYR A 1 487 ? 5.099   21.324  18.293  0.04 14.77 ? 543  TYR A HH   1  
ATOM   7143   N N    . PHE A 1 488 ? 9.834   19.405  24.199  0.04 14.16 ? 544  PHE A N    1  
ATOM   7144   C CA   . PHE A 1 488 ? 9.044   19.741  25.367  0.04 14.36 ? 544  PHE A CA   1  
ATOM   7145   C C    . PHE A 1 488 ? 8.139   20.942  25.032  0.04 14.69 ? 544  PHE A C    1  
ATOM   7146   O O    . PHE A 1 488 ? 8.316   22.047  25.519  0.04 15.05 ? 544  PHE A O    1  
ATOM   7147   C CB   . PHE A 1 488 ? 9.984   20.013  26.560  0.04 14.52 ? 544  PHE A CB   1  
ATOM   7148   C CG   . PHE A 1 488 ? 10.748  18.780  27.042  0.04 14.25 ? 544  PHE A CG   1  
ATOM   7149   C CD1  . PHE A 1 488 ? 10.120  17.836  27.803  0.04 14.11 ? 544  PHE A CD1  1  
ATOM   7150   C CD2  . PHE A 1 488 ? 12.095  18.583  26.739  0.04 14.20 ? 544  PHE A CD2  1  
ATOM   7151   C CE1  . PHE A 1 488 ? 10.824  16.700  28.273  0.04 13.91 ? 544  PHE A CE1  1  
ATOM   7152   C CE2  . PHE A 1 488 ? 12.783  17.477  27.212  0.04 14.01 ? 544  PHE A CE2  1  
ATOM   7153   C CZ   . PHE A 1 488 ? 12.146  16.537  27.963  0.04 13.86 ? 544  PHE A CZ   1  
ATOM   7154   H H    . PHE A 1 488 ? 10.641  19.696  24.221  0.04 14.25 ? 544  PHE A H    1  
ATOM   7155   H HA   . PHE A 1 488 ? 8.478   18.992  25.604  0.04 14.20 ? 544  PHE A HA   1  
ATOM   7156   H HB2  . PHE A 1 488 ? 10.629  20.685  26.295  0.04 14.68 ? 544  PHE A HB2  1  
ATOM   7157   H HB3  . PHE A 1 488 ? 9.449   20.349  27.294  0.04 14.70 ? 544  PHE A HB3  1  
ATOM   7158   H HD1  . PHE A 1 488 ? 9.221   17.946  28.022  0.04 14.17 ? 544  PHE A HD1  1  
ATOM   7159   H HD2  . PHE A 1 488 ? 12.545  19.212  26.230  0.04 14.32 ? 544  PHE A HD2  1  
ATOM   7160   H HE1  . PHE A 1 488 ? 10.388  16.065  28.792  0.04 13.84 ? 544  PHE A HE1  1  
ATOM   7161   H HE2  . PHE A 1 488 ? 13.680  17.360  26.994  0.04 14.00 ? 544  PHE A HE2  1  
ATOM   7162   H HZ   . PHE A 1 488 ? 12.612  15.796  28.263  0.04 13.76 ? 544  PHE A HZ   1  
ATOM   7163   N N    . ASN A 1 489 ? 7.113   20.700  24.205  0.04 14.61 ? 545  ASN A N    1  
ATOM   7164   C CA   . ASN A 1 489 ? 6.248   21.768  23.728  0.04 14.93 ? 545  ASN A CA   1  
ATOM   7165   C C    . ASN A 1 489 ? 5.326   22.361  24.774  0.04 15.23 ? 545  ASN A C    1  
ATOM   7166   O O    . ASN A 1 489 ? 4.927   23.549  24.719  0.04 15.62 ? 545  ASN A O    1  
ATOM   7167   C CB   . ASN A 1 489 ? 5.440   21.310  22.496  0.04 14.79 ? 545  ASN A CB   1  
ATOM   7168   C CG   . ASN A 1 489 ? 4.419   20.073  22.737  0.04 15.01 ? 545  ASN A CG   1  
ATOM   7169   O OD1  . ASN A 1 489 ? 4.570   19.094  23.546  0.04 15.40 ? 545  ASN A OD1  1  
ATOM   7170   N ND2  . ASN A 1 489 ? 3.379   20.159  21.853  0.04 14.81 ? 545  ASN A ND2  1  
ATOM   7171   H H    . ASN A 1 489 ? 6.900   19.919  23.916  0.04 14.38 ? 545  ASN A H    1  
ATOM   7172   H HA   . ASN A 1 489 ? 6.821   22.491  23.423  0.04 15.12 ? 545  ASN A HA   1  
ATOM   7173   H HB2  . ASN A 1 489 ? 4.938   22.066  22.154  0.04 14.86 ? 545  ASN A HB2  1  
ATOM   7174   H HB3  . ASN A 1 489 ? 6.074   21.022  21.826  0.04 14.50 ? 545  ASN A HB3  1  
ATOM   7175   H HD21 . ASN A 1 489 ? 2.761   19.563  21.847  0.04 14.74 ? 545  ASN A HD21 1  
ATOM   7176   H HD22 . ASN A 1 489 ? 3.350   20.808  21.287  0.04 14.77 ? 545  ASN A HD22 1  
ATOM   7177   N N    . VAL A 1 490 ? 4.965   21.469  25.695  0.04 15.09 ? 546  VAL A N    1  
ATOM   7178   C CA   . VAL A 1 490 ? 4.211   21.808  26.876  0.04 15.41 ? 546  VAL A CA   1  
ATOM   7179   C C    . VAL A 1 490 ? 4.983   22.770  27.814  0.04 15.72 ? 546  VAL A C    1  
ATOM   7180   O O    . VAL A 1 490 ? 4.447   23.825  28.200  0.04 16.13 ? 546  VAL A O    1  
ATOM   7181   C CB   . VAL A 1 490 ? 3.844   20.522  27.617  0.04 15.23 ? 546  VAL A CB   1  
ATOM   7182   C CG1  . VAL A 1 490 ? 3.213   20.815  28.955  0.04 15.58 ? 546  VAL A CG1  1  
ATOM   7183   C CG2  . VAL A 1 490 ? 2.883   19.722  26.774  0.04 15.11 ? 546  VAL A CG2  1  
ATOM   7184   H H    . VAL A 1 490 ? 5.152   20.634  25.643  0.04 14.83 ? 546  VAL A H    1  
ATOM   7185   H HA   . VAL A 1 490 ? 3.395   22.254  26.605  0.04 15.60 ? 546  VAL A HA   1  
ATOM   7186   H HB   . VAL A 1 490 ? 4.644   19.991  27.760  0.04 14.99 ? 546  VAL A HB   1  
ATOM   7187   H HG11 . VAL A 1 490 ? 2.786   20.009  29.287  0.04 15.51 ? 546  VAL A HG11 1  
ATOM   7188   H HG12 . VAL A 1 490 ? 3.907   21.086  29.581  0.04 15.60 ? 546  VAL A HG12 1  
ATOM   7189   H HG13 . VAL A 1 490 ? 2.559   21.523  28.858  0.04 15.86 ? 546  VAL A HG13 1  
ATOM   7190   H HG21 . VAL A 1 490 ? 2.252   19.274  27.356  0.04 14.96 ? 546  VAL A HG21 1  
ATOM   7191   H HG22 . VAL A 1 490 ? 2.411   20.327  26.179  0.04 15.37 ? 546  VAL A HG22 1  
ATOM   7192   H HG23 . VAL A 1 490 ? 3.386   19.074  26.257  0.04 14.94 ? 546  VAL A HG23 1  
ATOM   7193   N N    . ASN A 1 491 ? 6.225   22.407  28.166  0.04 15.56 ? 547  ASN A N    1  
ATOM   7194   C CA   . ASN A 1 491 ? 7.077   23.279  29.004  0.04 15.88 ? 547  ASN A CA   1  
ATOM   7195   C C    . ASN A 1 491 ? 8.490   23.347  28.411  0.04 15.74 ? 547  ASN A C    1  
ATOM   7196   O O    . ASN A 1 491 ? 9.365   22.560  28.799  0.04 15.52 ? 547  ASN A O    1  
ATOM   7197   C CB   . ASN A 1 491 ? 7.159   22.796  30.455  0.04 15.94 ? 547  ASN A CB   1  
ATOM   7198   C CG   . ASN A 1 491 ? 7.855   23.797  31.354  0.04 16.33 ? 547  ASN A CG   1  
ATOM   7199   O OD1  . ASN A 1 491 ? 8.649   24.630  30.894  0.04 16.48 ? 547  ASN A OD1  1  
ATOM   7200   N ND2  . ASN A 1 491 ? 7.546   23.740  32.630  0.04 16.53 ? 547  ASN A ND2  1  
ATOM   7201   H H    . ASN A 1 491 ? 6.603   21.673  27.934  0.04 15.30 ? 547  ASN A H    1  
ATOM   7202   H HA   . ASN A 1 491 ? 6.711   24.172  29.016  0.04 16.18 ? 547  ASN A HA   1  
ATOM   7203   H HB2  . ASN A 1 491 ? 6.264   22.659  30.804  0.04 16.03 ? 547  ASN A HB2  1  
ATOM   7204   H HB3  . ASN A 1 491 ? 7.659   21.967  30.493  0.04 15.67 ? 547  ASN A HB3  1  
ATOM   7205   H HD21 . ASN A 1 491 ? 8.017   24.163  33.207  0.04 16.76 ? 547  ASN A HD21 1  
ATOM   7206   H HD22 . ASN A 1 491 ? 6.870   23.276  32.884  0.04 16.44 ? 547  ASN A HD22 1  
ATOM   7207   N N    . PRO A 1 492 ? 8.707   24.299  27.489  0.04 15.92 ? 548  PRO A N    1  
ATOM   7208   C CA   . PRO A 1 492 ? 9.977   24.301  26.762  0.04 15.81 ? 548  PRO A CA   1  
ATOM   7209   C C    . PRO A 1 492 ? 11.134  24.863  27.538  0.04 16.07 ? 548  PRO A C    1  
ATOM   7210   O O    . PRO A 1 492 ? 12.205  24.945  26.952  0.04 16.04 ? 548  PRO A O    1  
ATOM   7211   C CB   . PRO A 1 492 ? 9.685   25.134  25.512  0.04 15.94 ? 548  PRO A CB   1  
ATOM   7212   C CG   . PRO A 1 492 ? 8.492   25.889  25.819  0.04 16.28 ? 548  PRO A CG   1  
ATOM   7213   C CD   . PRO A 1 492 ? 7.693   25.107  26.803  0.04 16.12 ? 548  PRO A CD   1  
ATOM   7214   H HA   . PRO A 1 492 ? 10.204  23.401  26.483  0.04 15.49 ? 548  PRO A HA   1  
ATOM   7215   H HB2  . PRO A 1 492 ? 10.427  25.726  25.322  0.04 16.10 ? 548  PRO A HB2  1  
ATOM   7216   H HB3  . PRO A 1 492 ? 9.524   24.537  24.770  0.04 15.67 ? 548  PRO A HB3  1  
ATOM   7217   H HG2  . PRO A 1 492 ? 8.739   26.746  26.201  0.04 16.60 ? 548  PRO A HG2  1  
ATOM   7218   H HG3  . PRO A 1 492 ? 7.979   26.021  25.005  0.04 16.31 ? 548  PRO A HG3  1  
ATOM   7219   H HD2  . PRO A 1 492 ? 7.240   25.699  27.422  0.04 16.40 ? 548  PRO A HD2  1  
ATOM   7220   H HD3  . PRO A 1 492 ? 7.072   24.525  26.337  0.04 15.89 ? 548  PRO A HD3  1  
ATOM   7221   N N    . ASP A 1 493 ? 10.964  25.135  28.818  0.04 16.34 ? 549  ASP A N    1  
ATOM   7222   C CA   . ASP A 1 493 ? 12.105  25.487  29.674  0.04 16.58 ? 549  ASP A CA   1  
ATOM   7223   C C    . ASP A 1 493 ? 12.807  24.276  30.273  0.04 16.26 ? 549  ASP A C    1  
ATOM   7224   O O    . ASP A 1 493 ? 13.849  24.409  30.906  0.04 16.43 ? 549  ASP A O    1  
ATOM   7225   C CB   . ASP A 1 493 ? 11.648  26.425  30.783  0.04 17.04 ? 549  ASP A CB   1  
ATOM   7226   C CG   . ASP A 1 493 ? 11.160  27.742  30.242  0.04 17.46 ? 549  ASP A CG   1  
ATOM   7227   O OD1  . ASP A 1 493 ? 11.655  28.154  29.157  0.04 17.44 ? 549  ASP A OD1  1  
ATOM   7228   O OD2  . ASP A 1 493 ? 10.285  28.344  30.894  0.04 17.85 ? 549  ASP A OD2  1  
ATOM   7229   H H    . ASP A 1 493 ? 10.208  25.132  29.225  0.04 16.40 ? 549  ASP A H    1  
ATOM   7230   H HA   . ASP A 1 493 ? 12.768  25.949  29.138  0.04 16.69 ? 549  ASP A HA   1  
ATOM   7231   H HB2  . ASP A 1 493 ? 10.913  26.021  31.266  0.04 16.96 ? 549  ASP A HB2  1  
ATOM   7232   H HB3  . ASP A 1 493 ? 12.393  26.582  31.381  0.04 17.18 ? 549  ASP A HB3  1  
ATOM   7233   N N    . ILE A 1 494 ? 12.221  23.104  30.075  0.04 15.85 ? 550  ILE A N    1  
ATOM   7234   C CA   . ILE A 1 494 ? 12.805  21.878  30.573  0.04 15.57 ? 550  ILE A CA   1  
ATOM   7235   C C    . ILE A 1 494 ? 14.172  21.599  29.973  0.04 15.45 ? 550  ILE A C    1  
ATOM   7236   O O    . ILE A 1 494 ? 14.492  21.967  28.840  0.04 15.41 ? 550  ILE A O    1  
ATOM   7237   C CB   . ILE A 1 494 ? 11.834  20.689  30.337  0.04 15.20 ? 550  ILE A CB   1  
ATOM   7238   C CG1  . ILE A 1 494 ? 10.615  20.831  31.257  0.04 15.41 ? 550  ILE A CG1  1  
ATOM   7239   C CG2  . ILE A 1 494 ? 12.556  19.302  30.523  0.04 14.88 ? 550  ILE A CG2  1  
ATOM   7240   C CD1  . ILE A 1 494 ? 9.520   19.776  30.981  0.04 15.16 ? 550  ILE A CD1  1  
ATOM   7241   H H    . ILE A 1 494 ? 11.484  22.993  29.654  0.04 15.75 ? 550  ILE A H    1  
ATOM   7242   H HA   . ILE A 1 494 ? 12.927  21.969  31.530  0.04 15.75 ? 550  ILE A HA   1  
ATOM   7243   H HB   . ILE A 1 494 ? 11.514  20.751  29.426  0.04 15.09 ? 550  ILE A HB   1  
ATOM   7244   H HG12 . ILE A 1 494 ? 10.897  20.731  32.179  0.04 15.50 ? 550  ILE A HG12 1  
ATOM   7245   H HG13 . ILE A 1 494 ? 10.224  21.705  31.124  0.04 15.66 ? 550  ILE A HG13 1  
ATOM   7246   H HG21 . ILE A 1 494 ? 11.896  18.624  30.728  0.04 14.77 ? 550  ILE A HG21 1  
ATOM   7247   H HG22 . ILE A 1 494 ? 13.019  19.060  29.709  0.04 14.68 ? 550  ILE A HG22 1  
ATOM   7248   H HG23 . ILE A 1 494 ? 13.185  19.367  31.258  0.04 15.02 ? 550  ILE A HG23 1  
ATOM   7249   H HD11 . ILE A 1 494 ? 8.696   20.065  31.406  0.04 15.36 ? 550  ILE A HD11 1  
ATOM   7250   H HD12 . ILE A 1 494 ? 9.390   19.690  30.023  0.04 15.01 ? 550  ILE A HD12 1  
ATOM   7251   H HD13 . ILE A 1 494 ? 9.806   18.930  31.356  0.04 14.98 ? 550  ILE A HD13 1  
ATOM   7252   N N    . ARG A 1 495 ? 14.986  20.970  30.801  0.04 15.44 ? 551  ARG A N    1  
ATOM   7253   C CA   . ARG A 1 495 ? 16.286  20.424  30.433  0.04 15.32 ? 551  ARG A CA   1  
ATOM   7254   C C    . ARG A 1 495 ? 16.333  18.916  30.654  0.04 14.96 ? 551  ARG A C    1  
ATOM   7255   O O    . ARG A 1 495 ? 15.891  18.393  31.689  0.04 14.97 ? 551  ARG A O    1  
ATOM   7256   C CB   . ARG A 1 495 ? 17.402  21.070  31.266  0.04 15.70 ? 551  ARG A CB   1  
ATOM   7257   C CG   . ARG A 1 495 ? 17.537  22.549  30.968  0.04 16.10 ? 551  ARG A CG   1  
ATOM   7258   C CD   . ARG A 1 495 ? 18.027  22.765  29.537  0.04 16.01 ? 551  ARG A CD   1  
ATOM   7259   N NE   . ARG A 1 495 ? 18.225  24.176  29.183  0.04 16.42 ? 551  ARG A NE   1  
ATOM   7260   C CZ   . ARG A 1 495 ? 17.359  24.947  28.538  0.04 16.50 ? 551  ARG A CZ   1  
ATOM   7261   N NH1  . ARG A 1 495 ? 16.175  24.489  28.144  0.04 16.20 ? 551  ARG A NH1  1  
ATOM   7262   N NH2  . ARG A 1 495 ? 17.693  26.199  28.261  0.04 16.92 ? 551  ARG A NH2  1  
ATOM   7263   H H    . ARG A 1 495 ? 14.794  20.832  31.623  0.04 15.54 ? 551  ARG A H    1  
ATOM   7264   H HA   . ARG A 1 495 ? 16.459  20.589  29.498  0.04 15.24 ? 551  ARG A HA   1  
ATOM   7265   H HB2  . ARG A 1 495 ? 17.203  20.963  32.207  0.04 15.81 ? 551  ARG A HB2  1  
ATOM   7266   H HB3  . ARG A 1 495 ? 18.244  20.640  31.053  0.04 15.63 ? 551  ARG A HB3  1  
ATOM   7267   H HG2  . ARG A 1 495 ? 16.673  22.976  31.075  0.04 16.18 ? 551  ARG A HG2  1  
ATOM   7268   H HG3  . ARG A 1 495 ? 18.187  22.938  31.573  0.04 16.37 ? 551  ARG A HG3  1  
ATOM   7269   H HD2  . ARG A 1 495 ? 18.883  22.322  29.437  0.04 15.97 ? 551  ARG A HD2  1  
ATOM   7270   H HD3  . ARG A 1 495 ? 17.394  22.381  28.916  0.04 15.75 ? 551  ARG A HD3  1  
ATOM   7271   H HE   . ARG A 1 495 ? 18.932  24.559  29.487  0.04 16.67 ? 551  ARG A HE   1  
ATOM   7272   H HH11 . ARG A 1 495 ? 15.948  23.680  28.311  0.04 15.94 ? 551  ARG A HH11 1  
ATOM   7273   H HH12 . ARG A 1 495 ? 15.630  25.008  27.731  0.04 16.28 ? 551  ARG A HH12 1  
ATOM   7274   H HH21 . ARG A 1 495 ? 18.450  26.504  28.514  0.04 17.14 ? 551  ARG A HH21 1  
ATOM   7275   H HH22 . ARG A 1 495 ? 17.139  26.712  27.857  0.04 17.00 ? 551  ARG A HH22 1  
ATOM   7276   N N    . GLN A 1 496 ? 16.932  18.249  29.674  0.04 14.70 ? 552  GLN A N    1  
ATOM   7277   C CA   . GLN A 1 496 ? 17.140  16.797  29.694  0.04 14.42 ? 552  GLN A CA   1  
ATOM   7278   C C    . GLN A 1 496 ? 18.632  16.589  29.812  0.04 14.56 ? 552  GLN A C    1  
ATOM   7279   O O    . GLN A 1 496 ? 19.379  17.041  28.948  0.04 14.62 ? 552  GLN A O    1  
ATOM   7280   C CB   . GLN A 1 496 ? 16.591  16.247  28.390  0.04 14.05 ? 552  GLN A CB   1  
ATOM   7281   C CG   . GLN A 1 496 ? 16.851  14.773  28.141  0.04 13.79 ? 552  GLN A CG   1  
ATOM   7282   C CD   . GLN A 1 496 ? 15.997  13.845  29.010  0.04 13.62 ? 552  GLN A CD   1  
ATOM   7283   O OE1  . GLN A 1 496 ? 14.911  14.204  29.454  0.04 13.66 ? 552  GLN A OE1  1  
ATOM   7284   N NE2  . GLN A 1 496 ? 16.478  12.656  29.219  0.04 13.46 ? 552  GLN A NE2  1  
ATOM   7285   H H    . GLN A 1 496 ? 17.223  18.623  28.963  0.04 14.70 ? 552  GLN A H    1  
ATOM   7286   H HA   . GLN A 1 496 ? 16.683  16.380  30.437  0.04 14.41 ? 552  GLN A HA   1  
ATOM   7287   H HB2  . GLN A 1 496 ? 15.633  16.380  28.393  0.04 13.98 ? 552  GLN A HB2  1  
ATOM   7288   H HB3  . GLN A 1 496 ? 16.992  16.731  27.655  0.04 14.08 ? 552  GLN A HB3  1  
ATOM   7289   H HG2  . GLN A 1 496 ? 16.632  14.583  27.217  0.04 13.64 ? 552  GLN A HG2  1  
ATOM   7290   H HG3  . GLN A 1 496 ? 17.786  14.573  28.298  0.04 13.92 ? 552  GLN A HG3  1  
ATOM   7291   H HE21 . GLN A 1 496 ? 17.214  12.416  28.845  0.04 13.47 ? 552  GLN A HE21 1  
ATOM   7292   H HE22 . GLN A 1 496 ? 16.059  12.107  29.733  0.04 13.37 ? 552  GLN A HE22 1  
ATOM   7293   N N    . GLN A 1 497 ? 19.125  15.998  30.903  0.04 14.65 ? 553  GLN A N    1  
ATOM   7294   C CA   . GLN A 1 497 ? 20.567  16.013  31.111  0.04 14.88 ? 553  GLN A CA   1  
ATOM   7295   C C    . GLN A 1 497 ? 21.302  15.294  29.992  0.04 14.66 ? 553  GLN A C    1  
ATOM   7296   O O    . GLN A 1 497 ? 22.335  15.777  29.500  0.04 14.86 ? 553  GLN A O    1  
ATOM   7297   C CB   . GLN A 1 497 ? 20.968  15.442  32.487  0.04 15.06 ? 553  GLN A CB   1  
ATOM   7298   C CG   . GLN A 1 497 ? 22.473  15.411  32.736  0.04 15.42 ? 553  GLN A CG   1  
ATOM   7299   C CD   . GLN A 1 497 ? 22.870  15.744  34.181  0.04 15.62 ? 553  GLN A CD   1  
ATOM   7300   O OE1  . GLN A 1 497 ? 23.104  16.911  34.512  0.04 16.02 ? 553  GLN A OE1  1  
ATOM   7301   N NE2  . GLN A 1 497 ? 23.068  14.712  35.000  0.04 15.38 ? 553  GLN A NE2  1  
ATOM   7302   H H    . GLN A 1 497 ? 18.665  15.599  31.505  0.04 14.62 ? 553  GLN A H    1  
ATOM   7303   H HA   . GLN A 1 497 ? 20.865  16.935  31.095  0.04 15.11 ? 553  GLN A HA   1  
ATOM   7304   H HB2  . GLN A 1 497 ? 20.556  15.982  33.182  0.04 15.17 ? 553  GLN A HB2  1  
ATOM   7305   H HB3  . GLN A 1 497 ? 20.646  14.529  32.535  0.04 14.85 ? 553  GLN A HB3  1  
ATOM   7306   H HG2  . GLN A 1 497 ? 22.809  14.527  32.536  0.04 15.34 ? 553  GLN A HG2  1  
ATOM   7307   H HG3  . GLN A 1 497 ? 22.903  16.054  32.155  0.04 15.66 ? 553  GLN A HG3  1  
ATOM   7308   H HE21 . GLN A 1 497 ? 23.587  14.076  34.763  0.04 15.21 ? 553  GLN A HE21 1  
ATOM   7309   H HE22 . GLN A 1 497 ? 22.696  14.697  35.774  0.04 15.44 ? 553  GLN A HE22 1  
ATOM   7310   N N    . HIS A 1 498 ? 20.799  14.148  29.566  0.04 14.30 ? 554  HIS A N    1  
ATOM   7311   C CA   . HIS A 1 498 ? 21.449  13.407  28.506  0.04 14.12 ? 554  HIS A CA   1  
ATOM   7312   C C    . HIS A 1 498 ? 20.458  12.535  27.750  0.04 13.72 ? 554  HIS A C    1  
ATOM   7313   O O    . HIS A 1 498 ? 19.361  12.227  28.229  0.04 13.60 ? 554  HIS A O    1  
ATOM   7314   C CB   . HIS A 1 498 ? 22.598  12.542  29.044  0.04 14.25 ? 554  HIS A CB   1  
ATOM   7315   C CG   . HIS A 1 498 ? 22.279  11.837  30.332  0.04 14.28 ? 554  HIS A CG   1  
ATOM   7316   N ND1  . HIS A 1 498 ? 23.087  11.930  31.449  0.04 14.61 ? 554  HIS A ND1  1  
ATOM   7317   C CD2  . HIS A 1 498 ? 21.224  11.062  30.694  0.04 14.06 ? 554  HIS A CD2  1  
ATOM   7318   C CE1  . HIS A 1 498 ? 22.557  11.200  32.427  0.04 14.59 ? 554  HIS A CE1  1  
ATOM   7319   N NE2  . HIS A 1 498 ? 21.406  10.705  32.010  0.04 14.26 ? 554  HIS A NE2  1  
ATOM   7320   H H    . HIS A 1 498 ? 20.084  13.777  29.866  0.04 14.18 ? 554  HIS A H    1  
ATOM   7321   H HA   . HIS A 1 498 ? 21.818  14.035  27.866  0.04 14.19 ? 554  HIS A HA   1  
ATOM   7322   H HB2  . HIS A 1 498 ? 22.817  11.879  28.373  0.04 14.10 ? 554  HIS A HB2  1  
ATOM   7323   H HB3  . HIS A 1 498 ? 23.370  13.106  29.199  0.04 14.50 ? 554  HIS A HB3  1  
ATOM   7324   H HD2  . HIS A 1 498 ? 20.497  10.827  30.161  0.04 13.83 ? 554  HIS A HD2  1  
ATOM   7325   H HE1  . HIS A 1 498 ? 22.910  11.104  33.281  0.04 14.80 ? 554  HIS A HE1  1  
ATOM   7326   N N    . GLY A 1 499 ? 20.856  12.134  26.551  0.04 13.56 ? 555  GLY A N    1  
ATOM   7327   C CA   . GLY A 1 499 ? 20.152  11.099  25.820  0.04 13.23 ? 555  GLY A CA   1  
ATOM   7328   C C    . GLY A 1 499 ? 20.504  9.689   26.294  0.04 13.16 ? 555  GLY A C    1  
ATOM   7329   O O    . GLY A 1 499 ? 19.657  8.806   26.279  0.04 12.95 ? 555  GLY A O    1  
ATOM   7330   H H    . GLY A 1 499 ? 21.550  12.441  26.150  0.04 13.66 ? 555  GLY A H    1  
ATOM   7331   H HA2  . GLY A 1 499 ? 19.193  11.227  25.911  0.04 13.14 ? 555  GLY A HA2  1  
ATOM   7332   H HA3  . GLY A 1 499 ? 20.381  11.165  24.882  0.04 13.17 ? 555  GLY A HA3  1  
ATOM   7333   N N    . PHE A 1 500 ? 21.752  9.484   26.714  0.04 13.39 ? 556  PHE A N    1  
ATOM   7334   C CA   . PHE A 1 500 ? 22.333  8.169   26.968  0.04 13.39 ? 556  PHE A CA   1  
ATOM   7335   C C    . PHE A 1 500 ? 23.008  8.205   28.314  0.04 13.70 ? 556  PHE A C    1  
ATOM   7336   O O    . PHE A 1 500 ? 23.567  9.217   28.703  0.04 13.97 ? 556  PHE A O    1  
ATOM   7337   C CB   . PHE A 1 500 ? 23.326  7.851   25.845  0.04 13.41 ? 556  PHE A CB   1  
ATOM   7338   C CG   . PHE A 1 500 ? 22.670  7.871   24.509  0.04 13.15 ? 556  PHE A CG   1  
ATOM   7339   C CD1  . PHE A 1 500 ? 22.568  9.038   23.778  0.04 13.15 ? 556  PHE A CD1  1  
ATOM   7340   C CD2  . PHE A 1 500 ? 22.048  6.735   24.012  0.04 12.92 ? 556  PHE A CD2  1  
ATOM   7341   C CE1  . PHE A 1 500 ? 21.891  9.057   22.560  0.04 12.95 ? 556  PHE A CE1  1  
ATOM   7342   C CE2  . PHE A 1 500 ? 21.364  6.757   22.825  0.04 12.71 ? 556  PHE A CE2  1  
ATOM   7343   C CZ   . PHE A 1 500 ? 21.267  7.898   22.100  0.04 12.72 ? 556  PHE A CZ   1  
ATOM   7344   H H    . PHE A 1 500 ? 22.311  10.117  26.858  0.04 13.57 ? 556  PHE A H    1  
ATOM   7345   H HA   . PHE A 1 500 ? 21.649  7.486   26.981  0.04 13.21 ? 556  PHE A HA   1  
ATOM   7346   H HB2  . PHE A 1 500 ? 24.027  8.517   25.851  0.04 13.61 ? 556  PHE A HB2  1  
ATOM   7347   H HB3  . PHE A 1 500 ? 23.699  6.968   25.990  0.04 13.43 ? 556  PHE A HB3  1  
ATOM   7348   H HD1  . PHE A 1 500 ? 22.959  9.815   24.106  0.04 13.33 ? 556  PHE A HD1  1  
ATOM   7349   H HD2  . PHE A 1 500 ? 22.080  5.947   24.503  0.04 12.94 ? 556  PHE A HD2  1  
ATOM   7350   H HE1  . PHE A 1 500 ? 21.827  9.840   22.065  0.04 12.98 ? 556  PHE A HE1  1  
ATOM   7351   H HE2  . PHE A 1 500 ? 20.972  5.972   22.514  0.04 12.59 ? 556  PHE A HE2  1  
ATOM   7352   H HZ   . PHE A 1 500 ? 20.831  7.900   21.280  0.04 12.61 ? 556  PHE A HZ   1  
ATOM   7353   N N    . GLN A 1 501 ? 22.913  7.105   29.045  0.04 13.71 ? 557  GLN A N    1  
ATOM   7354   C CA   . GLN A 1 501 ? 23.608  6.976   30.313  0.04 14.04 ? 557  GLN A CA   1  
ATOM   7355   C C    . GLN A 1 501 ? 24.243  5.604   30.386  0.04 14.09 ? 557  GLN A C    1  
ATOM   7356   O O    . GLN A 1 501 ? 23.607  4.595   30.069  0.04 13.86 ? 557  GLN A O    1  
ATOM   7357   C CB   . GLN A 1 501 ? 22.653  7.134   31.497  0.04 14.10 ? 557  GLN A CB   1  
ATOM   7358   C CG   . GLN A 1 501 ? 23.258  6.516   32.724  0.04 14.50 ? 557  GLN A CG   1  
ATOM   7359   C CD   . GLN A 1 501 ? 22.506  6.789   33.933  0.04 14.65 ? 557  GLN A CD   1  
ATOM   7360   O OE1  . GLN A 1 501 ? 21.301  6.937   33.899  0.04 14.46 ? 557  GLN A OE1  1  
ATOM   7361   N NE2  . GLN A 1 501 ? 23.203  6.833   35.045  0.04 15.06 ? 557  GLN A NE2  1  
ATOM   7362   H H    . GLN A 1 501 ? 22.446  6.421   28.836  0.04 13.54 ? 557  GLN A H    1  
ATOM   7363   H HA   . GLN A 1 501 ? 24.294  7.646   30.371  0.04 14.24 ? 557  GLN A HA   1  
ATOM   7364   H HB2  . GLN A 1 501 ? 22.506  8.076   31.669  0.04 14.09 ? 557  GLN A HB2  1  
ATOM   7365   H HB3  . GLN A 1 501 ? 21.816  6.689   31.310  0.04 13.92 ? 557  GLN A HB3  1  
ATOM   7366   H HG2  . GLN A 1 501 ? 23.262  5.549   32.635  0.04 14.52 ? 557  GLN A HG2  1  
ATOM   7367   H HG3  . GLN A 1 501 ? 24.161  6.857   32.838  0.04 14.68 ? 557  GLN A HG3  1  
ATOM   7368   H HE21 . GLN A 1 501 ? 24.052  6.703   35.020  0.04 15.21 ? 557  GLN A HE21 1  
ATOM   7369   H HE22 . GLN A 1 501 ? 22.808  7.000   35.788  0.04 15.19 ? 557  GLN A HE22 1  
ATOM   7370   N N    . ALA A 1 502 ? 25.495  5.554   30.837  0.04 14.42 ? 558  ALA A N    1  
ATOM   7371   C CA   . ALA A 1 502 ? 26.213  4.291   30.859  0.04 14.54 ? 558  ALA A CA   1  
ATOM   7372   C C    . ALA A 1 502 ? 27.339  4.290   31.856  0.04 15.01 ? 558  ALA A C    1  
ATOM   7373   O O    . ALA A 1 502 ? 27.685  5.322   32.437  0.04 15.21 ? 558  ALA A O    1  
ATOM   7374   C CB   . ALA A 1 502 ? 26.763  3.980   29.452  0.04 14.36 ? 558  ALA A CB   1  
ATOM   7375   H H    . ALA A 1 502 ? 25.939  6.224   31.133  0.04 14.61 ? 558  ALA A H    1  
ATOM   7376   H HA   . ALA A 1 502 ? 25.591  3.591   31.109  0.04 14.47 ? 558  ALA A HA   1  
ATOM   7377   H HB1  . ALA A 1 502 ? 27.353  3.214   29.496  0.04 14.46 ? 558  ALA A HB1  1  
ATOM   7378   H HB2  . ALA A 1 502 ? 26.022  3.798   28.856  0.04 14.08 ? 558  ALA A HB2  1  
ATOM   7379   H HB3  . ALA A 1 502 ? 27.258  4.753   29.146  0.04 14.45 ? 558  ALA A HB3  1  
ATOM   7380   N N    . PRO A 1 503 ? 27.922  3.117   32.064  0.04 15.24 ? 559  PRO A N    1  
ATOM   7381   C CA   . PRO A 1 503 ? 29.241  3.050   32.663  0.04 15.74 ? 559  PRO A CA   1  
ATOM   7382   C C    . PRO A 1 503 ? 30.330  3.586   31.760  0.04 15.86 ? 559  PRO A C    1  
ATOM   7383   O O    . PRO A 1 503 ? 30.216  3.580   30.511  0.04 15.56 ? 559  PRO A O    1  
ATOM   7384   C CB   . PRO A 1 503 ? 29.460  1.528   32.854  0.04 15.93 ? 559  PRO A CB   1  
ATOM   7385   C CG   . PRO A 1 503 ? 28.525  0.874   31.986  0.04 15.53 ? 559  PRO A CG   1  
ATOM   7386   C CD   . PRO A 1 503 ? 27.332  1.776   31.885  0.04 15.10 ? 559  PRO A CD   1  
ATOM   7387   H HA   . PRO A 1 503 ? 29.271  3.499   33.520  0.04 15.89 ? 559  PRO A HA   1  
ATOM   7388   H HB2  . PRO A 1 503 ? 30.366  1.295   32.601  0.04 16.20 ? 559  PRO A HB2  1  
ATOM   7389   H HB3  . PRO A 1 503 ? 29.290  1.297   33.781  0.04 16.04 ? 559  PRO A HB3  1  
ATOM   7390   H HG2  . PRO A 1 503 ? 28.940  0.752   31.126  0.04 15.51 ? 559  PRO A HG2  1  
ATOM   7391   H HG3  . PRO A 1 503 ? 28.286  0.017   32.373  0.04 15.59 ? 559  PRO A HG3  1  
ATOM   7392   H HD2  . PRO A 1 503 ? 26.913  1.685   31.017  0.04 14.86 ? 559  PRO A HD2  1  
ATOM   7393   H HD3  . PRO A 1 503 ? 26.708  1.598   32.606  0.04 15.06 ? 559  PRO A HD3  1  
ATOM   7394   N N    . VAL A 1 504 ? 31.399  4.004   32.424  0.04 16.29 ? 560  VAL A N    1  
ATOM   7395   C CA   . VAL A 1 504 ? 32.632  4.399   31.770  0.04 16.53 ? 560  VAL A CA   1  
ATOM   7396   C C    . VAL A 1 504 ? 33.651  3.265   31.954  0.04 16.88 ? 560  VAL A C    1  
ATOM   7397   O O    . VAL A 1 504 ? 34.529  3.326   32.807  0.04 17.32 ? 560  VAL A O    1  
ATOM   7398   C CB   . VAL A 1 504 ? 33.146  5.730   32.364  0.04 16.88 ? 560  VAL A CB   1  
ATOM   7399   C CG1  . VAL A 1 504 ? 34.375  6.132   31.690  0.04 17.13 ? 560  VAL A CG1  1  
ATOM   7400   C CG2  . VAL A 1 504 ? 32.080  6.791   32.190  0.04 16.58 ? 560  VAL A CG2  1  
ATOM   7401   H H    . VAL A 1 504 ? 31.429  4.066   33.280  0.04 16.48 ? 560  VAL A H    1  
ATOM   7402   H HA   . VAL A 1 504 ? 32.489  4.524   30.818  0.04 16.28 ? 560  VAL A HA   1  
ATOM   7403   H HB   . VAL A 1 504 ? 33.323  5.623   33.311  0.04 17.17 ? 560  VAL A HB   1  
ATOM   7404   H HG11 . VAL A 1 504 ? 34.550  7.063   31.899  0.04 17.52 ? 560  VAL A HG11 1  
ATOM   7405   H HG12 . VAL A 1 504 ? 35.111  5.587   32.010  0.04 17.12 ? 560  VAL A HG12 1  
ATOM   7406   H HG13 . VAL A 1 504 ? 34.264  6.023   30.732  0.04 16.95 ? 560  VAL A HG13 1  
ATOM   7407   H HG21 . VAL A 1 504 ? 32.476  7.663   32.345  0.04 16.81 ? 560  VAL A HG21 1  
ATOM   7408   H HG22 . VAL A 1 504 ? 31.731  6.742   31.284  0.04 16.29 ? 560  VAL A HG22 1  
ATOM   7409   H HG23 . VAL A 1 504 ? 31.365  6.629   32.824  0.04 16.46 ? 560  VAL A HG23 1  
ATOM   7410   N N    . LYS A 1 505 ? 33.503  2.234   31.125  0.04 16.69 ? 561  LYS A N    1  
ATOM   7411   C CA   . LYS A 1 505 ? 34.232  0.974   31.252  0.04 16.95 ? 561  LYS A CA   1  
ATOM   7412   C C    . LYS A 1 505 ? 34.772  0.573   29.900  0.04 16.85 ? 561  LYS A C    1  
ATOM   7413   O O    . LYS A 1 505 ? 34.141  0.866   28.874  0.04 16.44 ? 561  LYS A O    1  
ATOM   7414   C CB   . LYS A 1 505 ? 33.312  -0.156  31.770  0.04 16.74 ? 561  LYS A CB   1  
ATOM   7415   C CG   . LYS A 1 505 ? 32.847  -0.048  33.228  0.04 16.91 ? 561  LYS A CG   1  
ATOM   7416   C CD   . LYS A 1 505 ? 31.891  -1.190  33.648  0.04 16.75 ? 561  LYS A CD   1  
ATOM   7417   C CE   . LYS A 1 505 ? 31.366  -0.998  35.078  0.04 16.92 ? 561  LYS A CE   1  
ATOM   7418   N NZ   . LYS A 1 505 ? 30.857  -2.269  35.645  0.04 16.81 ? 561  LYS A NZ   1  
ATOM   7419   H H    . LYS A 1 505 ? 32.977  2.249   30.448  0.04 16.43 ? 561  LYS A H    1  
ATOM   7420   H HA   . LYS A 1 505 ? 34.964  1.097   31.875  0.04 17.35 ? 561  LYS A HA   1  
ATOM   7421   H HB2  . LYS A 1 505 ? 32.521  -0.188  31.211  0.04 16.36 ? 561  LYS A HB2  1  
ATOM   7422   H HB3  . LYS A 1 505 ? 33.799  -0.992  31.690  0.04 16.89 ? 561  LYS A HB3  1  
ATOM   7423   H HG2  . LYS A 1 505 ? 33.628  -0.099  33.806  0.04 17.31 ? 561  LYS A HG2  1  
ATOM   7424   H HG3  . LYS A 1 505 ? 32.387  0.798   33.359  0.04 16.77 ? 561  LYS A HG3  1  
ATOM   7425   H HD2  . LYS A 1 505 ? 31.131  -1.186  33.046  0.04 16.38 ? 561  LYS A HD2  1  
ATOM   7426   H HD3  . LYS A 1 505 ? 32.349  -2.040  33.594  0.04 16.95 ? 561  LYS A HD3  1  
ATOM   7427   H HE2  . LYS A 1 505 ? 32.084  -0.682  35.649  0.04 17.32 ? 561  LYS A HE2  1  
ATOM   7428   H HE3  . LYS A 1 505 ? 30.642  -0.355  35.071  0.04 16.74 ? 561  LYS A HE3  1  
ATOM   7429   H HZ1  . LYS A 1 505 ? 30.656  -2.159  36.503  0.04 16.83 ? 561  LYS A HZ1  1  
ATOM   7430   H HZ2  . LYS A 1 505 ? 30.121  -2.513  35.208  0.04 16.49 ? 561  LYS A HZ2  1  
ATOM   7431   H HZ3  . LYS A 1 505 ? 31.470  -2.909  35.570  0.04 17.06 ? 561  LYS A HZ3  1  
ATOM   7432   N N    . PRO A 1 506 ? 35.916  -0.133  29.884  0.04 17.26 ? 562  PRO A N    1  
ATOM   7433   C CA   . PRO A 1 506 ? 36.543  -0.586  28.647  0.04 17.21 ? 562  PRO A CA   1  
ATOM   7434   C C    . PRO A 1 506 ? 35.614  -1.266  27.649  0.04 16.80 ? 562  PRO A C    1  
ATOM   7435   O O    . PRO A 1 506 ? 35.702  -1.011  26.462  0.04 16.64 ? 562  PRO A O    1  
ATOM   7436   C CB   . PRO A 1 506 ? 37.623  -1.556  29.146  0.04 17.82 ? 562  PRO A CB   1  
ATOM   7437   C CG   . PRO A 1 506 ? 37.974  -1.044  30.477  0.04 18.21 ? 562  PRO A CG   1  
ATOM   7438   C CD   . PRO A 1 506 ? 36.712  -0.523  31.065  0.04 17.84 ? 562  PRO A CD   1  
ATOM   7439   H HA   . PRO A 1 506 ? 36.983  0.142   28.195  0.04 17.13 ? 562  PRO A HA   1  
ATOM   7440   H HB2  . PRO A 1 506 ? 37.270  -2.457  29.200  0.04 17.85 ? 562  PRO A HB2  1  
ATOM   7441   H HB3  . PRO A 1 506 ? 38.389  -1.517  28.553  0.04 17.95 ? 562  PRO A HB3  1  
ATOM   7442   H HG2  . PRO A 1 506 ? 38.330  -1.761  31.024  0.04 18.58 ? 562  PRO A HG2  1  
ATOM   7443   H HG3  . PRO A 1 506 ? 38.613  -0.323  30.401  0.04 18.33 ? 562  PRO A HG3  1  
ATOM   7444   H HD2  . PRO A 1 506 ? 36.263  -1.220  31.566  0.04 17.84 ? 562  PRO A HD2  1  
ATOM   7445   H HD3  . PRO A 1 506 ? 36.903  0.247   31.622  0.04 17.98 ? 562  PRO A HD3  1  
ATOM   7446   N N    . GLY A 1 507 ? 34.712  -2.111  28.132  0.04 16.67 ? 563  GLY A N    1  
ATOM   7447   C CA   . GLY A 1 507 ? 33.853  -2.854  27.245  0.04 16.29 ? 563  GLY A CA   1  
ATOM   7448   C C    . GLY A 1 507 ? 32.451  -2.321  27.040  0.04 15.75 ? 563  GLY A C    1  
ATOM   7449   O O    . GLY A 1 507 ? 31.663  -3.033  26.445  0.04 15.43 ? 563  GLY A O    1  
ATOM   7450   H H    . GLY A 1 507 ? 34.583  -2.267  28.964  0.04 16.82 ? 563  GLY A H    1  
ATOM   7451   H HA2  . GLY A 1 507 ? 34.255  -2.911  26.366  0.04 16.30 ? 563  GLY A HA2  1  
ATOM   7452   H HA3  . GLY A 1 507 ? 33.773  -3.758  27.585  0.04 16.40 ? 563  GLY A HA3  1  
ATOM   7453   N N    . VAL A 1 508 ? 32.163  -1.084  27.459  0.04 15.68 ? 564  VAL A N    1  
ATOM   7454   C CA   . VAL A 1 508 ? 30.832  -0.492  27.323  0.04 15.22 ? 564  VAL A CA   1  
ATOM   7455   C C    . VAL A 1 508 ? 30.988  0.698   26.374  0.04 15.16 ? 564  VAL A C    1  
ATOM   7456   O O    . VAL A 1 508 ? 31.154  1.836   26.805  0.04 15.46 ? 564  VAL A O    1  
ATOM   7457   C CB   . VAL A 1 508 ? 30.294  -0.071  28.697  0.04 15.22 ? 564  VAL A CB   1  
ATOM   7458   C CG1  . VAL A 1 508 ? 28.989  0.666   28.597  0.04 14.80 ? 564  VAL A CG1  1  
ATOM   7459   C CG2  . VAL A 1 508 ? 30.132  -1.309  29.582  0.04 15.31 ? 564  VAL A CG2  1  
ATOM   7460   H H    . VAL A 1 508 ? 32.724  -0.559  27.840  0.04 15.92 ? 564  VAL A H    1  
ATOM   7461   H HA   . VAL A 1 508 ? 30.211  -1.117  26.932  0.04 14.98 ? 564  VAL A HA   1  
ATOM   7462   H HB   . VAL A 1 508 ? 30.939  0.514   29.121  0.04 15.48 ? 564  VAL A HB   1  
ATOM   7463   H HG11 . VAL A 1 508 ? 28.336  0.220   29.154  0.04 14.65 ? 564  VAL A HG11 1  
ATOM   7464   H HG12 . VAL A 1 508 ? 29.124  1.578   28.894  0.04 14.90 ? 564  VAL A HG12 1  
ATOM   7465   H HG13 . VAL A 1 508 ? 28.683  0.656   27.678  0.04 14.63 ? 564  VAL A HG13 1  
ATOM   7466   H HG21 . VAL A 1 508 ? 29.732  -1.062  30.426  0.04 15.31 ? 564  VAL A HG21 1  
ATOM   7467   H HG22 . VAL A 1 508 ? 29.557  -1.940  29.119  0.04 15.08 ? 564  VAL A HG22 1  
ATOM   7468   H HG23 . VAL A 1 508 ? 31.003  -1.708  29.727  0.04 15.61 ? 564  VAL A HG23 1  
ATOM   7469   N N    . LYS A 1 509 ? 30.918  0.406   25.076  0.04 14.84 ? 565  LYS A N    1  
ATOM   7470   C CA   . LYS A 1 509 ? 31.290  1.374   24.051  0.04 14.83 ? 565  LYS A CA   1  
ATOM   7471   C C    . LYS A 1 509 ? 30.157  1.746   23.126  0.04 14.38 ? 565  LYS A C    1  
ATOM   7472   O O    . LYS A 1 509 ? 29.219  0.980   22.887  0.04 14.10 ? 565  LYS A O    1  
ATOM   7473   C CB   . LYS A 1 509 ? 32.435  0.797   23.228  0.04 15.07 ? 565  LYS A CB   1  
ATOM   7474   C CG   . LYS A 1 509 ? 33.609  0.392   24.074  0.04 15.53 ? 565  LYS A CG   1  
ATOM   7475   C CD   . LYS A 1 509 ? 34.798  0.018   23.256  0.04 15.81 ? 565  LYS A CD   1  
ATOM   7476   C CE   . LYS A 1 509 ? 34.445  -1.073  22.272  0.04 15.55 ? 565  LYS A CE   1  
ATOM   7477   N NZ   . LYS A 1 509 ? 35.200  -0.848  21.050  0.04 15.76 ? 565  LYS A NZ   1  
ATOM   7478   H H    . LYS A 1 509 ? 30.644  -0.341  24.760  0.04 14.65 ? 565  LYS A H    1  
ATOM   7479   H HA   . LYS A 1 509 ? 31.591  2.184   24.475  0.04 15.00 ? 565  LYS A HA   1  
ATOM   7480   H HB2  . LYS A 1 509 ? 32.078  0.023   22.771  0.04 14.88 ? 565  LYS A HB2  1  
ATOM   7481   H HB3  . LYS A 1 509 ? 32.733  1.458   22.583  0.04 15.14 ? 565  LYS A HB3  1  
ATOM   7482   H HG2  . LYS A 1 509 ? 33.855  1.145   24.632  0.04 15.74 ? 565  LYS A HG2  1  
ATOM   7483   H HG3  . LYS A 1 509 ? 33.365  -0.368  24.630  0.04 15.49 ? 565  LYS A HG3  1  
ATOM   7484   H HD2  . LYS A 1 509 ? 35.112  0.794   22.765  0.04 15.90 ? 565  LYS A HD2  1  
ATOM   7485   H HD3  . LYS A 1 509 ? 35.501  -0.322  23.832  0.04 16.12 ? 565  LYS A HD3  1  
ATOM   7486   H HE2  . LYS A 1 509 ? 34.713  -1.929  22.643  0.04 15.60 ? 565  LYS A HE2  1  
ATOM   7487   H HE3  . LYS A 1 509 ? 33.516  -1.088  22.036  0.04 15.22 ? 565  LYS A HE3  1  
ATOM   7488   H HZ1  . LYS A 1 509 ? 35.011  -1.489  20.461  0.04 15.62 ? 565  LYS A HZ1  1  
ATOM   7489   H HZ2  . LYS A 1 509 ? 34.989  -0.060  20.706  0.04 15.73 ? 565  LYS A HZ2  1  
ATOM   7490   H HZ3  . LYS A 1 509 ? 36.072  -0.876  21.234  0.04 16.09 ? 565  LYS A HZ3  1  
ATOM   7491   N N    . PHE A 1 510 ? 30.231  2.980   22.643  0.04 14.36 ? 566  PHE A N    1  
ATOM   7492   C CA   . PHE A 1 510 ? 29.292  3.470   21.654  0.04 14.01 ? 566  PHE A CA   1  
ATOM   7493   C C    . PHE A 1 510 ? 29.979  4.087   20.478  0.04 14.11 ? 566  PHE A C    1  
ATOM   7494   O O    . PHE A 1 510 ? 31.182  4.424   20.513  0.04 14.41 ? 566  PHE A O    1  
ATOM   7495   C CB   . PHE A 1 510 ? 28.322  4.497   22.267  0.04 13.90 ? 566  PHE A CB   1  
ATOM   7496   C CG   . PHE A 1 510 ? 27.312  3.890   23.185  0.04 13.72 ? 566  PHE A CG   1  
ATOM   7497   C CD1  . PHE A 1 510 ? 27.196  4.294   24.509  0.04 13.94 ? 566  PHE A CD1  1  
ATOM   7498   C CD2  . PHE A 1 510 ? 26.497  2.874   22.731  0.04 13.37 ? 566  PHE A CD2  1  
ATOM   7499   C CE1  . PHE A 1 510 ? 26.222  3.701   25.344  0.04 13.81 ? 566  PHE A CE1  1  
ATOM   7500   C CE2  . PHE A 1 510 ? 25.564  2.281   23.561  0.04 13.23 ? 566  PHE A CE2  1  
ATOM   7501   C CZ   . PHE A 1 510 ? 25.430  2.684   24.861  0.04 13.45 ? 566  PHE A CZ   1  
ATOM   7502   H H    . PHE A 1 510 ? 30.821  3.555   22.880  0.04 14.57 ? 566  PHE A H    1  
ATOM   7503   H HA   . PHE A 1 510 ? 28.769  2.727   21.316  0.04 13.81 ? 566  PHE A HA   1  
ATOM   7504   H HB2  . PHE A 1 510 ? 28.832  5.131   22.790  0.04 14.13 ? 566  PHE A HB2  1  
ATOM   7505   H HB3  . PHE A 1 510 ? 27.851  4.948   21.553  0.04 13.74 ? 566  PHE A HB3  1  
ATOM   7506   H HD1  . PHE A 1 510 ? 27.732  4.978   24.833  0.04 14.20 ? 566  PHE A HD1  1  
ATOM   7507   H HD2  . PHE A 1 510 ? 26.573  2.582   21.847  0.04 13.25 ? 566  PHE A HD2  1  
ATOM   7508   H HE1  . PHE A 1 510 ? 26.142  3.973   26.228  0.04 13.98 ? 566  PHE A HE1  1  
ATOM   7509   H HE2  . PHE A 1 510 ? 25.020  1.602   23.228  0.04 13.02 ? 566  PHE A HE2  1  
ATOM   7510   H HZ   . PHE A 1 510 ? 24.794  2.284   25.407  0.04 13.39 ? 566  PHE A HZ   1  
ATOM   7511   N N    . HIS A 1 511 ? 29.190  4.198   19.422  0.04 13.88 ? 567  HIS A N    1  
ATOM   7512   C CA   . HIS A 1 511 ? 29.635  4.752   18.168  0.04 13.97 ? 567  HIS A CA   1  
ATOM   7513   C C    . HIS A 1 511 ? 28.502  5.545   17.578  0.04 13.71 ? 567  HIS A C    1  
ATOM   7514   O O    . HIS A 1 511 ? 27.425  4.997   17.365  0.04 13.40 ? 567  HIS A O    1  
ATOM   7515   C CB   . HIS A 1 511 ? 30.014  3.618   17.210  0.04 14.00 ? 567  HIS A CB   1  
ATOM   7516   C CG   . HIS A 1 511 ? 30.953  2.634   17.805  0.04 14.23 ? 567  HIS A CG   1  
ATOM   7517   N ND1  . HIS A 1 511 ? 32.277  2.945   18.056  0.04 14.65 ? 567  HIS A ND1  1  
ATOM   7518   C CD2  . HIS A 1 511 ? 30.789  1.336   18.159  0.04 14.15 ? 567  HIS A CD2  1  
ATOM   7519   C CE1  . HIS A 1 511 ? 32.876  1.880   18.564  0.04 14.81 ? 567  HIS A CE1  1  
ATOM   7520   N NE2  . HIS A 1 511 ? 32.005  0.891   18.629  0.04 14.51 ? 567  HIS A NE2  1  
ATOM   7521   H H    . HIS A 1 511 ? 28.367  3.964   19.416  0.04 13.68 ? 567  HIS A H    1  
ATOM   7522   H HA   . HIS A 1 511 ? 30.407  5.323   18.306  0.04 14.22 ? 567  HIS A HA   1  
ATOM   7523   H HB2  . HIS A 1 511 ? 29.209  3.133   16.962  0.04 13.76 ? 567  HIS A HB2  1  
ATOM   7524   H HB3  . HIS A 1 511 ? 30.435  3.992   16.418  0.04 14.14 ? 567  HIS A HB3  1  
ATOM   7525   H HD2  . HIS A 1 511 ? 30.009  0.839   18.097  0.04 13.91 ? 567  HIS A HD2  1  
ATOM   7526   H HE1  . HIS A 1 511 ? 33.768  1.832   18.824  0.04 15.11 ? 567  HIS A HE1  1  
ATOM   7527   N N    . ASP A 1 512 ? 28.756  6.818   17.299  0.04 13.88 ? 568  ASP A N    1  
ATOM   7528   C CA   . ASP A 1 512 ? 27.823  7.676   16.572  0.04 13.72 ? 568  ASP A CA   1  
ATOM   7529   C C    . ASP A 1 512 ? 26.516  7.942   17.338  0.04 13.45 ? 568  ASP A C    1  
ATOM   7530   O O    . ASP A 1 512 ? 25.411  7.560   16.921  0.04 13.16 ? 568  ASP A O    1  
ATOM   7531   C CB   . ASP A 1 512 ? 27.574  7.127   15.145  0.04 13.59 ? 568  ASP A CB   1  
ATOM   7532   C CG   . ASP A 1 512 ? 28.851  6.935   14.339  0.04 13.89 ? 568  ASP A CG   1  
ATOM   7533   O OD1  . ASP A 1 512 ? 29.926  7.315   14.791  0.04 14.21 ? 568  ASP A OD1  1  
ATOM   7534   O OD2  . ASP A 1 512 ? 28.724  6.352   13.217  0.04 13.82 ? 568  ASP A OD2  1  
ATOM   7535   H H    . ASP A 1 512 ? 29.484  7.214   17.517  0.04 14.11 ? 568  ASP A H    1  
ATOM   7536   H HA   . ASP A 1 512 ? 28.253  8.538   16.464  0.04 13.91 ? 568  ASP A HA   1  
ATOM   7537   H HB2  . ASP A 1 512 ? 27.148  6.260   15.215  0.04 13.41 ? 568  ASP A HB2  1  
ATOM   7538   H HB3  . ASP A 1 512 ? 27.007  7.735   14.649  0.04 13.53 ? 568  ASP A HB3  1  
ATOM   7539   N N    . LEU A 1 513 ? 26.665  8.658   18.452  0.04 13.59 ? 569  LEU A N    1  
ATOM   7540   C CA   . LEU A 1 513 ? 25.546  9.087   19.274  0.04 13.41 ? 569  LEU A CA   1  
ATOM   7541   C C    . LEU A 1 513 ? 25.171  10.523  18.914  0.04 13.51 ? 569  LEU A C    1  
ATOM   7542   O O    . LEU A 1 513 ? 26.006  11.333  18.542  0.04 13.80 ? 569  LEU A O    1  
ATOM   7543   C CB   . LEU A 1 513 ? 25.953  9.116   20.745  0.04 13.56 ? 569  LEU A CB   1  
ATOM   7544   C CG   . LEU A 1 513 ? 26.290  7.797   21.417  0.04 13.57 ? 569  LEU A CG   1  
ATOM   7545   C CD1  . LEU A 1 513 ? 26.816  7.997   22.841  0.04 13.76 ? 569  LEU A CD1  1  
ATOM   7546   C CD2  . LEU A 1 513 ? 25.057  6.862   21.397  0.04 13.23 ? 569  LEU A CD2  1  
ATOM   7547   H H    . LEU A 1 513 ? 27.423  8.914   18.753  0.04 13.81 ? 569  LEU A H    1  
ATOM   7548   H HA   . LEU A 1 513 ? 24.789  8.505   19.154  0.04 13.19 ? 569  LEU A HA   1  
ATOM   7549   H HB2  . LEU A 1 513 ? 26.736  9.679   20.824  0.04 13.80 ? 569  LEU A HB2  1  
ATOM   7550   H HB3  . LEU A 1 513 ? 25.226  9.514   21.247  0.04 13.45 ? 569  LEU A HB3  1  
ATOM   7551   H HG   . LEU A 1 513 ? 26.995  7.364   20.907  0.04 13.71 ? 569  LEU A HG   1  
ATOM   7552   H HD11 . LEU A 1 513 ? 27.199  7.170   23.171  0.04 13.83 ? 569  LEU A HD11 1  
ATOM   7553   H HD12 . LEU A 1 513 ? 27.487  8.697   22.834  0.04 13.98 ? 569  LEU A HD12 1  
ATOM   7554   H HD13 . LEU A 1 513 ? 26.071  8.260   23.406  0.04 13.62 ? 569  LEU A HD13 1  
ATOM   7555   H HD21 . LEU A 1 513 ? 25.009  6.397   22.249  0.04 13.25 ? 569  LEU A HD21 1  
ATOM   7556   H HD22 . LEU A 1 513 ? 24.260  7.392   21.259  0.04 13.09 ? 569  LEU A HD22 1  
ATOM   7557   H HD23 . LEU A 1 513 ? 25.159  6.220   20.676  0.04 13.17 ? 569  LEU A HD23 1  
ATOM   7558   N N    . LEU A 1 514 ? 23.892  10.846  19.071  0.04 13.31 ? 570  LEU A N    1  
ATOM   7559   C CA   . LEU A 1 514 ? 23.417  12.212  18.823  0.04 13.43 ? 570  LEU A CA   1  
ATOM   7560   C C    . LEU A 1 514 ? 22.184  12.532  19.653  0.04 13.30 ? 570  LEU A C    1  
ATOM   7561   O O    . LEU A 1 514 ? 21.356  11.689  19.926  0.04 13.04 ? 570  LEU A O    1  
ATOM   7562   C CB   . LEU A 1 514 ? 23.093  12.430  17.331  0.04 13.42 ? 570  LEU A CB   1  
ATOM   7563   C CG   . LEU A 1 514 ? 22.033  11.488  16.769  0.04 13.13 ? 570  LEU A CG   1  
ATOM   7564   C CD1  . LEU A 1 514 ? 21.009  12.272  15.958  0.04 13.21 ? 570  LEU A CD1  1  
ATOM   7565   C CD2  . LEU A 1 514 ? 22.710  10.391  15.961  0.04 13.06 ? 570  LEU A CD2  1  
ATOM   7566   H H    . LEU A 1 514 ? 23.285  10.295  19.314  0.04 13.12 ? 570  LEU A H    1  
ATOM   7567   H HA   . LEU A 1 514 ? 24.118  12.828  19.071  0.04 13.67 ? 570  LEU A HA   1  
ATOM   7568   H HB2  . LEU A 1 514 ? 22.779  13.342  17.221  0.04 13.54 ? 570  LEU A HB2  1  
ATOM   7569   H HB3  . LEU A 1 514 ? 23.901  12.297  16.809  0.04 13.56 ? 570  LEU A HB3  1  
ATOM   7570   H HG   . LEU A 1 514 ? 21.568  11.071  17.510  0.04 12.97 ? 570  LEU A HG   1  
ATOM   7571   H HD11 . LEU A 1 514 ? 20.439  11.647  15.479  0.04 13.13 ? 570  LEU A HD11 1  
ATOM   7572   H HD12 . LEU A 1 514 ? 20.478  12.817  16.559  0.04 13.14 ? 570  LEU A HD12 1  
ATOM   7573   H HD13 . LEU A 1 514 ? 21.477  12.841  15.326  0.04 13.44 ? 570  LEU A HD13 1  
ATOM   7574   H HD21 . LEU A 1 514 ? 22.024  9.831   15.564  0.04 12.85 ? 570  LEU A HD21 1  
ATOM   7575   H HD22 . LEU A 1 514 ? 23.255  10.802  15.272  0.04 13.17 ? 570  LEU A HD22 1  
ATOM   7576   H HD23 . LEU A 1 514 ? 23.266  9.855   16.549  0.04 13.13 ? 570  LEU A HD23 1  
ATOM   7577   N N    . VAL A 1 515 ? 22.070  13.804  20.031  0.04 13.52 ? 571  VAL A N    1  
ATOM   7578   C CA   . VAL A 1 515 ? 20.838  14.339  20.599  0.04 13.45 ? 571  VAL A CA   1  
ATOM   7579   C C    . VAL A 1 515 ? 20.427  15.607  19.843  0.04 13.62 ? 571  VAL A C    1  
ATOM   7580   O O    . VAL A 1 515 ? 21.246  16.319  19.306  0.04 13.87 ? 571  VAL A O    1  
ATOM   7581   C CB   . VAL A 1 515 ? 20.963  14.585  22.130  0.04 13.59 ? 571  VAL A CB   1  
ATOM   7582   C CG1  . VAL A 1 515 ? 21.303  13.291  22.844  0.04 13.42 ? 571  VAL A CG1  1  
ATOM   7583   C CG2  . VAL A 1 515 ? 21.974  15.708  22.463  0.04 13.98 ? 571  VAL A CG2  1  
ATOM   7584   H H    . VAL A 1 515 ? 22.705  14.372  19.981  0.04 13.72 ? 571  VAL A H    1  
ATOM   7585   H HA   . VAL A 1 515 ? 20.140  13.698  20.461  0.04 13.23 ? 571  VAL A HA   1  
ATOM   7586   H HB   . VAL A 1 515 ? 20.094  14.871  22.451  0.04 13.56 ? 571  VAL A HB   1  
ATOM   7587   H HG11 . VAL A 1 515 ? 21.383  13.466  23.795  0.04 13.57 ? 571  VAL A HG11 1  
ATOM   7588   H HG12 . VAL A 1 515 ? 20.598  12.645  22.682  0.04 13.23 ? 571  VAL A HG12 1  
ATOM   7589   H HG13 . VAL A 1 515 ? 22.147  12.956  22.498  0.04 13.38 ? 571  VAL A HG13 1  
ATOM   7590   H HG21 . VAL A 1 515 ? 22.097  15.719  23.422  0.04 14.05 ? 571  VAL A HG21 1  
ATOM   7591   H HG22 . VAL A 1 515 ? 22.820  15.518  22.024  0.04 14.05 ? 571  VAL A HG22 1  
ATOM   7592   H HG23 . VAL A 1 515 ? 21.623  16.555  22.151  0.04 14.10 ? 571  VAL A HG23 1  
ATOM   7593   N N    . VAL A 1 516 ? 19.132  15.863  19.809  0.04 13.52 ? 572  VAL A N    1  
ATOM   7594   C CA   . VAL A 1 516 ? 18.586  16.935  18.982  0.04 13.69 ? 572  VAL A CA   1  
ATOM   7595   C C    . VAL A 1 516 ? 17.380  17.564  19.689  0.04 13.73 ? 572  VAL A C    1  
ATOM   7596   O O    . VAL A 1 516 ? 16.479  16.845  20.140  0.04 13.50 ? 572  VAL A O    1  
ATOM   7597   C CB   . VAL A 1 516 ? 18.084  16.402  17.617  0.04 13.52 ? 572  VAL A CB   1  
ATOM   7598   C CG1  . VAL A 1 516 ? 17.663  17.563  16.725  0.04 13.79 ? 572  VAL A CG1  1  
ATOM   7599   C CG2  . VAL A 1 516 ? 19.123  15.500  16.931  0.04 13.40 ? 572  VAL A CG2  1  
ATOM   7600   H H    . VAL A 1 516 ? 18.546  15.420  20.248  0.04 13.37 ? 572  VAL A H    1  
ATOM   7601   H HA   . VAL A 1 516 ? 19.250  17.625  18.830  0.04 13.92 ? 572  VAL A HA   1  
ATOM   7602   H HB   . VAL A 1 516 ? 17.303  15.849  17.780  0.04 13.34 ? 572  VAL A HB   1  
ATOM   7603   H HG11 . VAL A 1 516 ? 17.464  17.222  15.836  0.04 13.70 ? 572  VAL A HG11 1  
ATOM   7604   H HG12 . VAL A 1 516 ? 16.876  17.986  17.104  0.04 13.88 ? 572  VAL A HG12 1  
ATOM   7605   H HG13 . VAL A 1 516 ? 18.393  18.202  16.680  0.04 13.99 ? 572  VAL A HG13 1  
ATOM   7606   H HG21 . VAL A 1 516 ? 18.799  15.229  16.056  0.04 13.34 ? 572  VAL A HG21 1  
ATOM   7607   H HG22 . VAL A 1 516 ? 19.955  15.991  16.838  0.04 13.59 ? 572  VAL A HG22 1  
ATOM   7608   H HG23 . VAL A 1 516 ? 19.274  14.721  17.488  0.04 13.23 ? 572  VAL A HG23 1  
ATOM   7609   N N    . SER A 1 517 ? 17.392  18.887  19.843  0.04 14.07 ? 573  SER A N    1  
ATOM   7610   C CA   . SER A 1 517 ? 16.184  19.608  20.246  0.04 14.17 ? 573  SER A CA   1  
ATOM   7611   C C    . SER A 1 517 ? 15.401  20.027  19.037  0.04 14.21 ? 573  SER A C    1  
ATOM   7612   O O    . SER A 1 517 ? 15.946  20.632  18.134  0.04 14.42 ? 573  SER A O    1  
ATOM   7613   C CB   . SER A 1 517 ? 16.533  20.875  21.047  0.04 14.57 ? 573  SER A CB   1  
ATOM   7614   O OG   . SER A 1 517 ? 15.381  21.642  21.333  0.04 14.76 ? 573  SER A OG   1  
ATOM   7615   H H    . SER A 1 517 ? 18.076  19.388  19.725  0.04 14.26 ? 573  SER A H    1  
ATOM   7616   H HA   . SER A 1 517 ? 15.633  19.030  20.789  0.04 14.00 ? 573  SER A HA   1  
ATOM   7617   H HB2  . SER A 1 517 ? 16.956  20.610  21.880  0.04 14.56 ? 573  SER A HB2  1  
ATOM   7618   H HB3  . SER A 1 517 ? 17.139  21.423  20.523  0.04 14.75 ? 573  SER A HB3  1  
ATOM   7619   H HG   . SER A 1 517 ? 15.591  22.432  21.523  0.04 14.77 ? 573  SER A HG   1  
ATOM   7620   N N    . LEU A 1 518 ? 14.111  19.726  19.035  0.04 14.05 ? 574  LEU A N    1  
ATOM   7621   C CA   . LEU A 1 518 ? 13.259  20.054  17.891  0.04 14.10 ? 574  LEU A CA   1  
ATOM   7622   C C    . LEU A 1 518 ? 12.707  21.486  18.070  0.04 14.49 ? 574  LEU A C    1  
ATOM   7623   O O    . LEU A 1 518 ? 11.775  21.745  18.843  0.04 14.56 ? 574  LEU A O    1  
ATOM   7624   C CB   . LEU A 1 518 ? 12.179  18.944  17.719  0.04 13.79 ? 574  LEU A CB   1  
ATOM   7625   C CG   . LEU A 1 518 ? 12.707  17.489  17.674  0.04 13.43 ? 574  LEU A CG   1  
ATOM   7626   C CD1  . LEU A 1 518 ? 11.566  16.525  17.573  0.04 13.23 ? 574  LEU A CD1  1  
ATOM   7627   C CD2  . LEU A 1 518 ? 13.679  17.246  16.526  0.04 13.45 ? 574  LEU A CD2  1  
ATOM   7628   H H    . LEU A 1 518 ? 13.702  19.336  19.675  0.04 13.93 ? 574  LEU A H    1  
ATOM   7629   H HA   . LEU A 1 518 ? 13.799  20.055  17.087  0.04 14.12 ? 574  LEU A HA   1  
ATOM   7630   H HB2  . LEU A 1 518 ? 11.548  18.998  18.449  0.04 13.80 ? 574  LEU A HB2  1  
ATOM   7631   H HB3  . LEU A 1 518 ? 11.718  19.106  16.880  0.04 13.86 ? 574  LEU A HB3  1  
ATOM   7632   H HG   . LEU A 1 518 ? 13.186  17.300  18.498  0.04 13.36 ? 574  LEU A HG   1  
ATOM   7633   H HD11 . LEU A 1 518 ? 11.878  15.644  17.836  0.04 13.03 ? 574  LEU A HD11 1  
ATOM   7634   H HD12 . LEU A 1 518 ? 10.851  16.817  18.162  0.04 13.33 ? 574  LEU A HD12 1  
ATOM   7635   H HD13 . LEU A 1 518 ? 11.253  16.515  16.656  0.04 13.24 ? 574  LEU A HD13 1  
ATOM   7636   H HD21 . LEU A 1 518 ? 14.089  16.375  16.642  0.04 13.24 ? 574  LEU A HD21 1  
ATOM   7637   H HD22 . LEU A 1 518 ? 13.190  17.270  15.690  0.04 13.60 ? 574  LEU A HD22 1  
ATOM   7638   H HD23 . LEU A 1 518 ? 14.356  17.941  16.533  0.04 13.54 ? 574  LEU A HD23 1  
ATOM   7639   N N    . GLY A 1 519 ? 13.295  22.436  17.351  0.04 14.80 ? 575  GLY A N    1  
ATOM   7640   C CA   . GLY A 1 519 ? 12.813  23.805  17.423  0.04 15.23 ? 575  GLY A CA   1  
ATOM   7641   C C    . GLY A 1 519 ? 13.015  24.532  18.741  0.04 15.48 ? 575  GLY A C    1  
ATOM   7642   O O    . GLY A 1 519 ? 12.221  25.380  19.109  0.04 15.78 ? 575  GLY A O    1  
ATOM   7643   H H    . GLY A 1 519 ? 13.971  22.322  16.833  0.04 14.79 ? 575  GLY A H    1  
ATOM   7644   H HA2  . GLY A 1 519 ? 13.242  24.325  16.724  0.04 15.42 ? 575  GLY A HA2  1  
ATOM   7645   H HA3  . GLY A 1 519 ? 11.860  23.814  17.241  0.04 15.24 ? 575  GLY A HA3  1  
ATOM   7646   N N    . GLY A 1 520 ? 14.025  24.140  19.494  0.04 15.38 ? 576  GLY A N    1  
ATOM   7647   C CA   . GLY A 1 520 ? 14.315  24.789  20.767  0.04 15.65 ? 576  GLY A CA   1  
ATOM   7648   C C    . GLY A 1 520 ? 13.325  24.493  21.881  0.04 15.57 ? 576  GLY A C    1  
ATOM   7649   O O    . GLY A 1 520 ? 13.322  25.169  22.902  0.04 15.85 ? 576  GLY A O    1  
ATOM   7650   H H    . GLY A 1 520 ? 14.565  23.506  19.290  0.04 15.18 ? 576  GLY A H    1  
ATOM   7651   H HA2  . GLY A 1 520 ? 15.199  24.531  21.068  0.04 15.62 ? 576  GLY A HA2  1  
ATOM   7652   H HA3  . GLY A 1 520 ? 14.319  25.748  20.627  0.04 15.98 ? 576  GLY A HA3  1  
ATOM   7653   N N    . LYS A 1 521 ? 12.491  23.485  21.713  0.04 15.23 ? 577  LYS A N    1  
ATOM   7654   C CA   . LYS A 1 521 ? 11.487  23.131  22.718  0.04 15.17 ? 577  LYS A CA   1  
ATOM   7655   C C    . LYS A 1 521 ? 12.142  22.175  23.756  0.04 14.92 ? 577  LYS A C    1  
ATOM   7656   O O    . LYS A 1 521 ? 12.152  20.940  23.650  0.04 14.55 ? 577  LYS A O    1  
ATOM   7657   C CB   . LYS A 1 521 ? 10.201  22.621  22.038  0.04 15.04 ? 577  LYS A CB   1  
ATOM   7658   C CG   . LYS A 1 521 ? 9.467   23.713  21.169  0.04 15.41 ? 577  LYS A CG   1  
ATOM   7659   C CD   . LYS A 1 521 ? 9.060   24.976  22.040  0.04 15.87 ? 577  LYS A CD   1  
ATOM   7660   C CE   . LYS A 1 521 ? 8.087   26.024  21.379  0.04 16.20 ? 577  LYS A CE   1  
ATOM   7661   N NZ   . LYS A 1 521 ? 7.384   27.034  22.312  0.04 16.71 ? 577  LYS A NZ   1  
ATOM   7662   H H    . LYS A 1 521 ? 12.482  22.985  21.015  0.04 15.05 ? 577  LYS A H    1  
ATOM   7663   H HA   . LYS A 1 521 ? 11.241  23.930  23.204  0.04 15.46 ? 577  LYS A HA   1  
ATOM   7664   H HB2  . LYS A 1 521 ? 10.437  21.889  21.448  0.04 14.79 ? 577  LYS A HB2  1  
ATOM   7665   H HB3  . LYS A 1 521 ? 9.586   22.307  22.719  0.04 14.98 ? 577  LYS A HB3  1  
ATOM   7666   H HG2  . LYS A 1 521 ? 10.058  23.996  20.457  0.04 15.49 ? 577  LYS A HG2  1  
ATOM   7667   H HG3  . LYS A 1 521 ? 8.659   23.323  20.796  0.04 15.31 ? 577  LYS A HG3  1  
ATOM   7668   H HD2  . LYS A 1 521 ? 8.618   24.656  22.842  0.04 15.80 ? 577  LYS A HD2  1  
ATOM   7669   H HD3  . LYS A 1 521 ? 9.867   25.449  22.288  0.04 16.05 ? 577  LYS A HD3  1  
ATOM   7670   H HE2  . LYS A 1 521 ? 8.597   26.539  20.732  0.04 16.28 ? 577  LYS A HE2  1  
ATOM   7671   H HE3  . LYS A 1 521 ? 7.398   25.520  20.914  0.04 16.02 ? 577  LYS A HE3  1  
ATOM   7672   H HZ1  . LYS A 1 521 ? 6.793   27.512  21.851  0.04 16.92 ? 577  LYS A HZ1  1  
ATOM   7673   H HZ2  . LYS A 1 521 ? 6.955   26.607  22.966  0.04 16.68 ? 577  LYS A HZ2  1  
ATOM   7674   H HZ3  . LYS A 1 521 ? 7.981   27.586  22.675  0.04 16.87 ? 577  LYS A HZ3  1  
ATOM   7675   N N    . GLY A 1 522 ? 12.727  22.820  24.765  0.04 15.19 ? 578  GLY A N    1  
ATOM   7676   C CA   . GLY A 1 522 ? 13.637  22.171  25.698  0.04 15.09 ? 578  GLY A CA   1  
ATOM   7677   C C    . GLY A 1 522 ? 15.027  22.033  25.090  0.04 15.05 ? 578  GLY A C    1  
ATOM   7678   O O    . GLY A 1 522 ? 15.214  22.317  23.926  0.04 15.06 ? 578  GLY A O    1  
ATOM   7679   H H    . GLY A 1 522 ? 12.603  23.650  24.931  0.04 15.46 ? 578  GLY A H    1  
ATOM   7680   H HA2  . GLY A 1 522 ? 13.684  22.675  26.520  0.04 15.32 ? 578  GLY A HA2  1  
ATOM   7681   H HA3  . GLY A 1 522 ? 13.316  21.280  25.903  0.04 14.84 ? 578  GLY A HA3  1  
ATOM   7682   N N    . GLN A 1 523 ? 16.003  21.628  25.890  0.04 15.07 ? 579  GLN A N    1  
ATOM   7683   C CA   . GLN A 1 523 ? 17.360  21.377  25.395  0.04 15.05 ? 579  GLN A CA   1  
ATOM   7684   C C    . GLN A 1 523 ? 17.961  20.203  26.154  0.04 14.86 ? 579  GLN A C    1  
ATOM   7685   O O    . GLN A 1 523 ? 17.577  19.942  27.302  0.04 14.87 ? 579  GLN A O    1  
ATOM   7686   C CB   . GLN A 1 523 ? 18.300  22.574  25.587  0.04 15.51 ? 579  GLN A CB   1  
ATOM   7687   C CG   . GLN A 1 523 ? 17.846  23.910  24.976  0.04 15.83 ? 579  GLN A CG   1  
ATOM   7688   C CD   . GLN A 1 523 ? 17.991  24.002  23.451  0.04 15.76 ? 579  GLN A CD   1  
ATOM   7689   O OE1  . GLN A 1 523 ? 18.492  23.109  22.789  0.04 15.49 ? 579  GLN A OE1  1  
ATOM   7690   N NE2  . GLN A 1 523 ? 17.564  25.135  22.901  0.04 16.05 ? 579  GLN A NE2  1  
ATOM   7691   H H    . GLN A 1 523 ? 15.914  21.494  26.729  0.04 15.11 ? 579  GLN A H    1  
ATOM   7692   H HA   . GLN A 1 523 ? 17.340  21.152  24.454  0.04 14.91 ? 579  GLN A HA   1  
ATOM   7693   H HB2  . GLN A 1 523 ? 18.441  22.712  26.537  0.04 15.66 ? 579  GLN A HB2  1  
ATOM   7694   H HB3  . GLN A 1 523 ? 19.151  22.349  25.177  0.04 15.50 ? 579  GLN A HB3  1  
ATOM   7695   H HG2  . GLN A 1 523 ? 16.914  24.055  25.194  0.04 15.82 ? 579  GLN A HG2  1  
ATOM   7696   H HG3  . GLN A 1 523 ? 18.383  24.618  25.358  0.04 16.14 ? 579  GLN A HG3  1  
ATOM   7697   H HE21 . GLN A 1 523 ? 17.026  25.646  23.329  0.04 16.23 ? 579  GLN A HE21 1  
ATOM   7698   H HE22 . GLN A 1 523 ? 17.819  25.345  22.111  0.04 16.06 ? 579  GLN A HE22 1  
ATOM   7699   N N    . TYR A 1 524 ? 18.970  19.559  25.542  0.04 14.74 ? 580  TYR A N    1  
ATOM   7700   C CA   . TYR A 1 524 ? 19.821  18.603  26.224  0.04 14.67 ? 580  TYR A CA   1  
ATOM   7701   C C    . TYR A 1 524 ? 21.017  19.333  26.825  0.04 15.08 ? 580  TYR A C    1  
ATOM   7702   O O    . TYR A 1 524 ? 21.534  20.300  26.236  0.04 15.34 ? 580  TYR A O    1  
ATOM   7703   C CB   . TYR A 1 524 ? 20.358  17.548  25.236  0.04 14.39 ? 580  TYR A CB   1  
ATOM   7704   C CG   . TYR A 1 524 ? 19.305  16.587  24.757  0.04 14.00 ? 580  TYR A CG   1  
ATOM   7705   C CD1  . TYR A 1 524 ? 18.399  16.945  23.759  0.04 13.89 ? 580  TYR A CD1  1  
ATOM   7706   C CD2  . TYR A 1 524 ? 19.218  15.306  25.289  0.04 13.78 ? 580  TYR A CD2  1  
ATOM   7707   C CE1  . TYR A 1 524 ? 17.430  16.091  23.357  0.04 13.57 ? 580  TYR A CE1  1  
ATOM   7708   C CE2  . TYR A 1 524 ? 18.236  14.440  24.871  0.04 13.46 ? 580  TYR A CE2  1  
ATOM   7709   C CZ   . TYR A 1 524 ? 17.344  14.843  23.901  0.04 13.36 ? 580  TYR A CZ   1  
ATOM   7710   O OH   . TYR A 1 524 ? 16.326  14.015  23.449  0.04 13.08 ? 580  TYR A OH   1  
ATOM   7711   H H    . TYR A 1 524 ? 19.184  19.674  24.722  0.04 14.72 ? 580  TYR A H    1  
ATOM   7712   H HA   . TYR A 1 524 ? 19.310  18.168  26.914  0.04 14.58 ? 580  TYR A HA   1  
ATOM   7713   H HB2  . TYR A 1 524 ? 20.708  18.011  24.460  0.04 14.48 ? 580  TYR A HB2  1  
ATOM   7714   H HB3  . TYR A 1 524 ? 21.064  17.044  25.666  0.04 14.42 ? 580  TYR A HB3  1  
ATOM   7715   H HD1  . TYR A 1 524 ? 18.436  17.797  23.391  0.04 14.06 ? 580  TYR A HD1  1  
ATOM   7716   H HD2  . TYR A 1 524 ? 19.809  15.044  25.954  0.04 13.87 ? 580  TYR A HD2  1  
ATOM   7717   H HE1  . TYR A 1 524 ? 16.824  16.347  22.700  0.04 13.53 ? 580  TYR A HE1  1  
ATOM   7718   H HE2  . TYR A 1 524 ? 18.182  13.590  25.247  0.04 13.34 ? 580  TYR A HE2  1  
ATOM   7719   H HH   . TYR A 1 524 ? 16.494  13.218  23.654  0.04 12.97 ? 580  TYR A HH   1  
ATOM   7720   N N    . GLU A 1 525 ? 21.469  18.875  27.988  0.04 15.18 ? 581  GLU A N    1  
ATOM   7721   C CA   . GLU A 1 525 ? 22.687  19.400  28.600  0.04 15.58 ? 581  GLU A CA   1  
ATOM   7722   C C    . GLU A 1 525 ? 23.941  18.745  28.045  0.04 15.58 ? 581  GLU A C    1  
ATOM   7723   O O    . GLU A 1 525 ? 25.003  19.361  27.993  0.04 15.93 ? 581  GLU A O    1  
ATOM   7724   C CB   . GLU A 1 525 ? 22.619  19.223  30.118  0.04 15.76 ? 581  GLU A CB   1  
ATOM   7725   C CG   . GLU A 1 525 ? 21.409  19.956  30.691  0.04 15.91 ? 581  GLU A CG   1  
ATOM   7726   C CD   . GLU A 1 525 ? 21.273  19.865  32.200  0.04 16.11 ? 581  GLU A CD   1  
ATOM   7727   O OE1  . GLU A 1 525 ? 21.542  18.787  32.750  0.04 15.98 ? 581  GLU A OE1  1  
ATOM   7728   O OE2  . GLU A 1 525 ? 20.868  20.872  32.824  0.04 16.44 ? 581  GLU A OE2  1  
ATOM   7729   H H    . GLU A 1 525 ? 21.091  18.253  28.439  0.04 15.03 ? 581  GLU A H    1  
ATOM   7730   H HA   . GLU A 1 525 ? 22.736  20.355  28.430  0.04 15.81 ? 581  GLU A HA   1  
ATOM   7731   H HB2  . GLU A 1 525 ? 22.541  18.279  30.327  0.04 15.55 ? 581  GLU A HB2  1  
ATOM   7732   H HB3  . GLU A 1 525 ? 23.423  19.589  30.520  0.04 16.04 ? 581  GLU A HB3  1  
ATOM   7733   H HG2  . GLU A 1 525 ? 21.480  20.894  30.454  0.04 16.15 ? 581  GLU A HG2  1  
ATOM   7734   H HG3  . GLU A 1 525 ? 20.609  19.574  30.301  0.04 15.66 ? 581  GLU A HG3  1  
ATOM   7735   N N    . HIS A 1 526 ? 23.796  17.483  27.628  0.04 15.21 ? 582  HIS A N    1  
ATOM   7736   C CA   . HIS A 1 526 ? 24.897  16.645  27.174  0.04 15.18 ? 582  HIS A CA   1  
ATOM   7737   C C    . HIS A 1 526 ? 24.310  15.544  26.301  0.04 14.73 ? 582  HIS A C    1  
ATOM   7738   O O    . HIS A 1 526 ? 23.093  15.395  26.215  0.04 14.47 ? 582  HIS A O    1  
ATOM   7739   C CB   . HIS A 1 526 ? 25.646  16.012  28.359  0.04 15.37 ? 582  HIS A CB   1  
ATOM   7740   C CG   . HIS A 1 526 ? 26.360  17.014  29.205  0.04 15.85 ? 582  HIS A CG   1  
ATOM   7741   N ND1  . HIS A 1 526 ? 27.449  17.730  28.744  0.04 16.20 ? 582  HIS A ND1  1  
ATOM   7742   C CD2  . HIS A 1 526 ? 26.161  17.408  30.487  0.04 16.09 ? 582  HIS A CD2  1  
ATOM   7743   C CE1  . HIS A 1 526 ? 27.874  18.540  29.706  0.04 16.63 ? 582  HIS A CE1  1  
ATOM   7744   N NE2  . HIS A 1 526 ? 27.111  18.367  30.774  0.04 16.57 ? 582  HIS A NE2  1  
ATOM   7745   H H    . HIS A 1 526 ? 23.040  17.082  27.599  0.04 14.98 ? 582  HIS A H    1  
ATOM   7746   H HA   . HIS A 1 526 ? 25.527  17.170  26.660  0.04 15.36 ? 582  HIS A HA   1  
ATOM   7747   H HB2  . HIS A 1 526 ? 25.015  15.533  28.916  0.04 15.22 ? 582  HIS A HB2  1  
ATOM   7748   H HB3  . HIS A 1 526 ? 26.309  15.399  28.014  0.04 15.34 ? 582  HIS A HB3  1  
ATOM   7749   H HD2  . HIS A 1 526 ? 25.499  17.103  31.062  0.04 15.98 ? 582  HIS A HD2  1  
ATOM   7750   H HE1  . HIS A 1 526 ? 28.592  19.124  29.644  0.04 16.94 ? 582  HIS A HE1  1  
ATOM   7751   N N    . VAL A 1 527 ? 25.193  14.779  25.679  0.04 14.69 ? 583  VAL A N    1  
ATOM   7752   C CA   . VAL A 1 527 ? 24.800  13.665  24.816  0.04 14.32 ? 583  VAL A CA   1  
ATOM   7753   C C    . VAL A 1 527 ? 24.701  12.386  25.655  0.04 14.18 ? 583  VAL A C    1  
ATOM   7754   O O    . VAL A 1 527 ? 23.656  11.730  25.701  0.04 13.89 ? 583  VAL A O    1  
ATOM   7755   C CB   . VAL A 1 527 ? 25.831  13.475  23.687  0.04 14.39 ? 583  VAL A CB   1  
ATOM   7756   C CG1  . VAL A 1 527 ? 25.487  12.286  22.824  0.04 14.05 ? 583  VAL A CG1  1  
ATOM   7757   C CG2  . VAL A 1 527 ? 25.898  14.730  22.807  0.04 14.53 ? 583  VAL A CG2  1  
ATOM   7758   H H    . VAL A 1 527 ? 26.041  14.877  25.740  0.04 14.90 ? 583  VAL A H    1  
ATOM   7759   H HA   . VAL A 1 527 ? 23.937  13.843  24.416  0.04 14.14 ? 583  VAL A HA   1  
ATOM   7760   H HB   . VAL A 1 527 ? 26.697  13.325  24.093  0.04 14.60 ? 583  VAL A HB   1  
ATOM   7761   H HG11 . VAL A 1 527 ? 26.021  12.311  22.014  0.04 14.11 ? 583  VAL A HG11 1  
ATOM   7762   H HG12 . VAL A 1 527 ? 25.661  11.468  23.315  0.04 14.01 ? 583  VAL A HG12 1  
ATOM   7763   H HG13 . VAL A 1 527 ? 24.544  12.337  22.588  0.04 13.85 ? 583  VAL A HG13 1  
ATOM   7764   H HG21 . VAL A 1 527 ? 26.569  14.609  22.119  0.04 14.55 ? 583  VAL A HG21 1  
ATOM   7765   H HG22 . VAL A 1 527 ? 25.029  14.867  22.407  0.04 14.36 ? 583  VAL A HG22 1  
ATOM   7766   H HG23 . VAL A 1 527 ? 26.136  15.488  23.363  0.04 14.79 ? 583  VAL A HG23 1  
ATOM   7767   N N    . ILE A 1 528 ? 25.789  12.066  26.336  0.04 14.44 ? 584  ILE A N    1  
ATOM   7768   C CA   . ILE A 1 528 ? 25.851  10.868  27.150  0.04 14.38 ? 584  ILE A CA   1  
ATOM   7769   C C    . ILE A 1 528 ? 26.555  11.188  28.475  0.04 14.77 ? 584  ILE A C    1  
ATOM   7770   O O    . ILE A 1 528 ? 27.608  11.805  28.477  0.04 15.11 ? 584  ILE A O    1  
ATOM   7771   C CB   . ILE A 1 528 ? 26.558  9.713   26.368  0.04 14.31 ? 584  ILE A CB   1  
ATOM   7772   C CG1  . ILE A 1 528 ? 26.620  8.473   27.249  0.04 14.33 ? 584  ILE A CG1  1  
ATOM   7773   C CG2  . ILE A 1 528 ? 27.917  10.161  25.845  0.04 14.62 ? 584  ILE A CG2  1  
ATOM   7774   C CD1  . ILE A 1 528 ? 26.883  7.236   26.438  0.04 14.15 ? 584  ILE A CD1  1  
ATOM   7775   H H    . ILE A 1 528 ? 26.510  12.526  26.340  0.04 14.67 ? 584  ILE A H    1  
ATOM   7776   H HA   . ILE A 1 528 ? 24.951  10.582  27.351  0.04 14.18 ? 584  ILE A HA   1  
ATOM   7777   H HB   . ILE A 1 528 ? 26.015  9.496   25.598  0.04 14.07 ? 584  ILE A HB   1  
ATOM   7778   H HG12 . ILE A 1 528 ? 27.314  8.576   27.918  0.04 14.61 ? 584  ILE A HG12 1  
ATOM   7779   H HG13 . ILE A 1 528 ? 25.755  8.377   27.678  0.04 14.22 ? 584  ILE A HG13 1  
ATOM   7780   H HG21 . ILE A 1 528 ? 28.115  9.668   25.033  0.04 14.57 ? 584  ILE A HG21 1  
ATOM   7781   H HG22 . ILE A 1 528 ? 27.888  11.108  25.645  0.04 14.63 ? 584  ILE A HG22 1  
ATOM   7782   H HG23 . ILE A 1 528 ? 28.592  9.988   26.514  0.04 14.89 ? 584  ILE A HG23 1  
ATOM   7783   H HD11 . ILE A 1 528 ? 26.946  6.478   27.042  0.04 14.22 ? 584  ILE A HD11 1  
ATOM   7784   H HD12 . ILE A 1 528 ? 26.141  7.105   25.825  0.04 13.89 ? 584  ILE A HD12 1  
ATOM   7785   H HD13 . ILE A 1 528 ? 27.708  7.340   25.942  0.04 14.26 ? 584  ILE A HD13 1  
ATOM   7786   N N    . ASN A 1 529 ? 25.946  10.800  29.597  0.04 14.75 ? 585  ASN A N    1  
ATOM   7787   C CA   . ASN A 1 529 ? 26.503  11.096  30.919  0.04 15.13 ? 585  ASN A CA   1  
ATOM   7788   C C    . ASN A 1 529 ? 26.774  12.605  31.103  0.04 15.39 ? 585  ASN A C    1  
ATOM   7789   O O    . ASN A 1 529 ? 25.824  13.365  31.239  0.04 15.24 ? 585  ASN A O    1  
ATOM   7790   C CB   . ASN A 1 529 ? 27.764  10.271  31.175  0.04 15.42 ? 585  ASN A CB   1  
ATOM   7791   C CG   . ASN A 1 529 ? 27.465  8.803   31.459  0.04 15.21 ? 585  ASN A CG   1  
ATOM   7792   O OD1  . ASN A 1 529 ? 26.378  8.312   31.161  0.04 14.90 ? 585  ASN A OD1  1  
ATOM   7793   N ND2  . ASN A 1 529 ? 28.429  8.110   32.029  0.04 15.42 ? 585  ASN A ND2  1  
ATOM   7794   H H    . ASN A 1 529 ? 25.203  10.372  29.621  0.04 14.54 ? 585  ASN A H    1  
ATOM   7795   H HA   . ASN A 1 529 ? 25.854  10.835  31.590  0.04 15.08 ? 585  ASN A HA   1  
ATOM   7796   H HB2  . ASN A 1 529 ? 28.340  10.322  30.397  0.04 15.49 ? 585  ASN A HB2  1  
ATOM   7797   H HB3  . ASN A 1 529 ? 28.225  10.626  31.948  0.04 15.69 ? 585  ASN A HB3  1  
ATOM   7798   H HD21 . ASN A 1 529 ? 28.308  7.281   32.227  0.04 15.30 ? 585  ASN A HD21 1  
ATOM   7799   H HD22 . ASN A 1 529 ? 29.183  8.487   32.202  0.04 15.71 ? 585  ASN A HD22 1  
ATOM   7800   N N    . ASP A 1 530 ? 28.053  13.003  31.110  0.04 15.80 ? 586  ASP A N    1  
ATOM   7801   C CA   . ASP A 1 530 ? 28.454  14.406  31.196  0.04 16.11 ? 586  ASP A CA   1  
ATOM   7802   C C    . ASP A 1 530 ? 29.268  14.836  29.970  0.04 16.23 ? 586  ASP A C    1  
ATOM   7803   O O    . ASP A 1 530 ? 29.918  15.897  29.982  0.04 16.64 ? 586  ASP A O    1  
ATOM   7804   C CB   . ASP A 1 530 ? 29.239  14.665  32.513  0.04 16.57 ? 586  ASP A CB   1  
ATOM   7805   C CG   . ASP A 1 530 ? 30.057  13.434  33.018  0.04 16.80 ? 586  ASP A CG   1  
ATOM   7806   O OD1  . ASP A 1 530 ? 30.780  13.641  34.027  0.04 16.97 ? 586  ASP A OD1  1  
ATOM   7807   O OD2  . ASP A 1 530 ? 30.000  12.307  32.457  0.04 16.83 ? 586  ASP A OD2  1  
ATOM   7808   H H    . ASP A 1 530 ? 28.726  12.476  31.047  0.04 15.93 ? 586  ASP A H    1  
ATOM   7809   H HA   . ASP A 1 530 ? 27.661  14.961  31.221  0.04 15.96 ? 586  ASP A HA   1  
ATOM   7810   H HB2  . ASP A 1 530 ? 29.866  15.390  32.367  0.04 16.83 ? 586  ASP A HB2  1  
ATOM   7811   H HB3  . ASP A 1 530 ? 28.606  14.911  33.208  0.04 16.51 ? 586  ASP A HB3  1  
ATOM   7812   N N    . ILE A 1 531 ? 29.215  14.030  28.915  0.04 15.88 ? 587  ILE A N    1  
ATOM   7813   C CA   . ILE A 1 531 ? 30.038  14.180  27.721  0.04 15.95 ? 587  ILE A CA   1  
ATOM   7814   C C    . ILE A 1 531 ? 29.162  14.660  26.564  0.04 15.66 ? 587  ILE A C    1  
ATOM   7815   O O    . ILE A 1 531 ? 27.978  14.250  26.419  0.04 15.27 ? 587  ILE A O    1  
ATOM   7816   C CB   . ILE A 1 531 ? 30.672  12.802  27.325  0.04 15.82 ? 587  ILE A CB   1  
ATOM   7817   C CG1  . ILE A 1 531 ? 31.765  12.384  28.312  0.04 16.17 ? 587  ILE A CG1  1  
ATOM   7818   C CG2  . ILE A 1 531 ? 31.239  12.798  25.879  0.04 15.85 ? 587  ILE A CG2  1  
ATOM   7819   C CD1  . ILE A 1 531 ? 32.037  10.870  28.306  0.04 15.95 ? 587  ILE A CD1  1  
ATOM   7820   H H    . ILE A 1 531 ? 28.684  13.356  28.856  0.04 15.61 ? 587  ILE A H    1  
ATOM   7821   H HA   . ILE A 1 531 ? 30.750  14.815  27.873  0.04 16.29 ? 587  ILE A HA   1  
ATOM   7822   H HB   . ILE A 1 531 ? 29.963  12.141  27.363  0.04 15.51 ? 587  ILE A HB   1  
ATOM   7823   H HG12 . ILE A 1 531 ? 32.591  12.837  28.081  0.04 16.41 ? 587  ILE A HG12 1  
ATOM   7824   H HG13 . ILE A 1 531 ? 31.499  12.638  29.211  0.04 16.35 ? 587  ILE A HG13 1  
ATOM   7825   H HG21 . ILE A 1 531 ? 32.033  12.242  25.863  0.04 15.81 ? 587  ILE A HG21 1  
ATOM   7826   H HG22 . ILE A 1 531 ? 30.573  12.439  25.273  0.04 15.61 ? 587  ILE A HG22 1  
ATOM   7827   H HG23 . ILE A 1 531 ? 31.467  13.704  25.619  0.04 16.16 ? 587  ILE A HG23 1  
ATOM   7828   H HD11 . ILE A 1 531 ? 32.638  10.648  29.033  0.04 16.21 ? 587  ILE A HD11 1  
ATOM   7829   H HD12 . ILE A 1 531 ? 31.194  10.400  28.420  0.04 15.70 ? 587  ILE A HD12 1  
ATOM   7830   H HD13 . ILE A 1 531 ? 32.431  10.623  27.455  0.04 15.85 ? 587  ILE A HD13 1  
ATOM   7831   N N    . GLY A 1 532 ? 29.744  15.511  25.731  0.04 15.89 ? 588  GLY A N    1  
ATOM   7832   C CA   . GLY A 1 532 ? 29.077  16.043  24.578  0.04 15.72 ? 588  GLY A CA   1  
ATOM   7833   C C    . GLY A 1 532 ? 28.403  17.359  24.901  0.04 15.93 ? 588  GLY A C    1  
ATOM   7834   O O    . GLY A 1 532 ? 27.946  17.601  26.046  0.04 16.13 ? 588  GLY A O    1  
ATOM   7835   H H    . GLY A 1 532 ? 30.551  15.800  25.828  0.04 16.18 ? 588  GLY A H    1  
ATOM   7836   H HA2  . GLY A 1 532 ? 29.738  16.200  23.884  0.04 15.84 ? 588  GLY A HA2  1  
ATOM   7837   H HA3  . GLY A 1 532 ? 28.418  15.415  24.246  0.04 15.40 ? 588  GLY A HA3  1  
ATOM   7838   N N    . ASP A 1 533 ? 28.380  18.218  23.889  0.04 15.94 ? 589  ASP A N    1  
ATOM   7839   C CA   . ASP A 1 533 ? 27.893  19.570  24.039  0.04 16.18 ? 589  ASP A CA   1  
ATOM   7840   C C    . ASP A 1 533 ? 26.396  19.543  24.327  0.04 15.86 ? 589  ASP A C    1  
ATOM   7841   O O    . ASP A 1 533 ? 25.668  18.656  23.895  0.04 15.45 ? 589  ASP A O    1  
ATOM   7842   C CB   . ASP A 1 533 ? 28.083  20.388  22.744  0.04 16.32 ? 589  ASP A CB   1  
ATOM   7843   C CG   . ASP A 1 533 ? 29.510  20.444  22.259  0.04 16.74 ? 589  ASP A CG   1  
ATOM   7844   O OD1  . ASP A 1 533 ? 30.433  20.100  23.028  0.04 17.01 ? 589  ASP A OD1  1  
ATOM   7845   O OD2  . ASP A 1 533 ? 29.712  20.875  21.080  0.04 16.84 ? 589  ASP A OD2  1  
ATOM   7846   H H    . ASP A 1 533 ? 28.648  18.037  23.093  0.04 15.83 ? 589  ASP A H    1  
ATOM   7847   H HA   . ASP A 1 533 ? 28.364  19.993  24.768  0.04 16.47 ? 589  ASP A HA   1  
ATOM   7848   H HB2  . ASP A 1 533 ? 27.546  19.996  22.037  0.04 16.04 ? 589  ASP A HB2  1  
ATOM   7849   H HB3  . ASP A 1 533 ? 27.795  21.298  22.912  0.04 16.44 ? 589  ASP A HB3  1  
ATOM   7850   N N    . PRO A 1 534 ? 25.910  20.558  25.028  0.04 16.09 ? 590  PRO A N    1  
ATOM   7851   C CA   . PRO A 1 534 ? 24.466  20.736  25.069  0.04 15.86 ? 590  PRO A CA   1  
ATOM   7852   C C    . PRO A 1 534 ? 23.938  21.085  23.693  0.04 15.75 ? 590  PRO A C    1  
ATOM   7853   O O    . PRO A 1 534 ? 24.682  21.578  22.860  0.04 16.00 ? 590  PRO A O    1  
ATOM   7854   C CB   . PRO A 1 534 ? 24.285  21.948  25.996  0.04 16.26 ? 590  PRO A CB   1  
ATOM   7855   C CG   . PRO A 1 534 ? 25.593  22.689  25.894  0.04 16.72 ? 590  PRO A CG   1  
ATOM   7856   C CD   . PRO A 1 534 ? 26.637  21.638  25.724  0.04 16.61 ? 590  PRO A CD   1  
ATOM   7857   H HA   . PRO A 1 534 ? 24.013  19.959  25.422  0.04 15.60 ? 590  PRO A HA   1  
ATOM   7858   H HB2  . PRO A 1 534 ? 23.550  22.494  25.683  0.04 16.26 ? 590  PRO A HB2  1  
ATOM   7859   H HB3  . PRO A 1 534 ? 24.130  21.642  26.903  0.04 16.24 ? 590  PRO A HB3  1  
ATOM   7860   H HG2  . PRO A 1 534 ? 25.559  23.261  25.114  0.04 16.81 ? 590  PRO A HG2  1  
ATOM   7861   H HG3  . PRO A 1 534 ? 25.749  23.217  26.694  0.04 17.00 ? 590  PRO A HG3  1  
ATOM   7862   H HD2  . PRO A 1 534 ? 27.357  21.980  25.173  0.04 16.82 ? 590  PRO A HD2  1  
ATOM   7863   H HD3  . PRO A 1 534 ? 26.965  21.339  26.588  0.04 16.68 ? 590  PRO A HD3  1  
ATOM   7864   N N    . THR A 1 535 ? 22.653  20.884  23.466  0.04 15.44 ? 591  THR A N    1  
ATOM   7865   C CA   . THR A 1 535 ? 22.044  21.530  22.319  0.04 15.44 ? 591  THR A CA   1  
ATOM   7866   C C    . THR A 1 535 ? 21.833  23.019  22.641  0.04 15.87 ? 591  THR A C    1  
ATOM   7867   O O    . THR A 1 535 ? 21.729  23.426  23.809  0.04 16.06 ? 591  THR A O    1  
ATOM   7868   C CB   . THR A 1 535 ? 20.728  20.875  21.971  0.04 15.04 ? 591  THR A CB   1  
ATOM   7869   O OG1  . THR A 1 535 ? 19.845  20.896  23.102  0.04 15.01 ? 591  THR A OG1  1  
ATOM   7870   C CG2  . THR A 1 535 ? 20.941  19.434  21.544  0.04 14.67 ? 591  THR A CG2  1  
ATOM   7871   H H    . THR A 1 535 ? 22.125  20.414  23.946  0.04 15.25 ? 591  THR A H    1  
ATOM   7872   H HA   . THR A 1 535 ? 22.632  21.464  21.554  0.04 15.48 ? 591  THR A HA   1  
ATOM   7873   H HB   . THR A 1 535 ? 20.321  21.363  21.237  0.04 15.09 ? 591  THR A HB   1  
ATOM   7874   H HG1  . THR A 1 535 ? 19.163  20.443  22.950  0.04 14.79 ? 591  THR A HG1  1  
ATOM   7875   H HG21 . THR A 1 535 ? 20.083  19.008  21.401  0.04 14.44 ? 591  THR A HG21 1  
ATOM   7876   H HG22 . THR A 1 535 ? 21.461  19.382  20.727  0.04 14.72 ? 591  THR A HG22 1  
ATOM   7877   H HG23 . THR A 1 535 ? 21.406  18.954  22.248  0.04 14.61 ? 591  THR A HG23 1  
ATOM   7878   N N    . SER A 1 536 ? 21.812  23.833  21.588  0.04 16.06 ? 592  SER A N    1  
ATOM   7879   C CA   . SER A 1 536 ? 21.656  25.288  21.712  0.04 16.49 ? 592  SER A CA   1  
ATOM   7880   C C    . SER A 1 536 ? 20.852  25.796  20.514  0.04 16.53 ? 592  SER A C    1  
ATOM   7881   O O    . SER A 1 536 ? 20.722  25.093  19.517  0.04 16.28 ? 592  SER A O    1  
ATOM   7882   C CB   . SER A 1 536 ? 23.038  25.962  21.768  0.04 16.97 ? 592  SER A CB   1  
ATOM   7883   O OG   . SER A 1 536 ? 23.759  25.838  20.557  0.04 17.09 ? 592  SER A OG   1  
ATOM   7884   H H    . SER A 1 536 ? 21.898  23.561  20.782  0.04 15.98 ? 592  SER A H    1  
ATOM   7885   H HA   . SER A 1 536 ? 21.161  25.494  22.519  0.04 16.46 ? 592  SER A HA   1  
ATOM   7886   H HB2  . SER A 1 536 ? 22.921  26.906  21.961  0.04 17.27 ? 592  SER A HB2  1  
ATOM   7887   H HB3  . SER A 1 536 ? 23.555  25.547  22.476  0.04 16.94 ? 592  SER A HB3  1  
ATOM   7888   H HG   . SER A 1 536 ? 23.699  25.049  20.267  0.04 16.85 ? 592  SER A HG   1  
ATOM   7889   N N    . GLY A 1 537 ? 20.329  27.012  20.614  0.04 16.87 ? 593  GLY A N    1  
ATOM   7890   C CA   . GLY A 1 537 ? 19.616  27.615  19.508  0.04 16.98 ? 593  GLY A CA   1  
ATOM   7891   C C    . GLY A 1 537 ? 18.210  27.060  19.393  0.04 16.58 ? 593  GLY A C    1  
ATOM   7892   O O    . GLY A 1 537 ? 17.747  26.379  20.273  0.04 16.17 ? 593  GLY A O    1  
ATOM   7893   H H    . GLY A 1 537 ? 20.368  27.510  21.310  0.04 17.07 ? 593  GLY A H    1  
ATOM   7894   H HA2  . GLY A 1 537 ? 19.560  28.572  19.650  0.04 17.31 ? 593  GLY A HA2  1  
ATOM   7895   H HA3  . GLY A 1 537 ? 20.092  27.452  18.681  0.04 17.03 ? 593  GLY A HA3  1  
ATOM   7896   N N    . ASP A 1 538 ? 17.514  27.402  18.310  0.04 16.74 ? 594  ASP A N    1  
ATOM   7897   C CA   . ASP A 1 538 ? 16.199  26.834  18.003  0.04 16.44 ? 594  ASP A CA   1  
ATOM   7898   C C    . ASP A 1 538 ? 16.195  26.299  16.583  0.04 16.27 ? 594  ASP A C    1  
ATOM   7899   O O    . ASP A 1 538 ? 15.141  26.176  15.951  0.04 16.16 ? 594  ASP A O    1  
ATOM   7900   C CB   . ASP A 1 538 ? 15.085  27.856  18.184  0.04 16.73 ? 594  ASP A CB   1  
ATOM   7901   C CG   . ASP A 1 538 ? 15.099  28.943  17.122  0.04 17.25 ? 594  ASP A CG   1  
ATOM   7902   O OD1  . ASP A 1 538 ? 16.148  29.138  16.456  0.04 17.36 ? 594  ASP A OD1  1  
ATOM   7903   O OD2  . ASP A 1 538 ? 14.059  29.638  16.981  0.04 17.61 ? 594  ASP A OD2  1  
ATOM   7904   H H    . ASP A 1 538 ? 17.785  27.967  17.727  0.04 17.03 ? 594  ASP A H    1  
ATOM   7905   H HA   . ASP A 1 538 ? 16.019  26.085  18.591  0.04 16.14 ? 594  ASP A HA   1  
ATOM   7906   H HB2  . ASP A 1 538 ? 14.233  27.395  18.142  0.04 16.52 ? 594  ASP A HB2  1  
ATOM   7907   H HB3  . ASP A 1 538 ? 15.194  28.288  19.045  0.04 16.82 ? 594  ASP A HB3  1  
ATOM   7908   N N    . THR A 1 539 ? 17.385  25.960  16.109  0.04 16.25 ? 595  THR A N    1  
ATOM   7909   C CA   . THR A 1 539 ? 17.612  25.665  14.699  0.04 16.22 ? 595  THR A CA   1  
ATOM   7910   C C    . THR A 1 539 ? 17.831  24.180  14.426  0.04 15.72 ? 595  THR A C    1  
ATOM   7911   O O    . THR A 1 539 ? 18.224  23.801  13.313  0.04 15.66 ? 595  THR A O    1  
ATOM   7912   C CB   . THR A 1 539 ? 18.791  26.498  14.214  0.04 16.58 ? 595  THR A CB   1  
ATOM   7913   O OG1  . THR A 1 539 ? 19.868  26.359  15.149  0.04 16.46 ? 595  THR A OG1  1  
ATOM   7914   C CG2  . THR A 1 539 ? 18.345  27.995  14.129  0.04 17.13 ? 595  THR A CG2  1  
ATOM   7915   H H    . THR A 1 539 ? 18.095  25.898  16.587  0.04 16.29 ? 595  THR A H    1  
ATOM   7916   H HA   . THR A 1 539 ? 16.836  25.932  14.188  0.04 16.34 ? 595  THR A HA   1  
ATOM   7917   H HB   . THR A 1 539 ? 19.074  26.200  13.336  0.04 16.57 ? 595  THR A HB   1  
ATOM   7918   H HG1  . THR A 1 539 ? 20.603  26.334  14.741  0.04 16.65 ? 595  THR A HG1  1  
ATOM   7919   H HG21 . THR A 1 539 ? 19.007  28.516  13.648  0.04 17.40 ? 595  THR A HG21 1  
ATOM   7920   H HG22 . THR A 1 539 ? 17.499  28.057  13.668  0.04 17.21 ? 595  THR A HG22 1  
ATOM   7921   H HG23 . THR A 1 539 ? 18.240  28.369  15.018  0.04 17.19 ? 595  THR A HG23 1  
ATOM   7922   N N    . THR A 1 540 ? 17.554  23.352  15.435  0.04 15.39 ? 596  THR A N    1  
ATOM   7923   C CA   . THR A 1 540 ? 17.557  21.878  15.290  0.04 14.92 ? 596  THR A CA   1  
ATOM   7924   C C    . THR A 1 540 ? 18.890  21.379  14.705  0.04 14.87 ? 596  THR A C    1  
ATOM   7925   O O    . THR A 1 540 ? 18.966  20.727  13.645  0.04 14.58 ? 596  THR A O    1  
ATOM   7926   C CB   . THR A 1 540 ? 16.293  21.390  14.532  0.04 14.74 ? 596  THR A CB   1  
ATOM   7927   O OG1  . THR A 1 540 ? 15.138  22.044  15.081  0.04 14.87 ? 596  THR A OG1  1  
ATOM   7928   C CG2  . THR A 1 540 ? 16.094  19.863  14.712  0.04 14.28 ? 596  THR A CG2  1  
ATOM   7929   H H    . THR A 1 540 ? 17.336  23.614  16.219  0.04 15.44 ? 596  THR A H    1  
ATOM   7930   H HA   . THR A 1 540 ? 17.498  21.499  16.180  0.04 14.78 ? 596  THR A HA   1  
ATOM   7931   H HB   . THR A 1 540 ? 16.367  21.591  13.589  0.04 14.86 ? 596  THR A HB   1  
ATOM   7932   H HG1  . THR A 1 540 ? 14.955  22.725  14.630  0.04 15.12 ? 596  THR A HG1  1  
ATOM   7933   H HG21 . THR A 1 540 ? 15.320  19.563  14.211  0.04 14.19 ? 596  THR A HG21 1  
ATOM   7934   H HG22 . THR A 1 540 ? 16.882  19.382  14.410  0.04 14.19 ? 596  THR A HG22 1  
ATOM   7935   H HG23 . THR A 1 540 ? 15.949  19.655  15.650  0.04 14.18 ? 596  THR A HG23 1  
ATOM   7936   N N    . ILE A 1 541 ? 19.960  21.678  15.423  0.04 15.17 ? 597  ILE A N    1  
ATOM   7937   C CA   . ILE A 1 541 ? 21.311  21.242  15.076  0.04 15.19 ? 597  ILE A CA   1  
ATOM   7938   C C    . ILE A 1 541 ? 21.729  20.095  16.031  0.04 14.89 ? 597  ILE A C    1  
ATOM   7939   O O    . ILE A 1 541 ? 21.758  20.284  17.250  0.04 14.95 ? 597  ILE A O    1  
ATOM   7940   C CB   . ILE A 1 541 ? 22.335  22.426  15.186  0.04 15.69 ? 597  ILE A CB   1  
ATOM   7941   C CG1  . ILE A 1 541 ? 22.064  23.477  14.101  0.04 16.04 ? 597  ILE A CG1  1  
ATOM   7942   C CG2  . ILE A 1 541 ? 23.774  21.898  15.119  0.04 15.75 ? 597  ILE A CG2  1  
ATOM   7943   C CD1  . ILE A 1 541 ? 23.064  24.585  14.089  0.04 16.56 ? 597  ILE A CD1  1  
ATOM   7944   H H    . ILE A 1 541 ? 19.930  22.160  16.134  0.04 15.40 ? 597  ILE A H    1  
ATOM   7945   H HA   . ILE A 1 541 ? 21.325  20.919  14.164  0.04 15.11 ? 597  ILE A HA   1  
ATOM   7946   H HB   . ILE A 1 541 ? 22.214  22.858  16.045  0.04 15.79 ? 597  ILE A HB   1  
ATOM   7947   H HG12 . ILE A 1 541 ? 22.065  23.046  13.233  0.04 15.94 ? 597  ILE A HG12 1  
ATOM   7948   H HG13 . ILE A 1 541 ? 21.195  23.872  14.270  0.04 16.05 ? 597  ILE A HG13 1  
ATOM   7949   H HG21 . ILE A 1 541 ? 24.374  22.563  14.748  0.04 16.07 ? 597  ILE A HG21 1  
ATOM   7950   H HG22 . ILE A 1 541 ? 24.059  21.671  16.016  0.04 15.72 ? 597  ILE A HG22 1  
ATOM   7951   H HG23 . ILE A 1 541 ? 23.783  21.105  14.559  0.04 15.52 ? 597  ILE A HG23 1  
ATOM   7952   H HD11 . ILE A 1 541 ? 22.603  25.426  13.936  0.04 16.80 ? 597  ILE A HD11 1  
ATOM   7953   H HD12 . ILE A 1 541 ? 23.515  24.615  14.948  0.04 16.62 ? 597  ILE A HD12 1  
ATOM   7954   H HD13 . ILE A 1 541 ? 23.709  24.426  13.381  0.04 16.63 ? 597  ILE A HD13 1  
ATOM   7955   N N    . PRO A 1 542 ? 22.046  18.905  15.500  0.04 14.59 ? 598  PRO A N    1  
ATOM   7956   C CA   . PRO A 1 542 ? 22.365  17.821  16.440  0.04 14.37 ? 598  PRO A CA   1  
ATOM   7957   C C    . PRO A 1 542 ? 23.661  18.018  17.194  0.04 14.66 ? 598  PRO A C    1  
ATOM   7958   O O    . PRO A 1 542 ? 24.650  18.460  16.600  0.04 15.01 ? 598  PRO A O    1  
ATOM   7959   C CB   . PRO A 1 542 ? 22.529  16.598  15.529  0.04 14.15 ? 598  PRO A CB   1  
ATOM   7960   C CG   . PRO A 1 542 ? 21.865  16.970  14.239  0.04 14.09 ? 598  PRO A CG   1  
ATOM   7961   C CD   . PRO A 1 542 ? 22.086  18.427  14.103  0.04 14.45 ? 598  PRO A CD   1  
ATOM   7962   H HA   . PRO A 1 542 ? 21.633  17.680  17.059  0.04 14.20 ? 598  PRO A HA   1  
ATOM   7963   H HB2  . PRO A 1 542 ? 23.476  16.446  15.384  0.04 14.32 ? 598  PRO A HB2  1  
ATOM   7964   H HB3  . PRO A 1 542 ? 22.113  15.822  15.928  0.04 13.93 ? 598  PRO A HB3  1  
ATOM   7965   H HG2  . PRO A 1 542 ? 22.284  16.489  13.508  0.04 14.08 ? 598  PRO A HG2  1  
ATOM   7966   H HG3  . PRO A 1 542 ? 20.917  16.773  14.289  0.04 13.87 ? 598  PRO A HG3  1  
ATOM   7967   H HD2  . PRO A 1 542 ? 22.956  18.590  13.708  0.04 14.65 ? 598  PRO A HD2  1  
ATOM   7968   H HD3  . PRO A 1 542 ? 21.366  18.823  13.589  0.04 14.40 ? 598  PRO A HD3  1  
ATOM   7969   N N    . SER A 1 543 ? 23.675  17.626  18.465  0.04 14.54 ? 599  SER A N    1  
ATOM   7970   C CA   . SER A 1 543 ? 24.935  17.490  19.227  0.04 14.77 ? 599  SER A CA   1  
ATOM   7971   C C    . SER A 1 543 ? 25.373  16.025  19.213  0.04 14.53 ? 599  SER A C    1  
ATOM   7972   O O    . SER A 1 543 ? 24.568  15.148  19.403  0.04 14.21 ? 599  SER A O    1  
ATOM   7973   C CB   . SER A 1 543 ? 24.761  18.006  20.657  0.04 14.90 ? 599  SER A CB   1  
ATOM   7974   O OG   . SER A 1 543 ? 25.940  17.766  21.407  0.04 15.13 ? 599  SER A OG   1  
ATOM   7975   H H    . SER A 1 543 ? 22.969  17.436  18.911  0.04 14.36 ? 599  SER A H    1  
ATOM   7976   H HA   . SER A 1 543 ? 25.631  18.008  18.803  0.04 15.02 ? 599  SER A HA   1  
ATOM   7977   H HB2  . SER A 1 543 ? 24.606  18.963  20.619  0.04 15.09 ? 599  SER A HB2  1  
ATOM   7978   H HB3  . SER A 1 543 ? 24.005  17.568  21.075  0.04 14.66 ? 599  SER A HB3  1  
ATOM   7979   H HG   . SER A 1 543 ? 26.616  17.940  20.948  0.04 15.37 ? 599  SER A HG   1  
ATOM   7980   N N    . GLN A 1 544 ? 26.662  15.793  18.990  0.04 14.73 ? 600  GLN A N    1  
ATOM   7981   C CA   . GLN A 1 544 ? 27.175  14.468  18.641  0.04 14.56 ? 600  GLN A CA   1  
ATOM   7982   C C    . GLN A 1 544 ? 28.353  14.028  19.484  0.04 14.79 ? 600  GLN A C    1  
ATOM   7983   O O    . GLN A 1 544 ? 29.221  14.835  19.874  0.04 15.17 ? 600  GLN A O    1  
ATOM   7984   C CB   . GLN A 1 544 ? 27.674  14.522  17.202  0.04 14.65 ? 600  GLN A CB   1  
ATOM   7985   C CG   . GLN A 1 544 ? 26.560  14.859  16.201  0.04 14.46 ? 600  GLN A CG   1  
ATOM   7986   C CD   . GLN A 1 544 ? 27.067  15.151  14.814  0.04 14.71 ? 600  GLN A CD   1  
ATOM   7987   O OE1  . GLN A 1 544 ? 28.109  15.805  14.628  0.04 15.10 ? 600  GLN A OE1  1  
ATOM   7988   N NE2  . GLN A 1 544 ? 26.338  14.648  13.815  0.04 14.52 ? 600  GLN A NE2  1  
ATOM   7989   H H    . GLN A 1 544 ? 27.271  16.394  19.031  0.04 14.99 ? 600  GLN A H    1  
ATOM   7990   H HA   . GLN A 1 544 ? 26.469  13.814  18.708  0.04 14.28 ? 600  GLN A HA   1  
ATOM   7991   H HB2  . GLN A 1 544 ? 28.347  15.214  17.140  0.04 14.95 ? 600  GLN A HB2  1  
ATOM   7992   H HB3  . GLN A 1 544 ? 28.058  13.664  16.965  0.04 14.56 ? 600  GLN A HB3  1  
ATOM   7993   H HG2  . GLN A 1 544 ? 25.956  14.103  16.130  0.04 14.19 ? 600  GLN A HG2  1  
ATOM   7994   H HG3  . GLN A 1 544 ? 26.069  15.639  16.508  0.04 14.47 ? 600  GLN A HG3  1  
ATOM   7995   H HE21 . GLN A 1 544 ? 25.748  14.043  13.978  0.04 14.26 ? 600  GLN A HE21 1  
ATOM   7996   H HE22 . GLN A 1 544 ? 26.462  14.921  13.007  0.04 14.66 ? 600  GLN A HE22 1  
ATOM   7997   N N    . VAL A 1 545 ? 28.421  12.714  19.697  0.04 14.59 ? 601  VAL A N    1  
ATOM   7998   C CA   . VAL A 1 545 ? 29.617  12.057  20.224  0.04 14.83 ? 601  VAL A CA   1  
ATOM   7999   C C    . VAL A 1 545 ? 29.949  10.897  19.260  0.04 14.72 ? 601  VAL A C    1  
ATOM   8000   O O    . VAL A 1 545 ? 29.155  9.966   19.120  0.04 14.38 ? 601  VAL A O    1  
ATOM   8001   C CB   . VAL A 1 545 ? 29.373  11.567  21.686  0.04 14.79 ? 601  VAL A CB   1  
ATOM   8002   C CG1  . VAL A 1 545 ? 30.414  10.563  22.087  0.04 14.99 ? 601  VAL A CG1  1  
ATOM   8003   C CG2  . VAL A 1 545 ? 29.377  12.746  22.657  0.04 15.03 ? 601  VAL A CG2  1  
ATOM   8004   H H    . VAL A 1 545 ? 27.770  12.176  19.554  0.04 14.34 ? 601  VAL A H    1  
ATOM   8005   H HA   . VAL A 1 545 ? 30.370  12.668  20.225  0.04 15.13 ? 601  VAL A HA   1  
ATOM   8006   H HB   . VAL A 1 545 ? 28.508  11.133  21.733  0.04 14.51 ? 601  VAL A HB   1  
ATOM   8007   H HG11 . VAL A 1 545 ? 30.302  10.367  23.031  0.04 15.01 ? 601  VAL A HG11 1  
ATOM   8008   H HG12 . VAL A 1 545 ? 30.309  9.753   21.563  0.04 14.82 ? 601  VAL A HG12 1  
ATOM   8009   H HG13 . VAL A 1 545 ? 31.291  10.951  21.935  0.04 15.28 ? 601  VAL A HG13 1  
ATOM   8010   H HG21 . VAL A 1 545 ? 29.152  12.429  23.542  0.04 14.98 ? 601  VAL A HG21 1  
ATOM   8011   H HG22 . VAL A 1 545 ? 30.269  13.132  22.661  0.04 15.34 ? 601  VAL A HG22 1  
ATOM   8012   H HG23 . VAL A 1 545 ? 28.736  13.406  22.356  0.04 14.95 ? 601  VAL A HG23 1  
ATOM   8013   N N    . VAL A 1 546 ? 31.097  10.964  18.574  0.04 15.03 ? 602  VAL A N    1  
ATOM   8014   C CA   . VAL A 1 546 ? 31.530  9.899   17.655  0.04 14.98 ? 602  VAL A CA   1  
ATOM   8015   C C    . VAL A 1 546 ? 31.918  8.607   18.420  0.04 14.90 ? 602  VAL A C    1  
ATOM   8016   O O    . VAL A 1 546 ? 31.574  7.493   17.977  0.04 14.66 ? 602  VAL A O    1  
ATOM   8017   C CB   . VAL A 1 546 ? 32.720  10.355  16.745  0.04 15.41 ? 602  VAL A CB   1  
ATOM   8018   C CG1  . VAL A 1 546 ? 33.207  9.186   15.894  0.04 15.34 ? 602  VAL A CG1  1  
ATOM   8019   C CG2  . VAL A 1 546 ? 32.281  11.499  15.855  0.04 15.56 ? 602  VAL A CG2  1  
ATOM   8020   H H    . VAL A 1 546 ? 31.645  11.621  18.620  0.04 15.30 ? 602  VAL A H    1  
ATOM   8021   H HA   . VAL A 1 546 ? 30.791  9.683   17.067  0.04 14.75 ? 602  VAL A HA   1  
ATOM   8022   H HB   . VAL A 1 546 ? 33.450  10.652  17.306  0.04 15.66 ? 602  VAL A HB   1  
ATOM   8023   H HG11 . VAL A 1 546 ? 33.935  9.494   15.328  0.04 15.64 ? 602  VAL A HG11 1  
ATOM   8024   H HG12 . VAL A 1 546 ? 33.526  8.479   16.475  0.04 15.14 ? 602  VAL A HG12 1  
ATOM   8025   H HG13 . VAL A 1 546 ? 32.479  8.856   15.344  0.04 15.22 ? 602  VAL A HG13 1  
ATOM   8026   H HG21 . VAL A 1 546 ? 32.945  11.626  15.162  0.04 15.83 ? 602  VAL A HG21 1  
ATOM   8027   H HG22 . VAL A 1 546 ? 31.422  11.290  15.459  0.04 15.32 ? 602  VAL A HG22 1  
ATOM   8028   H HG23 . VAL A 1 546 ? 32.203  12.302  16.393  0.04 15.66 ? 602  VAL A HG23 1  
ATOM   8029   N N    . SER A 1 547 ? 32.655  8.769   19.531  0.04 15.14 ? 603  SER A N    1  
ATOM   8030   C CA   . SER A 1 547 ? 33.138  7.643   20.375  0.04 15.21 ? 603  SER A CA   1  
ATOM   8031   C C    . SER A 1 547 ? 32.862  7.730   21.888  0.04 15.41 ? 603  SER A C    1  
ATOM   8032   O O    . SER A 1 547 ? 32.577  8.786   22.453  0.04 15.79 ? 603  SER A O    1  
ATOM   8033   C CB   . SER A 1 547 ? 34.651  7.422   20.137  0.04 15.54 ? 603  SER A CB   1  
ATOM   8034   O OG   . SER A 1 547 ? 34.856  6.867   18.857  0.04 15.51 ? 603  SER A OG   1  
ATOM   8035   H H    . SER A 1 547 ? 32.893  9.541   19.826  0.04 15.30 ? 603  SER A H    1  
ATOM   8036   H HA   . SER A 1 547 ? 32.697  6.837   20.070  0.04 14.94 ? 603  SER A HA   1  
ATOM   8037   H HB2  . SER A 1 547 ? 35.104  8.277   20.192  0.04 15.87 ? 603  SER A HB2  1  
ATOM   8038   H HB3  . SER A 1 547 ? 35.011  6.810   20.797  0.04 15.49 ? 603  SER A HB3  1  
ATOM   8039   H HG   . SER A 1 547 ? 34.116  6.719   18.494  0.04 15.28 ? 603  SER A HG   1  
ATOM   8040   N N    . PHE A 1 548 ? 32.951  6.570   22.542  0.04 15.19 ? 604  PHE A N    1  
ATOM   8041   C CA   . PHE A 1 548 ? 32.640  6.401   23.957  0.04 15.33 ? 604  PHE A CA   1  
ATOM   8042   C C    . PHE A 1 548 ? 33.192  5.051   24.318  0.04 15.33 ? 604  PHE A C    1  
ATOM   8043   O O    . PHE A 1 548 ? 32.762  4.089   23.705  0.04 15.01 ? 604  PHE A O    1  
ATOM   8044   C CB   . PHE A 1 548 ? 31.119  6.323   24.127  0.04 15.04 ? 604  PHE A CB   1  
ATOM   8045   C CG   . PHE A 1 548 ? 30.601  6.545   25.525  0.04 15.08 ? 604  PHE A CG   1  
ATOM   8046   C CD1  . PHE A 1 548 ? 30.604  7.814   26.121  0.04 15.39 ? 604  PHE A CD1  1  
ATOM   8047   C CD2  . PHE A 1 548 ? 30.001  5.481   26.209  0.04 14.81 ? 604  PHE A CD2  1  
ATOM   8048   C CE1  . PHE A 1 548 ? 30.040  7.994   27.372  0.04 15.47 ? 604  PHE A CE1  1  
ATOM   8049   C CE2  . PHE A 1 548 ? 29.412  5.671   27.467  0.04 14.88 ? 604  PHE A CE2  1  
ATOM   8050   C CZ   . PHE A 1 548 ? 29.433  6.915   28.039  0.04 15.21 ? 604  PHE A CZ   1  
ATOM   8051   H H    . PHE A 1 548 ? 33.197  5.842   22.160  0.04 14.96 ? 604  PHE A H    1  
ATOM   8052   H HA   . PHE A 1 548 ? 33.002  7.123   24.487  0.04 15.64 ? 604  PHE A HA   1  
ATOM   8053   H HB2  . PHE A 1 548 ? 30.700  6.976   23.546  0.04 15.14 ? 604  PHE A HB2  1  
ATOM   8054   H HB3  . PHE A 1 548 ? 30.827  5.440   23.866  0.04 14.74 ? 604  PHE A HB3  1  
ATOM   8055   H HD1  . PHE A 1 548 ? 30.982  8.537   25.680  0.04 15.60 ? 604  PHE A HD1  1  
ATOM   8056   H HD2  . PHE A 1 548 ? 29.962  4.647   25.805  0.04 14.61 ? 604  PHE A HD2  1  
ATOM   8057   H HE1  . PHE A 1 548 ? 30.056  8.831   27.775  0.04 15.71 ? 604  PHE A HE1  1  
ATOM   8058   H HE2  . PHE A 1 548 ? 29.028  4.956   27.922  0.04 14.73 ? 604  PHE A HE2  1  
ATOM   8059   H HZ   . PHE A 1 548 ? 29.082  7.036   28.894  0.04 15.28 ? 604  PHE A HZ   1  
ATOM   8060   N N    . PRO A 1 549 ? 34.126  4.955   25.297  0.04 15.72 ? 605  PRO A N    1  
ATOM   8061   C CA   . PRO A 1 549 ? 34.686  6.023   26.145  0.04 16.16 ? 605  PRO A CA   1  
ATOM   8062   C C    . PRO A 1 549 ? 36.187  6.282   25.936  0.04 16.61 ? 605  PRO A C    1  
ATOM   8063   O O    . PRO A 1 549 ? 36.897  5.367   25.540  0.04 16.59 ? 605  PRO A O    1  
ATOM   8064   C CB   . PRO A 1 549 ? 34.485  5.461   27.539  0.04 16.31 ? 605  PRO A CB   1  
ATOM   8065   C CG   . PRO A 1 549 ? 34.666  3.960   27.356  0.04 16.18 ? 605  PRO A CG   1  
ATOM   8066   C CD   . PRO A 1 549 ? 34.376  3.622   25.891  0.04 15.71 ? 605  PRO A CD   1  
ATOM   8067   O OXT  . PRO A 1 549 ? 36.763  7.375   26.134  0.04 17.04 ? 605  PRO A OXT  1  
ATOM   8068   H HA   . PRO A 1 549 ? 34.198  6.855   26.067  0.04 16.10 ? 605  PRO A HA   1  
ATOM   8069   H HB2  . PRO A 1 549 ? 35.158  5.823   28.133  0.04 16.68 ? 605  PRO A HB2  1  
ATOM   8070   H HB3  . PRO A 1 549 ? 33.594  5.675   27.858  0.04 16.14 ? 605  PRO A HB3  1  
ATOM   8071   H HG2  . PRO A 1 549 ? 35.569  3.732   27.586  0.04 16.46 ? 605  PRO A HG2  1  
ATOM   8072   H HG3  . PRO A 1 549 ? 34.044  3.495   27.936  0.04 16.16 ? 605  PRO A HG3  1  
ATOM   8073   H HD2  . PRO A 1 549 ? 35.145  3.209   25.475  0.04 15.74 ? 605  PRO A HD2  1  
ATOM   8074   H HD3  . PRO A 1 549 ? 33.592  3.062   25.821  0.04 15.44 ? 605  PRO A HD3  1  
HETATM 8075   C C2   . BGC B 2 .   ? 12.049  17.447  11.471  0.04 17.03 ? 1    BGC B C2   1  
HETATM 8076   C C3   . BGC B 2 .   ? 11.090  17.919  12.442  0.04 15.62 ? 1    BGC B C3   1  
HETATM 8077   C C4   . BGC B 2 .   ? 11.570  19.120  13.153  0.04 16.95 ? 1    BGC B C4   1  
HETATM 8078   C C5   . BGC B 2 .   ? 11.983  20.200  12.111  0.04 17.34 ? 1    BGC B C5   1  
HETATM 8079   C C6   . BGC B 2 .   ? 12.511  21.336  12.699  0.04 23.74 ? 1    BGC B C6   1  
HETATM 8080   C C1   . BGC B 2 .   ? 12.515  18.505  10.541  0.04 18.38 ? 1    BGC B C1   1  
HETATM 8081   O O1   . BGC B 2 .   ? 13.555  18.068  9.716   0.04 23.88 ? 1    BGC B O1   1  
HETATM 8082   O O2   . BGC B 2 .   ? 11.538  16.340  10.677  0.04 17.66 ? 1    BGC B O2   1  
HETATM 8083   O O3   . BGC B 2 .   ? 10.851  16.807  13.447  0.04 15.58 ? 1    BGC B O3   1  
HETATM 8084   O O4   . BGC B 2 .   ? 10.577  19.674  13.988  0.04 19.72 ? 1    BGC B O4   1  
HETATM 8085   O O5   . BGC B 2 .   ? 13.064  19.562  11.318  0.04 20.16 ? 1    BGC B O5   1  
HETATM 8086   O O6   . BGC B 2 .   ? 12.728  22.374  11.773  0.04 26.43 ? 1    BGC B O6   1  
HETATM 8087   C C2   . BGC B 2 .   ? 9.458   15.149  14.430  0.04 14.67 ? 2    BGC B C2   1  
HETATM 8088   C C3   . BGC B 2 .   ? 8.243   14.827  15.154  0.04 15.44 ? 2    BGC B C3   1  
HETATM 8089   C C4   . BGC B 2 .   ? 7.952   15.867  16.144  0.04 17.08 ? 2    BGC B C4   1  
HETATM 8090   C C5   . BGC B 2 .   ? 7.779   17.212  15.420  0.04 17.39 ? 2    BGC B C5   1  
HETATM 8091   C C6   . BGC B 2 .   ? 7.480   18.220  16.301  0.04 22.19 ? 2    BGC B C6   1  
HETATM 8092   C C1   . BGC B 2 .   ? 9.508   16.515  13.850  0.04 14.53 ? 2    BGC B C1   1  
HETATM 8093   O O2   . BGC B 2 .   ? 9.561   14.169  13.363  0.04 15.22 ? 2    BGC B O2   1  
HETATM 8094   O O3   . BGC B 2 .   ? 8.423   13.522  15.837  0.04 17.62 ? 2    BGC B O3   1  
HETATM 8095   O O4   . BGC B 2 .   ? 6.760   15.543  16.874  0.04 19.33 ? 2    BGC B O4   1  
HETATM 8096   O O5   . BGC B 2 .   ? 9.184   17.454  14.908  0.04 16.42 ? 2    BGC B O5   1  
HETATM 8097   O O6   . BGC B 2 .   ? 7.191   19.455  15.690  0.04 23.81 ? 2    BGC B O6   1  
HETATM 8098   C C2   . BGC B 2 .   ? 7.601   11.404  16.538  0.04 14.11 ? 3    BGC B C2   1  
HETATM 8099   C C3   . BGC B 2 .   ? 6.427   10.555  16.593  0.04 15.30 ? 3    BGC B C3   1  
HETATM 8100   C C4   . BGC B 2 .   ? 5.151   11.316  16.688  0.04 16.26 ? 3    BGC B C4   1  
HETATM 8101   C C5   . BGC B 2 .   ? 5.043   12.265  15.471  0.04 17.33 ? 3    BGC B C5   1  
HETATM 8102   C C6   . BGC B 2 .   ? 3.919   13.073  15.498  0.04 20.52 ? 3    BGC B C6   1  
HETATM 8103   C C1   . BGC B 2 .   ? 7.500   12.487  15.537  0.04 15.90 ? 3    BGC B C1   1  
HETATM 8104   O O2   . BGC B 2 .   ? 8.814   10.604  16.251  0.04 14.78 ? 3    BGC B O2   1  
HETATM 8105   O O3   . BGC B 2 .   ? 6.466   9.589   17.713  0.04 15.27 ? 3    BGC B O3   1  
HETATM 8106   O O4   . BGC B 2 .   ? 4.019   10.484  16.702  0.04 15.41 ? 3    BGC B O4   1  
HETATM 8107   O O5   . BGC B 2 .   ? 6.221   13.170  15.634  0.04 18.46 ? 3    BGC B O5   1  
HETATM 8108   O O6   . BGC B 2 .   ? 3.864   14.043  16.488  0.04 26.24 ? 3    BGC B O6   1  
HETATM 8109   C C2   . BGC C 2 .   ? -0.854  13.249  -1.795  0.04 21.32 ? 1    BGC C C2   1  
HETATM 8110   C C3   . BGC C 2 .   ? -1.593  12.617  -2.812  0.04 21.32 ? 1    BGC C C3   1  
HETATM 8111   C C4   . BGC C 2 .   ? -3.010  12.885  -2.613  0.04 21.32 ? 1    BGC C C4   1  
HETATM 8112   C C5   . BGC C 2 .   ? -3.405  14.358  -2.349  0.04 21.32 ? 1    BGC C C5   1  
HETATM 8113   C C6   . BGC C 2 .   ? -4.271  14.411  -1.263  0.04 21.32 ? 1    BGC C C6   1  
HETATM 8114   C C1   . BGC C 2 .   ? -0.829  14.636  -2.239  0.04 21.32 ? 1    BGC C C1   1  
HETATM 8115   O O1   . BGC C 2 .   ? 0.125   15.392  -1.545  0.04 21.32 ? 1    BGC C O1   1  
HETATM 8116   O O2   . BGC C 2 .   ? 0.478   12.731  -1.538  0.04 21.32 ? 1    BGC C O2   1  
HETATM 8117   O O3   . BGC C 2 .   ? -1.310  11.168  -3.056  0.04 21.32 ? 1    BGC C O3   1  
HETATM 8118   O O4   . BGC C 2 .   ? -3.701  12.539  -3.761  0.04 21.32 ? 1    BGC C O4   1  
HETATM 8119   O O5   . BGC C 2 .   ? -2.162  15.240  -2.166  0.04 21.32 ? 1    BGC C O5   1  
HETATM 8120   O O6   . BGC C 2 .   ? -4.340  13.281  -0.450  0.04 21.32 ? 1    BGC C O6   1  
HETATM 8121   C C2   . BGC C 2 .   ? 0.207   10.153  -4.675  0.04 26.41 ? 2    BGC C C2   1  
HETATM 8122   C C3   . BGC C 2 .   ? 0.315   9.737   -6.043  0.04 25.05 ? 2    BGC C C3   1  
HETATM 8123   C C4   . BGC C 2 .   ? -0.936  9.321   -6.639  0.04 27.47 ? 2    BGC C C4   1  
HETATM 8124   C C5   . BGC C 2 .   ? -2.025  10.423  -6.599  0.04 28.19 ? 2    BGC C C5   1  
HETATM 8125   C C6   . BGC C 2 .   ? -3.236  9.903   -6.894  0.04 31.90 ? 2    BGC C C6   1  
HETATM 8126   C C1   . BGC C 2 .   ? -0.885  11.110  -4.425  0.04 28.91 ? 2    BGC C C1   1  
HETATM 8127   O O2   . BGC C 2 .   ? 1.498   10.750  -4.295  0.04 26.25 ? 2    BGC C O2   1  
HETATM 8128   O O3   . BGC C 2 .   ? 1.209   8.545   -6.068  0.04 26.97 ? 2    BGC C O3   1  
HETATM 8129   O O4   . BGC C 2 .   ? -0.670  8.925   -7.978  0.04 28.49 ? 2    BGC C O4   1  
HETATM 8130   O O5   . BGC C 2 .   ? -2.098  10.822  -5.134  0.04 30.05 ? 2    BGC C O5   1  
HETATM 8131   O O6   . BGC C 2 .   ? -4.132  9.782   -5.839  0.04 47.52 ? 2    BGC C O6   1  
HETATM 8132   C C2   . BGC C 2 .   ? 3.569   8.226   -6.395  0.04 27.31 ? 3    BGC C C2   1  
HETATM 8133   C C3   . BGC C 2 .   ? 4.592   8.222   -7.379  0.04 26.38 ? 3    BGC C C3   1  
HETATM 8134   C C4   . BGC C 2 .   ? 4.255   7.526   -8.663  0.04 26.01 ? 3    BGC C C4   1  
HETATM 8135   C C5   . BGC C 2 .   ? 2.913   8.033   -9.240  0.04 29.62 ? 3    BGC C C5   1  
HETATM 8136   C C6   . BGC C 2 .   ? 2.537   7.280   -10.323 0.04 32.44 ? 3    BGC C C6   1  
HETATM 8137   C C1   . BGC C 2 .   ? 2.281   8.660   -6.969  0.04 29.29 ? 3    BGC C C1   1  
HETATM 8138   O O2   . BGC C 2 .   ? 3.941   9.112   -5.259  0.04 24.12 ? 3    BGC C O2   1  
HETATM 8139   O O3   . BGC C 2 .   ? 5.839   7.676   -6.830  0.04 23.98 ? 3    BGC C O3   1  
HETATM 8140   O O4   . BGC C 2 .   ? 5.227   7.741   -9.650  0.04 28.07 ? 3    BGC C O4   1  
HETATM 8141   O O5   . BGC C 2 .   ? 1.954   7.808   -8.105  0.04 27.17 ? 3    BGC C O5   1  
HETATM 8142   O O6   . BGC C 2 .   ? 1.372   7.644   -10.971 0.04 34.15 ? 3    BGC C O6   1  
HETATM 8143   O O    . HOH D 3 .   ? 16.809  -19.873 35.935  0.04 17.47 ? 801  HOH A O    1  
HETATM 8144   O O    . HOH D 3 .   ? 37.446  4.011   23.985  0.04 16.95 ? 802  HOH A O    1  
HETATM 8145   O O    . HOH D 3 .   ? 20.067  24.776  16.837  0.04 15.73 ? 803  HOH A O    1  
HETATM 8146   O O    . HOH D 3 .   ? 37.743  7.214   28.308  0.04 17.86 ? 804  HOH A O    1  
HETATM 8147   O O    . HOH D 3 .   ? 14.516  26.130  26.673  0.04 16.60 ? 805  HOH A O    1  
HETATM 8148   O O    . HOH D 3 .   ? 25.508  21.486  29.532  0.04 16.95 ? 806  HOH A O    1  
HETATM 8149   O O    . HOH D 3 .   ? -4.425  -3.991  -16.413 0.04 19.74 ? 807  HOH A O    1  
HETATM 8150   O O    . HOH D 3 .   ? 18.333  -22.829 27.175  0.04 16.61 ? 808  HOH A O    1  
HETATM 8151   O O    . HOH D 3 .   ? 9.879   28.025  22.633  0.04 16.94 ? 809  HOH A O    1  
HETATM 8152   O O    . HOH D 3 .   ? 16.515  -25.518 19.261  0.04 16.29 ? 810  HOH A O    1  
HETATM 8153   O O    . HOH D 3 .   ? 15.026  26.993  23.961  0.04 16.65 ? 811  HOH A O    1  
HETATM 8154   O O    . HOH D 3 .   ? 34.393  -3.391  30.751  0.04 17.10 ? 812  HOH A O    1  
HETATM 8155   O O    . HOH D 3 .   ? 17.096  -2.096  -12.803 0.04 16.14 ? 813  HOH A O    1  
HETATM 8156   O O    . HOH D 3 .   ? -4.412  -8.486  35.899  0.04 15.95 ? 814  HOH A O    1  
HETATM 8157   O O    . HOH D 3 .   ? 10.880  1.148   -13.882 0.04 16.89 ? 815  HOH A O    1  
HETATM 8158   O O    . HOH D 3 .   ? 13.909  23.697  33.608  0.04 16.58 ? 816  HOH A O    1  
HETATM 8159   O O    . HOH D 3 .   ? 0.436   -7.567  37.434  0.04 15.39 ? 817  HOH A O    1  
HETATM 8160   O O    . HOH D 3 .   ? 0.751   -1.060  -18.555 0.04 19.37 ? 818  HOH A O    1  
HETATM 8161   O O    . HOH D 3 .   ? -1.224  -4.780  35.801  0.04 14.95 ? 819  HOH A O    1  
HETATM 8162   O O    . HOH D 3 .   ? -8.425  2.586   25.029  0.04 14.50 ? 820  HOH A O    1  
HETATM 8163   O O    . HOH D 3 .   ? 9.551   -22.345 29.785  0.04 16.38 ? 821  HOH A O    1  
HETATM 8164   O O    . HOH D 3 .   ? 14.404  28.192  28.636  0.04 17.45 ? 822  HOH A O    1  
HETATM 8165   O O    . HOH D 3 .   ? 5.875   -0.150  -14.899 0.04 17.25 ? 823  HOH A O    1  
HETATM 8166   O O    . HOH D 3 .   ? 13.575  -24.821 24.287  0.04 16.40 ? 824  HOH A O    1  
HETATM 8167   O O    . HOH D 3 .   ? 15.194  26.868  30.737  0.04 17.29 ? 825  HOH A O    1  
HETATM 8168   O O    . HOH D 3 .   ? 6.402   -10.811 -16.553 0.04 18.35 ? 826  HOH A O    1  
HETATM 8169   O O    . HOH D 3 .   ? -12.663 -0.393  -11.479 0.04 20.28 ? 827  HOH A O    1  
HETATM 8170   O O    . HOH D 3 .   ? 3.169   22.946  32.628  0.04 16.61 ? 828  HOH A O    1  
HETATM 8171   O O    . HOH D 3 .   ? 8.872   -6.201  -14.690 0.04 16.90 ? 829  HOH A O    1  
HETATM 8172   O O    . HOH D 3 .   ? 15.466  6.799   -9.764  0.04 15.52 ? 830  HOH A O    1  
HETATM 8173   O O    . HOH D 3 .   ? -7.003  2.889   34.522  0.04 15.40 ? 831  HOH A O    1  
HETATM 8174   O O    . HOH D 3 .   ? 8.055   -26.617 25.509  0.04 17.19 ? 832  HOH A O    1  
HETATM 8175   O O    . HOH D 3 .   ? -10.175 -4.260  30.712  0.04 15.89 ? 833  HOH A O    1  
HETATM 8176   O O    . HOH D 3 .   ? 22.898  22.864  32.375  0.04 17.15 ? 834  HOH A O    1  
HETATM 8177   O O    . HOH D 3 .   ? -4.729  1.597   35.609  0.04 15.43 ? 835  HOH A O    1  
HETATM 8178   O O    . HOH D 3 .   ? 21.098  22.722  27.752  0.04 16.14 ? 836  HOH A O    1  
HETATM 8179   O O    . HOH D 3 .   ? 18.326  -8.732  -9.360  0.04 15.76 ? 837  HOH A O    1  
HETATM 8180   O O    . HOH D 3 .   ? 12.451  -3.000  -15.334 0.04 16.68 ? 838  HOH A O    1  
HETATM 8181   O O    . HOH D 3 .   ? 23.445  -1.356  38.339  0.04 15.80 ? 839  HOH A O    1  
HETATM 8182   O O    . HOH D 3 .   ? 30.119  -1.555  38.395  0.04 17.49 ? 840  HOH A O    1  
HETATM 8183   O O    . HOH D 3 .   ? 18.383  -6.214  -11.725 0.04 15.88 ? 841  HOH A O    1  
HETATM 8184   O O    . HOH D 3 .   ? 8.472   -27.929 19.545  0.04 16.99 ? 842  HOH A O    1  
HETATM 8185   O O    . HOH D 3 .   ? -13.503 -6.536  32.467  0.04 16.97 ? 843  HOH A O    1  
HETATM 8186   O O    . HOH D 3 .   ? -2.561  17.276  0.266   0.04 17.00 ? 844  HOH A O    1  
HETATM 8187   O O    . HOH D 3 .   ? 16.430  -20.203 30.250  0.04 16.19 ? 845  HOH A O    1  
HETATM 8188   O O    . HOH D 3 .   ? 33.587  2.038   6.462   0.04 15.13 ? 846  HOH A O    1  
HETATM 8189   O O    . HOH D 3 .   ? 9.085   -27.324 23.564  0.04 17.12 ? 847  HOH A O    1  
HETATM 8190   O O    . HOH D 3 .   ? -9.502  -1.387  -12.175 0.04 19.53 ? 848  HOH A O    1  
HETATM 8191   O O    . HOH D 3 .   ? 2.189   -2.430  37.661  0.04 14.66 ? 849  HOH A O    1  
HETATM 8192   O O    . HOH D 3 .   ? 17.364  5.495   -8.905  0.04 15.65 ? 850  HOH A O    1  
HETATM 8193   O O    . HOH D 3 .   ? 30.210  -5.315  37.397  0.04 17.41 ? 851  HOH A O    1  
HETATM 8194   O O    . HOH D 3 .   ? 14.659  -24.718 26.841  0.04 16.65 ? 852  HOH A O    1  
HETATM 8195   O O    . HOH D 3 .   ? -1.151  16.154  30.361  0.04 14.91 ? 853  HOH A O    1  
HETATM 8196   O O    . HOH D 3 .   ? 2.453   4.443   40.087  0.04 15.25 ? 854  HOH A O    1  
HETATM 8197   O O    . HOH D 3 .   ? 1.183   18.027  29.962  0.04 15.19 ? 855  HOH A O    1  
HETATM 8198   O O    . HOH D 3 .   ? 20.537  25.681  27.006  0.04 16.70 ? 856  HOH A O    1  
HETATM 8199   O O    . HOH D 3 .   ? 15.209  -27.116 16.280  0.04 16.35 ? 857  HOH A O    1  
HETATM 8200   O O    . HOH D 3 .   ? 16.372  -21.994 28.999  0.04 16.46 ? 858  HOH A O    1  
HETATM 8201   O O    . HOH D 3 .   ? -3.130  13.627  32.489  0.04 15.28 ? 859  HOH A O    1  
HETATM 8202   O O    . HOH D 3 .   ? 11.720  -27.858 18.306  0.04 16.76 ? 860  HOH A O    1  
HETATM 8203   O O    . HOH D 3 .   ? 33.592  11.449  24.012  0.04 16.12 ? 861  HOH A O    1  
HETATM 8204   O O    . HOH D 3 .   ? 33.403  -2.508  17.176  0.04 15.26 ? 862  HOH A O    1  
HETATM 8205   O O    . HOH D 3 .   ? -1.268  7.264   35.692  0.04 14.84 ? 863  HOH A O    1  
HETATM 8206   O O    . HOH D 3 .   ? 4.377   19.595  4.608   0.04 15.51 ? 864  HOH A O    1  
HETATM 8207   O O    . HOH D 3 .   ? 16.518  23.399  34.787  0.04 17.08 ? 865  HOH A O    1  
HETATM 8208   O O    . HOH D 3 .   ? 32.211  0.151   6.660   0.04 14.84 ? 866  HOH A O    1  
HETATM 8209   O O    . HOH D 3 .   ? 17.715  27.456  31.380  0.04 17.75 ? 867  HOH A O    1  
HETATM 8210   O O    . HOH D 3 .   ? 9.352   -25.151 28.511  0.04 17.48 ? 868  HOH A O    1  
HETATM 8211   O O    . HOH D 3 .   ? -2.635  3.093   36.633  0.04 15.03 ? 869  HOH A O    1  
HETATM 8212   O O    . HOH D 3 .   ? -13.874 6.275   3.666   0.04 17.40 ? 870  HOH A O    1  
HETATM 8213   O O    . HOH D 3 .   ? -11.886 -4.988  29.031  0.04 16.03 ? 871  HOH A O    1  
HETATM 8214   O O    . HOH D 3 .   ? 16.470  0.412   -12.882 0.04 16.32 ? 872  HOH A O    1  
HETATM 8215   O O    . HOH D 3 .   ? 33.077  -13.758 9.370   0.04 15.84 ? 873  HOH A O    1  
HETATM 8216   O O    . HOH D 3 .   ? 25.470  21.143  32.205  0.04 17.19 ? 874  HOH A O    1  
HETATM 8217   O O    . HOH D 3 .   ? 31.555  -1.977  -0.189  0.04 15.47 ? 875  HOH A O    1  
HETATM 8218   O O    . HOH D 3 .   ? 29.074  24.437  21.007  0.04 17.82 ? 876  HOH A O    1  
HETATM 8219   O O    . HOH D 3 .   ? -5.771  11.353  39.758  0.04 17.16 ? 877  HOH A O    1  
HETATM 8220   O O    . HOH D 3 .   ? 36.086  10.334  21.966  0.04 16.79 ? 878  HOH A O    1  
HETATM 8221   O O    . HOH D 3 .   ? 9.671   -24.752 30.298  0.04 17.41 ? 879  HOH A O    1  
HETATM 8222   O O    . HOH D 3 .   ? -0.900  4.005   36.342  0.04 14.57 ? 880  HOH A O    1  
HETATM 8223   O O    . HOH D 3 .   ? 27.380  3.210   39.842  0.04 17.21 ? 881  HOH A O    1  
HETATM 8224   O O    . HOH D 3 .   ? 4.594   -29.194 23.422  0.04 17.83 ? 882  HOH A O    1  
HETATM 8225   O O    . HOH D 3 .   ? 1.577   3.006   37.904  0.04 14.75 ? 883  HOH A O    1  
HETATM 8226   O O    . HOH D 3 .   ? 14.466  -9.184  -12.645 0.04 16.14 ? 884  HOH A O    1  
HETATM 8227   O O    . HOH D 3 .   ? -11.419 9.040   21.010  0.04 15.45 ? 885  HOH A O    1  
HETATM 8228   O O    . HOH D 3 .   ? 5.319   19.802  1.691   0.04 15.95 ? 886  HOH A O    1  
HETATM 8229   O O    . HOH D 3 .   ? -9.340  -1.409  25.225  0.04 14.71 ? 887  HOH A O    1  
HETATM 8230   O O    . HOH D 3 .   ? -2.115  -9.906  35.917  0.04 15.55 ? 888  HOH A O    1  
HETATM 8231   O O    . HOH D 3 .   ? 23.207  22.939  29.532  0.04 16.75 ? 889  HOH A O    1  
HETATM 8232   O O    . HOH D 3 .   ? -11.379 4.536   28.048  0.04 15.89 ? 890  HOH A O    1  
HETATM 8233   O O    . HOH D 3 .   ? 7.700   -28.923 21.870  0.04 17.56 ? 891  HOH A O    1  
HETATM 8234   O O    . HOH D 3 .   ? 4.378   -11.268 -18.562 0.04 19.08 ? 892  HOH A O    1  
HETATM 8235   O O    . HOH D 3 .   ? 3.306   2.127   -17.366 0.04 18.64 ? 893  HOH A O    1  
HETATM 8236   O O    . HOH D 3 .   ? -9.943  5.157   31.488  0.04 15.55 ? 894  HOH A O    1  
HETATM 8237   O O    . HOH D 3 .   ? 11.079  -26.034 30.283  0.04 17.89 ? 895  HOH A O    1  
HETATM 8238   O O    . HOH D 3 .   ? 23.524  -25.376 14.666  0.04 17.01 ? 896  HOH A O    1  
HETATM 8239   O O    . HOH D 3 .   ? -11.809 0.034   25.347  0.04 15.43 ? 897  HOH A O    1  
HETATM 8240   O O    . HOH D 3 .   ? 23.334  -26.252 16.521  0.04 17.32 ? 898  HOH A O    1  
HETATM 8241   O O    . HOH D 3 .   ? 9.912   22.037  38.511  0.04 17.20 ? 899  HOH A O    1  
HETATM 8242   O O    . HOH D 3 .   ? 10.680  9.710   26.908  0.04 12.55 ? 900  HOH A O    1  
HETATM 8243   O O    . HOH D 3 .   ? -3.010  -2.463  29.280  0.04 13.74 ? 901  HOH A O    1  
HETATM 8244   O O    . HOH D 3 .   ? 16.549  23.341  18.276  0.04 15.28 ? 902  HOH A O    1  
HETATM 8245   O O    . HOH D 3 .   ? 19.299  -13.183 7.735   0.04 13.16 ? 903  HOH A O    1  
HETATM 8246   O O    . HOH D 3 .   ? 10.376  -13.341 14.714  0.04 12.45 ? 904  HOH A O    1  
HETATM 8247   O O    . HOH D 3 .   ? 1.126   3.558   33.798  0.04 13.87 ? 905  HOH A O    1  
HETATM 8248   O O    . HOH D 3 .   ? 12.839  0.580   30.161  0.04 12.60 ? 906  HOH A O    1  
HETATM 8249   O O    . HOH D 3 .   ? -3.408  1.854   23.915  0.04 13.09 ? 907  HOH A O    1  
HETATM 8250   O O    . HOH D 3 .   ? 1.882   11.374  8.156   0.04 13.41 ? 908  HOH A O    1  
HETATM 8251   O O    . HOH D 3 .   ? 3.554   -6.922  4.245   0.04 12.69 ? 909  HOH A O    1  
HETATM 8252   O O    . HOH D 3 .   ? -4.753  0.819   2.377   0.04 14.30 ? 910  HOH A O    1  
HETATM 8253   O O    . HOH D 3 .   ? 28.683  17.018  21.392  0.04 15.71 ? 911  HOH A O    1  
HETATM 8254   O O    . HOH D 3 .   ? -8.048  -2.494  29.983  0.04 15.04 ? 912  HOH A O    1  
HETATM 8255   O O    . HOH D 3 .   ? 19.348  20.602  18.643  0.04 14.72 ? 913  HOH A O    1  
HETATM 8256   O O    . HOH D 3 .   ? 1.993   -9.154  4.567   0.04 12.99 ? 914  HOH A O    1  
HETATM 8257   O O    . HOH D 3 .   ? 6.869   -13.288 -4.235  0.04 14.60 ? 915  HOH A O    1  
HETATM 8258   O O    . HOH D 3 .   ? 4.142   -11.210 4.227   0.04 13.09 ? 916  HOH A O    1  
HETATM 8259   O O    . HOH D 3 .   ? 18.723  12.683  31.487  0.04 14.16 ? 917  HOH A O    1  
HETATM 8260   O O    . HOH D 3 .   ? 16.285  -16.042 23.068  0.04 13.86 ? 918  HOH A O    1  
HETATM 8261   O O    . HOH D 3 .   ? 16.858  -10.741 12.438  0.04 12.32 ? 919  HOH A O    1  
HETATM 8262   O O    . HOH D 3 .   ? 2.637   -7.060  8.664   0.04 12.28 ? 920  HOH A O    1  
HETATM 8263   O O    . HOH D 3 .   ? 19.806  3.261   6.280   0.04 12.46 ? 921  HOH A O    1  
HETATM 8264   O O    . HOH D 3 .   ? -9.656  -17.215 27.901  0.04 16.87 ? 922  HOH A O    1  
HETATM 8265   O O    . HOH D 3 .   ? 26.677  -2.105  5.468   0.04 13.55 ? 923  HOH A O    1  
HETATM 8266   O O    . HOH D 3 .   ? 17.739  -16.925 29.227  0.04 15.20 ? 924  HOH A O    1  
HETATM 8267   O O    . HOH D 3 .   ? 18.041  7.685   15.327  0.04 12.10 ? 925  HOH A O    1  
HETATM 8268   O O    . HOH D 3 .   ? 15.350  -17.965 28.689  0.04 15.13 ? 926  HOH A O    1  
HETATM 8269   O O    . HOH D 3 .   ? 31.755  2.895   28.492  0.04 15.50 ? 927  HOH A O    1  
HETATM 8270   O O    . HOH D 3 .   ? 25.034  -5.197  27.830  0.04 14.05 ? 928  HOH A O    1  
HETATM 8271   O O    . HOH D 3 .   ? 22.260  -8.387  26.610  0.04 13.68 ? 929  HOH A O    1  
HETATM 8272   O O    . HOH D 3 .   ? 1.703   -7.747  33.305  0.04 14.37 ? 930  HOH A O    1  
HETATM 8273   O O    . HOH D 3 .   ? 5.720   -7.782  6.212   0.04 12.33 ? 931  HOH A O    1  
HETATM 8274   O O    . HOH D 3 .   ? 3.183   1.545   18.027  0.04 11.76 ? 932  HOH A O    1  
HETATM 8275   O O    . HOH D 3 .   ? -0.730  -11.000 33.533  0.04 15.15 ? 933  HOH A O    1  
HETATM 8276   O O    . HOH D 3 .   ? 3.188   0.237   -15.347 0.04 17.86 ? 934  HOH A O    1  
HETATM 8277   O O    . HOH D 3 .   ? -5.734  -3.782  30.462  0.04 14.60 ? 935  HOH A O    1  
HETATM 8278   O O    . HOH D 3 .   ? 22.720  22.311  18.977  0.04 15.69 ? 936  HOH A O    1  
HETATM 8279   O O    . HOH D 3 .   ? 4.049   -13.065 2.159   0.04 13.61 ? 937  HOH A O    1  
HETATM 8280   O O    . HOH D 3 .   ? -6.654  0.661   16.381  0.04 13.49 ? 938  HOH A O    1  
HETATM 8281   O O    . HOH D 3 .   ? 13.162  12.625  31.083  0.04 13.59 ? 939  HOH A O    1  
HETATM 8282   O O    . HOH D 3 .   ? 9.315   2.147   9.680   0.04 11.57 ? 940  HOH A O    1  
HETATM 8283   O O    . HOH D 3 .   ? 7.019   -6.924  4.822   0.04 12.24 ? 941  HOH A O    1  
HETATM 8284   O O    . HOH D 3 .   ? 29.234  -2.077  4.058   0.04 14.31 ? 942  HOH A O    1  
HETATM 8285   O O    . HOH D 3 .   ? 13.023  -10.230 7.050   0.04 12.32 ? 943  HOH A O    1  
HETATM 8286   O O    . HOH D 3 .   ? 10.716  15.942  24.850  0.04 13.39 ? 944  HOH A O    1  
HETATM 8287   O O    . HOH D 3 .   ? 7.043   19.557  28.083  0.04 14.72 ? 945  HOH A O    1  
HETATM 8288   O O    . HOH D 3 .   ? 5.527   5.088   -5.997  0.04 14.82 ? 946  HOH A O    1  
HETATM 8289   O O    . HOH D 3 .   ? -2.521  10.316  1.656   0.04 14.99 ? 947  HOH A O    1  
HETATM 8290   O O    . HOH D 3 .   ? 12.092  15.460  8.095   0.04 13.49 ? 948  HOH A O    1  
HETATM 8291   O O    . HOH D 3 .   ? 17.909  -15.693 7.541   0.04 13.48 ? 949  HOH A O    1  
HETATM 8292   O O    . HOH D 3 .   ? 24.550  -8.867  21.791  0.04 13.63 ? 950  HOH A O    1  
HETATM 8293   O O    . HOH D 3 .   ? 11.147  -11.815 5.624   0.04 12.67 ? 951  HOH A O    1  
HETATM 8294   O O    . HOH D 3 .   ? 3.270   -13.073 6.085   0.04 13.32 ? 952  HOH A O    1  
HETATM 8295   O O    . HOH D 3 .   ? 4.441   12.969  24.338  0.04 13.02 ? 953  HOH A O    1  
HETATM 8296   O O    . HOH D 3 .   ? -4.837  -0.179  -0.293  0.04 14.79 ? 954  HOH A O    1  
HETATM 8297   O O    . HOH D 3 .   ? 15.389  -22.007 9.886   0.04 14.97 ? 955  HOH A O    1  
HETATM 8298   O O    . HOH D 3 .   ? 10.057  -22.097 13.685  0.04 14.71 ? 956  HOH A O    1  
HETATM 8299   O O    . HOH D 3 .   ? 10.327  2.014   7.620   0.04 11.81 ? 957  HOH A O    1  
HETATM 8300   O O    . HOH D 3 .   ? 22.471  -16.483 17.720  0.04 14.44 ? 958  HOH A O    1  
HETATM 8301   O O    . HOH D 3 .   ? -9.171  7.261   5.338   0.04 15.81 ? 959  HOH A O    1  
HETATM 8302   O O    . HOH D 3 .   ? 5.213   0.904   29.338  0.04 12.58 ? 960  HOH A O    1  
HETATM 8303   O O    . HOH D 3 .   ? -11.572 -4.980  13.316  0.04 14.97 ? 961  HOH A O    1  
HETATM 8304   O O    . HOH D 3 .   ? 18.844  23.158  19.965  0.04 15.43 ? 962  HOH A O    1  
HETATM 8305   O O    . HOH D 3 .   ? 1.688   -1.872  -16.460 0.04 18.11 ? 963  HOH A O    1  
HETATM 8306   O O    . HOH D 3 .   ? 21.319  -13.975 18.921  0.04 13.65 ? 964  HOH A O    1  
HETATM 8307   O O    . HOH D 3 .   ? -10.332 -18.895 15.020  0.04 16.52 ? 965  HOH A O    1  
HETATM 8308   O O    . HOH D 3 .   ? 3.708   3.597   34.281  0.04 13.68 ? 966  HOH A O    1  
HETATM 8309   O O    . HOH D 3 .   ? -7.949  -3.338  27.263  0.04 14.99 ? 967  HOH A O    1  
HETATM 8310   O O    . HOH D 3 .   ? 6.664   5.607   -10.347 0.04 15.95 ? 968  HOH A O    1  
HETATM 8311   O O    . HOH D 3 .   ? 10.464  23.421  35.660  0.04 16.99 ? 969  HOH A O    1  
HETATM 8312   O O    . HOH D 3 .   ? 21.401  -3.478  -6.154  0.04 14.63 ? 970  HOH A O    1  
HETATM 8313   O O    . HOH D 3 .   ? -9.715  -11.796 10.323  0.04 15.36 ? 971  HOH A O    1  
HETATM 8314   O O    . HOH D 3 .   ? 30.629  6.664   3.007   0.04 15.42 ? 972  HOH A O    1  
HETATM 8315   O O    . HOH D 3 .   ? 7.274   10.092  13.302  0.04 12.21 ? 973  HOH A O    1  
HETATM 8316   O O    . HOH D 3 .   ? 2.077   2.505   -10.779 0.04 16.38 ? 974  HOH A O    1  
HETATM 8317   O O    . HOH D 3 .   ? -6.856  1.104   21.835  0.04 13.73 ? 975  HOH A O    1  
HETATM 8318   O O    . HOH D 3 .   ? 10.820  10.975  30.453  0.04 13.23 ? 976  HOH A O    1  
HETATM 8319   O O    . HOH D 3 .   ? -9.894  -13.923 25.640  0.04 16.14 ? 977  HOH A O    1  
HETATM 8320   O O    . HOH D 3 .   ? -0.209  -8.696  3.424   0.04 13.50 ? 978  HOH A O    1  
HETATM 8321   O O    . HOH D 3 .   ? 25.289  21.550  20.193  0.04 16.05 ? 979  HOH A O    1  
HETATM 8322   O O    . HOH D 3 .   ? 6.914   -3.578  35.052  0.04 13.79 ? 980  HOH A O    1  
HETATM 8323   O O    . HOH D 3 .   ? -2.754  -7.233  -13.519 0.04 18.09 ? 981  HOH A O    1  
HETATM 8324   O O    . HOH D 3 .   ? -2.995  -17.337 30.300  0.04 16.02 ? 982  HOH A O    1  
HETATM 8325   O O    . HOH D 3 .   ? -7.110  -0.182  24.015  0.04 14.10 ? 983  HOH A O    1  
HETATM 8326   O O    . HOH D 3 .   ? 12.832  -15.146 12.641  0.04 12.88 ? 984  HOH A O    1  
HETATM 8327   O O    . HOH D 3 .   ? 17.172  -20.310 14.470  0.04 14.39 ? 985  HOH A O    1  
HETATM 8328   O O    . HOH D 3 .   ? -7.175  -23.129 12.509  0.04 17.06 ? 986  HOH A O    1  
HETATM 8329   O O    . HOH D 3 .   ? 19.446  9.002   33.207  0.04 14.08 ? 987  HOH A O    1  
HETATM 8330   O O    . HOH D 3 .   ? 9.052   10.735  34.976  0.04 14.13 ? 988  HOH A O    1  
HETATM 8331   O O    . HOH D 3 .   ? -5.717  -24.739 5.584   0.04 17.99 ? 989  HOH A O    1  
HETATM 8332   O O    . HOH D 3 .   ? -7.716  -0.040  18.912  0.04 13.67 ? 990  HOH A O    1  
HETATM 8333   O O    . HOH D 3 .   ? -11.486 -7.215  13.788  0.04 15.23 ? 991  HOH A O    1  
HETATM 8334   O O    . HOH D 3 .   ? 10.876  -9.288  -11.278 0.04 15.89 ? 992  HOH A O    1  
HETATM 8335   O O    . HOH D 3 .   ? 1.010   -7.758  10.377  0.04 12.49 ? 993  HOH A O    1  
HETATM 8336   O O    . HOH D 3 .   ? 14.897  -11.848 34.156  0.04 14.87 ? 994  HOH A O    1  
HETATM 8337   O O    . HOH D 3 .   ? 11.263  11.831  15.259  0.04 12.28 ? 995  HOH A O    1  
HETATM 8338   O O    . HOH D 3 .   ? -9.363  -12.326 7.483   0.04 15.51 ? 996  HOH A O    1  
HETATM 8339   O O    . HOH D 3 .   ? 1.085   -13.473 -14.641 0.04 18.33 ? 997  HOH A O    1  
HETATM 8340   O O    . HOH D 3 .   ? 23.516  13.903  13.343  0.04 13.73 ? 998  HOH A O    1  
HETATM 8341   O O    . HOH D 3 .   ? 28.392  -6.272  23.708  0.04 14.34 ? 999  HOH A O    1  
HETATM 8342   O O    . HOH D 3 .   ? 17.664  -17.272 5.642   0.04 14.01 ? 1000 HOH A O    1  
HETATM 8343   O O    . HOH D 3 .   ? -12.223 -3.482  -2.039  0.04 17.06 ? 1001 HOH A O    1  
HETATM 8344   O O    . HOH D 3 .   ? -8.335  0.731   10.658  0.04 14.21 ? 1002 HOH A O    1  
HETATM 8345   O O    . HOH D 3 .   ? -2.113  -9.554  -14.399 0.04 18.46 ? 1003 HOH A O    1  
HETATM 8346   O O    . HOH D 3 .   ? 11.388  0.836   37.069  0.04 13.78 ? 1004 HOH A O    1  
HETATM 8347   O O    . HOH D 3 .   ? 32.425  6.253   15.837  0.04 14.77 ? 1005 HOH A O    1  
HETATM 8348   O O    . HOH D 3 .   ? 31.035  9.275   33.808  0.04 16.28 ? 1006 HOH A O    1  
HETATM 8349   O O    . HOH D 3 .   ? 8.589   25.990  35.338  0.04 17.35 ? 1007 HOH A O    1  
HETATM 8350   O O    . HOH D 3 .   ? 13.806  -12.714 -6.763  0.04 15.01 ? 1008 HOH A O    1  
HETATM 8351   O O    . HOH D 3 .   ? 25.331  -13.648 4.561   0.04 14.55 ? 1009 HOH A O    1  
HETATM 8352   O O    . HOH D 3 .   ? 19.193  -8.951  34.610  0.04 14.79 ? 1010 HOH A O    1  
HETATM 8353   O O    . HOH D 3 .   ? 11.683  -4.119  34.839  0.04 13.84 ? 1011 HOH A O    1  
HETATM 8354   O O    . HOH D 3 .   ? 1.752   -9.169  7.433   0.04 12.75 ? 1012 HOH A O    1  
HETATM 8355   O O    . HOH D 3 .   ? 5.424   -7.339  8.876   0.04 12.05 ? 1013 HOH A O    1  
HETATM 8356   O O    . HOH D 3 .   ? 12.704  -17.182 10.505  0.04 13.34 ? 1014 HOH A O    1  
HETATM 8357   O O    . HOH D 3 .   ? 30.944  3.153   13.822  0.04 14.08 ? 1015 HOH A O    1  
HETATM 8358   O O    . HOH D 3 .   ? -12.469 2.395   28.063  0.04 15.44 ? 1016 HOH A O    1  
HETATM 8359   O O    . HOH D 3 .   ? -2.107  6.797   4.700   0.04 13.83 ? 1017 HOH A O    1  
HETATM 8360   O O    . HOH D 3 .   ? 7.407   -13.354 31.652  0.04 14.62 ? 1018 HOH A O    1  
HETATM 8361   O O    . HOH D 3 .   ? 1.151   -31.062 6.888   0.04 18.24 ? 1019 HOH A O    1  
HETATM 8362   O O    . HOH D 3 .   ? 21.431  -17.482 -0.576  0.04 15.21 ? 1020 HOH A O    1  
HETATM 8363   O O    . HOH D 3 .   ? 13.342  -13.475 3.839   0.04 12.96 ? 1021 HOH A O    1  
HETATM 8364   O O    . HOH D 3 .   ? -4.584  1.977   -4.027  0.04 15.70 ? 1022 HOH A O    1  
HETATM 8365   O O    . HOH D 3 .   ? 16.304  -11.178 -7.990  0.04 15.67 ? 1023 HOH A O    1  
HETATM 8366   O O    . HOH D 3 .   ? 13.853  0.230   33.173  0.04 13.12 ? 1024 HOH A O    1  
HETATM 8367   O O    . HOH D 3 .   ? -5.363  3.437   22.650  0.04 13.50 ? 1025 HOH A O    1  
HETATM 8368   O O    . HOH D 3 .   ? 6.007   16.976  1.684   0.04 15.18 ? 1026 HOH A O    1  
HETATM 8369   O O    . HOH D 3 .   ? -5.353  -22.756 27.558  0.04 17.92 ? 1027 HOH A O    1  
HETATM 8370   O O    . HOH D 3 .   ? 21.114  14.044  4.231   0.04 14.54 ? 1028 HOH A O    1  
HETATM 8371   O O    . HOH D 3 .   ? 15.650  -21.674 12.012  0.04 14.56 ? 1029 HOH A O    1  
HETATM 8372   O O    . HOH D 3 .   ? 23.201  3.716   34.602  0.04 14.79 ? 1030 HOH A O    1  
HETATM 8373   O O    . HOH D 3 .   ? -6.534  13.816  23.893  0.04 14.96 ? 1031 HOH A O    1  
HETATM 8374   O O    . HOH D 3 .   ? 14.727  -15.473 3.491   0.04 13.96 ? 1032 HOH A O    1  
HETATM 8375   O O    . HOH D 3 .   ? -3.347  -24.002 27.617  0.04 17.60 ? 1033 HOH A O    1  
HETATM 8376   O O    . HOH D 3 .   ? 2.521   14.778  22.964  0.04 13.60 ? 1034 HOH A O    1  
HETATM 8377   O O    . HOH D 3 .   ? 23.938  -5.894  35.357  0.04 15.53 ? 1035 HOH A O    1  
HETATM 8378   O O    . HOH D 3 .   ? -11.208 -21.316 14.137  0.04 17.85 ? 1036 HOH A O    1  
HETATM 8379   O O    . HOH D 3 .   ? 9.423   -10.297 33.185  0.04 14.29 ? 1037 HOH A O    1  
HETATM 8380   O O    . HOH D 3 .   ? 14.747  1.414   36.677  0.04 14.08 ? 1038 HOH A O    1  
HETATM 8381   O O    . HOH D 3 .   ? 6.067   18.757  6.606   0.04 14.80 ? 1039 HOH A O    1  
HETATM 8382   O O    . HOH D 3 .   ? 5.997   12.651  37.172  0.04 14.94 ? 1040 HOH A O    1  
HETATM 8383   O O    . HOH D 3 .   ? 22.602  1.948   37.369  0.04 15.24 ? 1041 HOH A O    1  
HETATM 8384   O O    . HOH D 3 .   ? -12.401 -19.302 21.087  0.04 17.77 ? 1042 HOH A O    1  
HETATM 8385   O O    . HOH D 3 .   ? 31.329  -1.700  6.796   0.04 14.78 ? 1043 HOH A O    1  
HETATM 8386   O O    . HOH D 3 .   ? 13.586  17.063  6.667   0.04 14.24 ? 1044 HOH A O    1  
HETATM 8387   O O    . HOH D 3 .   ? 25.849  15.503  4.652   0.04 15.16 ? 1045 HOH A O    1  
HETATM 8388   O O    . HOH D 3 .   ? 25.798  15.854  9.990   0.04 14.80 ? 1046 HOH A O    1  
HETATM 8389   O O    . HOH D 3 .   ? -3.833  1.565   -12.399 0.04 17.73 ? 1047 HOH A O    1  
HETATM 8390   O O    . HOH D 3 .   ? 3.919   -25.975 25.726  0.04 17.21 ? 1048 HOH A O    1  
HETATM 8391   O O    . HOH D 3 .   ? 14.182  -17.689 24.142  0.04 14.20 ? 1049 HOH A O    1  
HETATM 8392   O O    . HOH D 3 .   ? -10.287 -11.912 20.638  0.04 15.33 ? 1050 HOH A O    1  
HETATM 8393   O O    . HOH D 3 .   ? 31.263  -5.515  12.365  0.04 14.40 ? 1051 HOH A O    1  
HETATM 8394   O O    . HOH D 3 .   ? -8.897  -18.006 2.614   0.04 16.95 ? 1052 HOH A O    1  
HETATM 8395   O O    . HOH D 3 .   ? -6.456  7.106   31.689  0.04 15.09 ? 1053 HOH A O    1  
HETATM 8396   O O    . HOH D 3 .   ? 24.566  7.479   11.697  0.04 13.07 ? 1054 HOH A O    1  
HETATM 8397   O O    . HOH D 3 .   ? 34.465  6.404   13.283  0.04 15.54 ? 1055 HOH A O    1  
HETATM 8398   O O    . HOH D 3 .   ? -11.307 -4.619  8.776   0.04 15.18 ? 1056 HOH A O    1  
HETATM 8399   O O    . HOH D 3 .   ? 26.919  5.277   -4.298  0.04 15.41 ? 1057 HOH A O    1  
HETATM 8400   O O    . HOH D 3 .   ? 9.840   13.317  -2.627  0.04 15.07 ? 1058 HOH A O    1  
HETATM 8401   O O    . HOH D 3 .   ? -3.923  -27.169 26.842  0.04 19.23 ? 1059 HOH A O    1  
HETATM 8402   O O    . HOH D 3 .   ? 23.773  -7.829  33.567  0.04 15.54 ? 1060 HOH A O    1  
HETATM 8403   O O    . HOH D 3 .   ? -11.935 1.840   7.118   0.04 15.81 ? 1061 HOH A O    1  
HETATM 8404   O O    . HOH D 3 .   ? -0.680  8.028   -1.558  0.04 14.82 ? 1062 HOH A O    1  
HETATM 8405   O O    . HOH D 3 .   ? -7.943  8.254   13.486  0.04 14.68 ? 1063 HOH A O    1  
HETATM 8406   O O    . HOH D 3 .   ? 22.855  -9.161  -1.910  0.04 14.43 ? 1064 HOH A O    1  
HETATM 8407   O O    . HOH D 3 .   ? 2.011   12.765  -5.642  0.04 16.41 ? 1065 HOH A O    1  
HETATM 8408   O O    . HOH D 3 .   ? -1.063  -17.200 -9.833  0.04 17.52 ? 1066 HOH A O    1  
HETATM 8409   O O    . HOH D 3 .   ? 33.076  -6.441  10.341  0.04 15.01 ? 1067 HOH A O    1  
HETATM 8410   O O    . HOH D 3 .   ? 10.625  26.860  18.808  0.04 16.31 ? 1068 HOH A O    1  
HETATM 8411   O O    . HOH D 3 .   ? 23.955  -16.939 26.010  0.04 15.47 ? 1069 HOH A O    1  
HETATM 8412   O O    . HOH D 3 .   ? -10.086 1.655   -9.077  0.04 18.65 ? 1070 HOH A O    1  
HETATM 8413   O O    . HOH D 3 .   ? 22.716  19.292  35.444  0.04 17.05 ? 1071 HOH A O    1  
HETATM 8414   O O    . HOH D 3 .   ? 32.906  5.140   17.369  0.04 15.14 ? 1072 HOH A O    1  
HETATM 8415   O O    . HOH D 3 .   ? 36.065  10.315  11.721  0.04 16.41 ? 1073 HOH A O    1  
HETATM 8416   O O    . HOH D 3 .   ? 2.354   17.999  23.485  0.04 14.22 ? 1074 HOH A O    1  
HETATM 8417   O O    . HOH D 3 .   ? 22.356  17.858  5.623   0.04 14.80 ? 1075 HOH A O    1  
HETATM 8418   O O    . HOH D 3 .   ? -5.284  11.749  -1.313  0.04 16.41 ? 1076 HOH A O    1  
HETATM 8419   O O    . HOH D 3 .   ? 23.058  25.284  18.162  0.04 16.54 ? 1077 HOH A O    1  
HETATM 8420   O O    . HOH D 3 .   ? -0.862  10.591  -0.599  0.04 15.15 ? 1078 HOH A O    1  
HETATM 8421   O O    . HOH D 3 .   ? 19.703  19.516  11.582  0.04 14.59 ? 1079 HOH A O    1  
HETATM 8422   O O    . HOH D 3 .   ? 13.861  -24.950 9.527   0.04 15.51 ? 1080 HOH A O    1  
HETATM 8423   O O    . HOH D 3 .   ? 11.016  -1.362  34.707  0.04 13.35 ? 1081 HOH A O    1  
HETATM 8424   O O    . HOH D 3 .   ? -0.996  8.269   2.684   0.04 14.20 ? 1082 HOH A O    1  
HETATM 8425   O O    . HOH D 3 .   ? -0.159  6.200   1.096   0.04 14.08 ? 1083 HOH A O    1  
HETATM 8426   O O    . HOH D 3 .   ? -8.879  8.270   31.054  0.04 15.75 ? 1084 HOH A O    1  
HETATM 8427   O O    . HOH D 3 .   ? 4.270   10.526  36.147  0.04 14.54 ? 1085 HOH A O    1  
HETATM 8428   O O    . HOH D 3 .   ? 33.235  8.043   11.105  0.04 15.32 ? 1086 HOH A O    1  
HETATM 8429   O O    . HOH D 3 .   ? 14.430  -1.775  37.324  0.04 14.30 ? 1087 HOH A O    1  
HETATM 8430   O O    . HOH D 3 .   ? 2.495   12.125  25.093  0.04 13.22 ? 1088 HOH A O    1  
HETATM 8431   O O    . HOH D 3 .   ? 7.123   -25.751 17.230  0.04 15.96 ? 1089 HOH A O    1  
HETATM 8432   O O    . HOH D 3 .   ? 0.106   -22.184 25.595  0.04 16.22 ? 1090 HOH A O    1  
HETATM 8433   O O    . HOH D 3 .   ? 9.133   15.964  -4.062  0.04 16.03 ? 1091 HOH A O    1  
HETATM 8434   O O    . HOH D 3 .   ? 16.045  19.791  10.209  0.04 14.43 ? 1092 HOH A O    1  
HETATM 8435   O O    . HOH D 3 .   ? 29.102  -8.912  0.002   0.04 15.39 ? 1093 HOH A O    1  
HETATM 8436   O O    . HOH D 3 .   ? 30.847  -5.474  22.446  0.04 14.86 ? 1094 HOH A O    1  
HETATM 8437   O O    . HOH D 3 .   ? -12.589 -2.810  0.946   0.04 16.87 ? 1095 HOH A O    1  
HETATM 8438   O O    . HOH D 3 .   ? 29.982  -12.562 5.992   0.04 15.29 ? 1096 HOH A O    1  
HETATM 8439   O O    . HOH D 3 .   ? -12.556 -6.380  -2.220  0.04 17.52 ? 1097 HOH A O    1  
HETATM 8440   O O    . HOH D 3 .   ? 25.691  14.667  33.379  0.04 15.94 ? 1098 HOH A O    1  
HETATM 8441   O O    . HOH D 3 .   ? 25.549  8.760   35.299  0.04 15.57 ? 1099 HOH A O    1  
HETATM 8442   O O    . HOH D 3 .   ? -3.120  -30.098 11.428  0.04 18.50 ? 1100 HOH A O    1  
HETATM 8443   O O    . HOH D 3 .   ? -9.105  -14.776 2.455   0.04 16.49 ? 1101 HOH A O    1  
HETATM 8444   O O    . HOH D 3 .   ? -1.043  -26.078 2.838   0.04 17.39 ? 1102 HOH A O    1  
HETATM 8445   O O    . HOH D 3 .   ? 6.359   -28.481 4.170   0.04 17.29 ? 1103 HOH A O    1  
HETATM 8446   O O    . HOH D 3 .   ? 8.878   4.006   38.638  0.04 14.39 ? 1104 HOH A O    1  
HETATM 8447   O O    . HOH D 3 .   ? 7.205   -16.395 30.142  0.04 14.69 ? 1105 HOH A O    1  
HETATM 8448   O O    . HOH D 3 .   ? 2.627   14.420  0.380   0.04 15.23 ? 1106 HOH A O    1  
HETATM 8449   O O    . HOH D 3 .   ? -2.924  9.909   -2.548  0.04 16.11 ? 1107 HOH A O    1  
HETATM 8450   O O    . HOH D 3 .   ? 8.613   -14.465 35.557  0.04 15.52 ? 1108 HOH A O    1  
HETATM 8451   O O    . HOH D 3 .   ? -6.983  13.743  5.585   0.04 16.01 ? 1109 HOH A O    1  
HETATM 8452   O O    . HOH D 3 .   ? -9.607  8.834   2.018   0.04 16.56 ? 1110 HOH A O    1  
HETATM 8453   O O    . HOH D 3 .   ? 6.898   -12.326 -11.754 0.04 16.59 ? 1111 HOH A O    1  
HETATM 8454   O O    . HOH D 3 .   ? 29.680  -0.315  1.940   0.04 14.76 ? 1112 HOH A O    1  
HETATM 8455   O O    . HOH D 3 .   ? -11.623 -8.652  20.346  0.04 15.54 ? 1113 HOH A O    1  
HETATM 8456   O O    . HOH D 3 .   ? -9.783  -14.159 -7.907  0.04 18.90 ? 1114 HOH A O    1  
HETATM 8457   O O    . HOH D 3 .   ? 18.174  -7.505  35.997  0.04 14.90 ? 1115 HOH A O    1  
HETATM 8458   O O    . HOH D 3 .   ? 1.958   10.817  35.511  0.04 14.69 ? 1116 HOH A O    1  
HETATM 8459   O O    . HOH D 3 .   ? 19.023  -10.172 -4.089  0.04 14.44 ? 1117 HOH A O    1  
HETATM 8460   O O    . HOH D 3 .   ? 5.687   18.099  38.875  0.04 16.52 ? 1118 HOH A O    1  
HETATM 8461   O O    . HOH D 3 .   ? 6.171   -20.270 -4.517  0.04 16.12 ? 1119 HOH A O    1  
HETATM 8462   O O    . HOH D 3 .   ? 21.340  18.573  7.543   0.04 14.98 ? 1120 HOH A O    1  
HETATM 8463   O O    . HOH D 3 .   ? 23.047  -12.479 19.920  0.04 13.61 ? 1121 HOH A O    1  
HETATM 8464   O O    . HOH D 3 .   ? 24.802  -10.580 19.072  0.04 13.67 ? 1122 HOH A O    1  
HETATM 8465   O O    . HOH D 3 .   ? 17.360  9.580   -5.186  0.04 15.08 ? 1123 HOH A O    1  
HETATM 8466   O O    . HOH D 3 .   ? 5.958   -16.288 -10.821 0.04 16.94 ? 1124 HOH A O    1  
HETATM 8467   O O    . HOH D 3 .   ? 24.850  -6.229  -4.403  0.04 14.99 ? 1125 HOH A O    1  
HETATM 8468   O O    . HOH D 3 .   ? 10.851  16.085  41.555  0.04 16.56 ? 1126 HOH A O    1  
HETATM 8469   O O    . HOH D 3 .   ? -3.933  4.289   -6.663  0.04 16.49 ? 1127 HOH A O    1  
HETATM 8470   O O    . HOH D 3 .   ? 29.017  17.635  12.199  0.04 15.81 ? 1128 HOH A O    1  
HETATM 8471   O O    . HOH D 3 .   ? 26.327  24.852  17.346  0.04 17.04 ? 1129 HOH A O    1  
HETATM 8472   O O    . HOH D 3 .   ? -4.588  -20.642 29.142  0.04 17.11 ? 1130 HOH A O    1  
HETATM 8473   O O    . HOH D 3 .   ? 2.072   15.507  19.069  0.04 13.60 ? 1131 HOH A O    1  
HETATM 8474   O O    . HOH D 3 .   ? 14.349  24.461  13.901  0.04 15.63 ? 1132 HOH A O    1  
HETATM 8475   O O    . HOH D 3 .   ? 11.972  6.769   39.427  0.04 14.79 ? 1133 HOH A O    1  
HETATM 8476   O O    . HOH D 3 .   ? -3.423  13.686  11.776  0.04 14.45 ? 1134 HOH A O    1  
HETATM 8477   O O    . HOH D 3 .   ? 26.001  4.454   -6.773  0.04 16.05 ? 1135 HOH A O    1  
HETATM 8478   O O    . HOH D 3 .   ? 14.226  11.840  42.219  0.04 16.19 ? 1136 HOH A O    1  
HETATM 8479   O O    . HOH D 3 .   ? 7.249   -19.308 -5.906  0.04 16.18 ? 1137 HOH A O    1  
HETATM 8480   O O    . HOH D 3 .   ? -13.632 -3.730  9.985   0.04 16.18 ? 1138 HOH A O    1  
HETATM 8481   O O    . HOH D 3 .   ? 1.468   0.667   -13.589 0.04 17.40 ? 1139 HOH A O    1  
ATOM   8482   N N    . GLU A 1 1   ? -8.491  -30.064 19.332  0.04 19.95 ? 57   GLU A N    2  
ATOM   8483   C CA   . GLU A 1 1   ? -9.506  -29.189 19.946  0.04 20.07 ? 57   GLU A CA   2  
ATOM   8484   C C    . GLU A 1 1   ? -9.700  -27.995 19.038  0.04 19.59 ? 57   GLU A C    2  
ATOM   8485   O O    . GLU A 1 1   ? -10.737 -27.795 18.382  0.04 19.54 ? 57   GLU A O    2  
ATOM   8486   C CB   . GLU A 1 1   ? -9.028  -28.708 21.329  0.04 20.04 ? 57   GLU A CB   2  
ATOM   8487   C CG   . GLU A 1 1   ? -10.100 -28.789 22.315  0.04 20.73 ? 57   GLU A CG   2  
ATOM   8488   C CD   . GLU A 1 1   ? -11.327 -27.968 21.954  0.04 20.89 ? 57   GLU A CD   2  
ATOM   8489   O OE1  . GLU A 1 1   ? -11.463 -26.866 22.541  0.04 20.50 ? 57   GLU A OE1  2  
ATOM   8490   O OE2  . GLU A 1 1   ? -12.159 -28.460 21.137  0.04 21.43 ? 57   GLU A OE2  2  
ATOM   8491   H HA   . GLU A 1 1   ? -10.343 -29.670 20.041  0.04 20.52 ? 57   GLU A HA   2  
ATOM   8492   H HB2  . GLU A 1 1   ? -8.304  -29.273 21.635  0.04 19.94 ? 57   GLU A HB2  2  
ATOM   8493   H HB3  . GLU A 1 1   ? -8.743  -27.787 21.304  0.04 19.72 ? 57   GLU A HB3  2  
ATOM   8494   H HG2  . GLU A 1 1   ? -10.387 -29.719 22.364  0.04 21.10 ? 57   GLU A HG2  2  
ATOM   8495   H HG3  . GLU A 1 1   ? -9.782  -28.499 23.180  0.04 20.73 ? 57   GLU A HG3  2  
ATOM   8496   N N    . VAL A 1 2   ? -8.644  -27.212 19.000  0.04 19.28 ? 58   VAL A N    2  
ATOM   8497   C CA   . VAL A 1 2   ? -8.452  -26.303 17.915  0.04 18.78 ? 58   VAL A CA   2  
ATOM   8498   C C    . VAL A 1 2   ? -8.086  -27.156 16.705  0.04 18.78 ? 58   VAL A C    2  
ATOM   8499   O O    . VAL A 1 2   ? -7.536  -28.257 16.811  0.04 18.73 ? 58   VAL A O    2  
ATOM   8500   C CB   . VAL A 1 2   ? -7.336  -25.334 18.220  0.04 18.17 ? 58   VAL A CB   2  
ATOM   8501   C CG1  . VAL A 1 2   ? -7.085  -24.437 17.010  0.04 17.73 ? 58   VAL A CG1  2  
ATOM   8502   C CG2  . VAL A 1 2   ? -7.699  -24.551 19.482  0.04 18.24 ? 58   VAL A CG2  2  
ATOM   8503   H H    . VAL A 1 2   ? -8.007  -27.213 19.579  0.04 19.38 ? 58   VAL A H    2  
ATOM   8504   H HA   . VAL A 1 2   ? -9.265  -25.812 17.735  0.04 18.84 ? 58   VAL A HA   2  
ATOM   8505   H HB   . VAL A 1 2   ? -6.523  -25.835 18.403  0.04 18.05 ? 58   VAL A HB   2  
ATOM   8506   H HG11 . VAL A 1 2   ? -6.705  -23.602 17.328  0.04 17.39 ? 58   VAL A HG11 2  
ATOM   8507   H HG12 . VAL A 1 2   ? -6.457  -24.879 16.417  0.04 17.66 ? 58   VAL A HG12 2  
ATOM   8508   H HG13 . VAL A 1 2   ? -7.923  -24.271 16.552  0.04 17.88 ? 58   VAL A HG13 2  
ATOM   8509   H HG21 . VAL A 1 2   ? -7.111  -23.788 19.577  0.04 17.91 ? 58   VAL A HG21 2  
ATOM   8510   H HG22 . VAL A 1 2   ? -8.621  -24.264 19.418  0.04 18.26 ? 58   VAL A HG22 2  
ATOM   8511   H HG23 . VAL A 1 2   ? -7.595  -25.144 20.246  0.04 18.60 ? 58   VAL A HG23 2  
ATOM   8512   N N    . VAL A 1 3   ? -8.394  -26.607 15.543  0.04 18.85 ? 59   VAL A N    2  
ATOM   8513   C CA   . VAL A 1 3   ? -8.154  -27.266 14.285  0.04 18.94 ? 59   VAL A CA   2  
ATOM   8514   C C    . VAL A 1 3   ? -6.951  -26.518 13.736  0.04 18.34 ? 59   VAL A C    2  
ATOM   8515   O O    . VAL A 1 3   ? -6.768  -25.344 14.049  0.04 17.94 ? 59   VAL A O    2  
ATOM   8516   C CB   . VAL A 1 3   ? -9.419  -27.123 13.410  0.04 19.30 ? 59   VAL A CB   2  
ATOM   8517   C CG1  . VAL A 1 3   ? -9.787  -25.674 13.234  0.04 18.93 ? 59   VAL A CG1  2  
ATOM   8518   C CG2  . VAL A 1 3   ? -9.275  -27.788 12.046  0.04 19.50 ? 59   VAL A CG2  2  
ATOM   8519   H H    . VAL A 1 3   ? -8.728  -25.823 15.467  0.04 18.87 ? 59   VAL A H    2  
ATOM   8520   H HA   . VAL A 1 3   ? -7.936  -28.204 14.398  0.04 19.18 ? 59   VAL A HA   2  
ATOM   8521   H HB   . VAL A 1 3   ? -10.155 -27.561 13.868  0.04 19.69 ? 59   VAL A HB   2  
ATOM   8522   H HG11 . VAL A 1 3   ? -10.591 -25.628 12.691  0.04 19.22 ? 59   VAL A HG11 2  
ATOM   8523   H HG12 . VAL A 1 3   ? -9.972  -25.286 14.102  0.04 18.75 ? 59   VAL A HG12 2  
ATOM   8524   H HG13 . VAL A 1 3   ? -9.059  -25.207 12.795  0.04 18.62 ? 59   VAL A HG13 2  
ATOM   8525   H HG21 . VAL A 1 3   ? -9.874  -27.346 11.424  0.04 19.61 ? 59   VAL A HG21 2  
ATOM   8526   H HG22 . VAL A 1 3   ? -8.358  -27.695 11.745  0.04 19.16 ? 59   VAL A HG22 2  
ATOM   8527   H HG23 . VAL A 1 3   ? -9.507  -28.725 12.119  0.04 19.87 ? 59   VAL A HG23 2  
ATOM   8528   N N    . GLY A 1 4   ? -6.073  -27.177 13.006  0.04 18.29 ? 60   GLY A N    2  
ATOM   8529   C CA   . GLY A 1 4   ? -5.099  -26.449 12.234  0.04 17.83 ? 60   GLY A CA   2  
ATOM   8530   C C    . GLY A 1 4   ? -5.728  -26.022 10.916  0.04 17.80 ? 60   GLY A C    2  
ATOM   8531   O O    . GLY A 1 4   ? -6.580  -26.737 10.387  0.04 18.23 ? 60   GLY A O    2  
ATOM   8532   H H    . GLY A 1 4   ? -6.012  -28.032 12.950  0.04 18.56 ? 60   GLY A H    2  
ATOM   8533   H HA2  . GLY A 1 4   ? -4.821  -25.660 12.719  0.04 17.48 ? 60   GLY A HA2  2  
ATOM   8534   H HA3  . GLY A 1 4   ? -4.324  -26.994 12.075  0.04 17.89 ? 60   GLY A HA3  2  
ATOM   8535   N N    . GLY A 1 5   ? -5.342  -24.843 10.427  0.04 17.33 ? 61   GLY A N    2  
ATOM   8536   C CA   . GLY A 1 5   ? -5.661  -24.413 9.076   0.04 17.27 ? 61   GLY A CA   2  
ATOM   8537   C C    . GLY A 1 5   ? -6.993  -23.696 8.932   0.04 17.44 ? 61   GLY A C    2  
ATOM   8538   O O    . GLY A 1 5   ? -7.544  -23.128 9.867   0.04 17.38 ? 61   GLY A O    2  
ATOM   8539   H H    . GLY A 1 5   ? -4.879  -24.267 10.864  0.04 17.06 ? 61   GLY A H    2  
ATOM   8540   H HA2  . GLY A 1 5   ? -4.966  -23.827 8.752   0.04 16.91 ? 61   GLY A HA2  2  
ATOM   8541   H HA3  . GLY A 1 5   ? -5.679  -25.192 8.500   0.04 17.49 ? 61   GLY A HA3  2  
ATOM   8542   N N    . GLY A 1 6   ? -7.511  -23.731 7.718   0.04 17.69 ? 62   GLY A N    2  
ATOM   8543   C CA   . GLY A 1 6   ? -8.750  -23.050 7.419   0.04 17.84 ? 62   GLY A CA   2  
ATOM   8544   C C    . GLY A 1 6   ? -8.553  -21.793 6.610   0.04 17.48 ? 62   GLY A C    2  
ATOM   8545   O O    . GLY A 1 6   ? -7.445  -21.332 6.368   0.04 17.18 ? 62   GLY A O    2  
ATOM   8546   H H    . GLY A 1 6   ? -7.164  -24.150 7.051   0.04 17.80 ? 62   GLY A H    2  
ATOM   8547   H HA2  . GLY A 1 6   ? -9.323  -23.645 6.914   0.04 18.22 ? 62   GLY A HA2  2  
ATOM   8548   H HA3  . GLY A 1 6   ? -9.207  -22.811 8.238   0.04 17.86 ? 62   GLY A HA3  2  
ATOM   8549   N N    . ASP A 1 7   ? -9.678  -21.290 6.136   0.04 17.53 ? 63   ASP A N    2  
ATOM   8550   C CA   . ASP A 1 7   ? -9.707  -20.093 5.342   0.04 17.34 ? 63   ASP A CA   2  
ATOM   8551   C C    . ASP A 1 7   ? -9.212  -18.936 6.216   0.04 16.81 ? 63   ASP A C    2  
ATOM   8552   O O    . ASP A 1 7   ? -9.216  -19.006 7.453   0.04 16.70 ? 63   ASP A O    2  
ATOM   8553   C CB   . ASP A 1 7   ? -11.144 -19.885 4.837   0.04 17.80 ? 63   ASP A CB   2  
ATOM   8554   C CG   . ASP A 1 7   ? -11.268 -18.767 3.824   0.04 17.70 ? 63   ASP A CG   2  
ATOM   8555   O OD1  . ASP A 1 7   ? -12.074 -18.921 2.864   0.04 17.89 ? 63   ASP A OD1  2  
ATOM   8556   O OD2  . ASP A 1 7   ? -10.582 -17.720 3.999   0.04 17.53 ? 63   ASP A OD2  2  
ATOM   8557   H H    . ASP A 1 7   ? -10.452 -21.637 6.268   0.04 17.72 ? 63   ASP A H    2  
ATOM   8558   H HA   . ASP A 1 7   ? -9.116  -20.184 4.581   0.04 17.30 ? 63   ASP A HA   2  
ATOM   8559   H HB2  . ASP A 1 7   ? -11.439 -20.706 4.409   0.04 18.14 ? 63   ASP A HB2  2  
ATOM   8560   H HB3  . ASP A 1 7   ? -11.724 -19.676 5.585   0.04 17.87 ? 63   ASP A HB3  2  
ATOM   8561   N N    . LEU A 1 8   ? -8.728  -17.895 5.552   0.04 16.50 ? 64   LEU A N    2  
ATOM   8562   C CA   . LEU A 1 8   ? -8.201  -16.718 6.242   0.04 16.01 ? 64   LEU A CA   2  
ATOM   8563   C C    . LEU A 1 8   ? -9.214  -15.585 6.398   0.04 16.00 ? 64   LEU A C    2  
ATOM   8564   O O    . LEU A 1 8   ? -8.928  -14.562 7.020   0.04 15.65 ? 64   LEU A O    2  
ATOM   8565   C CB   . LEU A 1 8   ? -6.959  -16.226 5.511   0.04 15.68 ? 64   LEU A CB   2  
ATOM   8566   C CG   . LEU A 1 8   ? -5.853  -17.266 5.321   0.04 15.78 ? 64   LEU A CG   2  
ATOM   8567   C CD1  . LEU A 1 8   ? -4.649  -16.706 4.566   0.04 15.85 ? 64   LEU A CD1  2  
ATOM   8568   C CD2  . LEU A 1 8   ? -5.445  -17.876 6.674   0.04 15.42 ? 64   LEU A CD2  2  
ATOM   8569   H H    . LEU A 1 8   ? -8.690  -17.848 4.694   0.04 16.59 ? 64   LEU A H    2  
ATOM   8570   H HA   . LEU A 1 8   ? -7.934  -16.974 7.137   0.04 15.90 ? 64   LEU A HA   2  
ATOM   8571   H HB2  . LEU A 1 8   ? -7.215  -15.911 4.632   0.04 15.74 ? 64   LEU A HB2  2  
ATOM   8572   H HB3  . LEU A 1 8   ? -6.580  -15.497 6.022   0.04 15.37 ? 64   LEU A HB3  2  
ATOM   8573   H HG   . LEU A 1 8   ? -6.211  -17.988 4.782   0.04 16.07 ? 64   LEU A HG   2  
ATOM   8574   H HD11 . LEU A 1 8   ? -4.158  -17.441 4.172   0.04 16.02 ? 64   LEU A HD11 2  
ATOM   8575   H HD12 . LEU A 1 8   ? -4.953  -16.110 3.869   0.04 16.05 ? 64   LEU A HD12 2  
ATOM   8576   H HD13 . LEU A 1 8   ? -4.085  -16.225 5.196   0.04 15.56 ? 64   LEU A HD13 2  
ATOM   8577   H HD21 . LEU A 1 8   ? -4.828  -18.603 6.505   0.04 15.49 ? 64   LEU A HD21 2  
ATOM   8578   H HD22 . LEU A 1 8   ? -5.009  -17.198 7.213   0.04 15.14 ? 64   LEU A HD22 2  
ATOM   8579   H HD23 . LEU A 1 8   ? -6.227  -18.217 7.128   0.04 15.46 ? 64   LEU A HD23 2  
ATOM   8580   N N    . GLY A 1 9   ? -10.389 -15.771 5.813   0.04 16.43 ? 65   GLY A N    2  
ATOM   8581   C CA   . GLY A 1 9   ? -11.511 -14.881 6.078   0.04 16.52 ? 65   GLY A CA   2  
ATOM   8582   C C    . GLY A 1 9   ? -11.444 -13.603 5.251   0.04 16.49 ? 65   GLY A C    2  
ATOM   8583   O O    . GLY A 1 9   ? -10.472 -13.372 4.508   0.04 16.39 ? 65   GLY A O    2  
ATOM   8584   H H    . GLY A 1 9   ? -10.557 -16.404 5.259   0.04 16.69 ? 65   GLY A H    2  
ATOM   8585   H HA2  . GLY A 1 9   ? -12.349 -15.340 5.910   0.04 16.87 ? 65   GLY A HA2  2  
ATOM   8586   H HA3  . GLY A 1 9   ? -11.486 -14.629 7.016   0.04 16.30 ? 65   GLY A HA3  2  
ATOM   8587   N N    . PRO A 1 10  ? -12.450 -12.738 5.412   0.04 16.59 ? 66   PRO A N    2  
ATOM   8588   C CA   . PRO A 1 10  ? -12.722 -11.545 4.603   0.04 16.75 ? 66   PRO A CA   2  
ATOM   8589   C C    . PRO A 1 10  ? -11.773 -10.362 4.828   0.04 16.31 ? 66   PRO A C    2  
ATOM   8590   O O    . PRO A 1 10  ? -11.901 -9.404  4.080   0.04 16.41 ? 66   PRO A O    2  
ATOM   8591   C CB   . PRO A 1 10  ? -14.148 -11.167 5.017   0.04 17.12 ? 66   PRO A CB   2  
ATOM   8592   C CG   . PRO A 1 10  ? -14.239 -11.650 6.415   0.04 16.91 ? 66   PRO A CG   2  
ATOM   8593   C CD   . PRO A 1 10  ? -13.460 -12.917 6.478   0.04 16.63 ? 66   PRO A CD   2  
ATOM   8594   H HA   . PRO A 1 10  ? -12.725 -11.775 3.660   0.04 16.96 ? 66   PRO A HA   2  
ATOM   8595   H HB2  . PRO A 1 10  ? -14.257 -10.204 4.969   0.04 17.12 ? 66   PRO A HB2  2  
ATOM   8596   H HB3  . PRO A 1 10  ? -14.795 -11.615 4.453   0.04 17.49 ? 66   PRO A HB3  2  
ATOM   8597   H HG2  . PRO A 1 10  ? -13.857 -10.989 7.015   0.04 16.68 ? 66   PRO A HG2  2  
ATOM   8598   H HG3  . PRO A 1 10  ? -15.169 -11.822 6.640   0.04 17.22 ? 66   PRO A HG3  2  
ATOM   8599   H HD2  . PRO A 1 10  ? -13.035 -13.002 7.346   0.04 16.30 ? 66   PRO A HD2  2  
ATOM   8600   H HD3  . PRO A 1 10  ? -14.027 -13.677 6.282   0.04 16.86 ? 66   PRO A HD3  2  
ATOM   8601   N N    . ASN A 1 11  ? -10.839 -10.416 5.791   0.04 15.87 ? 67   ASN A N    2  
ATOM   8602   C CA   . ASN A 1 11  ? -9.870  -9.318  5.964   0.04 15.45 ? 67   ASN A CA   2  
ATOM   8603   C C    . ASN A 1 11  ? -8.548  -9.562  5.252   0.04 15.18 ? 67   ASN A C    2  
ATOM   8604   O O    . ASN A 1 11  ? -7.648  -8.714  5.264   0.04 14.85 ? 67   ASN A O    2  
ATOM   8605   C CB   . ASN A 1 11  ? -9.613  -9.026  7.443   0.04 15.17 ? 67   ASN A CB   2  
ATOM   8606   C CG   . ASN A 1 11  ? -10.763 -8.272  8.098   0.04 15.46 ? 67   ASN A CG   2  
ATOM   8607   O OD1  . ASN A 1 11  ? -11.621 -7.673  7.404   0.04 15.80 ? 67   ASN A OD1  2  
ATOM   8608   N ND2  . ASN A 1 11  ? -10.774 -8.258  9.439   0.04 15.35 ? 67   ASN A ND2  2  
ATOM   8609   H H    . ASN A 1 11  ? -10.743 -11.071 6.338   0.04 15.82 ? 67   ASN A H    2  
ATOM   8610   H HA   . ASN A 1 11  ? -10.238 -8.506  5.583   0.04 15.55 ? 67   ASN A HA   2  
ATOM   8611   H HB2  . ASN A 1 11  ? -9.499  -9.870  7.905   0.04 15.07 ? 67   ASN A HB2  2  
ATOM   8612   H HB3  . ASN A 1 11  ? -8.815  -8.487  7.527   0.04 14.93 ? 67   ASN A HB3  2  
ATOM   8613   H HD21 . ASN A 1 11  ? -11.029 -7.555  9.860   0.04 15.29 ? 67   ASN A HD21 2  
ATOM   8614   H HD22 . ASN A 1 11  ? -10.516 -8.947  9.881   0.04 15.34 ? 67   ASN A HD22 2  
ATOM   8615   N N    . VAL A 1 12  ? -8.417  -10.746 4.670   0.04 15.34 ? 68   VAL A N    2  
ATOM   8616   C CA   . VAL A 1 12  ? -7.284  -11.079 3.823   0.04 15.21 ? 68   VAL A CA   2  
ATOM   8617   C C    . VAL A 1 12  ? -7.848  -11.105 2.396   0.04 15.58 ? 68   VAL A C    2  
ATOM   8618   O O    . VAL A 1 12  ? -8.735  -11.895 2.042   0.04 15.98 ? 68   VAL A O    2  
ATOM   8619   C CB   . VAL A 1 12  ? -6.657  -12.425 4.168   0.04 15.20 ? 68   VAL A CB   2  
ATOM   8620   C CG1  . VAL A 1 12  ? -5.481  -12.708 3.232   0.04 15.06 ? 68   VAL A CG1  2  
ATOM   8621   C CG2  . VAL A 1 12  ? -6.197  -12.451 5.645   0.04 14.92 ? 68   VAL A CG2  2  
ATOM   8622   H H    . VAL A 1 12  ? -8.983  -11.388 4.750   0.04 15.56 ? 68   VAL A H    2  
ATOM   8623   H HA   . VAL A 1 12  ? -6.610  -10.389 3.874   0.04 14.94 ? 68   VAL A HA   2  
ATOM   8624   H HB   . VAL A 1 12  ? -7.310  -13.134 4.051   0.04 15.49 ? 68   VAL A HB   2  
ATOM   8625   H HG11 . VAL A 1 12  ? -5.280  -13.657 3.264   0.04 15.16 ? 68   VAL A HG11 2  
ATOM   8626   H HG12 . VAL A 1 12  ? -5.710  -12.452 2.327   0.04 15.20 ? 68   VAL A HG12 2  
ATOM   8627   H HG13 . VAL A 1 12  ? -4.719  -12.193 3.541   0.04 14.76 ? 68   VAL A HG13 2  
ATOM   8628   H HG21 . VAL A 1 12  ? -5.618  -13.214 5.792   0.04 14.87 ? 68   VAL A HG21 2  
ATOM   8629   H HG22 . VAL A 1 12  ? -5.733  -11.624 5.830   0.04 14.67 ? 68   VAL A HG22 2  
ATOM   8630   H HG23 . VAL A 1 12  ? -6.981  -12.516 6.214   0.04 15.09 ? 68   VAL A HG23 2  
ATOM   8631   N N    . LEU A 1 13  ? -7.369  -10.151 1.621   0.04 15.49 ? 69   LEU A N    2  
ATOM   8632   C CA   . LEU A 1 13  ? -7.773  -9.986  0.249   0.04 15.87 ? 69   LEU A CA   2  
ATOM   8633   C C    . LEU A 1 13  ? -6.655  -10.651 -0.577  0.04 15.81 ? 69   LEU A C    2  
ATOM   8634   O O    . LEU A 1 13  ? -5.503  -10.190 -0.601  0.04 15.48 ? 69   LEU A O    2  
ATOM   8635   C CB   . LEU A 1 13  ? -7.954  -8.486  -0.036  0.04 15.90 ? 69   LEU A CB   2  
ATOM   8636   C CG   . LEU A 1 13  ? -9.199  -7.860  0.647   0.04 16.34 ? 69   LEU A CG   2  
ATOM   8637   C CD1  . LEU A 1 13  ? -9.168  -7.630  2.153   0.04 16.21 ? 69   LEU A CD1  2  
ATOM   8638   C CD2  . LEU A 1 13  ? -9.547  -6.569  -0.011  0.04 16.48 ? 69   LEU A CD2  2  
ATOM   8639   H H    . LEU A 1 13  ? -6.790  -9.574  1.875   0.04 15.25 ? 69   LEU A H    2  
ATOM   8640   H HA   . LEU A 1 13  ? -8.610  -10.444 0.077   0.04 16.17 ? 69   LEU A HA   2  
ATOM   8641   H HB2  . LEU A 1 13  ? -7.172  -8.003  0.268   0.04 15.62 ? 69   LEU A HB2  2  
ATOM   8642   H HB3  . LEU A 1 13  ? -8.056  -8.375  -0.994  0.04 15.97 ? 69   LEU A HB3  2  
ATOM   8643   H HG   . LEU A 1 13  ? -9.948  -8.464  0.487   0.04 16.63 ? 69   LEU A HG   2  
ATOM   8644   H HD11 . LEU A 1 13  ? -9.804  -6.929  2.371   0.04 16.46 ? 69   LEU A HD11 2  
ATOM   8645   H HD12 . LEU A 1 13  ? -9.432  -8.449  2.605   0.04 16.22 ? 69   LEU A HD12 2  
ATOM   8646   H HD13 . LEU A 1 13  ? -8.278  -7.363  2.431   0.04 15.89 ? 69   LEU A HD13 2  
ATOM   8647   H HD21 . LEU A 1 13  ? -10.406 -6.274  0.336   0.04 16.74 ? 69   LEU A HD21 2  
ATOM   8648   H HD22 . LEU A 1 13  ? -8.871  -5.907  0.179   0.04 16.18 ? 69   LEU A HD22 2  
ATOM   8649   H HD23 . LEU A 1 13  ? -9.618  -6.714  -0.968  0.04 16.62 ? 69   LEU A HD23 2  
ATOM   8650   N N    . VAL A 1 14  ? -6.984  -11.784 -1.189  0.04 16.17 ? 70   VAL A N    2  
ATOM   8651   C CA   . VAL A 1 14  ? -6.061  -12.568 -1.986  0.04 16.17 ? 70   VAL A CA   2  
ATOM   8652   C C    . VAL A 1 14  ? -6.401  -12.396 -3.462  0.04 16.52 ? 70   VAL A C    2  
ATOM   8653   O O    . VAL A 1 14  ? -7.440  -12.858 -3.930  0.04 16.93 ? 70   VAL A O    2  
ATOM   8654   C CB   . VAL A 1 14  ? -6.118  -14.073 -1.633  0.04 16.35 ? 70   VAL A CB   2  
ATOM   8655   C CG1  . VAL A 1 14  ? -5.255  -14.860 -2.591  0.04 16.37 ? 70   VAL A CG1  2  
ATOM   8656   C CG2  . VAL A 1 14  ? -5.689  -14.342 -0.142  0.04 16.06 ? 70   VAL A CG2  2  
ATOM   8657   H H    . VAL A 1 14  ? -7.772  -12.132 -1.154  0.04 16.44 ? 70   VAL A H    2  
ATOM   8658   H HA   . VAL A 1 14  ? -5.159  -12.254 -1.840  0.04 15.86 ? 70   VAL A HA   2  
ATOM   8659   H HB   . VAL A 1 14  ? -7.034  -14.376 -1.736  0.04 16.68 ? 70   VAL A HB   2  
ATOM   8660   H HG11 . VAL A 1 14  ? -5.187  -15.775 -2.272  0.04 16.43 ? 70   VAL A HG11 2  
ATOM   8661   H HG12 . VAL A 1 14  ? -5.661  -14.855 -3.474  0.04 16.66 ? 70   VAL A HG12 2  
ATOM   8662   H HG13 . VAL A 1 14  ? -4.371  -14.459 -2.625  0.04 16.08 ? 70   VAL A HG13 2  
ATOM   8663   H HG21 . VAL A 1 14  ? -5.672  -15.298 0.016   0.04 16.17 ? 70   VAL A HG21 2  
ATOM   8664   H HG22 . VAL A 1 14  ? -4.808  -13.966 0.010   0.04 15.73 ? 70   VAL A HG22 2  
ATOM   8665   H HG23 . VAL A 1 14  ? -6.332  -13.922 0.452   0.04 16.11 ? 70   VAL A HG23 2  
ATOM   8666   N N    . PHE A 1 15  ? -5.473  -11.759 -4.175  0.04 16.40 ? 71   PHE A N    2  
ATOM   8667   C CA   . PHE A 1 15  ? -5.584  -11.452 -5.601  0.04 16.70 ? 71   PHE A CA   2  
ATOM   8668   C C    . PHE A 1 15  ? -4.816  -12.494 -6.394  0.04 16.81 ? 71   PHE A C    2  
ATOM   8669   O O    . PHE A 1 15  ? -3.746  -12.946 -5.993  0.04 16.51 ? 71   PHE A O    2  
ATOM   8670   C CB   . PHE A 1 15  ? -5.022  -10.048 -5.899  0.04 16.45 ? 71   PHE A CB   2  
ATOM   8671   C CG   . PHE A 1 15  ? -5.692  -8.957  -5.127  0.04 16.33 ? 71   PHE A CG   2  
ATOM   8672   C CD1  . PHE A 1 15  ? -6.948  -8.483  -5.474  0.04 16.71 ? 71   PHE A CD1  2  
ATOM   8673   C CD2  . PHE A 1 15  ? -5.078  -8.421  -4.026  0.04 15.87 ? 71   PHE A CD2  2  
ATOM   8674   C CE1  . PHE A 1 15  ? -7.548  -7.488  -4.730  0.04 16.63 ? 71   PHE A CE1  2  
ATOM   8675   C CE2  . PHE A 1 15  ? -5.667  -7.423  -3.295  0.04 15.78 ? 71   PHE A CE2  2  
ATOM   8676   C CZ   . PHE A 1 15  ? -6.892  -6.969  -3.632  0.04 16.15 ? 71   PHE A CZ   2  
ATOM   8677   H H    . PHE A 1 15  ? -4.738  -11.477 -3.836  0.04 16.17 ? 71   PHE A H    2  
ATOM   8678   H HA   . PHE A 1 15  ? -6.513  -11.474 -5.874  0.04 17.02 ? 71   PHE A HA   2  
ATOM   8679   H HB2  . PHE A 1 15  ? -4.079  -10.031 -5.669  0.04 16.17 ? 71   PHE A HB2  2  
ATOM   8680   H HB3  . PHE A 1 15  ? -5.130  -9.857  -6.846  0.04 16.70 ? 71   PHE A HB3  2  
ATOM   8681   H HD1  . PHE A 1 15  ? -7.392  -8.834  -6.210  0.04 17.04 ? 71   PHE A HD1  2  
ATOM   8682   H HD2  . PHE A 1 15  ? -4.232  -8.728  -3.780  0.04 15.64 ? 71   PHE A HD2  2  
ATOM   8683   H HE1  . PHE A 1 15  ? -8.384  -7.172  -4.967  0.04 16.91 ? 71   PHE A HE1  2  
ATOM   8684   H HE2  . PHE A 1 15  ? -5.229  -7.075  -2.551  0.04 15.49 ? 71   PHE A HE2  2  
ATOM   8685   H HZ   . PHE A 1 15  ? -7.283  -6.294  -3.127  0.04 16.11 ? 71   PHE A HZ   2  
ATOM   8686   N N    . ASP A 1 16  ? -5.351  -12.888 -7.546  0.04 17.28 ? 72   ASP A N    2  
ATOM   8687   C CA   . ASP A 1 16  ? -4.553  -13.682 -8.442  0.04 17.42 ? 72   ASP A CA   2  
ATOM   8688   C C    . ASP A 1 16  ? -4.573  -13.000 -9.794  0.04 17.66 ? 72   ASP A C    2  
ATOM   8689   O O    . ASP A 1 16  ? -5.235  -11.981 -9.970  0.04 17.77 ? 72   ASP A O    2  
ATOM   8690   C CB   . ASP A 1 16  ? -4.885  -15.193 -8.338  0.04 17.84 ? 72   ASP A CB   2  
ATOM   8691   C CG   . ASP A 1 16  ? -5.744  -15.736 -9.452  0.04 18.30 ? 72   ASP A CG   2  
ATOM   8692   O OD1  . ASP A 1 16  ? -6.421  -16.742 -9.230  0.04 18.32 ? 72   ASP A OD1  2  
ATOM   8693   O OD2  . ASP A 1 16  ? -5.773  -15.207 -10.539 0.04 18.65 ? 72   ASP A OD2  2  
ATOM   8694   H H    . ASP A 1 16  ? -6.142  -12.703 -7.819  0.04 17.55 ? 72   ASP A H    2  
ATOM   8695   H HA   . ASP A 1 16  ? -3.633  -13.608 -8.151  0.04 17.13 ? 72   ASP A HA   2  
ATOM   8696   H HB2  . ASP A 1 16  ? -4.054  -15.693 -8.342  0.04 18.00 ? 72   ASP A HB2  2  
ATOM   8697   H HB3  . ASP A 1 16  ? -5.353  -15.351 -7.506  0.04 17.68 ? 72   ASP A HB3  2  
ATOM   8698   N N    . PRO A 1 17  ? -3.750  -13.490 -10.715 0.04 17.78 ? 73   PRO A N    2  
ATOM   8699   C CA   . PRO A 1 17  ? -3.588  -12.653 -11.885 0.04 18.06 ? 73   PRO A CA   2  
ATOM   8700   C C    . PRO A 1 17  ? -4.833  -12.677 -12.779 0.04 18.62 ? 73   PRO A C    2  
ATOM   8701   O O    . PRO A 1 17  ? -5.073  -11.745 -13.552 0.04 18.88 ? 73   PRO A O    2  
ATOM   8702   C CB   . PRO A 1 17  ? -2.335  -13.252 -12.534 0.04 18.16 ? 73   PRO A CB   2  
ATOM   8703   C CG   . PRO A 1 17  ? -1.543  -13.793 -11.348 0.04 17.73 ? 73   PRO A CG   2  
ATOM   8704   C CD   . PRO A 1 17  ? -2.582  -14.369 -10.487 0.04 17.67 ? 73   PRO A CD   2  
ATOM   8705   H HA   . PRO A 1 17  ? -3.400  -11.740 -11.617 0.04 17.83 ? 73   PRO A HA   2  
ATOM   8706   H HB2  . PRO A 1 17  ? -2.587  -13.971 -13.135 0.04 18.52 ? 73   PRO A HB2  2  
ATOM   8707   H HB3  . PRO A 1 17  ? -1.829  -12.568 -13.001 0.04 18.14 ? 73   PRO A HB3  2  
ATOM   8708   H HG2  . PRO A 1 17  ? -0.926  -14.480 -11.650 0.04 17.87 ? 73   PRO A HG2  2  
ATOM   8709   H HG3  . PRO A 1 17  ? -1.071  -13.076 -10.898 0.04 17.41 ? 73   PRO A HG3  2  
ATOM   8710   H HD2  . PRO A 1 17  ? -2.777  -15.275 -10.769 0.04 17.95 ? 73   PRO A HD2  2  
ATOM   8711   H HD3  . PRO A 1 17  ? -2.289  -14.340 -9.565  0.04 17.33 ? 73   PRO A HD3  2  
ATOM   8712   N N    . SER A 1 18  ? -5.680  -13.689 -12.614 0.04 18.81 ? 74   SER A N    2  
ATOM   8713   C CA   . SER A 1 18  ? -6.913  -13.709 -13.381 0.04 19.36 ? 74   SER A CA   2  
ATOM   8714   C C    . SER A 1 18  ? -7.830  -12.616 -12.870 0.04 19.36 ? 74   SER A C    2  
ATOM   8715   O O    . SER A 1 18  ? -8.301  -11.749 -13.655 0.04 19.85 ? 74   SER A O    2  
ATOM   8716   C CB   . SER A 1 18  ? -7.569  -15.079 -13.315 0.04 19.84 ? 74   SER A CB   2  
ATOM   8717   O OG   . SER A 1 18  ? -7.847  -15.474 -11.974 0.04 19.87 ? 74   SER A OG   2  
ATOM   8718   H H    . SER A 1 18  ? -5.565  -14.358 -12.085 0.04 18.67 ? 74   SER A H    2  
ATOM   8719   H HA   . SER A 1 18  ? -6.709  -13.515 -14.312 0.04 19.53 ? 74   SER A HA   2  
ATOM   8720   H HB2  . SER A 1 18  ? -8.396  -15.049 -13.823 0.04 20.25 ? 74   SER A HB2  2  
ATOM   8721   H HB3  . SER A 1 18  ? -6.955  -15.710 -13.723 0.04 19.76 ? 74   SER A HB3  2  
ATOM   8722   H HG   . SER A 1 18  ? -7.137  -15.484 -11.531 0.04 19.51 ? 74   SER A HG   2  
ATOM   8723   N N    . THR A 1 19  ? -7.981  -12.621 -11.538 0.04 18.85 ? 75   THR A N    2  
ATOM   8724   C CA   . THR A 1 19  ? -8.876  -11.753 -10.774 0.04 18.83 ? 75   THR A CA   2  
ATOM   8725   C C    . THR A 1 19  ? -9.110  -10.395 -11.407 0.04 19.11 ? 75   THR A C    2  
ATOM   8726   O O    . THR A 1 19  ? -8.129  -9.686  -11.662 0.04 19.10 ? 75   THR A O    2  
ATOM   8727   C CB   . THR A 1 19  ? -8.279  -11.473 -9.367  0.04 18.19 ? 75   THR A CB   2  
ATOM   8728   O OG1  . THR A 1 19  ? -7.815  -12.710 -8.794  0.04 17.99 ? 75   THR A OG1  2  
ATOM   8729   C CG2  . THR A 1 19  ? -9.331  -10.795 -8.476  0.04 18.16 ? 75   THR A CG2  2  
ATOM   8730   H H    . THR A 1 19  ? -7.526  -13.140 -11.025 0.04 18.54 ? 75   THR A H    2  
ATOM   8731   H HA   . THR A 1 19  ? -9.726  -12.206 -10.662 0.04 19.06 ? 75   THR A HA   2  
ATOM   8732   H HB   . THR A 1 19  ? -7.525  -10.868 -9.452  0.04 17.96 ? 75   THR A HB   2  
ATOM   8733   H HG1  . THR A 1 19  ? -8.105  -12.799 -8.011  0.04 18.25 ? 75   THR A HG1  2  
ATOM   8734   H HG21 . THR A 1 19  ? -8.996  -10.696 -7.570  0.04 17.78 ? 75   THR A HG21 2  
ATOM   8735   H HG22 . THR A 1 19  ? -9.538  -9.912  -8.820  0.04 18.28 ? 75   THR A HG22 2  
ATOM   8736   H HG23 . THR A 1 19  ? -10.140 -11.319 -8.460  0.04 18.42 ? 75   THR A HG23 2  
ATOM   8737   N N    . PRO A 1 20  ? -10.395 -10.015 -11.647 0.04 19.39 ? 76   PRO A N    2  
ATOM   8738   C CA   . PRO A 1 20  ? -10.633 -8.679  -12.187 0.04 19.73 ? 76   PRO A CA   2  
ATOM   8739   C C    . PRO A 1 20  ? -10.330 -7.543  -11.190 0.04 19.40 ? 76   PRO A C    2  
ATOM   8740   O O    . PRO A 1 20  ? -10.322 -7.777  -9.976  0.04 19.14 ? 76   PRO A O    2  
ATOM   8741   C CB   . PRO A 1 20  ? -12.150 -8.687  -12.382 0.04 20.34 ? 76   PRO A CB   2  
ATOM   8742   C CG   . PRO A 1 20  ? -12.622 -9.352  -11.111 0.04 20.14 ? 76   PRO A CG   2  
ATOM   8743   C CD   . PRO A 1 20  ? -11.603 -10.514 -10.956 0.04 19.63 ? 76   PRO A CD   2  
ATOM   8744   H HA   . PRO A 1 20  ? -10.162 -8.538  -13.022 0.04 19.89 ? 76   PRO A HA   2  
ATOM   8745   H HB2  . PRO A 1 20  ? -12.489 -7.779  -12.447 0.04 20.48 ? 76   PRO A HB2  2  
ATOM   8746   H HB3  . PRO A 1 20  ? -12.384 -9.213  -13.162 0.04 20.70 ? 76   PRO A HB3  2  
ATOM   8747   H HG2  . PRO A 1 20  ? -12.569 -8.736  -10.360 0.04 20.02 ? 76   PRO A HG2  2  
ATOM   8748   H HG3  . PRO A 1 20  ? -13.529 -9.682  -11.225 0.04 20.54 ? 76   PRO A HG3  2  
ATOM   8749   H HD2  . PRO A 1 20  ? -11.424 -10.653 -10.014 0.04 19.32 ? 76   PRO A HD2  2  
ATOM   8750   H HD3  . PRO A 1 20  ? -11.937 -11.323 -11.374 0.04 19.84 ? 76   PRO A HD3  2  
ATOM   8751   N N    . ASP A 1 21  ? -10.099 -6.332  -11.714 0.04 19.47 ? 77   ASP A N    2  
ATOM   8752   C CA   . ASP A 1 21  ? -10.296 -5.080  -10.966 0.04 19.30 ? 77   ASP A CA   2  
ATOM   8753   C C    . ASP A 1 21  ? -9.510  -4.981  -9.654  0.04 18.61 ? 77   ASP A C    2  
ATOM   8754   O O    . ASP A 1 21  ? -10.071 -4.978  -8.556  0.04 18.43 ? 77   ASP A O    2  
ATOM   8755   C CB   . ASP A 1 21  ? -11.789 -4.856  -10.721 0.04 19.71 ? 77   ASP A CB   2  
ATOM   8756   C CG   . ASP A 1 21  ? -12.073 -3.632  -9.868  0.04 19.65 ? 77   ASP A CG   2  
ATOM   8757   O OD1  . ASP A 1 21  ? -11.377 -2.607  -10.010 0.04 19.39 ? 77   ASP A OD1  2  
ATOM   8758   O OD2  . ASP A 1 21  ? -13.024 -3.717  -9.057  0.04 19.92 ? 77   ASP A OD2  2  
ATOM   8759   H H    . ASP A 1 21  ? -9.815  -6.207  -12.518 0.04 19.63 ? 77   ASP A H    2  
ATOM   8760   H HA   . ASP A 1 21  ? -9.985  -4.351  -11.527 0.04 19.42 ? 77   ASP A HA   2  
ATOM   8761   H HB2  . ASP A 1 21  ? -12.234 -4.738  -11.575 0.04 20.16 ? 77   ASP A HB2  2  
ATOM   8762   H HB3  . ASP A 1 21  ? -12.149 -5.627  -10.254 0.04 19.60 ? 77   ASP A HB3  2  
ATOM   8763   N N    . ILE A 1 22  ? -8.197  -4.884  -9.784  0.04 18.26 ? 78   ILE A N    2  
ATOM   8764   C CA   . ILE A 1 22  ? -7.306  -4.896  -8.628  0.04 17.63 ? 78   ILE A CA   2  
ATOM   8765   C C    . ILE A 1 22  ? -7.101  -3.466  -8.111  0.04 17.41 ? 78   ILE A C    2  
ATOM   8766   O O    . ILE A 1 22  ? -7.383  -3.142  -6.956  0.04 17.05 ? 78   ILE A O    2  
ATOM   8767   C CB   . ILE A 1 22  ? -5.970  -5.572  -9.048  0.04 17.38 ? 78   ILE A CB   2  
ATOM   8768   C CG1  . ILE A 1 22  ? -6.306  -6.808  -9.933  0.04 17.67 ? 78   ILE A CG1  2  
ATOM   8769   C CG2  . ILE A 1 22  ? -5.137  -5.906  -7.833  0.04 16.80 ? 78   ILE A CG2  2  
ATOM   8770   C CD1  . ILE A 1 22  ? -5.342  -7.990  -9.806  0.04 17.55 ? 78   ILE A CD1  2  
ATOM   8771   H H    . ILE A 1 22  ? -7.790  -4.800  -10.535 0.04 18.39 ? 78   ILE A H    2  
ATOM   8772   H HA   . ILE A 1 22  ? -7.697  -5.423  -7.915  0.04 17.55 ? 78   ILE A HA   2  
ATOM   8773   H HB   . ILE A 1 22  ? -5.470  -4.939  -9.586  0.04 17.45 ? 78   ILE A HB   2  
ATOM   8774   H HG12 . ILE A 1 22  ? -7.184  -7.146  -9.701  0.04 17.59 ? 78   ILE A HG12 2  
ATOM   8775   H HG13 . ILE A 1 22  ? -6.307  -6.531  -10.859 0.04 18.07 ? 78   ILE A HG13 2  
ATOM   8776   H HG21 . ILE A 1 22  ? -4.266  -6.228  -8.110  0.04 16.67 ? 78   ILE A HG21 2  
ATOM   8777   H HG22 . ILE A 1 22  ? -5.030  -5.097  -7.311  0.04 16.64 ? 78   ILE A HG22 2  
ATOM   8778   H HG23 . ILE A 1 22  ? -5.597  -6.584  -7.312  0.04 16.75 ? 78   ILE A HG23 2  
ATOM   8779   H HD11 . ILE A 1 22  ? -5.510  -8.612  -10.530 0.04 17.81 ? 78   ILE A HD11 2  
ATOM   8780   H HD12 . ILE A 1 22  ? -4.433  -7.662  -9.859  0.04 17.59 ? 78   ILE A HD12 2  
ATOM   8781   H HD13 . ILE A 1 22  ? -5.491  -8.435  -8.958  0.04 17.19 ? 78   ILE A HD13 2  
ATOM   8782   N N    . GLN A 1 23  ? -6.612  -2.622  -9.014  0.04 17.68 ? 79   GLN A N    2  
ATOM   8783   C CA   . GLN A 1 23  ? -6.464  -1.182  -8.813  0.04 17.53 ? 79   GLN A CA   2  
ATOM   8784   C C    . GLN A 1 23  ? -7.620  -0.584  -8.009  0.04 17.66 ? 79   GLN A C    2  
ATOM   8785   O O    . GLN A 1 23  ? -7.422  0.054   -6.963  0.04 17.34 ? 79   GLN A O    2  
ATOM   8786   C CB   . GLN A 1 23  ? -6.406  -0.567  -10.221 0.04 17.85 ? 79   GLN A CB   2  
ATOM   8787   C CG   . GLN A 1 23  ? -5.944  0.897   -10.391 0.04 17.94 ? 79   GLN A CG   2  
ATOM   8788   C CD   . GLN A 1 23  ? -4.409  1.022   -10.406 0.04 17.63 ? 79   GLN A CD   2  
ATOM   8789   O OE1  . GLN A 1 23  ? -3.752  1.365   -11.434 0.04 17.83 ? 79   GLN A OE1  2  
ATOM   8790   N NE2  . GLN A 1 23  ? -3.860  0.788   -9.272  0.04 17.15 ? 79   GLN A NE2  2  
ATOM   8791   H H    . GLN A 1 23  ? -6.347  -2.878  -9.789  0.04 17.98 ? 79   GLN A H    2  
ATOM   8792   H HA   . GLN A 1 23  ? -5.640  -0.991  -8.347  0.04 17.14 ? 79   GLN A HA   2  
ATOM   8793   H HB2  . GLN A 1 23  ? -5.796  -1.111  -10.742 0.04 17.68 ? 79   GLN A HB2  2  
ATOM   8794   H HB3  . GLN A 1 23  ? -7.298  -0.628  -10.599 0.04 18.24 ? 79   GLN A HB3  2  
ATOM   8795   H HG2  . GLN A 1 23  ? -6.280  1.247   -11.228 0.04 18.36 ? 79   GLN A HG2  2  
ATOM   8796   H HG3  . GLN A 1 23  ? -6.277  1.420   -9.644  0.04 17.82 ? 79   GLN A HG3  2  
ATOM   8797   H HE21 . GLN A 1 23  ? -4.297  0.326   -8.692  0.04 17.04 ? 79   GLN A HE21 2  
ATOM   8798   H HE22 . GLN A 1 23  ? -3.154  1.193   -9.036  0.04 16.95 ? 79   GLN A HE22 2  
ATOM   8799   N N    . GLY A 1 24  ? -8.832  -0.778  -8.499  0.04 18.16 ? 80   GLY A N    2  
ATOM   8800   C CA   . GLY A 1 24  ? -9.989  -0.264  -7.784  0.04 18.34 ? 80   GLY A CA   2  
ATOM   8801   C C    . GLY A 1 24  ? -9.924  -0.633  -6.315  0.04 17.95 ? 80   GLY A C    2  
ATOM   8802   O O    . GLY A 1 24  ? -10.166 0.202   -5.418  0.04 17.86 ? 80   GLY A O    2  
ATOM   8803   H H    . GLY A 1 24  ? -9.009  -1.197  -9.228  0.04 18.42 ? 80   GLY A H    2  
ATOM   8804   H HA2  . GLY A 1 24  ? -10.033 0.700   -7.868  0.04 18.35 ? 80   GLY A HA2  2  
ATOM   8805   H HA3  . GLY A 1 24  ? -10.801 -0.645  -8.154  0.04 18.75 ? 80   GLY A HA3  2  
ATOM   8806   N N    . LYS A 1 25  ? -9.581  -1.895  -6.071  0.04 17.79 ? 81   LYS A N    2  
ATOM   8807   C CA   . LYS A 1 25  ? -9.940  -2.557  -4.819  0.04 17.42 ? 81   LYS A CA   2  
ATOM   8808   C C    . LYS A 1 25  ? -9.010  -2.071  -3.715  0.04 16.87 ? 81   LYS A C    2  
ATOM   8809   O O    . LYS A 1 25  ? -9.431  -1.773  -2.601  0.04 16.73 ? 81   LYS A O    2  
ATOM   8810   C CB   . LYS A 1 25  ? -9.800  -4.063  -4.961  0.04 17.39 ? 81   LYS A CB   2  
ATOM   8811   C CG   . LYS A 1 25  ? -11.006 -4.766  -5.365  0.04 17.97 ? 81   LYS A CG   2  
ATOM   8812   C CD   . LYS A 1 25  ? -10.695 -6.246  -5.353  0.04 18.11 ? 81   LYS A CD   2  
ATOM   8813   C CE   . LYS A 1 25  ? -11.784 -7.035  -6.013  0.04 18.65 ? 81   LYS A CE   2  
ATOM   8814   N NZ   . LYS A 1 25  ? -11.216 -8.055  -6.940  0.04 18.93 ? 81   LYS A NZ   2  
ATOM   8815   H H    . LYS A 1 25  ? -9.127  -2.388  -6.608  0.04 17.92 ? 81   LYS A H    2  
ATOM   8816   H HA   . LYS A 1 25  ? -10.854 -2.347  -4.577  0.04 17.61 ? 81   LYS A HA   2  
ATOM   8817   H HB2  . LYS A 1 25  ? -9.115  -4.262  -5.615  0.04 17.30 ? 81   LYS A HB2  2  
ATOM   8818   H HB3  . LYS A 1 25  ? -9.542  -4.427  -4.100  0.04 17.12 ? 81   LYS A HB3  2  
ATOM   8819   H HG2  . LYS A 1 25  ? -11.722 -4.581  -4.736  0.04 18.00 ? 81   LYS A HG2  2  
ATOM   8820   H HG3  . LYS A 1 25  ? -11.260 -4.497  -6.263  0.04 18.29 ? 81   LYS A HG3  2  
ATOM   8821   H HD2  . LYS A 1 25  ? -9.882  -6.399  -5.858  0.04 18.21 ? 81   LYS A HD2  2  
ATOM   8822   H HD3  . LYS A 1 25  ? -10.594 -6.558  -4.441  0.04 17.78 ? 81   LYS A HD3  2  
ATOM   8823   H HE2  . LYS A 1 25  ? -12.323 -7.487  -5.345  0.04 18.55 ? 81   LYS A HE2  2  
ATOM   8824   H HE3  . LYS A 1 25  ? -12.335 -6.429  -6.536  0.04 18.98 ? 81   LYS A HE3  2  
ATOM   8825   H HZ1  . LYS A 1 25  ? -11.873 -8.564  -7.258  0.04 19.08 ? 81   LYS A HZ1  2  
ATOM   8826   H HZ2  . LYS A 1 25  ? -10.810 -7.652  -7.622  0.04 19.25 ? 81   LYS A HZ2  2  
ATOM   8827   H HZ3  . LYS A 1 25  ? -10.634 -8.573  -6.512  0.04 18.67 ? 81   LYS A HZ3  2  
ATOM   8828   N N    . VAL A 1 26  ? -7.713  -2.051  -4.020  0.04 16.58 ? 82   VAL A N    2  
ATOM   8829   C CA   . VAL A 1 26  ? -6.787  -1.379  -3.164  0.04 16.08 ? 82   VAL A CA   2  
ATOM   8830   C C    . VAL A 1 26  ? -7.148  0.090   -3.072  0.04 16.13 ? 82   VAL A C    2  
ATOM   8831   O O    . VAL A 1 26  ? -6.862  0.724   -2.080  0.04 15.80 ? 82   VAL A O    2  
ATOM   8832   C CB   . VAL A 1 26  ? -5.341  -1.540  -3.669  0.04 15.82 ? 82   VAL A CB   2  
ATOM   8833   C CG1  . VAL A 1 26  ? -4.241  -0.968  -2.626  0.04 15.43 ? 82   VAL A CG1  2  
ATOM   8834   C CG2  . VAL A 1 26  ? -5.105  -2.969  -3.969  0.04 15.69 ? 82   VAL A CG2  2  
ATOM   8835   H H    . VAL A 1 26  ? -7.375  -2.416  -4.718  0.04 16.68 ? 82   VAL A H    2  
ATOM   8836   H HA   . VAL A 1 26  ? -6.838  -1.746  -2.267  0.04 15.90 ? 82   VAL A HA   2  
ATOM   8837   H HB   . VAL A 1 26  ? -5.240  -1.057  -4.508  0.04 16.06 ? 82   VAL A HB   2  
ATOM   8838   H HG11 . VAL A 1 26  ? -3.378  -0.916  -3.067  0.04 15.32 ? 82   VAL A HG11 2  
ATOM   8839   H HG12 . VAL A 1 26  ? -4.508  -0.079  -2.353  0.04 15.55 ? 82   VAL A HG12 2  
ATOM   8840   H HG13 . VAL A 1 26  ? -4.174  -1.566  -1.866  0.04 15.18 ? 82   VAL A HG13 2  
ATOM   8841   H HG21 . VAL A 1 26  ? -4.154  -3.097  -4.126  0.04 15.42 ? 82   VAL A HG21 2  
ATOM   8842   H HG22 . VAL A 1 26  ? -5.392  -3.503  -3.212  0.04 15.63 ? 82   VAL A HG22 2  
ATOM   8843   H HG23 . VAL A 1 26  ? -5.598  -3.227  -4.761  0.04 15.96 ? 82   VAL A HG23 2  
ATOM   8844   N N    . ASP A 1 27  ? -7.703  0.669   -4.129  0.04 16.58 ? 83   ASP A N    2  
ATOM   8845   C CA   . ASP A 1 27  ? -8.079  2.069   -4.054  0.04 16.70 ? 83   ASP A CA   2  
ATOM   8846   C C    . ASP A 1 27  ? -9.209  2.241   -3.043  0.04 16.82 ? 83   ASP A C    2  
ATOM   8847   O O    . ASP A 1 27  ? -9.296  3.255   -2.373  0.04 16.69 ? 83   ASP A O    2  
ATOM   8848   C CB   . ASP A 1 27  ? -8.490  2.645   -5.434  0.04 17.19 ? 83   ASP A CB   2  
ATOM   8849   C CG   . ASP A 1 27  ? -7.312  3.182   -6.240  0.04 17.07 ? 83   ASP A CG   2  
ATOM   8850   O OD1  . ASP A 1 27  ? -6.155  3.186   -5.716  0.04 16.59 ? 83   ASP A OD1  2  
ATOM   8851   O OD2  . ASP A 1 27  ? -7.575  3.647   -7.393  0.04 17.50 ? 83   ASP A OD2  2  
ATOM   8852   H H    . ASP A 1 27  ? -7.876  0.283   -4.877  0.04 16.85 ? 83   ASP A H    2  
ATOM   8853   H HA   . ASP A 1 27  ? -7.322  2.573   -3.723  0.04 16.40 ? 83   ASP A HA   2  
ATOM   8854   H HB2  . ASP A 1 27  ? -8.898  1.963   -5.979  0.04 17.50 ? 83   ASP A HB2  2  
ATOM   8855   H HB3  . ASP A 1 27  ? -9.117  3.374   -5.304  0.04 17.30 ? 83   ASP A HB3  2  
ATOM   8856   N N    . GLU A 1 28  ? -10.052 1.239   -2.904  0.04 17.06 ? 84   GLU A N    2  
ATOM   8857   C CA   . GLU A 1 28  ? -11.173 1.396   -1.994  0.04 17.18 ? 84   GLU A CA   2  
ATOM   8858   C C    . GLU A 1 28  ? -10.741 1.020   -0.586  0.04 16.66 ? 84   GLU A C    2  
ATOM   8859   O O    . GLU A 1 28  ? -11.201 1.615   0.371   0.04 16.61 ? 84   GLU A O    2  
ATOM   8860   C CB   . GLU A 1 28  ? -12.251 0.493   -2.491  0.04 17.55 ? 84   GLU A CB   2  
ATOM   8861   C CG   . GLU A 1 28  ? -13.442 0.155   -1.610  0.04 17.30 ? 84   GLU A CG   2  
ATOM   8862   C CD   . GLU A 1 28  ? -13.916 -1.192  -2.062  0.04 17.55 ? 84   GLU A CD   2  
ATOM   8863   O OE1  . GLU A 1 28  ? -13.344 -1.634  -3.102  0.04 17.21 ? 84   GLU A OE1  2  
ATOM   8864   O OE2  . GLU A 1 28  ? -14.791 -1.799  -1.415  0.04 18.09 ? 84   GLU A OE2  2  
ATOM   8865   H H    . GLU A 1 28  ? -10.000 0.476   -3.293  0.04 17.18 ? 84   GLU A H    2  
ATOM   8866   H HA   . GLU A 1 28  ? -11.493 2.312   -1.996  0.04 17.40 ? 84   GLU A HA   2  
ATOM   8867   H HB2  . GLU A 1 28  ? -12.589 0.832   -3.337  0.04 17.87 ? 84   GLU A HB2  2  
ATOM   8868   H HB3  . GLU A 1 28  ? -11.755 -0.321  -2.643  0.04 17.72 ? 84   GLU A HB3  2  
ATOM   8869   H HG2  . GLU A 1 28  ? -13.208 0.117   -0.672  0.04 16.91 ? 84   GLU A HG2  2  
ATOM   8870   H HG3  . GLU A 1 28  ? -14.147 0.801   -1.768  0.04 17.44 ? 84   GLU A HG3  2  
ATOM   8871   N N    . VAL A 1 29  ? -9.867  0.022   -0.460  0.04 16.30 ? 85   VAL A N    2  
ATOM   8872   C CA   . VAL A 1 29  ? -9.195  -0.180  0.825   0.04 15.82 ? 85   VAL A CA   2  
ATOM   8873   C C    . VAL A 1 29  ? -8.490  1.135   1.185   0.04 15.59 ? 85   VAL A C    2  
ATOM   8874   O O    . VAL A 1 29  ? -8.648  1.672   2.279   0.04 15.48 ? 85   VAL A O    2  
ATOM   8875   C CB   . VAL A 1 29  ? -8.179  -1.363  0.813   0.04 15.52 ? 85   VAL A CB   2  
ATOM   8876   C CG1  . VAL A 1 29  ? -7.430  -1.450  2.134   0.04 15.05 ? 85   VAL A CG1  2  
ATOM   8877   C CG2  . VAL A 1 29  ? -8.878  -2.675  0.554   0.04 15.79 ? 85   VAL A CG2  2  
ATOM   8878   H H    . VAL A 1 29  ? -9.662  -0.537  -1.076  0.04 16.34 ? 85   VAL A H    2  
ATOM   8879   H HA   . VAL A 1 29  ? -9.857  -0.371  1.505   0.04 15.90 ? 85   VAL A HA   2  
ATOM   8880   H HB   . VAL A 1 29  ? -7.526  -1.219  0.111   0.04 15.50 ? 85   VAL A HB   2  
ATOM   8881   H HG11 . VAL A 1 29  ? -7.638  -2.289  2.567   0.04 15.01 ? 85   VAL A HG11 2  
ATOM   8882   H HG12 . VAL A 1 29  ? -6.474  -1.409  1.959   0.04 14.83 ? 85   VAL A HG12 2  
ATOM   8883   H HG13 . VAL A 1 29  ? -7.689  -0.719  2.712   0.04 15.03 ? 85   VAL A HG13 2  
ATOM   8884   H HG21 . VAL A 1 29  ? -8.221  -3.347  0.314   0.04 15.64 ? 85   VAL A HG21 2  
ATOM   8885   H HG22 . VAL A 1 29  ? -9.352  -2.946  1.357   0.04 15.79 ? 85   VAL A HG22 2  
ATOM   8886   H HG23 . VAL A 1 29  ? -9.508  -2.554  -0.175  0.04 16.12 ? 85   VAL A HG23 2  
ATOM   8887   N N    . PHE A 1 30  ? -7.682  1.655   0.259   0.04 15.55 ? 86   PHE A N    2  
ATOM   8888   C CA   . PHE A 1 30  ? -6.919  2.866   0.534   0.04 15.37 ? 86   PHE A CA   2  
ATOM   8889   C C    . PHE A 1 30  ? -7.852  3.973   0.975   0.04 15.65 ? 86   PHE A C    2  
ATOM   8890   O O    . PHE A 1 30  ? -7.546  4.684   1.928   0.04 15.47 ? 86   PHE A O    2  
ATOM   8891   C CB   . PHE A 1 30  ? -6.040  3.324   -0.663  0.04 15.42 ? 86   PHE A CB   2  
ATOM   8892   C CG   . PHE A 1 30  ? -5.338  4.648   -0.432  0.04 15.23 ? 86   PHE A CG   2  
ATOM   8893   C CD1  . PHE A 1 30  ? -4.358  4.767   0.521   0.04 14.78 ? 86   PHE A CD1  2  
ATOM   8894   C CD2  . PHE A 1 30  ? -5.695  5.782   -1.142  0.04 15.54 ? 86   PHE A CD2  2  
ATOM   8895   C CE1  . PHE A 1 30  ? -3.706  5.986   0.743   0.04 14.62 ? 86   PHE A CE1  2  
ATOM   8896   C CE2  . PHE A 1 30  ? -5.070  6.983   -0.928  0.04 15.39 ? 86   PHE A CE2  2  
ATOM   8897   C CZ   . PHE A 1 30  ? -4.071  7.093   0.029   0.04 14.92 ? 86   PHE A CZ   2  
ATOM   8898   H H    . PHE A 1 30  ? -7.573  1.329   -0.525  0.04 15.65 ? 86   PHE A H    2  
ATOM   8899   H HA   . PHE A 1 30  ? -6.331  2.683   1.284   0.04 15.06 ? 86   PHE A HA   2  
ATOM   8900   H HB2  . PHE A 1 30  ? -5.355  2.659   -0.829  0.04 15.27 ? 86   PHE A HB2  2  
ATOM   8901   H HB3  . PHE A 1 30  ? -6.601  3.413   -1.450  0.04 15.76 ? 86   PHE A HB3  2  
ATOM   8902   H HD1  . PHE A 1 30  ? -4.107  4.016   1.009   0.04 14.60 ? 86   PHE A HD1  2  
ATOM   8903   H HD2  . PHE A 1 30  ? -6.357  5.723   -1.787  0.04 15.87 ? 86   PHE A HD2  2  
ATOM   8904   H HE1  . PHE A 1 30  ? -3.040  6.047   1.393   0.04 14.34 ? 86   PHE A HE1  2  
ATOM   8905   H HE2  . PHE A 1 30  ? -5.325  7.729   -1.424  0.04 15.62 ? 86   PHE A HE2  2  
ATOM   8906   H HZ   . PHE A 1 30  ? -3.645  7.905   0.181   0.04 14.84 ? 86   PHE A HZ   2  
ATOM   8907   N N    . ARG A 1 31  ? -8.987  4.110   0.278   0.04 16.14 ? 87   ARG A N    2  
ATOM   8908   C CA   . ARG A 1 31  ? -10.069 5.011   0.667   0.04 16.49 ? 87   ARG A CA   2  
ATOM   8909   C C    . ARG A 1 31  ? -10.451 4.826   2.124   0.04 16.32 ? 87   ARG A C    2  
ATOM   8910   O O    . ARG A 1 31  ? -10.483 5.820   2.862   0.04 16.31 ? 87   ARG A O    2  
ATOM   8911   C CB   . ARG A 1 31  ? -11.334 4.757   -0.164  0.04 17.08 ? 87   ARG A CB   2  
ATOM   8912   C CG   . ARG A 1 31  ? -11.419 5.469   -1.522  0.04 17.37 ? 87   ARG A CG   2  
ATOM   8913   C CD   . ARG A 1 31  ? -12.865 5.816   -1.904  0.04 18.04 ? 87   ARG A CD   2  
ATOM   8914   N NE   . ARG A 1 31  ? -13.588 4.598   -2.272  0.04 18.28 ? 87   ARG A NE   2  
ATOM   8915   C CZ   . ARG A 1 31  ? -13.509 4.019   -3.477  0.04 18.26 ? 87   ARG A CZ   2  
ATOM   8916   N NH1  . ARG A 1 31  ? -14.160 2.902   -3.704  0.04 18.55 ? 87   ARG A NH1  2  
ATOM   8917   N NH2  . ARG A 1 31  ? -12.768 4.546   -4.455  0.04 17.99 ? 87   ARG A NH2  2  
ATOM   8918   H H    . ARG A 1 31  ? -9.153  3.673   -0.442  0.04 16.30 ? 87   ARG A H    2  
ATOM   8919   H HA   . ARG A 1 31  ? -9.789  5.930   0.539   0.04 16.49 ? 87   ARG A HA   2  
ATOM   8920   H HB2  . ARG A 1 31  ? -11.424 3.811   -0.324  0.04 17.11 ? 87   ARG A HB2  2  
ATOM   8921   H HB3  . ARG A 1 31  ? -12.091 5.071   0.357   0.04 17.31 ? 87   ARG A HB3  2  
ATOM   8922   H HG2  . ARG A 1 31  ? -10.901 6.289   -1.490  0.04 17.29 ? 87   ARG A HG2  2  
ATOM   8923   H HG3  . ARG A 1 31  ? -11.074 4.882   -2.211  0.04 17.25 ? 87   ARG A HG3  2  
ATOM   8924   H HD2  . ARG A 1 31  ? -13.312 6.252   -1.164  0.04 18.18 ? 87   ARG A HD2  2  
ATOM   8925   H HD3  . ARG A 1 31  ? -12.851 6.405   -2.680  0.04 18.22 ? 87   ARG A HD3  2  
ATOM   8926   H HE   . ARG A 1 31  ? -14.211 4.332   -1.741  0.04 18.50 ? 87   ARG A HE   2  
ATOM   8927   H HH11 . ARG A 1 31  ? -14.648 2.560   -3.085  0.04 18.74 ? 87   ARG A HH11 2  
ATOM   8928   H HH12 . ARG A 1 31  ? -14.127 2.536   -4.482  0.04 18.55 ? 87   ARG A HH12 2  
ATOM   8929   H HH21 . ARG A 1 31  ? -12.320 5.269   -4.321  0.04 17.82 ? 87   ARG A HH21 2  
ATOM   8930   H HH22 . ARG A 1 31  ? -12.733 4.158   -5.223  0.04 18.00 ? 87   ARG A HH22 2  
ATOM   8931   N N    . LYS A 1 32  ? -10.748 3.582   2.517   0.04 16.20 ? 88   LYS A N    2  
ATOM   8932   C CA   . LYS A 1 32  ? -11.179 3.285   3.884   0.04 16.05 ? 88   LYS A CA   2  
ATOM   8933   C C    . LYS A 1 32  ? -10.020 3.676   4.874   0.04 15.56 ? 88   LYS A C    2  
ATOM   8934   O O    . LYS A 1 32  ? -10.249 4.318   5.892   0.04 15.54 ? 88   LYS A O    2  
ATOM   8935   C CB   . LYS A 1 32  ? -11.689 1.800   4.023   0.04 16.06 ? 88   LYS A CB   2  
ATOM   8936   C CG   . LYS A 1 32  ? -13.022 1.387   3.242   0.04 16.60 ? 88   LYS A CG   2  
ATOM   8937   C CD   . LYS A 1 32  ? -13.663 0.086   3.798   0.04 16.67 ? 88   LYS A CD   2  
ATOM   8938   C CE   . LYS A 1 32  ? -13.007 -1.105  3.163   0.04 16.72 ? 88   LYS A CE   2  
ATOM   8939   N NZ   . LYS A 1 32  ? -13.669 -2.367  3.555   0.04 17.04 ? 88   LYS A NZ   2  
ATOM   8940   H H    . LYS A 1 32  ? -10.706 2.888   2.009   0.04 16.21 ? 88   LYS A H    2  
ATOM   8941   H HA   . LYS A 1 32  ? -11.936 3.860   4.080   0.04 16.33 ? 88   LYS A HA   2  
ATOM   8942   H HB2  . LYS A 1 32  ? -10.987 1.205   3.718   0.04 16.01 ? 88   LYS A HB2  2  
ATOM   8943   H HB3  . LYS A 1 32  ? -11.850 1.637   4.960   0.04 15.82 ? 88   LYS A HB3  2  
ATOM   8944   H HG2  . LYS A 1 32  ? -13.681 2.100   3.319   0.04 16.66 ? 88   LYS A HG2  2  
ATOM   8945   H HG3  . LYS A 1 32  ? -12.809 1.233   2.308   0.04 16.87 ? 88   LYS A HG3  2  
ATOM   8946   H HD2  . LYS A 1 32  ? -13.525 0.037   4.758   0.04 16.39 ? 88   LYS A HD2  2  
ATOM   8947   H HD3  . LYS A 1 32  ? -14.613 0.065   3.592   0.04 17.02 ? 88   LYS A HD3  2  
ATOM   8948   H HE2  . LYS A 1 32  ? -13.061 -1.015  2.198   0.04 16.93 ? 88   LYS A HE2  2  
ATOM   8949   H HE3  . LYS A 1 32  ? -12.076 -1.130  3.434   0.04 16.38 ? 88   LYS A HE3  2  
ATOM   8950   H HZ1  . LYS A 1 32  ? -13.121 -3.043  3.373   0.04 17.07 ? 88   LYS A HZ1  2  
ATOM   8951   H HZ2  . LYS A 1 32  ? -13.868 -2.358  4.421   0.04 16.89 ? 88   LYS A HZ2  2  
ATOM   8952   H HZ3  . LYS A 1 32  ? -14.420 -2.474  3.087   0.04 17.39 ? 88   LYS A HZ3  2  
ATOM   8953   N N    . GLN A 1 33  ? -8.759  3.411   4.489   0.04 15.21 ? 89   GLN A N    2  
ATOM   8954   C CA   . GLN A 1 33  ? -7.616  3.381   5.427   0.04 14.74 ? 89   GLN A CA   2  
ATOM   8955   C C    . GLN A 1 33  ? -6.651  4.554   5.438   0.04 14.58 ? 89   GLN A C    2  
ATOM   8956   O O    . GLN A 1 33  ? -5.861  4.710   6.372   0.04 14.25 ? 89   GLN A O    2  
ATOM   8957   C CB   . GLN A 1 33  ? -6.791  2.106   5.180   0.04 14.46 ? 89   GLN A CB   2  
ATOM   8958   C CG   . GLN A 1 33  ? -7.518  0.839   5.613   0.04 14.58 ? 89   GLN A CG   2  
ATOM   8959   C CD   . GLN A 1 33  ? -8.145  1.016   7.000   0.04 14.59 ? 89   GLN A CD   2  
ATOM   8960   O OE1  . GLN A 1 33  ? -9.365  1.174   7.151   0.04 14.95 ? 89   GLN A OE1  2  
ATOM   8961   N NE2  . GLN A 1 33  ? -7.297  1.038   8.015   0.04 14.23 ? 89   GLN A NE2  2  
ATOM   8962   H H    . GLN A 1 33  ? -8.539  3.238   3.679   0.04 15.26 ? 89   GLN A H    2  
ATOM   8963   H HA   . GLN A 1 33  ? -7.976  3.352   6.324   0.04 14.73 ? 89   GLN A HA   2  
ATOM   8964   H HB2  . GLN A 1 33  ? -6.587  2.029   4.238   0.04 14.52 ? 89   GLN A HB2  2  
ATOM   8965   H HB3  . GLN A 1 33  ? -5.967  2.166   5.685   0.04 14.18 ? 89   GLN A HB3  2  
ATOM   8966   H HG2  . GLN A 1 33  ? -8.217  0.630   4.976   0.04 14.87 ? 89   GLN A HG2  2  
ATOM   8967   H HG3  . GLN A 1 33  ? -6.879  0.110   5.656   0.04 14.39 ? 89   GLN A HG3  2  
ATOM   8968   H HE21 . GLN A 1 33  ? -6.732  0.400   8.118   0.04 14.11 ? 89   GLN A HE21 2  
ATOM   8969   H HE22 . GLN A 1 33  ? -7.311  1.693   8.571   0.04 14.15 ? 89   GLN A HE22 2  
ATOM   8970   N N    . GLU A 1 34  ? -6.726  5.373   4.419   0.04 14.83 ? 90   GLU A N    2  
ATOM   8971   C CA   . GLU A 1 34  ? -5.791  6.466   4.217   0.04 14.73 ? 90   GLU A CA   2  
ATOM   8972   C C    . GLU A 1 34  ? -5.636  7.417   5.413   0.04 14.57 ? 90   GLU A C    2  
ATOM   8973   O O    . GLU A 1 34  ? -4.523  7.759   5.795   0.04 14.29 ? 90   GLU A O    2  
ATOM   8974   C CB   . GLU A 1 34  ? -6.201  7.233   2.948   0.04 15.15 ? 90   GLU A CB   2  
ATOM   8975   C CG   . GLU A 1 34  ? -5.602  8.607   2.886   0.04 15.14 ? 90   GLU A CG   2  
ATOM   8976   C CD   . GLU A 1 34  ? -5.879  9.373   1.590   0.04 15.65 ? 90   GLU A CD   2  
ATOM   8977   O OE1  . GLU A 1 34  ? -6.951  9.224   0.952   0.04 15.98 ? 90   GLU A OE1  2  
ATOM   8978   O OE2  . GLU A 1 34  ? -5.003  10.184  1.242   0.04 15.77 ? 90   GLU A OE2  2  
ATOM   8979   H H    . GLU A 1 34  ? -7.320  5.311   3.801   0.04 15.10 ? 90   GLU A H    2  
ATOM   8980   H HA   . GLU A 1 34  ? -4.916  6.081   4.047   0.04 14.51 ? 90   GLU A HA   2  
ATOM   8981   H HB2  . GLU A 1 34  ? -5.897  6.741   2.170   0.04 15.26 ? 90   GLU A HB2  2  
ATOM   8982   H HB3  . GLU A 1 34  ? -7.166  7.327   2.918   0.04 15.40 ? 90   GLU A HB3  2  
ATOM   8983   H HG2  . GLU A 1 34  ? -5.960  9.146   3.609   0.04 14.98 ? 90   GLU A HG2  2  
ATOM   8984   H HG3  . GLU A 1 34  ? -4.640  8.523   2.974   0.04 14.98 ? 90   GLU A HG3  2  
ATOM   8985   N N    . SER A 1 35  ? -6.751  7.894   5.959   0.04 14.82 ? 91   SER A N    2  
ATOM   8986   C CA   . SER A 1 35  ? -6.668  8.800   7.106   0.04 14.73 ? 91   SER A CA   2  
ATOM   8987   C C    . SER A 1 35  ? -7.033  8.112   8.441   0.04 14.65 ? 91   SER A C    2  
ATOM   8988   O O    . SER A 1 35  ? -7.244  8.773   9.470   0.04 14.71 ? 91   SER A O    2  
ATOM   8989   C CB   . SER A 1 35  ? -7.495  10.082  6.895   0.04 15.13 ? 91   SER A CB   2  
ATOM   8990   O OG   . SER A 1 35  ? -8.890  9.897   7.032   0.04 15.56 ? 91   SER A OG   2  
ATOM   8991   H H    . SER A 1 35  ? -7.544  7.702   5.695   0.04 15.06 ? 91   SER A H    2  
ATOM   8992   H HA   . SER A 1 35  ? -5.751  9.096   7.198   0.04 14.47 ? 91   SER A HA   2  
ATOM   8993   H HB2  . SER A 1 35  ? -7.223  10.706  7.584   0.04 15.06 ? 91   SER A HB2  2  
ATOM   8994   H HB3  . SER A 1 35  ? -7.300  10.455  6.019   0.04 15.18 ? 91   SER A HB3  2  
ATOM   8995   H HG   . SER A 1 35  ? -9.144  10.132  7.797   0.04 15.59 ? 91   SER A HG   2  
ATOM   8996   N N    . ASN A 1 36  ? -7.086  6.786   8.419   0.04 14.56 ? 92   ASN A N    2  
ATOM   8997   C CA   . ASN A 1 36  ? -7.640  6.016   9.544   0.04 14.53 ? 92   ASN A CA   2  
ATOM   8998   C C    . ASN A 1 36  ? -6.585  5.616   10.576  0.04 14.11 ? 92   ASN A C    2  
ATOM   8999   O O    . ASN A 1 36  ? -6.294  4.434   10.787  0.04 13.92 ? 92   ASN A O    2  
ATOM   9000   C CB   . ASN A 1 36  ? -8.329  4.776   8.993   0.04 14.65 ? 92   ASN A CB   2  
ATOM   9001   C CG   . ASN A 1 36  ? -9.325  4.185   9.953   0.04 14.79 ? 92   ASN A CG   2  
ATOM   9002   O OD1  . ASN A 1 36  ? -9.306  4.481   11.141  0.04 14.84 ? 92   ASN A OD1  2  
ATOM   9003   N ND2  . ASN A 1 36  ? -10.185 3.322   9.434   0.04 14.89 ? 92   ASN A ND2  2  
ATOM   9004   H H    . ASN A 1 36  ? -6.830  6.302   7.758   0.04 14.54 ? 92   ASN A H    2  
ATOM   9005   H HA   . ASN A 1 36  ? -8.307  6.555   9.999   0.04 14.74 ? 92   ASN A HA   2  
ATOM   9006   H HB2  . ASN A 1 36  ? -8.815  5.026   8.192   0.04 14.90 ? 92   ASN A HB2  2  
ATOM   9007   H HB3  . ASN A 1 36  ? -7.664  4.104   8.786   0.04 14.42 ? 92   ASN A HB3  2  
ATOM   9008   H HD21 . ASN A 1 36  ? -10.596 2.762   9.941   0.04 14.74 ? 92   ASN A HD21 2  
ATOM   9009   H HD22 . ASN A 1 36  ? -10.331 3.315   8.586   0.04 15.11 ? 92   ASN A HD22 2  
ATOM   9010   N N    . GLN A 1 37  ? -6.020  6.617   11.234  0.04 14.01 ? 93   GLN A N    2  
ATOM   9011   C CA   . GLN A 1 37  ? -4.857  6.431   12.085  0.04 13.64 ? 93   GLN A CA   2  
ATOM   9012   C C    . GLN A 1 37  ? -5.123  5.542   13.303  0.04 13.57 ? 93   GLN A C    2  
ATOM   9013   O O    . GLN A 1 37  ? -4.235  4.797   13.705  0.04 13.29 ? 93   GLN A O    2  
ATOM   9014   C CB   . GLN A 1 37  ? -4.265  7.798   12.475  0.04 13.62 ? 93   GLN A CB   2  
ATOM   9015   C CG   . GLN A 1 37  ? -3.020  7.657   13.321  0.04 13.27 ? 93   GLN A CG   2  
ATOM   9016   C CD   . GLN A 1 37  ? -2.145  8.900   13.443  0.04 13.27 ? 93   GLN A CD   2  
ATOM   9017   O OE1  . GLN A 1 37  ? -1.194  8.878   14.209  0.04 13.03 ? 93   GLN A OE1  2  
ATOM   9018   N NE2  . GLN A 1 37  ? -2.415  9.944   12.668  0.04 13.58 ? 93   GLN A NE2  2  
ATOM   9019   H H    . GLN A 1 37  ? -6.301  7.427   11.194  0.04 14.17 ? 93   GLN A H    2  
ATOM   9020   H HA   . GLN A 1 37  ? -4.174  5.986   11.565  0.04 13.46 ? 93   GLN A HA   2  
ATOM   9021   H HB2  . GLN A 1 37  ? -4.031  8.271   11.665  0.04 13.69 ? 93   GLN A HB2  2  
ATOM   9022   H HB3  . GLN A 1 37  ? -4.937  8.301   12.962  0.04 13.81 ? 93   GLN A HB3  2  
ATOM   9023   H HG2  . GLN A 1 37  ? -3.271  7.370   14.210  0.04 13.22 ? 93   GLN A HG2  2  
ATOM   9024   H HG3  . GLN A 1 37  ? -2.457  6.971   12.925  0.04 13.11 ? 93   GLN A HG3  2  
ATOM   9025   H HE21 . GLN A 1 37  ? -2.947  9.868   11.998  0.04 13.77 ? 93   GLN A HE21 2  
ATOM   9026   H HE22 . GLN A 1 37  ? -2.049  10.703  12.837  0.04 13.60 ? 93   GLN A HE22 2  
ATOM   9027   N N    . PHE A 1 38  ? -6.325  5.638   13.883  0.04 13.87 ? 94   PHE A N    2  
ATOM   9028   C CA   . PHE A 1 38  ? -6.635  4.926   15.136  0.04 13.86 ? 94   PHE A CA   2  
ATOM   9029   C C    . PHE A 1 38  ? -7.885  4.053   15.075  0.04 14.15 ? 94   PHE A C    2  
ATOM   9030   O O    . PHE A 1 38  ? -8.409  3.630   16.118  0.04 14.30 ? 94   PHE A O    2  
ATOM   9031   C CB   . PHE A 1 38  ? -6.800  5.922   16.280  0.04 13.94 ? 94   PHE A CB   2  
ATOM   9032   C CG   . PHE A 1 38  ? -5.579  6.758   16.536  0.04 13.66 ? 94   PHE A CG   2  
ATOM   9033   C CD1  . PHE A 1 38  ? -4.419  6.214   17.079  0.04 13.32 ? 94   PHE A CD1  2  
ATOM   9034   C CD2  . PHE A 1 38  ? -5.607  8.115   16.250  0.04 13.77 ? 94   PHE A CD2  2  
ATOM   9035   C CE1  . PHE A 1 38  ? -3.319  7.011   17.317  0.04 13.12 ? 94   PHE A CE1  2  
ATOM   9036   C CE2  . PHE A 1 38  ? -4.513  8.915   16.490  0.04 13.56 ? 94   PHE A CE2  2  
ATOM   9037   C CZ   . PHE A 1 38  ? -3.383  8.393   17.034  0.04 13.24 ? 94   PHE A CZ   2  
ATOM   9038   H H    . PHE A 1 38  ? -6.975  6.105   13.580  0.04 14.10 ? 94   PHE A H    2  
ATOM   9039   H HA   . PHE A 1 38  ? -5.895  4.341   15.359  0.04 13.62 ? 94   PHE A HA   2  
ATOM   9040   H HB2  . PHE A 1 38  ? -7.529  6.524   16.064  0.04 14.18 ? 94   PHE A HB2  2  
ATOM   9041   H HB3  . PHE A 1 38  ? -7.002  5.438   17.094  0.04 13.97 ? 94   PHE A HB3  2  
ATOM   9042   H HD1  . PHE A 1 38  ? -4.380  5.307   17.277  0.04 13.26 ? 94   PHE A HD1  2  
ATOM   9043   H HD2  . PHE A 1 38  ? -6.377  8.492   15.897  0.04 14.02 ? 94   PHE A HD2  2  
ATOM   9044   H HE1  . PHE A 1 38  ? -2.548  6.640   17.675  0.04 12.92 ? 94   PHE A HE1  2  
ATOM   9045   H HE2  . PHE A 1 38  ? -4.557  9.825   16.292  0.04 13.66 ? 94   PHE A HE2  2  
ATOM   9046   H HZ   . PHE A 1 38  ? -2.641  8.933   17.178  0.04 13.12 ? 94   PHE A HZ   2  
ATOM   9047   N N    . GLY A 1 39  ? -8.354  3.750   13.873  0.04 14.26 ? 95   GLY A N    2  
ATOM   9048   C CA   . GLY A 1 39  ? -9.520  2.919   13.751  0.04 14.56 ? 95   GLY A CA   2  
ATOM   9049   C C    . GLY A 1 39  ? -9.167  1.483   14.025  0.04 14.39 ? 95   GLY A C    2  
ATOM   9050   O O    . GLY A 1 39  ? -7.999  1.132   14.148  0.04 14.03 ? 95   GLY A O    2  
ATOM   9051   H H    . GLY A 1 39  ? -8.008  4.003   13.130  0.04 14.18 ? 95   GLY A H    2  
ATOM   9052   H HA2  . GLY A 1 39  ? -10.193 3.200   14.392  0.04 14.74 ? 95   GLY A HA2  2  
ATOM   9053   H HA3  . GLY A 1 39  ? -9.901  2.979   12.862  0.04 14.75 ? 95   GLY A HA3  2  
ATOM   9054   N N    . THR A 1 40  ? -10.193 0.648   14.085  0.04 14.67 ? 96   THR A N    2  
ATOM   9055   C CA   . THR A 1 40  ? -10.033 -0.742  14.469  0.04 14.58 ? 96   THR A CA   2  
ATOM   9056   C C    . THR A 1 40  ? -10.130 -1.720  13.273  0.04 14.60 ? 96   THR A C    2  
ATOM   9057   O O    . THR A 1 40  ? -10.043 -2.951  13.462  0.04 14.50 ? 96   THR A O    2  
ATOM   9058   C CB   . THR A 1 40  ? -10.980 -1.074  15.650  0.04 14.91 ? 96   THR A CB   2  
ATOM   9059   O OG1  . THR A 1 40  ? -12.329 -0.700  15.326  0.04 15.36 ? 96   THR A OG1  2  
ATOM   9060   C CG2  . THR A 1 40  ? -10.530 -0.311  16.912  0.04 14.84 ? 96   THR A CG2  2  
ATOM   9061   H H    . THR A 1 40  ? -10.998 0.866   13.893  0.04 14.95 ? 96   THR A H    2  
ATOM   9062   H HA   . THR A 1 40  ? -9.137  -0.853  14.823  0.04 14.32 ? 96   THR A HA   2  
ATOM   9063   H HB   . THR A 1 40  ? -10.937 -2.024  15.838  0.04 14.88 ? 96   THR A HB   2  
ATOM   9064   H HG1  . THR A 1 40  ? -12.584 -1.112  14.641  0.04 15.42 ? 96   THR A HG1  2  
ATOM   9065   H HG21 . THR A 1 40  ? -10.936 -0.703  17.698  0.04 15.05 ? 96   THR A HG21 2  
ATOM   9066   H HG22 . THR A 1 40  ? -9.569  -0.366  17.002  0.04 14.56 ? 96   THR A HG22 2  
ATOM   9067   H HG23 . THR A 1 40  ? -10.793 0.620   16.850  0.04 14.90 ? 96   THR A HG23 2  
ATOM   9068   N N    . ASP A 1 41  ? -10.220 -1.189  12.052  0.04 14.77 ? 97   ASP A N    2  
ATOM   9069   C CA   . ASP A 1 41  ? -10.210 -2.042  10.849  0.04 14.82 ? 97   ASP A CA   2  
ATOM   9070   C C    . ASP A 1 41  ? -8.759  -2.373  10.452  0.04 14.39 ? 97   ASP A C    2  
ATOM   9071   O O    . ASP A 1 41  ? -7.819  -1.603  10.703  0.04 14.10 ? 97   ASP A O    2  
ATOM   9072   C CB   . ASP A 1 41  ? -10.886 -1.415  9.627   0.04 15.11 ? 97   ASP A CB   2  
ATOM   9073   C CG   . ASP A 1 41  ? -12.213 -0.779  9.947   0.04 15.64 ? 97   ASP A CG   2  
ATOM   9074   O OD1  . ASP A 1 41  ? -13.250 -1.482  10.026  0.04 15.83 ? 97   ASP A OD1  2  
ATOM   9075   O OD2  . ASP A 1 41  ? -12.112 0.446   10.060  0.04 15.90 ? 97   ASP A OD2  2  
ATOM   9076   H H    . ASP A 1 41  ? -10.276 -0.349  11.890  0.04 14.87 ? 97   ASP A H    2  
ATOM   9077   H HA   . ASP A 1 41  ? -10.659 -2.879  11.047  0.04 14.97 ? 97   ASP A HA   2  
ATOM   9078   H HB2  . ASP A 1 41  ? -10.315 -0.718  9.274   0.04 15.02 ? 97   ASP A HB2  2  
ATOM   9079   H HB3  . ASP A 1 41  ? -11.033 -2.095  8.951   0.04 15.11 ? 97   ASP A HB3  2  
ATOM   9080   N N    . ARG A 1 42  ? -8.626  -3.509  9.770   0.04 14.39 ? 98   ARG A N    2  
ATOM   9081   C CA   . ARG A 1 42  ? -7.349  -4.134  9.452   0.04 14.07 ? 98   ARG A CA   2  
ATOM   9082   C C    . ARG A 1 42  ? -7.455  -4.865  8.118   0.04 14.25 ? 98   ARG A C    2  
ATOM   9083   O O    . ARG A 1 42  ? -8.447  -5.516  7.876   0.04 14.58 ? 98   ARG A O    2  
ATOM   9084   C CB   . ARG A 1 42  ? -6.980  -5.151  10.549  0.04 13.93 ? 98   ARG A CB   2  
ATOM   9085   C CG   . ARG A 1 42  ? -6.850  -4.585  11.980  0.04 13.78 ? 98   ARG A CG   2  
ATOM   9086   C CD   . ARG A 1 42  ? -5.631  -3.680  12.109  0.04 13.43 ? 98   ARG A CD   2  
ATOM   9087   N NE   . ARG A 1 42  ? -5.346  -3.217  13.462  0.04 13.28 ? 98   ARG A NE   2  
ATOM   9088   C CZ   . ARG A 1 42  ? -5.831  -2.113  14.027  0.04 13.35 ? 98   ARG A CZ   2  
ATOM   9089   N NH1  . ARG A 1 42  ? -6.710  -1.374  13.379  0.04 13.59 ? 98   ARG A NH1  2  
ATOM   9090   N NH2  . ARG A 1 42  ? -5.472  -1.764  15.262  0.04 13.21 ? 98   ARG A NH2  2  
ATOM   9091   H H    . ARG A 1 42  ? -9.295  -3.955  9.470   0.04 14.62 ? 98   ARG A H    2  
ATOM   9092   H HA   . ARG A 1 42  ? -6.651  -3.465  9.393   0.04 13.88 ? 98   ARG A HA   2  
ATOM   9093   H HB2  . ARG A 1 42  ? -7.637  -5.861  10.554  0.04 14.14 ? 98   ARG A HB2  2  
ATOM   9094   H HB3  . ARG A 1 42  ? -6.111  -5.510  10.316  0.04 13.74 ? 98   ARG A HB3  2  
ATOM   9095   H HG2  . ARG A 1 42  ? -7.644  -4.079  12.205  0.04 13.96 ? 98   ARG A HG2  2  
ATOM   9096   H HG3  . ARG A 1 42  ? -6.743  -5.322  12.599  0.04 13.76 ? 98   ARG A HG3  2  
ATOM   9097   H HD2  . ARG A 1 42  ? -4.852  -4.156  11.792  0.04 13.29 ? 98   ARG A HD2  2  
ATOM   9098   H HD3  . ARG A 1 42  ? -5.771  -2.895  11.565  0.04 13.48 ? 98   ARG A HD3  2  
ATOM   9099   H HE   . ARG A 1 42  ? -5.032  -3.807  14.007  0.04 13.22 ? 98   ARG A HE   2  
ATOM   9100   H HH11 . ARG A 1 42  ? -6.948  -1.582  12.583  0.04 13.69 ? 98   ARG A HH11 2  
ATOM   9101   H HH12 . ARG A 1 42  ? -7.030  -0.669  13.747  0.04 13.65 ? 98   ARG A HH12 2  
ATOM   9102   H HH21 . ARG A 1 42  ? -4.911  -2.235  15.707  0.04 13.08 ? 98   ARG A HH21 2  
ATOM   9103   H HH22 . ARG A 1 42  ? -5.811  -1.063  15.618  0.04 13.28 ? 98   ARG A HH22 2  
ATOM   9104   N N    . TYR A 1 43  ? -6.407  -4.770  7.283   0.04 14.05 ? 99   TYR A N    2  
ATOM   9105   C CA   . TYR A 1 43  ? -6.422  -5.398  5.955   0.04 14.23 ? 99   TYR A CA   2  
ATOM   9106   C C    . TYR A 1 43  ? -5.058  -5.964  5.600   0.04 13.97 ? 99   TYR A C    2  
ATOM   9107   O O    . TYR A 1 43  ? -4.011  -5.319  5.787   0.04 13.67 ? 99   TYR A O    2  
ATOM   9108   C CB   . TYR A 1 43  ? -6.838  -4.392  4.856   0.04 14.43 ? 99   TYR A CB   2  
ATOM   9109   C CG   . TYR A 1 43  ? -8.231  -3.816  5.014   0.04 14.76 ? 99   TYR A CG   2  
ATOM   9110   C CD1  . TYR A 1 43  ? -8.437  -2.625  5.680   0.04 14.70 ? 99   TYR A CD1  2  
ATOM   9111   C CD2  . TYR A 1 43  ? -9.333  -4.471  4.486   0.04 15.18 ? 99   TYR A CD2  2  
ATOM   9112   C CE1  . TYR A 1 43  ? -9.705  -2.101  5.827   0.04 15.05 ? 99   TYR A CE1  2  
ATOM   9113   C CE2  . TYR A 1 43  ? -10.629 -3.947  4.625   0.04 15.54 ? 99   TYR A CE2  2  
ATOM   9114   C CZ   . TYR A 1 43  ? -10.792 -2.768  5.291   0.04 15.47 ? 99   TYR A CZ   2  
ATOM   9115   O OH   . TYR A 1 43  ? -12.076 -2.278  5.438   0.04 15.87 ? 99   TYR A OH   2  
ATOM   9116   H H    . TYR A 1 43  ? -5.688  -4.351  7.461   0.04 13.83 ? 99   TYR A H    2  
ATOM   9117   H HA   . TYR A 1 43  ? -7.047  -6.135  5.956   0.04 14.44 ? 99   TYR A HA   2  
ATOM   9118   H HB2  . TYR A 1 43  ? -6.221  -3.647  4.886   0.04 14.24 ? 99   TYR A HB2  2  
ATOM   9119   H HB3  . TYR A 1 43  ? -6.782  -4.829  3.996   0.04 14.55 ? 99   TYR A HB3  2  
ATOM   9120   H HD1  . TYR A 1 43  ? -7.713  -2.165  6.039   0.04 14.44 ? 99   TYR A HD1  2  
ATOM   9121   H HD2  . TYR A 1 43  ? -9.219  -5.276  4.035   0.04 15.25 ? 99   TYR A HD2  2  
ATOM   9122   H HE1  . TYR A 1 43  ? -9.824  -1.298  6.283   0.04 15.02 ? 99   TYR A HE1  2  
ATOM   9123   H HE2  . TYR A 1 43  ? -11.361 -4.400  4.276   0.04 15.84 ? 99   TYR A HE2  2  
ATOM   9124   H HH   . TYR A 1 43  ? -12.274 -2.209  6.254   0.04 15.84 ? 99   TYR A HH   2  
ATOM   9125   N N    . ALA A 1 44  ? -5.076  -7.183  5.052   0.04 14.12 ? 100  ALA A N    2  
ATOM   9126   C CA   . ALA A 1 44  ? -3.893  -7.745  4.384   0.04 13.98 ? 100  ALA A CA   2  
ATOM   9127   C C    . ALA A 1 44  ? -4.216  -7.993  2.927   0.04 14.29 ? 100  ALA A C    2  
ATOM   9128   O O    . ALA A 1 44  ? -5.195  -8.651  2.600   0.04 14.64 ? 100  ALA A O    2  
ATOM   9129   C CB   . ALA A 1 44  ? -3.436  -9.041  5.034   0.04 13.94 ? 100  ALA A CB   2  
ATOM   9130   H H    . ALA A 1 44  ? -5.757  -7.703  5.045   0.04 14.32 ? 100  ALA A H    2  
ATOM   9131   H HA   . ALA A 1 44  ? -3.164  -7.116  4.427   0.04 13.77 ? 100  ALA A HA   2  
ATOM   9132   H HB1  . ALA A 1 44  ? -2.720  -9.414  4.497   0.04 13.84 ? 100  ALA A HB1  2  
ATOM   9133   H HB2  . ALA A 1 44  ? -3.110  -8.846  5.927   0.04 13.80 ? 100  ALA A HB2  2  
ATOM   9134   H HB3  . ALA A 1 44  ? -4.176  -9.664  5.075   0.04 14.18 ? 100  ALA A HB3  2  
ATOM   9135   N N    . LEU A 1 45  ? -3.363  -7.456  2.058   0.04 14.18 ? 101  LEU A N    2  
ATOM   9136   C CA   . LEU A 1 45  ? -3.478  -7.603  0.602   0.04 14.47 ? 101  LEU A CA   2  
ATOM   9137   C C    . LEU A 1 45  ? -2.392  -8.607  0.167   0.04 14.39 ? 101  LEU A C    2  
ATOM   9138   O O    . LEU A 1 45  ? -1.181  -8.380  0.401   0.04 14.08 ? 101  LEU A O    2  
ATOM   9139   C CB   . LEU A 1 45  ? -3.244  -6.248  -0.101  0.04 14.46 ? 101  LEU A CB   2  
ATOM   9140   C CG   . LEU A 1 45  ? -4.035  -5.070  0.480   0.04 14.48 ? 101  LEU A CG   2  
ATOM   9141   C CD1  . LEU A 1 45  ? -3.720  -3.789  -0.264  0.04 14.52 ? 101  LEU A CD1  2  
ATOM   9142   C CD2  . LEU A 1 45  ? -5.550  -5.347  0.442   0.04 14.87 ? 101  LEU A CD2  2  
ATOM   9143   H H    . LEU A 1 45  ? -2.687  -6.986  2.293   0.04 13.96 ? 101  LEU A H    2  
ATOM   9144   H HA   . LEU A 1 45  ? -4.351  -7.944  0.364   0.04 14.73 ? 101  LEU A HA   2  
ATOM   9145   H HB2  . LEU A 1 45  ? -2.302  -6.030  -0.033  0.04 14.23 ? 101  LEU A HB2  2  
ATOM   9146   H HB3  . LEU A 1 45  ? -3.498  -6.336  -1.030  0.04 14.69 ? 101  LEU A HB3  2  
ATOM   9147   H HG   . LEU A 1 45  ? -3.770  -4.949  1.406   0.04 14.25 ? 101  LEU A HG   2  
ATOM   9148   H HD11 . LEU A 1 45  ? -4.119  -3.039  0.202   0.04 14.54 ? 101  LEU A HD11 2  
ATOM   9149   H HD12 . LEU A 1 45  ? -2.756  -3.688  -0.293  0.04 14.29 ? 101  LEU A HD12 2  
ATOM   9150   H HD13 . LEU A 1 45  ? -4.077  -3.846  -1.165  0.04 14.77 ? 101  LEU A HD13 2  
ATOM   9151   H HD21 . LEU A 1 45  ? -6.030  -4.528  0.627   0.04 14.95 ? 101  LEU A HD21 2  
ATOM   9152   H HD22 . LEU A 1 45  ? -5.783  -5.678  -0.441  0.04 15.10 ? 101  LEU A HD22 2  
ATOM   9153   H HD23 . LEU A 1 45  ? -5.764  -6.013  1.113   0.04 14.82 ? 101  LEU A HD23 2  
ATOM   9154   N N    . MET A 1 46  ? -2.809  -9.705  -0.460  0.04 14.70 ? 102  MET A N    2  
ATOM   9155   C CA   . MET A 1 46  ? -1.930  -10.813 -0.828  0.04 14.70 ? 102  MET A CA   2  
ATOM   9156   C C    . MET A 1 46  ? -2.024  -11.122 -2.292  0.04 15.05 ? 102  MET A C    2  
ATOM   9157   O O    . MET A 1 46  ? -3.101  -11.244 -2.851  0.04 15.40 ? 102  MET A O    2  
ATOM   9158   C CB   . MET A 1 46  ? -2.285  -12.063 0.008   0.04 14.79 ? 102  MET A CB   2  
ATOM   9159   C CG   . MET A 1 46  ? -2.131  -11.797 1.471   0.04 14.54 ? 102  MET A CG   2  
ATOM   9160   S SD   . MET A 1 46  ? -0.462  -11.223 1.485   0.04 14.04 ? 102  MET A SD   2  
ATOM   9161   C CE   . MET A 1 46  ? 0.233   -12.523 1.992   0.04 14.05 ? 102  MET A CE   2  
ATOM   9162   H H    . MET A 1 46  ? -3.624  -9.838  -0.696  0.04 14.94 ? 102  MET A H    2  
ATOM   9163   H HA   . MET A 1 46  ? -1.016  -10.539 -0.709  0.04 14.46 ? 102  MET A HA   2  
ATOM   9164   H HB2  . MET A 1 46  ? -3.202  -12.319 -0.162  0.04 15.07 ? 102  MET A HB2  2  
ATOM   9165   H HB3  . MET A 1 46  ? -1.684  -12.785 -0.218  0.04 14.76 ? 102  MET A HB3  2  
ATOM   9166   H HG2  . MET A 1 46  ? -2.734  -11.098 1.773   0.04 14.59 ? 102  MET A HG2  2  
ATOM   9167   H HG3  . MET A 1 46  ? -2.176  -12.600 2.015   0.04 14.66 ? 102  MET A HG3  2  
ATOM   9168   H HE1  . MET A 1 46  ? 1.173   -12.467 1.778   0.04 14.06 ? 102  MET A HE1  2  
ATOM   9169   H HE2  . MET A 1 46  ? 0.130   -12.527 2.961   0.04 13.83 ? 102  MET A HE2  2  
ATOM   9170   H HE3  . MET A 1 46  ? -0.178  -13.301 1.618   0.04 14.25 ? 102  MET A HE3  2  
ATOM   9171   N N    . PHE A 1 47  ? -0.857  -11.206 -2.908  0.04 14.99 ? 103  PHE A N    2  
ATOM   9172   C CA   . PHE A 1 47  ? -0.765  -11.393 -4.349  0.04 15.33 ? 103  PHE A CA   2  
ATOM   9173   C C    . PHE A 1 47  ? -0.107  -12.724 -4.702  0.04 15.47 ? 103  PHE A C    2  
ATOM   9174   O O    . PHE A 1 47  ? 1.057   -12.979 -4.393  0.04 15.24 ? 103  PHE A O    2  
ATOM   9175   C CB   . PHE A 1 47  ? -0.008  -10.209 -4.966  0.04 15.22 ? 103  PHE A CB   2  
ATOM   9176   C CG   . PHE A 1 47  ? -0.804  -8.913  -4.966  0.04 15.23 ? 103  PHE A CG   2  
ATOM   9177   C CD1  . PHE A 1 47  ? -0.970  -8.156  -3.818  0.04 14.91 ? 103  PHE A CD1  2  
ATOM   9178   C CD2  . PHE A 1 47  ? -1.396  -8.472  -6.138  0.04 15.60 ? 103  PHE A CD2  2  
ATOM   9179   C CE1  . PHE A 1 47  ? -1.703  -6.991  -3.859  0.04 14.97 ? 103  PHE A CE1  2  
ATOM   9180   C CE2  . PHE A 1 47  ? -2.137  -7.330  -6.169  0.04 15.66 ? 103  PHE A CE2  2  
ATOM   9181   C CZ   . PHE A 1 47  ? -2.290  -6.587  -5.020  0.04 15.34 ? 103  PHE A CZ   2  
ATOM   9182   H H    . PHE A 1 47  ? -0.098  -11.151 -2.512  0.04 14.77 ? 103  PHE A H    2  
ATOM   9183   H HA   . PHE A 1 47  ? -1.657  -11.400 -4.722  0.04 15.59 ? 103  PHE A HA   2  
ATOM   9184   H HB2  . PHE A 1 47  ? 0.813   -10.068 -4.472  0.04 14.96 ? 103  PHE A HB2  2  
ATOM   9185   H HB3  . PHE A 1 47  ? 0.194   -10.427 -5.888  0.04 15.45 ? 103  PHE A HB3  2  
ATOM   9186   H HD1  . PHE A 1 47  ? -0.577  -8.434  -3.021  0.04 14.68 ? 103  PHE A HD1  2  
ATOM   9187   H HD2  . PHE A 1 47  ? -1.300  -8.971  -6.914  0.04 15.83 ? 103  PHE A HD2  2  
ATOM   9188   H HE1  . PHE A 1 47  ? -1.820  -6.486  -3.087  0.04 14.78 ? 103  PHE A HE1  2  
ATOM   9189   H HE2  . PHE A 1 47  ? -2.522  -7.049  -6.965  0.04 15.94 ? 103  PHE A HE2  2  
ATOM   9190   H HZ   . PHE A 1 47  ? -2.781  -5.797  -5.036  0.04 15.41 ? 103  PHE A HZ   2  
ATOM   9191   N N    . LYS A 1 48  ? -0.862  -13.578 -5.368  0.04 15.89 ? 104  LYS A N    2  
ATOM   9192   C CA   . LYS A 1 48  ? -0.340  -14.877 -5.788  0.04 16.11 ? 104  LYS A CA   2  
ATOM   9193   C C    . LYS A 1 48  ? 0.766   -14.653 -6.834  0.04 16.14 ? 104  LYS A C    2  
ATOM   9194   O O    . LYS A 1 48  ? 0.857   -13.573 -7.443  0.04 16.16 ? 104  LYS A O    2  
ATOM   9195   C CB   . LYS A 1 48  ? -1.470  -15.790 -6.304  0.04 16.63 ? 104  LYS A CB   2  
ATOM   9196   C CG   . LYS A 1 48  ? -2.528  -16.115 -5.257  0.04 16.74 ? 104  LYS A CG   2  
ATOM   9197   C CD   . LYS A 1 48  ? -3.550  -17.182 -5.753  0.04 17.33 ? 104  LYS A CD   2  
ATOM   9198   C CE   . LYS A 1 48  ? -4.408  -17.722 -4.617  0.04 17.54 ? 104  LYS A CE   2  
ATOM   9199   N NZ   . LYS A 1 48  ? -5.430  -18.775 -5.068  0.04 18.07 ? 104  LYS A NZ   2  
ATOM   9200   H H    . LYS A 1 48  ? -1.678  -13.430 -5.593  0.04 16.07 ? 104  LYS A H    2  
ATOM   9201   H HA   . LYS A 1 48  ? 0.056   -15.314 -5.020  0.04 15.95 ? 104  LYS A HA   2  
ATOM   9202   H HB2  . LYS A 1 48  ? -1.909  -15.344 -7.044  0.04 16.80 ? 104  LYS A HB2  2  
ATOM   9203   H HB3  . LYS A 1 48  ? -1.092  -16.632 -6.605  0.04 16.78 ? 104  LYS A HB3  2  
ATOM   9204   H HG2  . LYS A 1 48  ? -2.092  -16.456 -4.463  0.04 16.54 ? 104  LYS A HG2  2  
ATOM   9205   H HG3  . LYS A 1 48  ? -3.019  -15.306 -5.043  0.04 16.70 ? 104  LYS A HG3  2  
ATOM   9206   H HD2  . LYS A 1 48  ? -4.129  -16.776 -6.407  0.04 17.55 ? 104  LYS A HD2  2  
ATOM   9207   H HD3  . LYS A 1 48  ? -3.077  -17.929 -6.154  0.04 17.39 ? 104  LYS A HD3  2  
ATOM   9208   H HE2  . LYS A 1 48  ? -3.835  -18.130 -3.958  0.04 17.29 ? 104  LYS A HE2  2  
ATOM   9209   H HE3  . LYS A 1 48  ? -4.896  -16.985 -4.223  0.04 17.62 ? 104  LYS A HE3  2  
ATOM   9210   H HZ1  . LYS A 1 48  ? -5.795  -19.161 -4.352  0.04 18.17 ? 104  LYS A HZ1  2  
ATOM   9211   H HZ2  . LYS A 1 48  ? -6.075  -18.393 -5.547  0.04 18.34 ? 104  LYS A HZ2  2  
ATOM   9212   H HZ3  . LYS A 1 48  ? -5.032  -19.399 -5.563  0.04 18.05 ? 104  LYS A HZ3  2  
ATOM   9213   N N    . PRO A 1 49  ? 1.590   -15.666 -7.077  0.04 16.20 ? 105  PRO A N    2  
ATOM   9214   C CA   . PRO A 1 49  ? 2.719   -15.447 -7.986  0.04 16.29 ? 105  PRO A CA   2  
ATOM   9215   C C    . PRO A 1 49  ? 2.263   -15.140 -9.400  0.04 16.73 ? 105  PRO A C    2  
ATOM   9216   O O    . PRO A 1 49  ? 1.254   -15.687 -9.858  0.04 17.11 ? 105  PRO A O    2  
ATOM   9217   C CB   . PRO A 1 49  ? 3.461   -16.791 -7.969  0.04 16.39 ? 105  PRO A CB   2  
ATOM   9218   C CG   . PRO A 1 49  ? 2.975   -17.494 -6.791  0.04 16.09 ? 105  PRO A CG   2  
ATOM   9219   C CD   . PRO A 1 49  ? 1.574   -17.045 -6.559  0.04 16.13 ? 105  PRO A CD   2  
ATOM   9220   H HA   . PRO A 1 49  ? 3.296   -14.744 -7.654  0.04 16.03 ? 105  PRO A HA   2  
ATOM   9221   H HB2  . PRO A 1 49  ? 3.245   -17.295 -8.772  0.04 16.72 ? 105  PRO A HB2  2  
ATOM   9222   H HB3  . PRO A 1 49  ? 4.417   -16.638 -7.905  0.04 16.33 ? 105  PRO A HB3  2  
ATOM   9223   H HG2  . PRO A 1 49  ? 3.013   -18.450 -6.956  0.04 16.22 ? 105  PRO A HG2  2  
ATOM   9224   H HG3  . PRO A 1 49  ? 3.534   -17.260 -6.031  0.04 15.79 ? 105  PRO A HG3  2  
ATOM   9225   H HD2  . PRO A 1 49  ? 0.962   -17.605 -7.045  0.04 16.41 ? 105  PRO A HD2  2  
ATOM   9226   H HD3  . PRO A 1 49  ? 1.371   -17.044 -5.610  0.04 15.87 ? 105  PRO A HD3  2  
ATOM   9227   N N    . GLY A 1 50  ? 3.025   -14.270 -10.068 0.04 16.69 ? 106  GLY A N    2  
ATOM   9228   C CA   . GLY A 1 50  ? 2.743   -13.878 -11.434 0.04 17.08 ? 106  GLY A CA   2  
ATOM   9229   C C    . GLY A 1 50  ? 3.104   -12.428 -11.664 0.04 16.90 ? 106  GLY A C    2  
ATOM   9230   O O    . GLY A 1 50  ? 3.850   -11.826 -10.879 0.04 16.48 ? 106  GLY A O    2  
ATOM   9231   H H    . GLY A 1 50  ? 3.722   -13.891 -9.745  0.04 16.47 ? 106  GLY A H    2  
ATOM   9232   H HA2  . GLY A 1 50  ? 3.255   -14.431 -12.045 0.04 17.34 ? 106  GLY A HA2  2  
ATOM   9233   H HA3  . GLY A 1 50  ? 1.799   -13.988 -11.627 0.04 17.22 ? 106  GLY A HA3  2  
ATOM   9234   N N    . THR A 1 51  ? 2.543   -11.878 -12.734 0.04 17.26 ? 107  THR A N    2  
ATOM   9235   C CA   . THR A 1 51  ? 2.779   -10.507 -13.138 0.04 17.19 ? 107  THR A CA   2  
ATOM   9236   C C    . THR A 1 51  ? 1.505   -9.692  -13.069 0.04 17.32 ? 107  THR A C    2  
ATOM   9237   O O    . THR A 1 51  ? 0.461   -10.090 -13.600 0.04 17.72 ? 107  THR A O    2  
ATOM   9238   C CB   . THR A 1 51  ? 3.289   -10.430 -14.574 0.04 17.56 ? 107  THR A CB   2  
ATOM   9239   O OG1  . THR A 1 51  ? 4.330   -11.382 -14.786 0.04 17.45 ? 107  THR A OG1  2  
ATOM   9240   C CG2  . THR A 1 51  ? 3.811   -9.017  -14.851 0.04 17.54 ? 107  THR A CG2  2  
ATOM   9241   H H    . THR A 1 51  ? 2.011   -12.301 -13.261 0.04 17.58 ? 107  THR A H    2  
ATOM   9242   H HA   . THR A 1 51  ? 3.438   -10.104 -12.550 0.04 16.85 ? 107  THR A HA   2  
ATOM   9243   H HB   . THR A 1 51  ? 2.555   -10.613 -15.183 0.04 17.92 ? 107  THR A HB   2  
ATOM   9244   H HG1  . THR A 1 51  ? 4.994   -11.184 -14.311 0.04 17.16 ? 107  THR A HG1  2  
ATOM   9245   H HG21 . THR A 1 51  ? 4.519   -9.041  -15.513 0.04 17.69 ? 107  THR A HG21 2  
ATOM   9246   H HG22 . THR A 1 51  ? 3.082   -8.467  -15.178 0.04 17.75 ? 107  THR A HG22 2  
ATOM   9247   H HG23 . THR A 1 51  ? 4.160   -8.621  -14.038 0.04 17.19 ? 107  THR A HG23 2  
ATOM   9248   N N    . TYR A 1 52  ? 1.611   -8.536  -12.436 0.04 16.99 ? 108  TYR A N    2  
ATOM   9249   C CA   . TYR A 1 52  ? 0.502   -7.601  -12.301 0.04 17.09 ? 108  TYR A CA   2  
ATOM   9250   C C    . TYR A 1 52  ? 0.842   -6.283  -12.992 0.04 17.22 ? 108  TYR A C    2  
ATOM   9251   O O    . TYR A 1 52  ? 1.890   -5.698  -12.761 0.04 17.03 ? 108  TYR A O    2  
ATOM   9252   C CB   . TYR A 1 52  ? 0.175   -7.355  -10.839 0.04 16.65 ? 108  TYR A CB   2  
ATOM   9253   C CG   . TYR A 1 52  ? -0.218  -8.593  -10.091 0.04 16.57 ? 108  TYR A CG   2  
ATOM   9254   C CD1  . TYR A 1 52  ? 0.736   -9.431  -9.510  0.04 16.31 ? 108  TYR A CD1  2  
ATOM   9255   C CD2  . TYR A 1 52  ? -1.539  -8.924  -9.949  0.04 16.80 ? 108  TYR A CD2  2  
ATOM   9256   C CE1  . TYR A 1 52  ? 0.370   -10.563 -8.841  0.04 16.28 ? 108  TYR A CE1  2  
ATOM   9257   C CE2  . TYR A 1 52  ? -1.919  -10.064 -9.270  0.04 16.77 ? 108  TYR A CE2  2  
ATOM   9258   C CZ   . TYR A 1 52  ? -0.961  -10.867 -8.689  0.04 16.51 ? 108  TYR A CZ   2  
ATOM   9259   O OH   . TYR A 1 52  ? -1.377  -11.992 -8.005  0.04 16.52 ? 108  TYR A OH   2  
ATOM   9260   H H    . TYR A 1 52  ? 2.334   -8.259  -12.072 0.04 16.73 ? 108  TYR A H    2  
ATOM   9261   H HA   . TYR A 1 52  ? -0.286  -7.971  -12.730 0.04 17.39 ? 108  TYR A HA   2  
ATOM   9262   H HB2  . TYR A 1 52  ? 0.959   -6.983  -10.404 0.04 16.37 ? 108  TYR A HB2  2  
ATOM   9263   H HB3  . TYR A 1 52  ? -0.566  -6.731  -10.789 0.04 16.75 ? 108  TYR A HB3  2  
ATOM   9264   H HD1  . TYR A 1 52  ? 1.640   -9.222  -9.600  0.04 16.18 ? 108  TYR A HD1  2  
ATOM   9265   H HD2  . TYR A 1 52  ? -2.184  -8.374  -10.328 0.04 17.00 ? 108  TYR A HD2  2  
ATOM   9266   H HE1  . TYR A 1 52  ? 1.015   -11.103 -8.451  0.04 16.13 ? 108  TYR A HE1  2  
ATOM   9267   H HE2  . TYR A 1 52  ? -2.821  -10.271 -9.171  0.04 16.95 ? 108  TYR A HE2  2  
ATOM   9268   H HH   . TYR A 1 52  ? -1.005  -12.676 -8.319  0.04 16.60 ? 108  TYR A HH   2  
ATOM   9269   N N    . ASN A 1 53  ? -0.052  -5.844  -13.877 0.04 17.62 ? 109  ASN A N    2  
ATOM   9270   C CA   . ASN A 1 53  ? 0.155   -4.625  -14.637 0.04 17.87 ? 109  ASN A CA   2  
ATOM   9271   C C    . ASN A 1 53  ? -0.765  -3.533  -14.119 0.04 17.87 ? 109  ASN A C    2  
ATOM   9272   O O    . ASN A 1 53  ? -1.756  -3.827  -13.459 0.04 17.84 ? 109  ASN A O    2  
ATOM   9273   C CB   . ASN A 1 53  ? -0.144  -4.911  -16.097 0.04 18.46 ? 109  ASN A CB   2  
ATOM   9274   C CG   . ASN A 1 53  ? 0.720   -6.014  -16.635 0.04 18.49 ? 109  ASN A CG   2  
ATOM   9275   O OD1  . ASN A 1 53  ? 1.886   -5.774  -16.906 0.04 18.26 ? 109  ASN A OD1  2  
ATOM   9276   N ND2  . ASN A 1 53  ? 0.175   -7.237  -16.739 0.04 18.78 ? 109  ASN A ND2  2  
ATOM   9277   H H    . ASN A 1 53  ? -0.785  -6.253  -14.054 0.04 17.77 ? 109  ASN A H    2  
ATOM   9278   H HA   . ASN A 1 53  ? 1.075   -4.329  -14.578 0.04 17.69 ? 109  ASN A HA   2  
ATOM   9279   H HB2  . ASN A 1 53  ? -1.067  -5.183  -16.175 0.04 18.69 ? 109  ASN A HB2  2  
ATOM   9280   H HB3  . ASN A 1 53  ? 0.026   -4.109  -16.614 0.04 18.64 ? 109  ASN A HB3  2  
ATOM   9281   H HD21 . ASN A 1 53  ? -0.084  -7.535  -17.503 0.04 19.03 ? 109  ASN A HD21 2  
ATOM   9282   H HD22 . ASN A 1 53  ? 0.071   -7.720  -16.037 0.04 18.73 ? 109  ASN A HD22 2  
ATOM   9283   N N    . ASP A 1 54  ? -0.443  -2.284  -14.409 0.04 17.95 ? 110  ASP A N    2  
ATOM   9284   C CA   . ASP A 1 54  ? -1.398  -1.196  -14.202 0.04 18.08 ? 110  ASP A CA   2  
ATOM   9285   C C    . ASP A 1 54  ? -1.805  -1.102  -12.741 0.04 17.65 ? 110  ASP A C    2  
ATOM   9286   O O    . ASP A 1 54  ? -2.994  -1.124  -12.375 0.04 17.83 ? 110  ASP A O    2  
ATOM   9287   C CB   . ASP A 1 54  ? -2.600  -1.411  -15.124 0.04 18.70 ? 110  ASP A CB   2  
ATOM   9288   C CG   . ASP A 1 54  ? -2.175  -1.547  -16.559 0.04 19.15 ? 110  ASP A CG   2  
ATOM   9289   O OD1  . ASP A 1 54  ? -1.457  -0.641  -17.008 0.04 19.32 ? 110  ASP A OD1  2  
ATOM   9290   O OD2  . ASP A 1 54  ? -2.507  -2.549  -17.234 0.04 19.38 ? 110  ASP A OD2  2  
ATOM   9291   H H    . ASP A 1 54  ? 0.315   -2.039  -14.725 0.04 17.96 ? 110  ASP A H    2  
ATOM   9292   H HA   . ASP A 1 54  ? -0.973  -0.359  -14.452 0.04 18.09 ? 110  ASP A HA   2  
ATOM   9293   H HB2  . ASP A 1 54  ? -3.071  -2.218  -14.868 0.04 18.70 ? 110  ASP A HB2  2  
ATOM   9294   H HB3  . ASP A 1 54  ? -3.188  -0.644  -15.055 0.04 18.85 ? 110  ASP A HB3  2  
ATOM   9295   N N    . ILE A 1 55  ? -0.805  -1.003  -11.894 0.04 17.14 ? 111  ILE A N    2  
ATOM   9296   C CA   . ILE A 1 55  ? -1.037  -1.092  -10.465 0.04 16.73 ? 111  ILE A CA   2  
ATOM   9297   C C    . ILE A 1 55  ? -0.271  -0.002  -9.741  0.04 16.36 ? 111  ILE A C    2  
ATOM   9298   O O    . ILE A 1 55  ? 0.882   0.285   -10.021 0.04 16.14 ? 111  ILE A O    2  
ATOM   9299   C CB   . ILE A 1 55  ? -0.784  -2.540  -9.981  0.04 16.46 ? 111  ILE A CB   2  
ATOM   9300   C CG1  . ILE A 1 55  ? -1.410  -2.819  -8.612  0.04 15.99 ? 111  ILE A CG1  2  
ATOM   9301   C CG2  . ILE A 1 55  ? 0.691   -2.912  -10.032 0.04 16.38 ? 111  ILE A CG2  2  
ATOM   9302   C CD1  . ILE A 1 55  ? -1.777  -4.285  -8.478  0.04 15.80 ? 111  ILE A CD1  2  
ATOM   9303   H H    . ILE A 1 55  ? 0.015   -0.880  -12.121 0.04 17.03 ? 111  ILE A H    2  
ATOM   9304   H HA   . ILE A 1 55  ? -1.972  -0.921  -10.281 0.04 16.89 ? 111  ILE A HA   2  
ATOM   9305   H HB   . ILE A 1 55  ? -1.238  -3.117  -10.614 0.04 16.69 ? 111  ILE A HB   2  
ATOM   9306   H HG12 . ILE A 1 55  ? -0.773  -2.594  -7.919  0.04 15.76 ? 111  ILE A HG12 2  
ATOM   9307   H HG13 . ILE A 1 55  ? -2.225  -2.298  -8.500  0.04 16.06 ? 111  ILE A HG13 2  
ATOM   9308   H HG21 . ILE A 1 55  ? 0.780   -3.828  -9.724  0.04 16.21 ? 111  ILE A HG21 2  
ATOM   9309   H HG22 . ILE A 1 55  ? 1.002   -2.842  -10.947 0.04 16.71 ? 111  ILE A HG22 2  
ATOM   9310   H HG23 . ILE A 1 55  ? 1.200   -2.317  -9.459  0.04 16.21 ? 111  ILE A HG23 2  
ATOM   9311   H HD11 . ILE A 1 55  ? -2.199  -4.425  -7.613  0.04 15.54 ? 111  ILE A HD11 2  
ATOM   9312   H HD12 . ILE A 1 55  ? -2.394  -4.521  -9.190  0.04 16.06 ? 111  ILE A HD12 2  
ATOM   9313   H HD13 . ILE A 1 55  ? -0.971  -4.823  -8.547  0.04 15.71 ? 111  ILE A HD13 2  
ATOM   9314   N N    . ASN A 1 56  ? -0.994  0.658   -8.848  0.04 16.34 ? 112  ASN A N    2  
ATOM   9315   C CA   . ASN A 1 56  ? -0.532  1.802   -8.091  0.04 15.98 ? 112  ASN A CA   2  
ATOM   9316   C C    . ASN A 1 56  ? -1.186  1.547   -6.754  0.04 15.71 ? 112  ASN A C    2  
ATOM   9317   O O    . ASN A 1 56  ? -2.270  2.078   -6.459  0.04 15.91 ? 112  ASN A O    2  
ATOM   9318   C CB   . ASN A 1 56  ? -0.971  3.124   -8.751  0.04 16.23 ? 112  ASN A CB   2  
ATOM   9319   C CG   . ASN A 1 56  ? -0.429  4.349   -8.031  0.04 15.87 ? 112  ASN A CG   2  
ATOM   9320   O OD1  . ASN A 1 56  ? 0.503   4.242   -7.269  0.04 15.43 ? 112  ASN A OD1  2  
ATOM   9321   N ND2  . ASN A 1 56  ? -1.034  5.530   -8.270  0.04 16.09 ? 112  ASN A ND2  2  
ATOM   9322   H H    . ASN A 1 56  ? -1.772  0.399   -8.623  0.04 16.55 ? 112  ASN A H    2  
ATOM   9323   H HA   . ASN A 1 56  ? 0.433   1.783   -7.977  0.04 15.75 ? 112  ASN A HA   2  
ATOM   9324   H HB2  . ASN A 1 56  ? -0.615  3.137   -9.653  0.04 16.44 ? 112  ASN A HB2  2  
ATOM   9325   H HB3  . ASN A 1 56  ? -1.938  3.178   -8.772  0.04 16.44 ? 112  ASN A HB3  2  
ATOM   9326   H HD21 . ASN A 1 56  ? -1.324  5.998   -7.612  0.04 16.31 ? 112  ASN A HD21 2  
ATOM   9327   H HD22 . ASN A 1 56  ? -1.115  5.826   -9.075  0.04 16.04 ? 112  ASN A HD22 2  
ATOM   9328   N N    . ALA A 1 57  ? -0.569  0.641   -6.002  0.04 15.31 ? 113  ALA A N    2  
ATOM   9329   C CA   . ALA A 1 57  ? -1.150  0.131   -4.766  0.04 15.05 ? 113  ALA A CA   2  
ATOM   9330   C C    . ALA A 1 57  ? -0.782  1.100   -3.652  0.04 14.77 ? 113  ALA A C    2  
ATOM   9331   O O    . ALA A 1 57  ? 0.314   1.018   -3.080  0.04 14.45 ? 113  ALA A O    2  
ATOM   9332   C CB   . ALA A 1 57  ? -0.660  -1.346  -4.467  0.04 14.81 ? 113  ALA A CB   2  
ATOM   9333   H H    . ALA A 1 57  ? 0.205   0.311   -6.179  0.04 15.19 ? 113  ALA A H    2  
ATOM   9334   H HA   . ALA A 1 57  ? -2.115  0.117   -4.853  0.04 15.27 ? 113  ALA A HA   2  
ATOM   9335   H HB1  . ALA A 1 57  ? -0.714  -1.517  -3.512  0.04 14.65 ? 113  ALA A HB1  2  
ATOM   9336   H HB2  . ALA A 1 57  ? -1.233  -1.971  -4.939  0.04 15.02 ? 113  ALA A HB2  2  
ATOM   9337   H HB3  . ALA A 1 57  ? 0.258   -1.450  -4.765  0.04 14.64 ? 113  ALA A HB3  2  
ATOM   9338   N N    . GLN A 1 58  ? -1.691  2.026   -3.340  0.04 14.93 ? 114  GLN A N    2  
ATOM   9339   C CA   . GLN A 1 58  ? -1.447  3.051   -2.329  0.04 14.71 ? 114  GLN A CA   2  
ATOM   9340   C C    . GLN A 1 58  ? -1.763  2.364   -0.991  0.04 14.43 ? 114  GLN A C    2  
ATOM   9341   O O    . GLN A 1 58  ? -2.822  1.738   -0.863  0.04 14.59 ? 114  GLN A O    2  
ATOM   9342   C CB   . GLN A 1 58  ? -2.353  4.305   -2.544  0.04 15.05 ? 114  GLN A CB   2  
ATOM   9343   C CG   . GLN A 1 58  ? -1.881  5.411   -3.603  0.04 15.42 ? 114  GLN A CG   2  
ATOM   9344   C CD   . GLN A 1 58  ? -3.023  6.338   -4.068  0.04 15.73 ? 114  GLN A CD   2  
ATOM   9345   O OE1  . GLN A 1 58  ? -2.885  7.570   -4.094  0.04 15.56 ? 114  GLN A OE1  2  
ATOM   9346   N NE2  . GLN A 1 58  ? -4.150  5.751   -4.413  0.04 16.22 ? 114  GLN A NE2  2  
ATOM   9347   H H    . GLN A 1 58  ? -2.464  2.081   -3.713  0.04 15.19 ? 114  GLN A H    2  
ATOM   9348   H HA   . GLN A 1 58  ? -0.520  3.323   -2.331  0.04 14.55 ? 114  GLN A HA   2  
ATOM   9349   H HB2  . GLN A 1 58  ? -3.217  3.989   -2.846  0.04 15.23 ? 114  GLN A HB2  2  
ATOM   9350   H HB3  . GLN A 1 58  ? -2.453  4.763   -1.697  0.04 14.91 ? 114  GLN A HB3  2  
ATOM   9351   H HG2  . GLN A 1 58  ? -1.209  5.979   -3.194  0.04 15.28 ? 114  GLN A HG2  2  
ATOM   9352   H HG3  . GLN A 1 58  ? -1.512  4.962   -4.378  0.04 15.64 ? 114  GLN A HG3  2  
ATOM   9353   H HE21 . GLN A 1 58  ? -4.146  4.951   -4.726  0.04 16.35 ? 114  GLN A HE21 2  
ATOM   9354   H HE22 . GLN A 1 58  ? -4.888  6.180   -4.330  0.04 16.42 ? 114  GLN A HE22 2  
ATOM   9355   N N    . ILE A 1 59  ? -0.875  2.504   -0.009  0.04 14.05 ? 115  ILE A N    2  
ATOM   9356   C CA   . ILE A 1 59  ? -0.948  1.772   1.268   0.04 13.79 ? 115  ILE A CA   2  
ATOM   9357   C C    . ILE A 1 59  ? -1.278  2.739   2.390   0.04 13.70 ? 115  ILE A C    2  
ATOM   9358   O O    . ILE A 1 59  ? -0.497  3.654   2.677   0.04 13.57 ? 115  ILE A O    2  
ATOM   9359   C CB   . ILE A 1 59  ? 0.375   1.086   1.553   0.04 13.47 ? 115  ILE A CB   2  
ATOM   9360   C CG1  . ILE A 1 59  ? 0.792   0.170   0.378   0.04 13.60 ? 115  ILE A CG1  2  
ATOM   9361   C CG2  . ILE A 1 59  ? 0.305   0.304   2.827   0.04 13.27 ? 115  ILE A CG2  2  
ATOM   9362   C CD1  . ILE A 1 59  ? -0.223  -0.857  -0.035  0.04 13.87 ? 115  ILE A CD1  2  
ATOM   9363   H H    . ILE A 1 59  ? -0.200  3.029   -0.050  0.04 13.96 ? 115  ILE A H    2  
ATOM   9364   H HA   . ILE A 1 59  ? -1.639  1.096   1.215   0.04 13.91 ? 115  ILE A HA   2  
ATOM   9365   H HB   . ILE A 1 59  ? 1.054   1.767   1.653   0.04 13.34 ? 115  ILE A HB   2  
ATOM   9366   H HG12 . ILE A 1 59  ? 0.970   0.724   -0.398  0.04 13.72 ? 115  ILE A HG12 2  
ATOM   9367   H HG13 . ILE A 1 59  ? 1.601   -0.294  0.630   0.04 13.41 ? 115  ILE A HG13 2  
ATOM   9368   H HG21 . ILE A 1 59  ? 1.202   0.006   3.050   0.04 13.08 ? 115  ILE A HG21 2  
ATOM   9369   H HG22 . ILE A 1 59  ? -0.047  0.861   3.535   0.04 13.23 ? 115  ILE A HG22 2  
ATOM   9370   H HG23 . ILE A 1 59  ? -0.274  -0.461  2.701   0.04 13.41 ? 115  ILE A HG23 2  
ATOM   9371   H HD11 . ILE A 1 59  ? 0.174   -1.451  -0.692  0.04 13.95 ? 115  ILE A HD11 2  
ATOM   9372   H HD12 . ILE A 1 59  ? -0.489  -1.361  0.749   0.04 13.78 ? 115  ILE A HD12 2  
ATOM   9373   H HD13 . ILE A 1 59  ? -0.996  -0.412  -0.414  0.04 14.08 ? 115  ILE A HD13 2  
ATOM   9374   N N    . GLY A 1 60  ? -2.470  2.581   2.985   0.04 13.82 ? 116  GLY A N    2  
ATOM   9375   C CA   . GLY A 1 60  ? -2.877  3.396   4.124   0.04 13.78 ? 116  GLY A CA   2  
ATOM   9376   C C    . GLY A 1 60  ? -2.589  2.753   5.452   0.04 13.48 ? 116  GLY A C    2  
ATOM   9377   O O    . GLY A 1 60  ? -1.792  1.847   5.558   0.04 13.25 ? 116  GLY A O    2  
ATOM   9378   H H    . GLY A 1 60  ? -3.061  2.009   2.740   0.04 13.95 ? 116  GLY A H    2  
ATOM   9379   H HA2  . GLY A 1 60  ? -2.435  4.256   4.096   0.04 13.77 ? 116  GLY A HA2  2  
ATOM   9380   H HA3  . GLY A 1 60  ? -3.832  3.547   4.067   0.04 14.01 ? 116  GLY A HA3  2  
ATOM   9381   N N    . PHE A 1 61  ? -3.260  3.236   6.491   0.04 13.50 ? 117  PHE A N    2  
ATOM   9382   C CA   . PHE A 1 61  ? -3.077  2.673   7.823   0.04 13.27 ? 117  PHE A CA   2  
ATOM   9383   C C    . PHE A 1 61  ? -3.540  1.216   7.882   0.04 13.29 ? 117  PHE A C    2  
ATOM   9384   O O    . PHE A 1 61  ? -4.455  0.808   7.194   0.04 13.56 ? 117  PHE A O    2  
ATOM   9385   C CB   . PHE A 1 61  ? -3.855  3.484   8.867   0.04 13.38 ? 117  PHE A CB   2  
ATOM   9386   C CG   . PHE A 1 61  ? -3.204  4.814   9.217   0.04 13.31 ? 117  PHE A CG   2  
ATOM   9387   C CD1  . PHE A 1 61  ? -3.549  5.972   8.544   0.04 13.56 ? 117  PHE A CD1  2  
ATOM   9388   C CD2  . PHE A 1 61  ? -2.189  4.882   10.173  0.04 13.02 ? 117  PHE A CD2  2  
ATOM   9389   C CE1  . PHE A 1 61  ? -2.934  7.173   8.853   0.04 13.53 ? 117  PHE A CE1  2  
ATOM   9390   C CE2  . PHE A 1 61  ? -1.572  6.090   10.483  0.04 12.98 ? 117  PHE A CE2  2  
ATOM   9391   C CZ   . PHE A 1 61  ? -1.949  7.221   9.825   0.04 13.24 ? 117  PHE A CZ   2  
ATOM   9392   H H    . PHE A 1 61  ? -3.809  3.895   6.458   0.04 13.68 ? 117  PHE A H    2  
ATOM   9393   H HA   . PHE A 1 61  ? -2.136  2.712   8.049   0.04 13.05 ? 117  PHE A HA   2  
ATOM   9394   H HB2  . PHE A 1 61  ? -4.746  3.655   8.526   0.04 13.63 ? 117  PHE A HB2  2  
ATOM   9395   H HB3  . PHE A 1 61  ? -3.910  2.960   9.682   0.04 13.28 ? 117  PHE A HB3  2  
ATOM   9396   H HD1  . PHE A 1 61  ? -4.212  5.951   7.894   0.04 13.78 ? 117  PHE A HD1  2  
ATOM   9397   H HD2  . PHE A 1 61  ? -1.934  4.121   10.632  0.04 12.87 ? 117  PHE A HD2  2  
ATOM   9398   H HE1  . PHE A 1 61  ? -3.179  7.948   8.406   0.04 13.73 ? 117  PHE A HE1  2  
ATOM   9399   H HE2  . PHE A 1 61  ? -0.908  6.127   11.134  0.04 12.81 ? 117  PHE A HE2  2  
ATOM   9400   H HZ   . PHE A 1 61  ? -1.533  8.024   10.026  0.04 13.24 ? 117  PHE A HZ   2  
ATOM   9401   N N    . TYR A 1 62  ? -2.864  0.446   8.727   0.04 13.03 ? 118  TYR A N    2  
ATOM   9402   C CA   . TYR A 1 62  ? -3.223  -0.958  9.021   0.04 13.06 ? 118  TYR A CA   2  
ATOM   9403   C C    . TYR A 1 62  ? -3.535  -1.773  7.769   0.04 13.24 ? 118  TYR A C    2  
ATOM   9404   O O    . TYR A 1 62  ? -4.476  -2.546  7.744   0.04 13.46 ? 118  TYR A O    2  
ATOM   9405   C CB   . TYR A 1 62  ? -4.401  -1.060  9.988   0.04 13.25 ? 118  TYR A CB   2  
ATOM   9406   C CG   . TYR A 1 62  ? -4.309  -0.157  11.192  0.04 13.14 ? 118  TYR A CG   2  
ATOM   9407   C CD1  . TYR A 1 62  ? -3.486  -0.436  12.268  0.04 12.90 ? 118  TYR A CD1  2  
ATOM   9408   C CD2  . TYR A 1 62  ? -5.080  0.979   11.255  0.04 13.34 ? 118  TYR A CD2  2  
ATOM   9409   C CE1  . TYR A 1 62  ? -3.444  0.405   13.380  0.04 12.84 ? 118  TYR A CE1  2  
ATOM   9410   C CE2  . TYR A 1 62  ? -5.033  1.821   12.324  0.04 13.28 ? 118  TYR A CE2  2  
ATOM   9411   C CZ   . TYR A 1 62  ? -4.225  1.534   13.384  0.04 13.03 ? 118  TYR A CZ   2  
ATOM   9412   O OH   . TYR A 1 62  ? -4.216  2.404   14.437  0.04 13.01 ? 118  TYR A OH   2  
ATOM   9413   H H    . TYR A 1 62  ? -2.168  0.717   9.148   0.04 12.86 ? 118  TYR A H    2  
ATOM   9414   H HA   . TYR A 1 62  ? -2.469  -1.373  9.455   0.04 12.87 ? 118  TYR A HA   2  
ATOM   9415   H HB2  . TYR A 1 62  ? -5.210  -0.836  9.507   0.04 13.48 ? 118  TYR A HB2  2  
ATOM   9416   H HB3  . TYR A 1 62  ? -4.452  -1.978  10.283  0.04 13.25 ? 118  TYR A HB3  2  
ATOM   9417   H HD1  . TYR A 1 62  ? -2.965  -1.208  12.260  0.04 12.79 ? 118  TYR A HD1  2  
ATOM   9418   H HD2  . TYR A 1 62  ? -5.640  1.192   10.543  0.04 13.53 ? 118  TYR A HD2  2  
ATOM   9419   H HE1  . TYR A 1 62  ? -2.891  0.224   14.103  0.04 12.70 ? 118  TYR A HE1  2  
ATOM   9420   H HE2  . TYR A 1 62  ? -5.568  2.582   12.330  0.04 13.44 ? 118  TYR A HE2  2  
ATOM   9421   H HH   . TYR A 1 62  ? -4.967  2.400   14.816  0.04 13.15 ? 118  TYR A HH   2  
ATOM   9422   N N    . THR A 1 63  ? -2.663  -1.619  6.775   0.04 13.15 ? 119  THR A N    2  
ATOM   9423   C CA   . THR A 1 63  ? -2.744  -2.371  5.522   0.04 13.32 ? 119  THR A CA   2  
ATOM   9424   C C    . THR A 1 63  ? -1.376  -2.958  5.219   0.04 13.09 ? 119  THR A C    2  
ATOM   9425   O O    . THR A 1 63  ? -0.464  -2.204  4.917   0.04 12.90 ? 119  THR A O    2  
ATOM   9426   C CB   . THR A 1 63  ? -3.146  -1.451  4.340   0.04 13.56 ? 119  THR A CB   2  
ATOM   9427   O OG1  . THR A 1 63  ? -4.423  -0.862  4.618   0.04 13.81 ? 119  THR A OG1  2  
ATOM   9428   C CG2  . THR A 1 63  ? -3.297  -2.231  3.067   0.04 13.77 ? 119  THR A CG2  2  
ATOM   9429   H H    . THR A 1 63  ? -2.001  -1.079  6.808   0.04 13.01 ? 119  THR A H    2  
ATOM   9430   H HA   . THR A 1 63  ? -3.393  -3.076  5.603   0.04 13.46 ? 119  THR A HA   2  
ATOM   9431   H HB   . THR A 1 63  ? -2.488  -0.754  4.220   0.04 13.44 ? 119  THR A HB   2  
ATOM   9432   H HG1  . THR A 1 63  ? -4.377  -0.441  5.342   0.04 13.71 ? 119  THR A HG1  2  
ATOM   9433   H HG21 . THR A 1 63  ? -3.577  -1.639  2.348   0.04 13.97 ? 119  THR A HG21 2  
ATOM   9434   H HG22 . THR A 1 63  ? -2.445  -2.639  2.830   0.04 13.64 ? 119  THR A HG22 2  
ATOM   9435   H HG23 . THR A 1 63  ? -3.971  -2.921  3.173   0.04 13.89 ? 119  THR A HG23 2  
ATOM   9436   N N    . SER A 1 64  ? -1.258  -4.290  5.250   0.04 13.14 ? 120  SER A N    2  
ATOM   9437   C CA   . SER A 1 64  ? -0.052  -4.993  4.785   0.04 13.01 ? 120  SER A CA   2  
ATOM   9438   C C    . SER A 1 64  ? -0.252  -5.426  3.343   0.04 13.27 ? 120  SER A C    2  
ATOM   9439   O O    . SER A 1 64  ? -1.365  -5.701  2.913   0.04 13.55 ? 120  SER A O    2  
ATOM   9440   C CB   . SER A 1 64  ? 0.226   -6.250  5.626   0.04 12.93 ? 120  SER A CB   2  
ATOM   9441   O OG   . SER A 1 64  ? -0.874  -7.153  5.609   0.04 13.17 ? 120  SER A OG   2  
ATOM   9442   H H    . SER A 1 64  ? -1.878  -4.819  5.508   0.04 13.27 ? 120  SER A H    2  
ATOM   9443   H HA   . SER A 1 64  ? 0.711   -4.408  4.836   0.04 12.86 ? 120  SER A HA   2  
ATOM   9444   H HB2  . SER A 1 64  ? 1.002   -6.714  5.278   0.04 12.88 ? 120  SER A HB2  2  
ATOM   9445   H HB3  . SER A 1 64  ? 0.394   -5.989  6.547   0.04 12.78 ? 120  SER A HB3  2  
ATOM   9446   H HG   . SER A 1 64  ? -0.641  -7.892  5.919   0.04 13.22 ? 120  SER A HG   2  
ATOM   9447   N N    . ILE A 1 65  ? 0.837   -5.436  2.586   0.04 13.21 ? 121  ILE A N    2  
ATOM   9448   C CA   . ILE A 1 65  ? 0.793   -5.953  1.213   0.04 13.48 ? 121  ILE A CA   2  
ATOM   9449   C C    . ILE A 1 65  ? 2.007   -6.838  1.010   0.04 13.38 ? 121  ILE A C    2  
ATOM   9450   O O    . ILE A 1 65  ? 3.121   -6.539  1.450   0.04 13.14 ? 121  ILE A O    2  
ATOM   9451   C CB   . ILE A 1 65  ? 0.738   -4.816  0.169   0.04 13.62 ? 121  ILE A CB   2  
ATOM   9452   C CG1  . ILE A 1 65  ? 0.558   -5.396  -1.243  0.04 13.96 ? 121  ILE A CG1  2  
ATOM   9453   C CG2  . ILE A 1 65  ? 1.948   -3.939  0.253   0.04 13.39 ? 121  ILE A CG2  2  
ATOM   9454   C CD1  . ILE A 1 65  ? 0.174   -4.358  -2.249  0.04 14.22 ? 121  ILE A CD1  2  
ATOM   9455   H H    . ILE A 1 65  ? 1.601   -5.159  2.839   0.04 13.04 ? 121  ILE A H    2  
ATOM   9456   H HA   . ILE A 1 65  ? 0.008   -6.495  1.099   0.04 13.66 ? 121  ILE A HA   2  
ATOM   9457   H HB   . ILE A 1 65  ? -0.034  -4.263  0.370   0.04 13.69 ? 121  ILE A HB   2  
ATOM   9458   H HG12 . ILE A 1 65  ? 1.406   -5.776  -1.526  0.04 13.91 ? 121  ILE A HG12 2  
ATOM   9459   H HG13 . ILE A 1 65  ? -0.125  -6.082  -1.236  0.04 14.10 ? 121  ILE A HG13 2  
ATOM   9460   H HG21 . ILE A 1 65  ? 1.815   -3.155  -0.304  0.04 13.51 ? 121  ILE A HG21 2  
ATOM   9461   H HG22 . ILE A 1 65  ? 2.065   -3.666  1.175   0.04 13.21 ? 121  ILE A HG22 2  
ATOM   9462   H HG23 . ILE A 1 65  ? 2.723   -4.436  -0.049  0.04 13.33 ? 121  ILE A HG23 2  
ATOM   9463   H HD11 . ILE A 1 65  ? -0.085  -4.804  -3.071  0.04 14.46 ? 121  ILE A HD11 2  
ATOM   9464   H HD12 . ILE A 1 65  ? -0.573  -3.835  -1.915  0.04 14.29 ? 121  ILE A HD12 2  
ATOM   9465   H HD13 . ILE A 1 65  ? 0.939   -3.785  -2.406  0.04 14.12 ? 121  ILE A HD13 2  
ATOM   9466   N N    . ALA A 1 66  ? 1.762   -7.963  0.355   0.04 13.62 ? 122  ALA A N    2  
ATOM   9467   C CA   . ALA A 1 66  ? 2.806   -8.943  0.138   0.04 13.61 ? 122  ALA A CA   2  
ATOM   9468   C C    . ALA A 1 66  ? 2.528   -9.845  -1.029  0.04 13.95 ? 122  ALA A C    2  
ATOM   9469   O O    . ALA A 1 66  ? 1.395   -10.076 -1.422  0.04 14.21 ? 122  ALA A O    2  
ATOM   9470   C CB   . ALA A 1 66  ? 2.989   -9.812  1.373   0.04 13.50 ? 122  ALA A CB   2  
ATOM   9471   H H    . ALA A 1 66  ? 1.005   -8.179  0.026   0.04 13.81 ? 122  ALA A H    2  
ATOM   9472   H HA   . ALA A 1 66  ? 3.631   -8.480  -0.037  0.04 13.48 ? 122  ALA A HA   2  
ATOM   9473   H HB1  . ALA A 1 66  ? 3.526   -10.582 1.138   0.04 13.58 ? 122  ALA A HB1  2  
ATOM   9474   H HB2  . ALA A 1 66  ? 3.421   -9.292  2.068   0.04 13.28 ? 122  ALA A HB2  2  
ATOM   9475   H HB3  . ALA A 1 66  ? 2.114   -10.110 1.664   0.04 13.62 ? 122  ALA A HB3  2  
ATOM   9476   N N    . GLY A 1 67  ? 3.611   -10.376 -1.543  0.04 13.97 ? 123  GLY A N    2  
ATOM   9477   C CA   . GLY A 1 67  ? 3.558   -11.461 -2.518  0.04 14.30 ? 123  GLY A CA   2  
ATOM   9478   C C    . GLY A 1 67  ? 3.629   -12.832 -1.864  0.04 14.34 ? 123  GLY A C    2  
ATOM   9479   O O    . GLY A 1 67  ? 4.074   -12.988 -0.739  0.04 14.09 ? 123  GLY A O    2  
ATOM   9480   H H    . GLY A 1 67  ? 4.404   -10.140 -1.324  0.04 13.82 ? 123  GLY A H    2  
ATOM   9481   H HA2  . GLY A 1 67  ? 2.746   -11.402 -3.034  0.04 14.51 ? 123  GLY A HA2  2  
ATOM   9482   H HA3  . GLY A 1 67  ? 4.306   -11.378 -3.124  0.04 14.33 ? 123  GLY A HA3  2  
ATOM   9483   N N    . LEU A 1 68  ? 3.206   -13.830 -2.635  0.04 14.70 ? 124  LEU A N    2  
ATOM   9484   C CA   . LEU A 1 68  ? 3.084   -15.207 -2.178  0.04 14.84 ? 124  LEU A CA   2  
ATOM   9485   C C    . LEU A 1 68  ? 4.027   -16.187 -2.882  0.04 15.09 ? 124  LEU A C    2  
ATOM   9486   O O    . LEU A 1 68  ? 3.872   -17.403 -2.808  0.04 15.32 ? 124  LEU A O    2  
ATOM   9487   C CB   . LEU A 1 68  ? 1.627   -15.651 -2.308  0.04 15.11 ? 124  LEU A CB   2  
ATOM   9488   C CG   . LEU A 1 68  ? 0.595   -15.022 -1.367  0.04 14.97 ? 124  LEU A CG   2  
ATOM   9489   C CD1  . LEU A 1 68  ? -0.841  -15.371 -1.755  0.04 15.36 ? 124  LEU A CD1  2  
ATOM   9490   C CD2  . LEU A 1 68  ? 0.892   -15.501 0.049   0.04 14.76 ? 124  LEU A CD2  2  
ATOM   9491   H H    . LEU A 1 68  ? 2.976   -13.720 -3.452  0.04 14.88 ? 124  LEU A H    2  
ATOM   9492   H HA   . LEU A 1 68  ? 3.312   -15.238 -1.235  0.04 14.63 ? 124  LEU A HA   2  
ATOM   9493   H HB2  . LEU A 1 68  ? 1.333   -15.450 -3.213  0.04 15.32 ? 124  LEU A HB2  2  
ATOM   9494   H HB3  . LEU A 1 68  ? 1.603   -16.613 -2.172  0.04 15.25 ? 124  LEU A HB3  2  
ATOM   9495   H HG   . LEU A 1 68  ? 0.688   -14.058 -1.389  0.04 14.80 ? 124  LEU A HG   2  
ATOM   9496   H HD11 . LEU A 1 68  ? -1.454  -14.954 -1.130  0.04 15.30 ? 124  LEU A HD11 2  
ATOM   9497   H HD12 . LEU A 1 68  ? -1.009  -15.038 -2.650  0.04 15.49 ? 124  LEU A HD12 2  
ATOM   9498   H HD13 . LEU A 1 68  ? -0.945  -16.336 -1.726  0.04 15.57 ? 124  LEU A HD13 2  
ATOM   9499   H HD21 . LEU A 1 68  ? 0.116   -15.339 0.609   0.04 14.69 ? 124  LEU A HD21 2  
ATOM   9500   H HD22 . LEU A 1 68  ? 1.083   -16.450 0.019   0.04 14.96 ? 124  LEU A HD22 2  
ATOM   9501   H HD23 . LEU A 1 68  ? 1.660   -15.017 0.392   0.04 14.54 ? 124  LEU A HD23 2  
ATOM   9502   N N    . GLY A 1 69  ? 5.063   -15.661 -3.521  0.04 15.06 ? 125  GLY A N    2  
ATOM   9503   C CA   . GLY A 1 69  ? 6.136   -16.505 -3.995  0.04 15.27 ? 125  GLY A CA   2  
ATOM   9504   C C    . GLY A 1 69  ? 7.095   -16.819 -2.868  0.04 15.05 ? 125  GLY A C    2  
ATOM   9505   O O    . GLY A 1 69  ? 6.941   -16.337 -1.749  0.04 14.73 ? 125  GLY A O    2  
ATOM   9506   H H    . GLY A 1 69  ? 5.161   -14.828 -3.691  0.04 14.95 ? 125  GLY A H    2  
ATOM   9507   H HA2  . GLY A 1 69  ? 5.783   -17.337 -4.346  0.04 15.54 ? 125  GLY A HA2  2  
ATOM   9508   H HA3  . GLY A 1 69  ? 6.627   -16.052 -4.699  0.04 15.31 ? 125  GLY A HA3  2  
ATOM   9509   N N    . LEU A 1 70  ? 8.114   -17.622 -3.180  0.04 15.29 ? 126  LEU A N    2  
ATOM   9510   C CA   . LEU A 1 70  ? 9.137   -17.928 -2.208  0.04 15.19 ? 126  LEU A CA   2  
ATOM   9511   C C    . LEU A 1 70  ? 10.128  -16.755 -2.193  0.04 14.91 ? 126  LEU A C    2  
ATOM   9512   O O    . LEU A 1 70  ? 10.765  -16.467 -1.183  0.04 14.64 ? 126  LEU A O    2  
ATOM   9513   C CB   . LEU A 1 70  ? 9.819   -19.250 -2.586  0.04 15.60 ? 126  LEU A CB   2  
ATOM   9514   C CG   . LEU A 1 70  ? 10.845  -19.804 -1.601  0.04 15.72 ? 126  LEU A CG   2  
ATOM   9515   C CD1  . LEU A 1 70  ? 10.346  -19.805 -0.122  0.04 15.55 ? 126  LEU A CD1  2  
ATOM   9516   C CD2  . LEU A 1 70  ? 11.275  -21.236 -2.065  0.04 16.23 ? 126  LEU A CD2  2  
ATOM   9517   H H    . LEU A 1 70  ? 8.229   -17.991 -3.945  0.04 15.55 ? 126  LEU A H    2  
ATOM   9518   H HA   . LEU A 1 70  ? 8.744   -18.017 -1.328  0.04 15.08 ? 126  LEU A HA   2  
ATOM   9519   H HB2  . LEU A 1 70  ? 9.137   -19.931 -2.686  0.04 15.78 ? 126  LEU A HB2  2  
ATOM   9520   H HB3  . LEU A 1 70  ? 10.268  -19.120 -3.436  0.04 15.73 ? 126  LEU A HB3  2  
ATOM   9521   H HG   . LEU A 1 70  ? 11.635  -19.246 -1.642  0.04 15.58 ? 126  LEU A HG   2  
ATOM   9522   H HD11 . LEU A 1 70  ? 10.993  -20.283 0.399   0.04 15.51 ? 126  LEU A HD11 2  
ATOM   9523   H HD12 . LEU A 1 70  ? 10.276  -18.891 0.188   0.04 15.29 ? 126  LEU A HD12 2  
ATOM   9524   H HD13 . LEU A 1 70  ? 9.482   -20.238 -0.067  0.04 15.77 ? 126  LEU A HD13 2  
ATOM   9525   H HD21 . LEU A 1 70  ? 12.224  -21.338 -1.904  0.04 16.28 ? 126  LEU A HD21 2  
ATOM   9526   H HD22 . LEU A 1 70  ? 10.773  -21.903 -1.572  0.04 16.41 ? 126  LEU A HD22 2  
ATOM   9527   H HD23 . LEU A 1 70  ? 11.097  -21.328 -3.012  0.04 16.32 ? 126  LEU A HD23 2  
ATOM   9528   N N    . ASN A 1 71  ? 10.134  -16.044 -3.318  0.04 15.02 ? 127  ASN A N    2  
ATOM   9529   C CA   . ASN A 1 71  ? 11.292  -15.364 -3.858  0.04 14.83 ? 127  ASN A CA   2  
ATOM   9530   C C    . ASN A 1 71  ? 10.621  -14.100 -4.386  0.04 14.69 ? 127  ASN A C    2  
ATOM   9531   O O    . ASN A 1 71  ? 9.574   -14.188 -5.057  0.04 14.84 ? 127  ASN A O    2  
ATOM   9532   C CB   . ASN A 1 71  ? 11.900  -16.186 -5.028  0.04 15.13 ? 127  ASN A CB   2  
ATOM   9533   C CG   . ASN A 1 71  ? 13.022  -17.161 -4.613  0.04 15.21 ? 127  ASN A CG   2  
ATOM   9534   O OD1  . ASN A 1 71  ? 13.274  -18.136 -5.334  0.04 15.52 ? 127  ASN A OD1  2  
ATOM   9535   N ND2  . ASN A 1 71  ? 13.688  -16.897 -3.490  0.04 14.97 ? 127  ASN A ND2  2  
ATOM   9536   H H    . ASN A 1 71  ? 9.433   -15.897 -3.791  0.04 15.23 ? 127  ASN A H    2  
ATOM   9537   H HA   . ASN A 1 71  ? 11.935  -15.170 -3.164  0.04 14.62 ? 127  ASN A HA   2  
ATOM   9538   H HB2  . ASN A 1 71  ? 11.202  -16.744 -5.361  0.04 15.38 ? 127  ASN A HB2  2  
ATOM   9539   H HB3  . ASN A 1 71  ? 12.222  -15.647 -5.738  0.04 15.04 ? 127  ASN A HB3  2  
ATOM   9540   H HD21 . ASN A 1 71  ? 14.134  -17.522 -3.099  0.04 14.99 ? 127  ASN A HD21 2  
ATOM   9541   H HD22 . ASN A 1 71  ? 13.668  -16.110 -3.150  0.04 14.81 ? 127  ASN A HD22 2  
ATOM   9542   N N    . PRO A 1 72  ? 11.172  -12.923 -4.099  0.04 14.43 ? 128  PRO A N    2  
ATOM   9543   C CA   . PRO A 1 72  ? 10.379  -11.715 -4.383  0.04 14.32 ? 128  PRO A CA   2  
ATOM   9544   C C    . PRO A 1 72  ? 9.993   -11.524 -5.878  0.04 14.64 ? 128  PRO A C    2  
ATOM   9545   O O    . PRO A 1 72  ? 8.895   -11.066 -6.187  0.04 14.68 ? 128  PRO A O    2  
ATOM   9546   C CB   . PRO A 1 72  ? 11.274  -10.584 -3.858  0.04 14.06 ? 128  PRO A CB   2  
ATOM   9547   C CG   . PRO A 1 72  ? 12.155  -11.303 -2.767  0.04 13.93 ? 128  PRO A CG   2  
ATOM   9548   C CD   . PRO A 1 72  ? 12.454  -12.603 -3.436  0.04 14.20 ? 128  PRO A CD   2  
ATOM   9549   H HA   . PRO A 1 72  ? 9.568   -11.732 -3.852  0.04 14.21 ? 128  PRO A HA   2  
ATOM   9550   H HB2  . PRO A 1 72  ? 11.836  -10.257 -4.577  0.04 14.19 ? 128  PRO A HB2  2  
ATOM   9551   H HB3  . PRO A 1 72  ? 10.734  -9.870  -3.489  0.04 13.90 ? 128  PRO A HB3  2  
ATOM   9552   H HG2  . PRO A 1 72  ? 12.962  -10.797 -2.591  0.04 13.91 ? 128  PRO A HG2  2  
ATOM   9553   H HG3  . PRO A 1 72  ? 11.627  -11.431 -1.970  0.04 13.73 ? 128  PRO A HG3  2  
ATOM   9554   H HD2  . PRO A 1 72  ? 13.156  -12.485 -4.093  0.04 14.35 ? 128  PRO A HD2  2  
ATOM   9555   H HD3  . PRO A 1 72  ? 12.692  -13.279 -2.786  0.04 14.12 ? 128  PRO A HD3  2  
ATOM   9556   N N    . ASP A 1 73  ? 10.872  -11.943 -6.777  0.04 14.91 ? 129  ASP A N    2  
ATOM   9557   C CA   . ASP A 1 73  ? 10.611  -11.825 -8.220  0.04 15.26 ? 129  ASP A CA   2  
ATOM   9558   C C    . ASP A 1 73  ? 9.436   -12.682 -8.690  0.04 15.56 ? 129  ASP A C    2  
ATOM   9559   O O    . ASP A 1 73  ? 8.804   -12.394 -9.706  0.04 15.90 ? 129  ASP A O    2  
ATOM   9560   C CB   . ASP A 1 73  ? 11.833  -12.244 -9.010  0.04 15.51 ? 129  ASP A CB   2  
ATOM   9561   C CG   . ASP A 1 73  ? 12.862  -11.139 -9.171  0.04 15.36 ? 129  ASP A CG   2  
ATOM   9562   O OD1  . ASP A 1 73  ? 12.712  -10.002 -8.685  0.04 15.30 ? 129  ASP A OD1  2  
ATOM   9563   O OD2  . ASP A 1 73  ? 13.823  -11.401 -9.889  0.04 15.33 ? 129  ASP A OD2  2  
ATOM   9564   H H    . ASP A 1 73  ? 11.627  -12.295 -6.579  0.04 14.90 ? 129  ASP A H    2  
ATOM   9565   H HA   . ASP A 1 73  ? 10.420  -10.901 -8.428  0.04 15.19 ? 129  ASP A HA   2  
ATOM   9566   H HB2  . ASP A 1 73  ? 12.252  -13.005 -8.586  0.04 15.52 ? 129  ASP A HB2  2  
ATOM   9567   H HB3  . ASP A 1 73  ? 11.537  -12.492 -9.900  0.04 15.79 ? 129  ASP A HB3  2  
ATOM   9568   N N    . ASP A 1 74  ? 9.141   -13.739 -7.960  0.04 15.49 ? 130  ASP A N    2  
ATOM   9569   C CA   . ASP A 1 74  ? 8.007   -14.572 -8.307  0.04 15.79 ? 130  ASP A CA   2  
ATOM   9570   C C    . ASP A 1 74  ? 6.687   -13.793 -8.350  0.04 15.76 ? 130  ASP A C    2  
ATOM   9571   O O    . ASP A 1 74  ? 5.756   -14.203 -9.034  0.04 16.08 ? 130  ASP A O    2  
ATOM   9572   C CB   . ASP A 1 74  ? 7.944   -15.781 -7.359  0.04 15.79 ? 130  ASP A CB   2  
ATOM   9573   C CG   . ASP A 1 74  ? 9.110   -16.765 -7.589  0.04 15.84 ? 130  ASP A CG   2  
ATOM   9574   O OD1  . ASP A 1 74  ? 9.617   -17.408 -6.656  0.04 15.73 ? 130  ASP A OD1  2  
ATOM   9575   O OD2  . ASP A 1 74  ? 9.516   -16.942 -8.725  0.04 16.01 ? 130  ASP A OD2  2  
ATOM   9576   H H    . ASP A 1 74  ? 9.566   -13.991 -7.258  0.04 15.30 ? 130  ASP A H    2  
ATOM   9577   H HA   . ASP A 1 74  ? 8.156   -14.916 -9.202  0.04 16.09 ? 130  ASP A HA   2  
ATOM   9578   H HB2  . ASP A 1 74  ? 7.981   -15.468 -6.444  0.04 15.54 ? 130  ASP A HB2  2  
ATOM   9579   H HB3  . ASP A 1 74  ? 7.110   -16.248 -7.512  0.04 16.05 ? 130  ASP A HB3  2  
ATOM   9580   N N    . THR A 1 75  ? 6.646   -12.623 -7.714  0.04 15.41 ? 131  THR A N    2  
ATOM   9581   C CA   . THR A 1 75  ? 5.455   -11.782 -7.714  0.04 15.40 ? 131  THR A CA   2  
ATOM   9582   C C    . THR A 1 75  ? 5.837   -10.350 -8.064  0.04 15.30 ? 131  THR A C    2  
ATOM   9583   O O    . THR A 1 75  ? 6.360   -9.624  -7.219  0.04 14.96 ? 131  THR A O    2  
ATOM   9584   C CB   . THR A 1 75  ? 4.718   -11.775 -6.354  0.04 15.10 ? 131  THR A CB   2  
ATOM   9585   O OG1  . THR A 1 75  ? 4.577   -13.120 -5.861  0.04 15.18 ? 131  THR A OG1  2  
ATOM   9586   C CG2  . THR A 1 75  ? 3.328   -11.223 -6.538  0.04 15.22 ? 131  THR A CG2  2  
ATOM   9587   H H    . THR A 1 75  ? 7.301   -12.291 -7.275  0.04 15.21 ? 131  THR A H    2  
ATOM   9588   H HA   . THR A 1 75  ? 4.840   -12.095 -8.393  0.04 15.68 ? 131  THR A HA   2  
ATOM   9589   H HB   . THR A 1 75  ? 5.202   -11.224 -5.720  0.04 14.83 ? 131  THR A HB   2  
ATOM   9590   H HG1  . THR A 1 75  ? 4.986   -13.656 -6.355  0.04 15.39 ? 131  THR A HG1  2  
ATOM   9591   H HG21 . THR A 1 75  ? 2.678   -11.884 -6.259  0.04 15.45 ? 131  THR A HG21 2  
ATOM   9592   H HG22 . THR A 1 75  ? 3.199   -10.412 -6.023  0.04 15.00 ? 131  THR A HG22 2  
ATOM   9593   H HG23 . THR A 1 75  ? 3.185   -11.034 -7.480  0.04 15.32 ? 131  THR A HG23 2  
ATOM   9594   N N    . THR A 1 76  ? 5.557   -9.954  -9.294  0.04 15.64 ? 132  THR A N    2  
ATOM   9595   C CA   . THR A 1 76  ? 6.113   -8.737  -9.841  0.04 15.67 ? 132  THR A CA   2  
ATOM   9596   C C    . THR A 1 76  ? 5.013   -7.758  -10.254 0.04 15.82 ? 132  THR A C    2  
ATOM   9597   O O    . THR A 1 76  ? 4.070   -8.127  -10.928 0.04 16.15 ? 132  THR A O    2  
ATOM   9598   C CB   . THR A 1 76  ? 6.977   -9.064  -11.036 0.04 16.02 ? 132  THR A CB   2  
ATOM   9599   O OG1  . THR A 1 76  ? 7.918   -10.075 -10.649 0.04 15.84 ? 132  THR A OG1  2  
ATOM   9600   C CG2  . THR A 1 76  ? 7.750   -7.815  -11.500 0.04 16.25 ? 132  THR A CG2  2  
ATOM   9601   H H    . THR A 1 76  ? 5.055   -10.389 -9.840  0.04 15.89 ? 132  THR A H    2  
ATOM   9602   H HA   . THR A 1 76  ? 6.667   -8.314  -9.177  0.04 15.40 ? 132  THR A HA   2  
ATOM   9603   H HB   . THR A 1 76  ? 6.427   -9.382  -11.767 0.04 16.26 ? 132  THR A HB   2  
ATOM   9604   H HG1  . THR A 1 76  ? 8.659   -9.937  -11.020 0.04 15.94 ? 132  THR A HG1  2  
ATOM   9605   H HG21 . THR A 1 76  ? 8.434   -8.075  -12.136 0.04 16.46 ? 132  THR A HG21 2  
ATOM   9606   H HG22 . THR A 1 76  ? 7.154   -7.177  -11.921 0.04 16.45 ? 132  THR A HG22 2  
ATOM   9607   H HG23 . THR A 1 76  ? 8.182   -7.396  -10.739 0.04 16.04 ? 132  THR A HG23 2  
ATOM   9608   N N    . PHE A 1 77  ? 5.152   -6.522  -9.807  0.04 15.59 ? 133  PHE A N    2  
ATOM   9609   C CA   . PHE A 1 77  ? 4.240   -5.434  -10.182 0.04 15.76 ? 133  PHE A CA   2  
ATOM   9610   C C    . PHE A 1 77  ? 4.922   -4.560  -11.230 0.04 16.00 ? 133  PHE A C    2  
ATOM   9611   O O    . PHE A 1 77  ? 6.020   -4.055  -10.993 0.04 15.80 ? 133  PHE A O    2  
ATOM   9612   C CB   . PHE A 1 77  ? 3.949   -4.487  -8.996  0.04 15.40 ? 133  PHE A CB   2  
ATOM   9613   C CG   . PHE A 1 77  ? 3.016   -5.028  -7.921  0.04 15.24 ? 133  PHE A CG   2  
ATOM   9614   C CD1  . PHE A 1 77  ? 2.577   -6.331  -7.912  0.04 15.36 ? 133  PHE A CD1  2  
ATOM   9615   C CD2  . PHE A 1 77  ? 2.596   -4.177  -6.911  0.04 15.01 ? 133  PHE A CD2  2  
ATOM   9616   C CE1  . PHE A 1 77  ? 1.723   -6.786  -6.917  0.04 15.25 ? 133  PHE A CE1  2  
ATOM   9617   C CE2  . PHE A 1 77  ? 1.758   -4.628  -5.928  0.04 14.90 ? 133  PHE A CE2  2  
ATOM   9618   C CZ   . PHE A 1 77  ? 1.326   -5.929  -5.928  0.04 15.02 ? 133  PHE A CZ   2  
ATOM   9619   H H    . PHE A 1 77  ? 5.778   -6.275  -9.275  0.04 15.36 ? 133  PHE A H    2  
ATOM   9620   H HA   . PHE A 1 77  ? 3.408   -5.779  -10.534 0.04 15.98 ? 133  PHE A HA   2  
ATOM   9621   H HB2  . PHE A 1 77  ? 4.794   -4.287  -8.562  0.04 15.17 ? 133  PHE A HB2  2  
ATOM   9622   H HB3  . PHE A 1 77  ? 3.557   -3.676  -9.344  0.04 15.53 ? 133  PHE A HB3  2  
ATOM   9623   H HD1  . PHE A 1 77  ? 2.850   -6.910  -8.585  0.04 15.53 ? 133  PHE A HD1  2  
ATOM   9624   H HD2  . PHE A 1 77  ? 2.884   -3.297  -6.901  0.04 14.96 ? 133  PHE A HD2  2  
ATOM   9625   H HE1  . PHE A 1 77  ? 1.434   -7.669  -6.923  0.04 15.35 ? 133  PHE A HE1  2  
ATOM   9626   H HE2  . PHE A 1 77  ? 1.483   -4.048  -5.254  0.04 14.77 ? 133  PHE A HE2  2  
ATOM   9627   H HZ   . PHE A 1 77  ? 0.756   -6.227  -5.258  0.04 14.97 ? 133  PHE A HZ   2  
ATOM   9628   N N    . ASN A 1 78  ? 4.274   -4.384  -12.369 0.04 16.45 ? 134  ASN A N    2  
ATOM   9629   C CA   . ASN A 1 78  ? 4.591   -3.268  -13.253 0.04 16.72 ? 134  ASN A CA   2  
ATOM   9630   C C    . ASN A 1 78  ? 3.735   -2.139  -12.744 0.04 16.66 ? 134  ASN A C    2  
ATOM   9631   O O    . ASN A 1 78  ? 2.538   -2.029  -13.050 0.04 16.94 ? 134  ASN A O    2  
ATOM   9632   C CB   . ASN A 1 78  ? 4.335   -3.649  -14.700 0.04 17.27 ? 134  ASN A CB   2  
ATOM   9633   C CG   . ASN A 1 78  ? 5.292   -4.691  -15.160 0.04 17.34 ? 134  ASN A CG   2  
ATOM   9634   O OD1  . ASN A 1 78  ? 6.484   -4.606  -14.895 0.04 17.15 ? 134  ASN A OD1  2  
ATOM   9635   N ND2  . ASN A 1 78  ? 4.782   -5.689  -15.803 0.04 17.65 ? 134  ASN A ND2  2  
ATOM   9636   H H    . ASN A 1 78  ? 3.648   -4.894  -12.656 0.04 16.63 ? 134  ASN A H    2  
ATOM   9637   H HA   . ASN A 1 78  ? 5.521   -3.017  -13.155 0.04 16.58 ? 134  ASN A HA   2  
ATOM   9638   H HB2  . ASN A 1 78  ? 3.438   -3.999  -14.785 0.04 17.42 ? 134  ASN A HB2  2  
ATOM   9639   H HB3  . ASN A 1 78  ? 4.448   -2.873  -15.269 0.04 17.48 ? 134  ASN A HB3  2  
ATOM   9640   H HD21 . ASN A 1 78  ? 5.154   -6.461  -15.770 0.04 17.67 ? 134  ASN A HD21 2  
ATOM   9641   H HD22 . ASN A 1 78  ? 4.071   -5.573  -16.269 0.04 17.87 ? 134  ASN A HD22 2  
ATOM   9642   N N    . GLY A 1 79  ? 4.368   -1.377  -11.866 0.04 16.30 ? 135  GLY A N    2  
ATOM   9643   C CA   . GLY A 1 79  ? 3.689   -0.422  -11.018 0.04 16.14 ? 135  GLY A CA   2  
ATOM   9644   C C    . GLY A 1 79  ? 4.397   -0.269  -9.693  0.04 15.63 ? 135  GLY A C    2  
ATOM   9645   O O    . GLY A 1 79  ? 5.591   -0.533  -9.572  0.04 15.46 ? 135  GLY A O    2  
ATOM   9646   H H    . GLY A 1 79  ? 5.213   -1.407  -11.734 0.04 16.15 ? 135  GLY A H    2  
ATOM   9647   H HA2  . GLY A 1 79  ? 3.655   0.443   -11.451 0.04 16.33 ? 135  GLY A HA2  2  
ATOM   9648   H HA3  . GLY A 1 79  ? 2.792   -0.734  -10.859 0.04 16.20 ? 135  GLY A HA3  2  
ATOM   9649   N N    . ASP A 1 80  ? 3.628   0.173   -8.692  0.04 15.43 ? 136  ASP A N    2  
ATOM   9650   C CA   . ASP A 1 80  ? 4.194   0.744   -7.480  0.04 15.03 ? 136  ASP A CA   2  
ATOM   9651   C C    . ASP A 1 80  ? 3.461   0.244   -6.251  0.04 14.75 ? 136  ASP A C    2  
ATOM   9652   O O    . ASP A 1 80  ? 2.277   -0.092  -6.304  0.04 14.90 ? 136  ASP A O    2  
ATOM   9653   C CB   . ASP A 1 80  ? 4.112   2.283   -7.531  0.04 15.17 ? 136  ASP A CB   2  
ATOM   9654   C CG   . ASP A 1 80  ? 4.830   2.894   -8.741  0.04 15.44 ? 136  ASP A CG   2  
ATOM   9655   O OD1  . ASP A 1 80  ? 4.575   2.474   -9.886  0.04 15.82 ? 136  ASP A OD1  2  
ATOM   9656   O OD2  . ASP A 1 80  ? 5.584   3.849   -8.532  0.04 15.30 ? 136  ASP A OD2  2  
ATOM   9657   H H    . ASP A 1 80  ? 2.773   0.161   -8.700  0.04 15.54 ? 136  ASP A H    2  
ATOM   9658   H HA   . ASP A 1 80  ? 5.125   0.491   -7.402  0.04 14.90 ? 136  ASP A HA   2  
ATOM   9659   H HB2  . ASP A 1 80  ? 3.185   2.554   -7.571  0.04 15.37 ? 136  ASP A HB2  2  
ATOM   9660   H HB3  . ASP A 1 80  ? 4.524   2.636   -6.725  0.04 14.92 ? 136  ASP A HB3  2  
ATOM   9661   N N    . VAL A 1 81  ? 4.189   0.210   -5.146  0.04 14.37 ? 137  VAL A N    2  
ATOM   9662   C CA   . VAL A 1 81  ? 3.624   -0.000  -3.807  0.04 14.10 ? 137  VAL A CA   2  
ATOM   9663   C C    . VAL A 1 81  ? 4.025   1.263   -3.068  0.04 13.98 ? 137  VAL A C    2  
ATOM   9664   O O    . VAL A 1 81  ? 5.202   1.454   -2.723  0.04 13.78 ? 137  VAL A O    2  
ATOM   9665   C CB   . VAL A 1 81  ? 4.166   -1.300  -3.178  0.04 13.78 ? 137  VAL A CB   2  
ATOM   9666   C CG1  . VAL A 1 81  ? 3.730   -1.457  -1.760  0.04 13.51 ? 137  VAL A CG1  2  
ATOM   9667   C CG2  . VAL A 1 81  ? 3.685   -2.523  -3.985  0.04 13.92 ? 137  VAL A CG2  2  
ATOM   9668   H H    . VAL A 1 81  ? 5.039   0.322   -5.135  0.04 14.27 ? 137  VAL A H    2  
ATOM   9669   H HA   . VAL A 1 81  ? 2.657   -0.040  -3.860  0.04 14.23 ? 137  VAL A HA   2  
ATOM   9670   H HB   . VAL A 1 81  ? 5.139   -1.279  -3.198  0.04 13.69 ? 137  VAL A HB   2  
ATOM   9671   H HG11 . VAL A 1 81  ? 3.644   -2.405  -1.567  0.04 13.33 ? 137  VAL A HG11 2  
ATOM   9672   H HG12 . VAL A 1 81  ? 4.397   -1.063  -1.178  0.04 13.45 ? 137  VAL A HG12 2  
ATOM   9673   H HG13 . VAL A 1 81  ? 2.872   -1.020  -1.641  0.04 13.61 ? 137  VAL A HG13 2  
ATOM   9674   H HG21 . VAL A 1 81  ? 4.207   -3.295  -3.722  0.04 13.74 ? 137  VAL A HG21 2  
ATOM   9675   H HG22 . VAL A 1 81  ? 2.745   -2.680  -3.796  0.04 14.05 ? 137  VAL A HG22 2  
ATOM   9676   H HG23 . VAL A 1 81  ? 3.810   -2.346  -4.932  0.04 14.09 ? 137  VAL A HG23 2  
ATOM   9677   N N    . THR A 1 82  ? 3.048   2.144   -2.874  0.04 14.17 ? 138  THR A N    2  
ATOM   9678   C CA   . THR A 1 82  ? 3.294   3.579   -2.624  0.04 14.19 ? 138  THR A CA   2  
ATOM   9679   C C    . THR A 1 82  ? 2.695   4.100   -1.330  0.04 13.90 ? 138  THR A C    2  
ATOM   9680   O O    . THR A 1 82  ? 1.468   4.018   -1.136  0.04 13.89 ? 138  THR A O    2  
ATOM   9681   C CB   . THR A 1 82  ? 2.603   4.474   -3.726  0.04 14.60 ? 138  THR A CB   2  
ATOM   9682   O OG1  . THR A 1 82  ? 3.248   4.325   -4.992  0.04 14.97 ? 138  THR A OG1  2  
ATOM   9683   C CG2  . THR A 1 82  ? 2.566   5.974   -3.380  0.04 14.66 ? 138  THR A CG2  2  
ATOM   9684   H H    . THR A 1 82  ? 2.218   1.932   -2.874  0.04 14.32 ? 138  THR A H    2  
ATOM   9685   H HA   . THR A 1 82  ? 4.246   3.748   -2.629  0.04 14.17 ? 138  THR A HA   2  
ATOM   9686   H HB   . THR A 1 82  ? 1.682   4.186   -3.808  0.04 14.62 ? 138  THR A HB   2  
ATOM   9687   H HG1  . THR A 1 82  ? 3.212   3.524   -5.238  0.04 15.19 ? 138  THR A HG1  2  
ATOM   9688   H HG21 . THR A 1 82  ? 3.203   6.450   -3.936  0.04 14.94 ? 138  THR A HG21 2  
ATOM   9689   H HG22 . THR A 1 82  ? 1.683   6.323   -3.572  0.04 14.66 ? 138  THR A HG22 2  
ATOM   9690   H HG23 . THR A 1 82  ? 2.773   6.172   -2.458  0.04 14.46 ? 138  THR A HG23 2  
ATOM   9691   N N    . VAL A 1 83  ? 3.535   4.688   -0.474  0.04 13.69 ? 139  VAL A N    2  
ATOM   9692   C CA   . VAL A 1 83  ? 3.077   5.578   0.599   0.04 13.59 ? 139  VAL A CA   2  
ATOM   9693   C C    . VAL A 1 83  ? 3.473   7.048   0.358   0.04 13.74 ? 139  VAL A C    2  
ATOM   9694   O O    . VAL A 1 83  ? 4.649   7.338   0.115   0.04 13.71 ? 139  VAL A O    2  
ATOM   9695   C CB   . VAL A 1 83  ? 3.621   5.120   1.989   0.04 13.21 ? 139  VAL A CB   2  
ATOM   9696   C CG1  . VAL A 1 83  ? 3.079   6.031   3.031   0.04 13.16 ? 139  VAL A CG1  2  
ATOM   9697   C CG2  . VAL A 1 83  ? 3.244   3.697   2.340   0.04 13.10 ? 139  VAL A CG2  2  
ATOM   9698   H H    . VAL A 1 83  ? 4.386   4.586   -0.484  0.04 13.63 ? 139  VAL A H    2  
ATOM   9699   H HA   . VAL A 1 83  ? 2.110   5.545   0.633   0.04 13.71 ? 139  VAL A HA   2  
ATOM   9700   H HB   . VAL A 1 83  ? 4.589   5.198   1.984   0.04 13.10 ? 139  VAL A HB   2  
ATOM   9701   H HG11 . VAL A 1 83  ? 3.310   5.686   3.908   0.04 12.95 ? 139  VAL A HG11 2  
ATOM   9702   H HG12 . VAL A 1 83  ? 3.467   6.911   2.906   0.04 13.22 ? 139  VAL A HG12 2  
ATOM   9703   H HG13 . VAL A 1 83  ? 2.117   6.070   2.926   0.04 13.31 ? 139  VAL A HG13 2  
ATOM   9704   H HG21 . VAL A 1 83  ? 3.606   3.494   3.214   0.04 12.88 ? 139  VAL A HG21 2  
ATOM   9705   H HG22 . VAL A 1 83  ? 2.277   3.610   2.357   0.04 13.18 ? 139  VAL A HG22 2  
ATOM   9706   H HG23 . VAL A 1 83  ? 3.620   3.096   1.681   0.04 13.19 ? 139  VAL A HG23 2  
ATOM   9707   N N    . ASP A 1 84  ? 2.494   7.953   0.457   0.04 13.93 ? 140  ASP A N    2  
ATOM   9708   C CA   . ASP A 1 84  ? 2.735   9.406   0.319   0.04 14.16 ? 140  ASP A CA   2  
ATOM   9709   C C    . ASP A 1 84  ? 1.940   10.062  1.476   0.04 14.14 ? 140  ASP A C    2  
ATOM   9710   O O    . ASP A 1 84  ? 1.446   9.368   2.381   0.04 13.98 ? 140  ASP A O    2  
ATOM   9711   C CB   . ASP A 1 84  ? 2.396   9.929   -1.095  0.04 14.60 ? 140  ASP A CB   2  
ATOM   9712   C CG   . ASP A 1 84  ? 3.033   11.325  -1.422  0.04 14.85 ? 140  ASP A CG   2  
ATOM   9713   O OD1  . ASP A 1 84  ? 2.741   11.834  -2.512  0.04 15.24 ? 140  ASP A OD1  2  
ATOM   9714   O OD2  . ASP A 1 84  ? 3.781   11.935  -0.587  0.04 14.68 ? 140  ASP A OD2  2  
ATOM   9715   H H    . ASP A 1 84  ? 1.674   7.753   0.618   0.04 13.95 ? 140  ASP A H    2  
ATOM   9716   H HA   . ASP A 1 84  ? 3.677   9.582   0.471   0.04 14.05 ? 140  ASP A HA   2  
ATOM   9717   H HB2  . ASP A 1 84  ? 2.740   9.300   -1.746  0.04 14.59 ? 140  ASP A HB2  2  
ATOM   9718   H HB3  . ASP A 1 84  ? 1.436   9.996   -1.192  0.04 14.77 ? 140  ASP A HB3  2  
ATOM   9719   N N    . ALA A 1 85  ? 1.839   11.382  1.464   0.04 14.32 ? 141  ALA A N    2  
ATOM   9720   C CA   . ALA A 1 85  ? 1.326   12.115  2.604   0.04 14.31 ? 141  ALA A CA   2  
ATOM   9721   C C    . ALA A 1 85  ? 0.185   13.095  2.282   0.04 14.75 ? 141  ALA A C    2  
ATOM   9722   O O    . ALA A 1 85  ? 0.033   14.111  2.956   0.04 14.86 ? 141  ALA A O    2  
ATOM   9723   C CB   . ALA A 1 85  ? 2.473   12.839  3.258   0.04 14.15 ? 141  ALA A CB   2  
ATOM   9724   H H    . ALA A 1 85  ? 2.055   11.877  0.796   0.04 14.46 ? 141  ALA A H    2  
ATOM   9725   H HA   . ALA A 1 85  ? 0.971   11.492  3.254   0.04 14.14 ? 141  ALA A HA   2  
ATOM   9726   H HB1  . ALA A 1 85  ? 2.194   13.198  4.114   0.04 14.18 ? 141  ALA A HB1  2  
ATOM   9727   H HB2  . ALA A 1 85  ? 3.194   12.206  3.388   0.04 13.88 ? 141  ALA A HB2  2  
ATOM   9728   H HB3  . ALA A 1 85  ? 2.769   13.555  2.674   0.04 14.32 ? 141  ALA A HB3  2  
ATOM   9729   N N    . GLY A 1 86  ? -0.615  12.785  1.257   0.04 15.04 ? 142  GLY A N    2  
ATOM   9730   C CA   . GLY A 1 86  ? -1.760  13.612  0.891   0.04 15.52 ? 142  GLY A CA   2  
ATOM   9731   C C    . GLY A 1 86  ? -2.577  14.030  2.106   0.04 15.60 ? 142  GLY A C    2  
ATOM   9732   O O    . GLY A 1 86  ? -2.946  15.208  2.226   0.04 15.94 ? 142  GLY A O    2  
ATOM   9733   H H    . GLY A 1 86  ? -0.512  12.091  0.758   0.04 14.98 ? 142  GLY A H    2  
ATOM   9734   H HA2  . GLY A 1 86  ? -1.460  14.407  0.426   0.04 15.67 ? 142  GLY A HA2  2  
ATOM   9735   H HA3  . GLY A 1 86  ? -2.350  13.118  0.304   0.04 15.71 ? 142  GLY A HA3  2  
ATOM   9736   N N    . TRP A 1 87  ? -2.821  13.072  3.006   0.04 15.33 ? 143  TRP A N    2  
ATOM   9737   C CA   . TRP A 1 87  ? -3.759  13.262  4.120   0.04 15.45 ? 143  TRP A CA   2  
ATOM   9738   C C    . TRP A 1 87  ? -3.234  14.182  5.255   0.04 15.39 ? 143  TRP A C    2  
ATOM   9739   O O    . TRP A 1 87  ? -4.052  14.741  6.026   0.04 15.61 ? 143  TRP A O    2  
ATOM   9740   C CB   . TRP A 1 87  ? -4.182  11.894  4.704   0.04 15.16 ? 143  TRP A CB   2  
ATOM   9741   C CG   . TRP A 1 87  ? -3.124  11.267  5.561   0.04 14.67 ? 143  TRP A CG   2  
ATOM   9742   C CD1  . TRP A 1 87  ? -2.038  10.533  5.126   0.04 14.38 ? 143  TRP A CD1  2  
ATOM   9743   C CD2  . TRP A 1 87  ? -3.008  11.343  6.990   0.04 14.46 ? 143  TRP A CD2  2  
ATOM   9744   N NE1  . TRP A 1 87  ? -1.276  10.144  6.202   0.04 14.00 ? 143  TRP A NE1  2  
ATOM   9745   C CE2  . TRP A 1 87  ? -1.842  10.639  7.354   0.04 14.05 ? 143  TRP A CE2  2  
ATOM   9746   C CE3  . TRP A 1 87  ? -3.778  11.953  7.997   0.04 14.63 ? 143  TRP A CE3  2  
ATOM   9747   C CZ2  . TRP A 1 87  ? -1.434  10.509  8.679   0.04 13.80 ? 143  TRP A CZ2  2  
ATOM   9748   C CZ3  . TRP A 1 87  ? -3.362  11.817  9.327   0.04 14.37 ? 143  TRP A CZ3  2  
ATOM   9749   C CH2  . TRP A 1 87  ? -2.198  11.100  9.651   0.04 13.96 ? 143  TRP A CH2  2  
ATOM   9750   H H    . TRP A 1 87  ? -2.470  12.288  2.980   0.04 15.11 ? 143  TRP A H    2  
ATOM   9751   H HA   . TRP A 1 87  ? -4.561  13.677  3.765   0.04 15.79 ? 143  TRP A HA   2  
ATOM   9752   H HB2  . TRP A 1 87  ? -4.977  12.007  5.247   0.04 15.29 ? 143  TRP A HB2  2  
ATOM   9753   H HB3  . TRP A 1 87  ? -4.371  11.293  3.968   0.04 15.21 ? 143  TRP A HB3  2  
ATOM   9754   H HD1  . TRP A 1 87  ? -1.859  10.331  4.240   0.04 14.45 ? 143  TRP A HD1  2  
ATOM   9755   H HE1  . TRP A 1 87  ? -0.553  9.681   6.161   0.04 13.80 ? 143  TRP A HE1  2  
ATOM   9756   H HE3  . TRP A 1 87  ? -4.545  12.430  7.784   0.04 14.93 ? 143  TRP A HE3  2  
ATOM   9757   H HZ2  . TRP A 1 87  ? -0.666  10.033  8.900   0.04 13.55 ? 143  TRP A HZ2  2  
ATOM   9758   H HZ3  . TRP A 1 87  ? -3.864  12.212  10.005  0.04 14.50 ? 143  TRP A HZ3  2  
ATOM   9759   H HH2  . TRP A 1 87  ? -1.939  11.021  10.541  0.04 13.82 ? 143  TRP A HH2  2  
ATOM   9760   N N    . PHE A 1 88  ? -1.911  14.309  5.411   0.04 15.12 ? 144  PHE A N    2  
ATOM   9761   C CA   . PHE A 1 88  ? -1.335  15.190  6.443   0.04 15.06 ? 144  PHE A CA   2  
ATOM   9762   C C    . PHE A 1 88  ? -0.462  16.229  5.755   0.04 15.29 ? 144  PHE A C    2  
ATOM   9763   O O    . PHE A 1 88  ? 0.517   16.708  6.308   0.04 15.14 ? 144  PHE A O    2  
ATOM   9764   C CB   . PHE A 1 88  ? -0.570  14.391  7.509   0.04 14.56 ? 144  PHE A CB   2  
ATOM   9765   C CG   . PHE A 1 88  ? -0.451  15.072  8.884   0.04 14.49 ? 144  PHE A CG   2  
ATOM   9766   C CD1  . PHE A 1 88  ? -1.239  16.183  9.229   0.04 14.83 ? 144  PHE A CD1  2  
ATOM   9767   C CD2  . PHE A 1 88  ? 0.448   14.594  9.839   0.04 14.10 ? 144  PHE A CD2  2  
ATOM   9768   C CE1  . PHE A 1 88  ? -1.123  16.796  10.489  0.04 14.77 ? 144  PHE A CE1  2  
ATOM   9769   C CE2  . PHE A 1 88  ? 0.572   15.227  11.136  0.04 14.04 ? 144  PHE A CE2  2  
ATOM   9770   C CZ   . PHE A 1 88  ? -0.231  16.297  11.453  0.04 14.36 ? 144  PHE A CZ   2  
ATOM   9771   H H    . PHE A 1 88  ? -1.327  13.906  4.925   0.04 14.99 ? 144  PHE A H    2  
ATOM   9772   H HA   . PHE A 1 88  ? -2.060  15.669  6.871   0.04 15.23 ? 144  PHE A HA   2  
ATOM   9773   H HB2  . PHE A 1 88  ? -1.029  13.545  7.640   0.04 14.45 ? 144  PHE A HB2  2  
ATOM   9774   H HB3  . PHE A 1 88  ? 0.331   14.230  7.184   0.04 14.42 ? 144  PHE A HB3  2  
ATOM   9775   H HD1  . PHE A 1 88  ? -1.850  16.523  8.619   0.04 15.12 ? 144  PHE A HD1  2  
ATOM   9776   H HD2  . PHE A 1 88  ? 0.982   13.861  9.639   0.04 13.89 ? 144  PHE A HD2  2  
ATOM   9777   H HE1  . PHE A 1 88  ? -1.665  17.524  10.690  0.04 15.02 ? 144  PHE A HE1  2  
ATOM   9778   H HE2  . PHE A 1 88  ? 1.169   14.893  11.763  0.04 13.80 ? 144  PHE A HE2  2  
ATOM   9779   H HZ   . PHE A 1 88  ? -0.154  16.717  12.279  0.04 14.35 ? 144  PHE A HZ   2  
ATOM   9780   N N    . ASP A 1 89  ? -0.842  16.476  4.501   0.04 15.70 ? 145  ASP A N    2  
ATOM   9781   C CA   . ASP A 1 89  ? -0.427  17.605  3.695   0.04 16.03 ? 145  ASP A CA   2  
ATOM   9782   C C    . ASP A 1 89  ? 1.064   17.805  3.773   0.04 15.76 ? 145  ASP A C    2  
ATOM   9783   O O    . ASP A 1 89  ? 1.599   18.925  3.905   0.04 15.85 ? 145  ASP A O    2  
ATOM   9784   C CB   . ASP A 1 89  ? -1.300  18.818  4.002   0.04 16.41 ? 145  ASP A CB   2  
ATOM   9785   C CG   . ASP A 1 89  ? -2.796  18.515  3.733   0.04 16.82 ? 145  ASP A CG   2  
ATOM   9786   O OD1  . ASP A 1 89  ? -3.070  17.894  2.695   0.04 17.04 ? 145  ASP A OD1  2  
ATOM   9787   O OD2  . ASP A 1 89  ? -3.687  18.823  4.556   0.04 16.94 ? 145  ASP A OD2  2  
ATOM   9788   H H    . ASP A 1 89  ? -1.377  15.964  4.064   0.04 15.81 ? 145  ASP A H    2  
ATOM   9789   H HA   . ASP A 1 89  ? -0.610  17.373  2.769   0.04 16.25 ? 145  ASP A HA   2  
ATOM   9790   H HB2  . ASP A 1 89  ? -1.194  19.060  4.937   0.04 16.21 ? 145  ASP A HB2  2  
ATOM   9791   H HB3  . ASP A 1 89  ? -1.040  19.555  3.427   0.04 16.61 ? 145  ASP A HB3  2  
ATOM   9792   N N    . GLY A 1 90  ? 1.712   16.659  3.586   0.04 15.46 ? 146  GLY A N    2  
ATOM   9793   C CA   . GLY A 1 90  ? 3.118   16.586  3.301   0.04 15.29 ? 146  GLY A CA   2  
ATOM   9794   C C    . GLY A 1 90  ? 3.923   16.229  4.525   0.04 14.86 ? 146  GLY A C    2  
ATOM   9795   O O    . GLY A 1 90  ? 5.119   15.956  4.399   0.04 14.75 ? 146  GLY A O    2  
ATOM   9796   H H    . GLY A 1 90  ? 1.334   15.889  3.604   0.04 15.39 ? 146  GLY A H    2  
ATOM   9797   H HA2  . GLY A 1 90  ? 3.264   15.905  2.629   0.04 15.25 ? 146  GLY A HA2  2  
ATOM   9798   H HA3  . GLY A 1 90  ? 3.426   17.437  2.949   0.04 15.54 ? 146  GLY A HA3  2  
ATOM   9799   N N    . ASN A 1 91  ? 3.269   16.211  5.690   0.04 14.67 ? 147  ASN A N    2  
ATOM   9800   C CA   . ASN A 1 91  ? 3.875   15.749  6.925   0.04 14.30 ? 147  ASN A CA   2  
ATOM   9801   C C    . ASN A 1 91  ? 3.737   14.214  6.898   0.04 13.92 ? 147  ASN A C    2  
ATOM   9802   O O    . ASN A 1 91  ? 2.626   13.706  6.851   0.04 13.92 ? 147  ASN A O    2  
ATOM   9803   C CB   . ASN A 1 91  ? 3.150   16.360  8.141   0.04 14.43 ? 147  ASN A CB   2  
ATOM   9804   C CG   . ASN A 1 91  ? 3.790   16.004  9.474   0.04 14.12 ? 147  ASN A CG   2  
ATOM   9805   O OD1  . ASN A 1 91  ? 4.472   14.985  9.618   0.04 13.77 ? 147  ASN A OD1  2  
ATOM   9806   N ND2  . ASN A 1 91  ? 3.548   16.857  10.482  0.04 14.29 ? 147  ASN A ND2  2  
ATOM   9807   H H    . ASN A 1 91  ? 2.454   16.459  5.793   0.04 14.77 ? 147  ASN A H    2  
ATOM   9808   H HA   . ASN A 1 91  ? 4.810   15.993  6.940   0.04 14.27 ? 147  ASN A HA   2  
ATOM   9809   H HB2  . ASN A 1 91  ? 3.175   17.327  8.058   0.04 14.68 ? 147  ASN A HB2  2  
ATOM   9810   H HB3  . ASN A 1 91  ? 2.227   16.059  8.161   0.04 14.49 ? 147  ASN A HB3  2  
ATOM   9811   H HD21 . ASN A 1 91  ? 4.160   17.042  11.053  0.04 14.16 ? 147  ASN A HD21 2  
ATOM   9812   H HD22 . ASN A 1 91  ? 2.777   17.231  10.543  0.04 14.56 ? 147  ASN A HD22 2  
ATOM   9813   N N    . ALA A 1 92  ? 4.858   13.510  6.838   0.04 13.65 ? 148  ALA A N    2  
ATOM   9814   C CA   . ALA A 1 92  ? 4.859   12.040  6.782   0.04 13.34 ? 148  ALA A CA   2  
ATOM   9815   C C    . ALA A 1 92  ? 5.085   11.391  8.128   0.04 13.03 ? 148  ALA A C    2  
ATOM   9816   O O    . ALA A 1 92  ? 5.211   10.177  8.206   0.04 12.79 ? 148  ALA A O    2  
ATOM   9817   C CB   . ALA A 1 92  ? 5.918   11.538  5.796   0.04 13.26 ? 148  ALA A CB   2  
ATOM   9818   H H    . ALA A 1 92  ? 5.644   13.855  6.840   0.04 13.65 ? 148  ALA A H    2  
ATOM   9819   H HA   . ALA A 1 92  ? 3.997   11.743  6.449   0.04 13.41 ? 148  ALA A HA   2  
ATOM   9820   H HB1  . ALA A 1 92  ? 5.882   10.571  5.778   0.04 13.07 ? 148  ALA A HB1  2  
ATOM   9821   H HB2  . ALA A 1 92  ? 5.737   11.887  4.913   0.04 13.46 ? 148  ALA A HB2  2  
ATOM   9822   H HB3  . ALA A 1 92  ? 6.786   11.826  6.101   0.04 13.24 ? 148  ALA A HB3  2  
ATOM   9823   N N    . THR A 1 93  ? 5.150   12.207  9.166   0.04 13.08 ? 149  THR A N    2  
ATOM   9824   C CA   . THR A 1 93  ? 5.496   11.776  10.518  0.04 12.86 ? 149  THR A CA   2  
ATOM   9825   C C    . THR A 1 93  ? 4.397   11.014  11.215  0.04 12.75 ? 149  THR A C    2  
ATOM   9826   O O    . THR A 1 93  ? 4.610   10.558  12.339  0.04 12.56 ? 149  THR A O    2  
ATOM   9827   C CB   . THR A 1 93  ? 5.960   12.955  11.465  0.04 13.01 ? 149  THR A CB   2  
ATOM   9828   O OG1  . THR A 1 93  ? 4.851   13.794  11.853  0.04 13.35 ? 149  THR A OG1  2  
ATOM   9829   C CG2  . THR A 1 93  ? 6.921   13.843  10.767  0.04 12.95 ? 149  THR A CG2  2  
ATOM   9830   H H    . THR A 1 93  ? 4.991   13.051  9.114   0.04 13.28 ? 149  THR A H    2  
ATOM   9831   H HA   . THR A 1 93  ? 6.243   11.175  10.454  0.04 12.69 ? 149  THR A HA   2  
ATOM   9832   H HB   . THR A 1 93  ? 6.385   12.583  12.250  0.04 12.94 ? 149  THR A HB   2  
ATOM   9833   H HG1  . THR A 1 93  ? 4.444   14.059  11.174  0.04 13.45 ? 149  THR A HG1  2  
ATOM   9834   H HG21 . THR A 1 93  ? 6.842   14.730  11.155  0.04 12.96 ? 149  THR A HG21 2  
ATOM   9835   H HG22 . THR A 1 93  ? 7.828   13.528  10.864  0.04 12.77 ? 149  THR A HG22 2  
ATOM   9836   H HG23 . THR A 1 93  ? 6.711   13.923  9.825   0.04 13.12 ? 149  THR A HG23 2  
ATOM   9837   N N    . GLN A 1 94  ? 3.249   10.852  10.583  0.04 12.90 ? 150  GLN A N    2  
ATOM   9838   C CA   . GLN A 1 94  ? 2.227   9.985   11.147  0.04 12.83 ? 150  GLN A CA   2  
ATOM   9839   C C    . GLN A 1 94  ? 1.888   8.790   10.234  0.04 12.78 ? 150  GLN A C    2  
ATOM   9840   O O    . GLN A 1 94  ? 0.869   8.127   10.436  0.04 12.83 ? 150  GLN A O    2  
ATOM   9841   C CB   . GLN A 1 94  ? 0.983   10.785  11.558  0.04 13.10 ? 150  GLN A CB   2  
ATOM   9842   C CG   . GLN A 1 94  ? 1.335   11.740  12.715  0.04 13.14 ? 150  GLN A CG   2  
ATOM   9843   C CD   . GLN A 1 94  ? 0.191   12.581  13.259  0.04 13.43 ? 150  GLN A CD   2  
ATOM   9844   O OE1  . GLN A 1 94  ? -0.958  12.286  13.055  0.04 13.58 ? 150  GLN A OE1  2  
ATOM   9845   N NE2  . GLN A 1 94  ? 0.538   13.612  14.008  0.04 13.54 ? 150  GLN A NE2  2  
ATOM   9846   H H    . GLN A 1 94  ? 3.036   11.219  9.837   0.04 13.06 ? 150  GLN A H    2  
ATOM   9847   H HA   . GLN A 1 94  ? 2.566   9.595   11.960  0.04 12.66 ? 150  GLN A HA   2  
ATOM   9848   H HB2  . GLN A 1 94  ? 0.653   11.304  10.808  0.04 13.30 ? 150  GLN A HB2  2  
ATOM   9849   H HB3  . GLN A 1 94  ? 0.299   10.168  11.863  0.04 13.07 ? 150  GLN A HB3  2  
ATOM   9850   H HG2  . GLN A 1 94  ? 1.676   11.206  13.451  0.04 12.95 ? 150  GLN A HG2  2  
ATOM   9851   H HG3  . GLN A 1 94  ? 2.028   12.344  12.415  0.04 13.17 ? 150  GLN A HG3  2  
ATOM   9852   H HE21 . GLN A 1 94  ? 1.367   13.765  14.177  0.04 13.45 ? 150  GLN A HE21 2  
ATOM   9853   H HE22 . GLN A 1 94  ? -0.070  14.132  14.326  0.04 13.72 ? 150  GLN A HE22 2  
ATOM   9854   N N    . ASN A 1 95  ? 2.785   8.488   9.290   0.04 12.70 ? 151  ASN A N    2  
ATOM   9855   C CA   . ASN A 1 95  ? 2.580   7.389   8.352   0.04 12.68 ? 151  ASN A CA   2  
ATOM   9856   C C    . ASN A 1 95  ? 3.088   6.084   8.984   0.04 12.40 ? 151  ASN A C    2  
ATOM   9857   O O    . ASN A 1 95  ? 4.172   5.571   8.657   0.04 12.26 ? 151  ASN A O    2  
ATOM   9858   C CB   . ASN A 1 95  ? 3.247   7.687   7.015   0.04 12.79 ? 151  ASN A CB   2  
ATOM   9859   C CG   . ASN A 1 95  ? 2.466   8.673   6.163   0.04 13.14 ? 151  ASN A CG   2  
ATOM   9860   O OD1  . ASN A 1 95  ? 1.377   9.141   6.530   0.04 13.31 ? 151  ASN A OD1  2  
ATOM   9861   N ND2  . ASN A 1 95  ? 3.016   9.004   4.999   0.04 13.29 ? 151  ASN A ND2  2  
ATOM   9862   H H    . ASN A 1 95  ? 3.525   8.906   9.174   0.04 12.68 ? 151  ASN A H    2  
ATOM   9863   H HA   . ASN A 1 95  ? 1.629   7.294   8.176   0.04 12.82 ? 151  ASN A HA   2  
ATOM   9864   H HB2  . ASN A 1 95  ? 4.129   8.058   7.179   0.04 12.73 ? 151  ASN A HB2  2  
ATOM   9865   H HB3  . ASN A 1 95  ? 3.317   6.855   6.517   0.04 12.74 ? 151  ASN A HB3  2  
ATOM   9866   H HD21 . ASN A 1 95  ? 2.522   9.287   4.357   0.04 13.50 ? 151  ASN A HD21 2  
ATOM   9867   H HD22 . ASN A 1 95  ? 3.867   8.919   4.893   0.04 13.19 ? 151  ASN A HD22 2  
ATOM   9868   N N    . PHE A 1 96  ? 2.240   5.548   9.855   0.04 12.37 ? 152  PHE A N    2  
ATOM   9869   C CA   . PHE A 1 96  ? 2.566   4.423   10.718  0.04 12.16 ? 152  PHE A CA   2  
ATOM   9870   C C    . PHE A 1 96  ? 1.809   3.156   10.309  0.04 12.21 ? 152  PHE A C    2  
ATOM   9871   O O    . PHE A 1 96  ? 0.841   3.203   9.580   0.04 12.41 ? 152  PHE A O    2  
ATOM   9872   C CB   . PHE A 1 96  ? 2.099   4.709   12.152  0.04 12.15 ? 152  PHE A CB   2  
ATOM   9873   C CG   . PHE A 1 96  ? 2.627   6.007   12.774  0.04 12.17 ? 152  PHE A CG   2  
ATOM   9874   C CD1  . PHE A 1 96  ? 3.948   6.393   12.660  0.04 12.05 ? 152  PHE A CD1  2  
ATOM   9875   C CD2  . PHE A 1 96  ? 1.779   6.777   13.543  0.04 12.33 ? 152  PHE A CD2  2  
ATOM   9876   C CE1  . PHE A 1 96  ? 4.384   7.564   13.277  0.04 12.11 ? 152  PHE A CE1  2  
ATOM   9877   C CE2  . PHE A 1 96  ? 2.215   7.920   14.183  0.04 12.38 ? 152  PHE A CE2  2  
ATOM   9878   C CZ   . PHE A 1 96  ? 3.512   8.320   14.042  0.04 12.27 ? 152  PHE A CZ   2  
ATOM   9879   H H    . PHE A 1 96  ? 1.443   5.844   9.973   0.04 12.50 ? 152  PHE A H    2  
ATOM   9880   H HA   . PHE A 1 96  ? 3.514   4.252   10.707  0.04 12.03 ? 152  PHE A HA   2  
ATOM   9881   H HB2  . PHE A 1 96  ? 1.134   4.763   12.145  0.04 12.29 ? 152  PHE A HB2  2  
ATOM   9882   H HB3  . PHE A 1 96  ? 2.378   3.975   12.719  0.04 12.03 ? 152  PHE A HB3  2  
ATOM   9883   H HD1  . PHE A 1 96  ? 4.542   5.891   12.151  0.04 11.96 ? 152  PHE A HD1  2  
ATOM   9884   H HD2  . PHE A 1 96  ? 0.896   6.509   13.643  0.04 12.43 ? 152  PHE A HD2  2  
ATOM   9885   H HE1  . PHE A 1 96  ? 5.274   7.825   13.187  0.04 12.05 ? 152  PHE A HE1  2  
ATOM   9886   H HE2  . PHE A 1 96  ? 1.614   8.434   14.675  0.04 12.52 ? 152  PHE A HE2  2  
ATOM   9887   H HZ   . PHE A 1 96  ? 3.803   9.102   14.454  0.04 12.33 ? 152  PHE A HZ   2  
ATOM   9888   N N    . TRP A 1 97  ? 2.261   2.031   10.870  0.04 12.05 ? 153  TRP A N    2  
ATOM   9889   C CA   . TRP A 1 97  ? 1.504   0.775   10.964  0.04 12.10 ? 153  TRP A CA   2  
ATOM   9890   C C    . TRP A 1 97  ? 1.070   0.219   9.614   0.04 12.25 ? 153  TRP A C    2  
ATOM   9891   O O    . TRP A 1 97  ? -0.112  0.032   9.350   0.04 12.46 ? 153  TRP A O    2  
ATOM   9892   C CB   . TRP A 1 97  ? 0.277   0.885   11.908  0.04 12.23 ? 153  TRP A CB   2  
ATOM   9893   C CG   . TRP A 1 97  ? 0.658   1.291   13.342  0.04 12.12 ? 153  TRP A CG   2  
ATOM   9894   C CD1  . TRP A 1 97  ? 1.545   0.654   14.181  0.04 11.95 ? 153  TRP A CD1  2  
ATOM   9895   C CD2  . TRP A 1 97  ? 0.150   2.418   14.080  0.04 12.22 ? 153  TRP A CD2  2  
ATOM   9896   N NE1  . TRP A 1 97  ? 1.634   1.324   15.373  0.04 11.93 ? 153  TRP A NE1  2  
ATOM   9897   C CE2  . TRP A 1 97  ? 0.787   2.412   15.336  0.04 12.09 ? 153  TRP A CE2  2  
ATOM   9898   C CE3  . TRP A 1 97  ? -0.784  3.406   13.808  0.04 12.44 ? 153  TRP A CE3  2  
ATOM   9899   C CZ2  . TRP A 1 97  ? 0.558   3.421   16.297  0.04 12.17 ? 153  TRP A CZ2  2  
ATOM   9900   C CZ3  . TRP A 1 97  ? -1.016  4.385   14.748  0.04 12.52 ? 153  TRP A CZ3  2  
ATOM   9901   C CH2  . TRP A 1 97  ? -0.342  4.389   15.977  0.04 12.39 ? 153  TRP A CH2  2  
ATOM   9902   H H    . TRP A 1 97  ? 3.046   1.969   11.206  0.04 11.92 ? 153  TRP A H    2  
ATOM   9903   H HA   . TRP A 1 97  ? 2.093   0.115   11.355  0.04 11.98 ? 153  TRP A HA   2  
ATOM   9904   H HB2  . TRP A 1 97  ? -0.307  1.573   11.561  0.04 12.37 ? 153  TRP A HB2  2  
ATOM   9905   H HB3  . TRP A 1 97  ? -0.189  0.035   11.927  0.04 12.29 ? 153  TRP A HB3  2  
ATOM   9906   H HD1  . TRP A 1 97  ? 2.033   -0.106  13.964  0.04 11.87 ? 153  TRP A HD1  2  
ATOM   9907   H HE1  . TRP A 1 97  ? 2.153   1.107   16.021  0.04 11.85 ? 153  TRP A HE1  2  
ATOM   9908   H HE3  . TRP A 1 97  ? -1.201  3.442   12.977  0.04 12.55 ? 153  TRP A HE3  2  
ATOM   9909   H HZ2  . TRP A 1 97  ? 0.972   3.396   17.130  0.04 12.11 ? 153  TRP A HZ2  2  
ATOM   9910   H HZ3  . TRP A 1 97  ? -1.626  5.057   14.551  0.04 12.70 ? 153  TRP A HZ3  2  
ATOM   9911   H HH2  . TRP A 1 97  ? -0.552  5.038   16.606  0.04 12.47 ? 153  TRP A HH2  2  
ATOM   9912   N N    . ARG A 1 98  ? 2.038   -0.064  8.763   0.04 12.18 ? 154  ARG A N    2  
ATOM   9913   C CA   . ARG A 1 98  ? 1.721   -0.658  7.454   0.04 12.35 ? 154  ARG A CA   2  
ATOM   9914   C C    . ARG A 1 98  ? 2.957   -1.425  7.020   0.04 12.23 ? 154  ARG A C    2  
ATOM   9915   O O    . ARG A 1 98  ? 3.987   -1.334  7.668   0.04 12.04 ? 154  ARG A O    2  
ATOM   9916   C CB   . ARG A 1 98  ? 1.333   0.443   6.454   0.04 12.55 ? 154  ARG A CB   2  
ATOM   9917   C CG   . ARG A 1 98  ? 2.433   1.490   6.156   0.04 12.48 ? 154  ARG A CG   2  
ATOM   9918   C CD   . ARG A 1 98  ? 1.865   2.790   5.602   0.04 12.71 ? 154  ARG A CD   2  
ATOM   9919   N NE   . ARG A 1 98  ? 1.180   3.527   6.659   0.04 12.72 ? 154  ARG A NE   2  
ATOM   9920   C CZ   . ARG A 1 98  ? 0.373   4.564   6.473   0.04 12.93 ? 154  ARG A CZ   2  
ATOM   9921   N NH1  . ARG A 1 98  ? 0.077   5.005   5.252   0.04 13.18 ? 154  ARG A NH1  2  
ATOM   9922   N NH2  . ARG A 1 98  ? -0.155  5.156   7.528   0.04 12.93 ? 154  ARG A NH2  2  
ATOM   9923   H H    . ARG A 1 98  ? 2.872   0.072   8.903   0.04 12.07 ? 154  ARG A H    2  
ATOM   9924   H HA   . ARG A 1 98  ? 0.985   -1.281  7.535   0.04 12.44 ? 154  ARG A HA   2  
ATOM   9925   H HB2  . ARG A 1 98  ? 1.067   0.022   5.623   0.04 12.68 ? 154  ARG A HB2  2  
ATOM   9926   H HB3  . ARG A 1 98  ? 0.582   0.933   6.817   0.04 12.64 ? 154  ARG A HB3  2  
ATOM   9927   H HG2  . ARG A 1 98  ? 2.905   1.694   6.981   0.04 12.33 ? 154  ARG A HG2  2  
ATOM   9928   H HG3  . ARG A 1 98  ? 3.048   1.118   5.502   0.04 12.47 ? 154  ARG A HG3  2  
ATOM   9929   H HD2  . ARG A 1 98  ? 2.597   3.334   5.279   0.04 12.70 ? 154  ARG A HD2  2  
ATOM   9930   H HD3  . ARG A 1 98  ? 1.236   2.605   4.887   0.04 12.89 ? 154  ARG A HD3  2  
ATOM   9931   H HE   . ARG A 1 98  ? 1.446   3.373   7.464   0.04 12.58 ? 154  ARG A HE   2  
ATOM   9932   H HH11 . ARG A 1 98  ? 0.418   4.623   4.563   0.04 13.20 ? 154  ARG A HH11 2  
ATOM   9933   H HH12 . ARG A 1 98  ? -0.454  5.669   5.157   0.04 13.35 ? 154  ARG A HH12 2  
ATOM   9934   H HH21 . ARG A 1 98  ? 0.034   4.867   8.313   0.04 12.79 ? 154  ARG A HH21 2  
ATOM   9935   H HH22 . ARG A 1 98  ? -0.691  5.816   7.428   0.04 13.10 ? 154  ARG A HH22 2  
ATOM   9936   N N    . SER A 1 99  ? 2.879   -2.209  5.956   0.04 12.36 ? 155  SER A N    2  
ATOM   9937   C CA   . SER A 1 99  ? 4.039   -3.028  5.578   0.04 12.28 ? 155  SER A CA   2  
ATOM   9938   C C    . SER A 1 99  ? 4.004   -3.496  4.141   0.04 12.49 ? 155  SER A C    2  
ATOM   9939   O O    . SER A 1 99  ? 2.955   -3.659  3.558   0.04 12.70 ? 155  SER A O    2  
ATOM   9940   C CB   . SER A 1 99  ? 4.155   -4.260  6.492   0.04 12.20 ? 155  SER A CB   2  
ATOM   9941   O OG   . SER A 1 99  ? 3.013   -5.099  6.401   0.04 12.38 ? 155  SER A OG   2  
ATOM   9942   H H    . SER A 1 99  ? 2.195   -2.288  5.439   0.04 12.52 ? 155  SER A H    2  
ATOM   9943   H HA   . SER A 1 99  ? 4.841   -2.503  5.689   0.04 12.18 ? 155  SER A HA   2  
ATOM   9944   H HB2  . SER A 1 99  ? 4.928   -4.782  6.227   0.04 12.18 ? 155  SER A HB2  2  
ATOM   9945   H HB3  . SER A 1 99  ? 4.257   -3.969  7.410   0.04 12.08 ? 155  SER A HB3  2  
ATOM   9946   H HG   . SER A 1 99  ? 2.912   -5.376  5.616   0.04 12.50 ? 155  SER A HG   2  
ATOM   9947   N N    . ALA A 1 100 ? 5.198   -3.744  3.606   0.04 12.45 ? 156  ALA A N    2  
ATOM   9948   C CA   . ALA A 1 100 ? 5.375   -4.333  2.255   0.04 12.66 ? 156  ALA A CA   2  
ATOM   9949   C C    . ALA A 1 100 ? 6.413   -5.431  2.340   0.04 12.61 ? 156  ALA A C    2  
ATOM   9950   O O    . ALA A 1 100 ? 7.451   -5.243  2.948   0.04 12.44 ? 156  ALA A O    2  
ATOM   9951   C CB   . ALA A 1 100 ? 5.842   -3.261  1.243   0.04 12.76 ? 156  ALA A CB   2  
ATOM   9952   H H    . ALA A 1 100 ? 5.938   -3.596  4.004   0.04 12.33 ? 156  ALA A H    2  
ATOM   9953   H HA   . ALA A 1 100 ? 4.543   -4.708  1.950   0.04 12.80 ? 156  ALA A HA   2  
ATOM   9954   H HB1  . ALA A 1 100 ? 5.804   -3.628  0.346   0.04 12.93 ? 156  ALA A HB1  2  
ATOM   9955   H HB2  . ALA A 1 100 ? 5.253   -2.490  1.308   0.04 12.80 ? 156  ALA A HB2  2  
ATOM   9956   H HB3  . ALA A 1 100 ? 6.745   -2.997  1.469   0.04 12.65 ? 156  ALA A HB3  2  
ATOM   9957   N N    . GLU A 1 101 ? 6.109   -6.585  1.745   0.04 12.80 ? 157  GLU A N    2  
ATOM   9958   C CA   . GLU A 1 101 ? 7.020   -7.735  1.774   0.04 12.82 ? 157  GLU A CA   2  
ATOM   9959   C C    . GLU A 1 101 ? 6.918   -8.610  0.537   0.04 13.11 ? 157  GLU A C    2  
ATOM   9960   O O    . GLU A 1 101 ? 5.870   -8.848  0.025   0.04 13.30 ? 157  GLU A O    2  
ATOM   9961   C CB   . GLU A 1 101 ? 6.760   -8.576  3.051   0.04 12.71 ? 157  GLU A CB   2  
ATOM   9962   C CG   . GLU A 1 101 ? 7.724   -9.735  3.312   0.04 12.75 ? 157  GLU A CG   2  
ATOM   9963   C CD   . GLU A 1 101 ? 7.561   -10.344 4.689   0.04 12.66 ? 157  GLU A CD   2  
ATOM   9964   O OE1  . GLU A 1 101 ? 6.403   -10.415 5.184   0.04 12.69 ? 157  GLU A OE1  2  
ATOM   9965   O OE2  . GLU A 1 101 ? 8.581   -10.770 5.300   0.04 12.58 ? 157  GLU A OE2  2  
ATOM   9966   H H    . GLU A 1 101 ? 5.383   -6.729  1.315   0.04 12.94 ? 157  GLU A H    2  
ATOM   9967   H HA   . GLU A 1 101 ? 7.920   -7.405  1.818   0.04 12.73 ? 157  GLU A HA   2  
ATOM   9968   H HB2  . GLU A 1 101 ? 6.790   -7.981  3.812   0.04 12.55 ? 157  GLU A HB2  2  
ATOM   9969   H HB3  . GLU A 1 101 ? 5.878   -8.974  2.984   0.04 12.83 ? 157  GLU A HB3  2  
ATOM   9970   H HG2  . GLU A 1 101 ? 7.550   -10.437 2.664   0.04 12.94 ? 157  GLU A HG2  2  
ATOM   9971   H HG3  . GLU A 1 101 ? 8.634   -9.416  3.213   0.04 12.70 ? 157  GLU A HG3  2  
ATOM   9972   N N    . ASN A 1 102 ? 8.062   -9.086  0.078   0.04 13.17 ? 158  ASN A N    2  
ATOM   9973   C CA   . ASN A 1 102 ? 8.112   -10.221 -0.862  0.04 13.45 ? 158  ASN A CA   2  
ATOM   9974   C C    . ASN A 1 102 ? 7.485   -9.944  -2.203  0.04 13.72 ? 158  ASN A C    2  
ATOM   9975   O O    . ASN A 1 102 ? 6.725   -10.736 -2.742  0.04 13.97 ? 158  ASN A O    2  
ATOM   9976   C CB   . ASN A 1 102 ? 7.520   -11.468 -0.203  0.04 13.52 ? 158  ASN A CB   2  
ATOM   9977   C CG   . ASN A 1 102 ? 7.922   -12.747 -0.907  0.04 13.80 ? 158  ASN A CG   2  
ATOM   9978   O OD1  . ASN A 1 102 ? 9.023   -12.840 -1.434  0.04 13.86 ? 158  ASN A OD1  2  
ATOM   9979   N ND2  . ASN A 1 102 ? 7.044   -13.751 -0.883  0.04 14.01 ? 158  ASN A ND2  2  
ATOM   9980   H H    . ASN A 1 102 ? 8.832   -8.791  0.304   0.04 13.06 ? 158  ASN A H    2  
ATOM   9981   H HA   . ASN A 1 102 ? 9.044   -10.411 -1.036  0.04 13.47 ? 158  ASN A HA   2  
ATOM   9982   H HB2  . ASN A 1 102 ? 7.857   -11.523 0.698   0.04 13.35 ? 158  ASN A HB2  2  
ATOM   9983   H HB3  . ASN A 1 102 ? 6.552   -11.398 -0.192  0.04 13.57 ? 158  ASN A HB3  2  
ATOM   9984   H HD21 . ASN A 1 102 ? 7.254   -14.512 -1.221  0.04 14.19 ? 158  ASN A HD21 2  
ATOM   9985   H HD22 . ASN A 1 102 ? 6.261   -13.635 -0.549  0.04 13.98 ? 158  ASN A HD22 2  
ATOM   9986   N N    . LEU A 1 103 ? 7.834   -8.788  -2.738  0.04 13.70 ? 159  LEU A N    2  
ATOM   9987   C CA   . LEU A 1 103 ? 7.389   -8.347  -4.061  0.04 13.98 ? 159  LEU A CA   2  
ATOM   9988   C C    . LEU A 1 103 ? 8.551   -7.771  -4.858  0.04 14.06 ? 159  LEU A C    2  
ATOM   9989   O O    . LEU A 1 103 ? 9.488   -7.199  -4.299  0.04 13.85 ? 159  LEU A O    2  
ATOM   9990   C CB   . LEU A 1 103 ? 6.330   -7.247  -3.959  0.04 13.94 ? 159  LEU A CB   2  
ATOM   9991   C CG   . LEU A 1 103 ? 4.971   -7.609  -3.376  0.04 13.94 ? 159  LEU A CG   2  
ATOM   9992   C CD1  . LEU A 1 103 ? 4.172   -6.356  -3.041  0.04 13.82 ? 159  LEU A CD1  2  
ATOM   9993   C CD2  . LEU A 1 103 ? 4.219   -8.451  -4.361  0.04 14.30 ? 159  LEU A CD2  2  
ATOM   9994   H H    . LEU A 1 103 ? 8.343   -8.222  -2.349  0.04 13.54 ? 159  LEU A H    2  
ATOM   9995   H HA   . LEU A 1 103 ? 7.023   -9.093  -4.555  0.04 14.18 ? 159  LEU A HA   2  
ATOM   9996   H HB2  . LEU A 1 103 ? 6.675   -6.517  -3.422  0.04 13.75 ? 159  LEU A HB2  2  
ATOM   9997   H HB3  . LEU A 1 103 ? 6.170   -6.934  -4.864  0.04 14.16 ? 159  LEU A HB3  2  
ATOM   9998   H HG   . LEU A 1 103 ? 5.089   -8.120  -2.561  0.04 13.80 ? 159  LEU A HG   2  
ATOM   9999   H HD11 . LEU A 1 103 ? 3.290   -6.621  -2.738  0.04 13.86 ? 159  LEU A HD11 2  
ATOM   10000  H HD12 . LEU A 1 103 ? 4.632   -5.864  -2.340  0.04 13.59 ? 159  LEU A HD12 2  
ATOM   10001  H HD13 . LEU A 1 103 ? 4.097   -5.808  -3.838  0.04 13.97 ? 159  LEU A HD13 2  
ATOM   10002  H HD21 . LEU A 1 103 ? 3.489   -8.887  -3.895  0.04 14.31 ? 159  LEU A HD21 2  
ATOM   10003  H HD22 . LEU A 1 103 ? 3.872   -7.879  -5.065  0.04 14.46 ? 159  LEU A HD22 2  
ATOM   10004  H HD23 . LEU A 1 103 ? 4.809   -9.118  -4.743  0.04 14.40 ? 159  LEU A HD23 2  
ATOM   10005  N N    . ALA A 1 104 ? 8.445   -7.882  -6.179  0.04 14.40 ? 160  ALA A N    2  
ATOM   10006  C CA   . ALA A 1 104 ? 9.356   -7.161  -7.088  0.04 14.54 ? 160  ALA A CA   2  
ATOM   10007  C C    . ALA A 1 104 ? 8.573   -6.042  -7.786  0.04 14.69 ? 160  ALA A C    2  
ATOM   10008  O O    . ALA A 1 104 ? 7.464   -6.286  -8.328  0.04 14.88 ? 160  ALA A O    2  
ATOM   10009  C CB   . ALA A 1 104 ? 9.973   -8.087  -8.137  0.04 14.87 ? 160  ALA A CB   2  
ATOM   10010  H H    . ALA A 1 104 ? 7.856   -8.357  -6.574  0.04 14.57 ? 160  ALA A H    2  
ATOM   10011  H HA   . ALA A 1 104 ? 10.061  -6.770  -6.568  0.04 14.36 ? 160  ALA A HA   2  
ATOM   10012  H HB1  . ALA A 1 104 ? 10.506  -7.551  -8.739  0.04 15.00 ? 160  ALA A HB1  2  
ATOM   10013  H HB2  . ALA A 1 104 ? 10.532  -8.749  -7.705  0.04 14.80 ? 160  ALA A HB2  2  
ATOM   10014  H HB3  . ALA A 1 104 ? 9.264   -8.529  -8.629  0.04 15.07 ? 160  ALA A HB3  2  
ATOM   10015  N N    . LEU A 1 105 ? 9.122   -4.830  -7.750  0.04 14.64 ? 161  LEU A N    2  
ATOM   10016  C CA   . LEU A 1 105 ? 8.429   -3.642  -8.265  0.04 14.79 ? 161  LEU A CA   2  
ATOM   10017  C C    . LEU A 1 105 ? 9.194   -3.040  -9.443  0.04 15.11 ? 161  LEU A C    2  
ATOM   10018  O O    . LEU A 1 105 ? 10.413  -2.911  -9.420  0.04 15.06 ? 161  LEU A O    2  
ATOM   10019  C CB   . LEU A 1 105 ? 8.309   -2.576  -7.173  0.04 14.49 ? 161  LEU A CB   2  
ATOM   10020  C CG   . LEU A 1 105 ? 7.670   -3.030  -5.850  0.04 14.17 ? 161  LEU A CG   2  
ATOM   10021  C CD1  . LEU A 1 105 ? 7.712   -1.886  -4.830  0.04 13.97 ? 161  LEU A CD1  2  
ATOM   10022  C CD2  . LEU A 1 105 ? 6.226   -3.564  -6.030  0.04 14.31 ? 161  LEU A CD2  2  
ATOM   10023  H H    . LEU A 1 105 ? 9.899   -4.663  -7.433  0.04 14.53 ? 161  LEU A H    2  
ATOM   10024  H HA   . LEU A 1 105 ? 7.541   -3.883  -8.553  0.04 14.93 ? 161  LEU A HA   2  
ATOM   10025  H HB2  . LEU A 1 105 ? 9.202   -2.251  -6.979  0.04 14.40 ? 161  LEU A HB2  2  
ATOM   10026  H HB3  . LEU A 1 105 ? 7.776   -1.843  -7.516  0.04 14.63 ? 161  LEU A HB3  2  
ATOM   10027  H HG   . LEU A 1 105 ? 8.206   -3.751  -5.493  0.04 14.02 ? 161  LEU A HG   2  
ATOM   10028  H HD11 . LEU A 1 105 ? 7.360   -2.194  -3.981  0.04 13.76 ? 161  LEU A HD11 2  
ATOM   10029  H HD12 . LEU A 1 105 ? 8.632   -1.592  -4.727  0.04 13.93 ? 161  LEU A HD12 2  
ATOM   10030  H HD13 . LEU A 1 105 ? 7.173   -1.150  -5.160  0.04 14.13 ? 161  LEU A HD13 2  
ATOM   10031  H HD21 . LEU A 1 105 ? 5.873   -3.830  -5.167  0.04 14.12 ? 161  LEU A HD21 2  
ATOM   10032  H HD22 . LEU A 1 105 ? 5.669   -2.874  -6.419  0.04 14.51 ? 161  LEU A HD22 2  
ATOM   10033  H HD23 . LEU A 1 105 ? 6.248   -4.335  -6.618  0.04 14.42 ? 161  LEU A HD23 2  
ATOM   10034  N N    . ASN A 1 106 ? 8.449   -2.724  -10.489 0.04 15.47 ? 162  ASN A N    2  
ATOM   10035  C CA   . ASN A 1 106 ? 8.947   -2.010  -11.679 0.04 15.85 ? 162  ASN A CA   2  
ATOM   10036  C C    . ASN A 1 106 ? 8.201   -0.674  -11.745 0.04 15.95 ? 162  ASN A C    2  
ATOM   10037  O O    . ASN A 1 106 ? 7.184   -0.566  -12.428 0.04 16.26 ? 162  ASN A O    2  
ATOM   10038  C CB   . ASN A 1 106 ? 8.678   -2.865  -12.923 0.04 16.27 ? 162  ASN A CB   2  
ATOM   10039  C CG   . ASN A 1 106 ? 9.242   -2.262  -14.194 0.04 16.70 ? 162  ASN A CG   2  
ATOM   10040  O OD1  . ASN A 1 106 ? 10.200  -1.492  -14.179 0.04 16.67 ? 162  ASN A OD1  2  
ATOM   10041  N ND2  . ASN A 1 106 ? 8.647   -2.629  -15.311 0.04 17.14 ? 162  ASN A ND2  2  
ATOM   10042  H H    . ASN A 1 106 ? 7.618   -2.929  -10.547 0.04 15.54 ? 162  ASN A H    2  
ATOM   10043  H HA   . ASN A 1 106 ? 9.896   -1.853  -11.603 0.04 15.79 ? 162  ASN A HA   2  
ATOM   10044  H HB2  . ASN A 1 106 ? 9.094   -3.729  -12.803 0.04 16.21 ? 162  ASN A HB2  2  
ATOM   10045  H HB3  . ASN A 1 106 ? 7.728   -2.982  -13.051 0.04 16.37 ? 162  ASN A HB3  2  
ATOM   10046  H HD21 . ASN A 1 106 ? 9.051   -2.541  -16.060 0.04 17.40 ? 162  ASN A HD21 2  
ATOM   10047  H HD22 . ASN A 1 106 ? 7.861   -2.961  -15.287 0.04 17.18 ? 162  ASN A HD22 2  
ATOM   10048  N N    . PRO A 1 107 ? 8.689   0.327   -10.996 0.04 15.70 ? 163  PRO A N    2  
ATOM   10049  C CA   . PRO A 1 107 ? 7.869   1.535   -10.753 0.04 15.75 ? 163  PRO A CA   2  
ATOM   10050  C C    . PRO A 1 107 ? 7.593   2.359   -12.008 0.04 16.25 ? 163  PRO A C    2  
ATOM   10051  O O    . PRO A 1 107 ? 8.477   2.505   -12.877 0.04 16.47 ? 163  PRO A O    2  
ATOM   10052  C CB   . PRO A 1 107 ? 8.710   2.338   -9.764  0.04 15.40 ? 163  PRO A CB   2  
ATOM   10053  C CG   . PRO A 1 107 ? 10.131  1.977   -10.145 0.04 15.23 ? 163  PRO A CG   2  
ATOM   10054  C CD   . PRO A 1 107 ? 10.064  0.492   -10.491 0.04 15.33 ? 163  PRO A CD   2  
ATOM   10055  H HA   . PRO A 1 107 ? 7.032   1.291   -10.331 0.04 15.70 ? 163  PRO A HA   2  
ATOM   10056  H HB2  . PRO A 1 107 ? 8.558   3.288   -9.889  0.04 15.55 ? 163  PRO A HB2  2  
ATOM   10057  H HB3  . PRO A 1 107 ? 8.513   2.073   -8.853  0.04 15.18 ? 163  PRO A HB3  2  
ATOM   10058  H HG2  . PRO A 1 107 ? 10.393  2.487   -10.919 0.04 15.39 ? 163  PRO A HG2  2  
ATOM   10059  H HG3  . PRO A 1 107 ? 10.729  2.131   -9.398  0.04 14.93 ? 163  PRO A HG3  2  
ATOM   10060  H HD2  . PRO A 1 107 ? 10.701  0.267   -11.185 0.04 15.42 ? 163  PRO A HD2  2  
ATOM   10061  H HD3  . PRO A 1 107 ? 10.202  -0.053  -9.701  0.04 15.09 ? 163  PRO A HD3  2  
ATOM   10062  N N    . VAL A 1 108 ? 6.379   2.888   -12.071 0.04 16.45 ? 164  VAL A N    2  
ATOM   10063  C CA   . VAL A 1 108 ? 5.844   3.586   -13.253 0.04 17.00 ? 164  VAL A CA   2  
ATOM   10064  C C    . VAL A 1 108 ? 6.738   4.671   -13.810 0.04 17.20 ? 164  VAL A C    2  
ATOM   10065  O O    . VAL A 1 108 ? 6.852   4.785   -15.036 0.04 17.59 ? 164  VAL A O    2  
ATOM   10066  C CB   . VAL A 1 108 ? 4.432   4.215   -13.011 0.04 17.23 ? 164  VAL A CB   2  
ATOM   10067  C CG1  . VAL A 1 108 ? 3.349   3.253   -13.429 0.04 17.21 ? 164  VAL A CG1  2  
ATOM   10068  C CG2  . VAL A 1 108 ? 4.246   4.838   -11.581 0.04 17.00 ? 164  VAL A CG2  2  
ATOM   10069  H H    . VAL A 1 108 ? 5.814   2.827   -11.431 0.04 16.32 ? 164  VAL A H    2  
ATOM   10070  H HA   . VAL A 1 108 ? 5.737   2.926   -13.954 0.04 17.18 ? 164  VAL A HA   2  
ATOM   10071  H HB   . VAL A 1 108 ? 4.350   4.971   -13.617 0.04 17.62 ? 164  VAL A HB   2  
ATOM   10072  H HG11 . VAL A 1 108 ? 2.523   3.476   -12.969 0.04 17.46 ? 164  VAL A HG11 2  
ATOM   10073  H HG12 . VAL A 1 108 ? 3.225   3.337   -14.390 0.04 17.33 ? 164  VAL A HG12 2  
ATOM   10074  H HG13 . VAL A 1 108 ? 3.624   2.346   -13.211 0.04 16.85 ? 164  VAL A HG13 2  
ATOM   10075  H HG21 . VAL A 1 108 ? 3.366   4.614   -11.246 0.04 17.17 ? 164  VAL A HG21 2  
ATOM   10076  H HG22 . VAL A 1 108 ? 4.924   4.491   -10.994 0.04 16.63 ? 164  VAL A HG22 2  
ATOM   10077  H HG23 . VAL A 1 108 ? 4.330   5.801   -11.629 0.04 17.10 ? 164  VAL A HG23 2  
ATOM   10078  N N    . ASN A 1 109 ? 7.366   5.470   -12.938 0.04 16.95 ? 165  ASN A N    2  
ATOM   10079  C CA   . ASN A 1 109 ? 8.292   6.506   -13.424 0.04 17.15 ? 165  ASN A CA   2  
ATOM   10080  C C    . ASN A 1 109 ? 9.752   6.174   -13.203 0.04 16.90 ? 165  ASN A C    2  
ATOM   10081  O O    . ASN A 1 109 ? 10.615  7.001   -13.473 0.04 16.98 ? 165  ASN A O    2  
ATOM   10082  C CB   . ASN A 1 109 ? 7.964   7.916   -12.827 0.04 17.13 ? 165  ASN A CB   2  
ATOM   10083  C CG   . ASN A 1 109 ? 8.518   8.141   -11.424 0.04 16.59 ? 165  ASN A CG   2  
ATOM   10084  O OD1  . ASN A 1 109 ? 9.260   7.335   -10.844 0.04 16.21 ? 165  ASN A OD1  2  
ATOM   10085  N ND2  . ASN A 1 109 ? 8.097   9.261   -10.836 0.04 16.59 ? 165  ASN A ND2  2  
ATOM   10086  H H    . ASN A 1 109 ? 7.291   5.428   -12.083 0.04 16.68 ? 165  ASN A H    2  
ATOM   10087  H HA   . ASN A 1 109 ? 8.181   6.595   -14.381 0.04 17.53 ? 165  ASN A HA   2  
ATOM   10088  H HB2  . ASN A 1 109 ? 8.336   8.602   -13.404 0.04 17.37 ? 165  ASN A HB2  2  
ATOM   10089  H HB3  . ASN A 1 109 ? 7.001   8.019   -12.771 0.04 17.26 ? 165  ASN A HB3  2  
ATOM   10090  H HD21 . ASN A 1 109 ? 8.037   9.299   -9.980  0.04 16.31 ? 165  ASN A HD21 2  
ATOM   10091  H HD22 . ASN A 1 109 ? 7.876   9.938   -11.315 0.04 16.88 ? 165  ASN A HD22 2  
ATOM   10092  N N    . GLY A 1 110 ? 10.039  4.975   -12.706 0.04 16.64 ? 166  GLY A N    2  
ATOM   10093  C CA   . GLY A 1 110 ? 11.408  4.573   -12.460 0.04 16.42 ? 166  GLY A CA   2  
ATOM   10094  C C    . GLY A 1 110 ? 11.821  4.569   -10.995 0.04 15.92 ? 166  GLY A C    2  
ATOM   10095  O O    . GLY A 1 110 ? 12.874  4.042   -10.642 0.04 15.72 ? 166  GLY A O    2  
ATOM   10096  H H    . GLY A 1 110 ? 9.453   4.388   -12.492 0.04 16.60 ? 166  GLY A H    2  
ATOM   10097  H HA2  . GLY A 1 110 ? 11.535  3.673   -12.803 0.04 16.44 ? 166  GLY A HA2  2  
ATOM   10098  H HA3  . GLY A 1 110 ? 12.019  5.156   -12.935 0.04 16.64 ? 166  GLY A HA3  2  
ATOM   10099  N N    . THR A 1 111 ? 10.984  5.156   -10.140 0.04 15.75 ? 167  THR A N    2  
ATOM   10100  C CA   . THR A 1 111 ? 11.283  5.242   -8.700  0.04 15.31 ? 167  THR A CA   2  
ATOM   10101  C C    . THR A 1 111 ? 10.017  5.027   -7.897  0.04 15.07 ? 167  THR A C    2  
ATOM   10102  O O    . THR A 1 111 ? 9.010   5.644   -8.148  0.04 15.26 ? 167  THR A O    2  
ATOM   10103  C CB   . THR A 1 111 ? 11.907  6.627   -8.361  0.04 15.39 ? 167  THR A CB   2  
ATOM   10104  O OG1  . THR A 1 111 ? 13.159  6.782   -9.037  0.04 15.70 ? 167  THR A OG1  2  
ATOM   10105  C CG2  . THR A 1 111 ? 12.129  6.794   -6.889  0.04 14.98 ? 167  THR A CG2  2  
ATOM   10106  H H    . THR A 1 111 ? 10.235  5.507   -10.362 0.04 15.90 ? 167  THR A H    2  
ATOM   10107  H HA   . THR A 1 111 ? 11.908  4.550   -8.447  0.04 15.14 ? 167  THR A HA   2  
ATOM   10108  H HB   . THR A 1 111 ? 11.297  7.324   -8.652  0.04 15.54 ? 167  THR A HB   2  
ATOM   10109  H HG1  . THR A 1 111 ? 13.027  7.049   -9.819  0.04 15.59 ? 167  THR A HG1  2  
ATOM   10110  H HG21 . THR A 1 111 ? 12.785  7.489   -6.735  0.04 15.05 ? 167  THR A HG21 2  
ATOM   10111  H HG22 . THR A 1 111 ? 11.294  7.046   -6.468  0.04 14.77 ? 167  THR A HG22 2  
ATOM   10112  H HG23 . THR A 1 111 ? 12.442  5.963   -6.502  0.04 14.88 ? 167  THR A HG23 2  
ATOM   10113  N N    . ASN A 1 112 ? 10.077  4.126   -6.927  0.04 14.69 ? 168  ASN A N    2  
ATOM   10114  C CA   . ASN A 1 112 ? 8.944   3.832   -6.053  0.04 14.46 ? 168  ASN A CA   2  
ATOM   10115  C C    . ASN A 1 112 ? 9.026   4.745   -4.842  0.04 14.22 ? 168  ASN A C    2  
ATOM   10116  O O    . ASN A 1 112 ? 10.111  4.938   -4.324  0.04 14.06 ? 168  ASN A O    2  
ATOM   10117  C CB   . ASN A 1 112 ? 9.030   2.365   -5.606  0.04 14.22 ? 168  ASN A CB   2  
ATOM   10118  C CG   . ASN A 1 112 ? 7.773   1.899   -4.966  0.04 14.09 ? 168  ASN A CG   2  
ATOM   10119  O OD1  . ASN A 1 112 ? 6.822   1.561   -5.659  0.04 14.31 ? 168  ASN A OD1  2  
ATOM   10120  N ND2  . ASN A 1 112 ? 7.748   1.894   -3.654  0.04 13.76 ? 168  ASN A ND2  2  
ATOM   10121  H H    . ASN A 1 112 ? 10.777  3.670   -6.736  0.04 14.57 ? 168  ASN A H    2  
ATOM   10122  H HA   . ASN A 1 112 ? 8.108   3.980   -6.517  0.04 14.64 ? 168  ASN A HA   2  
ATOM   10123  H HB2  . ASN A 1 112 ? 9.184   1.800   -6.377  0.04 14.39 ? 168  ASN A HB2  2  
ATOM   10124  H HB3  . ASN A 1 112 ? 9.749   2.260   -4.961  0.04 14.02 ? 168  ASN A HB3  2  
ATOM   10125  H HD21 . ASN A 1 112 ? 6.998   1.901   -3.232  0.04 13.71 ? 168  ASN A HD21 2  
ATOM   10126  H HD22 . ASN A 1 112 ? 8.487   1.892   -3.211  0.04 13.62 ? 168  ASN A HD22 2  
ATOM   10127  N N    . ARG A 1 113 ? 7.890   5.241   -4.358  0.04 14.22 ? 169  ARG A N    2  
ATOM   10128  C CA   . ARG A 1 113 ? 7.868   6.125   -3.181  0.04 14.03 ? 169  ARG A CA   2  
ATOM   10129  C C    . ARG A 1 113 ? 7.331   5.387   -1.972  0.04 13.70 ? 169  ARG A C    2  
ATOM   10130  O O    . ARG A 1 113 ? 6.163   4.983   -1.977  0.04 13.74 ? 169  ARG A O    2  
ATOM   10131  C CB   . ARG A 1 113 ? 7.000   7.365   -3.430  0.04 14.31 ? 169  ARG A CB   2  
ATOM   10132  C CG   . ARG A 1 113 ? 6.985   8.300   -2.235  0.04 14.17 ? 169  ARG A CG   2  
ATOM   10133  C CD   . ARG A 1 113 ? 6.286   9.639   -2.497  0.04 14.49 ? 169  ARG A CD   2  
ATOM   10134  N NE   . ARG A 1 113 ? 7.229   10.592  -3.128  0.04 14.78 ? 169  ARG A NE   2  
ATOM   10135  C CZ   . ARG A 1 113 ? 7.131   11.146  -4.321  0.04 15.20 ? 169  ARG A CZ   2  
ATOM   10136  N NH1  . ARG A 1 113 ? 6.131   10.914  -5.191  0.04 15.42 ? 169  ARG A NH1  2  
ATOM   10137  N NH2  . ARG A 1 113 ? 8.119   11.955  -4.654  0.04 15.45 ? 169  ARG A NH2  2  
ATOM   10138  H H    . ARG A 1 113 ? 7.114   5.090   -4.685  0.04 14.36 ? 169  ARG A H    2  
ATOM   10139  H HA   . ARG A 1 113 ? 8.769   6.413   -2.972  0.04 13.96 ? 169  ARG A HA   2  
ATOM   10140  H HB2  . ARG A 1 113 ? 7.341   7.857   -4.196  0.04 14.56 ? 169  ARG A HB2  2  
ATOM   10141  H HB3  . ARG A 1 113 ? 6.083   7.093   -3.598  0.04 14.38 ? 169  ARG A HB3  2  
ATOM   10142  H HG2  . ARG A 1 113 ? 6.553   7.862   -1.487  0.04 13.95 ? 169  ARG A HG2  2  
ATOM   10143  H HG3  . ARG A 1 113 ? 7.904   8.497   -1.998  0.04 14.11 ? 169  ARG A HG3  2  
ATOM   10144  H HD2  . ARG A 1 113 ? 5.529   9.519   -3.094  0.04 14.68 ? 169  ARG A HD2  2  
ATOM   10145  H HD3  . ARG A 1 113 ? 5.996   10.017  -1.658  0.04 14.38 ? 169  ARG A HD3  2  
ATOM   10146  H HE   . ARG A 1 113 ? 7.827   10.941  -2.615  0.04 14.70 ? 169  ARG A HE   2  
ATOM   10147  H HH11 . ARG A 1 113 ? 5.483   10.389  -4.990  0.04 15.29 ? 169  ARG A HH11 2  
ATOM   10148  H HH12 . ARG A 1 113 ? 6.137   11.310  -5.950  0.04 15.71 ? 169  ARG A HH12 2  
ATOM   10149  H HH21 . ARG A 1 113 ? 8.752   12.087  -4.089  0.04 15.33 ? 169  ARG A HH21 2  
ATOM   10150  H HH22 . ARG A 1 113 ? 8.120   12.352  -5.421  0.04 15.74 ? 169  ARG A HH22 2  
ATOM   10151  N N    . TRP A 1 114 ? 8.160   5.258   -0.928  0.04 13.41 ? 170  TRP A N    2  
ATOM   10152  C CA   . TRP A 1 114 ? 7.768   4.645   0.376   0.04 13.10 ? 170  TRP A CA   2  
ATOM   10153  C C    . TRP A 1 114 ? 8.049   5.679   1.474   0.04 12.98 ? 170  TRP A C    2  
ATOM   10154  O O    . TRP A 1 114 ? 9.064   5.609   2.169   0.04 12.79 ? 170  TRP A O    2  
ATOM   10155  C CB   . TRP A 1 114 ? 8.501   3.302   0.629   0.04 12.91 ? 170  TRP A CB   2  
ATOM   10156  C CG   . TRP A 1 114 ? 8.043   2.415   1.783   0.04 12.66 ? 170  TRP A CG   2  
ATOM   10157  C CD1  . TRP A 1 114 ? 8.704   2.168   2.960   0.04 12.42 ? 170  TRP A CD1  2  
ATOM   10158  C CD2  . TRP A 1 114 ? 6.829   1.658   1.855   0.04 12.65 ? 170  TRP A CD2  2  
ATOM   10159  N NE1  . TRP A 1 114 ? 7.972   1.318   3.747   0.04 12.27 ? 170  TRP A NE1  2  
ATOM   10160  C CE2  . TRP A 1 114 ? 6.828   0.974   3.094   0.04 12.40 ? 170  TRP A CE2  2  
ATOM   10161  C CE3  . TRP A 1 114 ? 5.757   1.461   0.979   0.04 12.87 ? 170  TRP A CE3  2  
ATOM   10162  C CZ2  . TRP A 1 114 ? 5.766   0.138   3.492   0.04 12.37 ? 170  TRP A CZ2  2  
ATOM   10163  C CZ3  . TRP A 1 114 ? 4.721   0.610   1.369   0.04 12.83 ? 170  TRP A CZ3  2  
ATOM   10164  C CH2  . TRP A 1 114 ? 4.747   -0.035  2.621   0.04 12.58 ? 170  TRP A CH2  2  
ATOM   10165  H H    . TRP A 1 114 ? 8.979   5.518   -0.938  0.04 13.40 ? 170  TRP A H    2  
ATOM   10166  H HA   . TRP A 1 114 ? 6.812   4.470   0.364   0.04 13.15 ? 170  TRP A HA   2  
ATOM   10167  H HB2  . TRP A 1 114 ? 8.405   2.772   -0.180  0.04 13.04 ? 170  TRP A HB2  2  
ATOM   10168  H HB3  . TRP A 1 114 ? 9.443   3.488   0.774   0.04 12.88 ? 170  TRP A HB3  2  
ATOM   10169  H HD1  . TRP A 1 114 ? 9.520   2.544   3.193   0.04 12.39 ? 170  TRP A HD1  2  
ATOM   10170  H HE1  . TRP A 1 114 ? 8.202   1.043   4.530   0.04 12.13 ? 170  TRP A HE1  2  
ATOM   10171  H HE3  . TRP A 1 114 ? 5.739   1.883   0.156   0.04 13.05 ? 170  TRP A HE3  2  
ATOM   10172  H HZ2  . TRP A 1 114 ? 5.787   -0.299  4.313   0.04 12.23 ? 170  TRP A HZ2  2  
ATOM   10173  H HZ3  . TRP A 1 114 ? 3.996   0.482   0.804   0.04 12.99 ? 170  TRP A HZ3  2  
ATOM   10174  H HH2  . TRP A 1 114 ? 4.034   -0.583  2.857   0.04 12.58 ? 170  TRP A HH2  2  
ATOM   10175  N N    . ALA A 1 115 ? 7.173   6.675   1.579   0.04 13.14 ? 171  ALA A N    2  
ATOM   10176  C CA   . ALA A 1 115 ? 7.420   7.813   2.469   0.04 13.11 ? 171  ALA A CA   2  
ATOM   10177  C C    . ALA A 1 115 ? 6.765   7.614   3.831   0.04 12.90 ? 171  ALA A C    2  
ATOM   10178  O O    . ALA A 1 115 ? 5.699   8.156   4.137   0.04 13.01 ? 171  ALA A O    2  
ATOM   10179  C CB   . ALA A 1 115 ? 6.946   9.067   1.818   0.04 13.45 ? 171  ALA A CB   2  
ATOM   10180  H H    . ALA A 1 115 ? 6.438   6.724   1.144   0.04 13.29 ? 171  ALA A H    2  
ATOM   10181  H HA   . ALA A 1 115 ? 8.368   7.889   2.618   0.04 13.05 ? 171  ALA A HA   2  
ATOM   10182  H HB1  . ALA A 1 115 ? 7.158   9.814   2.397   0.04 13.47 ? 171  ALA A HB1  2  
ATOM   10183  H HB2  . ALA A 1 115 ? 7.401   9.176   0.972   0.04 13.61 ? 171  ALA A HB2  2  
ATOM   10184  H HB3  . ALA A 1 115 ? 5.985   9.020   1.681   0.04 13.52 ? 171  ALA A HB3  2  
ATOM   10185  N N    . VAL A 1 116 ? 7.404   6.766   4.620   0.04 12.62 ? 172  VAL A N    2  
ATOM   10186  C CA   . VAL A 1 116 ? 6.844   6.288   5.865   0.04 12.42 ? 172  VAL A CA   2  
ATOM   10187  C C    . VAL A 1 116 ? 7.584   6.826   7.055   0.04 12.29 ? 172  VAL A C    2  
ATOM   10188  O O    . VAL A 1 116 ? 8.751   7.257   6.957   0.04 12.30 ? 172  VAL A O    2  
ATOM   10189  C CB   . VAL A 1 116 ? 6.853   4.732   5.903   0.04 12.25 ? 172  VAL A CB   2  
ATOM   10190  C CG1  . VAL A 1 116 ? 5.935   4.167   4.793   0.04 12.42 ? 172  VAL A CG1  2  
ATOM   10191  C CG2  . VAL A 1 116 ? 8.238   4.195   5.695   0.04 12.13 ? 172  VAL A CG2  2  
ATOM   10192  H H    . VAL A 1 116 ? 8.187   6.458   4.453   0.04 12.57 ? 172  VAL A H    2  
ATOM   10193  H HA   . VAL A 1 116 ? 5.925   6.588   5.936   0.04 12.51 ? 172  VAL A HA   2  
ATOM   10194  H HB   . VAL A 1 116 ? 6.529   4.426   6.759   0.04 12.16 ? 172  VAL A HB   2  
ATOM   10195  H HG11 . VAL A 1 116 ? 6.015   3.200   4.755   0.04 12.34 ? 172  VAL A HG11 2  
ATOM   10196  H HG12 . VAL A 1 116 ? 5.013   4.410   4.994   0.04 12.54 ? 172  VAL A HG12 2  
ATOM   10197  H HG13 . VAL A 1 116 ? 6.201   4.549   3.942   0.04 12.52 ? 172  VAL A HG13 2  
ATOM   10198  H HG21 . VAL A 1 116 ? 8.190   3.227   5.758   0.04 12.06 ? 172  VAL A HG21 2  
ATOM   10199  H HG22 . VAL A 1 116 ? 8.547   4.447   4.814   0.04 12.25 ? 172  VAL A HG22 2  
ATOM   10200  H HG23 . VAL A 1 116 ? 8.837   4.537   6.376   0.04 12.05 ? 172  VAL A HG23 2  
ATOM   10201  N N    . SER A 1 117 ? 6.913   6.791   8.197   0.04 12.19 ? 173  SER A N    2  
ATOM   10202  C CA   . SER A 1 117 ? 7.602   6.972   9.463   0.04 12.04 ? 173  SER A CA   2  
ATOM   10203  C C    . SER A 1 117 ? 7.702   5.617   10.163  0.04 11.84 ? 173  SER A C    2  
ATOM   10204  O O    . SER A 1 117 ? 8.037   4.624   9.502   0.04 11.79 ? 173  SER A O    2  
ATOM   10205  C CB   . SER A 1 117 ? 7.002   8.111   10.269  0.04 12.14 ? 173  SER A CB   2  
ATOM   10206  O OG   . SER A 1 117 ? 7.294   9.328   9.601   0.04 12.34 ? 173  SER A OG   2  
ATOM   10207  H H    . SER A 1 117 ? 6.067   6.669   8.265   0.04 12.22 ? 173  SER A H    2  
ATOM   10208  H HA   . SER A 1 117 ? 8.518   7.232   9.282   0.04 12.04 ? 173  SER A HA   2  
ATOM   10209  H HB2  . SER A 1 117 ? 6.036   8.010   10.330  0.04 12.20 ? 173  SER A HB2  2  
ATOM   10210  H HB3  . SER A 1 117 ? 7.407   8.135   11.150  0.04 12.05 ? 173  SER A HB3  2  
ATOM   10211  H HG   . SER A 1 117 ? 6.823   9.407   8.913   0.04 12.47 ? 173  SER A HG   2  
ATOM   10212  N N    . GLN A 1 118 ? 7.507   5.544   11.477  0.04 11.75 ? 174  GLN A N    2  
ATOM   10213  C CA   . GLN A 1 118 ? 7.731   4.287   12.187  0.04 11.59 ? 174  GLN A CA   2  
ATOM   10214  C C    . GLN A 1 118 ? 6.695   3.201   11.958  0.04 11.60 ? 174  GLN A C    2  
ATOM   10215  O O    . GLN A 1 118 ? 5.536   3.463   11.592  0.04 11.72 ? 174  GLN A O    2  
ATOM   10216  C CB   . GLN A 1 118 ? 7.913   4.535   13.701  0.04 11.54 ? 174  GLN A CB   2  
ATOM   10217  C CG   . GLN A 1 118 ? 9.068   5.497   14.062  0.04 11.56 ? 174  GLN A CG   2  
ATOM   10218  C CD   . GLN A 1 118 ? 8.648   6.962   14.125  0.04 11.71 ? 174  GLN A CD   2  
ATOM   10219  O OE1  . GLN A 1 118 ? 7.681   7.366   13.497  0.04 11.82 ? 174  GLN A OE1  2  
ATOM   10220  N NE2  . GLN A 1 118 ? 9.415   7.765   14.867  0.04 11.74 ? 174  GLN A NE2  2  
ATOM   10221  H H    . GLN A 1 118 ? 7.245   6.197   11.970  0.04 11.79 ? 174  GLN A H    2  
ATOM   10222  H HA   . GLN A 1 118 ? 8.577   3.929   11.878  0.04 11.55 ? 174  GLN A HA   2  
ATOM   10223  H HB2  . GLN A 1 118 ? 7.102   4.925   14.056  0.04 11.61 ? 174  GLN A HB2  2  
ATOM   10224  H HB3  . GLN A 1 118 ? 8.071   3.682   14.128  0.04 11.47 ? 174  GLN A HB3  2  
ATOM   10225  H HG2  . GLN A 1 118 ? 9.428   5.244   14.926  0.04 11.50 ? 174  GLN A HG2  2  
ATOM   10226  H HG3  . GLN A 1 118 ? 9.762   5.426   13.392  0.04 11.56 ? 174  GLN A HG3  2  
ATOM   10227  H HE21 . GLN A 1 118 ? 9.924   7.426   15.468  0.04 11.68 ? 174  GLN A HE21 2  
ATOM   10228  H HE22 . GLN A 1 118 ? 9.405   8.616   14.739  0.04 11.85 ? 174  GLN A HE22 2  
ATOM   10229  N N    . ALA A 1 119 ? 7.137   1.955   12.197  0.04 11.50 ? 175  ALA A N    2  
ATOM   10230  C CA   . ALA A 1 119 ? 6.329   0.751   12.123  0.04 11.52 ? 175  ALA A CA   2  
ATOM   10231  C C    . ALA A 1 119 ? 5.809   0.560   10.707  0.04 11.64 ? 175  ALA A C    2  
ATOM   10232  O O    . ALA A 1 119 ? 4.642   0.264   10.479  0.04 11.75 ? 175  ALA A O    2  
ATOM   10233  C CB   . ALA A 1 119 ? 5.187   0.737   13.137  0.04 11.57 ? 175  ALA A CB   2  
ATOM   10234  H H    . ALA A 1 119 ? 7.955   1.792   12.401  0.04 11.45 ? 175  ALA A H    2  
ATOM   10235  H HA   . ALA A 1 119 ? 6.896   -0.011  12.313  0.04 11.46 ? 175  ALA A HA   2  
ATOM   10236  H HB1  . ALA A 1 119 ? 4.657   -0.063  13.011  0.04 11.60 ? 175  ALA A HB1  2  
ATOM   10237  H HB2  . ALA A 1 119 ? 5.570   0.734   14.028  0.04 11.51 ? 175  ALA A HB2  2  
ATOM   10238  H HB3  . ALA A 1 119 ? 4.637   1.524   13.011  0.04 11.64 ? 175  ALA A HB3  2  
ATOM   10239  N N    . ALA A 1 120 ? 6.712   0.707   9.755   0.04 11.64 ? 176  ALA A N    2  
ATOM   10240  C CA   . ALA A 1 120 ? 6.341   0.597   8.345   0.04 11.79 ? 176  ALA A CA   2  
ATOM   10241  C C    . ALA A 1 120 ? 7.408   -0.220  7.593   0.04 11.77 ? 176  ALA A C    2  
ATOM   10242  O O    . ALA A 1 120 ? 8.097   0.287   6.676   0.04 11.85 ? 176  ALA A O    2  
ATOM   10243  C CB   . ALA A 1 120 ? 6.201   1.982   7.749   0.04 11.91 ? 176  ALA A CB   2  
ATOM   10244  H H    . ALA A 1 120 ? 7.540   0.867   9.888   0.04 11.59 ? 176  ALA A H    2  
ATOM   10245  H HA   . ALA A 1 120 ? 5.498   0.164   8.262   0.04 11.85 ? 176  ALA A HA   2  
ATOM   10246  H HB1  . ALA A 1 120 ? 5.764   1.901   6.885   0.04 12.03 ? 176  ALA A HB1  2  
ATOM   10247  H HB2  . ALA A 1 120 ? 5.671   2.534   8.346   0.04 11.92 ? 176  ALA A HB2  2  
ATOM   10248  H HB3  . ALA A 1 120 ? 7.085   2.369   7.650   0.04 11.88 ? 176  ALA A HB3  2  
ATOM   10249  N N    . PRO A 1 121 ? 7.587   -1.464  7.995   0.04 11.72 ? 177  PRO A N    2  
ATOM   10250  C CA   . PRO A 1 121 ? 8.684   -2.251  7.414   0.04 11.73 ? 177  PRO A CA   2  
ATOM   10251  C C    . PRO A 1 121 ? 8.543   -2.554  5.924   0.04 11.90 ? 177  PRO A C    2  
ATOM   10252  O O    . PRO A 1 121 ? 7.476   -2.701  5.347   0.04 12.02 ? 177  PRO A O    2  
ATOM   10253  C CB   . PRO A 1 121 ? 8.622   -3.557  8.192   0.04 11.69 ? 177  PRO A CB   2  
ATOM   10254  C CG   . PRO A 1 121 ? 7.180   -3.674  8.633   0.04 11.73 ? 177  PRO A CG   2  
ATOM   10255  C CD   . PRO A 1 121 ? 6.797   -2.249  8.955   0.04 11.69 ? 177  PRO A CD   2  
ATOM   10256  H HA   . PRO A 1 121 ? 9.531   -1.809  7.572   0.04 11.68 ? 177  PRO A HA   2  
ATOM   10257  H HB2  . PRO A 1 121 ? 8.849   -4.295  7.606   0.04 11.76 ? 177  PRO A HB2  2  
ATOM   10258  H HB3  . PRO A 1 121 ? 9.223   -3.511  8.952   0.04 11.60 ? 177  PRO A HB3  2  
ATOM   10259  H HG2  . PRO A 1 121 ? 6.646   -4.011  7.902   0.04 11.84 ? 177  PRO A HG2  2  
ATOM   10260  H HG3  . PRO A 1 121 ? 7.101   -4.241  9.413   0.04 11.69 ? 177  PRO A HG3  2  
ATOM   10261  H HD2  . PRO A 1 121 ? 5.856   -2.109  8.811   0.04 11.76 ? 177  PRO A HD2  2  
ATOM   10262  H HD3  . PRO A 1 121 ? 7.054   -2.026  9.863   0.04 11.60 ? 177  PRO A HD3  2  
ATOM   10263  N N    . PHE A 1 122 ? 9.723   -2.671  5.320   0.04 11.94 ? 178  PHE A N    2  
ATOM   10264  C CA   . PHE A 1 122 ? 9.899   -2.954  3.891   0.04 12.13 ? 178  PHE A CA   2  
ATOM   10265  C C    . PHE A 1 122 ? 10.926  -4.082  3.822   0.04 12.15 ? 178  PHE A C    2  
ATOM   10266  O O    . PHE A 1 122 ? 12.149  -3.874  4.008   0.04 12.12 ? 178  PHE A O    2  
ATOM   10267  C CB   . PHE A 1 122 ? 10.397  -1.642  3.272   0.04 12.21 ? 178  PHE A CB   2  
ATOM   10268  C CG   . PHE A 1 122 ? 10.443  -1.593  1.769   0.04 12.45 ? 178  PHE A CG   2  
ATOM   10269  C CD1  . PHE A 1 122 ? 9.403   -1.085  1.034   0.04 12.59 ? 178  PHE A CD1  2  
ATOM   10270  C CD2  . PHE A 1 122 ? 11.615  -1.966  1.094   0.04 12.58 ? 178  PHE A CD2  2  
ATOM   10271  C CE1  . PHE A 1 122 ? 9.473   -1.022  -0.357  0.04 12.86 ? 178  PHE A CE1  2  
ATOM   10272  C CE2  . PHE A 1 122 ? 11.697  -1.869  -0.245  0.04 12.84 ? 178  PHE A CE2  2  
ATOM   10273  C CZ   . PHE A 1 122 ? 10.658  -1.407  -0.981  0.04 12.97 ? 178  PHE A CZ   2  
ATOM   10274  H H    . PHE A 1 122 ? 10.470  -2.587  5.730   0.04 11.88 ? 178  PHE A H    2  
ATOM   10275  H HA   . PHE A 1 122 ? 9.066   -3.237  3.486   0.04 12.22 ? 178  PHE A HA   2  
ATOM   10276  H HB2  . PHE A 1 122 ? 9.792   -0.938  3.555   0.04 12.17 ? 178  PHE A HB2  2  
ATOM   10277  H HB3  . PHE A 1 122 ? 11.284  -1.455  3.610   0.04 12.16 ? 178  PHE A HB3  2  
ATOM   10278  H HD1  . PHE A 1 122 ? 8.617   -0.829  1.465   0.04 12.54 ? 178  PHE A HD1  2  
ATOM   10279  H HD2  . PHE A 1 122 ? 12.342  -2.281  1.577   0.04 12.51 ? 178  PHE A HD2  2  
ATOM   10280  H HE1  . PHE A 1 122 ? 8.761   -0.693  -0.854  0.04 12.98 ? 178  PHE A HE1  2  
ATOM   10281  H HE2  . PHE A 1 122 ? 12.478  -2.144  -0.666  0.04 12.94 ? 178  PHE A HE2  2  
ATOM   10282  H HZ   . PHE A 1 122 ? 10.725  -1.370  -1.906  0.04 13.17 ? 178  PHE A HZ   2  
ATOM   10283  N N    . ARG A 1 123 ? 10.416  -5.306  3.661   0.04 12.23 ? 179  ARG A N    2  
ATOM   10284  C CA   . ARG A 1 123 ? 11.229  -6.516  3.737   0.04 12.29 ? 179  ARG A CA   2  
ATOM   10285  C C    . ARG A 1 123 ? 11.176  -7.343  2.476   0.04 12.53 ? 179  ARG A C    2  
ATOM   10286  O O    . ARG A 1 123 ? 10.147  -7.498  1.866   0.04 12.65 ? 179  ARG A O    2  
ATOM   10287  C CB   . ARG A 1 123 ? 10.739  -7.436  4.861   0.04 12.22 ? 179  ARG A CB   2  
ATOM   10288  C CG   . ARG A 1 123 ? 10.985  -6.926  6.269   0.04 12.02 ? 179  ARG A CG   2  
ATOM   10289  C CD   . ARG A 1 123 ? 10.392  -7.903  7.301   0.04 12.00 ? 179  ARG A CD   2  
ATOM   10290  N NE   . ARG A 1 123 ? 10.495  -7.401  8.677   0.04 11.84 ? 179  ARG A NE   2  
ATOM   10291  C CZ   . ARG A 1 123 ? 11.510  -7.564  9.506   0.04 11.80 ? 179  ARG A CZ   2  
ATOM   10292  N NH1  . ARG A 1 123 ? 12.617  -8.212  9.127   0.04 11.91 ? 179  ARG A NH1  2  
ATOM   10293  N NH2  . ARG A 1 123 ? 11.442  -7.003  10.704  0.04 11.69 ? 179  ARG A NH2  2  
ATOM   10294  H H    . ARG A 1 123 ? 9.586   -5.452  3.500   0.04 12.28 ? 179  ARG A H    2  
ATOM   10295  H HA   . ARG A 1 123 ? 12.150  -6.288  3.912   0.04 12.26 ? 179  ARG A HA   2  
ATOM   10296  H HB2  . ARG A 1 123 ? 9.786   -7.573  4.759   0.04 12.26 ? 179  ARG A HB2  2  
ATOM   10297  H HB3  . ARG A 1 123 ? 11.201  -8.281  4.767   0.04 12.30 ? 179  ARG A HB3  2  
ATOM   10298  H HG2  . ARG A 1 123 ? 11.941  -6.864  6.404   0.04 12.00 ? 179  ARG A HG2  2  
ATOM   10299  H HG3  . ARG A 1 123 ? 10.565  -6.060  6.395   0.04 11.95 ? 179  ARG A HG3  2  
ATOM   10300  H HD2  . ARG A 1 123 ? 9.452   -8.023  7.111   0.04 12.04 ? 179  ARG A HD2  2  
ATOM   10301  H HD3  . ARG A 1 123 ? 10.858  -8.750  7.249   0.04 12.09 ? 179  ARG A HD3  2  
ATOM   10302  H HE   . ARG A 1 123 ? 9.775   -7.077  9.022   0.04 11.80 ? 179  ARG A HE   2  
ATOM   10303  H HH11 . ARG A 1 123 ? 12.670  -8.565  8.350   0.04 12.00 ? 179  ARG A HH11 2  
ATOM   10304  H HH12 . ARG A 1 123 ? 13.265  -8.297  9.678   0.04 11.91 ? 179  ARG A HH12 2  
ATOM   10305  H HH21 . ARG A 1 123 ? 10.730  -6.582  10.934  0.04 11.64 ? 179  ARG A HH21 2  
ATOM   10306  H HH22 . ARG A 1 123 ? 12.081  -7.089  11.267  0.04 11.68 ? 179  ARG A HH22 2  
ATOM   10307  N N    . ARG A 1 124 ? 12.307  -7.926  2.135   0.04 12.64 ? 180  ARG A N    2  
ATOM   10308  C CA   . ARG A 1 124 ? 12.306  -8.938  1.077   0.04 12.90 ? 180  ARG A CA   2  
ATOM   10309  C C    . ARG A 1 124 ? 11.716  -8.378  -0.226  0.04 13.07 ? 180  ARG A C    2  
ATOM   10310  O O    . ARG A 1 124 ? 10.997  -9.053  -0.933  0.04 13.26 ? 180  ARG A O    2  
ATOM   10311  C CB   . ARG A 1 124 ? 11.555  -10.221 1.535   0.04 12.96 ? 180  ARG A CB   2  
ATOM   10312  C CG   . ARG A 1 124 ? 12.135  -11.456 0.945   0.04 13.22 ? 180  ARG A CG   2  
ATOM   10313  C CD   . ARG A 1 124 ? 11.252  -12.696 1.297   0.04 13.35 ? 180  ARG A CD   2  
ATOM   10314  N NE   . ARG A 1 124 ? 11.777  -13.999 0.891   0.04 13.67 ? 180  ARG A NE   2  
ATOM   10315  C CZ   . ARG A 1 124 ? 12.878  -14.562 1.347   0.04 13.78 ? 180  ARG A CZ   2  
ATOM   10316  N NH1  . ARG A 1 124 ? 13.207  -15.750 0.927   0.04 14.10 ? 180  ARG A NH1  2  
ATOM   10317  N NH2  . ARG A 1 124 ? 13.640  -13.923 2.236   0.04 13.60 ? 180  ARG A NH2  2  
ATOM   10318  H H    . ARG A 1 124 ? 13.072  -7.758  2.480   0.04 12.60 ? 180  ARG A H    2  
ATOM   10319  H HA   . ARG A 1 124 ? 13.218  -9.175  0.881   0.04 12.98 ? 180  ARG A HA   2  
ATOM   10320  H HB2  . ARG A 1 124 ? 11.635  -10.319 2.498   0.04 12.82 ? 180  ARG A HB2  2  
ATOM   10321  H HB3  . ARG A 1 124 ? 10.615  -10.175 1.311   0.04 12.99 ? 180  ARG A HB3  2  
ATOM   10322  H HG2  . ARG A 1 124 ? 12.153  -11.361 -0.013  0.04 13.36 ? 180  ARG A HG2  2  
ATOM   10323  H HG3  . ARG A 1 124 ? 13.031  -11.578 1.295   0.04 13.20 ? 180  ARG A HG3  2  
ATOM   10324  H HD2  . ARG A 1 124 ? 11.148  -12.724 2.257   0.04 13.24 ? 180  ARG A HD2  2  
ATOM   10325  H HD3  . ARG A 1 124 ? 10.380  -12.574 0.907   0.04 13.35 ? 180  ARG A HD3  2  
ATOM   10326  H HE   . ARG A 1 124 ? 11.394  -14.387 0.209   0.04 13.82 ? 180  ARG A HE   2  
ATOM   10327  H HH11 . ARG A 1 124 ? 12.706  -16.148 0.352   0.04 14.24 ? 180  ARG A HH11 2  
ATOM   10328  H HH12 . ARG A 1 124 ? 13.931  -16.127 1.205   0.04 14.20 ? 180  ARG A HH12 2  
ATOM   10329  H HH21 . ARG A 1 124 ? 13.407  -13.143 2.501   0.04 13.41 ? 180  ARG A HH21 2  
ATOM   10330  H HH22 . ARG A 1 124 ? 14.368  -14.276 2.537   0.04 13.71 ? 180  ARG A HH22 2  
ATOM   10331  N N    . MET A 1 125 ? 12.085  -7.143  -0.563  0.04 13.03 ? 181  MET A N    2  
ATOM   10332  C CA   . MET A 1 125 ? 11.578  -6.473  -1.752  0.04 13.22 ? 181  MET A CA   2  
ATOM   10333  C C    . MET A 1 125 ? 12.676  -6.405  -2.797  0.04 13.44 ? 181  MET A C    2  
ATOM   10334  O O    . MET A 1 125 ? 13.848  -6.346  -2.489  0.04 13.39 ? 181  MET A O    2  
ATOM   10335  C CB   . MET A 1 125 ? 11.150  -5.041  -1.397  0.04 13.07 ? 181  MET A CB   2  
ATOM   10336  C CG   . MET A 1 125 ? 10.034  -4.999  -0.394  0.04 12.89 ? 181  MET A CG   2  
ATOM   10337  S SD   . MET A 1 125 ? 8.414   -5.572  -0.976  0.04 13.09 ? 181  MET A SD   2  
ATOM   10338  C CE   . MET A 1 125 ? 8.023   -4.270  -2.178  0.04 13.31 ? 181  MET A CE   2  
ATOM   10339  H H    . MET A 1 125 ? 12.635  -6.667  -0.111  0.04 12.93 ? 181  MET A H    2  
ATOM   10340  H HA   . MET A 1 125 ? 10.813  -6.938  -2.105  0.04 13.32 ? 181  MET A HA   2  
ATOM   10341  H HB2  . MET A 1 125 ? 11.903  -4.560  -1.025  0.04 12.97 ? 181  MET A HB2  2  
ATOM   10342  H HB3  . MET A 1 125 ? 10.839  -4.600  -2.200  0.04 13.22 ? 181  MET A HB3  2  
ATOM   10343  H HG2  . MET A 1 125 ? 10.292  -5.545  0.363   0.04 12.77 ? 181  MET A HG2  2  
ATOM   10344  H HG3  . MET A 1 125 ? 9.918   -4.080  -0.101  0.04 12.81 ? 181  MET A HG3  2  
ATOM   10345  H HE1  . MET A 1 125 ? 7.128   -4.409  -2.525  0.04 13.44 ? 181  MET A HE1  2  
ATOM   10346  H HE2  . MET A 1 125 ? 8.079   -3.411  -1.730  0.04 13.20 ? 181  MET A HE2  2  
ATOM   10347  H HE3  . MET A 1 125 ? 8.665   -4.310  -2.903  0.04 13.45 ? 181  MET A HE3  2  
ATOM   10348  N N    . HIS A 1 126 ? 12.264  -6.379  -4.065  0.04 13.72 ? 182  HIS A N    2  
ATOM   10349  C CA   . HIS A 1 126 ? 13.200  -6.136  -5.153  0.04 13.98 ? 182  HIS A CA   2  
ATOM   10350  C C    . HIS A 1 126 ? 12.656  -4.964  -5.933  0.04 14.13 ? 182  HIS A C    2  
ATOM   10351  O O    . HIS A 1 126 ? 11.648  -5.093  -6.632  0.04 14.34 ? 182  HIS A O    2  
ATOM   10352  C CB   . HIS A 1 126 ? 13.338  -7.334  -6.097  0.04 14.28 ? 182  HIS A CB   2  
ATOM   10353  C CG   . HIS A 1 126 ? 14.343  -7.100  -7.186  0.04 14.58 ? 182  HIS A CG   2  
ATOM   10354  N ND1  . HIS A 1 126 ? 14.372  -7.830  -8.361  0.04 14.96 ? 182  HIS A ND1  2  
ATOM   10355  C CD2  . HIS A 1 126 ? 15.291  -6.148  -7.306  0.04 14.60 ? 182  HIS A CD2  2  
ATOM   10356  C CE1  . HIS A 1 126 ? 15.348  -7.363  -9.130  0.04 15.19 ? 182  HIS A CE1  2  
ATOM   10357  N NE2  . HIS A 1 126 ? 15.930  -6.345  -8.505  0.04 14.98 ? 182  HIS A NE2  2  
ATOM   10358  H H    . HIS A 1 126 ? 11.456  -6.500  -4.320  0.04 13.79 ? 182  HIS A H    2  
ATOM   10359  H HA   . HIS A 1 126 ? 14.074  -5.920  -4.808  0.04 13.91 ? 182  HIS A HA   2  
ATOM   10360  H HB2  . HIS A 1 126 ? 13.606  -8.113  -5.594  0.04 14.22 ? 182  HIS A HB2  2  
ATOM   10361  H HB3  . HIS A 1 126 ? 12.484  -7.490  -6.522  0.04 14.38 ? 182  HIS A HB3  2  
ATOM   10362  H HD2  . HIS A 1 126 ? 15.495  -5.507  -6.663  0.04 14.41 ? 182  HIS A HD2  2  
ATOM   10363  H HE1  . HIS A 1 126 ? 15.583  -7.693  -9.963  0.04 15.47 ? 182  HIS A HE1  2  
ATOM   10364  N N    . VAL A 1 127 ? 13.341  -3.826  -5.830  0.04 14.06 ? 183  VAL A N    2  
ATOM   10365  C CA   . VAL A 1 127 ? 12.917  -2.620  -6.532  0.04 14.24 ? 183  VAL A CA   2  
ATOM   10366  C C    . VAL A 1 127 ? 13.805  -2.443  -7.755  0.04 14.59 ? 183  VAL A C    2  
ATOM   10367  O O    . VAL A 1 127 ? 15.013  -2.224  -7.648  0.04 14.60 ? 183  VAL A O    2  
ATOM   10368  C CB   . VAL A 1 127 ? 13.011  -1.371  -5.631  0.04 14.03 ? 183  VAL A CB   2  
ATOM   10369  C CG1  . VAL A 1 127 ? 12.608  -0.135  -6.419  0.04 14.28 ? 183  VAL A CG1  2  
ATOM   10370  C CG2  . VAL A 1 127 ? 12.150  -1.544  -4.388  0.04 13.70 ? 183  VAL A CG2  2  
ATOM   10371  H H    . VAL A 1 127 ? 14.058  -3.733  -5.369  0.04 13.94 ? 183  VAL A H    2  
ATOM   10372  H HA   . VAL A 1 127 ? 11.999  -2.726  -6.821  0.04 14.31 ? 183  VAL A HA   2  
ATOM   10373  H HB   . VAL A 1 127 ? 13.928  -1.260  -5.333  0.04 13.99 ? 183  VAL A HB   2  
ATOM   10374  H HG11 . VAL A 1 127 ? 12.470  0.601   -5.803  0.04 14.16 ? 183  VAL A HG11 2  
ATOM   10375  H HG12 . VAL A 1 127 ? 13.328  0.082   -7.037  0.04 14.49 ? 183  VAL A HG12 2  
ATOM   10376  H HG13 . VAL A 1 127 ? 11.795  -0.316  -6.915  0.04 14.37 ? 183  VAL A HG13 2  
ATOM   10377  H HG21 . VAL A 1 127 ? 12.268  -0.773  -3.808  0.04 13.59 ? 183  VAL A HG21 2  
ATOM   10378  H HG22 . VAL A 1 127 ? 11.219  -1.612  -4.654  0.04 13.75 ? 183  VAL A HG22 2  
ATOM   10379  H HG23 . VAL A 1 127 ? 12.414  -2.353  -3.925  0.04 13.57 ? 183  VAL A HG23 2  
ATOM   10380  N N    . LYS A 1 128 ? 13.194  -2.575  -8.937  0.04 14.92 ? 184  LYS A N    2  
ATOM   10381  C CA   . LYS A 1 128 ? 13.917  -2.515  -10.200 0.04 15.32 ? 184  LYS A CA   2  
ATOM   10382  C C    . LYS A 1 128 ? 13.846  -1.075  -10.690 0.04 15.48 ? 184  LYS A C    2  
ATOM   10383  O O    . LYS A 1 128 ? 13.145  -0.744  -11.623 0.04 15.79 ? 184  LYS A O    2  
ATOM   10384  C CB   . LYS A 1 128 ? 13.306  -3.530  -11.163 0.04 15.64 ? 184  LYS A CB   2  
ATOM   10385  C CG   . LYS A 1 128 ? 13.261  -4.923  -10.483 0.04 15.55 ? 184  LYS A CG   2  
ATOM   10386  C CD   . LYS A 1 128 ? 12.992  -6.048  -11.454 0.04 15.93 ? 184  LYS A CD   2  
ATOM   10387  C CE   . LYS A 1 128 ? 11.592  -5.968  -12.010 0.04 16.04 ? 184  LYS A CE   2  
ATOM   10388  N NZ   . LYS A 1 128 ? 11.276  -7.079  -12.971 0.04 16.32 ? 184  LYS A NZ   2  
ATOM   10389  H H    . LYS A 1 128 ? 12.357  -2.707  -9.029  0.04 14.94 ? 184  LYS A H    2  
ATOM   10390  H HA   . LYS A 1 128 ? 14.847  -2.742  -10.062 0.04 15.31 ? 184  LYS A HA   2  
ATOM   10391  H HB2  . LYS A 1 128 ? 12.403  -3.270  -11.392 0.04 15.67 ? 184  LYS A HB2  2  
ATOM   10392  H HB3  . LYS A 1 128 ? 13.843  -3.591  -11.964 0.04 15.93 ? 184  LYS A HB3  2  
ATOM   10393  H HG2  . LYS A 1 128 ? 14.116  -5.094  -10.058 0.04 15.53 ? 184  LYS A HG2  2  
ATOM   10394  H HG3  . LYS A 1 128 ? 12.564  -4.929  -9.808  0.04 15.30 ? 184  LYS A HG3  2  
ATOM   10395  H HD2  . LYS A 1 128 ? 13.624  -5.988  -12.189 0.04 16.20 ? 184  LYS A HD2  2  
ATOM   10396  H HD3  . LYS A 1 128 ? 13.088  -6.900  -10.999 0.04 15.87 ? 184  LYS A HD3  2  
ATOM   10397  H HE2  . LYS A 1 128 ? 10.963  -6.012  -11.271 0.04 15.77 ? 184  LYS A HE2  2  
ATOM   10398  H HE3  . LYS A 1 128 ? 11.495  -5.127  -12.485 0.04 16.23 ? 184  LYS A HE3  2  
ATOM   10399  H HZ1  . LYS A 1 128 ? 10.554  -6.876  -13.452 0.04 16.43 ? 184  LYS A HZ1  2  
ATOM   10400  H HZ2  . LYS A 1 128 ? 11.964  -7.203  -13.522 0.04 16.56 ? 184  LYS A HZ2  2  
ATOM   10401  H HZ3  . LYS A 1 128 ? 11.126  -7.836  -12.525 0.04 16.16 ? 184  LYS A HZ3  2  
ATOM   10402  N N    . GLY A 1 129 ? 14.548  -0.219  -9.963  0.04 15.30 ? 185  GLY A N    2  
ATOM   10403  C CA   . GLY A 1 129 ? 14.492  1.218   -10.131 0.04 15.41 ? 185  GLY A CA   2  
ATOM   10404  C C    . GLY A 1 129 ? 15.027  1.771   -8.844  0.04 15.06 ? 185  GLY A C    2  
ATOM   10405  O O    . GLY A 1 129 ? 15.683  1.057   -8.086  0.04 14.83 ? 185  GLY A O    2  
ATOM   10406  H H    . GLY A 1 129 ? 15.074  -0.461  -9.330  0.04 15.12 ? 185  GLY A H    2  
ATOM   10407  H HA2  . GLY A 1 129 ? 15.042  1.509   -10.870 0.04 15.68 ? 185  GLY A HA2  2  
ATOM   10408  H HA3  . GLY A 1 129 ? 13.586  1.525   -10.265 0.04 15.44 ? 185  GLY A HA3  2  
ATOM   10409  N N    . GLY A 1 130 ? 14.723  3.037   -8.600  0.04 15.07 ? 186  GLY A N    2  
ATOM   10410  C CA   . GLY A 1 130 ? 15.106  3.708   -7.367  0.04 14.78 ? 186  GLY A CA   2  
ATOM   10411  C C    . GLY A 1 130 ? 14.003  3.671   -6.344  0.04 14.46 ? 186  GLY A C    2  
ATOM   10412  O O    . GLY A 1 130 ? 12.874  3.230   -6.586  0.04 14.49 ? 186  GLY A O    2  
ATOM   10413  H H    . GLY A 1 130 ? 14.280  3.535   -9.139  0.04 15.25 ? 186  GLY A H    2  
ATOM   10414  H HA2  . GLY A 1 130 ? 15.895  3.291   -6.992  0.04 14.68 ? 186  GLY A HA2  2  
ATOM   10415  H HA3  . GLY A 1 130 ? 15.318  4.635   -7.549  0.04 14.93 ? 186  GLY A HA3  2  
ATOM   10416  N N    . LEU A 1 131 ? 14.337  4.165   -5.147  0.04 14.19 ? 187  LEU A N    2  
ATOM   10417  C CA   . LEU A 1 131 ? 13.402  4.171   -4.039  0.04 13.88 ? 187  LEU A CA   2  
ATOM   10418  C C    . LEU A 1 131 ? 13.530  5.518   -3.341  0.04 13.85 ? 187  LEU A C    2  
ATOM   10419  O O    . LEU A 1 131 ? 14.588  5.849   -2.797  0.04 13.79 ? 187  LEU A O    2  
ATOM   10420  C CB   . LEU A 1 131 ? 13.697  2.998   -3.082  0.04 13.56 ? 187  LEU A CB   2  
ATOM   10421  C CG   . LEU A 1 131 ? 12.723  2.813   -1.939  0.04 13.26 ? 187  LEU A CG   2  
ATOM   10422  C CD1  . LEU A 1 131 ? 11.341  2.355   -2.387  0.04 13.31 ? 187  LEU A CD1  2  
ATOM   10423  C CD2  . LEU A 1 131 ? 13.313  1.849   -0.957  0.04 13.02 ? 187  LEU A CD2  2  
ATOM   10424  H H    . LEU A 1 131 ? 15.099  4.518   -4.964  0.04 14.19 ? 187  LEU A H    2  
ATOM   10425  H HA   . LEU A 1 131 ? 12.495  4.087   -4.358  0.04 13.94 ? 187  LEU A HA   2  
ATOM   10426  H HB2  . LEU A 1 131 ? 13.713  2.170   -3.590  0.04 13.62 ? 187  LEU A HB2  2  
ATOM   10427  H HB3  . LEU A 1 131 ? 14.567  3.146   -2.680  0.04 13.52 ? 187  LEU A HB3  2  
ATOM   10428  H HG   . LEU A 1 131 ? 12.621  3.668   -1.488  0.04 13.22 ? 187  LEU A HG   2  
ATOM   10429  H HD11 . LEU A 1 131 ? 10.810  2.141   -1.605  0.04 13.18 ? 187  LEU A HD11 2  
ATOM   10430  H HD12 . LEU A 1 131 ? 10.923  3.075   -2.883  0.04 13.53 ? 187  LEU A HD12 2  
ATOM   10431  H HD13 . LEU A 1 131 ? 11.427  1.574   -2.957  0.04 13.29 ? 187  LEU A HD13 2  
ATOM   10432  H HD21 . LEU A 1 131 ? 12.755  1.822   -0.167  0.04 12.85 ? 187  LEU A HD21 2  
ATOM   10433  H HD22 . LEU A 1 131 ? 13.348  0.969   -1.369  0.04 13.08 ? 187  LEU A HD22 2  
ATOM   10434  H HD23 . LEU A 1 131 ? 14.209  2.137   -0.734  0.04 13.00 ? 187  LEU A HD23 2  
ATOM   10435  N N    . ASN A 1 132 ? 12.434  6.264   -3.338  0.04 13.93 ? 188  ASN A N    2  
ATOM   10436  C CA   . ASN A 1 132 ? 12.334  7.576   -2.700  0.04 13.96 ? 188  ASN A CA   2  
ATOM   10437  C C    . ASN A 1 132 ? 11.644  7.318   -1.361  0.04 13.63 ? 188  ASN A C    2  
ATOM   10438  O O    . ASN A 1 132 ? 10.628  6.637   -1.311  0.04 13.57 ? 188  ASN A O    2  
ATOM   10439  C CB   . ASN A 1 132 ? 11.508  8.511   -3.603  0.04 14.33 ? 188  ASN A CB   2  
ATOM   10440  C CG   . ASN A 1 132 ? 11.444  9.932   -3.098  0.04 14.42 ? 188  ASN A CG   2  
ATOM   10441  O OD1  . ASN A 1 132 ? 11.859  10.200  -1.963  0.04 14.20 ? 188  ASN A OD1  2  
ATOM   10442  N ND2  . ASN A 1 132 ? 10.924  10.842  -3.928  0.04 14.79 ? 188  ASN A ND2  2  
ATOM   10443  H H    . ASN A 1 132 ? 11.703  6.024   -3.716  0.04 13.99 ? 188  ASN A H    2  
ATOM   10444  H HA   . ASN A 1 132 ? 13.212  7.962   -2.556  0.04 13.98 ? 188  ASN A HA   2  
ATOM   10445  H HB2  . ASN A 1 132 ? 11.896  8.528   -4.490  0.04 14.55 ? 188  ASN A HB2  2  
ATOM   10446  H HB3  . ASN A 1 132 ? 10.597  8.180   -3.640  0.04 14.32 ? 188  ASN A HB3  2  
ATOM   10447  H HD21 . ASN A 1 132 ? 10.767  11.641  -3.653  0.04 14.88 ? 188  ASN A HD21 2  
ATOM   10448  H HD22 . ASN A 1 132 ? 10.735  10.628  -4.738  0.04 14.97 ? 188  ASN A HD22 2  
ATOM   10449  N N    . LEU A 1 133 ? 12.216  7.798   -0.260  0.04 13.45 ? 189  LEU A N    2  
ATOM   10450  C CA   . LEU A 1 133 ? 11.623  7.626   1.066   0.04 13.17 ? 189  LEU A CA   2  
ATOM   10451  C C    . LEU A 1 133 ? 10.940  8.874   1.602   0.04 13.25 ? 189  LEU A C    2  
ATOM   10452  O O    . LEU A 1 133 ? 10.450  8.863   2.748   0.04 13.05 ? 189  LEU A O    2  
ATOM   10453  C CB   . LEU A 1 133 ? 12.685  7.140   2.059   0.04 12.95 ? 189  LEU A CB   2  
ATOM   10454  C CG   . LEU A 1 133 ? 13.404  5.861   1.593   0.04 12.90 ? 189  LEU A CG   2  
ATOM   10455  C CD1  . LEU A 1 133 ? 14.508  5.484   2.592   0.04 12.72 ? 189  LEU A CD1  2  
ATOM   10456  C CD2  . LEU A 1 133 ? 12.372  4.766   1.427   0.04 12.79 ? 189  LEU A CD2  2  
ATOM   10457  H H    . LEU A 1 133 ? 12.961  8.223   -0.255  0.04 13.52 ? 189  LEU A H    2  
ATOM   10458  H HA   . LEU A 1 133 ? 10.941  6.942   1.022   0.04 13.08 ? 189  LEU A HA   2  
ATOM   10459  H HB2  . LEU A 1 133 ? 13.365  7.824   2.160   0.04 13.04 ? 189  LEU A HB2  2  
ATOM   10460  H HB3  . LEU A 1 133 ? 12.270  6.949   2.913   0.04 12.77 ? 189  LEU A HB3  2  
ATOM   10461  H HG   . LEU A 1 133 ? 13.817  6.018   0.732   0.04 13.08 ? 189  LEU A HG   2  
ATOM   10462  H HD11 . LEU A 1 133 ? 14.850  4.605   2.364   0.04 12.73 ? 189  LEU A HD11 2  
ATOM   10463  H HD12 . LEU A 1 133 ? 15.214  6.144   2.541   0.04 12.81 ? 189  LEU A HD12 2  
ATOM   10464  H HD13 . LEU A 1 133 ? 14.135  5.470   3.484   0.04 12.55 ? 189  LEU A HD13 2  
ATOM   10465  H HD21 . LEU A 1 133 ? 12.811  3.904   1.520   0.04 12.75 ? 189  LEU A HD21 2  
ATOM   10466  H HD22 . LEU A 1 133 ? 11.684  4.863   2.105   0.04 12.63 ? 189  LEU A HD22 2  
ATOM   10467  H HD23 . LEU A 1 133 ? 11.968  4.847   0.547   0.04 12.94 ? 189  LEU A HD23 2  
ATOM   10468  N N    . ALA A 1 134 ? 10.840  9.898   0.763   0.04 13.57 ? 190  ALA A N    2  
ATOM   10469  C CA   . ALA A 1 134 ? 10.330  11.213  1.176   0.04 13.70 ? 190  ALA A CA   2  
ATOM   10470  C C    . ALA A 1 134 ? 8.978   11.491  0.541   0.04 13.95 ? 190  ALA A C    2  
ATOM   10471  O O    . ALA A 1 134 ? 8.733   11.120  -0.606  0.04 14.13 ? 190  ALA A O    2  
ATOM   10472  C CB   . ALA A 1 134 ? 11.323  12.315  0.774   0.04 13.94 ? 190  ALA A CB   2  
ATOM   10473  H H    . ALA A 1 134 ? 11.067  9.868   -0.065  0.04 13.73 ? 190  ALA A H    2  
ATOM   10474  H HA   . ALA A 1 134 ? 10.249  11.222  2.140   0.04 13.52 ? 190  ALA A HA   2  
ATOM   10475  H HB1  . ALA A 1 134 ? 10.916  13.184  0.913   0.04 14.08 ? 190  ALA A HB1  2  
ATOM   10476  H HB2  . ALA A 1 134 ? 12.122  12.226  1.316   0.04 13.79 ? 190  ALA A HB2  2  
ATOM   10477  H HB3  . ALA A 1 134 ? 11.541  12.205  -0.165  0.04 14.13 ? 190  ALA A HB3  2  
ATOM   10478  N N    . PRO A 1 135 ? 8.080   12.180  1.266   0.04 14.00 ? 191  PRO A N    2  
ATOM   10479  C CA   . PRO A 1 135 ? 6.848   12.539  0.579   0.04 14.29 ? 191  PRO A CA   2  
ATOM   10480  C C    . PRO A 1 135 ? 7.137   13.593  -0.450  0.04 14.73 ? 191  PRO A C    2  
ATOM   10481  O O    . PRO A 1 135 ? 8.105   14.348  -0.331  0.04 14.79 ? 191  PRO A O    2  
ATOM   10482  C CB   . PRO A 1 135 ? 5.960   13.117  1.699   0.04 14.24 ? 191  PRO A CB   2  
ATOM   10483  C CG   . PRO A 1 135 ? 6.952   13.670  2.714   0.04 14.07 ? 191  PRO A CG   2  
ATOM   10484  C CD   . PRO A 1 135 ? 8.163   12.743  2.623   0.04 13.82 ? 191  PRO A CD   2  
ATOM   10485  H HA   . PRO A 1 135 ? 6.425   11.773  0.163   0.04 14.26 ? 191  PRO A HA   2  
ATOM   10486  H HB2  . PRO A 1 135 ? 5.398   13.820  1.340   0.04 14.51 ? 191  PRO A HB2  2  
ATOM   10487  H HB3  . PRO A 1 135 ? 5.416   12.418  2.095   0.04 14.07 ? 191  PRO A HB3  2  
ATOM   10488  H HG2  . PRO A 1 135 ? 7.212   14.569  2.461   0.04 14.29 ? 191  PRO A HG2  2  
ATOM   10489  H HG3  . PRO A 1 135 ? 6.571   13.664  3.604   0.04 13.94 ? 191  PRO A HG3  2  
ATOM   10490  H HD2  . PRO A 1 135 ? 8.986   13.246  2.720   0.04 13.84 ? 191  PRO A HD2  2  
ATOM   10491  H HD3  . PRO A 1 135 ? 8.100   12.031  3.282   0.04 13.57 ? 191  PRO A HD3  2  
ATOM   10492  N N    . ASP A 1 136 ? 6.314   13.612  -1.472  0.04 15.06 ? 192  ASP A N    2  
ATOM   10493  C CA   . ASP A 1 136 ? 6.488   14.564  -2.541  0.04 15.55 ? 192  ASP A CA   2  
ATOM   10494  C C    . ASP A 1 136 ? 6.492   15.951  -1.902  0.04 15.83 ? 192  ASP A C    2  
ATOM   10495  O O    . ASP A 1 136 ? 5.702   16.217  -0.950  0.04 16.20 ? 192  ASP A O    2  
ATOM   10496  C CB   . ASP A 1 136 ? 5.361   14.358  -3.537  0.04 15.81 ? 192  AS