data_4TZJ
# 
_entry.id   4TZJ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4TZJ         
WWPDB D_1000202325 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB '4TRK contains wild type HIM-3' 4TRK unspecified 
PDB .                               4TZL unspecified 
PDB .                               4TZM unspecified 
PDB .                               4TZN unspecified 
PDB .                               4TZO unspecified 
PDB .                               4TZQ unspecified 
PDB .                               4TZS unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4TZJ 
_pdbx_database_status.recvd_initial_deposition_date   2014-07-10 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Rosenberg, S.C.' 1 
'Corbett, K.D.'   2 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Dev.Cell 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1534-5807 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            31 
_citation.language                  ? 
_citation.page_first                487 
_citation.page_last                 502 
_citation.title                     
'The Chromosome Axis Controls Meiotic Events through a Hierarchical Assembly of HORMA Domain Proteins.' 
_citation.year                      2014 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.devcel.2014.09.013 
_citation.pdbx_database_id_PubMed   25446517 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Kim, Y.'         1 ? 
primary 'Rosenberg, S.C.' 2 ? 
primary 'Kugel, C.L.'     3 ? 
primary 'Kostow, N.'      4 ? 
primary 'Rog, O.'         5 ? 
primary 'Davydov, V.'     6 ? 
primary 'Su, T.Y.'        7 ? 
primary 'Dernburg, A.F.'  8 ? 
primary 'Corbett, K.D.'   9 ? 
# 
_cell.entry_id           4TZJ 
_cell.length_a           161.791 
_cell.length_b           161.791 
_cell.length_c           110.545 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              18 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4TZJ 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                155 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'H 3 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'C. elegans HIM-3 and HTP-3' 
_entity.formula_weight             33392.059 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'UNP G5EBG0 residues 1-276,UNP O01820 residues 649-663' 
_entity.details                    Chimera 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MATKEQIVEHRESEIPIASQWKATFPVDLEIEKNSEMFALRYIKCASAFILDRRGILDEKCFKTRTIDKLLVTAFQSSVP
AAKRVSSTFDGLRDAIQQGYLREFAIVFYKKPNEEDINEVFAFRFAYGDEGEIFVSLNNGIDTNESSQELLQAKFVDTDN
TKQMFASTIKKLHRCIKKMEPLPQGSDASFRVSYTEKAPKDYTPEGYLLSPMFYTLNQDIRKASIGIVCGGHHKIQMLAA
SQYLKQDFDLDKTTTLNPNMSIMANQSKRKGRISRDRHYGRVSSILDVAGSKD
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MATKEQIVEHRESEIPIASQWKATFPVDLEIEKNSEMFALRYIKCASAFILDRRGILDEKCFKTRTIDKLLVTAFQSSVP
AAKRVSSTFDGLRDAIQQGYLREFAIVFYKKPNEEDINEVFAFRFAYGDEGEIFVSLNNGIDTNESSQELLQAKFVDTDN
TKQMFASTIKKLHRCIKKMEPLPQGSDASFRVSYTEKAPKDYTPEGYLLSPMFYTLNQDIRKASIGIVCGGHHKIQMLAA
SQYLKQDFDLDKTTTLNPNMSIMANQSKRKGRISRDRHYGRVSSILDVAGSKD
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   THR n 
1 4   LYS n 
1 5   GLU n 
1 6   GLN n 
1 7   ILE n 
1 8   VAL n 
1 9   GLU n 
1 10  HIS n 
1 11  ARG n 
1 12  GLU n 
1 13  SER n 
1 14  GLU n 
1 15  ILE n 
1 16  PRO n 
1 17  ILE n 
1 18  ALA n 
1 19  SER n 
1 20  GLN n 
1 21  TRP n 
1 22  LYS n 
1 23  ALA n 
1 24  THR n 
1 25  PHE n 
1 26  PRO n 
1 27  VAL n 
1 28  ASP n 
1 29  LEU n 
1 30  GLU n 
1 31  ILE n 
1 32  GLU n 
1 33  LYS n 
1 34  ASN n 
1 35  SER n 
1 36  GLU n 
1 37  MET n 
1 38  PHE n 
1 39  ALA n 
1 40  LEU n 
1 41  ARG n 
1 42  TYR n 
1 43  ILE n 
1 44  LYS n 
1 45  CYS n 
1 46  ALA n 
1 47  SER n 
1 48  ALA n 
1 49  PHE n 
1 50  ILE n 
1 51  LEU n 
1 52  ASP n 
1 53  ARG n 
1 54  ARG n 
1 55  GLY n 
1 56  ILE n 
1 57  LEU n 
1 58  ASP n 
1 59  GLU n 
1 60  LYS n 
1 61  CYS n 
1 62  PHE n 
1 63  LYS n 
1 64  THR n 
1 65  ARG n 
1 66  THR n 
1 67  ILE n 
1 68  ASP n 
1 69  LYS n 
1 70  LEU n 
1 71  LEU n 
1 72  VAL n 
1 73  THR n 
1 74  ALA n 
1 75  PHE n 
1 76  GLN n 
1 77  SER n 
1 78  SER n 
1 79  VAL n 
1 80  PRO n 
1 81  ALA n 
1 82  ALA n 
1 83  LYS n 
1 84  ARG n 
1 85  VAL n 
1 86  SER n 
1 87  SER n 
1 88  THR n 
1 89  PHE n 
1 90  ASP n 
1 91  GLY n 
1 92  LEU n 
1 93  ARG n 
1 94  ASP n 
1 95  ALA n 
1 96  ILE n 
1 97  GLN n 
1 98  GLN n 
1 99  GLY n 
1 100 TYR n 
1 101 LEU n 
1 102 ARG n 
1 103 GLU n 
1 104 PHE n 
1 105 ALA n 
1 106 ILE n 
1 107 VAL n 
1 108 PHE n 
1 109 TYR n 
1 110 LYS n 
1 111 LYS n 
1 112 PRO n 
1 113 ASN n 
1 114 GLU n 
1 115 GLU n 
1 116 ASP n 
1 117 ILE n 
1 118 ASN n 
1 119 GLU n 
1 120 VAL n 
1 121 PHE n 
1 122 ALA n 
1 123 PHE n 
1 124 ARG n 
1 125 PHE n 
1 126 ALA n 
1 127 TYR n 
1 128 GLY n 
1 129 ASP n 
1 130 GLU n 
1 131 GLY n 
1 132 GLU n 
1 133 ILE n 
1 134 PHE n 
1 135 VAL n 
1 136 SER n 
1 137 LEU n 
1 138 ASN n 
1 139 ASN n 
1 140 GLY n 
1 141 ILE n 
1 142 ASP n 
1 143 THR n 
1 144 ASN n 
1 145 GLU n 
1 146 SER n 
1 147 SER n 
1 148 GLN n 
1 149 GLU n 
1 150 LEU n 
1 151 LEU n 
1 152 GLN n 
1 153 ALA n 
1 154 LYS n 
1 155 PHE n 
1 156 VAL n 
1 157 ASP n 
1 158 THR n 
1 159 ASP n 
1 160 ASN n 
1 161 THR n 
1 162 LYS n 
1 163 GLN n 
1 164 MET n 
1 165 PHE n 
1 166 ALA n 
1 167 SER n 
1 168 THR n 
1 169 ILE n 
1 170 LYS n 
1 171 LYS n 
1 172 LEU n 
1 173 HIS n 
1 174 ARG n 
1 175 CYS n 
1 176 ILE n 
1 177 LYS n 
1 178 LYS n 
1 179 MET n 
1 180 GLU n 
1 181 PRO n 
1 182 LEU n 
1 183 PRO n 
1 184 GLN n 
1 185 GLY n 
1 186 SER n 
1 187 ASP n 
1 188 ALA n 
1 189 SER n 
1 190 PHE n 
1 191 ARG n 
1 192 VAL n 
1 193 SER n 
1 194 TYR n 
1 195 THR n 
1 196 GLU n 
1 197 LYS n 
1 198 ALA n 
1 199 PRO n 
1 200 LYS n 
1 201 ASP n 
1 202 TYR n 
1 203 THR n 
1 204 PRO n 
1 205 GLU n 
1 206 GLY n 
1 207 TYR n 
1 208 LEU n 
1 209 LEU n 
1 210 SER n 
1 211 PRO n 
1 212 MET n 
1 213 PHE n 
1 214 TYR n 
1 215 THR n 
1 216 LEU n 
1 217 ASN n 
1 218 GLN n 
1 219 ASP n 
1 220 ILE n 
1 221 ARG n 
1 222 LYS n 
1 223 ALA n 
1 224 SER n 
1 225 ILE n 
1 226 GLY n 
1 227 ILE n 
1 228 VAL n 
1 229 CYS n 
1 230 GLY n 
1 231 GLY n 
1 232 HIS n 
1 233 HIS n 
1 234 LYS n 
1 235 ILE n 
1 236 GLN n 
1 237 MET n 
1 238 LEU n 
1 239 ALA n 
1 240 ALA n 
1 241 SER n 
1 242 GLN n 
1 243 TYR n 
1 244 LEU n 
1 245 LYS n 
1 246 GLN n 
1 247 ASP n 
1 248 PHE n 
1 249 ASP n 
1 250 LEU n 
1 251 ASP n 
1 252 LYS n 
1 253 THR n 
1 254 THR n 
1 255 THR n 
1 256 LEU n 
1 257 ASN n 
1 258 PRO n 
1 259 ASN n 
1 260 MET n 
1 261 SER n 
1 262 ILE n 
1 263 MET n 
1 264 ALA n 
1 265 ASN n 
1 266 GLN n 
1 267 SER n 
1 268 LYS n 
1 269 ARG n 
1 270 LYS n 
1 271 GLY n 
1 272 ARG n 
1 273 ILE n 
1 274 SER n 
1 275 ARG n 
1 276 ASP n 
1 277 ARG n 
1 278 HIS n 
1 279 TYR n 
1 280 GLY n 
1 281 ARG n 
1 282 VAL n 
1 283 SER n 
1 284 SER n 
1 285 ILE n 
1 286 LEU n 
1 287 ASP n 
1 288 VAL n 
1 289 ALA n 
1 290 GLY n 
1 291 SER n 
1 292 LYS n 
1 293 ASP n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1   276 ? ? 'him-3, CELE_ZK381.1, ZK381.1' ? ? ? ? ? ? 'Caenorhabditis elegans' 6239 ? ? ? ? ? ? 
? ? 'Escherichia coli' 562 ? ? ? ? ? ? 'Rosetta 2 pLysS' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
1 2 sample 'Biological sequence' 277 293 ? ? 'htp-3, CELE_F57C9.5, F57C9.5' ? ? ? ? ? ? 'Caenorhabditis elegans' 6239 ? ? ? ? ? ? 
? ? 'Escherichia coli' 562 ? ? ? ? ? ? 'Rosetta2 pLysS'  ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP G5EBG0_CAEEL G5EBG0 1 
;MATKEQIVEHRESEIPIASQWKATFPVDLEIEKNSEMFALRYIKCASAFILDRRGILDEKCFKTRTIDKLLVTAFQSSVP
AAKRVSSTFDGLRDAIQQGYLREFAIVFYKKPNEEDINEVFAFRFAYGDEGEIFVSLNNGIDTNESSQELLQAKFVDTDN
TKQMFASTIKKLHRCIKKMEPLPQGSDASFRVSYTEKAPKDYTPEGYLLSPMFYTLNQDIRKASIGIVCGGHHKIQMLAA
SQYLKQDFDLDKTTTLNPNMSIMANQSKRKGRISRD
;
1   ? 
2 UNP O01820_CAEEL O01820 1 RHYGRVSSILDVAGS 649 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4TZJ A 1   ? 276 ? G5EBG0 1   ? 276 ? 1   648 
2 2 4TZJ A 277 ? 291 ? O01820 649 ? 663 ? 649 663 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
2 4TZJ LYS A 292 ? UNP O01820 ? ? 'expression tag' 664 1 
2 4TZJ ASP A 293 ? UNP O01820 ? ? 'expression tag' 665 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4TZJ 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            4.17 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         70.50 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              4.75 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            298.15 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '15-22% PEG 3350' 
_exptl_crystal_grow.pdbx_pH_range   4.75 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2013-07-01 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.979 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SSRL BEAMLINE BL12-2' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.979 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL12-2 
_diffrn_source.pdbx_synchrotron_site       SSRL 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         4TZJ 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.85 
_reflns.d_resolution_low                 50 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       12444 
_reflns.number_obs                       12444 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             95.7 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  7.5 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  0.057 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            20.1 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 4TZJ 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.851 
_refine.ls_d_res_low                             38.239 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     12376 
_refine.ls_number_reflns_R_free                  580 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    94.53 
_refine.ls_percent_reflns_R_free                 4.69 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1802 
_refine.ls_R_factor_R_free                       0.2299 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1779 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4TRK 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 28.84 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.40 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.004  ? 1961 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.839  ? 2640 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 14.955 ? 730  ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.032  ? 289  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.004  ? 340  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
'X-RAY DIFFRACTION' 2.851  3.1377  . . 138 2917 94.00 . . . 0.3188 . 0.2968 . . . . . . . . 
'X-RAY DIFFRACTION' 3.1377 3.5914  . . 154 2959 96.00 . . . 0.2673 . 0.2068 . . . . . . . . 
'X-RAY DIFFRACTION' 3.5914 4.5236  . . 142 2951 95.00 . . . 0.2209 . 0.1701 . . . . . . . . 
'X-RAY DIFFRACTION' 4.5236 38.2426 . . 146 2969 93.00 . . . 0.2140 . 0.1610 . . . . . . . . 
# 
_struct.entry_id                     4TZJ 
_struct.title                        'Structure of C. elegans HIM-3 bound to HTP-3 closure motif-4' 
_struct.pdbx_descriptor              'Meiotic chromosome core protein,Protein HTP-3' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4TZJ 
_struct_keywords.text            'HORMA domain meiosis chromosome axis, Peptide Binding Protein' 
_struct_keywords.pdbx_keywords   'PEPTIDE BINDING PROTEIN' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 GLN A 20  ? THR A 24  ? GLN A 20  THR A 24  5 ? 5  
HELX_P HELX_P2 AA2 ILE A 31  ? ARG A 54  ? ILE A 31  ARG A 54  1 ? 24 
HELX_P HELX_P3 AA3 ASP A 58  ? LYS A 60  ? ASP A 58  LYS A 60  5 ? 3  
HELX_P HELX_P4 AA4 VAL A 79  ? GLN A 98  ? VAL A 79  GLN A 98  1 ? 20 
HELX_P HELX_P5 AA5 THR A 143 ? ALA A 153 ? THR A 143 ALA A 153 1 ? 11 
HELX_P HELX_P6 AA6 ASP A 157 ? LYS A 178 ? ASP A 157 LYS A 178 1 ? 22 
HELX_P HELX_P7 AA7 SER A 284 ? ALA A 289 ? SER A 656 ALA A 661 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          LYS 
_struct_mon_prot_cis.label_seq_id           111 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           LYS 
_struct_mon_prot_cis.auth_seq_id            111 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    112 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     112 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -2.16 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 7 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA2 5 6 ? anti-parallel 
AA2 6 7 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 PHE A 62  ? ILE A 67  ? PHE A 62  ILE A 67  
AA1 2 LEU A 70  ? PHE A 75  ? LEU A 70  PHE A 75  
AA2 1 LEU A 208 ? SER A 210 ? LEU A 208 SER A 210 
AA2 2 TYR A 279 ? VAL A 282 ? TYR A 651 VAL A 654 
AA2 3 SER A 186 ? TYR A 194 ? SER A 186 TYR A 194 
AA2 4 LEU A 101 ? LYS A 110 ? LEU A 101 LYS A 110 
AA2 5 ILE A 117 ? TYR A 127 ? ILE A 117 TYR A 127 
AA2 6 HIS A 233 ? SER A 241 ? HIS A 233 SER A 241 
AA2 7 ARG A 221 ? CYS A 229 ? ARG A 221 CYS A 229 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ILE A 67  ? N ILE A 67  O LEU A 70  ? O LEU A 70  
AA2 1 2 N LEU A 208 ? N LEU A 208 O ARG A 281 ? O ARG A 653 
AA2 2 3 O VAL A 282 ? O VAL A 654 N PHE A 190 ? N PHE A 190 
AA2 3 4 O ASP A 187 ? O ASP A 187 N TYR A 109 ? N TYR A 109 
AA2 4 5 N ARG A 102 ? N ARG A 102 O PHE A 125 ? O PHE A 125 
AA2 5 6 N ALA A 122 ? N ALA A 122 O LEU A 238 ? O LEU A 238 
AA2 6 7 O ALA A 239 ? O ALA A 239 N ALA A 223 ? N ALA A 223 
# 
_atom_sites.entry_id                    4TZJ 
_atom_sites.fract_transf_matrix[1][1]   0.006181 
_atom_sites.fract_transf_matrix[1][2]   0.003568 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007137 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009046 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N   . SER A 1 19  ? 187.069 -22.377 59.255 1.00 152.50 ? 19  SER A N   1 
ATOM 2    C CA  . SER A 1 19  ? 186.883 -22.745 57.853 1.00 150.63 ? 19  SER A CA  1 
ATOM 3    C C   . SER A 1 19  ? 185.384 -22.882 57.542 1.00 138.33 ? 19  SER A C   1 
ATOM 4    O O   . SER A 1 19  ? 184.990 -23.345 56.470 1.00 130.82 ? 19  SER A O   1 
ATOM 5    C CB  . SER A 1 19  ? 187.660 -24.024 57.540 1.00 156.05 ? 19  SER A CB  1 
ATOM 6    O OG  . SER A 1 19  ? 187.652 -24.895 58.662 1.00 148.20 ? 19  SER A OG  1 
ATOM 7    N N   . GLN A 1 20  ? 184.549 -22.420 58.471 1.00 115.27 ? 20  GLN A N   1 
ATOM 8    C CA  . GLN A 1 20  ? 183.146 -22.170 58.153 1.00 91.68  ? 20  GLN A CA  1 
ATOM 9    C C   . GLN A 1 20  ? 183.076 -20.990 57.172 1.00 103.32 ? 20  GLN A C   1 
ATOM 10   O O   . GLN A 1 20  ? 183.930 -20.102 57.209 1.00 120.45 ? 20  GLN A O   1 
ATOM 11   C CB  . GLN A 1 20  ? 182.350 -21.887 59.428 1.00 84.70  ? 20  GLN A CB  1 
ATOM 12   C CG  . GLN A 1 20  ? 180.840 -22.127 59.333 1.00 108.36 ? 20  GLN A CG  1 
ATOM 13   C CD  . GLN A 1 20  ? 180.472 -23.598 59.212 1.00 116.41 ? 20  GLN A CD  1 
ATOM 14   O OE1 . GLN A 1 20  ? 181.338 -24.475 59.218 1.00 116.80 ? 20  GLN A OE1 1 
ATOM 15   N NE2 . GLN A 1 20  ? 179.178 -23.875 59.117 1.00 97.49  ? 20  GLN A NE2 1 
ATOM 16   N N   . TRP A 1 21  ? 182.082 -20.985 56.288 1.00 102.17 ? 21  TRP A N   1 
ATOM 17   C CA  . TRP A 1 21  ? 181.910 -19.873 55.356 1.00 75.91  ? 21  TRP A CA  1 
ATOM 18   C C   . TRP A 1 21  ? 181.857 -18.553 56.122 1.00 84.38  ? 21  TRP A C   1 
ATOM 19   O O   . TRP A 1 21  ? 182.444 -17.550 55.706 1.00 82.14  ? 21  TRP A O   1 
ATOM 20   C CB  . TRP A 1 21  ? 180.641 -20.072 54.517 1.00 69.84  ? 21  TRP A CB  1 
ATOM 21   C CG  . TRP A 1 21  ? 180.107 -18.835 53.861 1.00 64.71  ? 21  TRP A CG  1 
ATOM 22   C CD1 . TRP A 1 21  ? 179.430 -17.815 54.464 1.00 73.82  ? 21  TRP A CD1 1 
ATOM 23   C CD2 . TRP A 1 21  ? 180.167 -18.510 52.468 1.00 64.06  ? 21  TRP A CD2 1 
ATOM 24   N NE1 . TRP A 1 21  ? 179.085 -16.864 53.538 1.00 73.17  ? 21  TRP A NE1 1 
ATOM 25   C CE2 . TRP A 1 21  ? 179.521 -17.266 52.305 1.00 65.15  ? 21  TRP A CE2 1 
ATOM 26   C CE3 . TRP A 1 21  ? 180.709 -19.140 51.345 1.00 65.48  ? 21  TRP A CE3 1 
ATOM 27   C CZ2 . TRP A 1 21  ? 179.405 -16.646 51.066 1.00 71.76  ? 21  TRP A CZ2 1 
ATOM 28   C CZ3 . TRP A 1 21  ? 180.591 -18.520 50.116 1.00 74.24  ? 21  TRP A CZ3 1 
ATOM 29   C CH2 . TRP A 1 21  ? 179.944 -17.286 49.987 1.00 73.60  ? 21  TRP A CH2 1 
ATOM 30   N N   . LYS A 1 22  ? 181.173 -18.582 57.262 1.00 97.05  ? 22  LYS A N   1 
ATOM 31   C CA  . LYS A 1 22  ? 180.981 -17.408 58.104 1.00 98.86  ? 22  LYS A CA  1 
ATOM 32   C C   . LYS A 1 22  ? 182.305 -16.822 58.597 1.00 101.90 ? 22  LYS A C   1 
ATOM 33   O O   . LYS A 1 22  ? 182.394 -15.629 58.889 1.00 101.43 ? 22  LYS A O   1 
ATOM 34   C CB  . LYS A 1 22  ? 180.086 -17.768 59.292 1.00 106.59 ? 22  LYS A CB  1 
ATOM 35   C CG  . LYS A 1 22  ? 179.751 -16.607 60.212 1.00 105.16 ? 22  LYS A CG  1 
ATOM 36   C CD  . LYS A 1 22  ? 178.941 -17.077 61.408 1.00 113.53 ? 22  LYS A CD  1 
ATOM 37   C CE  . LYS A 1 22  ? 179.038 -16.089 62.557 1.00 115.47 ? 22  LYS A CE  1 
ATOM 38   N NZ  . LYS A 1 22  ? 178.001 -16.336 63.595 1.00 114.24 ? 22  LYS A NZ  1 
ATOM 39   N N   . ALA A 1 23  ? 183.335 -17.659 58.675 1.00 107.51 ? 23  ALA A N   1 
ATOM 40   C CA  . ALA A 1 23  ? 184.646 -17.215 59.138 1.00 105.21 ? 23  ALA A CA  1 
ATOM 41   C C   . ALA A 1 23  ? 185.300 -16.252 58.149 1.00 99.75  ? 23  ALA A C   1 
ATOM 42   O O   . ALA A 1 23  ? 186.180 -15.477 58.519 1.00 86.77  ? 23  ALA A O   1 
ATOM 43   C CB  . ALA A 1 23  ? 185.551 -18.411 59.383 1.00 92.31  ? 23  ALA A CB  1 
ATOM 44   N N   . THR A 1 24  ? 184.868 -16.308 56.894 1.00 101.10 ? 24  THR A N   1 
ATOM 45   C CA  . THR A 1 24  ? 185.418 -15.445 55.854 1.00 77.10  ? 24  THR A CA  1 
ATOM 46   C C   . THR A 1 24  ? 184.397 -14.420 55.388 1.00 87.83  ? 24  THR A C   1 
ATOM 47   O O   . THR A 1 24  ? 184.704 -13.237 55.240 1.00 90.60  ? 24  THR A O   1 
ATOM 48   C CB  . THR A 1 24  ? 185.885 -16.256 54.636 1.00 77.66  ? 24  THR A CB  1 
ATOM 49   O OG1 . THR A 1 24  ? 186.851 -17.225 55.050 1.00 87.16  ? 24  THR A OG1 1 
ATOM 50   C CG2 . THR A 1 24  ? 186.502 -15.342 53.586 1.00 67.32  ? 24  THR A CG2 1 
ATOM 51   N N   . PHE A 1 25  ? 183.177 -14.891 55.157 1.00 79.19  ? 25  PHE A N   1 
ATOM 52   C CA  . PHE A 1 25  ? 182.120 -14.057 54.608 1.00 76.41  ? 25  PHE A CA  1 
ATOM 53   C C   . PHE A 1 25  ? 180.972 -13.891 55.594 1.00 84.08  ? 25  PHE A C   1 
ATOM 54   O O   . PHE A 1 25  ? 180.790 -14.719 56.483 1.00 76.86  ? 25  PHE A O   1 
ATOM 55   C CB  . PHE A 1 25  ? 181.597 -14.660 53.304 1.00 78.57  ? 25  PHE A CB  1 
ATOM 56   C CG  . PHE A 1 25  ? 182.631 -14.759 52.223 1.00 67.82  ? 25  PHE A CG  1 
ATOM 57   C CD1 . PHE A 1 25  ? 183.175 -13.618 51.662 1.00 81.10  ? 25  PHE A CD1 1 
ATOM 58   C CD2 . PHE A 1 25  ? 183.054 -15.995 51.764 1.00 71.95  ? 25  PHE A CD2 1 
ATOM 59   C CE1 . PHE A 1 25  ? 184.126 -13.705 50.664 1.00 75.33  ? 25  PHE A CE1 1 
ATOM 60   C CE2 . PHE A 1 25  ? 184.005 -16.090 50.766 1.00 68.69  ? 25  PHE A CE2 1 
ATOM 61   C CZ  . PHE A 1 25  ? 184.542 -14.943 50.215 1.00 65.55  ? 25  PHE A CZ  1 
ATOM 62   N N   . PRO A 1 26  ? 180.197 -12.809 55.446 1.00 90.05  ? 26  PRO A N   1 
ATOM 63   C CA  . PRO A 1 26  ? 178.964 -12.680 56.222 1.00 79.73  ? 26  PRO A CA  1 
ATOM 64   C C   . PRO A 1 26  ? 177.834 -13.467 55.571 1.00 93.75  ? 26  PRO A C   1 
ATOM 65   O O   . PRO A 1 26  ? 177.931 -13.800 54.390 1.00 94.15  ? 26  PRO A O   1 
ATOM 66   C CB  . PRO A 1 26  ? 178.684 -11.179 56.180 1.00 77.79  ? 26  PRO A CB  1 
ATOM 67   C CG  . PRO A 1 26  ? 179.247 -10.750 54.867 1.00 86.21  ? 26  PRO A CG  1 
ATOM 68   C CD  . PRO A 1 26  ? 180.475 -11.601 54.648 1.00 87.79  ? 26  PRO A CD  1 
ATOM 69   N N   . VAL A 1 27  ? 176.788 -13.772 56.331 1.00 88.50  ? 27  VAL A N   1 
ATOM 70   C CA  . VAL A 1 27  ? 175.600 -14.397 55.764 1.00 90.72  ? 27  VAL A CA  1 
ATOM 71   C C   . VAL A 1 27  ? 174.445 -13.409 55.839 1.00 92.71  ? 27  VAL A C   1 
ATOM 72   O O   . VAL A 1 27  ? 174.662 -12.228 56.118 1.00 110.95 ? 27  VAL A O   1 
ATOM 73   C CB  . VAL A 1 27  ? 175.233 -15.708 56.486 1.00 84.76  ? 27  VAL A CB  1 
ATOM 74   C CG1 . VAL A 1 27  ? 176.377 -16.701 56.382 1.00 82.53  ? 27  VAL A CG1 1 
ATOM 75   C CG2 . VAL A 1 27  ? 174.894 -15.441 57.940 1.00 88.19  ? 27  VAL A CG2 1 
ATOM 76   N N   . ASP A 1 28  ? 173.229 -13.895 55.597 1.00 79.49  ? 28  ASP A N   1 
ATOM 77   C CA  . ASP A 1 28  ? 172.047 -13.040 55.513 1.00 84.59  ? 28  ASP A CA  1 
ATOM 78   C C   . ASP A 1 28  ? 172.298 -11.925 54.506 1.00 89.14  ? 28  ASP A C   1 
ATOM 79   O O   . ASP A 1 28  ? 172.128 -10.744 54.809 1.00 86.08  ? 28  ASP A O   1 
ATOM 80   C CB  . ASP A 1 28  ? 171.685 -12.460 56.884 1.00 81.50  ? 28  ASP A CB  1 
ATOM 81   C CG  . ASP A 1 28  ? 171.176 -13.514 57.847 1.00 103.56 ? 28  ASP A CG  1 
ATOM 82   O OD1 . ASP A 1 28  ? 170.661 -14.551 57.378 1.00 113.11 ? 28  ASP A OD1 1 
ATOM 83   O OD2 . ASP A 1 28  ? 171.290 -13.306 59.073 1.00 97.55  ? 28  ASP A OD2 1 
ATOM 84   N N   . LEU A 1 29  ? 172.705 -12.319 53.303 1.00 82.58  ? 29  LEU A N   1 
ATOM 85   C CA  . LEU A 1 29  ? 173.128 -11.376 52.274 1.00 83.04  ? 29  LEU A CA  1 
ATOM 86   C C   . LEU A 1 29  ? 171.983 -10.531 51.724 1.00 71.53  ? 29  LEU A C   1 
ATOM 87   O O   . LEU A 1 29  ? 172.192 -9.697  50.844 1.00 77.81  ? 29  LEU A O   1 
ATOM 88   C CB  . LEU A 1 29  ? 173.809 -12.124 51.126 1.00 79.80  ? 29  LEU A CB  1 
ATOM 89   C CG  . LEU A 1 29  ? 175.027 -12.962 51.515 1.00 84.25  ? 29  LEU A CG  1 
ATOM 90   C CD1 . LEU A 1 29  ? 175.611 -13.672 50.302 1.00 87.19  ? 29  LEU A CD1 1 
ATOM 91   C CD2 . LEU A 1 29  ? 176.072 -12.088 52.190 1.00 77.08  ? 29  LEU A CD2 1 
ATOM 92   N N   . GLU A 1 30  ? 170.776 -10.749 52.233 1.00 96.11  ? 30  GLU A N   1 
ATOM 93   C CA  . GLU A 1 30  ? 169.634 -9.946  51.821 1.00 112.94 ? 30  GLU A CA  1 
ATOM 94   C C   . GLU A 1 30  ? 169.766 -8.519  52.344 1.00 109.51 ? 30  GLU A C   1 
ATOM 95   O O   . GLU A 1 30  ? 169.372 -7.564  51.674 1.00 97.78  ? 30  GLU A O   1 
ATOM 96   C CB  . GLU A 1 30  ? 168.326 -10.574 52.301 1.00 117.80 ? 30  GLU A CB  1 
ATOM 97   C CG  . GLU A 1 30  ? 167.082 -9.799  51.891 1.00 148.84 ? 30  GLU A CG  1 
ATOM 98   C CD  . GLU A 1 30  ? 166.944 -9.632  50.385 1.00 161.14 ? 30  GLU A CD  1 
ATOM 99   O OE1 . GLU A 1 30  ? 167.552 -10.416 49.624 1.00 158.55 ? 30  GLU A OE1 1 
ATOM 100  O OE2 . GLU A 1 30  ? 166.222 -8.707  49.959 1.00 169.28 ? 30  GLU A OE2 1 
ATOM 101  N N   . ILE A 1 31  ? 170.321 -8.382  53.544 1.00 108.70 ? 31  ILE A N   1 
ATOM 102  C CA  . ILE A 1 31  ? 170.642 -7.070  54.089 1.00 94.19  ? 31  ILE A CA  1 
ATOM 103  C C   . ILE A 1 31  ? 171.665 -6.387  53.189 1.00 89.60  ? 31  ILE A C   1 
ATOM 104  O O   . ILE A 1 31  ? 172.639 -7.012  52.768 1.00 98.17  ? 31  ILE A O   1 
ATOM 105  C CB  . ILE A 1 31  ? 171.204 -7.161  55.522 1.00 93.61  ? 31  ILE A CB  1 
ATOM 106  C CG1 . ILE A 1 31  ? 170.285 -7.996  56.415 1.00 84.69  ? 31  ILE A CG1 1 
ATOM 107  C CG2 . ILE A 1 31  ? 171.400 -5.773  56.110 1.00 114.15 ? 31  ILE A CG2 1 
ATOM 108  C CD1 . ILE A 1 31  ? 170.874 -8.283  57.781 1.00 96.79  ? 31  ILE A CD1 1 
ATOM 109  N N   . GLU A 1 32  ? 171.436 -5.112  52.887 1.00 92.34  ? 32  GLU A N   1 
ATOM 110  C CA  . GLU A 1 32  ? 172.341 -4.353  52.030 1.00 90.19  ? 32  GLU A CA  1 
ATOM 111  C C   . GLU A 1 32  ? 173.735 -4.270  52.638 1.00 95.58  ? 32  GLU A C   1 
ATOM 112  O O   . GLU A 1 32  ? 174.737 -4.437  51.942 1.00 90.93  ? 32  GLU A O   1 
ATOM 113  C CB  . GLU A 1 32  ? 171.797 -2.946  51.784 1.00 87.20  ? 32  GLU A CB  1 
ATOM 114  C CG  . GLU A 1 32  ? 172.644 -2.122  50.830 1.00 103.93 ? 32  GLU A CG  1 
ATOM 115  C CD  . GLU A 1 32  ? 172.127 -0.709  50.663 1.00 134.15 ? 32  GLU A CD  1 
ATOM 116  O OE1 . GLU A 1 32  ? 170.940 -0.469  50.970 1.00 146.80 ? 32  GLU A OE1 1 
ATOM 117  O OE2 . GLU A 1 32  ? 172.906 0.161   50.223 1.00 139.70 ? 32  GLU A OE2 1 
ATOM 118  N N   . LYS A 1 33  ? 173.784 -4.011  53.942 1.00 105.38 ? 33  LYS A N   1 
ATOM 119  C CA  . LYS A 1 33  ? 175.040 -3.923  54.679 1.00 83.55  ? 33  LYS A CA  1 
ATOM 120  C C   . LYS A 1 33  ? 175.882 -5.184  54.519 1.00 95.00  ? 33  LYS A C   1 
ATOM 121  O O   . LYS A 1 33  ? 177.075 -5.112  54.227 1.00 100.73 ? 33  LYS A O   1 
ATOM 122  C CB  . LYS A 1 33  ? 174.764 -3.670  56.160 1.00 97.73  ? 33  LYS A CB  1 
ATOM 123  C CG  . LYS A 1 33  ? 176.008 -3.568  57.021 1.00 101.63 ? 33  LYS A CG  1 
ATOM 124  C CD  . LYS A 1 33  ? 175.640 -3.457  58.490 1.00 106.67 ? 33  LYS A CD  1 
ATOM 125  C CE  . LYS A 1 33  ? 174.636 -2.341  58.721 1.00 113.44 ? 33  LYS A CE  1 
ATOM 126  N NZ  . LYS A 1 33  ? 174.271 -2.201  60.157 1.00 128.45 ? 33  LYS A NZ  1 
ATOM 127  N N   . ASN A 1 34  ? 175.253 -6.338  54.715 1.00 105.36 ? 34  ASN A N   1 
ATOM 128  C CA  . ASN A 1 34  ? 175.937 -7.615  54.555 1.00 86.72  ? 34  ASN A CA  1 
ATOM 129  C C   . ASN A 1 34  ? 176.285 -7.886  53.097 1.00 84.55  ? 34  ASN A C   1 
ATOM 130  O O   . ASN A 1 34  ? 177.303 -8.510  52.800 1.00 89.91  ? 34  ASN A O   1 
ATOM 131  C CB  . ASN A 1 34  ? 175.085 -8.755  55.115 1.00 80.06  ? 34  ASN A CB  1 
ATOM 132  C CG  . ASN A 1 34  ? 175.096 -8.798  56.629 1.00 87.03  ? 34  ASN A CG  1 
ATOM 133  O OD1 . ASN A 1 34  ? 176.015 -8.287  57.268 1.00 112.01 ? 34  ASN A OD1 1 
ATOM 134  N ND2 . ASN A 1 34  ? 174.074 -9.412  57.212 1.00 98.93  ? 34  ASN A ND2 1 
ATOM 135  N N   . SER A 1 35  ? 175.435 -7.415  52.191 1.00 87.26  ? 35  SER A N   1 
ATOM 136  C CA  . SER A 1 35  ? 175.696 -7.547  50.763 1.00 86.00  ? 35  SER A CA  1 
ATOM 137  C C   . SER A 1 35  ? 176.937 -6.742  50.384 1.00 92.22  ? 35  SER A C   1 
ATOM 138  O O   . SER A 1 35  ? 177.712 -7.147  49.516 1.00 86.24  ? 35  SER A O   1 
ATOM 139  C CB  . SER A 1 35  ? 174.486 -7.086  49.948 1.00 81.04  ? 35  SER A CB  1 
ATOM 140  O OG  . SER A 1 35  ? 174.700 -7.276  48.560 1.00 83.07  ? 35  SER A OG  1 
ATOM 141  N N   . GLU A 1 36  ? 177.114 -5.604  51.051 1.00 100.25 ? 36  GLU A N   1 
ATOM 142  C CA  . GLU A 1 36  ? 178.285 -4.753  50.863 1.00 94.93  ? 36  GLU A CA  1 
ATOM 143  C C   . GLU A 1 36  ? 179.575 -5.490  51.183 1.00 89.02  ? 36  GLU A C   1 
ATOM 144  O O   . GLU A 1 36  ? 180.408 -5.708  50.302 1.00 84.15  ? 36  GLU A O   1 
ATOM 145  C CB  . GLU A 1 36  ? 178.192 -3.507  51.742 1.00 102.04 ? 36  GLU A CB  1 
ATOM 146  C CG  . GLU A 1 36  ? 177.612 -2.285  51.068 1.00 120.61 ? 36  GLU A CG  1 
ATOM 147  C CD  . GLU A 1 36  ? 177.406 -1.150  52.049 1.00 133.87 ? 36  GLU A CD  1 
ATOM 148  O OE1 . GLU A 1 36  ? 178.189 -1.060  53.018 1.00 142.77 ? 36  GLU A OE1 1 
ATOM 149  O OE2 . GLU A 1 36  ? 176.468 -0.350  51.852 1.00 125.38 ? 36  GLU A OE2 1 
ATOM 150  N N   . MET A 1 37  ? 179.728 -5.861  52.452 1.00 72.88  ? 37  MET A N   1 
ATOM 151  C CA  . MET A 1 37  ? 180.936 -6.522  52.938 1.00 72.57  ? 37  MET A CA  1 
ATOM 152  C C   . MET A 1 37  ? 181.300 -7.734  52.093 1.00 88.38  ? 37  MET A C   1 
ATOM 153  O O   . MET A 1 37  ? 182.476 -7.988  51.838 1.00 84.12  ? 37  MET A O   1 
ATOM 154  C CB  . MET A 1 37  ? 180.771 -6.958  54.396 1.00 74.20  ? 37  MET A CB  1 
ATOM 155  C CG  . MET A 1 37  ? 180.221 -5.899  55.333 1.00 83.81  ? 37  MET A CG  1 
ATOM 156  S SD  . MET A 1 37  ? 180.275 -6.477  57.040 1.00 131.36 ? 37  MET A SD  1 
ATOM 157  C CE  . MET A 1 37  ? 178.982 -5.489  57.779 1.00 101.42 ? 37  MET A CE  1 
ATOM 158  N N   . PHE A 1 38  ? 180.286 -8.479  51.664 1.00 78.11  ? 38  PHE A N   1 
ATOM 159  C CA  . PHE A 1 38  ? 180.512 -9.659  50.842 1.00 72.36  ? 38  PHE A CA  1 
ATOM 160  C C   . PHE A 1 38  ? 181.174 -9.299  49.519 1.00 70.83  ? 38  PHE A C   1 
ATOM 161  O O   . PHE A 1 38  ? 182.122 -9.958  49.092 1.00 71.29  ? 38  PHE A O   1 
ATOM 162  C CB  . PHE A 1 38  ? 179.205 -10.403 50.569 1.00 72.44  ? 38  PHE A CB  1 
ATOM 163  C CG  . PHE A 1 38  ? 179.360 -11.527 49.590 1.00 73.06  ? 38  PHE A CG  1 
ATOM 164  C CD1 . PHE A 1 38  ? 180.033 -12.681 49.951 1.00 63.68  ? 38  PHE A CD1 1 
ATOM 165  C CD2 . PHE A 1 38  ? 178.866 -11.419 48.300 1.00 70.73  ? 38  PHE A CD2 1 
ATOM 166  C CE1 . PHE A 1 38  ? 180.197 -13.715 49.053 1.00 64.81  ? 38  PHE A CE1 1 
ATOM 167  C CE2 . PHE A 1 38  ? 179.027 -12.452 47.395 1.00 64.56  ? 38  PHE A CE2 1 
ATOM 168  C CZ  . PHE A 1 38  ? 179.694 -13.601 47.774 1.00 66.94  ? 38  PHE A CZ  1 
ATOM 169  N N   . ALA A 1 39  ? 180.664 -8.253  48.877 1.00 77.58  ? 39  ALA A N   1 
ATOM 170  C CA  . ALA A 1 39  ? 181.163 -7.826  47.576 1.00 87.87  ? 39  ALA A CA  1 
ATOM 171  C C   . ALA A 1 39  ? 182.655 -7.516  47.620 1.00 88.62  ? 39  ALA A C   1 
ATOM 172  O O   . ALA A 1 39  ? 183.412 -7.939  46.746 1.00 93.32  ? 39  ALA A O   1 
ATOM 173  C CB  . ALA A 1 39  ? 180.387 -6.615  47.085 1.00 88.15  ? 39  ALA A CB  1 
ATOM 174  N N   . LEU A 1 40  ? 183.072 -6.785  48.648 1.00 78.49  ? 40  LEU A N   1 
ATOM 175  C CA  . LEU A 1 40  ? 184.472 -6.411  48.792 1.00 85.54  ? 40  LEU A CA  1 
ATOM 176  C C   . LEU A 1 40  ? 185.359 -7.624  49.041 1.00 77.69  ? 40  LEU A C   1 
ATOM 177  O O   . LEU A 1 40  ? 186.322 -7.856  48.311 1.00 79.66  ? 40  LEU A O   1 
ATOM 178  C CB  . LEU A 1 40  ? 184.650 -5.408  49.930 1.00 79.75  ? 40  LEU A CB  1 
ATOM 179  C CG  . LEU A 1 40  ? 186.104 -4.976  50.114 1.00 82.64  ? 40  LEU A CG  1 
ATOM 180  C CD1 . LEU A 1 40  ? 186.559 -4.132  48.933 1.00 73.99  ? 40  LEU A CD1 1 
ATOM 181  C CD2 . LEU A 1 40  ? 186.303 -4.239  51.424 1.00 99.69  ? 40  LEU A CD2 1 
ATOM 182  N N   . ARG A 1 41  ? 185.030 -8.392  50.076 1.00 84.23  ? 41  ARG A N   1 
ATOM 183  C CA  . ARG A 1 41  ? 185.824 -9.557  50.454 1.00 74.74  ? 41  ARG A CA  1 
ATOM 184  C C   . ARG A 1 41  ? 185.912 -10.570 49.316 1.00 73.02  ? 41  ARG A C   1 
ATOM 185  O O   . ARG A 1 41  ? 186.910 -11.278 49.189 1.00 79.45  ? 41  ARG A O   1 
ATOM 186  C CB  . ARG A 1 41  ? 185.245 -10.219 51.708 1.00 71.10  ? 41  ARG A CB  1 
ATOM 187  C CG  . ARG A 1 41  ? 185.142 -9.286  52.906 1.00 73.43  ? 41  ARG A CG  1 
ATOM 188  C CD  . ARG A 1 41  ? 184.797 -10.035 54.184 1.00 77.54  ? 41  ARG A CD  1 
ATOM 189  N NE  . ARG A 1 41  ? 184.167 -9.160  55.168 1.00 97.27  ? 41  ARG A NE  1 
ATOM 190  C CZ  . ARG A 1 41  ? 183.691 -9.571  56.340 1.00 116.38 ? 41  ARG A CZ  1 
ATOM 191  N NH1 . ARG A 1 41  ? 183.780 -10.849 56.683 1.00 114.14 ? 41  ARG A NH1 1 
ATOM 192  N NH2 . ARG A 1 41  ? 183.131 -8.702  57.171 1.00 121.27 ? 41  ARG A NH2 1 
ATOM 193  N N   . TYR A 1 42  ? 184.873 -10.628 48.487 1.00 75.94  ? 42  TYR A N   1 
ATOM 194  C CA  . TYR A 1 42  ? 184.876 -11.520 47.332 1.00 72.07  ? 42  TYR A CA  1 
ATOM 195  C C   . TYR A 1 42  ? 185.981 -11.159 46.344 1.00 73.09  ? 42  TYR A C   1 
ATOM 196  O O   . TYR A 1 42  ? 186.757 -12.022 45.935 1.00 91.78  ? 42  TYR A O   1 
ATOM 197  C CB  . TYR A 1 42  ? 183.521 -11.503 46.620 1.00 69.03  ? 42  TYR A CB  1 
ATOM 198  C CG  . TYR A 1 42  ? 183.526 -12.269 45.314 1.00 61.35  ? 42  TYR A CG  1 
ATOM 199  C CD1 . TYR A 1 42  ? 183.813 -13.627 45.284 1.00 71.57  ? 42  TYR A CD1 1 
ATOM 200  C CD2 . TYR A 1 42  ? 183.253 -11.631 44.111 1.00 75.43  ? 42  TYR A CD2 1 
ATOM 201  C CE1 . TYR A 1 42  ? 183.824 -14.330 44.093 1.00 70.58  ? 42  TYR A CE1 1 
ATOM 202  C CE2 . TYR A 1 42  ? 183.264 -12.326 42.915 1.00 78.52  ? 42  TYR A CE2 1 
ATOM 203  C CZ  . TYR A 1 42  ? 183.548 -13.675 42.912 1.00 81.49  ? 42  TYR A CZ  1 
ATOM 204  O OH  . TYR A 1 42  ? 183.557 -14.370 41.725 1.00 92.48  ? 42  TYR A OH  1 
ATOM 205  N N   . ILE A 1 43  ? 186.054 -9.888  45.957 1.00 69.20  ? 43  ILE A N   1 
ATOM 206  C CA  . ILE A 1 43  ? 187.072 -9.465  45.003 1.00 78.39  ? 43  ILE A CA  1 
ATOM 207  C C   . ILE A 1 43  ? 188.441 -9.400  45.674 1.00 74.83  ? 43  ILE A C   1 
ATOM 208  O O   . ILE A 1 43  ? 189.466 -9.539  45.011 1.00 77.25  ? 43  ILE A O   1 
ATOM 209  C CB  . ILE A 1 43  ? 186.747 -8.092  44.357 1.00 79.45  ? 43  ILE A CB  1 
ATOM 210  C CG1 . ILE A 1 43  ? 186.997 -6.941  45.334 1.00 73.04  ? 43  ILE A CG1 1 
ATOM 211  C CG2 . ILE A 1 43  ? 185.319 -8.071  43.827 1.00 93.44  ? 43  ILE A CG2 1 
ATOM 212  C CD1 . ILE A 1 43  ? 186.905 -5.572  44.697 1.00 76.27  ? 43  ILE A CD1 1 
ATOM 213  N N   . LYS A 1 44  ? 188.458 -9.202  46.988 1.00 75.75  ? 44  LYS A N   1 
ATOM 214  C CA  . LYS A 1 44  ? 189.717 -9.179  47.721 1.00 73.58  ? 44  LYS A CA  1 
ATOM 215  C C   . LYS A 1 44  ? 190.313 -10.581 47.768 1.00 80.35  ? 44  LYS A C   1 
ATOM 216  O O   . LYS A 1 44  ? 191.523 -10.756 47.628 1.00 77.78  ? 44  LYS A O   1 
ATOM 217  C CB  . LYS A 1 44  ? 189.521 -8.631  49.137 1.00 64.33  ? 44  LYS A CB  1 
ATOM 218  C CG  . LYS A 1 44  ? 190.824 -8.428  49.898 1.00 76.92  ? 44  LYS A CG  1 
ATOM 219  C CD  . LYS A 1 44  ? 190.640 -7.527  51.109 1.00 81.57  ? 44  LYS A CD  1 
ATOM 220  C CE  . LYS A 1 44  ? 191.962 -7.310  51.827 1.00 77.04  ? 44  LYS A CE  1 
ATOM 221  N NZ  . LYS A 1 44  ? 191.794 -6.724  53.186 1.00 87.49  ? 44  LYS A NZ  1 
ATOM 222  N N   . CYS A 1 45  ? 189.449 -11.577 47.957 1.00 83.01  ? 45  CYS A N   1 
ATOM 223  C CA  . CYS A 1 45  ? 189.872 -12.974 47.996 1.00 74.93  ? 45  CYS A CA  1 
ATOM 224  C C   . CYS A 1 45  ? 190.343 -13.460 46.633 1.00 66.17  ? 45  CYS A C   1 
ATOM 225  O O   . CYS A 1 45  ? 191.413 -14.054 46.519 1.00 78.13  ? 45  CYS A O   1 
ATOM 226  C CB  . CYS A 1 45  ? 188.739 -13.870 48.500 1.00 69.54  ? 45  CYS A CB  1 
ATOM 227  S SG  . CYS A 1 45  ? 188.692 -14.067 50.293 1.00 142.43 ? 45  CYS A SG  1 
ATOM 228  N N   . ALA A 1 46  ? 189.535 -13.214 45.606 1.00 60.42  ? 46  ALA A N   1 
ATOM 229  C CA  . ALA A 1 46  ? 189.887 -13.606 44.247 1.00 64.41  ? 46  ALA A CA  1 
ATOM 230  C C   . ALA A 1 46  ? 191.222 -12.996 43.837 1.00 76.68  ? 46  ALA A C   1 
ATOM 231  O O   . ALA A 1 46  ? 192.078 -13.678 43.274 1.00 82.07  ? 46  ALA A O   1 
ATOM 232  C CB  . ALA A 1 46  ? 188.795 -13.196 43.275 1.00 68.08  ? 46  ALA A CB  1 
ATOM 233  N N   . SER A 1 47  ? 191.392 -11.711 44.138 1.00 72.59  ? 47  SER A N   1 
ATOM 234  C CA  . SER A 1 47  ? 192.635 -10.999 43.854 1.00 64.88  ? 47  SER A CA  1 
ATOM 235  C C   . SER A 1 47  ? 193.828 -11.675 44.518 1.00 73.96  ? 47  SER A C   1 
ATOM 236  O O   . SER A 1 47  ? 194.845 -11.928 43.872 1.00 79.65  ? 47  SER A O   1 
ATOM 237  C CB  . SER A 1 47  ? 192.539 -9.545  44.321 1.00 69.79  ? 47  SER A CB  1 
ATOM 238  O OG  . SER A 1 47  ? 191.622 -8.812  43.529 1.00 73.52  ? 47  SER A OG  1 
ATOM 239  N N   . ALA A 1 48  ? 193.693 -11.962 45.811 1.00 60.05  ? 48  ALA A N   1 
ATOM 240  C CA  . ALA A 1 48  ? 194.747 -12.624 46.571 1.00 66.92  ? 48  ALA A CA  1 
ATOM 241  C C   . ALA A 1 48  ? 195.126 -13.955 45.930 1.00 75.91  ? 48  ALA A C   1 
ATOM 242  O O   . ALA A 1 48  ? 196.300 -14.316 45.874 1.00 87.07  ? 48  ALA A O   1 
ATOM 243  C CB  . ALA A 1 48  ? 194.312 -12.832 48.013 1.00 63.72  ? 48  ALA A CB  1 
ATOM 244  N N   . PHE A 1 49  ? 194.128 -14.679 45.437 1.00 75.88  ? 49  PHE A N   1 
ATOM 245  C CA  . PHE A 1 49  ? 194.387 -15.921 44.722 1.00 80.83  ? 49  PHE A CA  1 
ATOM 246  C C   . PHE A 1 49  ? 195.125 -15.646 43.416 1.00 80.96  ? 49  PHE A C   1 
ATOM 247  O O   . PHE A 1 49  ? 196.143 -16.274 43.122 1.00 75.15  ? 49  PHE A O   1 
ATOM 248  C CB  . PHE A 1 49  ? 193.083 -16.666 44.438 1.00 67.37  ? 49  PHE A CB  1 
ATOM 249  C CG  . PHE A 1 49  ? 193.286 -18.025 43.830 1.00 85.87  ? 49  PHE A CG  1 
ATOM 250  C CD1 . PHE A 1 49  ? 193.560 -19.120 44.631 1.00 91.80  ? 49  PHE A CD1 1 
ATOM 251  C CD2 . PHE A 1 49  ? 193.206 -18.206 42.459 1.00 94.24  ? 49  PHE A CD2 1 
ATOM 252  C CE1 . PHE A 1 49  ? 193.750 -20.372 44.077 1.00 94.77  ? 49  PHE A CE1 1 
ATOM 253  C CE2 . PHE A 1 49  ? 193.395 -19.456 41.899 1.00 85.98  ? 49  PHE A CE2 1 
ATOM 254  C CZ  . PHE A 1 49  ? 193.667 -20.540 42.710 1.00 84.42  ? 49  PHE A CZ  1 
ATOM 255  N N   . ILE A 1 50  ? 194.602 -14.700 42.643 1.00 77.06  ? 50  ILE A N   1 
ATOM 256  C CA  . ILE A 1 50  ? 195.162 -14.356 41.341 1.00 86.01  ? 50  ILE A CA  1 
ATOM 257  C C   . ILE A 1 50  ? 196.621 -13.914 41.440 1.00 84.10  ? 50  ILE A C   1 
ATOM 258  O O   . ILE A 1 50  ? 197.465 -14.351 40.656 1.00 86.23  ? 50  ILE A O   1 
ATOM 259  C CB  . ILE A 1 50  ? 194.336 -13.245 40.666 1.00 75.54  ? 50  ILE A CB  1 
ATOM 260  C CG1 . ILE A 1 50  ? 192.955 -13.778 40.277 1.00 69.90  ? 50  ILE A CG1 1 
ATOM 261  C CG2 . ILE A 1 50  ? 195.054 -12.714 39.441 1.00 77.81  ? 50  ILE A CG2 1 
ATOM 262  C CD1 . ILE A 1 50  ? 191.983 -12.702 39.851 1.00 73.23  ? 50  ILE A CD1 1 
ATOM 263  N N   . LEU A 1 51  ? 196.916 -13.057 42.411 1.00 76.86  ? 51  LEU A N   1 
ATOM 264  C CA  . LEU A 1 51  ? 198.281 -12.590 42.616 1.00 77.83  ? 51  LEU A CA  1 
ATOM 265  C C   . LEU A 1 51  ? 199.198 -13.736 43.032 1.00 83.05  ? 51  LEU A C   1 
ATOM 266  O O   . LEU A 1 51  ? 200.364 -13.780 42.642 1.00 104.99 ? 51  LEU A O   1 
ATOM 267  C CB  . LEU A 1 51  ? 198.321 -11.474 43.662 1.00 78.12  ? 51  LEU A CB  1 
ATOM 268  C CG  . LEU A 1 51  ? 197.536 -10.212 43.300 1.00 69.26  ? 51  LEU A CG  1 
ATOM 269  C CD1 . LEU A 1 51  ? 197.644 -9.160  44.396 1.00 77.16  ? 51  LEU A CD1 1 
ATOM 270  C CD2 . LEU A 1 51  ? 198.017 -9.664  41.967 1.00 55.23  ? 51  LEU A CD2 1 
ATOM 271  N N   . ASP A 1 52  ? 198.664 -14.667 43.816 1.00 88.62  ? 52  ASP A N   1 
ATOM 272  C CA  . ASP A 1 52  ? 199.447 -15.802 44.291 1.00 81.95  ? 52  ASP A CA  1 
ATOM 273  C C   . ASP A 1 52  ? 199.800 -16.766 43.159 1.00 69.45  ? 52  ASP A C   1 
ATOM 274  O O   . ASP A 1 52  ? 200.975 -17.000 42.880 1.00 91.32  ? 52  ASP A O   1 
ATOM 275  C CB  . ASP A 1 52  ? 198.690 -16.546 45.395 1.00 81.69  ? 52  ASP A CB  1 
ATOM 276  C CG  . ASP A 1 52  ? 199.584 -17.478 46.190 1.00 92.05  ? 52  ASP A CG  1 
ATOM 277  O OD1 . ASP A 1 52  ? 200.821 -17.319 46.123 1.00 112.66 ? 52  ASP A OD1 1 
ATOM 278  O OD2 . ASP A 1 52  ? 199.049 -18.364 46.889 1.00 95.25  ? 52  ASP A OD2 1 
ATOM 279  N N   . ARG A 1 53  ? 198.779 -17.313 42.506 1.00 78.66  ? 53  ARG A N   1 
ATOM 280  C CA  . ARG A 1 53  ? 198.973 -18.336 41.478 1.00 77.91  ? 53  ARG A CA  1 
ATOM 281  C C   . ARG A 1 53  ? 199.737 -17.851 40.252 1.00 93.07  ? 53  ARG A C   1 
ATOM 282  O O   . ARG A 1 53  ? 200.308 -18.653 39.515 1.00 97.79  ? 53  ARG A O   1 
ATOM 283  C CB  . ARG A 1 53  ? 197.625 -18.895 41.033 1.00 76.19  ? 53  ARG A CB  1 
ATOM 284  C CG  . ARG A 1 53  ? 196.885 -19.634 42.121 1.00 100.82 ? 53  ARG A CG  1 
ATOM 285  C CD  . ARG A 1 53  ? 197.624 -20.892 42.537 1.00 105.55 ? 53  ARG A CD  1 
ATOM 286  N NE  . ARG A 1 53  ? 196.890 -21.632 43.558 1.00 124.89 ? 53  ARG A NE  1 
ATOM 287  C CZ  . ARG A 1 53  ? 197.395 -22.641 44.259 1.00 132.45 ? 53  ARG A CZ  1 
ATOM 288  N NH1 . ARG A 1 53  ? 198.645 -23.032 44.054 1.00 154.31 ? 53  ARG A NH1 1 
ATOM 289  N NH2 . ARG A 1 53  ? 196.651 -23.257 45.168 1.00 110.31 ? 53  ARG A NH2 1 
ATOM 290  N N   . ARG A 1 54  ? 199.732 -16.544 40.022 1.00 85.74  ? 54  ARG A N   1 
ATOM 291  C CA  . ARG A 1 54  ? 200.464 -15.989 38.894 1.00 76.64  ? 54  ARG A CA  1 
ATOM 292  C C   . ARG A 1 54  ? 201.790 -15.420 39.378 1.00 83.71  ? 54  ARG A C   1 
ATOM 293  O O   . ARG A 1 54  ? 202.538 -14.811 38.613 1.00 100.36 ? 54  ARG A O   1 
ATOM 294  C CB  . ARG A 1 54  ? 199.631 -14.925 38.182 1.00 81.93  ? 54  ARG A CB  1 
ATOM 295  C CG  . ARG A 1 54  ? 198.334 -15.475 37.611 1.00 74.21  ? 54  ARG A CG  1 
ATOM 296  C CD  . ARG A 1 54  ? 198.603 -16.574 36.591 1.00 80.43  ? 54  ARG A CD  1 
ATOM 297  N NE  . ARG A 1 54  ? 198.866 -16.034 35.261 1.00 82.80  ? 54  ARG A NE  1 
ATOM 298  C CZ  . ARG A 1 54  ? 199.583 -16.650 34.327 1.00 79.04  ? 54  ARG A CZ  1 
ATOM 299  N NH1 . ARG A 1 54  ? 200.127 -17.834 34.572 1.00 73.92  ? 54  ARG A NH1 1 
ATOM 300  N NH2 . ARG A 1 54  ? 199.762 -16.077 33.145 1.00 82.38  ? 54  ARG A NH2 1 
ATOM 301  N N   . GLY A 1 55  ? 202.066 -15.634 40.661 1.00 84.64  ? 55  GLY A N   1 
ATOM 302  C CA  . GLY A 1 55  ? 203.347 -15.294 41.250 1.00 77.66  ? 55  GLY A CA  1 
ATOM 303  C C   . GLY A 1 55  ? 203.734 -13.832 41.168 1.00 90.76  ? 55  GLY A C   1 
ATOM 304  O O   . GLY A 1 55  ? 204.903 -13.509 40.960 1.00 105.10 ? 55  GLY A O   1 
ATOM 305  N N   . ILE A 1 56  ? 202.759 -12.944 41.319 1.00 87.36  ? 56  ILE A N   1 
ATOM 306  C CA  . ILE A 1 56  ? 203.058 -11.523 41.410 1.00 83.71  ? 56  ILE A CA  1 
ATOM 307  C C   . ILE A 1 56  ? 203.747 -11.269 42.746 1.00 83.70  ? 56  ILE A C   1 
ATOM 308  O O   . ILE A 1 56  ? 204.647 -10.435 42.849 1.00 89.76  ? 56  ILE A O   1 
ATOM 309  C CB  . ILE A 1 56  ? 201.793 -10.655 41.279 1.00 87.17  ? 56  ILE A CB  1 
ATOM 310  C CG1 . ILE A 1 56  ? 201.157 -10.856 39.903 1.00 96.19  ? 56  ILE A CG1 1 
ATOM 311  C CG2 . ILE A 1 56  ? 202.125 -9.185  41.483 1.00 72.97  ? 56  ILE A CG2 1 
ATOM 312  C CD1 . ILE A 1 56  ? 201.971 -10.270 38.770 1.00 92.88  ? 56  ILE A CD1 1 
ATOM 313  N N   . LEU A 1 57  ? 203.331 -12.018 43.763 1.00 70.45  ? 57  LEU A N   1 
ATOM 314  C CA  . LEU A 1 57  ? 203.958 -11.939 45.077 1.00 74.06  ? 57  LEU A CA  1 
ATOM 315  C C   . LEU A 1 57  ? 204.409 -13.307 45.581 1.00 79.82  ? 57  LEU A C   1 
ATOM 316  O O   . LEU A 1 57  ? 203.948 -14.345 45.106 1.00 82.07  ? 57  LEU A O   1 
ATOM 317  C CB  . LEU A 1 57  ? 203.004 -11.303 46.089 1.00 84.25  ? 57  LEU A CB  1 
ATOM 318  C CG  . LEU A 1 57  ? 202.425 -9.938  45.722 1.00 81.82  ? 57  LEU A CG  1 
ATOM 319  C CD1 . LEU A 1 57  ? 201.469 -9.452  46.801 1.00 68.81  ? 57  LEU A CD1 1 
ATOM 320  C CD2 . LEU A 1 57  ? 203.544 -8.937  45.502 1.00 85.14  ? 57  LEU A CD2 1 
ATOM 321  N N   . ASP A 1 58  ? 205.320 -13.288 46.549 1.00 91.89  ? 58  ASP A N   1 
ATOM 322  C CA  . ASP A 1 58  ? 205.827 -14.501 47.176 1.00 79.49  ? 58  ASP A CA  1 
ATOM 323  C C   . ASP A 1 58  ? 204.693 -15.241 47.880 1.00 88.13  ? 58  ASP A C   1 
ATOM 324  O O   . ASP A 1 58  ? 203.724 -14.621 48.315 1.00 105.48 ? 58  ASP A O   1 
ATOM 325  C CB  . ASP A 1 58  ? 206.939 -14.152 48.169 1.00 110.85 ? 58  ASP A CB  1 
ATOM 326  C CG  . ASP A 1 58  ? 207.824 -15.335 48.503 1.00 138.26 ? 58  ASP A CG  1 
ATOM 327  O OD1 . ASP A 1 58  ? 207.346 -16.270 49.180 1.00 140.30 ? 58  ASP A OD1 1 
ATOM 328  O OD2 . ASP A 1 58  ? 209.005 -15.323 48.097 1.00 151.91 ? 58  ASP A OD2 1 
ATOM 329  N N   . GLU A 1 59  ? 204.813 -16.561 47.987 1.00 97.83  ? 59  GLU A N   1 
ATOM 330  C CA  . GLU A 1 59  ? 203.798 -17.373 48.656 1.00 89.88  ? 59  GLU A CA  1 
ATOM 331  C C   . GLU A 1 59  ? 203.667 -16.978 50.126 1.00 90.97  ? 59  GLU A C   1 
ATOM 332  O O   . GLU A 1 59  ? 202.611 -17.151 50.739 1.00 98.52  ? 59  GLU A O   1 
ATOM 333  C CB  . GLU A 1 59  ? 204.138 -18.861 48.537 1.00 92.83  ? 59  GLU A CB  1 
ATOM 334  C CG  . GLU A 1 59  ? 203.069 -19.798 49.079 1.00 105.86 ? 59  GLU A CG  1 
ATOM 335  C CD  . GLU A 1 59  ? 201.886 -19.946 48.142 1.00 119.04 ? 59  GLU A CD  1 
ATOM 336  O OE1 . GLU A 1 59  ? 202.107 -20.193 46.937 1.00 113.11 ? 59  GLU A OE1 1 
ATOM 337  O OE2 . GLU A 1 59  ? 200.736 -19.816 48.611 1.00 121.37 ? 59  GLU A OE2 1 
ATOM 338  N N   . LYS A 1 60  ? 204.747 -16.434 50.679 1.00 96.88  ? 60  LYS A N   1 
ATOM 339  C CA  . LYS A 1 60  ? 204.779 -15.987 52.067 1.00 100.57 ? 60  LYS A CA  1 
ATOM 340  C C   . LYS A 1 60  ? 203.760 -14.881 52.340 1.00 94.02  ? 60  LYS A C   1 
ATOM 341  O O   . LYS A 1 60  ? 203.359 -14.665 53.483 1.00 92.58  ? 60  LYS A O   1 
ATOM 342  C CB  . LYS A 1 60  ? 206.181 -15.492 52.431 1.00 111.45 ? 60  LYS A CB  1 
ATOM 343  C CG  . LYS A 1 60  ? 206.559 -14.186 51.746 1.00 120.90 ? 60  LYS A CG  1 
ATOM 344  C CD  . LYS A 1 60  ? 207.910 -13.666 52.203 1.00 122.49 ? 60  LYS A CD  1 
ATOM 345  C CE  . LYS A 1 60  ? 208.282 -12.392 51.458 1.00 131.07 ? 60  LYS A CE  1 
ATOM 346  N NZ  . LYS A 1 60  ? 209.649 -11.916 51.810 1.00 145.06 ? 60  LYS A NZ  1 
ATOM 347  N N   . CYS A 1 61  ? 203.346 -14.185 51.285 1.00 79.85  ? 61  CYS A N   1 
ATOM 348  C CA  . CYS A 1 61  ? 202.419 -13.066 51.414 1.00 94.53  ? 61  CYS A CA  1 
ATOM 349  C C   . CYS A 1 61  ? 200.986 -13.534 51.637 1.00 92.24  ? 61  CYS A C   1 
ATOM 350  O O   . CYS A 1 61  ? 200.097 -12.729 51.915 1.00 83.07  ? 61  CYS A O   1 
ATOM 351  C CB  . CYS A 1 61  ? 202.479 -12.177 50.169 1.00 92.50  ? 61  CYS A CB  1 
ATOM 352  S SG  . CYS A 1 61  ? 204.066 -11.353 49.903 1.00 97.91  ? 61  CYS A SG  1 
ATOM 353  N N   . PHE A 1 62  ? 200.761 -14.837 51.517 1.00 95.91  ? 62  PHE A N   1 
ATOM 354  C CA  . PHE A 1 62  ? 199.405 -15.358 51.559 1.00 77.39  ? 62  PHE A CA  1 
ATOM 355  C C   . PHE A 1 62  ? 199.197 -16.405 52.640 1.00 83.74  ? 62  PHE A C   1 
ATOM 356  O O   . PHE A 1 62  ? 200.113 -17.141 53.004 1.00 82.21  ? 62  PHE A O   1 
ATOM 357  C CB  . PHE A 1 62  ? 199.030 -15.945 50.199 1.00 68.55  ? 62  PHE A CB  1 
ATOM 358  C CG  . PHE A 1 62  ? 199.236 -14.996 49.059 1.00 85.22  ? 62  PHE A CG  1 
ATOM 359  C CD1 . PHE A 1 62  ? 200.421 -14.998 48.342 1.00 89.16  ? 62  PHE A CD1 1 
ATOM 360  C CD2 . PHE A 1 62  ? 198.251 -14.088 48.715 1.00 76.86  ? 62  PHE A CD2 1 
ATOM 361  C CE1 . PHE A 1 62  ? 200.612 -14.120 47.295 1.00 83.94  ? 62  PHE A CE1 1 
ATOM 362  C CE2 . PHE A 1 62  ? 198.438 -13.207 47.672 1.00 81.23  ? 62  PHE A CE2 1 
ATOM 363  C CZ  . PHE A 1 62  ? 199.618 -13.224 46.958 1.00 82.18  ? 62  PHE A CZ  1 
ATOM 364  N N   . LYS A 1 63  ? 197.974 -16.446 53.152 1.00 76.86  ? 63  LYS A N   1 
ATOM 365  C CA  . LYS A 1 63  ? 197.540 -17.496 54.055 1.00 82.99  ? 63  LYS A CA  1 
ATOM 366  C C   . LYS A 1 63  ? 196.337 -18.171 53.423 1.00 84.43  ? 63  LYS A C   1 
ATOM 367  O O   . LYS A 1 63  ? 195.624 -17.560 52.626 1.00 75.61  ? 63  LYS A O   1 
ATOM 368  C CB  . LYS A 1 63  ? 197.193 -16.934 55.432 1.00 78.17  ? 63  LYS A CB  1 
ATOM 369  C CG  . LYS A 1 63  ? 196.065 -15.922 55.411 1.00 99.19  ? 63  LYS A CG  1 
ATOM 370  C CD  . LYS A 1 63  ? 195.864 -15.293 56.775 1.00 115.00 ? 63  LYS A CD  1 
ATOM 371  C CE  . LYS A 1 63  ? 194.691 -14.330 56.762 1.00 118.05 ? 63  LYS A CE  1 
ATOM 372  N NZ  . LYS A 1 63  ? 194.545 -13.625 58.062 1.00 132.28 ? 63  LYS A NZ  1 
ATOM 373  N N   . THR A 1 64  ? 196.111 -19.430 53.770 1.00 91.96  ? 64  THR A N   1 
ATOM 374  C CA  . THR A 1 64  ? 195.051 -20.186 53.130 1.00 86.57  ? 64  THR A CA  1 
ATOM 375  C C   . THR A 1 64  ? 194.151 -20.903 54.127 1.00 91.29  ? 64  THR A C   1 
ATOM 376  O O   . THR A 1 64  ? 194.619 -21.621 55.011 1.00 106.28 ? 64  THR A O   1 
ATOM 377  C CB  . THR A 1 64  ? 195.632 -21.213 52.146 1.00 95.40  ? 64  THR A CB  1 
ATOM 378  O OG1 . THR A 1 64  ? 196.097 -20.536 50.971 1.00 99.72  ? 64  THR A OG1 1 
ATOM 379  C CG2 . THR A 1 64  ? 194.578 -22.209 51.746 1.00 95.28  ? 64  THR A CG2 1 
ATOM 380  N N   . ARG A 1 65  ? 192.852 -20.676 53.979 1.00 97.11  ? 65  ARG A N   1 
ATOM 381  C CA  . ARG A 1 65  ? 191.841 -21.448 54.678 1.00 96.90  ? 65  ARG A CA  1 
ATOM 382  C C   . ARG A 1 65  ? 191.050 -22.227 53.638 1.00 93.82  ? 65  ARG A C   1 
ATOM 383  O O   . ARG A 1 65  ? 191.078 -21.899 52.453 1.00 92.83  ? 65  ARG A O   1 
ATOM 384  C CB  . ARG A 1 65  ? 190.924 -20.539 55.491 1.00 96.39  ? 65  ARG A CB  1 
ATOM 385  C CG  . ARG A 1 65  ? 190.160 -19.548 54.640 1.00 121.13 ? 65  ARG A CG  1 
ATOM 386  C CD  . ARG A 1 65  ? 189.594 -18.425 55.474 1.00 136.00 ? 65  ARG A CD  1 
ATOM 387  N NE  . ARG A 1 65  ? 190.572 -17.367 55.696 1.00 128.07 ? 65  ARG A NE  1 
ATOM 388  C CZ  . ARG A 1 65  ? 190.358 -16.305 56.464 1.00 136.44 ? 65  ARG A CZ  1 
ATOM 389  N NH1 . ARG A 1 65  ? 189.196 -16.158 57.087 1.00 138.69 ? 65  ARG A NH1 1 
ATOM 390  N NH2 . ARG A 1 65  ? 191.307 -15.390 56.611 1.00 150.74 ? 65  ARG A NH2 1 
ATOM 391  N N   . THR A 1 66  ? 190.351 -23.263 54.080 1.00 105.76 ? 66  THR A N   1 
ATOM 392  C CA  . THR A 1 66  ? 189.550 -24.083 53.185 1.00 108.11 ? 66  THR A CA  1 
ATOM 393  C C   . THR A 1 66  ? 188.064 -23.893 53.483 1.00 103.47 ? 66  THR A C   1 
ATOM 394  O O   . THR A 1 66  ? 187.632 -24.058 54.613 1.00 123.29 ? 66  THR A O   1 
ATOM 395  C CB  . THR A 1 66  ? 189.935 -25.580 53.308 1.00 111.29 ? 66  THR A CB  1 
ATOM 396  O OG1 . THR A 1 66  ? 189.078 -26.379 52.482 1.00 108.00 ? 66  THR A OG1 1 
ATOM 397  C CG2 . THR A 1 66  ? 189.838 -26.057 54.758 1.00 105.49 ? 66  THR A CG2 1 
ATOM 398  N N   . ILE A 1 67  ? 187.274 -23.530 52.480 1.00 92.45  ? 67  ILE A N   1 
ATOM 399  C CA  . ILE A 1 67  ? 185.831 -23.465 52.687 1.00 104.91 ? 67  ILE A CA  1 
ATOM 400  C C   . ILE A 1 67  ? 185.149 -24.638 51.983 1.00 122.98 ? 67  ILE A C   1 
ATOM 401  O O   . ILE A 1 67  ? 185.047 -24.672 50.753 1.00 126.14 ? 67  ILE A O   1 
ATOM 402  C CB  . ILE A 1 67  ? 185.230 -22.131 52.199 1.00 115.44 ? 67  ILE A CB  1 
ATOM 403  C CG1 . ILE A 1 67  ? 185.865 -20.949 52.942 1.00 110.22 ? 67  ILE A CG1 1 
ATOM 404  C CG2 . ILE A 1 67  ? 183.730 -22.119 52.426 1.00 120.10 ? 67  ILE A CG2 1 
ATOM 405  C CD1 . ILE A 1 67  ? 185.279 -19.575 52.574 1.00 105.19 ? 67  ILE A CD1 1 
ATOM 406  N N   . ASP A 1 68  ? 184.699 -25.596 52.793 1.00 125.08 ? 68  ASP A N   1 
ATOM 407  C CA  . ASP A 1 68  ? 184.047 -26.808 52.318 1.00 127.35 ? 68  ASP A CA  1 
ATOM 408  C C   . ASP A 1 68  ? 185.013 -27.483 51.359 1.00 125.41 ? 68  ASP A C   1 
ATOM 409  O O   . ASP A 1 68  ? 186.044 -28.035 51.737 1.00 125.91 ? 68  ASP A O   1 
ATOM 410  C CB  . ASP A 1 68  ? 182.710 -26.479 51.612 1.00 137.15 ? 68  ASP A CB  1 
ATOM 411  C CG  . ASP A 1 68  ? 181.954 -27.722 51.128 1.00 153.61 ? 68  ASP A CG  1 
ATOM 412  O OD1 . ASP A 1 68  ? 182.575 -28.808 51.032 1.00 169.65 ? 68  ASP A OD1 1 
ATOM 413  O OD2 . ASP A 1 68  ? 180.761 -27.583 50.755 1.00 147.44 ? 68  ASP A OD2 1 
ATOM 414  N N   . LYS A 1 69  ? 184.668 -27.375 50.089 1.00 131.68 ? 69  LYS A N   1 
ATOM 415  C CA  . LYS A 1 69  ? 185.399 -27.982 48.995 1.00 133.97 ? 69  LYS A CA  1 
ATOM 416  C C   . LYS A 1 69  ? 186.696 -27.251 48.766 1.00 124.43 ? 69  LYS A C   1 
ATOM 417  O O   . LYS A 1 69  ? 187.764 -27.837 48.599 1.00 119.30 ? 69  LYS A O   1 
ATOM 418  C CB  . LYS A 1 69  ? 184.546 -27.886 47.749 1.00 144.23 ? 69  LYS A CB  1 
ATOM 419  C CG  . LYS A 1 69  ? 183.145 -27.490 48.107 1.00 150.82 ? 69  LYS A CG  1 
ATOM 420  C CD  . LYS A 1 69  ? 182.402 -26.981 46.932 1.00 150.25 ? 69  LYS A CD  1 
ATOM 421  C CE  . LYS A 1 69  ? 180.916 -26.847 47.204 1.00 148.11 ? 69  LYS A CE  1 
ATOM 422  N NZ  . LYS A 1 69  ? 180.631 -26.089 48.466 1.00 137.32 ? 69  LYS A NZ  1 
ATOM 423  N N   . LEU A 1 70  ? 186.555 -25.933 48.786 1.00 106.99 ? 70  LEU A N   1 
ATOM 424  C CA  . LEU A 1 70  ? 187.484 -25.030 48.142 1.00 96.93  ? 70  LEU A CA  1 
ATOM 425  C C   . LEU A 1 70  ? 188.559 -24.458 49.042 1.00 105.02 ? 70  LEU A C   1 
ATOM 426  O O   . LEU A 1 70  ? 188.351 -24.216 50.231 1.00 99.94  ? 70  LEU A O   1 
ATOM 427  C CB  . LEU A 1 70  ? 186.693 -23.889 47.513 1.00 100.64 ? 70  LEU A CB  1 
ATOM 428  C CG  . LEU A 1 70  ? 186.295 -24.130 46.060 1.00 106.33 ? 70  LEU A CG  1 
ATOM 429  C CD1 . LEU A 1 70  ? 185.355 -23.045 45.595 1.00 108.23 ? 70  LEU A CD1 1 
ATOM 430  C CD2 . LEU A 1 70  ? 187.527 -24.182 45.173 1.00 114.07 ? 70  LEU A CD2 1 
ATOM 431  N N   . LEU A 1 71  ? 189.715 -24.241 48.434 1.00 111.78 ? 71  LEU A N   1 
ATOM 432  C CA  . LEU A 1 71  ? 190.805 -23.538 49.067 1.00 107.28 ? 71  LEU A CA  1 
ATOM 433  C C   . LEU A 1 71  ? 190.688 -22.072 48.677 1.00 107.47 ? 71  LEU A C   1 
ATOM 434  O O   . LEU A 1 71  ? 190.722 -21.741 47.493 1.00 124.09 ? 71  LEU A O   1 
ATOM 435  C CB  . LEU A 1 71  ? 192.141 -24.123 48.619 1.00 102.21 ? 71  LEU A CB  1 
ATOM 436  C CG  . LEU A 1 71  ? 193.132 -24.546 49.698 1.00 109.10 ? 71  LEU A CG  1 
ATOM 437  C CD1 . LEU A 1 71  ? 192.572 -25.665 50.567 1.00 111.91 ? 71  LEU A CD1 1 
ATOM 438  C CD2 . LEU A 1 71  ? 194.441 -24.967 49.055 1.00 107.56 ? 71  LEU A CD2 1 
ATOM 439  N N   . VAL A 1 72  ? 190.514 -21.196 49.659 1.00 95.51  ? 72  VAL A N   1 
ATOM 440  C CA  . VAL A 1 72  ? 190.432 -19.771 49.364 1.00 102.13 ? 72  VAL A CA  1 
ATOM 441  C C   . VAL A 1 72  ? 191.585 -19.034 50.040 1.00 98.93  ? 72  VAL A C   1 
ATOM 442  O O   . VAL A 1 72  ? 192.035 -19.410 51.125 1.00 81.95  ? 72  VAL A O   1 
ATOM 443  C CB  . VAL A 1 72  ? 189.066 -19.170 49.786 1.00 95.15  ? 72  VAL A CB  1 
ATOM 444  C CG1 . VAL A 1 72  ? 187.931 -20.079 49.337 1.00 94.14  ? 72  VAL A CG1 1 
ATOM 445  C CG2 . VAL A 1 72  ? 188.995 -18.954 51.284 1.00 93.07  ? 72  VAL A CG2 1 
ATOM 446  N N   . THR A 1 73  ? 192.073 -17.994 49.373 1.00 99.32  ? 73  THR A N   1 
ATOM 447  C CA  . THR A 1 73  ? 193.312 -17.339 49.770 1.00 90.69  ? 73  THR A CA  1 
ATOM 448  C C   . THR A 1 73  ? 193.061 -15.973 50.401 1.00 87.12  ? 73  THR A C   1 
ATOM 449  O O   . THR A 1 73  ? 192.062 -15.316 50.110 1.00 93.50  ? 73  THR A O   1 
ATOM 450  C CB  . THR A 1 73  ? 194.253 -17.173 48.558 1.00 88.89  ? 73  THR A CB  1 
ATOM 451  O OG1 . THR A 1 73  ? 194.170 -18.336 47.724 1.00 98.44  ? 73  THR A OG1 1 
ATOM 452  C CG2 . THR A 1 73  ? 195.693 -16.981 49.007 1.00 87.41  ? 73  THR A CG2 1 
ATOM 453  N N   . ALA A 1 74  ? 193.976 -15.556 51.271 1.00 76.36  ? 74  ALA A N   1 
ATOM 454  C CA  . ALA A 1 74  ? 193.903 -14.246 51.903 1.00 74.98  ? 74  ALA A CA  1 
ATOM 455  C C   . ALA A 1 74  ? 195.288 -13.619 51.991 1.00 75.89  ? 74  ALA A C   1 
ATOM 456  O O   . ALA A 1 74  ? 196.298 -14.322 51.978 1.00 92.58  ? 74  ALA A O   1 
ATOM 457  C CB  . ALA A 1 74  ? 193.284 -14.357 53.286 1.00 56.29  ? 74  ALA A CB  1 
ATOM 458  N N   . PHE A 1 75  ? 195.336 -12.295 52.074 1.00 90.94  ? 75  PHE A N   1 
ATOM 459  C CA  . PHE A 1 75  ? 196.599 -11.608 52.301 1.00 80.06  ? 75  PHE A CA  1 
ATOM 460  C C   . PHE A 1 75  ? 197.063 -11.844 53.734 1.00 83.18  ? 75  PHE A C   1 
ATOM 461  O O   . PHE A 1 75  ? 196.257 -11.841 54.665 1.00 91.31  ? 75  PHE A O   1 
ATOM 462  C CB  . PHE A 1 75  ? 196.470 -10.110 52.019 1.00 69.01  ? 75  PHE A CB  1 
ATOM 463  C CG  . PHE A 1 75  ? 196.286 -9.780  50.564 1.00 74.28  ? 75  PHE A CG  1 
ATOM 464  C CD1 . PHE A 1 75  ? 197.355 -9.847  49.685 1.00 72.87  ? 75  PHE A CD1 1 
ATOM 465  C CD2 . PHE A 1 75  ? 195.049 -9.392  50.076 1.00 75.33  ? 75  PHE A CD2 1 
ATOM 466  C CE1 . PHE A 1 75  ? 197.194 -9.541  48.347 1.00 69.37  ? 75  PHE A CE1 1 
ATOM 467  C CE2 . PHE A 1 75  ? 194.881 -9.083  48.737 1.00 72.26  ? 75  PHE A CE2 1 
ATOM 468  C CZ  . PHE A 1 75  ? 195.955 -9.158  47.872 1.00 78.94  ? 75  PHE A CZ  1 
ATOM 469  N N   . GLN A 1 76  ? 198.363 -12.058 53.905 1.00 84.49  ? 76  GLN A N   1 
ATOM 470  C CA  . GLN A 1 76  ? 198.927 -12.318 55.223 1.00 89.74  ? 76  GLN A CA  1 
ATOM 471  C C   . GLN A 1 76  ? 199.464 -11.028 55.836 1.00 95.87  ? 76  GLN A C   1 
ATOM 472  O O   . GLN A 1 76  ? 200.562 -10.581 55.505 1.00 114.13 ? 76  GLN A O   1 
ATOM 473  C CB  . GLN A 1 76  ? 200.028 -13.378 55.131 1.00 80.89  ? 76  GLN A CB  1 
ATOM 474  C CG  . GLN A 1 76  ? 200.798 -13.612 56.422 1.00 84.38  ? 76  GLN A CG  1 
ATOM 475  C CD  . GLN A 1 76  ? 199.889 -13.829 57.616 1.00 99.97  ? 76  GLN A CD  1 
ATOM 476  O OE1 . GLN A 1 76  ? 199.584 -12.894 58.355 1.00 125.52 ? 76  GLN A OE1 1 
ATOM 477  N NE2 . GLN A 1 76  ? 199.452 -15.068 57.810 1.00 87.84  ? 76  GLN A NE2 1 
ATOM 478  N N   . SER A 1 77  ? 198.684 -10.440 56.739 1.00 91.02  ? 77  SER A N   1 
ATOM 479  C CA  . SER A 1 77  ? 198.991 -9.125  57.298 1.00 102.39 ? 77  SER A CA  1 
ATOM 480  C C   . SER A 1 77  ? 200.263 -9.098  58.148 1.00 96.85  ? 77  SER A C   1 
ATOM 481  O O   . SER A 1 77  ? 200.721 -8.028  58.548 1.00 92.06  ? 77  SER A O   1 
ATOM 482  C CB  . SER A 1 77  ? 197.808 -8.622  58.129 1.00 91.88  ? 77  SER A CB  1 
ATOM 483  O OG  . SER A 1 77  ? 197.429 -9.575  59.106 1.00 103.37 ? 77  SER A OG  1 
ATOM 484  N N   . SER A 1 78  ? 200.827 -10.269 58.425 1.00 95.05  ? 78  SER A N   1 
ATOM 485  C CA  . SER A 1 78  ? 202.084 -10.351 59.162 1.00 104.16 ? 78  SER A CA  1 
ATOM 486  C C   . SER A 1 78  ? 203.245 -9.871  58.299 1.00 110.20 ? 78  SER A C   1 
ATOM 487  O O   . SER A 1 78  ? 204.267 -9.415  58.811 1.00 113.50 ? 78  SER A O   1 
ATOM 488  C CB  . SER A 1 78  ? 202.339 -11.781 59.639 1.00 102.55 ? 78  SER A CB  1 
ATOM 489  O OG  . SER A 1 78  ? 201.307 -12.222 60.503 1.00 114.03 ? 78  SER A OG  1 
ATOM 490  N N   . VAL A 1 79  ? 203.076 -9.980  56.986 1.00 108.34 ? 79  VAL A N   1 
ATOM 491  C CA  . VAL A 1 79  ? 204.082 -9.526  56.034 1.00 105.67 ? 79  VAL A CA  1 
ATOM 492  C C   . VAL A 1 79  ? 203.739 -8.125  55.530 1.00 104.91 ? 79  VAL A C   1 
ATOM 493  O O   . VAL A 1 79  ? 202.701 -7.932  54.897 1.00 99.32  ? 79  VAL A O   1 
ATOM 494  C CB  . VAL A 1 79  ? 204.198 -10.490 54.838 1.00 99.02  ? 79  VAL A CB  1 
ATOM 495  C CG1 . VAL A 1 79  ? 205.249 -9.997  53.856 1.00 107.83 ? 79  VAL A CG1 1 
ATOM 496  C CG2 . VAL A 1 79  ? 204.521 -11.899 55.320 1.00 81.40  ? 79  VAL A CG2 1 
ATOM 497  N N   . PRO A 1 80  ? 204.610 -7.142  55.819 1.00 98.99  ? 80  PRO A N   1 
ATOM 498  C CA  . PRO A 1 80  ? 204.396 -5.732  55.466 1.00 101.36 ? 80  PRO A CA  1 
ATOM 499  C C   . PRO A 1 80  ? 204.075 -5.517  53.987 1.00 101.86 ? 80  PRO A C   1 
ATOM 500  O O   . PRO A 1 80  ? 203.240 -4.673  53.660 1.00 108.31 ? 80  PRO A O   1 
ATOM 501  C CB  . PRO A 1 80  ? 205.731 -5.078  55.832 1.00 97.30  ? 80  PRO A CB  1 
ATOM 502  C CG  . PRO A 1 80  ? 206.261 -5.927  56.934 1.00 87.62  ? 80  PRO A CG  1 
ATOM 503  C CD  . PRO A 1 80  ? 205.856 -7.333  56.581 1.00 91.93  ? 80  PRO A CD  1 
ATOM 504  N N   . ALA A 1 81  ? 204.727 -6.276  53.113 1.00 98.21  ? 81  ALA A N   1 
ATOM 505  C CA  . ALA A 1 81  ? 204.469 -6.187  51.680 1.00 100.86 ? 81  ALA A CA  1 
ATOM 506  C C   . ALA A 1 81  ? 203.028 -6.575  51.367 1.00 97.28  ? 81  ALA A C   1 
ATOM 507  O O   . ALA A 1 81  ? 202.364 -5.936  50.551 1.00 95.10  ? 81  ALA A O   1 
ATOM 508  C CB  . ALA A 1 81  ? 205.437 -7.070  50.911 1.00 88.14  ? 81  ALA A CB  1 
ATOM 509  N N   . ALA A 1 82  ? 202.551 -7.626  52.026 1.00 96.96  ? 82  ALA A N   1 
ATOM 510  C CA  . ALA A 1 82  ? 201.174 -8.070  51.861 1.00 84.74  ? 82  ALA A CA  1 
ATOM 511  C C   . ALA A 1 82  ? 200.207 -7.024  52.404 1.00 90.39  ? 82  ALA A C   1 
ATOM 512  O O   . ALA A 1 82  ? 199.229 -6.670  51.746 1.00 80.64  ? 82  ALA A O   1 
ATOM 513  C CB  . ALA A 1 82  ? 200.960 -9.403  52.553 1.00 70.71  ? 82  ALA A CB  1 
ATOM 514  N N   . LYS A 1 83  ? 200.499 -6.534  53.605 1.00 94.55  ? 83  LYS A N   1 
ATOM 515  C CA  . LYS A 1 83  ? 199.686 -5.517  54.265 1.00 90.49  ? 83  LYS A CA  1 
ATOM 516  C C   . LYS A 1 83  ? 199.514 -4.278  53.388 1.00 98.39  ? 83  LYS A C   1 
ATOM 517  O O   . LYS A 1 83  ? 198.426 -3.707  53.310 1.00 106.00 ? 83  LYS A O   1 
ATOM 518  C CB  . LYS A 1 83  ? 200.318 -5.128  55.604 1.00 90.70  ? 83  LYS A CB  1 
ATOM 519  C CG  . LYS A 1 83  ? 199.330 -4.795  56.712 1.00 84.70  ? 83  LYS A CG  1 
ATOM 520  C CD  . LYS A 1 83  ? 200.067 -4.385  57.982 1.00 78.41  ? 83  LYS A CD  1 
ATOM 521  C CE  . LYS A 1 83  ? 199.113 -4.132  59.139 1.00 95.80  ? 83  LYS A CE  1 
ATOM 522  N NZ  . LYS A 1 83  ? 198.262 -5.318  59.439 1.00 116.36 ? 83  LYS A NZ  1 
ATOM 523  N N   . ARG A 1 84  ? 200.595 -3.874  52.728 1.00 100.03 ? 84  ARG A N   1 
ATOM 524  C CA  . ARG A 1 84  ? 200.575 -2.704  51.857 1.00 101.40 ? 84  ARG A CA  1 
ATOM 525  C C   . ARG A 1 84  ? 199.662 -2.912  50.649 1.00 98.08  ? 84  ARG A C   1 
ATOM 526  O O   . ARG A 1 84  ? 198.908 -2.015  50.271 1.00 96.82  ? 84  ARG A O   1 
ATOM 527  C CB  . ARG A 1 84  ? 201.995 -2.359  51.395 1.00 97.46  ? 84  ARG A CB  1 
ATOM 528  C CG  . ARG A 1 84  ? 202.830 -1.648  52.453 1.00 96.21  ? 84  ARG A CG  1 
ATOM 529  C CD  . ARG A 1 84  ? 204.164 -1.167  51.897 1.00 95.55  ? 84  ARG A CD  1 
ATOM 530  N NE  . ARG A 1 84  ? 205.106 -2.261  51.675 1.00 109.01 ? 84  ARG A NE  1 
ATOM 531  C CZ  . ARG A 1 84  ? 205.964 -2.700  52.589 1.00 106.21 ? 84  ARG A CZ  1 
ATOM 532  N NH1 . ARG A 1 84  ? 206.001 -2.139  53.790 1.00 117.50 ? 84  ARG A NH1 1 
ATOM 533  N NH2 . ARG A 1 84  ? 206.788 -3.700  52.304 1.00 91.09  ? 84  ARG A NH2 1 
ATOM 534  N N   . VAL A 1 85  ? 199.732 -4.096  50.049 1.00 100.42 ? 85  VAL A N   1 
ATOM 535  C CA  . VAL A 1 85  ? 198.873 -4.435  48.919 1.00 95.75  ? 85  VAL A CA  1 
ATOM 536  C C   . VAL A 1 85  ? 197.431 -4.613  49.378 1.00 90.65  ? 85  VAL A C   1 
ATOM 537  O O   . VAL A 1 85  ? 196.496 -4.134  48.734 1.00 92.78  ? 85  VAL A O   1 
ATOM 538  C CB  . VAL A 1 85  ? 199.346 -5.721  48.211 1.00 82.66  ? 85  VAL A CB  1 
ATOM 539  C CG1 . VAL A 1 85  ? 198.303 -6.200  47.209 1.00 77.11  ? 85  VAL A CG1 1 
ATOM 540  C CG2 . VAL A 1 85  ? 200.685 -5.489  47.530 1.00 68.02  ? 85  VAL A CG2 1 
ATOM 541  N N   . SER A 1 86  ? 197.265 -5.301  50.504 1.00 91.15  ? 86  SER A N   1 
ATOM 542  C CA  . SER A 1 86  ? 195.952 -5.547  51.090 1.00 83.75  ? 86  SER A CA  1 
ATOM 543  C C   . SER A 1 86  ? 195.199 -4.247  51.366 1.00 87.61  ? 86  SER A C   1 
ATOM 544  O O   . SER A 1 86  ? 193.972 -4.200  51.284 1.00 93.82  ? 86  SER A O   1 
ATOM 545  C CB  . SER A 1 86  ? 196.101 -6.352  52.386 1.00 87.31  ? 86  SER A CB  1 
ATOM 546  O OG  . SER A 1 86  ? 194.846 -6.775  52.886 1.00 86.02  ? 86  SER A OG  1 
ATOM 547  N N   . SER A 1 87  ? 195.947 -3.193  51.675 1.00 99.22  ? 87  SER A N   1 
ATOM 548  C CA  . SER A 1 87  ? 195.364 -1.916  52.078 1.00 89.98  ? 87  SER A CA  1 
ATOM 549  C C   . SER A 1 87  ? 194.746 -1.128  50.926 1.00 77.13  ? 87  SER A C   1 
ATOM 550  O O   . SER A 1 87  ? 193.885 -0.278  51.150 1.00 94.79  ? 87  SER A O   1 
ATOM 551  C CB  . SER A 1 87  ? 196.421 -1.055  52.771 1.00 96.69  ? 87  SER A CB  1 
ATOM 552  O OG  . SER A 1 87  ? 196.855 -1.659  53.976 1.00 100.50 ? 87  SER A OG  1 
ATOM 553  N N   . THR A 1 88  ? 195.185 -1.404  49.700 1.00 82.83  ? 88  THR A N   1 
ATOM 554  C CA  . THR A 1 88  ? 194.657 -0.714  48.524 1.00 84.38  ? 88  THR A CA  1 
ATOM 555  C C   . THR A 1 88  ? 193.147 -0.889  48.403 1.00 93.02  ? 88  THR A C   1 
ATOM 556  O O   . THR A 1 88  ? 192.454 -0.034  47.852 1.00 106.39 ? 88  THR A O   1 
ATOM 557  C CB  . THR A 1 88  ? 195.310 -1.217  47.222 1.00 90.65  ? 88  THR A CB  1 
ATOM 558  O OG1 . THR A 1 88  ? 194.829 -2.533  46.919 1.00 103.48 ? 88  THR A OG1 1 
ATOM 559  C CG2 . THR A 1 88  ? 196.824 -1.241  47.351 1.00 84.64  ? 88  THR A CG2 1 
ATOM 560  N N   . PHE A 1 89  ? 192.650 -2.004  48.929 1.00 90.53  ? 89  PHE A N   1 
ATOM 561  C CA  . PHE A 1 89  ? 191.235 -2.350  48.850 1.00 85.69  ? 89  PHE A CA  1 
ATOM 562  C C   . PHE A 1 89  ? 190.370 -1.547  49.814 1.00 91.51  ? 89  PHE A C   1 
ATOM 563  O O   . PHE A 1 89  ? 189.159 -1.433  49.621 1.00 106.94 ? 89  PHE A O   1 
ATOM 564  C CB  . PHE A 1 89  ? 191.048 -3.842  49.122 1.00 84.47  ? 89  PHE A CB  1 
ATOM 565  C CG  . PHE A 1 89  ? 191.592 -4.727  48.041 1.00 86.19  ? 89  PHE A CG  1 
ATOM 566  C CD1 . PHE A 1 89  ? 192.934 -5.066  48.010 1.00 82.61  ? 89  PHE A CD1 1 
ATOM 567  C CD2 . PHE A 1 89  ? 190.758 -5.219  47.052 1.00 63.30  ? 89  PHE A CD2 1 
ATOM 568  C CE1 . PHE A 1 89  ? 193.434 -5.880  47.012 1.00 66.94  ? 89  PHE A CE1 1 
ATOM 569  C CE2 . PHE A 1 89  ? 191.251 -6.032  46.052 1.00 73.54  ? 89  PHE A CE2 1 
ATOM 570  C CZ  . PHE A 1 89  ? 192.591 -6.364  46.031 1.00 73.57  ? 89  PHE A CZ  1 
ATOM 571  N N   . ASP A 1 90  ? 190.988 -1.000  50.854 1.00 94.89  ? 90  ASP A N   1 
ATOM 572  C CA  . ASP A 1 90  ? 190.251 -0.258  51.869 1.00 102.27 ? 90  ASP A CA  1 
ATOM 573  C C   . ASP A 1 90  ? 189.627 1.002   51.283 1.00 97.48  ? 90  ASP A C   1 
ATOM 574  O O   . ASP A 1 90  ? 188.583 1.463   51.746 1.00 108.69 ? 90  ASP A O   1 
ATOM 575  C CB  . ASP A 1 90  ? 191.166 0.094   53.041 1.00 120.32 ? 90  ASP A CB  1 
ATOM 576  C CG  . ASP A 1 90  ? 191.796 -1.131  53.671 1.00 146.87 ? 90  ASP A CG  1 
ATOM 577  O OD1 . ASP A 1 90  ? 191.113 -2.174  53.757 1.00 157.12 ? 90  ASP A OD1 1 
ATOM 578  O OD2 . ASP A 1 90  ? 192.971 -1.052  54.085 1.00 153.07 ? 90  ASP A OD2 1 
ATOM 579  N N   . GLY A 1 91  ? 190.270 1.554   50.260 1.00 103.52 ? 91  GLY A N   1 
ATOM 580  C CA  . GLY A 1 91  ? 189.714 2.680   49.537 1.00 93.26  ? 91  GLY A CA  1 
ATOM 581  C C   . GLY A 1 91  ? 188.504 2.245   48.737 1.00 92.56  ? 91  GLY A C   1 
ATOM 582  O O   . GLY A 1 91  ? 187.530 2.987   48.611 1.00 96.68  ? 91  GLY A O   1 
ATOM 583  N N   . LEU A 1 92  ? 188.565 1.027   48.205 1.00 84.82  ? 92  LEU A N   1 
ATOM 584  C CA  . LEU A 1 92  ? 187.482 0.484   47.393 1.00 89.82  ? 92  LEU A CA  1 
ATOM 585  C C   . LEU A 1 92  ? 186.214 0.256   48.208 1.00 91.03  ? 92  LEU A C   1 
ATOM 586  O O   . LEU A 1 92  ? 185.107 0.399   47.691 1.00 100.15 ? 92  LEU A O   1 
ATOM 587  C CB  . LEU A 1 92  ? 187.912 -0.826  46.730 1.00 76.01  ? 92  LEU A CB  1 
ATOM 588  C CG  . LEU A 1 92  ? 189.076 -0.748  45.742 1.00 86.13  ? 92  LEU A CG  1 
ATOM 589  C CD1 . LEU A 1 92  ? 189.239 -2.075  45.021 1.00 70.97  ? 92  LEU A CD1 1 
ATOM 590  C CD2 . LEU A 1 92  ? 188.876 0.389   44.748 1.00 89.10  ? 92  LEU A CD2 1 
ATOM 591  N N   . ARG A 1 93  ? 186.378 -0.102  49.479 1.00 88.39  ? 93  ARG A N   1 
ATOM 592  C CA  . ARG A 1 93  ? 185.236 -0.342  50.356 1.00 83.69  ? 93  ARG A CA  1 
ATOM 593  C C   . ARG A 1 93  ? 184.344 0.890   50.442 1.00 86.53  ? 93  ARG A C   1 
ATOM 594  O O   . ARG A 1 93  ? 183.119 0.789   50.373 1.00 84.72  ? 93  ARG A O   1 
ATOM 595  C CB  . ARG A 1 93  ? 185.695 -0.741  51.758 1.00 97.21  ? 93  ARG A CB  1 
ATOM 596  C CG  . ARG A 1 93  ? 184.545 -0.911  52.736 1.00 114.40 ? 93  ARG A CG  1 
ATOM 597  C CD  . ARG A 1 93  ? 185.027 -1.283  54.126 1.00 135.22 ? 93  ARG A CD  1 
ATOM 598  N NE  . ARG A 1 93  ? 185.847 -2.488  54.138 1.00 138.43 ? 93  ARG A NE  1 
ATOM 599  C CZ  . ARG A 1 93  ? 187.024 -2.582  54.747 1.00 132.78 ? 93  ARG A CZ  1 
ATOM 600  N NH1 . ARG A 1 93  ? 187.524 -1.538  55.395 1.00 140.21 ? 93  ARG A NH1 1 
ATOM 601  N NH2 . ARG A 1 93  ? 187.703 -3.720  54.708 1.00 128.43 ? 93  ARG A NH2 1 
ATOM 602  N N   . ASP A 1 94  ? 184.972 2.051   50.596 1.00 103.80 ? 94  ASP A N   1 
ATOM 603  C CA  . ASP A 1 94  ? 184.255 3.318   50.618 1.00 110.60 ? 94  ASP A CA  1 
ATOM 604  C C   . ASP A 1 94  ? 183.592 3.540   49.261 1.00 101.44 ? 94  ASP A C   1 
ATOM 605  O O   . ASP A 1 94  ? 182.448 3.982   49.182 1.00 104.71 ? 94  ASP A O   1 
ATOM 606  C CB  . ASP A 1 94  ? 185.211 4.467   50.962 1.00 122.96 ? 94  ASP A CB  1 
ATOM 607  C CG  . ASP A 1 94  ? 184.488 5.759   51.317 1.00 131.63 ? 94  ASP A CG  1 
ATOM 608  O OD1 . ASP A 1 94  ? 183.389 6.013   50.785 1.00 150.53 ? 94  ASP A OD1 1 
ATOM 609  O OD2 . ASP A 1 94  ? 185.027 6.527   52.142 1.00 143.51 ? 94  ASP A OD2 1 
ATOM 610  N N   . ALA A 1 95  ? 184.312 3.205   48.195 1.00 102.80 ? 95  ALA A N   1 
ATOM 611  C CA  . ALA A 1 95  ? 183.814 3.394   46.836 1.00 98.51  ? 95  ALA A CA  1 
ATOM 612  C C   . ALA A 1 95  ? 182.563 2.563   46.551 1.00 100.36 ? 95  ALA A C   1 
ATOM 613  O O   . ALA A 1 95  ? 181.742 2.937   45.714 1.00 95.12  ? 95  ALA A O   1 
ATOM 614  C CB  . ALA A 1 95  ? 184.904 3.058   45.828 1.00 84.85  ? 95  ALA A CB  1 
ATOM 615  N N   . ILE A 1 96  ? 182.416 1.443   47.252 1.00 102.79 ? 96  ILE A N   1 
ATOM 616  C CA  . ILE A 1 96  ? 181.318 0.517   46.993 1.00 93.87  ? 96  ILE A CA  1 
ATOM 617  C C   . ILE A 1 96  ? 180.043 0.886   47.758 1.00 92.45  ? 96  ILE A C   1 
ATOM 618  O O   . ILE A 1 96  ? 178.939 0.775   47.220 1.00 85.47  ? 96  ILE A O   1 
ATOM 619  C CB  . ILE A 1 96  ? 181.732 -0.928  47.335 1.00 85.37  ? 96  ILE A CB  1 
ATOM 620  C CG1 . ILE A 1 96  ? 182.867 -1.376  46.413 1.00 83.25  ? 96  ILE A CG1 1 
ATOM 621  C CG2 . ILE A 1 96  ? 180.553 -1.879  47.203 1.00 80.93  ? 96  ILE A CG2 1 
ATOM 622  C CD1 . ILE A 1 96  ? 183.282 -2.817  46.598 1.00 74.15  ? 96  ILE A CD1 1 
ATOM 623  N N   . GLN A 1 97  ? 180.195 1.330   49.005 1.00 94.21  ? 97  GLN A N   1 
ATOM 624  C CA  . GLN A 1 97  ? 179.056 1.794   49.796 1.00 98.93  ? 97  GLN A CA  1 
ATOM 625  C C   . GLN A 1 97  ? 178.279 2.881   49.066 1.00 96.13  ? 97  GLN A C   1 
ATOM 626  O O   . GLN A 1 97  ? 177.049 2.915   49.098 1.00 116.41 ? 97  GLN A O   1 
ATOM 627  C CB  . GLN A 1 97  ? 179.510 2.336   51.154 1.00 115.44 ? 97  GLN A CB  1 
ATOM 628  C CG  . GLN A 1 97  ? 180.057 1.309   52.122 1.00 124.16 ? 97  GLN A CG  1 
ATOM 629  C CD  . GLN A 1 97  ? 180.216 1.875   53.522 1.00 130.75 ? 97  GLN A CD  1 
ATOM 630  O OE1 . GLN A 1 97  ? 181.178 2.587   53.811 1.00 127.00 ? 97  GLN A OE1 1 
ATOM 631  N NE2 . GLN A 1 97  ? 179.263 1.570   54.396 1.00 121.23 ? 97  GLN A NE2 1 
ATOM 632  N N   . GLN A 1 98  ? 179.015 3.767   48.405 1.00 97.26  ? 98  GLN A N   1 
ATOM 633  C CA  . GLN A 1 98  ? 178.429 4.932   47.759 1.00 105.72 ? 98  GLN A CA  1 
ATOM 634  C C   . GLN A 1 98  ? 177.960 4.619   46.342 1.00 100.66 ? 98  GLN A C   1 
ATOM 635  O O   . GLN A 1 98  ? 177.514 5.509   45.617 1.00 110.90 ? 98  GLN A O   1 
ATOM 636  C CB  . GLN A 1 98  ? 179.439 6.080   47.738 1.00 108.53 ? 98  GLN A CB  1 
ATOM 637  C CG  . GLN A 1 98  ? 180.250 6.202   49.018 1.00 114.38 ? 98  GLN A CG  1 
ATOM 638  C CD  . GLN A 1 98  ? 180.306 7.618   49.549 1.00 135.83 ? 98  GLN A CD  1 
ATOM 639  O OE1 . GLN A 1 98  ? 179.274 8.243   49.793 1.00 157.67 ? 98  GLN A OE1 1 
ATOM 640  N NE2 . GLN A 1 98  ? 181.517 8.134   49.732 1.00 124.89 ? 98  GLN A NE2 1 
ATOM 641  N N   . GLY A 1 99  ? 178.063 3.352   45.953 1.00 92.64  ? 99  GLY A N   1 
ATOM 642  C CA  . GLY A 1 99  ? 177.643 2.921   44.632 1.00 94.51  ? 99  GLY A CA  1 
ATOM 643  C C   . GLY A 1 99  ? 178.455 3.557   43.520 1.00 98.59  ? 99  GLY A C   1 
ATOM 644  O O   . GLY A 1 99  ? 177.946 3.787   42.423 1.00 99.54  ? 99  GLY A O   1 
ATOM 645  N N   . TYR A 1 100 ? 179.723 3.836   43.805 1.00 97.56  ? 100 TYR A N   1 
ATOM 646  C CA  . TYR A 1 100 ? 180.598 4.507   42.848 1.00 101.34 ? 100 TYR A CA  1 
ATOM 647  C C   . TYR A 1 100 ? 181.340 3.521   41.947 1.00 94.87  ? 100 TYR A C   1 
ATOM 648  O O   . TYR A 1 100 ? 181.515 3.770   40.754 1.00 105.28 ? 100 TYR A O   1 
ATOM 649  C CB  . TYR A 1 100 ? 181.615 5.393   43.577 1.00 97.09  ? 100 TYR A CB  1 
ATOM 650  C CG  . TYR A 1 100 ? 181.029 6.598   44.285 1.00 103.38 ? 100 TYR A CG  1 
ATOM 651  C CD1 . TYR A 1 100 ? 179.741 7.039   44.009 1.00 104.07 ? 100 TYR A CD1 1 
ATOM 652  C CD2 . TYR A 1 100 ? 181.776 7.302   45.222 1.00 105.37 ? 100 TYR A CD2 1 
ATOM 653  C CE1 . TYR A 1 100 ? 179.210 8.144   44.655 1.00 99.24  ? 100 TYR A CE1 1 
ATOM 654  C CE2 . TYR A 1 100 ? 181.255 8.407   45.870 1.00 107.87 ? 100 TYR A CE2 1 
ATOM 655  C CZ  . TYR A 1 100 ? 179.973 8.823   45.585 1.00 103.48 ? 100 TYR A CZ  1 
ATOM 656  O OH  . TYR A 1 100 ? 179.455 9.921   46.232 1.00 97.06  ? 100 TYR A OH  1 
ATOM 657  N N   . LEU A 1 101 ? 181.775 2.406   42.523 1.00 82.74  ? 101 LEU A N   1 
ATOM 658  C CA  . LEU A 1 101 ? 182.629 1.453   41.817 1.00 86.18  ? 101 LEU A CA  1 
ATOM 659  C C   . LEU A 1 101 ? 181.862 0.608   40.800 1.00 83.89  ? 101 LEU A C   1 
ATOM 660  O O   . LEU A 1 101 ? 180.919 -0.097  41.153 1.00 94.71  ? 101 LEU A O   1 
ATOM 661  C CB  . LEU A 1 101 ? 183.336 0.541   42.824 1.00 88.87  ? 101 LEU A CB  1 
ATOM 662  C CG  . LEU A 1 101 ? 184.386 -0.426  42.273 1.00 80.90  ? 101 LEU A CG  1 
ATOM 663  C CD1 . LEU A 1 101 ? 185.492 0.334   41.560 1.00 82.72  ? 101 LEU A CD1 1 
ATOM 664  C CD2 . LEU A 1 101 ? 184.961 -1.287  43.386 1.00 71.86  ? 101 LEU A CD2 1 
ATOM 665  N N   . ARG A 1 102 ? 182.278 0.679   39.538 1.00 79.71  ? 102 ARG A N   1 
ATOM 666  C CA  . ARG A 1 102 ? 181.647 -0.104  38.479 1.00 75.34  ? 102 ARG A CA  1 
ATOM 667  C C   . ARG A 1 102 ? 182.483 -1.327  38.113 1.00 88.46  ? 102 ARG A C   1 
ATOM 668  O O   . ARG A 1 102 ? 181.985 -2.453  38.111 1.00 95.85  ? 102 ARG A O   1 
ATOM 669  C CB  . ARG A 1 102 ? 181.417 0.758   37.236 1.00 79.53  ? 102 ARG A CB  1 
ATOM 670  C CG  . ARG A 1 102 ? 181.044 -0.042  36.000 1.00 74.94  ? 102 ARG A CG  1 
ATOM 671  C CD  . ARG A 1 102 ? 179.628 -0.582  36.104 1.00 82.31  ? 102 ARG A CD  1 
ATOM 672  N NE  . ARG A 1 102 ? 178.634 0.487   36.139 1.00 111.99 ? 102 ARG A NE  1 
ATOM 673  C CZ  . ARG A 1 102 ? 177.413 0.358   36.648 1.00 116.58 ? 102 ARG A CZ  1 
ATOM 674  N NH1 . ARG A 1 102 ? 177.030 -0.796  37.178 1.00 113.21 ? 102 ARG A NH1 1 
ATOM 675  N NH2 . ARG A 1 102 ? 176.575 1.385   36.635 1.00 112.88 ? 102 ARG A NH2 1 
ATOM 676  N N   . GLU A 1 103 ? 183.753 -1.102  37.797 1.00 87.44  ? 103 GLU A N   1 
ATOM 677  C CA  . GLU A 1 103 ? 184.652 -2.201  37.468 1.00 90.42  ? 103 GLU A CA  1 
ATOM 678  C C   . GLU A 1 103 ? 185.966 -2.101  38.231 1.00 84.57  ? 103 GLU A C   1 
ATOM 679  O O   . GLU A 1 103 ? 186.554 -1.028  38.337 1.00 94.73  ? 103 GLU A O   1 
ATOM 680  C CB  . GLU A 1 103 ? 184.930 -2.246  35.961 1.00 92.18  ? 103 GLU A CB  1 
ATOM 681  C CG  . GLU A 1 103 ? 185.811 -3.417  35.536 1.00 85.21  ? 103 GLU A CG  1 
ATOM 682  C CD  . GLU A 1 103 ? 185.949 -3.541  34.029 1.00 109.25 ? 103 GLU A CD  1 
ATOM 683  O OE1 . GLU A 1 103 ? 185.032 -3.100  33.306 1.00 126.67 ? 103 GLU A OE1 1 
ATOM 684  O OE2 . GLU A 1 103 ? 186.973 -4.087  33.567 1.00 108.56 ? 103 GLU A OE2 1 
ATOM 685  N N   . PHE A 1 104 ? 186.411 -3.231  38.770 1.00 79.53  ? 104 PHE A N   1 
ATOM 686  C CA  . PHE A 1 104 ? 187.734 -3.338  39.369 1.00 79.62  ? 104 PHE A CA  1 
ATOM 687  C C   . PHE A 1 104 ? 188.513 -4.418  38.636 1.00 71.32  ? 104 PHE A C   1 
ATOM 688  O O   . PHE A 1 104 ? 188.110 -5.580  38.632 1.00 80.28  ? 104 PHE A O   1 
ATOM 689  C CB  . PHE A 1 104 ? 187.641 -3.658  40.862 1.00 73.93  ? 104 PHE A CB  1 
ATOM 690  C CG  . PHE A 1 104 ? 188.924 -4.174  41.452 1.00 74.70  ? 104 PHE A CG  1 
ATOM 691  C CD1 . PHE A 1 104 ? 189.937 -3.300  41.807 1.00 91.77  ? 104 PHE A CD1 1 
ATOM 692  C CD2 . PHE A 1 104 ? 189.115 -5.532  41.657 1.00 76.33  ? 104 PHE A CD2 1 
ATOM 693  C CE1 . PHE A 1 104 ? 191.118 -3.768  42.351 1.00 102.91 ? 104 PHE A CE1 1 
ATOM 694  C CE2 . PHE A 1 104 ? 190.294 -6.007  42.200 1.00 80.51  ? 104 PHE A CE2 1 
ATOM 695  C CZ  . PHE A 1 104 ? 191.297 -5.123  42.548 1.00 86.12  ? 104 PHE A CZ  1 
ATOM 696  N N   . ALA A 1 105 ? 189.626 -4.040  38.016 1.00 72.13  ? 105 ALA A N   1 
ATOM 697  C CA  . ALA A 1 105 ? 190.359 -4.973  37.170 1.00 77.52  ? 105 ALA A CA  1 
ATOM 698  C C   . ALA A 1 105 ? 191.836 -5.073  37.529 1.00 90.86  ? 105 ALA A C   1 
ATOM 699  O O   . ALA A 1 105 ? 192.493 -4.072  37.815 1.00 95.37  ? 105 ALA A O   1 
ATOM 700  C CB  . ALA A 1 105 ? 190.207 -4.580  35.708 1.00 75.66  ? 105 ALA A CB  1 
ATOM 701  N N   . ILE A 1 106 ? 192.344 -6.301  37.512 1.00 97.16  ? 106 ILE A N   1 
ATOM 702  C CA  . ILE A 1 106 ? 193.770 -6.556  37.653 1.00 82.60  ? 106 ILE A CA  1 
ATOM 703  C C   . ILE A 1 106 ? 194.367 -6.791  36.272 1.00 80.99  ? 106 ILE A C   1 
ATOM 704  O O   . ILE A 1 106 ? 193.969 -7.723  35.576 1.00 84.74  ? 106 ILE A O   1 
ATOM 705  C CB  . ILE A 1 106 ? 194.048 -7.779  38.543 1.00 66.81  ? 106 ILE A CB  1 
ATOM 706  C CG1 . ILE A 1 106 ? 193.409 -7.599  39.921 1.00 75.86  ? 106 ILE A CG1 1 
ATOM 707  C CG2 . ILE A 1 106 ? 195.542 -8.014  38.668 1.00 64.54  ? 106 ILE A CG2 1 
ATOM 708  C CD1 . ILE A 1 106 ? 193.412 -8.860  40.759 1.00 73.21  ? 106 ILE A CD1 1 
ATOM 709  N N   . VAL A 1 107 ? 195.310 -5.947  35.868 1.00 80.54  ? 107 VAL A N   1 
ATOM 710  C CA  . VAL A 1 107 ? 195.901 -6.070  34.540 1.00 83.60  ? 107 VAL A CA  1 
ATOM 711  C C   . VAL A 1 107 ? 197.379 -6.430  34.615 1.00 81.78  ? 107 VAL A C   1 
ATOM 712  O O   . VAL A 1 107 ? 198.088 -6.003  35.524 1.00 89.44  ? 107 VAL A O   1 
ATOM 713  C CB  . VAL A 1 107 ? 195.739 -4.772  33.723 1.00 80.25  ? 107 VAL A CB  1 
ATOM 714  C CG1 . VAL A 1 107 ? 194.288 -4.568  33.335 1.00 77.81  ? 107 VAL A CG1 1 
ATOM 715  C CG2 . VAL A 1 107 ? 196.254 -3.579  34.504 1.00 92.12  ? 107 VAL A CG2 1 
ATOM 716  N N   . PHE A 1 108 ? 197.832 -7.227  33.653 1.00 77.33  ? 108 PHE A N   1 
ATOM 717  C CA  . PHE A 1 108 ? 199.232 -7.625  33.578 1.00 73.55  ? 108 PHE A CA  1 
ATOM 718  C C   . PHE A 1 108 ? 199.882 -7.041  32.333 1.00 79.37  ? 108 PHE A C   1 
ATOM 719  O O   . PHE A 1 108 ? 199.281 -7.017  31.259 1.00 87.79  ? 108 PHE A O   1 
ATOM 720  C CB  . PHE A 1 108 ? 199.369 -9.150  33.572 1.00 78.48  ? 108 PHE A CB  1 
ATOM 721  C CG  . PHE A 1 108 ? 199.013 -9.800  34.878 1.00 78.28  ? 108 PHE A CG  1 
ATOM 722  C CD1 . PHE A 1 108 ? 198.943 -9.058  36.044 1.00 89.08  ? 108 PHE A CD1 1 
ATOM 723  C CD2 . PHE A 1 108 ? 198.751 -11.158 34.939 1.00 104.08 ? 108 PHE A CD2 1 
ATOM 724  C CE1 . PHE A 1 108 ? 198.614 -9.659  37.245 1.00 83.86  ? 108 PHE A CE1 1 
ATOM 725  C CE2 . PHE A 1 108 ? 198.423 -11.763 36.139 1.00 103.43 ? 108 PHE A CE2 1 
ATOM 726  C CZ  . PHE A 1 108 ? 198.356 -11.011 37.293 1.00 81.56  ? 108 PHE A CZ  1 
ATOM 727  N N   . TYR A 1 109 ? 201.114 -6.572  32.486 1.00 76.96  ? 109 TYR A N   1 
ATOM 728  C CA  . TYR A 1 109 ? 201.863 -6.002  31.377 1.00 90.24  ? 109 TYR A CA  1 
ATOM 729  C C   . TYR A 1 109 ? 203.353 -6.218  31.593 1.00 92.68  ? 109 TYR A C   1 
ATOM 730  O O   . TYR A 1 109 ? 203.782 -6.609  32.677 1.00 88.53  ? 109 TYR A O   1 
ATOM 731  C CB  . TYR A 1 109 ? 201.566 -4.507  31.227 1.00 83.33  ? 109 TYR A CB  1 
ATOM 732  C CG  . TYR A 1 109 ? 201.976 -3.687  32.432 1.00 79.31  ? 109 TYR A CG  1 
ATOM 733  C CD1 . TYR A 1 109 ? 201.134 -3.558  33.528 1.00 74.97  ? 109 TYR A CD1 1 
ATOM 734  C CD2 . TYR A 1 109 ? 203.211 -3.051  32.476 1.00 90.84  ? 109 TYR A CD2 1 
ATOM 735  C CE1 . TYR A 1 109 ? 201.508 -2.815  34.634 1.00 79.50  ? 109 TYR A CE1 1 
ATOM 736  C CE2 . TYR A 1 109 ? 203.594 -2.307  33.577 1.00 89.03  ? 109 TYR A CE2 1 
ATOM 737  C CZ  . TYR A 1 109 ? 202.739 -2.191  34.653 1.00 83.19  ? 109 TYR A CZ  1 
ATOM 738  O OH  . TYR A 1 109 ? 203.117 -1.450  35.749 1.00 83.40  ? 109 TYR A OH  1 
ATOM 739  N N   . LYS A 1 110 ? 204.138 -5.958  30.556 1.00 81.77  ? 110 LYS A N   1 
ATOM 740  C CA  . LYS A 1 110 ? 205.584 -5.988  30.681 1.00 95.96  ? 110 LYS A CA  1 
ATOM 741  C C   . LYS A 1 110 ? 206.095 -4.582  30.945 1.00 109.26 ? 110 LYS A C   1 
ATOM 742  O O   . LYS A 1 110 ? 205.751 -3.647  30.221 1.00 118.73 ? 110 LYS A O   1 
ATOM 743  C CB  . LYS A 1 110 ? 206.228 -6.565  29.421 1.00 92.41  ? 110 LYS A CB  1 
ATOM 744  C CG  . LYS A 1 110 ? 205.926 -8.034  29.194 1.00 93.98  ? 110 LYS A CG  1 
ATOM 745  C CD  . LYS A 1 110 ? 206.504 -8.514  27.876 1.00 119.67 ? 110 LYS A CD  1 
ATOM 746  C CE  . LYS A 1 110 ? 206.236 -9.994  27.667 1.00 133.30 ? 110 LYS A CE  1 
ATOM 747  N NZ  . LYS A 1 110 ? 206.937 -10.821 28.688 1.00 136.73 ? 110 LYS A NZ  1 
ATOM 748  N N   . LYS A 1 111 ? 206.897 -4.432  31.994 1.00 103.31 ? 111 LYS A N   1 
ATOM 749  C CA  . LYS A 1 111 ? 207.521 -3.151  32.292 1.00 90.77  ? 111 LYS A CA  1 
ATOM 750  C C   . LYS A 1 111 ? 208.321 -2.685  31.081 1.00 98.60  ? 111 LYS A C   1 
ATOM 751  O O   . LYS A 1 111 ? 209.091 -3.459  30.513 1.00 103.13 ? 111 LYS A O   1 
ATOM 752  C CB  . LYS A 1 111 ? 208.427 -3.259  33.523 1.00 78.44  ? 111 LYS A CB  1 
ATOM 753  C CG  . LYS A 1 111 ? 207.803 -3.994  34.699 1.00 87.12  ? 111 LYS A CG  1 
ATOM 754  C CD  . LYS A 1 111 ? 208.612 -3.800  35.977 1.00 111.73 ? 111 LYS A CD  1 
ATOM 755  C CE  . LYS A 1 111 ? 208.096 -2.622  36.794 1.00 118.44 ? 111 LYS A CE  1 
ATOM 756  N NZ  . LYS A 1 111 ? 208.353 -2.792  38.254 1.00 108.02 ? 111 LYS A NZ  1 
ATOM 757  N N   . PRO A 1 112 ? 208.136 -1.419  30.674 1.00 102.90 ? 112 PRO A N   1 
ATOM 758  C CA  . PRO A 1 112 ? 207.199 -0.463  31.267 1.00 113.32 ? 112 PRO A CA  1 
ATOM 759  C C   . PRO A 1 112 ? 206.055 -0.036  30.340 1.00 122.93 ? 112 PRO A C   1 
ATOM 760  O O   . PRO A 1 112 ? 205.615 1.111   30.430 1.00 124.44 ? 112 PRO A O   1 
ATOM 761  C CB  . PRO A 1 112 ? 208.103 0.727   31.563 1.00 113.89 ? 112 PRO A CB  1 
ATOM 762  C CG  . PRO A 1 112 ? 209.058 0.723   30.379 1.00 84.97  ? 112 PRO A CG  1 
ATOM 763  C CD  . PRO A 1 112 ? 209.166 -0.720  29.888 1.00 87.18  ? 112 PRO A CD  1 
ATOM 764  N N   . ASN A 1 113 ? 205.587 -0.924  29.467 1.00 120.78 ? 113 ASN A N   1 
ATOM 765  C CA  . ASN A 1 113 ? 204.475 -0.595  28.576 1.00 113.46 ? 113 ASN A CA  1 
ATOM 766  C C   . ASN A 1 113 ? 203.129 -0.798  29.267 1.00 109.91 ? 113 ASN A C   1 
ATOM 767  O O   . ASN A 1 113 ? 202.405 -1.748  28.970 1.00 126.77 ? 113 ASN A O   1 
ATOM 768  C CB  . ASN A 1 113 ? 204.542 -1.436  27.300 1.00 101.41 ? 113 ASN A CB  1 
ATOM 769  C CG  . ASN A 1 113 ? 205.862 -1.286  26.570 1.00 114.79 ? 113 ASN A CG  1 
ATOM 770  O OD1 . ASN A 1 113 ? 206.452 -0.205  26.544 1.00 116.63 ? 113 ASN A OD1 1 
ATOM 771  N ND2 . ASN A 1 113 ? 206.333 -2.374  25.970 1.00 122.48 ? 113 ASN A ND2 1 
ATOM 772  N N   . GLU A 1 114 ? 202.795 0.115   30.176 1.00 98.71  ? 114 GLU A N   1 
ATOM 773  C CA  . GLU A 1 114 ? 201.652 -0.049  31.074 1.00 93.21  ? 114 GLU A CA  1 
ATOM 774  C C   . GLU A 1 114 ? 200.293 -0.134  30.376 1.00 102.10 ? 114 GLU A C   1 
ATOM 775  O O   . GLU A 1 114 ? 199.289 -0.460  31.010 1.00 113.57 ? 114 GLU A O   1 
ATOM 776  C CB  . GLU A 1 114 ? 201.627 1.096   32.090 1.00 98.27  ? 114 GLU A CB  1 
ATOM 777  C CG  . GLU A 1 114 ? 202.837 1.126   33.011 1.00 97.73  ? 114 GLU A CG  1 
ATOM 778  C CD  . GLU A 1 114 ? 202.726 2.182   34.093 1.00 118.16 ? 114 GLU A CD  1 
ATOM 779  O OE1 . GLU A 1 114 ? 201.665 2.834   34.185 1.00 138.38 ? 114 GLU A OE1 1 
ATOM 780  O OE2 . GLU A 1 114 ? 203.701 2.356   34.854 1.00 104.68 ? 114 GLU A OE2 1 
ATOM 781  N N   . GLU A 1 115 ? 200.257 0.157   29.080 1.00 104.14 ? 115 GLU A N   1 
ATOM 782  C CA  . GLU A 1 115 ? 199.010 0.072   28.327 1.00 104.84 ? 115 GLU A CA  1 
ATOM 783  C C   . GLU A 1 115 ? 199.029 -1.109  27.358 1.00 106.65 ? 115 GLU A C   1 
ATOM 784  O O   . GLU A 1 115 ? 198.039 -1.383  26.681 1.00 109.53 ? 115 GLU A O   1 
ATOM 785  C CB  . GLU A 1 115 ? 198.745 1.376   27.572 1.00 108.78 ? 115 GLU A CB  1 
ATOM 786  C CG  . GLU A 1 115 ? 198.973 2.631   28.405 1.00 109.03 ? 115 GLU A CG  1 
ATOM 787  C CD  . GLU A 1 115 ? 198.207 2.620   29.717 1.00 117.31 ? 115 GLU A CD  1 
ATOM 788  O OE1 . GLU A 1 115 ? 197.019 2.231   29.719 1.00 124.98 ? 115 GLU A OE1 1 
ATOM 789  O OE2 . GLU A 1 115 ? 198.796 3.002   30.750 1.00 113.43 ? 115 GLU A OE2 1 
ATOM 790  N N   . ASP A 1 116 ? 200.161 -1.802  27.297 1.00 119.61 ? 116 ASP A N   1 
ATOM 791  C CA  . ASP A 1 116 ? 200.272 -3.016  26.496 1.00 123.09 ? 116 ASP A CA  1 
ATOM 792  C C   . ASP A 1 116 ? 199.884 -4.218  27.349 1.00 117.34 ? 116 ASP A C   1 
ATOM 793  O O   . ASP A 1 116 ? 200.743 -4.898  27.911 1.00 122.67 ? 116 ASP A O   1 
ATOM 794  C CB  . ASP A 1 116 ? 201.690 -3.179  25.943 1.00 140.86 ? 116 ASP A CB  1 
ATOM 795  C CG  . ASP A 1 116 ? 201.826 -4.379  25.025 1.00 160.84 ? 116 ASP A CG  1 
ATOM 796  O OD1 . ASP A 1 116 ? 200.900 -4.624  24.223 1.00 158.16 ? 116 ASP A OD1 1 
ATOM 797  O OD2 . ASP A 1 116 ? 202.860 -5.076  25.103 1.00 175.01 ? 116 ASP A OD2 1 
ATOM 798  N N   . ILE A 1 117 ? 198.583 -4.469  27.443 1.00 108.00 ? 117 ILE A N   1 
ATOM 799  C CA  . ILE A 1 117 ? 198.049 -5.485  28.345 1.00 101.49 ? 117 ILE A CA  1 
ATOM 800  C C   . ILE A 1 117 ? 198.248 -6.905  27.817 1.00 97.34  ? 117 ILE A C   1 
ATOM 801  O O   . ILE A 1 117 ? 197.994 -7.187  26.645 1.00 107.71 ? 117 ILE A O   1 
ATOM 802  C CB  . ILE A 1 117 ? 196.548 -5.250  28.607 1.00 108.64 ? 117 ILE A CB  1 
ATOM 803  C CG1 . ILE A 1 117 ? 196.317 -3.827  29.117 1.00 105.41 ? 117 ILE A CG1 1 
ATOM 804  C CG2 . ILE A 1 117 ? 196.006 -6.266  29.602 1.00 107.63 ? 117 ILE A CG2 1 
ATOM 805  C CD1 . ILE A 1 117 ? 196.989 -3.536  30.441 1.00 107.29 ? 117 ILE A CD1 1 
ATOM 806  N N   . ASN A 1 118 ? 198.705 -7.794  28.694 1.00 87.99  ? 118 ASN A N   1 
ATOM 807  C CA  . ASN A 1 118 ? 198.907 -9.196  28.348 1.00 75.32  ? 118 ASN A CA  1 
ATOM 808  C C   . ASN A 1 118 ? 197.839 -10.088 28.965 1.00 83.08  ? 118 ASN A C   1 
ATOM 809  O O   . ASN A 1 118 ? 197.486 -11.129 28.412 1.00 95.32  ? 118 ASN A O   1 
ATOM 810  C CB  . ASN A 1 118 ? 200.289 -9.665  28.805 1.00 80.66  ? 118 ASN A CB  1 
ATOM 811  C CG  . ASN A 1 118 ? 201.412 -8.946  28.093 1.00 88.34  ? 118 ASN A CG  1 
ATOM 812  O OD1 . ASN A 1 118 ? 201.363 -8.741  26.881 1.00 93.46  ? 118 ASN A OD1 1 
ATOM 813  N ND2 . ASN A 1 118 ? 202.435 -8.556  28.845 1.00 105.25 ? 118 ASN A ND2 1 
ATOM 814  N N   . GLU A 1 119 ? 197.328 -9.669  30.117 1.00 88.42  ? 119 GLU A N   1 
ATOM 815  C CA  . GLU A 1 119 ? 196.370 -10.466 30.870 1.00 71.55  ? 119 GLU A CA  1 
ATOM 816  C C   . GLU A 1 119 ? 195.512 -9.571  31.757 1.00 77.68  ? 119 GLU A C   1 
ATOM 817  O O   . GLU A 1 119 ? 195.992 -8.570  32.290 1.00 72.26  ? 119 GLU A O   1 
ATOM 818  C CB  . GLU A 1 119 ? 197.106 -11.512 31.712 1.00 75.71  ? 119 GLU A CB  1 
ATOM 819  C CG  . GLU A 1 119 ? 196.216 -12.538 32.391 1.00 88.55  ? 119 GLU A CG  1 
ATOM 820  C CD  . GLU A 1 119 ? 197.003 -13.722 32.921 1.00 88.46  ? 119 GLU A CD  1 
ATOM 821  O OE1 . GLU A 1 119 ? 197.438 -14.561 32.104 1.00 98.02  ? 119 GLU A OE1 1 
ATOM 822  O OE2 . GLU A 1 119 ? 197.190 -13.815 34.152 1.00 75.69  ? 119 GLU A OE2 1 
ATOM 823  N N   . VAL A 1 120 ? 194.240 -9.921  31.910 1.00 80.20  ? 120 VAL A N   1 
ATOM 824  C CA  . VAL A 1 120 ? 193.358 -9.140  32.766 1.00 77.33  ? 120 VAL A CA  1 
ATOM 825  C C   . VAL A 1 120 ? 192.305 -10.002 33.454 1.00 74.96  ? 120 VAL A C   1 
ATOM 826  O O   . VAL A 1 120 ? 191.686 -10.871 32.840 1.00 77.22  ? 120 VAL A O   1 
ATOM 827  C CB  . VAL A 1 120 ? 192.655 -8.004  31.972 1.00 81.59  ? 120 VAL A CB  1 
ATOM 828  C CG1 . VAL A 1 120 ? 191.852 -8.562  30.805 1.00 81.53  ? 120 VAL A CG1 1 
ATOM 829  C CG2 . VAL A 1 120 ? 191.764 -7.179  32.890 1.00 82.98  ? 120 VAL A CG2 1 
ATOM 830  N N   . PHE A 1 121 ? 192.139 -9.771  34.750 1.00 75.22  ? 121 PHE A N   1 
ATOM 831  C CA  . PHE A 1 121 ? 191.007 -10.305 35.488 1.00 77.64  ? 121 PHE A CA  1 
ATOM 832  C C   . PHE A 1 121 ? 190.117 -9.139  35.890 1.00 86.93  ? 121 PHE A C   1 
ATOM 833  O O   . PHE A 1 121 ? 190.522 -8.282  36.676 1.00 85.90  ? 121 PHE A O   1 
ATOM 834  C CB  . PHE A 1 121 ? 191.465 -11.090 36.715 1.00 70.88  ? 121 PHE A CB  1 
ATOM 835  C CG  . PHE A 1 121 ? 192.315 -12.285 36.389 1.00 78.51  ? 121 PHE A CG  1 
ATOM 836  C CD1 . PHE A 1 121 ? 193.687 -12.159 36.240 1.00 84.60  ? 121 PHE A CD1 1 
ATOM 837  C CD2 . PHE A 1 121 ? 191.741 -13.536 36.237 1.00 70.37  ? 121 PHE A CD2 1 
ATOM 838  C CE1 . PHE A 1 121 ? 194.469 -13.260 35.944 1.00 73.93  ? 121 PHE A CE1 1 
ATOM 839  C CE2 . PHE A 1 121 ? 192.517 -14.639 35.939 1.00 66.86  ? 121 PHE A CE2 1 
ATOM 840  C CZ  . PHE A 1 121 ? 193.883 -14.501 35.793 1.00 76.58  ? 121 PHE A CZ  1 
ATOM 841  N N   . ALA A 1 122 ? 188.911 -9.096  35.335 1.00 78.69  ? 122 ALA A N   1 
ATOM 842  C CA  . ALA A 1 122 ? 188.020 -7.965  35.553 1.00 72.06  ? 122 ALA A CA  1 
ATOM 843  C C   . ALA A 1 122 ? 186.838 -8.337  36.435 1.00 79.79  ? 122 ALA A C   1 
ATOM 844  O O   . ALA A 1 122 ? 186.271 -9.422  36.312 1.00 87.73  ? 122 ALA A O   1 
ATOM 845  C CB  . ALA A 1 122 ? 187.531 -7.419  34.222 1.00 75.94  ? 122 ALA A CB  1 
ATOM 846  N N   . PHE A 1 123 ? 186.473 -7.421  37.326 1.00 80.07  ? 123 PHE A N   1 
ATOM 847  C CA  . PHE A 1 123 ? 185.316 -7.596  38.192 1.00 75.78  ? 123 PHE A CA  1 
ATOM 848  C C   . PHE A 1 123 ? 184.318 -6.465  37.958 1.00 80.72  ? 123 PHE A C   1 
ATOM 849  O O   . PHE A 1 123 ? 184.590 -5.315  38.296 1.00 88.68  ? 123 PHE A O   1 
ATOM 850  C CB  . PHE A 1 123 ? 185.735 -7.631  39.665 1.00 77.38  ? 123 PHE A CB  1 
ATOM 851  C CG  . PHE A 1 123 ? 186.687 -8.744  40.008 1.00 81.47  ? 123 PHE A CG  1 
ATOM 852  C CD1 . PHE A 1 123 ? 188.042 -8.634  39.731 1.00 93.23  ? 123 PHE A CD1 1 
ATOM 853  C CD2 . PHE A 1 123 ? 186.228 -9.896  40.623 1.00 93.68  ? 123 PHE A CD2 1 
ATOM 854  C CE1 . PHE A 1 123 ? 188.916 -9.657  40.052 1.00 94.46  ? 123 PHE A CE1 1 
ATOM 855  C CE2 . PHE A 1 123 ? 187.096 -10.921 40.947 1.00 90.98  ? 123 PHE A CE2 1 
ATOM 856  C CZ  . PHE A 1 123 ? 188.442 -10.801 40.661 1.00 81.58  ? 123 PHE A CZ  1 
ATOM 857  N N   . ARG A 1 124 ? 183.167 -6.790  37.378 1.00 77.95  ? 124 ARG A N   1 
ATOM 858  C CA  . ARG A 1 124 ? 182.165 -5.773  37.072 1.00 79.67  ? 124 ARG A CA  1 
ATOM 859  C C   . ARG A 1 124 ? 180.978 -5.848  38.030 1.00 84.06  ? 124 ARG A C   1 
ATOM 860  O O   . ARG A 1 124 ? 180.486 -6.931  38.345 1.00 88.26  ? 124 ARG A O   1 
ATOM 861  C CB  . ARG A 1 124 ? 181.703 -5.906  35.618 1.00 79.90  ? 124 ARG A CB  1 
ATOM 862  C CG  . ARG A 1 124 ? 182.788 -5.535  34.614 1.00 81.57  ? 124 ARG A CG  1 
ATOM 863  C CD  . ARG A 1 124 ? 182.254 -5.432  33.192 1.00 92.33  ? 124 ARG A CD  1 
ATOM 864  N NE  . ARG A 1 124 ? 181.273 -4.361  33.035 1.00 92.58  ? 124 ARG A NE  1 
ATOM 865  C CZ  . ARG A 1 124 ? 181.569 -3.064  33.001 1.00 108.31 ? 124 ARG A CZ  1 
ATOM 866  N NH1 . ARG A 1 124 ? 182.826 -2.660  33.121 1.00 124.31 ? 124 ARG A NH1 1 
ATOM 867  N NH2 . ARG A 1 124 ? 180.604 -2.168  32.850 1.00 104.28 ? 124 ARG A NH2 1 
ATOM 868  N N   . PHE A 1 125 ? 180.528 -4.681  38.486 1.00 94.14  ? 125 PHE A N   1 
ATOM 869  C CA  . PHE A 1 125 ? 179.521 -4.581  39.541 1.00 85.46  ? 125 PHE A CA  1 
ATOM 870  C C   . PHE A 1 125 ? 178.141 -4.172  39.030 1.00 87.77  ? 125 PHE A C   1 
ATOM 871  O O   . PHE A 1 125 ? 178.018 -3.502  38.005 1.00 96.80  ? 125 PHE A O   1 
ATOM 872  C CB  . PHE A 1 125 ? 179.969 -3.572  40.604 1.00 76.02  ? 125 PHE A CB  1 
ATOM 873  C CG  . PHE A 1 125 ? 181.082 -4.061  41.488 1.00 82.23  ? 125 PHE A CG  1 
ATOM 874  C CD1 . PHE A 1 125 ? 182.361 -4.250  40.988 1.00 90.58  ? 125 PHE A CD1 1 
ATOM 875  C CD2 . PHE A 1 125 ? 180.852 -4.307  42.831 1.00 78.31  ? 125 PHE A CD2 1 
ATOM 876  C CE1 . PHE A 1 125 ? 183.382 -4.692  41.808 1.00 85.67  ? 125 PHE A CE1 1 
ATOM 877  C CE2 . PHE A 1 125 ? 181.868 -4.747  43.656 1.00 84.49  ? 125 PHE A CE2 1 
ATOM 878  C CZ  . PHE A 1 125 ? 183.135 -4.940  43.144 1.00 77.35  ? 125 PHE A CZ  1 
ATOM 879  N N   . ALA A 1 126 ? 177.108 -4.573  39.767 1.00 83.18  ? 126 ALA A N   1 
ATOM 880  C CA  . ALA A 1 126 ? 175.744 -4.116  39.522 1.00 79.24  ? 126 ALA A CA  1 
ATOM 881  C C   . ALA A 1 126 ? 175.017 -3.939  40.852 1.00 86.19  ? 126 ALA A C   1 
ATOM 882  O O   . ALA A 1 126 ? 174.914 -4.880  41.639 1.00 91.85  ? 126 ALA A O   1 
ATOM 883  C CB  . ALA A 1 126 ? 174.997 -5.091  38.627 1.00 75.76  ? 126 ALA A CB  1 
ATOM 884  N N   . TYR A 1 127 ? 174.521 -2.730  41.099 1.00 92.87  ? 127 TYR A N   1 
ATOM 885  C CA  . TYR A 1 127 ? 173.884 -2.394  42.371 1.00 93.94  ? 127 TYR A CA  1 
ATOM 886  C C   . TYR A 1 127 ? 172.365 -2.425  42.280 1.00 101.19 ? 127 TYR A C   1 
ATOM 887  O O   . TYR A 1 127 ? 171.797 -1.874  41.346 1.00 91.97  ? 127 TYR A O   1 
ATOM 888  C CB  . TYR A 1 127 ? 174.317 -1.002  42.840 1.00 84.21  ? 127 TYR A CB  1 
ATOM 889  C CG  . TYR A 1 127 ? 175.806 -0.809  42.994 1.00 82.91  ? 127 TYR A CG  1 
ATOM 890  C CD1 . TYR A 1 127 ? 176.612 -0.565  41.889 1.00 78.14  ? 127 TYR A CD1 1 
ATOM 891  C CD2 . TYR A 1 127 ? 176.404 -0.844  44.246 1.00 82.02  ? 127 TYR A CD2 1 
ATOM 892  C CE1 . TYR A 1 127 ? 177.972 -0.379  42.025 1.00 86.69  ? 127 TYR A CE1 1 
ATOM 893  C CE2 . TYR A 1 127 ? 177.766 -0.657  44.393 1.00 86.67  ? 127 TYR A CE2 1 
ATOM 894  C CZ  . TYR A 1 127 ? 178.544 -0.425  43.278 1.00 87.67  ? 127 TYR A CZ  1 
ATOM 895  O OH  . TYR A 1 127 ? 179.901 -0.239  43.415 1.00 89.31  ? 127 TYR A OH  1 
ATOM 896  N N   . GLY A 1 128 ? 171.723 -3.054  43.264 1.00 104.79 ? 128 GLY A N   1 
ATOM 897  C CA  . GLY A 1 128 ? 170.274 -3.034  43.412 1.00 101.90 ? 128 GLY A CA  1 
ATOM 898  C C   . GLY A 1 128 ? 169.468 -3.008  42.128 1.00 133.52 ? 128 GLY A C   1 
ATOM 899  O O   . GLY A 1 128 ? 168.730 -2.057  41.872 1.00 148.25 ? 128 GLY A O   1 
ATOM 900  N N   . ASP A 1 129 ? 169.633 -4.054  41.324 1.00 141.31 ? 129 ASP A N   1 
ATOM 901  C CA  . ASP A 1 129 ? 168.977 -4.206  40.022 1.00 158.76 ? 129 ASP A CA  1 
ATOM 902  C C   . ASP A 1 129 ? 168.899 -2.946  39.158 1.00 160.86 ? 129 ASP A C   1 
ATOM 903  O O   . ASP A 1 129 ? 167.829 -2.626  38.634 1.00 140.50 ? 129 ASP A O   1 
ATOM 904  C CB  . ASP A 1 129 ? 167.559 -4.783  40.204 1.00 161.55 ? 129 ASP A CB  1 
ATOM 905  C CG  . ASP A 1 129 ? 166.667 -3.927  41.102 1.00 162.95 ? 129 ASP A CG  1 
ATOM 906  O OD1 . ASP A 1 129 ? 166.284 -2.807  40.702 1.00 156.98 ? 129 ASP A OD1 1 
ATOM 907  O OD2 . ASP A 1 129 ? 166.344 -4.381  42.218 1.00 171.96 ? 129 ASP A OD2 1 
ATOM 908  N N   . GLU A 1 130 ? 170.020 -2.243  38.987 1.00 164.32 ? 130 GLU A N   1 
ATOM 909  C CA  . GLU A 1 130 ? 170.068 -1.207  37.955 1.00 151.07 ? 130 GLU A CA  1 
ATOM 910  C C   . GLU A 1 130 ? 169.587 -1.823  36.649 1.00 151.02 ? 130 GLU A C   1 
ATOM 911  O O   . GLU A 1 130 ? 169.958 -2.955  36.315 1.00 151.80 ? 130 GLU A O   1 
ATOM 912  C CB  . GLU A 1 130 ? 171.471 -0.633  37.742 1.00 143.76 ? 130 GLU A CB  1 
ATOM 913  C CG  . GLU A 1 130 ? 172.193 -0.132  38.963 1.00 141.30 ? 130 GLU A CG  1 
ATOM 914  C CD  . GLU A 1 130 ? 173.694 -0.252  38.794 1.00 134.31 ? 130 GLU A CD  1 
ATOM 915  O OE1 . GLU A 1 130 ? 174.302 -1.138  39.430 1.00 114.86 ? 130 GLU A OE1 1 
ATOM 916  O OE2 . GLU A 1 130 ? 174.267 0.528   38.006 1.00 133.30 ? 130 GLU A OE2 1 
ATOM 917  N N   . GLY A 1 131 ? 168.746 -1.079  35.939 1.00 158.14 ? 131 GLY A N   1 
ATOM 918  C CA  . GLY A 1 131 ? 168.239 -1.506  34.657 1.00 172.12 ? 131 GLY A CA  1 
ATOM 919  C C   . GLY A 1 131 ? 169.358 -2.009  33.767 1.00 172.39 ? 131 GLY A C   1 
ATOM 920  O O   . GLY A 1 131 ? 169.547 -3.213  33.630 1.00 170.37 ? 131 GLY A O   1 
ATOM 921  N N   . GLU A 1 132 ? 170.112 -1.115  33.146 1.00 169.61 ? 132 GLU A N   1 
ATOM 922  C CA  . GLU A 1 132 ? 171.152 -1.595  32.247 1.00 161.72 ? 132 GLU A CA  1 
ATOM 923  C C   . GLU A 1 132 ? 172.399 -0.709  32.232 1.00 158.79 ? 132 GLU A C   1 
ATOM 924  O O   . GLU A 1 132 ? 172.362 0.458   32.632 1.00 163.87 ? 132 GLU A O   1 
ATOM 925  C CB  . GLU A 1 132 ? 170.619 -1.719  30.813 1.00 164.33 ? 132 GLU A CB  1 
ATOM 926  C CG  . GLU A 1 132 ? 169.695 -0.578  30.377 1.00 171.26 ? 132 GLU A CG  1 
ATOM 927  C CD  . GLU A 1 132 ? 168.179 -0.794  30.632 1.00 202.53 ? 132 GLU A CD  1 
ATOM 928  O OE1 . GLU A 1 132 ? 167.787 -1.760  31.314 1.00 199.81 ? 132 GLU A OE1 1 
ATOM 929  O OE2 . GLU A 1 132 ? 167.388 0.023   30.097 1.00 201.13 ? 132 GLU A OE2 1 
ATOM 930  N N   . ILE A 1 133 ? 173.493 -1.278  31.728 1.00 148.62 ? 133 ILE A N   1 
ATOM 931  C CA  . ILE A 1 133 ? 174.806 -0.637  31.735 1.00 142.29 ? 133 ILE A CA  1 
ATOM 932  C C   . ILE A 1 133 ? 175.333 -0.422  30.316 1.00 151.40 ? 133 ILE A C   1 
ATOM 933  O O   . ILE A 1 133 ? 175.343 -1.348  29.506 1.00 151.48 ? 133 ILE A O   1 
ATOM 934  C CB  . ILE A 1 133 ? 175.820 -1.490  32.536 1.00 127.04 ? 133 ILE A CB  1 
ATOM 935  C CG1 . ILE A 1 133 ? 175.257 -1.791  33.927 1.00 110.56 ? 133 ILE A CG1 1 
ATOM 936  C CG2 . ILE A 1 133 ? 177.193 -0.797  32.626 1.00 116.74 ? 133 ILE A CG2 1 
ATOM 937  C CD1 . ILE A 1 133 ? 175.991 -2.875  34.670 1.00 111.84 ? 133 ILE A CD1 1 
ATOM 938  N N   . PHE A 1 134 ? 175.772 0.797   30.017 1.00 157.34 ? 134 PHE A N   1 
ATOM 939  C CA  . PHE A 1 134 ? 176.290 1.108   28.689 1.00 164.66 ? 134 PHE A CA  1 
ATOM 940  C C   . PHE A 1 134 ? 177.571 0.331   28.414 1.00 164.32 ? 134 PHE A C   1 
ATOM 941  O O   . PHE A 1 134 ? 178.603 0.572   29.037 1.00 165.63 ? 134 PHE A O   1 
ATOM 942  C CB  . PHE A 1 134 ? 176.538 2.613   28.540 1.00 161.62 ? 134 PHE A CB  1 
ATOM 943  C CG  . PHE A 1 134 ? 177.177 3.003   27.232 1.00 166.37 ? 134 PHE A CG  1 
ATOM 944  C CD1 . PHE A 1 134 ? 176.477 2.900   26.040 1.00 173.37 ? 134 PHE A CD1 1 
ATOM 945  C CD2 . PHE A 1 134 ? 178.474 3.489   27.200 1.00 168.14 ? 134 PHE A CD2 1 
ATOM 946  C CE1 . PHE A 1 134 ? 177.063 3.265   24.841 1.00 179.07 ? 134 PHE A CE1 1 
ATOM 947  C CE2 . PHE A 1 134 ? 179.065 3.856   26.005 1.00 175.63 ? 134 PHE A CE2 1 
ATOM 948  C CZ  . PHE A 1 134 ? 178.359 3.744   24.824 1.00 180.29 ? 134 PHE A CZ  1 
ATOM 949  N N   . VAL A 1 135 ? 177.492 -0.619  27.492 1.00 158.87 ? 135 VAL A N   1 
ATOM 950  C CA  . VAL A 1 135 ? 178.680 -1.316  27.033 1.00 149.56 ? 135 VAL A CA  1 
ATOM 951  C C   . VAL A 1 135 ? 179.589 -0.311  26.326 1.00 153.42 ? 135 VAL A C   1 
ATOM 952  O O   . VAL A 1 135 ? 179.429 -0.061  25.134 1.00 159.34 ? 135 VAL A O   1 
ATOM 953  C CB  . VAL A 1 135 ? 178.326 -2.481  26.072 1.00 139.37 ? 135 VAL A CB  1 
ATOM 954  C CG1 . VAL A 1 135 ? 179.545 -3.340  25.783 1.00 135.54 ? 135 VAL A CG1 1 
ATOM 955  C CG2 . VAL A 1 135 ? 177.201 -3.334  26.649 1.00 151.87 ? 135 VAL A CG2 1 
ATOM 956  N N   . SER A 1 136 ? 180.521 0.289   27.061 1.00 156.94 ? 136 SER A N   1 
ATOM 957  C CA  . SER A 1 136 ? 181.509 1.175   26.447 1.00 162.03 ? 136 SER A CA  1 
ATOM 958  C C   . SER A 1 136 ? 182.392 0.347   25.501 1.00 154.12 ? 136 SER A C   1 
ATOM 959  O O   . SER A 1 136 ? 182.712 -0.809  25.803 1.00 137.69 ? 136 SER A O   1 
ATOM 960  C CB  . SER A 1 136 ? 182.333 1.888   27.529 1.00 162.39 ? 136 SER A CB  1 
ATOM 961  O OG  . SER A 1 136 ? 183.349 2.692   26.966 1.00 168.31 ? 136 SER A OG  1 
ATOM 962  N N   . LEU A 1 137 ? 182.775 0.918   24.356 1.00 167.88 ? 137 LEU A N   1 
ATOM 963  C CA  . LEU A 1 137 ? 183.363 0.080   23.304 1.00 165.84 ? 137 LEU A CA  1 
ATOM 964  C C   . LEU A 1 137 ? 184.791 0.406   22.859 1.00 161.24 ? 137 LEU A C   1 
ATOM 965  O O   . LEU A 1 137 ? 185.403 -0.407  22.176 1.00 163.54 ? 137 LEU A O   1 
ATOM 966  C CB  . LEU A 1 137 ? 182.422 0.052   22.075 1.00 166.50 ? 137 LEU A CB  1 
ATOM 967  C CG  . LEU A 1 137 ? 181.822 1.286   21.378 1.00 160.97 ? 137 LEU A CG  1 
ATOM 968  C CD1 . LEU A 1 137 ? 182.402 1.628   20.001 1.00 165.97 ? 137 LEU A CD1 1 
ATOM 969  C CD2 . LEU A 1 137 ? 180.333 1.039   21.247 1.00 159.29 ? 137 LEU A CD2 1 
ATOM 970  N N   . ASN A 1 138 ? 185.370 1.527   23.272 1.00 153.23 ? 138 ASN A N   1 
ATOM 971  C CA  . ASN A 1 138 ? 186.800 1.713   22.965 1.00 142.78 ? 138 ASN A CA  1 
ATOM 972  C C   . ASN A 1 138 ? 187.768 1.148   24.032 1.00 137.53 ? 138 ASN A C   1 
ATOM 973  O O   . ASN A 1 138 ? 188.968 0.999   23.773 1.00 135.50 ? 138 ASN A O   1 
ATOM 974  C CB  . ASN A 1 138 ? 187.111 3.185   22.721 1.00 152.79 ? 138 ASN A CB  1 
ATOM 975  C CG  . ASN A 1 138 ? 186.879 3.611   21.275 1.00 175.12 ? 138 ASN A CG  1 
ATOM 976  O OD1 . ASN A 1 138 ? 186.136 2.978   20.527 1.00 185.49 ? 138 ASN A OD1 1 
ATOM 977  N ND2 . ASN A 1 138 ? 187.565 4.677   20.867 1.00 177.24 ? 138 ASN A ND2 1 
ATOM 978  N N   . ASN A 1 139 ? 187.263 0.838   25.226 1.00 130.03 ? 139 ASN A N   1 
ATOM 979  C CA  . ASN A 1 139 ? 188.107 0.142   26.198 1.00 123.68 ? 139 ASN A CA  1 
ATOM 980  C C   . ASN A 1 139 ? 187.389 -0.924  27.023 1.00 113.49 ? 139 ASN A C   1 
ATOM 981  O O   . ASN A 1 139 ? 186.203 -1.205  26.824 1.00 114.34 ? 139 ASN A O   1 
ATOM 982  C CB  . ASN A 1 139 ? 188.800 1.147   27.138 1.00 123.22 ? 139 ASN A CB  1 
ATOM 983  C CG  . ASN A 1 139 ? 187.829 1.922   28.028 1.00 120.90 ? 139 ASN A CG  1 
ATOM 984  O OD1 . ASN A 1 139 ? 186.744 1.451   28.375 1.00 124.50 ? 139 ASN A OD1 1 
ATOM 985  N ND2 . ASN A 1 139 ? 188.243 3.118   28.424 1.00 121.01 ? 139 ASN A ND2 1 
ATOM 986  N N   . GLY A 1 140 ? 188.143 -1.518  27.942 1.00 97.98  ? 140 GLY A N   1 
ATOM 987  C CA  . GLY A 1 140 ? 187.632 -2.524  28.851 1.00 89.00  ? 140 GLY A CA  1 
ATOM 988  C C   . GLY A 1 140 ? 187.493 -3.903  28.237 1.00 93.32  ? 140 GLY A C   1 
ATOM 989  O O   . GLY A 1 140 ? 187.855 -4.127  27.081 1.00 105.30 ? 140 GLY A O   1 
ATOM 990  N N   . ILE A 1 141 ? 186.962 -4.830  29.026 1.00 91.58  ? 141 ILE A N   1 
ATOM 991  C CA  . ILE A 1 141 ? 186.730 -6.198  28.579 1.00 92.38  ? 141 ILE A CA  1 
ATOM 992  C C   . ILE A 1 141 ? 185.239 -6.412  28.333 1.00 104.62 ? 141 ILE A C   1 
ATOM 993  O O   . ILE A 1 141 ? 184.821 -7.439  27.796 1.00 107.74 ? 141 ILE A O   1 
ATOM 994  C CB  . ILE A 1 141 ? 187.241 -7.222  29.617 1.00 84.00  ? 141 ILE A CB  1 
ATOM 995  C CG1 . ILE A 1 141 ? 187.470 -8.593  28.976 1.00 76.78  ? 141 ILE A CG1 1 
ATOM 996  C CG2 . ILE A 1 141 ? 186.278 -7.314  30.795 1.00 75.54  ? 141 ILE A CG2 1 
ATOM 997  C CD1 . ILE A 1 141 ? 187.898 -9.660  29.962 1.00 78.75  ? 141 ILE A CD1 1 
ATOM 998  N N   . ASP A 1 142 ? 184.446 -5.419  28.724 1.00 107.31 ? 142 ASP A N   1 
ATOM 999  C CA  . ASP A 1 142 ? 182.991 -5.499  28.667 1.00 121.46 ? 142 ASP A CA  1 
ATOM 1000 C C   . ASP A 1 142 ? 182.461 -5.697  27.249 1.00 117.34 ? 142 ASP A C   1 
ATOM 1001 O O   . ASP A 1 142 ? 182.838 -4.975  26.326 1.00 119.03 ? 142 ASP A O   1 
ATOM 1002 C CB  . ASP A 1 142 ? 182.379 -4.234  29.275 1.00 140.00 ? 142 ASP A CB  1 
ATOM 1003 C CG  . ASP A 1 142 ? 180.883 -4.351  29.485 1.00 146.59 ? 142 ASP A CG  1 
ATOM 1004 O OD1 . ASP A 1 142 ? 180.383 -5.489  29.602 1.00 139.09 ? 142 ASP A OD1 1 
ATOM 1005 O OD2 . ASP A 1 142 ? 180.208 -3.301  29.537 1.00 151.46 ? 142 ASP A OD2 1 
ATOM 1006 N N   . THR A 1 143 ? 181.588 -6.687  27.087 1.00 112.88 ? 143 THR A N   1 
ATOM 1007 C CA  . THR A 1 143 ? 180.932 -6.944  25.809 1.00 111.53 ? 143 THR A CA  1 
ATOM 1008 C C   . THR A 1 143 ? 179.417 -6.924  25.987 1.00 127.88 ? 143 THR A C   1 
ATOM 1009 O O   . THR A 1 143 ? 178.920 -6.948  27.113 1.00 131.16 ? 143 THR A O   1 
ATOM 1010 C CB  . THR A 1 143 ? 181.353 -8.300  25.209 1.00 109.32 ? 143 THR A CB  1 
ATOM 1011 O OG1 . THR A 1 143 ? 180.657 -9.359  25.878 1.00 124.85 ? 143 THR A OG1 1 
ATOM 1012 C CG2 . THR A 1 143 ? 182.855 -8.510  25.346 1.00 119.01 ? 143 THR A CG2 1 
ATOM 1013 N N   . ASN A 1 144 ? 178.689 -6.880  24.874 1.00 134.69 ? 144 ASN A N   1 
ATOM 1014 C CA  . ASN A 1 144 ? 177.229 -6.872  24.910 1.00 135.48 ? 144 ASN A CA  1 
ATOM 1015 C C   . ASN A 1 144 ? 176.642 -8.096  25.607 1.00 136.67 ? 144 ASN A C   1 
ATOM 1016 O O   . ASN A 1 144 ? 175.730 -7.977  26.424 1.00 135.27 ? 144 ASN A O   1 
ATOM 1017 C CB  . ASN A 1 144 ? 176.661 -6.773  23.492 1.00 138.09 ? 144 ASN A CB  1 
ATOM 1018 C CG  . ASN A 1 144 ? 176.272 -5.356  23.114 1.00 147.11 ? 144 ASN A CG  1 
ATOM 1019 O OD1 . ASN A 1 144 ? 176.868 -4.386  23.584 1.00 149.01 ? 144 ASN A OD1 1 
ATOM 1020 N ND2 . ASN A 1 144 ? 175.259 -5.229  22.265 1.00 152.44 ? 144 ASN A ND2 1 
ATOM 1021 N N   . GLU A 1 145 ? 177.171 -9.271  25.281 1.00 137.28 ? 145 GLU A N   1 
ATOM 1022 C CA  . GLU A 1 145 ? 176.666 -10.516 25.850 1.00 126.86 ? 145 GLU A CA  1 
ATOM 1023 C C   . GLU A 1 145 ? 176.989 -10.625 27.334 1.00 119.64 ? 145 GLU A C   1 
ATOM 1024 O O   . GLU A 1 145 ? 176.223 -11.210 28.100 1.00 113.38 ? 145 GLU A O   1 
ATOM 1025 C CB  . GLU A 1 145 ? 177.234 -11.729 25.109 1.00 132.01 ? 145 GLU A CB  1 
ATOM 1026 C CG  . GLU A 1 145 ? 177.614 -11.479 23.655 1.00 159.97 ? 145 GLU A CG  1 
ATOM 1027 C CD  . GLU A 1 145 ? 179.030 -10.953 23.487 1.00 176.65 ? 145 GLU A CD  1 
ATOM 1028 O OE1 . GLU A 1 145 ? 179.961 -11.532 24.087 1.00 181.18 ? 145 GLU A OE1 1 
ATOM 1029 O OE2 . GLU A 1 145 ? 179.209 -9.961  22.749 1.00 180.73 ? 145 GLU A OE2 1 
ATOM 1030 N N   . SER A 1 146 ? 178.123 -10.060 27.736 1.00 117.43 ? 146 SER A N   1 
ATOM 1031 C CA  . SER A 1 146 ? 178.538 -10.095 29.132 1.00 108.84 ? 146 SER A CA  1 
ATOM 1032 C C   . SER A 1 146 ? 177.534 -9.363  30.018 1.00 110.12 ? 146 SER A C   1 
ATOM 1033 O O   . SER A 1 146 ? 177.051 -9.909  31.011 1.00 115.52 ? 146 SER A O   1 
ATOM 1034 C CB  . SER A 1 146 ? 179.927 -9.477  29.296 1.00 105.78 ? 146 SER A CB  1 
ATOM 1035 O OG  . SER A 1 146 ? 179.846 -8.066  29.400 1.00 123.33 ? 146 SER A OG  1 
ATOM 1036 N N   . SER A 1 147 ? 177.218 -8.127  29.643 1.00 105.14 ? 147 SER A N   1 
ATOM 1037 C CA  . SER A 1 147 ? 176.326 -7.286  30.435 1.00 107.53 ? 147 SER A CA  1 
ATOM 1038 C C   . SER A 1 147 ? 174.885 -7.791  30.415 1.00 110.62 ? 147 SER A C   1 
ATOM 1039 O O   . SER A 1 147 ? 174.096 -7.460  31.299 1.00 105.62 ? 147 SER A O   1 
ATOM 1040 C CB  . SER A 1 147 ? 176.382 -5.838  29.941 1.00 107.37 ? 147 SER A CB  1 
ATOM 1041 O OG  . SER A 1 147 ? 176.075 -5.758  28.562 1.00 111.65 ? 147 SER A OG  1 
ATOM 1042 N N   . GLN A 1 148 ? 174.542 -8.585  29.405 1.00 115.99 ? 148 GLN A N   1 
ATOM 1043 C CA  . GLN A 1 148 ? 173.244 -9.251  29.381 1.00 109.72 ? 148 GLN A CA  1 
ATOM 1044 C C   . GLN A 1 148 ? 173.160 -10.243 30.533 1.00 113.28 ? 148 GLN A C   1 
ATOM 1045 O O   . GLN A 1 148 ? 172.228 -10.202 31.337 1.00 131.46 ? 148 GLN A O   1 
ATOM 1046 C CB  . GLN A 1 148 ? 173.013 -9.965  28.047 1.00 111.35 ? 148 GLN A CB  1 
ATOM 1047 C CG  . GLN A 1 148 ? 172.303 -9.122  26.999 1.00 128.94 ? 148 GLN A CG  1 
ATOM 1048 C CD  . GLN A 1 148 ? 170.964 -8.595  27.482 1.00 143.60 ? 148 GLN A CD  1 
ATOM 1049 O OE1 . GLN A 1 148 ? 170.721 -7.389  27.478 1.00 137.47 ? 148 GLN A OE1 1 
ATOM 1050 N NE2 . GLN A 1 148 ? 170.087 -9.500  27.901 1.00 152.03 ? 148 GLN A NE2 1 
ATOM 1051 N N   . GLU A 1 149 ? 174.153 -11.126 30.604 1.00 95.92  ? 149 GLU A N   1 
ATOM 1052 C CA  . GLU A 1 149 ? 174.251 -12.127 31.660 1.00 96.60  ? 149 GLU A CA  1 
ATOM 1053 C C   . GLU A 1 149 ? 174.238 -11.485 33.042 1.00 103.74 ? 149 GLU A C   1 
ATOM 1054 O O   . GLU A 1 149 ? 173.618 -12.004 33.970 1.00 115.54 ? 149 GLU A O   1 
ATOM 1055 C CB  . GLU A 1 149 ? 175.524 -12.957 31.487 1.00 90.85  ? 149 GLU A CB  1 
ATOM 1056 C CG  . GLU A 1 149 ? 175.685 -13.571 30.108 1.00 101.67 ? 149 GLU A CG  1 
ATOM 1057 C CD  . GLU A 1 149 ? 177.054 -14.187 29.905 1.00 118.86 ? 149 GLU A CD  1 
ATOM 1058 O OE1 . GLU A 1 149 ? 177.899 -14.071 30.818 1.00 124.00 ? 149 GLU A OE1 1 
ATOM 1059 O OE2 . GLU A 1 149 ? 177.288 -14.780 28.831 1.00 118.30 ? 149 GLU A OE2 1 
ATOM 1060 N N   . LEU A 1 150 ? 174.929 -10.356 33.169 1.00 93.50  ? 150 LEU A N   1 
ATOM 1061 C CA  . LEU A 1 150 ? 174.968 -9.616  34.425 1.00 93.30  ? 150 LEU A CA  1 
ATOM 1062 C C   . LEU A 1 150 ? 173.582 -9.106  34.791 1.00 97.91  ? 150 LEU A C   1 
ATOM 1063 O O   . LEU A 1 150 ? 173.162 -9.192  35.943 1.00 106.26 ? 150 LEU A O   1 
ATOM 1064 C CB  . LEU A 1 150 ? 175.952 -8.448  34.334 1.00 89.20  ? 150 LEU A CB  1 
ATOM 1065 C CG  . LEU A 1 150 ? 176.076 -7.564  35.578 1.00 83.51  ? 150 LEU A CG  1 
ATOM 1066 C CD1 . LEU A 1 150 ? 176.274 -8.405  36.832 1.00 85.68  ? 150 LEU A CD1 1 
ATOM 1067 C CD2 . LEU A 1 150 ? 177.212 -6.568  35.418 1.00 68.95  ? 150 LEU A CD2 1 
ATOM 1068 N N   . LEU A 1 151 ? 172.876 -8.576  33.799 1.00 97.69  ? 151 LEU A N   1 
ATOM 1069 C CA  . LEU A 1 151 ? 171.524 -8.076  34.002 1.00 97.34  ? 151 LEU A CA  1 
ATOM 1070 C C   . LEU A 1 151 ? 170.562 -9.192  34.407 1.00 99.97  ? 151 LEU A C   1 
ATOM 1071 O O   . LEU A 1 151 ? 169.755 -9.027  35.324 1.00 103.96 ? 151 LEU A O   1 
ATOM 1072 C CB  . LEU A 1 151 ? 171.026 -7.379  32.732 1.00 103.86 ? 151 LEU A CB  1 
ATOM 1073 C CG  . LEU A 1 151 ? 169.576 -6.890  32.731 1.00 114.37 ? 151 LEU A CG  1 
ATOM 1074 C CD1 . LEU A 1 151 ? 169.231 -6.204  34.042 1.00 118.16 ? 151 LEU A CD1 1 
ATOM 1075 C CD2 . LEU A 1 151 ? 169.330 -5.948  31.563 1.00 105.73 ? 151 LEU A CD2 1 
ATOM 1076 N N   . GLN A 1 152 ? 170.659 -10.327 33.726 1.00 101.94 ? 152 GLN A N   1 
ATOM 1077 C CA  . GLN A 1 152 ? 169.730 -11.432 33.936 1.00 113.05 ? 152 GLN A CA  1 
ATOM 1078 C C   . GLN A 1 152 ? 170.005 -12.199 35.224 1.00 111.13 ? 152 GLN A C   1 
ATOM 1079 O O   . GLN A 1 152 ? 169.086 -12.753 35.828 1.00 118.69 ? 152 GLN A O   1 
ATOM 1080 C CB  . GLN A 1 152 ? 169.778 -12.388 32.747 1.00 125.59 ? 152 GLN A CB  1 
ATOM 1081 C CG  . GLN A 1 152 ? 169.440 -11.735 31.422 1.00 138.27 ? 152 GLN A CG  1 
ATOM 1082 C CD  . GLN A 1 152 ? 169.715 -12.646 30.247 1.00 147.21 ? 152 GLN A CD  1 
ATOM 1083 O OE1 . GLN A 1 152 ? 170.152 -13.784 30.420 1.00 153.47 ? 152 GLN A OE1 1 
ATOM 1084 N NE2 . GLN A 1 152 ? 169.462 -12.152 29.042 1.00 146.33 ? 152 GLN A NE2 1 
ATOM 1085 N N   . ALA A 1 153 ? 171.271 -12.241 35.631 1.00 105.08 ? 153 ALA A N   1 
ATOM 1086 C CA  . ALA A 1 153 ? 171.654 -12.917 36.865 1.00 103.57 ? 153 ALA A CA  1 
ATOM 1087 C C   . ALA A 1 153 ? 170.885 -12.338 38.046 1.00 107.48 ? 153 ALA A C   1 
ATOM 1088 O O   . ALA A 1 153 ? 170.764 -11.121 38.183 1.00 110.59 ? 153 ALA A O   1 
ATOM 1089 C CB  . ALA A 1 153 ? 173.151 -12.802 37.095 1.00 87.69  ? 153 ALA A CB  1 
ATOM 1090 N N   . LYS A 1 154 ? 170.353 -13.213 38.889 1.00 98.51  ? 154 LYS A N   1 
ATOM 1091 C CA  . LYS A 1 154 ? 169.536 -12.773 40.011 1.00 95.10  ? 154 LYS A CA  1 
ATOM 1092 C C   . LYS A 1 154 ? 169.985 -13.388 41.324 1.00 87.19  ? 154 LYS A C   1 
ATOM 1093 O O   . LYS A 1 154 ? 170.384 -14.551 41.376 1.00 77.93  ? 154 LYS A O   1 
ATOM 1094 C CB  . LYS A 1 154 ? 168.064 -13.110 39.764 1.00 92.67  ? 154 LYS A CB  1 
ATOM 1095 C CG  . LYS A 1 154 ? 167.419 -12.300 38.657 1.00 102.33 ? 154 LYS A CG  1 
ATOM 1096 C CD  . LYS A 1 154 ? 167.374 -10.825 39.023 1.00 116.57 ? 154 LYS A CD  1 
ATOM 1097 C CE  . LYS A 1 154 ? 166.770 -9.994  37.904 1.00 118.94 ? 154 LYS A CE  1 
ATOM 1098 N NZ  . LYS A 1 154 ? 166.755 -8.543  38.236 1.00 124.90 ? 154 LYS A NZ  1 
ATOM 1099 N N   . PHE A 1 155 ? 169.921 -12.595 42.387 1.00 92.07  ? 155 PHE A N   1 
ATOM 1100 C CA  . PHE A 1 155 ? 170.129 -13.120 43.725 1.00 88.88  ? 155 PHE A CA  1 
ATOM 1101 C C   . PHE A 1 155 ? 168.948 -14.008 44.087 1.00 98.12  ? 155 PHE A C   1 
ATOM 1102 O O   . PHE A 1 155 ? 167.800 -13.675 43.796 1.00 110.49 ? 155 PHE A O   1 
ATOM 1103 C CB  . PHE A 1 155 ? 170.286 -11.991 44.743 1.00 93.26  ? 155 PHE A CB  1 
ATOM 1104 C CG  . PHE A 1 155 ? 170.419 -12.469 46.160 1.00 95.36  ? 155 PHE A CG  1 
ATOM 1105 C CD1 . PHE A 1 155 ? 171.549 -13.156 46.571 1.00 91.66  ? 155 PHE A CD1 1 
ATOM 1106 C CD2 . PHE A 1 155 ? 169.412 -12.235 47.081 1.00 75.56  ? 155 PHE A CD2 1 
ATOM 1107 C CE1 . PHE A 1 155 ? 171.674 -13.598 47.874 1.00 73.53  ? 155 PHE A CE1 1 
ATOM 1108 C CE2 . PHE A 1 155 ? 169.530 -12.675 48.386 1.00 85.33  ? 155 PHE A CE2 1 
ATOM 1109 C CZ  . PHE A 1 155 ? 170.663 -13.357 48.783 1.00 83.33  ? 155 PHE A CZ  1 
ATOM 1110 N N   . VAL A 1 156 ? 169.233 -15.144 44.711 1.00 101.02 ? 156 VAL A N   1 
ATOM 1111 C CA  . VAL A 1 156 ? 168.188 -16.084 45.093 1.00 97.31  ? 156 VAL A CA  1 
ATOM 1112 C C   . VAL A 1 156 ? 168.141 -16.212 46.611 1.00 98.84  ? 156 VAL A C   1 
ATOM 1113 O O   . VAL A 1 156 ? 167.153 -15.846 47.248 1.00 106.08 ? 156 VAL A O   1 
ATOM 1114 C CB  . VAL A 1 156 ? 168.417 -17.466 44.448 1.00 88.15  ? 156 VAL A CB  1 
ATOM 1115 C CG1 . VAL A 1 156 ? 167.494 -18.510 45.059 1.00 75.92  ? 156 VAL A CG1 1 
ATOM 1116 C CG2 . VAL A 1 156 ? 168.232 -17.381 42.937 1.00 83.38  ? 156 VAL A CG2 1 
ATOM 1117 N N   . ASP A 1 157 ? 169.223 -16.730 47.181 1.00 91.39  ? 157 ASP A N   1 
ATOM 1118 C CA  . ASP A 1 157 ? 169.406 -16.756 48.625 1.00 95.71  ? 157 ASP A CA  1 
ATOM 1119 C C   . ASP A 1 157 ? 170.893 -16.873 48.935 1.00 96.56  ? 157 ASP A C   1 
ATOM 1120 O O   . ASP A 1 157 ? 171.705 -17.075 48.032 1.00 102.71 ? 157 ASP A O   1 
ATOM 1121 C CB  . ASP A 1 157 ? 168.616 -17.903 49.264 1.00 93.66  ? 157 ASP A CB  1 
ATOM 1122 C CG  . ASP A 1 157 ? 169.024 -19.265 48.738 1.00 116.57 ? 157 ASP A CG  1 
ATOM 1123 O OD1 . ASP A 1 157 ? 170.098 -19.765 49.134 1.00 124.86 ? 157 ASP A OD1 1 
ATOM 1124 O OD2 . ASP A 1 157 ? 168.260 -19.844 47.937 1.00 115.33 ? 157 ASP A OD2 1 
ATOM 1125 N N   . THR A 1 158 ? 171.248 -16.738 50.209 1.00 82.37  ? 158 THR A N   1 
ATOM 1126 C CA  . THR A 1 158 ? 172.649 -16.754 50.613 1.00 84.39  ? 158 THR A CA  1 
ATOM 1127 C C   . THR A 1 158 ? 173.304 -18.101 50.319 1.00 83.67  ? 158 THR A C   1 
ATOM 1128 O O   . THR A 1 158 ? 174.404 -18.159 49.768 1.00 75.08  ? 158 THR A O   1 
ATOM 1129 C CB  . THR A 1 158 ? 172.804 -16.429 52.112 1.00 94.19  ? 158 THR A CB  1 
ATOM 1130 O OG1 . THR A 1 158 ? 172.408 -15.073 52.352 1.00 80.54  ? 158 THR A OG1 1 
ATOM 1131 C CG2 . THR A 1 158 ? 174.251 -16.607 52.551 1.00 80.63  ? 158 THR A CG2 1 
ATOM 1132 N N   . ASP A 1 159 ? 172.619 -19.183 50.674 1.00 81.50  ? 159 ASP A N   1 
ATOM 1133 C CA  . ASP A 1 159 ? 173.159 -20.522 50.463 1.00 75.75  ? 159 ASP A CA  1 
ATOM 1134 C C   . ASP A 1 159 ? 173.257 -20.884 48.981 1.00 83.05  ? 159 ASP A C   1 
ATOM 1135 O O   . ASP A 1 159 ? 174.097 -21.695 48.596 1.00 83.91  ? 159 ASP A O   1 
ATOM 1136 C CB  . ASP A 1 159 ? 172.322 -21.561 51.208 1.00 73.22  ? 159 ASP A CB  1 
ATOM 1137 C CG  . ASP A 1 159 ? 172.543 -21.515 52.709 1.00 87.00  ? 159 ASP A CG  1 
ATOM 1138 O OD1 . ASP A 1 159 ? 173.195 -20.563 53.188 1.00 89.71  ? 159 ASP A OD1 1 
ATOM 1139 O OD2 . ASP A 1 159 ? 172.069 -22.435 53.407 1.00 82.15  ? 159 ASP A OD2 1 
ATOM 1140 N N   . ASN A 1 160 ? 172.407 -20.289 48.151 1.00 74.27  ? 160 ASN A N   1 
ATOM 1141 C CA  . ASN A 1 160 ? 172.567 -20.428 46.708 1.00 74.36  ? 160 ASN A CA  1 
ATOM 1142 C C   . ASN A 1 160 ? 173.801 -19.676 46.229 1.00 84.20  ? 160 ASN A C   1 
ATOM 1143 O O   . ASN A 1 160 ? 174.511 -20.126 45.329 1.00 96.70  ? 160 ASN A O   1 
ATOM 1144 C CB  . ASN A 1 160 ? 171.333 -19.923 45.962 1.00 90.33  ? 160 ASN A CB  1 
ATOM 1145 C CG  . ASN A 1 160 ? 171.504 -19.980 44.455 1.00 95.20  ? 160 ASN A CG  1 
ATOM 1146 O OD1 . ASN A 1 160 ? 171.575 -21.057 43.863 1.00 109.41 ? 160 ASN A OD1 1 
ATOM 1147 N ND2 . ASN A 1 160 ? 171.592 -18.813 43.827 1.00 82.17  ? 160 ASN A ND2 1 
ATOM 1148 N N   . THR A 1 161 ? 174.047 -18.521 46.840 1.00 80.25  ? 161 THR A N   1 
ATOM 1149 C CA  . THR A 1 161 ? 175.207 -17.705 46.510 1.00 78.82  ? 161 THR A CA  1 
ATOM 1150 C C   . THR A 1 161 ? 176.485 -18.422 46.948 1.00 76.08  ? 161 THR A C   1 
ATOM 1151 O O   . THR A 1 161 ? 177.522 -18.318 46.291 1.00 74.92  ? 161 THR A O   1 
ATOM 1152 C CB  . THR A 1 161 ? 175.113 -16.309 47.168 1.00 83.37  ? 161 THR A CB  1 
ATOM 1153 O OG1 . THR A 1 161 ? 174.069 -15.557 46.536 1.00 89.65  ? 161 THR A OG1 1 
ATOM 1154 C CG2 . THR A 1 161 ? 176.420 -15.544 47.021 1.00 74.99  ? 161 THR A CG2 1 
ATOM 1155 N N   . LYS A 1 162 ? 176.396 -19.165 48.050 1.00 80.02  ? 162 LYS A N   1 
ATOM 1156 C CA  . LYS A 1 162 ? 177.505 -20.000 48.507 1.00 72.59  ? 162 LYS A CA  1 
ATOM 1157 C C   . LYS A 1 162 ? 177.927 -20.990 47.429 1.00 75.50  ? 162 LYS A C   1 
ATOM 1158 O O   . LYS A 1 162 ? 179.113 -21.273 47.257 1.00 85.12  ? 162 LYS A O   1 
ATOM 1159 C CB  . LYS A 1 162 ? 177.129 -20.773 49.773 1.00 59.16  ? 162 LYS A CB  1 
ATOM 1160 C CG  . LYS A 1 162 ? 176.966 -19.944 51.031 1.00 62.72  ? 162 LYS A CG  1 
ATOM 1161 C CD  . LYS A 1 162 ? 176.942 -20.868 52.239 1.00 61.93  ? 162 LYS A CD  1 
ATOM 1162 C CE  . LYS A 1 162 ? 176.483 -20.161 53.499 1.00 72.78  ? 162 LYS A CE  1 
ATOM 1163 N NZ  . LYS A 1 162 ? 176.258 -21.136 54.604 1.00 89.88  ? 162 LYS A NZ  1 
ATOM 1164 N N   . GLN A 1 163 ? 176.942 -21.521 46.714 1.00 85.80  ? 163 GLN A N   1 
ATOM 1165 C CA  . GLN A 1 163 ? 177.195 -22.501 45.667 1.00 82.43  ? 163 GLN A CA  1 
ATOM 1166 C C   . GLN A 1 163 ? 177.691 -21.820 44.398 1.00 84.99  ? 163 GLN A C   1 
ATOM 1167 O O   . GLN A 1 163 ? 178.590 -22.326 43.725 1.00 90.49  ? 163 GLN A O   1 
ATOM 1168 C CB  . GLN A 1 163 ? 175.931 -23.310 45.379 1.00 87.28  ? 163 GLN A CB  1 
ATOM 1169 C CG  . GLN A 1 163 ? 175.327 -23.958 46.614 1.00 103.13 ? 163 GLN A CG  1 
ATOM 1170 C CD  . GLN A 1 163 ? 174.116 -24.811 46.295 1.00 117.25 ? 163 GLN A CD  1 
ATOM 1171 O OE1 . GLN A 1 163 ? 173.014 -24.298 46.097 1.00 117.14 ? 163 GLN A OE1 1 
ATOM 1172 N NE2 . GLN A 1 163 ? 174.313 -26.123 46.249 1.00 116.58 ? 163 GLN A NE2 1 
ATOM 1173 N N   . MET A 1 164 ? 177.096 -20.675 44.078 1.00 89.31  ? 164 MET A N   1 
ATOM 1174 C CA  . MET A 1 164 ? 177.531 -19.872 42.942 1.00 89.56  ? 164 MET A CA  1 
ATOM 1175 C C   . MET A 1 164 ? 178.992 -19.481 43.105 1.00 81.77  ? 164 MET A C   1 
ATOM 1176 O O   . MET A 1 164 ? 179.769 -19.528 42.152 1.00 89.98  ? 164 MET A O   1 
ATOM 1177 C CB  . MET A 1 164 ? 176.661 -18.623 42.794 1.00 92.31  ? 164 MET A CB  1 
ATOM 1178 C CG  . MET A 1 164 ? 175.290 -18.891 42.203 1.00 101.29 ? 164 MET A CG  1 
ATOM 1179 S SD  . MET A 1 164 ? 175.393 -19.784 40.641 1.00 103.54 ? 164 MET A SD  1 
ATOM 1180 C CE  . MET A 1 164 ? 176.412 -18.674 39.671 1.00 99.97  ? 164 MET A CE  1 
ATOM 1181 N N   . PHE A 1 165 ? 179.351 -19.097 44.326 1.00 80.21  ? 165 PHE A N   1 
ATOM 1182 C CA  . PHE A 1 165 ? 180.734 -18.812 44.681 1.00 73.73  ? 165 PHE A CA  1 
ATOM 1183 C C   . PHE A 1 165 ? 181.614 -20.021 44.398 1.00 85.62  ? 165 PHE A C   1 
ATOM 1184 O O   . PHE A 1 165 ? 182.580 -19.935 43.640 1.00 81.56  ? 165 PHE A O   1 
ATOM 1185 C CB  . PHE A 1 165 ? 180.833 -18.420 46.158 1.00 74.89  ? 165 PHE A CB  1 
ATOM 1186 C CG  . PHE A 1 165 ? 182.240 -18.206 46.642 1.00 82.54  ? 165 PHE A CG  1 
ATOM 1187 C CD1 . PHE A 1 165 ? 182.887 -17.001 46.423 1.00 82.97  ? 165 PHE A CD1 1 
ATOM 1188 C CD2 . PHE A 1 165 ? 182.913 -19.208 47.325 1.00 85.76  ? 165 PHE A CD2 1 
ATOM 1189 C CE1 . PHE A 1 165 ? 184.179 -16.800 46.873 1.00 81.48  ? 165 PHE A CE1 1 
ATOM 1190 C CE2 . PHE A 1 165 ? 184.207 -19.013 47.775 1.00 87.94  ? 165 PHE A CE2 1 
ATOM 1191 C CZ  . PHE A 1 165 ? 184.840 -17.808 47.549 1.00 71.96  ? 165 PHE A CZ  1 
ATOM 1192 N N   . ALA A 1 166 ? 181.259 -21.144 45.016 1.00 95.03  ? 166 ALA A N   1 
ATOM 1193 C CA  . ALA A 1 166 ? 181.985 -22.397 44.854 1.00 85.29  ? 166 ALA A CA  1 
ATOM 1194 C C   . ALA A 1 166 ? 182.167 -22.756 43.385 1.00 83.64  ? 166 ALA A C   1 
ATOM 1195 O O   . ALA A 1 166 ? 183.274 -23.064 42.944 1.00 80.71  ? 166 ALA A O   1 
ATOM 1196 C CB  . ALA A 1 166 ? 181.266 -23.517 45.583 1.00 75.54  ? 166 ALA A CB  1 
ATOM 1197 N N   . SER A 1 167 ? 181.072 -22.707 42.635 1.00 87.55  ? 167 SER A N   1 
ATOM 1198 C CA  . SER A 1 167 ? 181.103 -22.944 41.199 1.00 77.19  ? 167 SER A CA  1 
ATOM 1199 C C   . SER A 1 167 ? 182.061 -21.989 40.490 1.00 81.84  ? 167 SER A C   1 
ATOM 1200 O O   . SER A 1 167 ? 182.895 -22.410 39.688 1.00 94.10  ? 167 SER A O   1 
ATOM 1201 C CB  . SER A 1 167 ? 179.697 -22.805 40.612 1.00 79.05  ? 167 SER A CB  1 
ATOM 1202 O OG  . SER A 1 167 ? 179.722 -22.883 39.199 1.00 109.92 ? 167 SER A OG  1 
ATOM 1203 N N   . THR A 1 168 ? 181.939 -20.703 40.804 1.00 82.78  ? 168 THR A N   1 
ATOM 1204 C CA  . THR A 1 168 ? 182.722 -19.664 40.143 1.00 82.75  ? 168 THR A CA  1 
ATOM 1205 C C   . THR A 1 168 ? 184.214 -19.774 40.448 1.00 89.61  ? 168 THR A C   1 
ATOM 1206 O O   . THR A 1 168 ? 185.040 -19.808 39.536 1.00 95.86  ? 168 THR A O   1 
ATOM 1207 C CB  . THR A 1 168 ? 182.240 -18.259 40.548 1.00 79.18  ? 168 THR A CB  1 
ATOM 1208 O OG1 . THR A 1 168 ? 180.819 -18.170 40.381 1.00 86.36  ? 168 THR A OG1 1 
ATOM 1209 C CG2 . THR A 1 168 ? 182.914 -17.199 39.695 1.00 80.42  ? 168 THR A CG2 1 
ATOM 1210 N N   . ILE A 1 169 ? 184.549 -19.825 41.735 1.00 83.96  ? 169 ILE A N   1 
ATOM 1211 C CA  . ILE A 1 169 ? 185.939 -19.910 42.171 1.00 78.12  ? 169 ILE A CA  1 
ATOM 1212 C C   . ILE A 1 169 ? 186.609 -21.156 41.602 1.00 90.32  ? 169 ILE A C   1 
ATOM 1213 O O   . ILE A 1 169 ? 187.798 -21.146 41.283 1.00 105.77 ? 169 ILE A O   1 
ATOM 1214 C CB  . ILE A 1 169 ? 186.038 -19.904 43.712 1.00 74.59  ? 169 ILE A CB  1 
ATOM 1215 C CG1 . ILE A 1 169 ? 185.635 -18.534 44.253 1.00 73.53  ? 169 ILE A CG1 1 
ATOM 1216 C CG2 . ILE A 1 169 ? 187.446 -20.232 44.176 1.00 72.86  ? 169 ILE A CG2 1 
ATOM 1217 C CD1 . ILE A 1 169 ? 186.316 -17.374 43.551 1.00 83.61  ? 169 ILE A CD1 1 
ATOM 1218 N N   . LYS A 1 170 ? 185.836 -22.222 41.444 1.00 78.21  ? 170 LYS A N   1 
ATOM 1219 C CA  . LYS A 1 170 ? 186.362 -23.435 40.839 1.00 80.32  ? 170 LYS A CA  1 
ATOM 1220 C C   . LYS A 1 170 ? 186.818 -23.214 39.403 1.00 79.30  ? 170 LYS A C   1 
ATOM 1221 O O   . LYS A 1 170 ? 187.917 -23.621 39.030 1.00 98.55  ? 170 LYS A O   1 
ATOM 1222 C CB  . LYS A 1 170 ? 185.324 -24.546 40.880 1.00 87.91  ? 170 LYS A CB  1 
ATOM 1223 C CG  . LYS A 1 170 ? 185.398 -25.378 42.131 1.00 94.19  ? 170 LYS A CG  1 
ATOM 1224 C CD  . LYS A 1 170 ? 184.137 -26.187 42.283 1.00 103.57 ? 170 LYS A CD  1 
ATOM 1225 C CE  . LYS A 1 170 ? 184.072 -26.877 43.625 1.00 103.99 ? 170 LYS A CE  1 
ATOM 1226 N NZ  . LYS A 1 170 ? 182.725 -27.470 43.826 1.00 99.97  ? 170 LYS A NZ  1 
ATOM 1227 N N   . LYS A 1 171 ? 185.975 -22.571 38.601 1.00 80.69  ? 171 LYS A N   1 
ATOM 1228 C CA  . LYS A 1 171 ? 186.315 -22.298 37.209 1.00 73.36  ? 171 LYS A CA  1 
ATOM 1229 C C   . LYS A 1 171 ? 187.500 -21.337 37.123 1.00 90.93  ? 171 LYS A C   1 
ATOM 1230 O O   . LYS A 1 171 ? 188.234 -21.330 36.134 1.00 91.13  ? 171 LYS A O   1 
ATOM 1231 C CB  . LYS A 1 171 ? 185.109 -21.728 36.457 1.00 76.96  ? 171 LYS A CB  1 
ATOM 1232 C CG  . LYS A 1 171 ? 185.321 -21.607 34.955 1.00 93.15  ? 171 LYS A CG  1 
ATOM 1233 C CD  . LYS A 1 171 ? 184.002 -21.517 34.204 1.00 99.93  ? 171 LYS A CD  1 
ATOM 1234 C CE  . LYS A 1 171 ? 184.219 -21.086 32.760 1.00 106.57 ? 171 LYS A CE  1 
ATOM 1235 N NZ  . LYS A 1 171 ? 182.992 -20.491 32.161 1.00 118.87 ? 171 LYS A NZ  1 
ATOM 1236 N N   . LEU A 1 172 ? 187.686 -20.532 38.165 1.00 94.57  ? 172 LEU A N   1 
ATOM 1237 C CA  . LEU A 1 172 ? 188.838 -19.642 38.240 1.00 79.31  ? 172 LEU A CA  1 
ATOM 1238 C C   . LEU A 1 172 ? 190.127 -20.444 38.370 1.00 77.11  ? 172 LEU A C   1 
ATOM 1239 O O   . LEU A 1 172 ? 191.141 -20.111 37.757 1.00 90.32  ? 172 LEU A O   1 
ATOM 1240 C CB  . LEU A 1 172 ? 188.704 -18.672 39.416 1.00 69.72  ? 172 LEU A CB  1 
ATOM 1241 C CG  . LEU A 1 172 ? 189.859 -17.681 39.582 1.00 71.77  ? 172 LEU A CG  1 
ATOM 1242 C CD1 . LEU A 1 172 ? 189.975 -16.776 38.365 1.00 63.17  ? 172 LEU A CD1 1 
ATOM 1243 C CD2 . LEU A 1 172 ? 189.703 -16.860 40.854 1.00 55.13  ? 172 LEU A CD2 1 
ATOM 1244 N N   . HIS A 1 173 ? 190.079 -21.504 39.171 1.00 81.97  ? 173 HIS A N   1 
ATOM 1245 C CA  . HIS A 1 173 ? 191.235 -22.372 39.368 1.00 75.16  ? 173 HIS A CA  1 
ATOM 1246 C C   . HIS A 1 173 ? 191.564 -23.137 38.091 1.00 77.76  ? 173 HIS A C   1 
ATOM 1247 O O   . HIS A 1 173 ? 192.723 -23.203 37.679 1.00 71.82  ? 173 HIS A O   1 
ATOM 1248 C CB  . HIS A 1 173 ? 190.988 -23.350 40.518 1.00 80.52  ? 173 HIS A CB  1 
ATOM 1249 C CG  . HIS A 1 173 ? 190.877 -22.698 41.863 1.00 87.76  ? 173 HIS A CG  1 
ATOM 1250 N ND1 . HIS A 1 173 ? 191.097 -23.378 43.038 1.00 107.49 ? 173 HIS A ND1 1 
ATOM 1251 C CD2 . HIS A 1 173 ? 190.568 -21.426 42.215 1.00 95.46  ? 173 HIS A CD2 1 
ATOM 1252 C CE1 . HIS A 1 173 ? 190.929 -22.557 44.061 1.00 115.55 ? 173 HIS A CE1 1 
ATOM 1253 N NE2 . HIS A 1 173 ? 190.607 -21.366 43.587 1.00 97.72  ? 173 HIS A NE2 1 
ATOM 1254 N N   . ARG A 1 174 ? 190.535 -23.715 37.473 1.00 73.51  ? 174 ARG A N   1 
ATOM 1255 C CA  . ARG A 1 174 ? 190.686 -24.428 36.207 1.00 85.14  ? 174 ARG A CA  1 
ATOM 1256 C C   . ARG A 1 174 ? 191.350 -23.558 35.146 1.00 84.39  ? 174 ARG A C   1 
ATOM 1257 O O   . ARG A 1 174 ? 192.241 -24.006 34.426 1.00 89.94  ? 174 ARG A O   1 
ATOM 1258 C CB  . ARG A 1 174 ? 189.326 -24.909 35.690 1.00 74.34  ? 174 ARG A CB  1 
ATOM 1259 C CG  . ARG A 1 174 ? 188.881 -26.263 36.214 1.00 93.73  ? 174 ARG A CG  1 
ATOM 1260 C CD  . ARG A 1 174 ? 187.752 -26.829 35.360 1.00 112.23 ? 174 ARG A CD  1 
ATOM 1261 N NE  . ARG A 1 174 ? 186.525 -26.042 35.461 1.00 119.24 ? 174 ARG A NE  1 
ATOM 1262 C CZ  . ARG A 1 174 ? 185.632 -26.174 36.436 1.00 116.82 ? 174 ARG A CZ  1 
ATOM 1263 N NH1 . ARG A 1 174 ? 185.827 -27.065 37.399 1.00 119.71 ? 174 ARG A NH1 1 
ATOM 1264 N NH2 . ARG A 1 174 ? 184.543 -25.417 36.450 1.00 107.30 ? 174 ARG A NH2 1 
ATOM 1265 N N   . CYS A 1 175 ? 190.904 -22.310 35.060 1.00 76.27  ? 175 CYS A N   1 
ATOM 1266 C CA  . CYS A 1 175 ? 191.392 -21.377 34.052 1.00 76.29  ? 175 CYS A CA  1 
ATOM 1267 C C   . CYS A 1 175 ? 192.881 -21.078 34.208 1.00 81.95  ? 175 CYS A C   1 
ATOM 1268 O O   . CYS A 1 175 ? 193.645 -21.159 33.245 1.00 95.14  ? 175 CYS A O   1 
ATOM 1269 C CB  . CYS A 1 175 ? 190.588 -20.079 34.116 1.00 86.01  ? 175 CYS A CB  1 
ATOM 1270 S SG  . CYS A 1 175 ? 191.053 -18.845 32.888 1.00 101.74 ? 175 CYS A SG  1 
ATOM 1271 N N   . ILE A 1 176 ? 193.285 -20.734 35.426 1.00 69.38  ? 176 ILE A N   1 
ATOM 1272 C CA  . ILE A 1 176 ? 194.670 -20.377 35.709 1.00 77.68  ? 176 ILE A CA  1 
ATOM 1273 C C   . ILE A 1 176 ? 195.576 -21.602 35.551 1.00 86.28  ? 176 ILE A C   1 
ATOM 1274 O O   . ILE A 1 176 ? 196.736 -21.485 35.149 1.00 93.19  ? 176 ILE A O   1 
ATOM 1275 C CB  . ILE A 1 176 ? 194.798 -19.766 37.124 1.00 76.62  ? 176 ILE A CB  1 
ATOM 1276 C CG1 . ILE A 1 176 ? 194.223 -18.347 37.127 1.00 77.80  ? 176 ILE A CG1 1 
ATOM 1277 C CG2 . ILE A 1 176 ? 196.244 -19.718 37.582 1.00 61.73  ? 176 ILE A CG2 1 
ATOM 1278 C CD1 . ILE A 1 176 ? 194.128 -17.721 38.499 1.00 79.80  ? 176 ILE A CD1 1 
ATOM 1279 N N   . LYS A 1 177 ? 195.023 -22.776 35.842 1.00 99.76  ? 177 LYS A N   1 
ATOM 1280 C CA  . LYS A 1 177 ? 195.721 -24.043 35.638 1.00 85.82  ? 177 LYS A CA  1 
ATOM 1281 C C   . LYS A 1 177 ? 196.181 -24.218 34.193 1.00 81.26  ? 177 LYS A C   1 
ATOM 1282 O O   . LYS A 1 177 ? 197.233 -24.800 33.933 1.00 89.69  ? 177 LYS A O   1 
ATOM 1283 C CB  . LYS A 1 177 ? 194.819 -25.215 36.029 1.00 93.25  ? 177 LYS A CB  1 
ATOM 1284 C CG  . LYS A 1 177 ? 195.258 -25.975 37.267 1.00 108.35 ? 177 LYS A CG  1 
ATOM 1285 C CD  . LYS A 1 177 ? 194.171 -26.943 37.710 1.00 124.94 ? 177 LYS A CD  1 
ATOM 1286 C CE  . LYS A 1 177 ? 193.735 -27.849 36.566 1.00 129.94 ? 177 LYS A CE  1 
ATOM 1287 N NZ  . LYS A 1 177 ? 192.485 -28.592 36.892 1.00 120.06 ? 177 LYS A NZ  1 
ATOM 1288 N N   . LYS A 1 178 ? 195.383 -23.711 33.259 1.00 82.75  ? 178 LYS A N   1 
ATOM 1289 C CA  . LYS A 1 178 ? 195.671 -23.861 31.838 1.00 91.04  ? 178 LYS A CA  1 
ATOM 1290 C C   . LYS A 1 178 ? 196.429 -22.669 31.266 1.00 99.27  ? 178 LYS A C   1 
ATOM 1291 O O   . LYS A 1 178 ? 196.487 -22.489 30.048 1.00 105.44 ? 178 LYS A O   1 
ATOM 1292 C CB  . LYS A 1 178 ? 194.376 -24.068 31.054 1.00 88.55  ? 178 LYS A CB  1 
ATOM 1293 C CG  . LYS A 1 178 ? 194.041 -25.523 30.795 1.00 119.27 ? 178 LYS A CG  1 
ATOM 1294 C CD  . LYS A 1 178 ? 192.773 -25.657 29.969 1.00 124.70 ? 178 LYS A CD  1 
ATOM 1295 C CE  . LYS A 1 178 ? 192.745 -26.986 29.230 1.00 117.15 ? 178 LYS A CE  1 
ATOM 1296 N NZ  . LYS A 1 178 ? 192.090 -26.864 27.899 1.00 115.00 ? 178 LYS A NZ  1 
ATOM 1297 N N   . MET A 1 179 ? 197.011 -21.859 32.144 1.00 90.44  ? 179 MET A N   1 
ATOM 1298 C CA  . MET A 1 179 ? 197.776 -20.700 31.703 1.00 84.14  ? 179 MET A CA  1 
ATOM 1299 C C   . MET A 1 179 ? 199.270 -20.978 31.681 1.00 85.71  ? 179 MET A C   1 
ATOM 1300 O O   . MET A 1 179 ? 199.821 -21.564 32.612 1.00 102.42 ? 179 MET A O   1 
ATOM 1301 C CB  . MET A 1 179 ? 197.498 -19.488 32.596 1.00 80.29  ? 179 MET A CB  1 
ATOM 1302 C CG  . MET A 1 179 ? 196.189 -18.782 32.296 1.00 81.71  ? 179 MET A CG  1 
ATOM 1303 S SD  . MET A 1 179 ? 195.889 -17.370 33.375 1.00 90.03  ? 179 MET A SD  1 
ATOM 1304 C CE  . MET A 1 179 ? 194.329 -16.773 32.727 1.00 76.00  ? 179 MET A CE  1 
ATOM 1305 N N   . GLU A 1 180 ? 199.916 -20.551 30.602 1.00 84.03  ? 180 GLU A N   1 
ATOM 1306 C CA  . GLU A 1 180 ? 201.366 -20.599 30.497 1.00 80.32  ? 180 GLU A CA  1 
ATOM 1307 C C   . GLU A 1 180 ? 201.961 -19.655 31.540 1.00 85.89  ? 180 GLU A C   1 
ATOM 1308 O O   . GLU A 1 180 ? 201.312 -18.684 31.931 1.00 89.63  ? 180 GLU A O   1 
ATOM 1309 C CB  . GLU A 1 180 ? 201.803 -20.228 29.077 1.00 85.37  ? 180 GLU A CB  1 
ATOM 1310 C CG  . GLU A 1 180 ? 201.242 -21.169 28.019 1.00 109.54 ? 180 GLU A CG  1 
ATOM 1311 C CD  . GLU A 1 180 ? 201.687 -20.821 26.612 1.00 124.95 ? 180 GLU A CD  1 
ATOM 1312 O OE1 . GLU A 1 180 ? 201.570 -19.639 26.223 1.00 113.48 ? 180 GLU A OE1 1 
ATOM 1313 O OE2 . GLU A 1 180 ? 202.144 -21.733 25.892 1.00 135.68 ? 180 GLU A OE2 1 
ATOM 1314 N N   . PRO A 1 181 ? 203.188 -19.942 32.007 1.00 87.64  ? 181 PRO A N   1 
ATOM 1315 C CA  . PRO A 1 181 ? 203.788 -19.163 33.100 1.00 84.60  ? 181 PRO A CA  1 
ATOM 1316 C C   . PRO A 1 181 ? 203.872 -17.667 32.804 1.00 93.90  ? 181 PRO A C   1 
ATOM 1317 O O   . PRO A 1 181 ? 204.107 -17.279 31.661 1.00 87.68  ? 181 PRO A O   1 
ATOM 1318 C CB  . PRO A 1 181 ? 205.193 -19.764 33.232 1.00 72.63  ? 181 PRO A CB  1 
ATOM 1319 C CG  . PRO A 1 181 ? 205.105 -21.104 32.590 1.00 87.95  ? 181 PRO A CG  1 
ATOM 1320 C CD  . PRO A 1 181 ? 204.107 -20.973 31.495 1.00 81.53  ? 181 PRO A CD  1 
ATOM 1321 N N   . LEU A 1 182 ? 203.673 -16.844 33.829 1.00 70.31  ? 182 LEU A N   1 
ATOM 1322 C CA  . LEU A 1 182 ? 203.779 -15.398 33.671 1.00 76.47  ? 182 LEU A CA  1 
ATOM 1323 C C   . LEU A 1 182 ? 205.230 -14.987 33.442 1.00 86.77  ? 182 LEU A C   1 
ATOM 1324 O O   . LEU A 1 182 ? 206.056 -15.069 34.353 1.00 86.07  ? 182 LEU A O   1 
ATOM 1325 C CB  . LEU A 1 182 ? 203.211 -14.676 34.892 1.00 69.31  ? 182 LEU A CB  1 
ATOM 1326 C CG  . LEU A 1 182 ? 203.080 -13.161 34.728 1.00 78.69  ? 182 LEU A CG  1 
ATOM 1327 C CD1 . LEU A 1 182 ? 202.006 -12.813 33.705 1.00 62.07  ? 182 LEU A CD1 1 
ATOM 1328 C CD2 . LEU A 1 182 ? 202.798 -12.494 36.063 1.00 68.27  ? 182 LEU A CD2 1 
ATOM 1329 N N   . PRO A 1 183 ? 205.541 -14.535 32.218 1.00 82.11  ? 183 PRO A N   1 
ATOM 1330 C CA  . PRO A 1 183 ? 206.914 -14.213 31.816 1.00 84.27  ? 183 PRO A CA  1 
ATOM 1331 C C   . PRO A 1 183 ? 207.539 -13.135 32.693 1.00 88.81  ? 183 PRO A C   1 
ATOM 1332 O O   . PRO A 1 183 ? 206.929 -12.091 32.928 1.00 104.30 ? 183 PRO A O   1 
ATOM 1333 C CB  . PRO A 1 183 ? 206.755 -13.726 30.373 1.00 79.47  ? 183 PRO A CB  1 
ATOM 1334 C CG  . PRO A 1 183 ? 205.342 -13.281 30.277 1.00 83.60  ? 183 PRO A CG  1 
ATOM 1335 C CD  . PRO A 1 183 ? 204.568 -14.199 31.167 1.00 86.12  ? 183 PRO A CD  1 
ATOM 1336 N N   . GLN A 1 184 ? 208.751 -13.401 33.165 1.00 94.05  ? 184 GLN A N   1 
ATOM 1337 C CA  . GLN A 1 184 ? 209.431 -12.520 34.104 1.00 88.59  ? 184 GLN A CA  1 
ATOM 1338 C C   . GLN A 1 184 ? 209.631 -11.124 33.524 1.00 96.73  ? 184 GLN A C   1 
ATOM 1339 O O   . GLN A 1 184 ? 209.670 -10.947 32.307 1.00 89.53  ? 184 GLN A O   1 
ATOM 1340 C CB  . GLN A 1 184 ? 210.773 -13.125 34.513 1.00 79.75  ? 184 GLN A CB  1 
ATOM 1341 C CG  . GLN A 1 184 ? 211.068 -13.017 35.994 1.00 78.86  ? 184 GLN A CG  1 
ATOM 1342 C CD  . GLN A 1 184 ? 210.135 -13.858 36.844 1.00 84.07  ? 184 GLN A CD  1 
ATOM 1343 O OE1 . GLN A 1 184 ? 209.432 -14.734 36.341 1.00 96.34  ? 184 GLN A OE1 1 
ATOM 1344 N NE2 . GLN A 1 184 ? 210.133 -13.601 38.143 1.00 99.91  ? 184 GLN A NE2 1 
ATOM 1345 N N   . GLY A 1 185 ? 209.750 -10.135 34.402 1.00 89.29  ? 185 GLY A N   1 
ATOM 1346 C CA  . GLY A 1 185 ? 209.847 -8.753  33.973 1.00 85.10  ? 185 GLY A CA  1 
ATOM 1347 C C   . GLY A 1 185 ? 208.471 -8.168  33.723 1.00 100.14 ? 185 GLY A C   1 
ATOM 1348 O O   . GLY A 1 185 ? 208.330 -7.145  33.054 1.00 107.85 ? 185 GLY A O   1 
ATOM 1349 N N   . SER A 1 186 ? 207.449 -8.830  34.256 1.00 94.93  ? 186 SER A N   1 
ATOM 1350 C CA  . SER A 1 186 ? 206.082 -8.337  34.146 1.00 94.59  ? 186 SER A CA  1 
ATOM 1351 C C   . SER A 1 186 ? 205.685 -7.610  35.421 1.00 91.07  ? 186 SER A C   1 
ATOM 1352 O O   . SER A 1 186 ? 206.356 -7.721  36.444 1.00 97.32  ? 186 SER A O   1 
ATOM 1353 C CB  . SER A 1 186 ? 205.104 -9.483  33.871 1.00 90.10  ? 186 SER A CB  1 
ATOM 1354 O OG  . SER A 1 186 ? 205.348 -10.082 32.611 1.00 89.99  ? 186 SER A OG  1 
ATOM 1355 N N   . ASP A 1 187 ? 204.592 -6.860  35.357 1.00 88.45  ? 187 ASP A N   1 
ATOM 1356 C CA  . ASP A 1 187 ? 204.064 -6.208  36.545 1.00 84.67  ? 187 ASP A CA  1 
ATOM 1357 C C   . ASP A 1 187 ? 202.544 -6.218  36.500 1.00 85.10  ? 187 ASP A C   1 
ATOM 1358 O O   . ASP A 1 187 ? 201.945 -6.655  35.517 1.00 81.19  ? 187 ASP A O   1 
ATOM 1359 C CB  . ASP A 1 187 ? 204.595 -4.778  36.665 1.00 100.69 ? 187 ASP A CB  1 
ATOM 1360 C CG  . ASP A 1 187 ? 204.575 -4.267  38.095 1.00 101.91 ? 187 ASP A CG  1 
ATOM 1361 O OD1 . ASP A 1 187 ? 203.756 -4.765  38.898 1.00 76.88  ? 187 ASP A OD1 1 
ATOM 1362 O OD2 . ASP A 1 187 ? 205.385 -3.375  38.419 1.00 105.01 ? 187 ASP A OD2 1 
ATOM 1363 N N   . ALA A 1 188 ? 201.924 -5.739  37.572 1.00 82.63  ? 188 ALA A N   1 
ATOM 1364 C CA  . ALA A 1 188 ? 200.474 -5.759  37.682 1.00 80.33  ? 188 ALA A CA  1 
ATOM 1365 C C   . ALA A 1 188 ? 199.931 -4.421  38.161 1.00 86.85  ? 188 ALA A C   1 
ATOM 1366 O O   . ALA A 1 188 ? 200.619 -3.670  38.853 1.00 83.42  ? 188 ALA A O   1 
ATOM 1367 C CB  . ALA A 1 188 ? 200.039 -6.867  38.615 1.00 74.32  ? 188 ALA A CB  1 
ATOM 1368 N N   . SER A 1 189 ? 198.689 -4.131  37.791 1.00 93.64  ? 189 SER A N   1 
ATOM 1369 C CA  . SER A 1 189 ? 198.049 -2.886  38.187 1.00 76.73  ? 189 SER A CA  1 
ATOM 1370 C C   . SER A 1 189 ? 196.601 -3.097  38.604 1.00 93.34  ? 189 SER A C   1 
ATOM 1371 O O   . SER A 1 189 ? 195.907 -3.959  38.064 1.00 103.75 ? 189 SER A O   1 
ATOM 1372 C CB  . SER A 1 189 ? 198.110 -1.867  37.048 1.00 84.06  ? 189 SER A CB  1 
ATOM 1373 O OG  . SER A 1 189 ? 197.395 -0.691  37.385 1.00 99.76  ? 189 SER A OG  1 
ATOM 1374 N N   . PHE A 1 190 ? 196.159 -2.311  39.580 1.00 104.33 ? 190 PHE A N   1 
ATOM 1375 C CA  . PHE A 1 190 ? 194.744 -2.212  39.913 1.00 95.33  ? 190 PHE A CA  1 
ATOM 1376 C C   . PHE A 1 190 ? 194.161 -1.030  39.155 1.00 98.75  ? 190 PHE A C   1 
ATOM 1377 O O   . PHE A 1 190 ? 194.693 0.076   39.226 1.00 97.66  ? 190 PHE A O   1 
ATOM 1378 C CB  . PHE A 1 190 ? 194.530 -2.028  41.417 1.00 82.14  ? 190 PHE A CB  1 
ATOM 1379 C CG  . PHE A 1 190 ? 194.878 -3.235  42.239 1.00 69.75  ? 190 PHE A CG  1 
ATOM 1380 C CD1 . PHE A 1 190 ? 195.003 -4.483  41.653 1.00 71.95  ? 190 PHE A CD1 1 
ATOM 1381 C CD2 . PHE A 1 190 ? 195.073 -3.120  43.605 1.00 72.93  ? 190 PHE A CD2 1 
ATOM 1382 C CE1 . PHE A 1 190 ? 195.317 -5.593  42.416 1.00 74.32  ? 190 PHE A CE1 1 
ATOM 1383 C CE2 . PHE A 1 190 ? 195.391 -4.224  44.371 1.00 73.36  ? 190 PHE A CE2 1 
ATOM 1384 C CZ  . PHE A 1 190 ? 195.515 -5.462  43.776 1.00 66.93  ? 190 PHE A CZ  1 
ATOM 1385 N N   . ARG A 1 191 ? 193.084 -1.262  38.412 1.00 84.73  ? 191 ARG A N   1 
ATOM 1386 C CA  . ARG A 1 191 ? 192.478 -0.200  37.614 1.00 86.56  ? 191 ARG A CA  1 
ATOM 1387 C C   . ARG A 1 191 ? 190.962 -0.223  37.767 1.00 96.18  ? 191 ARG A C   1 
ATOM 1388 O O   . ARG A 1 191 ? 190.336 -1.277  37.661 1.00 99.90  ? 191 ARG A O   1 
ATOM 1389 C CB  . ARG A 1 191 ? 192.888 -0.339  36.144 1.00 66.62  ? 191 ARG A CB  1 
ATOM 1390 C CG  . ARG A 1 191 ? 194.394 -0.486  35.977 1.00 69.49  ? 191 ARG A CG  1 
ATOM 1391 C CD  . ARG A 1 191 ? 194.919 -0.138  34.599 1.00 87.33  ? 191 ARG A CD  1 
ATOM 1392 N NE  . ARG A 1 191 ? 196.380 -0.121  34.626 1.00 85.78  ? 191 ARG A NE  1 
ATOM 1393 C CZ  . ARG A 1 191 ? 197.158 -0.064  33.552 1.00 94.38  ? 191 ARG A CZ  1 
ATOM 1394 N NH1 . ARG A 1 191 ? 196.621 -0.018  32.341 1.00 96.51  ? 191 ARG A NH1 1 
ATOM 1395 N NH2 . ARG A 1 191 ? 198.478 -0.053  33.691 1.00 89.97  ? 191 ARG A NH2 1 
ATOM 1396 N N   . VAL A 1 192 ? 190.377 0.942   38.028 1.00 92.46  ? 192 VAL A N   1 
ATOM 1397 C CA  . VAL A 1 192 ? 188.951 1.022   38.320 1.00 95.61  ? 192 VAL A CA  1 
ATOM 1398 C C   . VAL A 1 192 ? 188.212 2.029   37.439 1.00 99.27  ? 192 VAL A C   1 
ATOM 1399 O O   . VAL A 1 192 ? 188.741 3.090   37.104 1.00 85.34  ? 192 VAL A O   1 
ATOM 1400 C CB  . VAL A 1 192 ? 188.706 1.383   39.803 1.00 95.62  ? 192 VAL A CB  1 
ATOM 1401 C CG1 . VAL A 1 192 ? 189.098 0.224   40.705 1.00 103.91 ? 192 VAL A CG1 1 
ATOM 1402 C CG2 . VAL A 1 192 ? 189.477 2.636   40.182 1.00 96.30  ? 192 VAL A CG2 1 
ATOM 1403 N N   . SER A 1 193 ? 186.986 1.675   37.062 1.00 87.96  ? 193 SER A N   1 
ATOM 1404 C CA  . SER A 1 193 ? 186.113 2.559   36.294 1.00 81.88  ? 193 SER A CA  1 
ATOM 1405 C C   . SER A 1 193 ? 184.822 2.793   37.071 1.00 90.05  ? 193 SER A C   1 
ATOM 1406 O O   . SER A 1 193 ? 184.417 1.955   37.875 1.00 83.44  ? 193 SER A O   1 
ATOM 1407 C CB  . SER A 1 193 ? 185.819 1.972   34.912 1.00 82.14  ? 193 SER A CB  1 
ATOM 1408 O OG  . SER A 1 193 ? 184.856 0.936   34.987 1.00 92.52  ? 193 SER A OG  1 
ATOM 1409 N N   . TYR A 1 194 ? 184.170 3.925   36.825 1.00 105.21 ? 194 TYR A N   1 
ATOM 1410 C CA  . TYR A 1 194 ? 183.115 4.387   37.721 1.00 100.99 ? 194 TYR A CA  1 
ATOM 1411 C C   . TYR A 1 194 ? 181.708 4.386   37.135 1.00 98.89  ? 194 TYR A C   1 
ATOM 1412 O O   . TYR A 1 194 ? 181.518 4.339   35.919 1.00 103.24 ? 194 TYR A O   1 
ATOM 1413 C CB  . TYR A 1 194 ? 183.451 5.796   38.208 1.00 98.80  ? 194 TYR A CB  1 
ATOM 1414 C CG  . TYR A 1 194 ? 184.806 5.883   38.865 1.00 105.17 ? 194 TYR A CG  1 
ATOM 1415 C CD1 . TYR A 1 194 ? 185.001 5.413   40.155 1.00 94.62  ? 194 TYR A CD1 1 
ATOM 1416 C CD2 . TYR A 1 194 ? 185.894 6.423   38.191 1.00 105.81 ? 194 TYR A CD2 1 
ATOM 1417 C CE1 . TYR A 1 194 ? 186.239 5.484   40.762 1.00 90.93  ? 194 TYR A CE1 1 
ATOM 1418 C CE2 . TYR A 1 194 ? 187.137 6.499   38.789 1.00 104.41 ? 194 TYR A CE2 1 
ATOM 1419 C CZ  . TYR A 1 194 ? 187.303 6.028   40.075 1.00 106.67 ? 194 TYR A CZ  1 
ATOM 1420 O OH  . TYR A 1 194 ? 188.537 6.100   40.678 1.00 111.46 ? 194 TYR A OH  1 
ATOM 1421 N N   . THR A 1 195 ? 180.726 4.437   38.031 1.00 95.27  ? 195 THR A N   1 
ATOM 1422 C CA  . THR A 1 195 ? 179.325 4.568   37.656 1.00 99.51  ? 195 THR A CA  1 
ATOM 1423 C C   . THR A 1 195 ? 178.986 6.040   37.444 1.00 112.41 ? 195 THR A C   1 
ATOM 1424 O O   . THR A 1 195 ? 179.812 6.915   37.702 1.00 116.59 ? 195 THR A O   1 
ATOM 1425 C CB  . THR A 1 195 ? 178.391 3.978   38.732 1.00 97.85  ? 195 THR A CB  1 
ATOM 1426 O OG1 . THR A 1 195 ? 178.538 4.714   39.952 1.00 108.49 ? 195 THR A OG1 1 
ATOM 1427 C CG2 . THR A 1 195 ? 178.725 2.519   38.990 1.00 89.76  ? 195 THR A CG2 1 
ATOM 1428 N N   . GLU A 1 196 ? 177.771 6.311   36.981 1.00 117.63 ? 196 GLU A N   1 
ATOM 1429 C CA  . GLU A 1 196 ? 177.347 7.683   36.716 1.00 106.25 ? 196 GLU A CA  1 
ATOM 1430 C C   . GLU A 1 196 ? 177.093 8.471   37.998 1.00 110.72 ? 196 GLU A C   1 
ATOM 1431 O O   . GLU A 1 196 ? 177.126 9.701   37.994 1.00 110.25 ? 196 GLU A O   1 
ATOM 1432 C CB  . GLU A 1 196 ? 176.092 7.691   35.840 1.00 117.99 ? 196 GLU A CB  1 
ATOM 1433 C CG  . GLU A 1 196 ? 176.370 7.567   34.349 1.00 132.20 ? 196 GLU A CG  1 
ATOM 1434 C CD  . GLU A 1 196 ? 177.067 8.789   33.778 1.00 158.28 ? 196 GLU A CD  1 
ATOM 1435 O OE1 . GLU A 1 196 ? 176.376 9.647   33.190 1.00 165.38 ? 196 GLU A OE1 1 
ATOM 1436 O OE2 . GLU A 1 196 ? 178.306 8.892   33.912 1.00 160.65 ? 196 GLU A OE2 1 
ATOM 1437 N N   . LYS A 1 197 ? 176.846 7.760   39.094 1.00 121.38 ? 197 LYS A N   1 
ATOM 1438 C CA  . LYS A 1 197 ? 176.598 8.397   40.384 1.00 122.99 ? 197 LYS A CA  1 
ATOM 1439 C C   . LYS A 1 197 ? 177.845 9.081   40.939 1.00 123.66 ? 197 LYS A C   1 
ATOM 1440 O O   . LYS A 1 197 ? 177.760 9.888   41.864 1.00 123.34 ? 197 LYS A O   1 
ATOM 1441 C CB  . LYS A 1 197 ? 176.091 7.372   41.402 1.00 114.08 ? 197 LYS A CB  1 
ATOM 1442 C CG  . LYS A 1 197 ? 174.759 6.729   41.055 1.00 112.28 ? 197 LYS A CG  1 
ATOM 1443 C CD  . LYS A 1 197 ? 174.364 5.666   42.079 1.00 115.59 ? 197 LYS A CD  1 
ATOM 1444 C CE  . LYS A 1 197 ? 173.926 6.274   43.410 1.00 106.30 ? 197 LYS A CE  1 
ATOM 1445 N NZ  . LYS A 1 197 ? 175.062 6.617   44.315 1.00 103.23 ? 197 LYS A NZ  1 
ATOM 1446 N N   . ALA A 1 198 ? 179.001 8.750   40.373 1.00 126.65 ? 198 ALA A N   1 
ATOM 1447 C CA  . ALA A 1 198 ? 180.275 9.217   40.901 1.00 109.15 ? 198 ALA A CA  1 
ATOM 1448 C C   . ALA A 1 198 ? 180.664 10.582  40.351 1.00 119.25 ? 198 ALA A C   1 
ATOM 1449 O O   . ALA A 1 198 ? 180.688 10.781  39.136 1.00 127.27 ? 198 ALA A O   1 
ATOM 1450 C CB  . ALA A 1 198 ? 181.369 8.204   40.602 1.00 112.68 ? 198 ALA A CB  1 
ATOM 1451 N N   . PRO A 1 199 ? 180.967 11.527  41.254 1.00 125.36 ? 199 PRO A N   1 
ATOM 1452 C CA  . PRO A 1 199 ? 181.489 12.852  40.906 1.00 119.22 ? 199 PRO A CA  1 
ATOM 1453 C C   . PRO A 1 199 ? 182.666 12.766  39.936 1.00 125.58 ? 199 PRO A C   1 
ATOM 1454 O O   . PRO A 1 199 ? 183.395 11.773  39.933 1.00 111.15 ? 199 PRO A O   1 
ATOM 1455 C CB  . PRO A 1 199 ? 181.938 13.428  42.260 1.00 113.38 ? 199 PRO A CB  1 
ATOM 1456 C CG  . PRO A 1 199 ? 181.718 12.329  43.280 1.00 123.84 ? 199 PRO A CG  1 
ATOM 1457 C CD  . PRO A 1 199 ? 180.706 11.410  42.696 1.00 120.00 ? 199 PRO A CD  1 
ATOM 1458 N N   . LYS A 1 200 ? 182.850 13.806  39.130 1.00 142.00 ? 200 LYS A N   1 
ATOM 1459 C CA  . LYS A 1 200 ? 183.884 13.820  38.099 1.00 139.45 ? 200 LYS A CA  1 
ATOM 1460 C C   . LYS A 1 200 ? 185.292 13.822  38.701 1.00 132.07 ? 200 LYS A C   1 
ATOM 1461 O O   . LYS A 1 200 ? 186.288 13.712  37.984 1.00 126.19 ? 200 LYS A O   1 
ATOM 1462 C CB  . LYS A 1 200 ? 183.692 15.039  37.188 1.00 143.20 ? 200 LYS A CB  1 
ATOM 1463 C CG  . LYS A 1 200 ? 184.460 14.994  35.873 1.00 153.72 ? 200 LYS A CG  1 
ATOM 1464 C CD  . LYS A 1 200 ? 184.201 16.244  35.043 1.00 158.76 ? 200 LYS A CD  1 
ATOM 1465 C CE  . LYS A 1 200 ? 185.122 16.311  33.836 1.00 148.15 ? 200 LYS A CE  1 
ATOM 1466 N NZ  . LYS A 1 200 ? 186.536 16.528  34.245 1.00 145.53 ? 200 LYS A NZ  1 
ATOM 1467 N N   . ASP A 1 201 ? 185.368 13.926  40.024 1.00 131.55 ? 201 ASP A N   1 
ATOM 1468 C CA  . ASP A 1 201 ? 186.643 14.093  40.707 1.00 132.70 ? 201 ASP A CA  1 
ATOM 1469 C C   . ASP A 1 201 ? 186.961 12.996  41.722 1.00 127.56 ? 201 ASP A C   1 
ATOM 1470 O O   . ASP A 1 201 ? 187.931 13.111  42.470 1.00 125.03 ? 201 ASP A O   1 
ATOM 1471 C CB  . ASP A 1 201 ? 186.672 15.449  41.415 1.00 151.91 ? 201 ASP A CB  1 
ATOM 1472 C CG  . ASP A 1 201 ? 185.354 15.782  42.088 1.00 170.17 ? 201 ASP A CG  1 
ATOM 1473 O OD1 . ASP A 1 201 ? 184.293 15.456  41.516 1.00 185.06 ? 201 ASP A OD1 1 
ATOM 1474 O OD2 . ASP A 1 201 ? 185.377 16.363  43.193 1.00 173.66 ? 201 ASP A OD2 1 
ATOM 1475 N N   . TYR A 1 202 ? 186.159 11.936  41.757 1.00 128.23 ? 202 TYR A N   1 
ATOM 1476 C CA  . TYR A 1 202 ? 186.350 10.908  42.776 1.00 121.45 ? 202 TYR A CA  1 
ATOM 1477 C C   . TYR A 1 202 ? 187.530 9.988   42.486 1.00 117.77 ? 202 TYR A C   1 
ATOM 1478 O O   . TYR A 1 202 ? 187.680 9.464   41.382 1.00 115.94 ? 202 TYR A O   1 
ATOM 1479 C CB  . TYR A 1 202 ? 185.088 10.059  42.949 1.00 118.46 ? 202 TYR A CB  1 
ATOM 1480 C CG  . TYR A 1 202 ? 185.216 9.037   44.063 1.00 107.60 ? 202 TYR A CG  1 
ATOM 1481 C CD1 . TYR A 1 202 ? 185.236 9.435   45.394 1.00 102.23 ? 202 TYR A CD1 1 
ATOM 1482 C CD2 . TYR A 1 202 ? 185.327 7.679   43.785 1.00 88.48  ? 202 TYR A CD2 1 
ATOM 1483 C CE1 . TYR A 1 202 ? 185.357 8.511   46.418 1.00 90.53  ? 202 TYR A CE1 1 
ATOM 1484 C CE2 . TYR A 1 202 ? 185.449 6.746   44.806 1.00 86.40  ? 202 TYR A CE2 1 
ATOM 1485 C CZ  . TYR A 1 202 ? 185.463 7.170   46.120 1.00 93.32  ? 202 TYR A CZ  1 
ATOM 1486 O OH  . TYR A 1 202 ? 185.583 6.257   47.143 1.00 90.47  ? 202 TYR A OH  1 
ATOM 1487 N N   . THR A 1 203 ? 188.363 9.803   43.503 1.00 117.26 ? 203 THR A N   1 
ATOM 1488 C CA  . THR A 1 203 ? 189.425 8.811   43.481 1.00 112.25 ? 203 THR A CA  1 
ATOM 1489 C C   . THR A 1 203 ? 189.538 8.209   44.878 1.00 100.04 ? 203 THR A C   1 
ATOM 1490 O O   . THR A 1 203 ? 189.652 8.937   45.865 1.00 112.17 ? 203 THR A O   1 
ATOM 1491 C CB  . THR A 1 203 ? 190.775 9.414   43.041 1.00 112.32 ? 203 THR A CB  1 
ATOM 1492 O OG1 . THR A 1 203 ? 190.889 9.335   41.615 1.00 115.88 ? 203 THR A OG1 1 
ATOM 1493 C CG2 . THR A 1 203 ? 191.931 8.651   43.659 1.00 109.77 ? 203 THR A CG2 1 
ATOM 1494 N N   . PRO A 1 204 ? 189.484 6.873   44.967 1.00 88.15  ? 204 PRO A N   1 
ATOM 1495 C CA  . PRO A 1 204 ? 189.540 6.187   46.261 1.00 102.81 ? 204 PRO A CA  1 
ATOM 1496 C C   . PRO A 1 204 ? 190.917 6.308   46.900 1.00 105.11 ? 204 PRO A C   1 
ATOM 1497 O O   . PRO A 1 204 ? 191.905 6.464   46.182 1.00 105.55 ? 204 PRO A O   1 
ATOM 1498 C CB  . PRO A 1 204 ? 189.228 4.724   45.906 1.00 91.64  ? 204 PRO A CB  1 
ATOM 1499 C CG  . PRO A 1 204 ? 188.760 4.738   44.471 1.00 77.73  ? 204 PRO A CG  1 
ATOM 1500 C CD  . PRO A 1 204 ? 189.401 5.926   43.844 1.00 83.77  ? 204 PRO A CD  1 
ATOM 1501 N N   . GLU A 1 205 ? 190.974 6.247   48.228 1.00 90.76  ? 205 GLU A N   1 
ATOM 1502 C CA  . GLU A 1 205 ? 192.245 6.258   48.946 1.00 85.87  ? 205 GLU A CA  1 
ATOM 1503 C C   . GLU A 1 205 ? 193.182 5.176   48.418 1.00 105.82 ? 205 GLU A C   1 
ATOM 1504 O O   . GLU A 1 205 ? 192.795 4.013   48.300 1.00 98.01  ? 205 GLU A O   1 
ATOM 1505 C CB  . GLU A 1 205 ? 192.021 6.055   50.447 1.00 103.24 ? 205 GLU A CB  1 
ATOM 1506 C CG  . GLU A 1 205 ? 191.597 7.297   51.212 1.00 129.84 ? 205 GLU A CG  1 
ATOM 1507 C CD  . GLU A 1 205 ? 191.375 7.011   52.686 1.00 154.14 ? 205 GLU A CD  1 
ATOM 1508 O OE1 . GLU A 1 205 ? 191.492 5.832   53.085 1.00 168.94 ? 205 GLU A OE1 1 
ATOM 1509 O OE2 . GLU A 1 205 ? 191.092 7.961   53.447 1.00 145.73 ? 205 GLU A OE2 1 
ATOM 1510 N N   . GLY A 1 206 ? 194.411 5.563   48.095 1.00 99.67  ? 206 GLY A N   1 
ATOM 1511 C CA  . GLY A 1 206 ? 195.404 4.612   47.631 1.00 91.22  ? 206 GLY A CA  1 
ATOM 1512 C C   . GLY A 1 206 ? 195.494 4.520   46.120 1.00 92.92  ? 206 GLY A C   1 
ATOM 1513 O O   . GLY A 1 206 ? 196.420 3.914   45.582 1.00 91.13  ? 206 GLY A O   1 
ATOM 1514 N N   . TYR A 1 207 ? 194.528 5.120   45.433 1.00 92.17  ? 207 TYR A N   1 
ATOM 1515 C CA  . TYR A 1 207 ? 194.529 5.139   43.975 1.00 94.57  ? 207 TYR A CA  1 
ATOM 1516 C C   . TYR A 1 207 ? 194.884 6.532   43.472 1.00 100.41 ? 207 TYR A C   1 
ATOM 1517 O O   . TYR A 1 207 ? 194.787 7.508   44.215 1.00 100.70 ? 207 TYR A O   1 
ATOM 1518 C CB  . TYR A 1 207 ? 193.167 4.704   43.425 1.00 90.55  ? 207 TYR A CB  1 
ATOM 1519 C CG  . TYR A 1 207 ? 192.916 3.212   43.501 1.00 91.55  ? 207 TYR A CG  1 
ATOM 1520 C CD1 . TYR A 1 207 ? 192.818 2.565   44.727 1.00 83.62  ? 207 TYR A CD1 1 
ATOM 1521 C CD2 . TYR A 1 207 ? 192.772 2.452   42.347 1.00 93.65  ? 207 TYR A CD2 1 
ATOM 1522 C CE1 . TYR A 1 207 ? 192.590 1.203   44.801 1.00 80.24  ? 207 TYR A CE1 1 
ATOM 1523 C CE2 . TYR A 1 207 ? 192.542 1.089   42.412 1.00 82.02  ? 207 TYR A CE2 1 
ATOM 1524 C CZ  . TYR A 1 207 ? 192.452 0.470   43.642 1.00 78.27  ? 207 TYR A CZ  1 
ATOM 1525 O OH  . TYR A 1 207 ? 192.223 -0.886  43.716 1.00 69.78  ? 207 TYR A OH  1 
ATOM 1526 N N   . LEU A 1 208 ? 195.310 6.620   42.216 1.00 85.32  ? 208 LEU A N   1 
ATOM 1527 C CA  . LEU A 1 208 ? 195.579 7.912   41.593 1.00 92.47  ? 208 LEU A CA  1 
ATOM 1528 C C   . LEU A 1 208 ? 194.705 8.104   40.358 1.00 92.91  ? 208 LEU A C   1 
ATOM 1529 O O   . LEU A 1 208 ? 194.366 7.140   39.670 1.00 100.88 ? 208 LEU A O   1 
ATOM 1530 C CB  . LEU A 1 208 ? 197.056 8.047   41.213 1.00 105.56 ? 208 LEU A CB  1 
ATOM 1531 C CG  . LEU A 1 208 ? 198.140 7.804   42.267 1.00 109.18 ? 208 LEU A CG  1 
ATOM 1532 C CD1 . LEU A 1 208 ? 199.484 8.308   41.761 1.00 90.22  ? 208 LEU A CD1 1 
ATOM 1533 C CD2 . LEU A 1 208 ? 197.794 8.457   43.595 1.00 115.10 ? 208 LEU A CD2 1 
ATOM 1534 N N   . LEU A 1 209 ? 194.345 9.353   40.084 1.00 109.43 ? 209 LEU A N   1 
ATOM 1535 C CA  . LEU A 1 209 ? 193.527 9.683   38.923 1.00 114.32 ? 209 LEU A CA  1 
ATOM 1536 C C   . LEU A 1 209 ? 194.274 9.372   37.629 1.00 106.43 ? 209 LEU A C   1 
ATOM 1537 O O   . LEU A 1 209 ? 195.479 9.598   37.528 1.00 114.48 ? 209 LEU A O   1 
ATOM 1538 C CB  . LEU A 1 209 ? 193.117 11.158  38.964 1.00 112.12 ? 209 LEU A CB  1 
ATOM 1539 C CG  . LEU A 1 209 ? 192.229 11.715  37.847 1.00 118.10 ? 209 LEU A CG  1 
ATOM 1540 C CD1 . LEU A 1 209 ? 191.092 10.769  37.526 1.00 108.93 ? 209 LEU A CD1 1 
ATOM 1541 C CD2 . LEU A 1 209 ? 191.685 13.079  38.238 1.00 133.79 ? 209 LEU A CD2 1 
ATOM 1542 N N   . SER A 1 210 ? 193.551 8.841   36.648 1.00 109.90 ? 210 SER A N   1 
ATOM 1543 C CA  . SER A 1 210 ? 194.126 8.523   35.347 1.00 111.29 ? 210 SER A CA  1 
ATOM 1544 C C   . SER A 1 210 ? 193.059 8.601   34.262 1.00 112.72 ? 210 SER A C   1 
ATOM 1545 O O   . SER A 1 210 ? 191.915 8.213   34.486 1.00 120.70 ? 210 SER A O   1 
ATOM 1546 C CB  . SER A 1 210 ? 194.764 7.132   35.364 1.00 102.80 ? 210 SER A CB  1 
ATOM 1547 O OG  . SER A 1 210 ? 195.275 6.787   34.087 1.00 114.27 ? 210 SER A OG  1 
ATOM 1548 N N   . PRO A 1 211 ? 193.429 9.117   33.081 1.00 110.17 ? 211 PRO A N   1 
ATOM 1549 C CA  . PRO A 1 211 ? 192.503 9.170   31.946 1.00 110.11 ? 211 PRO A CA  1 
ATOM 1550 C C   . PRO A 1 211 ? 192.432 7.834   31.214 1.00 118.42 ? 211 PRO A C   1 
ATOM 1551 O O   . PRO A 1 211 ? 191.647 7.676   30.278 1.00 116.04 ? 211 PRO A O   1 
ATOM 1552 C CB  . PRO A 1 211 ? 193.113 10.248  31.053 1.00 109.48 ? 211 PRO A CB  1 
ATOM 1553 C CG  . PRO A 1 211 ? 194.577 10.143  31.317 1.00 102.21 ? 211 PRO A CG  1 
ATOM 1554 C CD  . PRO A 1 211 ? 194.714 9.770   32.774 1.00 102.24 ? 211 PRO A CD  1 
ATOM 1555 N N   . MET A 1 212 ? 193.250 6.881   31.648 1.00 117.59 ? 212 MET A N   1 
ATOM 1556 C CA  . MET A 1 212 ? 193.358 5.598   30.967 1.00 110.85 ? 212 MET A CA  1 
ATOM 1557 C C   . MET A 1 212 ? 192.885 4.432   31.828 1.00 117.49 ? 212 MET A C   1 
ATOM 1558 O O   . MET A 1 212 ? 193.379 4.221   32.937 1.00 128.06 ? 212 MET A O   1 
ATOM 1559 C CB  . MET A 1 212 ? 194.803 5.357   30.527 1.00 112.17 ? 212 MET A CB  1 
ATOM 1560 C CG  . MET A 1 212 ? 195.321 6.362   29.513 1.00 117.36 ? 212 MET A CG  1 
ATOM 1561 S SD  . MET A 1 212 ? 197.066 6.128   29.121 1.00 134.99 ? 212 MET A SD  1 
ATOM 1562 C CE  . MET A 1 212 ? 197.832 6.593   30.672 1.00 95.35  ? 212 MET A CE  1 
ATOM 1563 N N   . PHE A 1 213 ? 191.922 3.680   31.306 1.00 117.57 ? 213 PHE A N   1 
ATOM 1564 C CA  . PHE A 1 213 ? 191.515 2.425   31.920 1.00 105.88 ? 213 PHE A CA  1 
ATOM 1565 C C   . PHE A 1 213 ? 192.476 1.340   31.451 1.00 101.96 ? 213 PHE A C   1 
ATOM 1566 O O   . PHE A 1 213 ? 193.636 1.306   31.863 1.00 111.47 ? 213 PHE A O   1 
ATOM 1567 C CB  . PHE A 1 213 ? 190.073 2.072   31.550 1.00 100.69 ? 213 PHE A CB  1 
ATOM 1568 C CG  . PHE A 1 213 ? 189.417 1.110   32.501 1.00 93.43  ? 213 PHE A CG  1 
ATOM 1569 C CD1 . PHE A 1 213 ? 189.786 1.074   33.836 1.00 100.76 ? 213 PHE A CD1 1 
ATOM 1570 C CD2 . PHE A 1 213 ? 188.433 0.240   32.060 1.00 83.02  ? 213 PHE A CD2 1 
ATOM 1571 C CE1 . PHE A 1 213 ? 189.183 0.190   34.714 1.00 88.53  ? 213 PHE A CE1 1 
ATOM 1572 C CE2 . PHE A 1 213 ? 187.827 -0.646  32.933 1.00 72.52  ? 213 PHE A CE2 1 
ATOM 1573 C CZ  . PHE A 1 213 ? 188.203 -0.671  34.261 1.00 66.51  ? 213 PHE A CZ  1 
ATOM 1574 N N   . TYR A 1 214 ? 191.992 0.464   30.578 1.00 96.77  ? 214 TYR A N   1 
ATOM 1575 C CA  . TYR A 1 214 ? 192.853 -0.497  29.898 1.00 92.31  ? 214 TYR A CA  1 
ATOM 1576 C C   . TYR A 1 214 ? 192.228 -0.912  28.570 1.00 99.24  ? 214 TYR A C   1 
ATOM 1577 O O   . TYR A 1 214 ? 191.014 -0.823  28.392 1.00 97.43  ? 214 TYR A O   1 
ATOM 1578 C CB  . TYR A 1 214 ? 193.116 -1.725  30.779 1.00 85.83  ? 214 TYR A CB  1 
ATOM 1579 C CG  . TYR A 1 214 ? 191.907 -2.605  31.011 1.00 93.61  ? 214 TYR A CG  1 
ATOM 1580 C CD1 . TYR A 1 214 ? 191.619 -3.664  30.158 1.00 95.71  ? 214 TYR A CD1 1 
ATOM 1581 C CD2 . TYR A 1 214 ? 191.062 -2.388  32.091 1.00 95.33  ? 214 TYR A CD2 1 
ATOM 1582 C CE1 . TYR A 1 214 ? 190.518 -4.472  30.366 1.00 91.19  ? 214 TYR A CE1 1 
ATOM 1583 C CE2 . TYR A 1 214 ? 189.959 -3.194  32.308 1.00 106.29 ? 214 TYR A CE2 1 
ATOM 1584 C CZ  . TYR A 1 214 ? 189.692 -4.233  31.443 1.00 99.60  ? 214 TYR A CZ  1 
ATOM 1585 O OH  . TYR A 1 214 ? 188.595 -5.036  31.657 1.00 87.14  ? 214 TYR A OH  1 
ATOM 1586 N N   . THR A 1 215 ? 193.060 -1.361  27.638 1.00 112.14 ? 215 THR A N   1 
ATOM 1587 C CA  . THR A 1 215 ? 192.579 -1.781  26.328 1.00 114.09 ? 215 THR A CA  1 
ATOM 1588 C C   . THR A 1 215 ? 193.165 -3.133  25.938 1.00 112.80 ? 215 THR A C   1 
ATOM 1589 O O   . THR A 1 215 ? 194.313 -3.437  26.260 1.00 117.36 ? 215 THR A O   1 
ATOM 1590 C CB  . THR A 1 215 ? 192.925 -0.747  25.243 1.00 104.83 ? 215 THR A CB  1 
ATOM 1591 O OG1 . THR A 1 215 ? 194.325 -0.448  25.299 1.00 123.54 ? 215 THR A OG1 1 
ATOM 1592 C CG2 . THR A 1 215 ? 192.131 0.535   25.455 1.00 87.03  ? 215 THR A CG2 1 
ATOM 1593 N N   . LEU A 1 216 ? 192.370 -3.938  25.242 1.00 105.74 ? 216 LEU A N   1 
ATOM 1594 C CA  . LEU A 1 216 ? 192.786 -5.284  24.867 1.00 102.29 ? 216 LEU A CA  1 
ATOM 1595 C C   . LEU A 1 216 ? 192.888 -5.454  23.358 1.00 111.29 ? 216 LEU A C   1 
ATOM 1596 O O   . LEU A 1 216 ? 192.107 -4.871  22.604 1.00 116.49 ? 216 LEU A O   1 
ATOM 1597 C CB  . LEU A 1 216 ? 191.810 -6.318  25.433 1.00 94.88  ? 216 LEU A CB  1 
ATOM 1598 C CG  . LEU A 1 216 ? 191.664 -6.355  26.954 1.00 98.95  ? 216 LEU A CG  1 
ATOM 1599 C CD1 . LEU A 1 216 ? 190.542 -7.298  27.364 1.00 93.73  ? 216 LEU A CD1 1 
ATOM 1600 C CD2 . LEU A 1 216 ? 192.977 -6.765  27.600 1.00 101.58 ? 216 LEU A CD2 1 
ATOM 1601 N N   . ASN A 1 217 ? 193.857 -6.255  22.924 1.00 108.87 ? 217 ASN A N   1 
ATOM 1602 C CA  . ASN A 1 217 ? 193.964 -6.631  21.521 1.00 117.27 ? 217 ASN A CA  1 
ATOM 1603 C C   . ASN A 1 217 ? 192.709 -7.377  21.088 1.00 120.25 ? 217 ASN A C   1 
ATOM 1604 O O   . ASN A 1 217 ? 192.015 -7.965  21.915 1.00 115.67 ? 217 ASN A O   1 
ATOM 1605 C CB  . ASN A 1 217 ? 195.203 -7.498  21.280 1.00 128.29 ? 217 ASN A CB  1 
ATOM 1606 C CG  . ASN A 1 217 ? 196.491 -6.797  21.663 1.00 148.47 ? 217 ASN A CG  1 
ATOM 1607 O OD1 . ASN A 1 217 ? 197.347 -7.371  22.338 1.00 159.39 ? 217 ASN A OD1 1 
ATOM 1608 N ND2 . ASN A 1 217 ? 196.638 -5.550  21.231 1.00 145.56 ? 217 ASN A ND2 1 
ATOM 1609 N N   . GLN A 1 218 ? 192.414 -7.350  19.794 1.00 127.57 ? 218 GLN A N   1 
ATOM 1610 C CA  . GLN A 1 218 ? 191.219 -8.010  19.285 1.00 140.37 ? 218 GLN A CA  1 
ATOM 1611 C C   . GLN A 1 218 ? 191.374 -9.529  19.280 1.00 144.23 ? 218 GLN A C   1 
ATOM 1612 O O   . GLN A 1 218 ? 190.423 -10.262 19.555 1.00 133.70 ? 218 GLN A O   1 
ATOM 1613 C CB  . GLN A 1 218 ? 190.894 -7.506  17.875 1.00 153.15 ? 218 GLN A CB  1 
ATOM 1614 C CG  . GLN A 1 218 ? 189.676 -8.159  17.233 1.00 163.87 ? 218 GLN A CG  1 
ATOM 1615 C CD  . GLN A 1 218 ? 188.382 -7.887  17.985 1.00 167.14 ? 218 GLN A CD  1 
ATOM 1616 O OE1 . GLN A 1 218 ? 188.318 -7.011  18.848 1.00 167.49 ? 218 GLN A OE1 1 
ATOM 1617 N NE2 . GLN A 1 218 ? 187.342 -8.643  17.656 1.00 169.10 ? 218 GLN A NE2 1 
ATOM 1618 N N   . ASP A 1 219 ? 192.584 -9.991  18.986 1.00 160.18 ? 219 ASP A N   1 
ATOM 1619 C CA  . ASP A 1 219 ? 192.859 -11.413 18.799 1.00 169.63 ? 219 ASP A CA  1 
ATOM 1620 C C   . ASP A 1 219 ? 192.831 -12.231 20.087 1.00 165.32 ? 219 ASP A C   1 
ATOM 1621 O O   . ASP A 1 219 ? 192.925 -13.458 20.048 1.00 172.50 ? 219 ASP A O   1 
ATOM 1622 C CB  . ASP A 1 219 ? 194.227 -11.594 18.142 1.00 172.24 ? 219 ASP A CB  1 
ATOM 1623 C CG  . ASP A 1 219 ? 195.369 -11.405 19.124 1.00 168.80 ? 219 ASP A CG  1 
ATOM 1624 O OD1 . ASP A 1 219 ? 195.381 -10.377 19.834 1.00 173.43 ? 219 ASP A OD1 1 
ATOM 1625 O OD2 . ASP A 1 219 ? 196.247 -12.290 19.197 1.00 160.03 ? 219 ASP A OD2 1 
ATOM 1626 N N   . ILE A 1 220 ? 192.710 -11.555 21.224 1.00 152.02 ? 220 ILE A N   1 
ATOM 1627 C CA  . ILE A 1 220 ? 192.933 -12.203 22.510 1.00 135.98 ? 220 ILE A CA  1 
ATOM 1628 C C   . ILE A 1 220 ? 191.751 -13.070 22.947 1.00 131.58 ? 220 ILE A C   1 
ATOM 1629 O O   . ILE A 1 220 ? 190.585 -12.736 22.731 1.00 134.01 ? 220 ILE A O   1 
ATOM 1630 C CB  . ILE A 1 220 ? 193.253 -11.160 23.610 1.00 132.22 ? 220 ILE A CB  1 
ATOM 1631 C CG1 . ILE A 1 220 ? 193.898 -11.830 24.827 1.00 127.98 ? 220 ILE A CG1 1 
ATOM 1632 C CG2 . ILE A 1 220 ? 192.009 -10.375 24.004 1.00 133.70 ? 220 ILE A CG2 1 
ATOM 1633 C CD1 . ILE A 1 220 ? 194.212 -10.868 25.954 1.00 120.65 ? 220 ILE A CD1 1 
ATOM 1634 N N   . ARG A 1 221 ? 192.084 -14.202 23.551 1.00 130.35 ? 221 ARG A N   1 
ATOM 1635 C CA  . ARG A 1 221 ? 191.111 -15.157 24.053 1.00 117.96 ? 221 ARG A CA  1 
ATOM 1636 C C   . ARG A 1 221 ? 190.542 -14.708 25.384 1.00 111.04 ? 221 ARG A C   1 
ATOM 1637 O O   . ARG A 1 221 ? 191.268 -14.519 26.364 1.00 96.63  ? 221 ARG A O   1 
ATOM 1638 C CB  . ARG A 1 221 ? 191.781 -16.510 24.196 1.00 124.40 ? 221 ARG A CB  1 
ATOM 1639 C CG  . ARG A 1 221 ? 193.280 -16.307 24.312 1.00 136.43 ? 221 ARG A CG  1 
ATOM 1640 C CD  . ARG A 1 221 ? 194.072 -17.552 24.040 1.00 151.26 ? 221 ARG A CD  1 
ATOM 1641 N NE  . ARG A 1 221 ? 193.655 -18.081 22.775 1.00 159.71 ? 221 ARG A NE  1 
ATOM 1642 C CZ  . ARG A 1 221 ? 194.241 -19.091 22.157 1.00 162.29 ? 221 ARG A CZ  1 
ATOM 1643 N NH1 . ARG A 1 221 ? 195.348 -19.637 22.650 1.00 168.86 ? 221 ARG A NH1 1 
ATOM 1644 N NH2 . ARG A 1 221 ? 193.749 -19.501 20.996 1.00 158.79 ? 221 ARG A NH2 1 
ATOM 1645 N N   . LYS A 1 222 ? 189.229 -14.559 25.409 1.00 123.11 ? 222 LYS A N   1 
ATOM 1646 C CA  . LYS A 1 222 ? 188.536 -14.121 26.596 1.00 120.34 ? 222 LYS A CA  1 
ATOM 1647 C C   . LYS A 1 222 ? 187.967 -15.316 27.339 1.00 123.64 ? 222 LYS A C   1 
ATOM 1648 O O   . LYS A 1 222 ? 188.087 -16.460 26.890 1.00 131.01 ? 222 LYS A O   1 
ATOM 1649 C CB  . LYS A 1 222 ? 187.434 -13.141 26.215 1.00 110.31 ? 222 LYS A CB  1 
ATOM 1650 C CG  . LYS A 1 222 ? 187.939 -11.938 25.438 1.00 115.80 ? 222 LYS A CG  1 
ATOM 1651 C CD  . LYS A 1 222 ? 186.867 -10.870 25.385 1.00 122.62 ? 222 LYS A CD  1 
ATOM 1652 C CE  . LYS A 1 222 ? 187.244 -9.729  24.460 1.00 125.22 ? 222 LYS A CE  1 
ATOM 1653 N NZ  . LYS A 1 222 ? 186.197 -8.669  24.461 1.00 114.76 ? 222 LYS A NZ  1 
ATOM 1654 N N   . ALA A 1 223 ? 187.352 -15.037 28.482 1.00 119.01 ? 223 ALA A N   1 
ATOM 1655 C CA  . ALA A 1 223 ? 186.739 -16.069 29.300 1.00 108.50 ? 223 ALA A CA  1 
ATOM 1656 C C   . ALA A 1 223 ? 185.768 -15.462 30.305 1.00 119.12 ? 223 ALA A C   1 
ATOM 1657 O O   . ALA A 1 223 ? 186.058 -14.441 30.929 1.00 130.03 ? 223 ALA A O   1 
ATOM 1658 C CB  . ALA A 1 223 ? 187.804 -16.880 30.019 1.00 99.71  ? 223 ALA A CB  1 
ATOM 1659 N N   . SER A 1 224 ? 184.612 -16.100 30.452 1.00 114.59 ? 224 SER A N   1 
ATOM 1660 C CA  . SER A 1 224 ? 183.633 -15.704 31.456 1.00 90.89  ? 224 SER A CA  1 
ATOM 1661 C C   . SER A 1 224 ? 183.678 -16.680 32.627 1.00 92.03  ? 224 SER A C   1 
ATOM 1662 O O   . SER A 1 224 ? 183.394 -17.866 32.466 1.00 96.09  ? 224 SER A O   1 
ATOM 1663 C CB  . SER A 1 224 ? 182.229 -15.652 30.853 1.00 84.31  ? 224 SER A CB  1 
ATOM 1664 O OG  . SER A 1 224 ? 181.251 -15.457 31.857 1.00 110.99 ? 224 SER A OG  1 
ATOM 1665 N N   . ILE A 1 225 ? 184.038 -16.178 33.805 1.00 81.05  ? 225 ILE A N   1 
ATOM 1666 C CA  . ILE A 1 225 ? 184.271 -17.037 34.962 1.00 85.53  ? 225 ILE A CA  1 
ATOM 1667 C C   . ILE A 1 225 ? 183.004 -17.247 35.787 1.00 83.33  ? 225 ILE A C   1 
ATOM 1668 O O   . ILE A 1 225 ? 182.796 -18.320 36.356 1.00 95.49  ? 225 ILE A O   1 
ATOM 1669 C CB  . ILE A 1 225 ? 185.384 -16.461 35.860 1.00 94.08  ? 225 ILE A CB  1 
ATOM 1670 C CG1 . ILE A 1 225 ? 186.624 -16.154 35.019 1.00 89.40  ? 225 ILE A CG1 1 
ATOM 1671 C CG2 . ILE A 1 225 ? 185.729 -17.426 36.989 1.00 100.93 ? 225 ILE A CG2 1 
ATOM 1672 C CD1 . ILE A 1 225 ? 187.302 -17.388 34.465 1.00 72.08  ? 225 ILE A CD1 1 
ATOM 1673 N N   . GLY A 1 226 ? 182.155 -16.228 35.851 1.00 81.89  ? 226 GLY A N   1 
ATOM 1674 C CA  . GLY A 1 226 ? 180.886 -16.369 36.537 1.00 76.42  ? 226 GLY A CA  1 
ATOM 1675 C C   . GLY A 1 226 ? 180.462 -15.178 37.371 1.00 90.16  ? 226 GLY A C   1 
ATOM 1676 O O   . GLY A 1 226 ? 181.283 -14.360 37.786 1.00 92.69  ? 226 GLY A O   1 
ATOM 1677 N N   . ILE A 1 227 ? 179.160 -15.093 37.619 1.00 85.69  ? 227 ILE A N   1 
ATOM 1678 C CA  . ILE A 1 227 ? 178.588 -14.023 38.421 1.00 75.62  ? 227 ILE A CA  1 
ATOM 1679 C C   . ILE A 1 227 ? 178.161 -14.558 39.783 1.00 74.63  ? 227 ILE A C   1 
ATOM 1680 O O   . ILE A 1 227 ? 177.623 -15.659 39.880 1.00 96.85  ? 227 ILE A O   1 
ATOM 1681 C CB  . ILE A 1 227 ? 177.370 -13.387 37.720 1.00 86.61  ? 227 ILE A CB  1 
ATOM 1682 C CG1 . ILE A 1 227 ? 177.712 -13.038 36.270 1.00 86.49  ? 227 ILE A CG1 1 
ATOM 1683 C CG2 . ILE A 1 227 ? 176.885 -12.161 38.483 1.00 85.08  ? 227 ILE A CG2 1 
ATOM 1684 C CD1 . ILE A 1 227 ? 176.585 -13.303 35.296 1.00 91.12  ? 227 ILE A CD1 1 
ATOM 1685 N N   . VAL A 1 228 ? 178.418 -13.788 40.834 1.00 73.61  ? 228 VAL A N   1 
ATOM 1686 C CA  . VAL A 1 228 ? 177.878 -14.101 42.151 1.00 74.93  ? 228 VAL A CA  1 
ATOM 1687 C C   . VAL A 1 228 ? 177.077 -12.901 42.631 1.00 79.70  ? 228 VAL A C   1 
ATOM 1688 O O   . VAL A 1 228 ? 177.395 -11.761 42.292 1.00 84.70  ? 228 VAL A O   1 
ATOM 1689 C CB  . VAL A 1 228 ? 178.980 -14.455 43.168 1.00 65.89  ? 228 VAL A CB  1 
ATOM 1690 C CG1 . VAL A 1 228 ? 179.726 -15.703 42.725 1.00 67.92  ? 228 VAL A CG1 1 
ATOM 1691 C CG2 . VAL A 1 228 ? 179.939 -13.294 43.348 1.00 92.87  ? 228 VAL A CG2 1 
ATOM 1692 N N   . CYS A 1 229 ? 176.029 -13.153 43.406 1.00 74.04  ? 229 CYS A N   1 
ATOM 1693 C CA  . CYS A 1 229 ? 175.119 -12.083 43.787 1.00 81.32  ? 229 CYS A CA  1 
ATOM 1694 C C   . CYS A 1 229 ? 174.857 -12.009 45.282 1.00 96.79  ? 229 CYS A C   1 
ATOM 1695 O O   . CYS A 1 229 ? 174.609 -13.021 45.938 1.00 115.89 ? 229 CYS A O   1 
ATOM 1696 C CB  . CYS A 1 229 ? 173.786 -12.238 43.052 1.00 86.01  ? 229 CYS A CB  1 
ATOM 1697 S SG  . CYS A 1 229 ? 173.915 -12.213 41.252 1.00 90.38  ? 229 CYS A SG  1 
ATOM 1698 N N   . GLY A 1 230 ? 174.930 -10.793 45.810 1.00 82.71  ? 230 GLY A N   1 
ATOM 1699 C CA  . GLY A 1 230 ? 174.371 -10.488 47.110 1.00 80.25  ? 230 GLY A CA  1 
ATOM 1700 C C   . GLY A 1 230 ? 172.991 -9.931  46.832 1.00 92.40  ? 230 GLY A C   1 
ATOM 1701 O O   . GLY A 1 230 ? 172.582 -9.851  45.673 1.00 97.46  ? 230 GLY A O   1 
ATOM 1702 N N   . GLY A 1 231 ? 172.271 -9.542  47.876 1.00 86.28  ? 231 GLY A N   1 
ATOM 1703 C CA  . GLY A 1 231 ? 170.935 -9.002  47.703 1.00 86.69  ? 231 GLY A CA  1 
ATOM 1704 C C   . GLY A 1 231 ? 170.911 -7.702  46.920 1.00 103.89 ? 231 GLY A C   1 
ATOM 1705 O O   . GLY A 1 231 ? 169.941 -7.408  46.220 1.00 104.11 ? 231 GLY A O   1 
ATOM 1706 N N   . HIS A 1 232 ? 171.985 -6.927  47.025 1.00 104.43 ? 232 HIS A N   1 
ATOM 1707 C CA  . HIS A 1 232 ? 172.017 -5.594  46.436 1.00 102.40 ? 232 HIS A CA  1 
ATOM 1708 C C   . HIS A 1 232 ? 173.217 -5.370  45.520 1.00 93.99  ? 232 HIS A C   1 
ATOM 1709 O O   . HIS A 1 232 ? 173.302 -4.343  44.848 1.00 96.32  ? 232 HIS A O   1 
ATOM 1710 C CB  . HIS A 1 232 ? 172.004 -4.537  47.541 1.00 113.68 ? 232 HIS A CB  1 
ATOM 1711 C CG  . HIS A 1 232 ? 170.753 -4.543  48.362 1.00 119.75 ? 232 HIS A CG  1 
ATOM 1712 N ND1 . HIS A 1 232 ? 169.768 -3.587  48.225 1.00 119.98 ? 232 HIS A ND1 1 
ATOM 1713 C CD2 . HIS A 1 232 ? 170.320 -5.392  49.323 1.00 120.37 ? 232 HIS A CD2 1 
ATOM 1714 C CE1 . HIS A 1 232 ? 168.787 -3.846  49.069 1.00 124.52 ? 232 HIS A CE1 1 
ATOM 1715 N NE2 . HIS A 1 232 ? 169.096 -4.936  49.748 1.00 124.03 ? 232 HIS A NE2 1 
ATOM 1716 N N   . HIS A 1 233 ? 174.142 -6.323  45.494 1.00 80.79  ? 233 HIS A N   1 
ATOM 1717 C CA  . HIS A 1 233 ? 175.289 -6.235  44.595 1.00 74.27  ? 233 HIS A CA  1 
ATOM 1718 C C   . HIS A 1 233 ? 175.470 -7.522  43.801 1.00 76.39  ? 233 HIS A C   1 
ATOM 1719 O O   . HIS A 1 233 ? 175.339 -8.620  44.340 1.00 85.60  ? 233 HIS A O   1 
ATOM 1720 C CB  . HIS A 1 233 ? 176.570 -5.922  45.371 1.00 78.35  ? 233 HIS A CB  1 
ATOM 1721 C CG  . HIS A 1 233 ? 176.398 -4.875  46.425 1.00 82.62  ? 233 HIS A CG  1 
ATOM 1722 N ND1 . HIS A 1 233 ? 176.009 -5.176  47.713 1.00 93.44  ? 233 HIS A ND1 1 
ATOM 1723 C CD2 . HIS A 1 233 ? 176.559 -3.531  46.386 1.00 72.90  ? 233 HIS A CD2 1 
ATOM 1724 C CE1 . HIS A 1 233 ? 175.938 -4.062  48.421 1.00 86.13  ? 233 HIS A CE1 1 
ATOM 1725 N NE2 . HIS A 1 233 ? 176.268 -3.051  47.639 1.00 90.46  ? 233 HIS A NE2 1 
ATOM 1726 N N   . LYS A 1 234 ? 175.770 -7.377  42.515 1.00 77.16  ? 234 LYS A N   1 
ATOM 1727 C CA  . LYS A 1 234 ? 176.036 -8.519  41.652 1.00 74.42  ? 234 LYS A CA  1 
ATOM 1728 C C   . LYS A 1 234 ? 177.424 -8.372  41.037 1.00 84.91  ? 234 LYS A C   1 
ATOM 1729 O O   . LYS A 1 234 ? 177.697 -7.400  40.335 1.00 100.91 ? 234 LYS A O   1 
ATOM 1730 C CB  . LYS A 1 234 ? 174.964 -8.637  40.565 1.00 67.27  ? 234 LYS A CB  1 
ATOM 1731 C CG  . LYS A 1 234 ? 173.553 -8.359  41.068 1.00 73.05  ? 234 LYS A CG  1 
ATOM 1732 C CD  . LYS A 1 234 ? 172.493 -8.849  40.094 1.00 95.74  ? 234 LYS A CD  1 
ATOM 1733 C CE  . LYS A 1 234 ? 172.480 -8.032  38.815 1.00 102.39 ? 234 LYS A CE  1 
ATOM 1734 N NZ  . LYS A 1 234 ? 171.319 -8.387  37.949 1.00 97.88  ? 234 LYS A NZ  1 
ATOM 1735 N N   . ILE A 1 235 ? 178.304 -9.331  41.312 1.00 86.43  ? 235 ILE A N   1 
ATOM 1736 C CA  . ILE A 1 235 ? 179.694 -9.224  40.880 1.00 75.51  ? 235 ILE A CA  1 
ATOM 1737 C C   . ILE A 1 235 ? 180.059 -10.274 39.837 1.00 76.37  ? 235 ILE A C   1 
ATOM 1738 O O   . ILE A 1 235 ? 180.119 -11.468 40.131 1.00 92.43  ? 235 ILE A O   1 
ATOM 1739 C CB  . ILE A 1 235 ? 180.663 -9.350  42.068 1.00 79.45  ? 235 ILE A CB  1 
ATOM 1740 C CG1 . ILE A 1 235 ? 180.237 -8.419  43.203 1.00 87.47  ? 235 ILE A CG1 1 
ATOM 1741 C CG2 . ILE A 1 235 ? 182.083 -9.037  41.631 1.00 76.84  ? 235 ILE A CG2 1 
ATOM 1742 C CD1 . ILE A 1 235 ? 179.820 -9.150  44.452 1.00 99.59  ? 235 ILE A CD1 1 
ATOM 1743 N N   . GLN A 1 236 ? 180.315 -9.806  38.620 1.00 75.48  ? 236 GLN A N   1 
ATOM 1744 C CA  . GLN A 1 236 ? 180.656 -10.669 37.496 1.00 81.94  ? 236 GLN A CA  1 
ATOM 1745 C C   . GLN A 1 236 ? 182.162 -10.673 37.242 1.00 88.84  ? 236 GLN A C   1 
ATOM 1746 O O   . GLN A 1 236 ? 182.802 -9.623  37.268 1.00 87.55  ? 236 GLN A O   1 
ATOM 1747 C CB  . GLN A 1 236 ? 179.904 -10.209 36.245 1.00 76.89  ? 236 GLN A CB  1 
ATOM 1748 C CG  . GLN A 1 236 ? 180.537 -10.609 34.927 1.00 83.25  ? 236 GLN A CG  1 
ATOM 1749 C CD  . GLN A 1 236 ? 179.872 -9.934  33.745 1.00 97.07  ? 236 GLN A CD  1 
ATOM 1750 O OE1 . GLN A 1 236 ? 180.033 -8.733  33.530 1.00 117.33 ? 236 GLN A OE1 1 
ATOM 1751 N NE2 . GLN A 1 236 ? 179.115 -10.705 32.971 1.00 83.35  ? 236 GLN A NE2 1 
ATOM 1752 N N   . MET A 1 237 ? 182.727 -11.853 37.000 1.00 91.16  ? 237 MET A N   1 
ATOM 1753 C CA  . MET A 1 237 ? 184.158 -11.964 36.733 1.00 85.26  ? 237 MET A CA  1 
ATOM 1754 C C   . MET A 1 237 ? 184.435 -12.335 35.280 1.00 90.21  ? 237 MET A C   1 
ATOM 1755 O O   . MET A 1 237 ? 183.960 -13.359 34.789 1.00 89.78  ? 237 MET A O   1 
ATOM 1756 C CB  . MET A 1 237 ? 184.803 -12.993 37.662 1.00 77.15  ? 237 MET A CB  1 
ATOM 1757 C CG  . MET A 1 237 ? 186.303 -12.804 37.836 1.00 76.48  ? 237 MET A CG  1 
ATOM 1758 S SD  . MET A 1 237 ? 187.152 -14.283 38.424 1.00 96.51  ? 237 MET A SD  1 
ATOM 1759 C CE  . MET A 1 237 ? 186.571 -14.374 40.116 1.00 61.08  ? 237 MET A CE  1 
ATOM 1760 N N   . LEU A 1 238 ? 185.210 -11.495 34.601 1.00 88.55  ? 238 LEU A N   1 
ATOM 1761 C CA  . LEU A 1 238 ? 185.606 -11.747 33.220 1.00 80.11  ? 238 LEU A CA  1 
ATOM 1762 C C   . LEU A 1 238 ? 187.127 -11.746 33.108 1.00 83.60  ? 238 LEU A C   1 
ATOM 1763 O O   . LEU A 1 238 ? 187.805 -11.023 33.838 1.00 96.15  ? 238 LEU A O   1 
ATOM 1764 C CB  . LEU A 1 238 ? 185.003 -10.699 32.283 1.00 97.95  ? 238 LEU A CB  1 
ATOM 1765 C CG  . LEU A 1 238 ? 183.501 -10.434 32.407 1.00 109.44 ? 238 LEU A CG  1 
ATOM 1766 C CD1 . LEU A 1 238 ? 183.075 -9.307  31.476 1.00 107.48 ? 238 LEU A CD1 1 
ATOM 1767 C CD2 . LEU A 1 238 ? 182.705 -11.698 32.123 1.00 120.46 ? 238 LEU A CD2 1 
ATOM 1768 N N   . ALA A 1 239 ? 187.664 -12.549 32.194 1.00 87.47  ? 239 ALA A N   1 
ATOM 1769 C CA  . ALA A 1 239 ? 189.112 -12.674 32.064 1.00 77.79  ? 239 ALA A CA  1 
ATOM 1770 C C   . ALA A 1 239 ? 189.579 -12.782 30.616 1.00 75.97  ? 239 ALA A C   1 
ATOM 1771 O O   . ALA A 1 239 ? 188.830 -13.201 29.734 1.00 80.49  ? 239 ALA A O   1 
ATOM 1772 C CB  . ALA A 1 239 ? 189.603 -13.876 32.857 1.00 67.42  ? 239 ALA A CB  1 
ATOM 1773 N N   . ALA A 1 240 ? 190.831 -12.397 30.389 1.00 69.57  ? 240 ALA A N   1 
ATOM 1774 C CA  . ALA A 1 240 ? 191.473 -12.519 29.086 1.00 81.27  ? 240 ALA A CA  1 
ATOM 1775 C C   . ALA A 1 240 ? 192.973 -12.696 29.285 1.00 85.35  ? 240 ALA A C   1 
ATOM 1776 O O   . ALA A 1 240 ? 193.545 -12.137 30.221 1.00 84.37  ? 240 ALA A O   1 
ATOM 1777 C CB  . ALA A 1 240 ? 191.185 -11.301 28.225 1.00 79.88  ? 240 ALA A CB  1 
ATOM 1778 N N   . SER A 1 241 ? 193.610 -13.474 28.414 1.00 85.71  ? 241 SER A N   1 
ATOM 1779 C CA  . SER A 1 241 ? 195.040 -13.731 28.551 1.00 95.96  ? 241 SER A CA  1 
ATOM 1780 C C   . SER A 1 241 ? 195.697 -14.219 27.266 1.00 94.56  ? 241 SER A C   1 
ATOM 1781 O O   . SER A 1 241 ? 195.147 -15.053 26.548 1.00 96.94  ? 241 SER A O   1 
ATOM 1782 C CB  . SER A 1 241 ? 195.290 -14.755 29.661 1.00 94.07  ? 241 SER A CB  1 
ATOM 1783 O OG  . SER A 1 241 ? 196.676 -15.008 29.813 1.00 94.29  ? 241 SER A OG  1 
ATOM 1784 N N   . GLN A 1 242 ? 196.887 -13.693 26.995 1.00 97.55  ? 242 GLN A N   1 
ATOM 1785 C CA  . GLN A 1 242 ? 197.724 -14.182 25.907 1.00 102.95 ? 242 GLN A CA  1 
ATOM 1786 C C   . GLN A 1 242 ? 198.215 -15.591 26.222 1.00 98.70  ? 242 GLN A C   1 
ATOM 1787 O O   . GLN A 1 242 ? 198.621 -16.335 25.330 1.00 111.49 ? 242 GLN A O   1 
ATOM 1788 C CB  . GLN A 1 242 ? 198.922 -13.254 25.686 1.00 106.49 ? 242 GLN A CB  1 
ATOM 1789 C CG  . GLN A 1 242 ? 198.571 -11.794 25.461 1.00 115.15 ? 242 GLN A CG  1 
ATOM 1790 C CD  . GLN A 1 242 ? 198.250 -11.482 24.014 1.00 134.87 ? 242 GLN A CD  1 
ATOM 1791 O OE1 . GLN A 1 242 ? 197.985 -12.381 23.216 1.00 142.19 ? 242 GLN A OE1 1 
ATOM 1792 N NE2 . GLN A 1 242 ? 198.279 -10.201 23.666 1.00 141.05 ? 242 GLN A NE2 1 
ATOM 1793 N N   . TYR A 1 243 ? 198.163 -15.949 27.500 1.00 86.05  ? 243 TYR A N   1 
ATOM 1794 C CA  . TYR A 1 243 ? 198.802 -17.158 27.999 1.00 99.95  ? 243 TYR A CA  1 
ATOM 1795 C C   . TYR A 1 243 ? 197.865 -18.361 28.073 1.00 101.60 ? 243 TYR A C   1 
ATOM 1796 O O   . TYR A 1 243 ? 198.043 -19.239 28.914 1.00 109.25 ? 243 TYR A O   1 
ATOM 1797 C CB  . TYR A 1 243 ? 199.402 -16.872 29.377 1.00 96.82  ? 243 TYR A CB  1 
ATOM 1798 C CG  . TYR A 1 243 ? 200.247 -15.619 29.393 1.00 88.28  ? 243 TYR A CG  1 
ATOM 1799 C CD1 . TYR A 1 243 ? 201.206 -15.396 28.415 1.00 88.08  ? 243 TYR A CD1 1 
ATOM 1800 C CD2 . TYR A 1 243 ? 200.065 -14.646 30.365 1.00 83.61  ? 243 TYR A CD2 1 
ATOM 1801 C CE1 . TYR A 1 243 ? 201.978 -14.250 28.417 1.00 97.12  ? 243 TYR A CE1 1 
ATOM 1802 C CE2 . TYR A 1 243 ? 200.831 -13.494 30.376 1.00 79.59  ? 243 TYR A CE2 1 
ATOM 1803 C CZ  . TYR A 1 243 ? 201.785 -13.301 29.398 1.00 89.03  ? 243 TYR A CZ  1 
ATOM 1804 O OH  . TYR A 1 243 ? 202.551 -12.157 29.399 1.00 99.25  ? 243 TYR A OH  1 
ATOM 1805 N N   . LEU A 1 244 ? 196.873 -18.396 27.189 1.00 111.78 ? 244 LEU A N   1 
ATOM 1806 C CA  . LEU A 1 244 ? 195.964 -19.534 27.082 1.00 118.89 ? 244 LEU A CA  1 
ATOM 1807 C C   . LEU A 1 244 ? 196.160 -20.238 25.738 1.00 134.88 ? 244 LEU A C   1 
ATOM 1808 O O   . LEU A 1 244 ? 196.567 -19.623 24.754 1.00 138.05 ? 244 LEU A O   1 
ATOM 1809 C CB  . LEU A 1 244 ? 194.513 -19.085 27.245 1.00 101.24 ? 244 LEU A CB  1 
ATOM 1810 C CG  . LEU A 1 244 ? 194.105 -18.733 28.677 1.00 91.59  ? 244 LEU A CG  1 
ATOM 1811 C CD1 . LEU A 1 244 ? 192.713 -18.121 28.737 1.00 89.03  ? 244 LEU A CD1 1 
ATOM 1812 C CD2 . LEU A 1 244 ? 194.176 -19.965 29.570 1.00 91.54  ? 244 LEU A CD2 1 
ATOM 1813 N N   . LYS A 1 245 ? 195.875 -21.533 25.709 1.00 142.84 ? 245 LYS A N   1 
ATOM 1814 C CA  . LYS A 1 245 ? 196.124 -22.319 24.514 1.00 150.19 ? 245 LYS A CA  1 
ATOM 1815 C C   . LYS A 1 245 ? 194.862 -22.442 23.667 1.00 153.64 ? 245 LYS A C   1 
ATOM 1816 O O   . LYS A 1 245 ? 194.943 -22.524 22.443 1.00 155.88 ? 245 LYS A O   1 
ATOM 1817 C CB  . LYS A 1 245 ? 196.665 -23.706 24.871 1.00 148.02 ? 245 LYS A CB  1 
ATOM 1818 N N   . GLN A 1 246 ? 193.712 -22.474 24.337 1.00 152.79 ? 246 GLN A N   1 
ATOM 1819 C CA  . GLN A 1 246 ? 192.389 -22.342 23.718 1.00 136.09 ? 246 GLN A CA  1 
ATOM 1820 C C   . GLN A 1 246 ? 191.300 -22.452 24.793 1.00 122.26 ? 246 GLN A C   1 
ATOM 1821 O O   . GLN A 1 246 ? 190.462 -23.351 24.757 1.00 115.18 ? 246 GLN A O   1 
ATOM 1822 C CB  . GLN A 1 246 ? 192.134 -23.388 22.619 1.00 119.93 ? 246 GLN A CB  1 
ATOM 1823 N N   . ARG A 1 277 ? 186.508 8.927   29.828 1.00 156.39 ? 649 ARG A N   1 
ATOM 1824 C CA  . ARG A 1 277 ? 186.183 9.967   30.795 1.00 146.22 ? 649 ARG A CA  1 
ATOM 1825 C C   . ARG A 1 277 ? 187.118 9.961   32.004 1.00 139.36 ? 649 ARG A C   1 
ATOM 1826 O O   . ARG A 1 277 ? 188.134 10.656  32.019 1.00 134.77 ? 649 ARG A O   1 
ATOM 1827 C CB  . ARG A 1 277 ? 184.734 9.819   31.269 1.00 122.81 ? 649 ARG A CB  1 
ATOM 1828 N N   . HIS A 1 278 ? 186.776 9.152   33.003 1.00 116.20 ? 650 HIS A N   1 
ATOM 1829 C CA  . HIS A 1 278 ? 187.325 9.304   34.348 1.00 108.80 ? 650 HIS A CA  1 
ATOM 1830 C C   . HIS A 1 278 ? 187.667 7.958   35.005 1.00 113.62 ? 650 HIS A C   1 
ATOM 1831 O O   . HIS A 1 278 ? 186.791 7.112   35.185 1.00 107.06 ? 650 HIS A O   1 
ATOM 1832 C CB  . HIS A 1 278 ? 186.310 10.088  35.187 1.00 117.36 ? 650 HIS A CB  1 
ATOM 1833 C CG  . HIS A 1 278 ? 186.620 10.132  36.653 1.00 127.73 ? 650 HIS A CG  1 
ATOM 1834 N ND1 . HIS A 1 278 ? 187.899 10.227  37.141 1.00 138.32 ? 650 HIS A ND1 1 
ATOM 1835 C CD2 . HIS A 1 278 ? 185.798 10.113  37.727 1.00 127.64 ? 650 HIS A CD2 1 
ATOM 1836 C CE1 . HIS A 1 278 ? 187.860 10.255  38.465 1.00 142.23 ? 650 HIS A CE1 1 
ATOM 1837 N NE2 . HIS A 1 278 ? 186.598 10.187  38.844 1.00 131.68 ? 650 HIS A NE2 1 
ATOM 1838 N N   . TYR A 1 279 ? 188.936 7.765   35.367 1.00 120.80 ? 651 TYR A N   1 
ATOM 1839 C CA  . TYR A 1 279 ? 189.392 6.464   35.870 1.00 112.67 ? 651 TYR A CA  1 
ATOM 1840 C C   . TYR A 1 279 ? 190.344 6.531   37.066 1.00 102.13 ? 651 TYR A C   1 
ATOM 1841 O O   . TYR A 1 279 ? 190.822 7.600   37.441 1.00 106.80 ? 651 TYR A O   1 
ATOM 1842 C CB  . TYR A 1 279 ? 190.070 5.681   34.744 1.00 86.82  ? 651 TYR A CB  1 
ATOM 1843 C CG  . TYR A 1 279 ? 189.198 5.497   33.530 1.00 97.96  ? 651 TYR A CG  1 
ATOM 1844 C CD1 . TYR A 1 279 ? 188.139 4.602   33.546 1.00 106.74 ? 651 TYR A CD1 1 
ATOM 1845 C CD2 . TYR A 1 279 ? 189.427 6.223   32.369 1.00 104.71 ? 651 TYR A CD2 1 
ATOM 1846 C CE1 . TYR A 1 279 ? 187.333 4.431   32.440 1.00 103.45 ? 651 TYR A CE1 1 
ATOM 1847 C CE2 . TYR A 1 279 ? 188.627 6.059   31.256 1.00 110.32 ? 651 TYR A CE2 1 
ATOM 1848 C CZ  . TYR A 1 279 ? 187.581 5.161   31.298 1.00 106.74 ? 651 TYR A CZ  1 
ATOM 1849 O OH  . TYR A 1 279 ? 186.781 4.992   30.193 1.00 115.13 ? 651 TYR A OH  1 
ATOM 1850 N N   . GLY A 1 280 ? 190.615 5.366   37.651 1.00 91.18  ? 652 GLY A N   1 
ATOM 1851 C CA  . GLY A 1 280 ? 191.536 5.246   38.768 1.00 100.73 ? 652 GLY A CA  1 
ATOM 1852 C C   . GLY A 1 280 ? 192.581 4.175   38.508 1.00 111.98 ? 652 GLY A C   1 
ATOM 1853 O O   . GLY A 1 280 ? 192.432 3.371   37.586 1.00 107.88 ? 652 GLY A O   1 
ATOM 1854 N N   . ARG A 1 281 ? 193.634 4.152   39.322 1.00 121.37 ? 653 ARG A N   1 
ATOM 1855 C CA  . ARG A 1 281 ? 194.767 3.272   39.051 1.00 108.97 ? 653 ARG A CA  1 
ATOM 1856 C C   . ARG A 1 281 ? 195.730 3.090   40.227 1.00 94.94  ? 653 ARG A C   1 
ATOM 1857 O O   . ARG A 1 281 ? 195.959 4.010   41.012 1.00 104.76 ? 653 ARG A O   1 
ATOM 1858 C CB  . ARG A 1 281 ? 195.546 3.805   37.842 1.00 98.77  ? 653 ARG A CB  1 
ATOM 1859 C CG  . ARG A 1 281 ? 196.768 2.989   37.456 1.00 87.24  ? 653 ARG A CG  1 
ATOM 1860 C CD  . ARG A 1 281 ? 197.432 3.548   36.212 1.00 93.95  ? 653 ARG A CD  1 
ATOM 1861 N NE  . ARG A 1 281 ? 196.588 3.388   35.032 1.00 100.48 ? 653 ARG A NE  1 
ATOM 1862 C CZ  . ARG A 1 281 ? 197.044 3.379   33.783 1.00 96.03  ? 653 ARG A CZ  1 
ATOM 1863 N NH1 . ARG A 1 281 ? 198.341 3.520   33.547 1.00 88.40  ? 653 ARG A NH1 1 
ATOM 1864 N NH2 . ARG A 1 281 ? 196.202 3.226   32.771 1.00 102.03 ? 653 ARG A NH2 1 
ATOM 1865 N N   . VAL A 1 282 ? 196.274 1.881   40.341 1.00 88.34  ? 654 VAL A N   1 
ATOM 1866 C CA  . VAL A 1 282 ? 197.475 1.629   41.126 1.00 88.83  ? 654 VAL A CA  1 
ATOM 1867 C C   . VAL A 1 282 ? 198.519 1.079   40.159 1.00 88.81  ? 654 VAL A C   1 
ATOM 1868 O O   . VAL A 1 282 ? 198.460 -0.089  39.775 1.00 92.12  ? 654 VAL A O   1 
ATOM 1869 C CB  . VAL A 1 282 ? 197.231 0.640   42.282 1.00 79.96  ? 654 VAL A CB  1 
ATOM 1870 C CG1 . VAL A 1 282 ? 198.542 0.275   42.957 1.00 62.17  ? 654 VAL A CG1 1 
ATOM 1871 C CG2 . VAL A 1 282 ? 196.259 1.231   43.289 1.00 83.79  ? 654 VAL A CG2 1 
ATOM 1872 N N   . SER A 1 283 ? 199.460 1.932   39.759 1.00 92.89  ? 655 SER A N   1 
ATOM 1873 C CA  . SER A 1 283 ? 200.364 1.644   38.643 1.00 98.39  ? 655 SER A CA  1 
ATOM 1874 C C   . SER A 1 283 ? 201.113 0.316   38.748 1.00 94.33  ? 655 SER A C   1 
ATOM 1875 O O   . SER A 1 283 ? 201.139 -0.456  37.792 1.00 84.68  ? 655 SER A O   1 
ATOM 1876 C CB  . SER A 1 283 ? 201.375 2.784   38.485 1.00 92.44  ? 655 SER A CB  1 
ATOM 1877 O OG  . SER A 1 283 ? 200.769 3.924   37.893 1.00 103.35 ? 655 SER A OG  1 
ATOM 1878 N N   . SER A 1 284 ? 201.719 0.046   39.900 1.00 94.78  ? 656 SER A N   1 
ATOM 1879 C CA  . SER A 1 284 ? 202.510 -1.171  40.053 1.00 91.69  ? 656 SER A CA  1 
ATOM 1880 C C   . SER A 1 284 ? 202.372 -1.782  41.444 1.00 92.85  ? 656 SER A C   1 
ATOM 1881 O O   . SER A 1 284 ? 202.718 -1.159  42.447 1.00 103.87 ? 656 SER A O   1 
ATOM 1882 C CB  . SER A 1 284 ? 203.987 -0.888  39.753 1.00 73.72  ? 656 SER A CB  1 
ATOM 1883 O OG  . SER A 1 284 ? 204.834 -1.815  40.408 1.00 92.96  ? 656 SER A OG  1 
ATOM 1884 N N   . ILE A 1 285 ? 201.878 -3.015  41.486 1.00 76.40  ? 657 ILE A N   1 
ATOM 1885 C CA  . ILE A 1 285 ? 201.728 -3.756  42.734 1.00 86.67  ? 657 ILE A CA  1 
ATOM 1886 C C   . ILE A 1 285 ? 203.094 -4.162  43.271 1.00 88.56  ? 657 ILE A C   1 
ATOM 1887 O O   . ILE A 1 285 ? 203.313 -4.189  44.483 1.00 84.53  ? 657 ILE A O   1 
ATOM 1888 C CB  . ILE A 1 285 ? 200.848 -5.004  42.532 1.00 86.49  ? 657 ILE A CB  1 
ATOM 1889 C CG1 . ILE A 1 285 ? 199.453 -4.580  42.080 1.00 92.42  ? 657 ILE A CG1 1 
ATOM 1890 C CG2 . ILE A 1 285 ? 200.755 -5.826  43.813 1.00 86.97  ? 657 ILE A CG2 1 
ATOM 1891 C CD1 . ILE A 1 285 ? 198.601 -5.718  41.604 1.00 121.47 ? 657 ILE A CD1 1 
ATOM 1892 N N   . LEU A 1 286 ? 204.012 -4.466  42.358 1.00 89.29  ? 658 LEU A N   1 
ATOM 1893 C CA  . LEU A 1 286 ? 205.384 -4.806  42.724 1.00 91.90  ? 658 LEU A CA  1 
ATOM 1894 C C   . LEU A 1 286 ? 206.045 -3.673  43.501 1.00 86.13  ? 658 LEU A C   1 
ATOM 1895 O O   . LEU A 1 286 ? 206.718 -3.907  44.505 1.00 89.84  ? 658 LEU A O   1 
ATOM 1896 C CB  . LEU A 1 286 ? 206.210 -5.139  41.478 1.00 93.00  ? 658 LEU A CB  1 
ATOM 1897 C CG  . LEU A 1 286 ? 206.007 -6.534  40.883 1.00 93.86  ? 658 LEU A CG  1 
ATOM 1898 C CD1 . LEU A 1 286 ? 206.713 -6.662  39.543 1.00 74.77  ? 658 LEU A CD1 1 
ATOM 1899 C CD2 . LEU A 1 286 ? 206.498 -7.596  41.853 1.00 103.11 ? 658 LEU A CD2 1 
ATOM 1900 N N   . ASP A 1 287 ? 205.841 -2.444  43.035 1.00 100.70 ? 659 ASP A N   1 
ATOM 1901 C CA  . ASP A 1 287 ? 206.415 -1.273  43.688 1.00 99.53  ? 659 ASP A CA  1 
ATOM 1902 C C   . ASP A 1 287 ? 205.772 -1.010  45.047 1.00 103.24 ? 659 ASP A C   1 
ATOM 1903 O O   . ASP A 1 287 ? 206.454 -0.630  45.999 1.00 117.95 ? 659 ASP A O   1 
ATOM 1904 C CB  . ASP A 1 287 ? 206.275 -0.037  42.795 1.00 87.45  ? 659 ASP A CB  1 
ATOM 1905 C CG  . ASP A 1 287 ? 207.202 -0.077  41.595 1.00 116.11 ? 659 ASP A CG  1 
ATOM 1906 O OD1 . ASP A 1 287 ? 208.156 -0.884  41.604 1.00 123.76 ? 659 ASP A OD1 1 
ATOM 1907 O OD2 . ASP A 1 287 ? 206.980 0.703   40.644 1.00 118.30 ? 659 ASP A OD2 1 
ATOM 1908 N N   . VAL A 1 288 ? 204.460 -1.214  45.130 1.00 102.28 ? 660 VAL A N   1 
ATOM 1909 C CA  . VAL A 1 288 ? 203.719 -1.008  46.373 1.00 88.71  ? 660 VAL A CA  1 
ATOM 1910 C C   . VAL A 1 288 ? 204.229 -1.929  47.483 1.00 102.37 ? 660 VAL A C   1 
ATOM 1911 O O   . VAL A 1 288 ? 204.294 -1.538  48.650 1.00 98.04  ? 660 VAL A O   1 
ATOM 1912 C CB  . VAL A 1 288 ? 202.201 -1.233  46.164 1.00 77.41  ? 660 VAL A CB  1 
ATOM 1913 C CG1 . VAL A 1 288 ? 201.459 -1.225  47.491 1.00 79.07  ? 660 VAL A CG1 1 
ATOM 1914 C CG2 . VAL A 1 288 ? 201.632 -0.172  45.241 1.00 92.80  ? 660 VAL A CG2 1 
ATOM 1915 N N   . ALA A 1 289 ? 204.617 -3.145  47.108 1.00 101.37 ? 661 ALA A N   1 
ATOM 1916 C CA  . ALA A 1 289 ? 205.096 -4.131  48.073 1.00 76.06  ? 661 ALA A CA  1 
ATOM 1917 C C   . ALA A 1 289 ? 206.509 -3.820  48.567 1.00 100.05 ? 661 ALA A C   1 
ATOM 1918 O O   . ALA A 1 289 ? 207.025 -4.495  49.460 1.00 114.42 ? 661 ALA A O   1 
ATOM 1919 C CB  . ALA A 1 289 ? 205.046 -5.522  47.465 1.00 64.13  ? 661 ALA A CB  1 
ATOM 1920 N N   . GLY A 1 290 ? 207.130 -2.801  47.982 1.00 103.20 ? 662 GLY A N   1 
ATOM 1921 C CA  . GLY A 1 290 ? 208.466 -2.391  48.377 1.00 95.19  ? 662 GLY A CA  1 
ATOM 1922 C C   . GLY A 1 290 ? 208.514 -0.950  48.847 1.00 107.13 ? 662 GLY A C   1 
ATOM 1923 O O   . GLY A 1 290 ? 208.580 -0.680  50.047 1.00 109.26 ? 662 GLY A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . SER A 19  ? 2.0858 1.9894 1.7191 -0.0963 0.0444  0.2025  19  SER A N   
2    C CA  . SER A 19  ? 2.0494 1.9376 1.7362 -0.0987 0.0446  0.1949  19  SER A CA  
3    C C   . SER A 19  ? 1.8868 1.7762 1.5928 -0.1167 0.0707  0.1970  19  SER A C   
4    O O   . SER A 19  ? 1.7819 1.6601 1.5284 -0.1225 0.0727  0.1931  19  SER A O   
5    C CB  . SER A 19  ? 2.1262 1.9803 1.8227 -0.0900 0.0273  0.2151  19  SER A CB  
6    O OG  . SER A 19  ? 2.0469 1.8820 1.7021 -0.0895 0.0273  0.2494  19  SER A OG  
7    N N   . GLN A 20  ? 1.5978 1.5057 1.2762 -0.1256 0.0906  0.1999  20  GLN A N   
8    C CA  . GLN A 20  ? 1.2848 1.2087 0.9897 -0.1405 0.1158  0.1932  20  GLN A CA  
9    C C   . GLN A 20  ? 1.4119 1.3595 1.1542 -0.1344 0.1141  0.1612  20  GLN A C   
10   O O   . GLN A 20  ? 1.6287 1.5853 1.3624 -0.1222 0.1025  0.1438  20  GLN A O   
11   C CB  . GLN A 20  ? 1.2035 1.1448 0.8699 -0.1495 0.1396  0.2018  20  GLN A CB  
12   C CG  . GLN A 20  ? 1.4905 1.4436 1.1831 -0.1680 0.1684  0.2066  20  GLN A CG  
13   C CD  . GLN A 20  ? 1.5993 1.5213 1.3025 -0.1823 0.1732  0.2354  20  GLN A CD  
14   O OE1 . GLN A 20  ? 1.6205 1.5076 1.3097 -0.1765 0.1556  0.2538  20  GLN A OE1 
15   N NE2 . GLN A 20  ? 1.3459 1.2804 1.0777 -0.2013 0.1980  0.2387  20  GLN A NE2 
16   N N   . TRP A 21  ? 1.3798 1.3377 1.1645 -0.1428 0.1250  0.1542  21  TRP A N   
17   C CA  . TRP A 21  ? 1.0286 1.0089 0.8467 -0.1353 0.1244  0.1293  21  TRP A CA  
18   C C   . TRP A 21  ? 1.1348 1.1371 0.9342 -0.1287 0.1356  0.1137  21  TRP A C   
19   O O   . TRP A 21  ? 1.1016 1.1094 0.9099 -0.1172 0.1284  0.0947  21  TRP A O   
20   C CB  . TRP A 21  ? 0.9316 0.9284 0.7936 -0.1457 0.1356  0.1269  21  TRP A CB  
21   C CG  . TRP A 21  ? 0.8467 0.8734 0.7385 -0.1374 0.1413  0.1071  21  TRP A CG  
22   C CD1 . TRP A 21  ? 0.9538 1.0056 0.8455 -0.1343 0.1600  0.0980  21  TRP A CD1 
23   C CD2 . TRP A 21  ? 0.8248 0.8585 0.7508 -0.1298 0.1292  0.0956  21  TRP A CD2 
24   N NE1 . TRP A 21  ? 0.9275 0.9987 0.8540 -0.1236 0.1595  0.0835  21  TRP A NE1 
25   C CE2 . TRP A 21  ? 0.8228 0.8843 0.7681 -0.1208 0.1403  0.0833  21  TRP A CE2 
26   C CE3 . TRP A 21  ? 0.8429 0.8619 0.7830 -0.1287 0.1110  0.0944  21  TRP A CE3 
27   C CZ2 . TRP A 21  ? 0.8922 0.9666 0.8677 -0.1103 0.1324  0.0744  21  TRP A CZ2 
28   C CZ3 . TRP A 21  ? 0.9397 0.9745 0.9064 -0.1198 0.1041  0.0826  21  TRP A CZ3 
29   C CH2 . TRP A 21  ? 0.9172 0.9792 0.9001 -0.1104 0.1141  0.0749  21  TRP A CH2 
30   N N   . LYS A 22  ? 1.3007 1.3134 1.0734 -0.1368 0.1552  0.1214  22  LYS A N   
31   C CA  . LYS A 22  ? 1.3232 1.3570 1.0760 -0.1324 0.1702  0.1041  22  LYS A CA  
32   C C   . LYS A 22  ? 1.3751 1.4019 1.0946 -0.1219 0.1533  0.0915  22  LYS A C   
33   O O   . LYS A 22  ? 1.3656 1.4059 1.0822 -0.1160 0.1604  0.0676  22  LYS A O   
34   C CB  . LYS A 22  ? 1.4273 1.4723 1.1501 -0.1446 0.1951  0.1172  22  LYS A CB  
35   C CG  . LYS A 22  ? 1.4086 1.4773 1.1098 -0.1411 0.2153  0.0964  22  LYS A CG  
36   C CD  . LYS A 22  ? 1.5228 1.6029 1.1879 -0.1538 0.2414  0.1114  22  LYS A CD  
37   C CE  . LYS A 22  ? 1.5561 1.6536 1.1777 -0.1495 0.2557  0.0903  22  LYS A CE  
38   N NZ  . LYS A 22  ? 1.5432 1.6598 1.1378 -0.1616 0.2892  0.0999  22  LYS A NZ  
39   N N   . ALA A 23  ? 1.4599 1.4662 1.1588 -0.1194 0.1310  0.1062  23  ALA A N   
40   C CA  . ALA A 23  ? 1.4400 1.4453 1.1121 -0.1100 0.1114  0.0946  23  ALA A CA  
41   C C   . ALA A 23  ? 1.3577 1.3652 1.0672 -0.1012 0.1016  0.0696  23  ALA A C   
42   O O   . ALA A 23  ? 1.1950 1.2092 0.8927 -0.0961 0.0924  0.0503  23  ALA A O   
43   C CB  . ALA A 23  ? 1.2909 1.2764 0.9400 -0.1068 0.0890  0.1190  23  ALA A CB  
44   N N   . THR A 24  ? 1.3616 1.3643 1.1156 -0.1006 0.1040  0.0701  24  THR A N   
45   C CA  . THR A 24  ? 1.0464 1.0489 0.8343 -0.0924 0.0976  0.0516  24  THR A CA  
46   C C   . THR A 24  ? 1.1682 1.1838 0.9850 -0.0909 0.1177  0.0390  24  THR A C   
47   O O   . THR A 24  ? 1.1986 1.2167 1.0272 -0.0847 0.1220  0.0194  24  THR A O   
48   C CB  . THR A 24  ? 1.0496 1.0373 0.8637 -0.0896 0.0820  0.0613  24  THR A CB  
49   O OG1 . THR A 24  ? 1.1815 1.1557 0.9746 -0.0879 0.0635  0.0736  24  THR A OG1 
50   C CG2 . THR A 24  ? 0.9085 0.8969 0.7524 -0.0816 0.0779  0.0444  24  THR A CG2 
51   N N   . PHE A 25  ? 1.0511 1.0750 0.8826 -0.0964 0.1301  0.0509  25  PHE A N   
52   C CA  . PHE A 25  ? 0.9989 1.0397 0.8646 -0.0923 0.1467  0.0427  25  PHE A CA  
53   C C   . PHE A 25  ? 1.0925 1.1525 0.9497 -0.0980 0.1706  0.0421  25  PHE A C   
54   O O   . PHE A 25  ? 1.0111 1.0708 0.8385 -0.1085 0.1749  0.0546  25  PHE A O   
55   C CB  . PHE A 25  ? 1.0136 1.0575 0.9143 -0.0929 0.1398  0.0533  25  PHE A CB  
56   C CG  . PHE A 25  ? 0.8795 0.9076 0.7896 -0.0865 0.1203  0.0520  25  PHE A CG  
57   C CD1 . PHE A 25  ? 1.0443 1.0698 0.9673 -0.0753 0.1198  0.0394  25  PHE A CD1 
58   C CD2 . PHE A 25  ? 0.9372 0.9516 0.8449 -0.0920 0.1051  0.0630  25  PHE A CD2 
59   C CE1 . PHE A 25  ? 0.9727 0.9859 0.9037 -0.0704 0.1054  0.0388  25  PHE A CE1 
60   C CE2 . PHE A 25  ? 0.8970 0.8993 0.8136 -0.0857 0.0900  0.0596  25  PHE A CE2 
61   C CZ  . PHE A 25  ? 0.8532 0.8569 0.7805 -0.0753 0.0906  0.0479  25  PHE A CZ  
62   N N   . PRO A 26  ? 1.1536 1.2302 1.0378 -0.0902 0.1879  0.0286  26  PRO A N   
63   C CA  . PRO A 26  ? 1.0140 1.1144 0.9009 -0.0946 0.2136  0.0272  26  PRO A CA  
64   C C   . PRO A 26  ? 1.1733 1.2932 1.0957 -0.1014 0.2172  0.0429  26  PRO A C   
65   O O   . PRO A 26  ? 1.1706 1.2874 1.1194 -0.0989 0.2003  0.0494  26  PRO A O   
66   C CB  . PRO A 26  ? 0.9792 1.0871 0.8892 -0.0802 0.2288  0.0052  26  PRO A CB  
67   C CG  . PRO A 26  ? 1.0809 1.1751 1.0195 -0.0689 0.2117  0.0055  26  PRO A CG  
68   C CD  . PRO A 26  ? 1.1169 1.1892 1.0294 -0.0759 0.1870  0.0143  26  PRO A CD  
69   N N   . VAL A 27  ? 1.0992 1.2411 1.0222 -0.1110 0.2394  0.0472  27  VAL A N   
70   C CA  . VAL A 27  ? 1.1045 1.2724 1.0702 -0.1192 0.2455  0.0577  27  VAL A CA  
71   C C   . VAL A 27  ? 1.1044 1.3085 1.1095 -0.1092 0.2688  0.0447  27  VAL A C   
72   O O   . VAL A 27  ? 1.3374 1.5388 1.3392 -0.0941 0.2774  0.0277  27  VAL A O   
73   C CB  . VAL A 27  ? 1.0363 1.2026 0.9816 -0.1412 0.2545  0.0764  27  VAL A CB  
74   C CG1 . VAL A 27  ? 1.0323 1.1601 0.9434 -0.1474 0.2310  0.0908  27  VAL A CG1 
75   C CG2 . VAL A 27  ? 1.0882 1.2642 0.9982 -0.1462 0.2823  0.0737  27  VAL A CG2 
76   N N   . ASP A 28  ? 0.9119 1.1502 0.9582 -0.1179 0.2794  0.0514  28  ASP A N   
77   C CA  . ASP A 28  ? 0.9459 1.2259 1.0421 -0.1062 0.2991  0.0405  28  ASP A CA  
78   C C   . ASP A 28  ? 0.9951 1.2726 1.1192 -0.0809 0.2850  0.0316  28  ASP A C   
79   O O   . ASP A 28  ? 0.9515 1.2332 1.0861 -0.0632 0.3005  0.0172  28  ASP A O   
80   C CB  . ASP A 28  ? 0.9107 1.2005 0.9856 -0.1059 0.3323  0.0284  28  ASP A CB  
81   C CG  . ASP A 28  ? 1.1937 1.4941 1.2469 -0.1305 0.3522  0.0409  28  ASP A CG  
82   O OD1 . ASP A 28  ? 1.3020 1.6147 1.3811 -0.1469 0.3467  0.0562  28  ASP A OD1 
83   O OD2 . ASP A 28  ? 1.1339 1.4296 1.1428 -0.1342 0.3742  0.0350  28  ASP A OD2 
84   N N   . LEU A 29  ? 0.9113 1.1800 1.0463 -0.0794 0.2570  0.0405  29  LEU A N   
85   C CA  . LEU A 29  ? 0.9149 1.1744 1.0660 -0.0569 0.2416  0.0375  29  LEU A CA  
86   C C   . LEU A 29  ? 0.7363 1.0363 0.9452 -0.0372 0.2493  0.0352  29  LEU A C   
87   O O   . LEU A 29  ? 0.8124 1.1066 1.0375 -0.0161 0.2385  0.0368  29  LEU A O   
88   C CB  . LEU A 29  ? 0.8814 1.1253 1.0255 -0.0617 0.2116  0.0477  29  LEU A CB  
89   C CG  . LEU A 29  ? 0.9681 1.1714 1.0617 -0.0768 0.2008  0.0512  29  LEU A CG  
90   C CD1 . LEU A 29  ? 1.0093 1.2005 1.1029 -0.0796 0.1740  0.0581  29  LEU A CD1 
91   C CD2 . LEU A 29  ? 0.8995 1.0709 0.9582 -0.0679 0.2060  0.0412  29  LEU A CD2 
92   N N   . GLU A 30  ? 1.0228 1.3647 1.2642 -0.0433 0.2684  0.0331  30  GLU A N   
93   C CA  . GLU A 30  ? 1.2008 1.5873 1.5031 -0.0224 0.2769  0.0304  30  GLU A CA  
94   C C   . GLU A 30  ? 1.1626 1.5324 1.4660 0.0015  0.2973  0.0173  30  GLU A C   
95   O O   . GLU A 30  ? 0.9965 1.3787 1.3399 0.0281  0.2954  0.0186  30  GLU A O   
96   C CB  . GLU A 30  ? 1.2315 1.6711 1.5732 -0.0370 0.2949  0.0294  30  GLU A CB  
97   C CG  . GLU A 30  ? 1.5826 2.0773 1.9956 -0.0142 0.3028  0.0261  30  GLU A CG  
98   C CD  . GLU A 30  ? 1.7208 2.2348 2.1670 0.0030  0.2703  0.0368  30  GLU A CD  
99   O OE1 . GLU A 30  ? 1.7017 2.1991 2.1235 -0.0101 0.2432  0.0449  30  GLU A OE1 
100  O OE2 . GLU A 30  ? 1.7964 2.3430 2.2924 0.0311  0.2722  0.0372  30  GLU A OE2 
101  N N   . ILE A 31  ? 1.1766 1.5178 1.4357 -0.0078 0.3166  0.0047  31  ILE A N   
102  C CA  . ILE A 31  ? 1.0031 1.3198 1.2559 0.0109  0.3352  -0.0131 31  ILE A CA  
103  C C   . ILE A 31  ? 0.9616 1.2374 1.2055 0.0259  0.3144  -0.0091 31  ILE A C   
104  O O   . ILE A 31  ? 1.0903 1.3401 1.2995 0.0136  0.2915  -0.0001 31  ILE A O   
105  C CB  . ILE A 31  ? 1.0221 1.3160 1.2186 -0.0053 0.3546  -0.0295 31  ILE A CB  
106  C CG1 . ILE A 31  ? 0.8970 1.2281 1.0925 -0.0241 0.3762  -0.0284 31  ILE A CG1 
107  C CG2 . ILE A 31  ? 1.2892 1.5623 1.4855 0.0127  0.3764  -0.0542 31  ILE A CG2 
108  C CD1 . ILE A 31  ? 1.0793 1.3900 1.2084 -0.0418 0.3913  -0.0386 31  ILE A CD1 
109  N N   . GLU A 32  ? 0.9871 1.2565 1.2649 0.0528  0.3244  -0.0149 32  GLU A N   
110  C CA  . GLU A 32  ? 0.9748 1.2036 1.2482 0.0675  0.3098  -0.0090 32  GLU A CA  
111  C C   . GLU A 32  ? 1.0776 1.2576 1.2965 0.0527  0.3088  -0.0230 32  GLU A C   
112  O O   . GLU A 32  ? 1.0349 1.1874 1.2327 0.0486  0.2878  -0.0134 32  GLU A O   
113  C CB  . GLU A 32  ? 0.9224 1.1475 1.2432 0.0994  0.3265  -0.0127 32  GLU A CB  
114  C CG  . GLU A 32  ? 1.1489 1.3308 1.4692 0.1152  0.3145  -0.0018 32  GLU A CG  
115  C CD  . GLU A 32  ? 1.5200 1.6899 1.8871 0.1477  0.3338  -0.0036 32  GLU A CD  
116  O OE1 . GLU A 32  ? 1.6532 1.8608 2.0638 0.1627  0.3499  -0.0078 32  GLU A OE1 
117  O OE2 . GLU A 32  ? 1.6073 1.7297 1.9711 0.1584  0.3343  -0.0004 32  GLU A OE2 
118  N N   . LYS A 33  ? 1.2112 1.3847 1.4082 0.0447  0.3316  -0.0469 33  LYS A N   
119  C CA  . LYS A 33  ? 0.9643 1.1003 1.1100 0.0300  0.3302  -0.0642 33  LYS A CA  
120  C C   . LYS A 33  ? 1.1250 1.2556 1.2288 0.0085  0.3038  -0.0498 33  LYS A C   
121  O O   . LYS A 33  ? 1.2156 1.3149 1.2968 0.0040  0.2879  -0.0507 33  LYS A O   
122  C CB  . LYS A 33  ? 1.1491 1.2918 1.2724 0.0227  0.3578  -0.0916 33  LYS A CB  
123  C CG  . LYS A 33  ? 1.2270 1.3390 1.2955 0.0073  0.3546  -0.1127 33  LYS A CG  
124  C CD  . LYS A 33  ? 1.2961 1.4223 1.3345 -0.0010 0.3808  -0.1387 33  LYS A CD  
125  C CE  . LYS A 33  ? 1.3640 1.4991 1.4471 0.0188  0.4134  -0.1587 33  LYS A CE  
126  N NZ  . LYS A 33  ? 1.5596 1.7102 1.6108 0.0108  0.4421  -0.1876 33  LYS A NZ  
127  N N   . ASN A 34  ? 1.2482 1.4091 1.3457 -0.0049 0.3008  -0.0369 34  ASN A N   
128  C CA  . ASN A 34  ? 1.0258 1.1800 1.0890 -0.0238 0.2775  -0.0218 34  ASN A CA  
129  C C   . ASN A 34  ? 0.9943 1.1418 1.0763 -0.0181 0.2519  -0.0038 34  ASN A C   
130  O O   . ASN A 34  ? 1.0783 1.2049 1.1328 -0.0277 0.2319  0.0024  34  ASN A O   
131  C CB  . ASN A 34  ? 0.9334 1.1179 0.9906 -0.0402 0.2846  -0.0117 34  ASN A CB  
132  C CG  . ASN A 34  ? 1.0352 1.2204 1.0511 -0.0514 0.3056  -0.0253 34  ASN A CG  
133  O OD1 . ASN A 34  ? 1.3718 1.5325 1.3515 -0.0517 0.3058  -0.0415 34  ASN A OD1 
134  N ND2 . ASN A 34  ? 1.1740 1.3900 1.1949 -0.0618 0.3237  -0.0194 34  ASN A ND2 
135  N N   . SER A 35  ? 1.0063 1.1744 1.1348 -0.0013 0.2526  0.0043  35  SER A N   
136  C CA  . SER A 35  ? 0.9864 1.1518 1.1295 0.0064  0.2296  0.0207  35  SER A CA  
137  C C   . SER A 35  ? 1.0843 1.2078 1.2118 0.0141  0.2242  0.0170  35  SER A C   
138  O O   . SER A 35  ? 1.0173 1.1272 1.1324 0.0111  0.2046  0.0271  35  SER A O   
139  C CB  . SER A 35  ? 0.8946 1.0951 1.0895 0.0260  0.2312  0.0306  35  SER A CB  
140  O OG  . SER A 35  ? 0.9172 1.1198 1.1194 0.0329  0.2075  0.0471  35  SER A OG  
141  N N   . GLU A 36  ? 1.1917 1.2955 1.3219 0.0228  0.2438  0.0002  36  GLU A N   
142  C CA  . GLU A 36  ? 1.1414 1.2043 1.2613 0.0265  0.2435  -0.0076 36  GLU A CA  
143  C C   . GLU A 36  ? 1.0866 1.1312 1.1645 0.0067  0.2282  -0.0129 36  GLU A C   
144  O O   . GLU A 36  ? 1.0316 1.0618 1.1040 0.0054  0.2119  -0.0027 36  GLU A O   
145  C CB  . GLU A 36  ? 1.2339 1.2792 1.3640 0.0347  0.2695  -0.0312 36  GLU A CB  
146  C CG  . GLU A 36  ? 1.4572 1.4933 1.6322 0.0606  0.2828  -0.0252 36  GLU A CG  
147  C CD  . GLU A 36  ? 1.6266 1.6453 1.8145 0.0680  0.3115  -0.0528 36  GLU A CD  
148  O OE1 . GLU A 36  ? 1.7558 1.7564 1.9126 0.0517  0.3172  -0.0785 36  GLU A OE1 
149  O OE2 . GLU A 36  ? 1.5032 1.5276 1.7331 0.0907  0.3279  -0.0502 36  GLU A OE2 
150  N N   . MET A 37  ? 0.8910 0.9387 0.9394 -0.0074 0.2341  -0.0284 37  MET A N   
151  C CA  . MET A 37  ? 0.9049 0.9390 0.9136 -0.0238 0.2191  -0.0340 37  MET A CA  
152  C C   . MET A 37  ? 1.1063 1.1440 1.1076 -0.0303 0.1954  -0.0130 37  MET A C   
153  O O   . MET A 37  ? 1.0630 1.0839 1.0494 -0.0357 0.1804  -0.0135 37  MET A O   
154  C CB  . MET A 37  ? 0.9332 0.9788 0.9072 -0.0363 0.2272  -0.0464 37  MET A CB  
155  C CG  . MET A 37  ? 1.0528 1.1007 1.0309 -0.0310 0.2538  -0.0705 37  MET A CG  
156  S SD  . MET A 37  ? 1.6690 1.7306 1.5915 -0.0476 0.2608  -0.0847 37  MET A SD  
157  C CE  . MET A 37  ? 1.2778 1.3556 1.2201 -0.0379 0.2978  -0.1059 37  MET A CE  
158  N N   . PHE A 38  ? 0.9637 1.0253 0.9789 -0.0303 0.1929  0.0029  38  PHE A N   
159  C CA  . PHE A 38  ? 0.8911 0.9559 0.9022 -0.0373 0.1722  0.0192  38  PHE A CA  
160  C C   . PHE A 38  ? 0.8720 0.9235 0.8956 -0.0279 0.1604  0.0254  38  PHE A C   
161  O O   . PHE A 38  ? 0.8871 0.9260 0.8956 -0.0341 0.1448  0.0286  38  PHE A O   
162  C CB  . PHE A 38  ? 0.8752 0.9707 0.9063 -0.0404 0.1731  0.0310  38  PHE A CB  
163  C CG  . PHE A 38  ? 0.8819 0.9800 0.9141 -0.0473 0.1527  0.0434  38  PHE A CG  
164  C CD1 . PHE A 38  ? 0.7770 0.8604 0.7822 -0.0620 0.1419  0.0466  38  PHE A CD1 
165  C CD2 . PHE A 38  ? 0.8379 0.9525 0.8970 -0.0380 0.1439  0.0511  38  PHE A CD2 
166  C CE1 . PHE A 38  ? 0.7908 0.8727 0.7991 -0.0682 0.1250  0.0543  38  PHE A CE1 
167  C CE2 . PHE A 38  ? 0.7593 0.8767 0.8169 -0.0455 0.1256  0.0576  38  PHE A CE2 
168  C CZ  . PHE A 38  ? 0.8034 0.9028 0.8372 -0.0611 0.1173  0.0576  38  PHE A CZ  
169  N N   . ALA A 39  ? 0.9473 1.0017 0.9986 -0.0117 0.1694  0.0282  39  ALA A N   
170  C CA  . ALA A 39  ? 1.0782 1.1213 1.1392 -0.0012 0.1614  0.0383  39  ALA A CA  
171  C C   . ALA A 39  ? 1.1036 1.1157 1.1478 -0.0065 0.1592  0.0296  39  ALA A C   
172  O O   . ALA A 39  ? 1.1678 1.1732 1.2049 -0.0085 0.1468  0.0366  39  ALA A O   
173  C CB  . ALA A 39  ? 1.0703 1.1170 1.1622 0.0193  0.1742  0.0448  39  ALA A CB  
174  N N   . LEU A 40  ? 0.9821 0.9784 1.0217 -0.0096 0.1719  0.0118  40  LEU A N   
175  C CA  . LEU A 40  ? 1.0826 1.0548 1.1128 -0.0164 0.1701  -0.0005 40  LEU A CA  
176  C C   . LEU A 40  ? 0.9903 0.9662 0.9954 -0.0300 0.1512  -0.0018 40  LEU A C   
177  O O   . LEU A 40  ? 1.0180 0.9855 1.0231 -0.0318 0.1416  0.0016  40  LEU A O   
178  C CB  . LEU A 40  ? 1.0135 0.9724 1.0443 -0.0188 0.1864  -0.0243 40  LEU A CB  
179  C CG  . LEU A 40  ? 1.0580 0.9967 1.0851 -0.0284 0.1838  -0.0408 40  LEU A CG  
180  C CD1 . LEU A 40  ? 0.9474 0.8642 0.9997 -0.0208 0.1912  -0.0315 40  LEU A CD1 
181  C CD2 . LEU A 40  ? 1.2784 1.2105 1.2990 -0.0354 0.1954  -0.0703 40  LEU A CD2 
182  N N   . ARG A 41  ? 1.0759 1.0640 1.0604 -0.0385 0.1475  -0.0055 41  ARG A N   
183  C CA  . ARG A 41  ? 0.9634 0.9525 0.9238 -0.0489 0.1299  -0.0041 41  ARG A CA  
184  C C   . ARG A 41  ? 0.9393 0.9307 0.9046 -0.0483 0.1157  0.0121  41  ARG A C   
185  O O   . ARG A 41  ? 1.0258 1.0109 0.9821 -0.0524 0.1017  0.0123  41  ARG A O   
186  C CB  . ARG A 41  ? 0.9218 0.9225 0.8573 -0.0566 0.1312  -0.0045 41  ARG A CB  
187  C CG  . ARG A 41  ? 0.9547 0.9564 0.8790 -0.0581 0.1459  -0.0243 41  ARG A CG  
188  C CD  . ARG A 41  ? 1.0145 1.0278 0.9037 -0.0669 0.1463  -0.0231 41  ARG A CD  
189  N NE  . ARG A 41  ? 1.2645 1.2852 1.1462 -0.0666 0.1670  -0.0408 41  ARG A NE  
190  C CZ  . ARG A 41  ? 1.5130 1.5465 1.3623 -0.0735 0.1744  -0.0419 41  ARG A CZ  
191  N NH1 . ARG A 41  ? 1.4925 1.5297 1.3145 -0.0811 0.1623  -0.0227 41  ARG A NH1 
192  N NH2 . ARG A 41  ? 1.5744 1.6153 1.4179 -0.0725 0.1958  -0.0617 41  ARG A NH2 
193  N N   . TYR A 42  ? 0.9673 0.9698 0.9483 -0.0424 0.1189  0.0238  42  TYR A N   
194  C CA  . TYR A 42  ? 0.9154 0.9224 0.9004 -0.0424 0.1059  0.0349  42  TYR A CA  
195  C C   . TYR A 42  ? 0.9313 0.9256 0.9203 -0.0375 0.1021  0.0339  42  TYR A C   
196  O O   . TYR A 42  ? 1.1718 1.1615 1.1539 -0.0415 0.0903  0.0339  42  TYR A O   
197  C CB  . TYR A 42  ? 0.8638 0.8921 0.8667 -0.0367 0.1086  0.0449  42  TYR A CB  
198  C CG  . TYR A 42  ? 0.7632 0.7988 0.7688 -0.0365 0.0949  0.0521  42  TYR A CG  
199  C CD1 . TYR A 42  ? 0.8973 0.9295 0.8926 -0.0477 0.0826  0.0513  42  TYR A CD1 
200  C CD2 . TYR A 42  ? 0.9349 0.9794 0.9516 -0.0244 0.0948  0.0594  42  TYR A CD2 
201  C CE1 . TYR A 42  ? 0.8821 0.9203 0.8794 -0.0483 0.0712  0.0527  42  TYR A CE1 
202  C CE2 . TYR A 42  ? 0.9718 1.0262 0.9855 -0.0247 0.0821  0.0631  42  TYR A CE2 
203  C CZ  . TYR A 42  ? 1.0134 1.0649 1.0179 -0.0374 0.0707  0.0573  42  TYR A CZ  
204  O OH  . TYR A 42  ? 1.1506 1.2115 1.1517 -0.0385 0.0591  0.0560  42  TYR A OH  
205  N N   . ILE A 43  ? 0.8801 0.8673 0.8821 -0.0287 0.1142  0.0334  43  ILE A N   
206  C CA  . ILE A 43  ? 0.9991 0.9739 1.0056 -0.0253 0.1151  0.0347  43  ILE A CA  
207  C C   . ILE A 43  ? 0.9591 0.9215 0.9626 -0.0338 0.1135  0.0198  43  ILE A C   
208  O O   . ILE A 43  ? 0.9904 0.9479 0.9969 -0.0351 0.1105  0.0186  43  ILE A O   
209  C CB  . ILE A 43  ? 1.0100 0.9763 1.0325 -0.0131 0.1308  0.0428  43  ILE A CB  
210  C CG1 . ILE A 43  ? 0.9311 0.8800 0.9641 -0.0143 0.1463  0.0291  43  ILE A CG1 
211  C CG2 . ILE A 43  ? 1.1785 1.1639 1.2080 -0.0020 0.1303  0.0575  43  ILE A CG2 
212  C CD1 . ILE A 43  ? 0.9719 0.9023 1.0238 -0.0028 0.1640  0.0375  43  ILE A CD1 
213  N N   . LYS A 44  ? 0.9731 0.9344 0.9707 -0.0395 0.1153  0.0072  44  LYS A N   
214  C CA  . LYS A 44  ? 0.9481 0.9051 0.9426 -0.0476 0.1097  -0.0088 44  LYS A CA  
215  C C   . LYS A 44  ? 1.0355 0.9998 1.0176 -0.0512 0.0905  -0.0053 44  LYS A C   
216  O O   . LYS A 44  ? 1.0006 0.9647 0.9898 -0.0535 0.0832  -0.0124 44  LYS A O   
217  C CB  . LYS A 44  ? 0.8336 0.7915 0.8190 -0.0526 0.1150  -0.0247 44  LYS A CB  
218  C CG  . LYS A 44  ? 0.9932 0.9519 0.9774 -0.0611 0.1076  -0.0446 44  LYS A CG  
219  C CD  . LYS A 44  ? 1.0545 1.0127 1.0322 -0.0662 0.1170  -0.0658 44  LYS A CD  
220  C CE  . LYS A 44  ? 0.9945 0.9596 0.9728 -0.0759 0.1065  -0.0887 44  LYS A CE  
221  N NZ  . LYS A 44  ? 1.1309 1.1017 1.0916 -0.0824 0.1104  -0.1124 44  LYS A NZ  
222  N N   . CYS A 45  ? 1.0719 1.0423 1.0399 -0.0516 0.0838  0.0055  45  CYS A N   
223  C CA  . CYS A 45  ? 0.9726 0.9435 0.9307 -0.0540 0.0675  0.0112  45  CYS A CA  
224  C C   . CYS A 45  ? 0.8585 0.8270 0.8286 -0.0502 0.0633  0.0149  45  CYS A C   
225  O O   . CYS A 45  ? 1.0095 0.9758 0.9833 -0.0496 0.0537  0.0109  45  CYS A O   
226  C CB  . CYS A 45  ? 0.9081 0.8824 0.8518 -0.0578 0.0654  0.0224  45  CYS A CB  
227  S SG  . CYS A 45  ? 1.8397 1.8162 1.7559 -0.0636 0.0631  0.0209  45  CYS A SG  
228  N N   . ALA A 46  ? 0.7828 0.7544 0.7587 -0.0465 0.0704  0.0221  46  ALA A N   
229  C CA  . ALA A 46  ? 0.8313 0.8035 0.8125 -0.0430 0.0681  0.0242  46  ALA A CA  
230  C C   . ALA A 46  ? 0.9845 0.9523 0.9766 -0.0410 0.0733  0.0166  46  ALA A C   
231  O O   . ALA A 46  ? 1.0516 1.0193 1.0475 -0.0403 0.0680  0.0124  46  ALA A O   
232  C CB  . ALA A 46  ? 0.8743 0.8558 0.8568 -0.0380 0.0742  0.0335  46  ALA A CB  
233  N N   . SER A 47  ? 0.9313 0.8950 0.9319 -0.0409 0.0855  0.0134  47  SER A N   
234  C CA  . SER A 47  ? 0.8296 0.7892 0.8462 -0.0425 0.0936  0.0050  47  SER A CA  
235  C C   . SER A 47  ? 0.9404 0.9059 0.9637 -0.0468 0.0809  -0.0077 47  SER A C   
236  O O   . SER A 47  ? 1.0067 0.9764 1.0434 -0.0463 0.0812  -0.0123 47  SER A O   
237  C CB  . SER A 47  ? 0.8913 0.8415 0.9188 -0.0444 0.1088  0.0006  47  SER A CB  
238  O OG  . SER A 47  ? 0.9410 0.8844 0.9680 -0.0367 0.1218  0.0151  47  SER A OG  
239  N N   . ALA A 48  ? 0.7665 0.7349 0.7803 -0.0500 0.0702  -0.0125 48  ALA A N   
240  C CA  . ALA A 48  ? 0.8493 0.8265 0.8669 -0.0513 0.0543  -0.0215 48  ALA A CA  
241  C C   . ALA A 48  ? 0.9624 0.9400 0.9818 -0.0455 0.0437  -0.0157 48  ALA A C   
242  O O   . ALA A 48  ? 1.0950 1.0811 1.1320 -0.0429 0.0364  -0.0236 48  ALA A O   
243  C CB  . ALA A 48  ? 0.8149 0.7949 0.8113 -0.0540 0.0442  -0.0222 48  ALA A CB  
244  N N   . PHE A 49  ? 0.9694 0.9391 0.9746 -0.0434 0.0433  -0.0042 49  PHE A N   
245  C CA  . PHE A 49  ? 1.0324 0.9981 1.0405 -0.0389 0.0360  -0.0021 49  PHE A CA  
246  C C   . PHE A 49  ? 1.0273 0.9978 1.0512 -0.0359 0.0463  -0.0089 49  PHE A C   
247  O O   . PHE A 49  ? 0.9473 0.9214 0.9866 -0.0314 0.0420  -0.0164 49  PHE A O   
248  C CB  . PHE A 49  ? 0.8699 0.8276 0.8622 -0.0408 0.0346  0.0079  49  PHE A CB  
249  C CG  . PHE A 49  ? 1.1060 1.0550 1.1016 -0.0381 0.0271  0.0067  49  PHE A CG  
250  C CD1 . PHE A 49  ? 1.1853 1.1226 1.1801 -0.0362 0.0145  0.0108  49  PHE A CD1 
251  C CD2 . PHE A 49  ? 1.2104 1.1615 1.2087 -0.0366 0.0332  0.0011  49  PHE A CD2 
252  C CE1 . PHE A 49  ? 1.2251 1.1488 1.2271 -0.0330 0.0094  0.0083  49  PHE A CE1 
253  C CE2 . PHE A 49  ? 1.1076 1.0491 1.1100 -0.0347 0.0277  -0.0049 49  PHE A CE2 
254  C CZ  . PHE A 49  ? 1.0917 1.0173 1.0987 -0.0329 0.0165  -0.0020 49  PHE A CZ  
255  N N   . ILE A 50  ? 0.9788 0.9500 0.9990 -0.0373 0.0609  -0.0051 50  ILE A N   
256  C CA  . ILE A 50  ? 1.0883 1.0636 1.1159 -0.0349 0.0741  -0.0074 50  ILE A CA  
257  C C   . ILE A 50  ? 1.0529 1.0359 1.1066 -0.0364 0.0799  -0.0186 50  ILE A C   
258  O O   . ILE A 50  ? 1.0737 1.0635 1.1392 -0.0334 0.0844  -0.0254 50  ILE A O   
259  C CB  . ILE A 50  ? 0.9599 0.9331 0.9772 -0.0345 0.0887  0.0039  50  ILE A CB  
260  C CG1 . ILE A 50  ? 0.8947 0.8695 0.8918 -0.0321 0.0820  0.0131  50  ILE A CG1 
261  C CG2 . ILE A 50  ? 0.9862 0.9623 1.0081 -0.0327 0.1053  0.0048  50  ILE A CG2 
262  C CD1 . ILE A 50  ? 0.9389 0.9150 0.9284 -0.0284 0.0919  0.0267  50  ILE A CD1 
263  N N   . LEU A 51  ? 0.9570 0.9414 1.0220 -0.0418 0.0804  -0.0233 51  LEU A N   
264  C CA  . LEU A 51  ? 0.9549 0.9516 1.0506 -0.0460 0.0843  -0.0370 51  LEU A CA  
265  C C   . LEU A 51  ? 1.0114 1.0219 1.1222 -0.0405 0.0665  -0.0460 51  LEU A C   
266  O O   . LEU A 51  ? 1.2745 1.3002 1.4144 -0.0399 0.0709  -0.0565 51  LEU A O   
267  C CB  . LEU A 51  ? 0.9561 0.9522 1.0600 -0.0546 0.0862  -0.0444 51  LEU A CB  
268  C CG  . LEU A 51  ? 0.8517 0.8308 0.9492 -0.0582 0.1063  -0.0364 51  LEU A CG  
269  C CD1 . LEU A 51  ? 0.9489 0.9251 1.0578 -0.0674 0.1090  -0.0495 51  LEU A CD1 
270  C CD2 . LEU A 51  ? 0.6711 0.6466 0.7809 -0.0589 0.1280  -0.0306 51  LEU A CD2 
271  N N   . ASP A 52  ? 1.0898 1.0948 1.1827 -0.0358 0.0478  -0.0404 52  ASP A N   
272  C CA  . ASP A 52  ? 0.9983 1.0116 1.1038 -0.0274 0.0294  -0.0441 52  ASP A CA  
273  C C   . ASP A 52  ? 0.8376 0.8481 0.9530 -0.0191 0.0336  -0.0461 52  ASP A C   
274  O O   . ASP A 52  ? 1.0989 1.1255 1.2453 -0.0137 0.0341  -0.0571 52  ASP A O   
275  C CB  . ASP A 52  ? 1.0074 1.0097 1.0868 -0.0248 0.0115  -0.0328 52  ASP A CB  
276  C CG  . ASP A 52  ? 1.1313 1.1429 1.2233 -0.0149 -0.0098 -0.0332 52  ASP A CG  
277  O OD1 . ASP A 52  ? 1.3740 1.4076 1.4989 -0.0111 -0.0130 -0.0457 52  ASP A OD1 
278  O OD2 . ASP A 52  ? 1.1835 1.1812 1.2541 -0.0104 -0.0229 -0.0197 52  ASP A OD2 
279  N N   . ARG A 53  ? 0.9682 0.9610 1.0593 -0.0184 0.0372  -0.0381 53  ARG A N   
280  C CA  . ARG A 53  ? 0.9591 0.9467 1.0546 -0.0114 0.0403  -0.0436 53  ARG A CA  
281  C C   . ARG A 53  ? 1.1415 1.1429 1.2520 -0.0113 0.0600  -0.0542 53  ARG A C   
282  O O   . ARG A 53  ? 1.1965 1.2000 1.3190 -0.0040 0.0639  -0.0646 53  ARG A O   
283  C CB  . ARG A 53  ? 0.9530 0.9226 1.0193 -0.0145 0.0398  -0.0362 53  ARG A CB  
284  C CG  . ARG A 53  ? 1.2744 1.2282 1.3282 -0.0153 0.0238  -0.0253 53  ARG A CG  
285  C CD  . ARG A 53  ? 1.3321 1.2759 1.4026 -0.0051 0.0109  -0.0273 53  ARG A CD  
286  N NE  . ARG A 53  ? 1.5886 1.5131 1.6437 -0.0066 -0.0020 -0.0126 53  ARG A NE  
287  C CZ  . ARG A 53  ? 1.6855 1.5969 1.7500 0.0031  -0.0154 -0.0061 53  ARG A CZ  
288  N NH1 . ARG A 53  ? 1.9503 1.8690 2.0439 0.0166  -0.0195 -0.0152 53  ARG A NH1 
289  N NH2 . ARG A 53  ? 1.4177 1.3095 1.4640 0.0002  -0.0239 0.0111  53  ARG A NH2 
290  N N   . ARG A 54  ? 1.0465 1.0552 1.1559 -0.0192 0.0748  -0.0514 54  ARG A N   
291  C CA  . ARG A 54  ? 0.9232 0.9439 1.0448 -0.0207 0.0971  -0.0575 54  ARG A CA  
292  C C   . ARG A 54  ? 0.9923 1.0332 1.1553 -0.0237 0.1010  -0.0681 54  ARG A C   
293  O O   . ARG A 54  ? 1.1931 1.2463 1.3740 -0.0279 0.1221  -0.0732 54  ARG A O   
294  C CB  . ARG A 54  ? 1.0014 1.0146 1.0968 -0.0269 0.1136  -0.0445 54  ARG A CB  
295  C CG  . ARG A 54  ? 0.9196 0.9218 0.9783 -0.0239 0.1081  -0.0361 54  ARG A CG  
296  C CD  . ARG A 54  ? 0.9989 1.0051 1.0519 -0.0181 0.1103  -0.0478 54  ARG A CD  
297  N NE  . ARG A 54  ? 1.0302 1.0458 1.0701 -0.0184 0.1324  -0.0468 54  ARG A NE  
298  C CZ  . ARG A 54  ? 0.9784 1.0039 1.0209 -0.0143 0.1434  -0.0611 54  ARG A CZ  
299  N NH1 . ARG A 54  ? 0.9069 0.9318 0.9698 -0.0084 0.1339  -0.0785 54  ARG A NH1 
300  N NH2 . ARG A 54  ? 1.0238 1.0587 1.0476 -0.0152 0.1654  -0.0573 54  ARG A NH2 
301  N N   . GLY A 55  ? 0.9972 1.0437 1.1749 -0.0223 0.0803  -0.0713 55  GLY A N   
302  C CA  . GLY A 55  ? 0.8858 0.9584 1.1065 -0.0242 0.0768  -0.0846 55  GLY A CA  
303  C C   . GLY A 55  ? 1.0429 1.1242 1.2814 -0.0390 0.0957  -0.0891 55  GLY A C   
304  O O   . GLY A 55  ? 1.2025 1.3082 1.4827 -0.0431 0.1055  -0.1023 55  GLY A O   
305  N N   . ILE A 56  ? 1.0158 1.0766 1.2271 -0.0472 0.1024  -0.0786 56  ILE A N   
306  C CA  . ILE A 56  ? 0.9630 1.0245 1.1929 -0.0617 0.1198  -0.0829 56  ILE A CA  
307  C C   . ILE A 56  ? 0.9469 1.0287 1.2048 -0.0680 0.1018  -0.1000 56  ILE A C   
308  O O   . ILE A 56  ? 1.0054 1.1034 1.3017 -0.0804 0.1122  -0.1145 56  ILE A O   
309  C CB  . ILE A 56  ? 1.0279 1.0601 1.2240 -0.0655 0.1309  -0.0672 56  ILE A CB  
310  C CG1 . ILE A 56  ? 1.1560 1.1750 1.3239 -0.0587 0.1463  -0.0503 56  ILE A CG1 
311  C CG2 . ILE A 56  ? 0.8422 0.8686 1.0617 -0.0802 0.1494  -0.0729 56  ILE A CG2 
312  C CD1 . ILE A 56  ? 1.1063 1.1305 1.2921 -0.0640 0.1745  -0.0493 56  ILE A CD1 
313  N N   . LEU A 57  ? 0.7854 0.8680 1.0235 -0.0601 0.0748  -0.0985 57  LEU A N   
314  C CA  . LEU A 57  ? 0.8171 0.9236 1.0732 -0.0634 0.0528  -0.1136 57  LEU A CA  
315  C C   . LEU A 57  ? 0.8833 1.0071 1.1426 -0.0473 0.0253  -0.1121 57  LEU A C   
316  O O   . LEU A 57  ? 0.9235 1.0315 1.1633 -0.0347 0.0225  -0.0984 57  LEU A O   
317  C CB  . LEU A 57  ? 0.9620 1.0528 1.1863 -0.0702 0.0468  -0.1123 57  LEU A CB  
318  C CG  . LEU A 57  ? 0.9401 1.0077 1.1610 -0.0830 0.0730  -0.1123 57  LEU A CG  
319  C CD1 . LEU A 57  ? 0.7899 0.8440 0.9806 -0.0868 0.0665  -0.1138 57  LEU A CD1 
320  C CD2 . LEU A 57  ? 0.9611 1.0438 1.2301 -0.0981 0.0887  -0.1313 57  LEU A CD2 
321  N N   . ASP A 58  ? 1.0163 1.1730 1.3021 -0.0477 0.0048  -0.1267 58  ASP A N   
322  C CA  . ASP A 58  ? 0.8512 1.0266 1.1425 -0.0301 -0.0241 -0.1229 58  ASP A CA  
323  C C   . ASP A 58  ? 0.9879 1.1357 1.2251 -0.0216 -0.0395 -0.1024 58  ASP A C   
324  O O   . ASP A 58  ? 1.2255 1.3548 1.4275 -0.0316 -0.0343 -0.0984 58  ASP A O   
325  C CB  . ASP A 58  ? 1.2212 1.4424 1.5480 -0.0334 -0.0457 -0.1426 58  ASP A CB  
326  C CG  . ASP A 58  ? 1.5506 1.8002 1.9025 -0.0119 -0.0723 -0.1398 58  ASP A CG  
327  O OD1 . ASP A 58  ? 1.5926 1.8287 1.9096 0.0031  -0.0938 -0.1212 58  ASP A OD1 
328  O OD2 . ASP A 58  ? 1.6924 1.9781 2.1015 -0.0097 -0.0708 -0.1552 58  ASP A OD2 
329  N N   . GLU A 59  ? 1.1131 1.2573 1.3469 -0.0032 -0.0563 -0.0893 59  GLU A N   
330  C CA  . GLU A 59  ? 1.0374 1.1540 1.2237 0.0041  -0.0692 -0.0675 59  GLU A CA  
331  C C   . GLU A 59  ? 1.0550 1.1863 1.2152 -0.0002 -0.0891 -0.0674 59  GLU A C   
332  O O   . GLU A 59  ? 1.1734 1.2823 1.2876 -0.0024 -0.0911 -0.0524 59  GLU A O   
333  C CB  . GLU A 59  ? 1.0744 1.1829 1.2699 0.0252  -0.0832 -0.0542 59  GLU A CB  
334  C CG  . GLU A 59  ? 1.2663 1.3396 1.4165 0.0310  -0.0917 -0.0293 59  GLU A CG  
335  C CD  . GLU A 59  ? 1.4526 1.4897 1.5808 0.0228  -0.0695 -0.0230 59  GLU A CD  
336  O OE1 . GLU A 59  ? 1.3721 1.4033 1.5223 0.0253  -0.0549 -0.0312 59  GLU A OE1 
337  O OE2 . GLU A 59  ? 1.5015 1.5196 1.5905 0.0139  -0.0666 -0.0111 59  GLU A OE2 
338  N N   . LYS A 60  ? 1.1061 1.2782 1.2966 -0.0025 -0.1029 -0.0862 60  LYS A N   
339  C CA  . LYS A 60  ? 1.1534 1.3475 1.3203 -0.0076 -0.1235 -0.0924 60  LYS A CA  
340  C C   . LYS A 60  ? 1.0878 1.2634 1.2211 -0.0269 -0.1055 -0.0998 60  LYS A C   
341  O O   . LYS A 60  ? 1.0801 1.2614 1.1759 -0.0306 -0.1177 -0.1004 60  LYS A O   
342  C CB  . LYS A 60  ? 1.2575 1.5044 1.4725 -0.0097 -0.1401 -0.1177 60  LYS A CB  
343  C CG  . LYS A 60  ? 1.3609 1.6176 1.6153 -0.0310 -0.1153 -0.1449 60  LYS A CG  
344  C CD  . LYS A 60  ? 1.3452 1.6579 1.6510 -0.0371 -0.1320 -0.1732 60  LYS A CD  
345  C CE  . LYS A 60  ? 1.4382 1.7546 1.7871 -0.0605 -0.1028 -0.1982 60  LYS A CE  
346  N NZ  . LYS A 60  ? 1.5759 1.9504 1.9853 -0.0693 -0.1170 -0.2284 60  LYS A NZ  
347  N N   . CYS A 61  ? 0.9112 1.0654 1.0573 -0.0377 -0.0759 -0.1049 61  CYS A N   
348  C CA  . CYS A 61  ? 1.1110 1.2461 1.2345 -0.0534 -0.0563 -0.1120 61  CYS A CA  
349  C C   . CYS A 61  ? 1.1095 1.2125 1.1825 -0.0497 -0.0514 -0.0896 61  CYS A C   
350  O O   . CYS A 61  ? 1.0055 1.0944 1.0565 -0.0594 -0.0373 -0.0934 61  CYS A O   
351  C CB  . CYS A 61  ? 1.0792 1.2014 1.2342 -0.0635 -0.0265 -0.1202 61  CYS A CB  
352  S SG  . CYS A 61  ? 1.1140 1.2725 1.3336 -0.0750 -0.0234 -0.1493 61  CYS A SG  
353  N N   . PHE A 62  ? 1.1646 1.2561 1.2234 -0.0359 -0.0618 -0.0671 62  PHE A N   
354  C CA  . PHE A 62  ? 0.9532 1.0146 0.9727 -0.0346 -0.0543 -0.0459 62  PHE A CA  
355  C C   . PHE A 62  ? 1.0456 1.1057 1.0306 -0.0256 -0.0750 -0.0269 62  PHE A C   
356  O O   . PHE A 62  ? 1.0178 1.0929 1.0129 -0.0135 -0.0967 -0.0223 62  PHE A O   
357  C CB  . PHE A 62  ? 0.8446 0.8833 0.8768 -0.0301 -0.0403 -0.0349 62  PHE A CB  
358  C CG  . PHE A 62  ? 1.0463 1.0852 1.1065 -0.0372 -0.0191 -0.0481 62  PHE A CG  
359  C CD1 . PHE A 62  ? 1.0777 1.1325 1.1775 -0.0341 -0.0180 -0.0591 62  PHE A CD1 
360  C CD2 . PHE A 62  ? 0.9493 0.9735 0.9975 -0.0459 0.0010  -0.0478 62  PHE A CD2 
361  C CE1 . PHE A 62  ? 1.0046 1.0581 1.1267 -0.0414 0.0043  -0.0679 62  PHE A CE1 
362  C CE2 . PHE A 62  ? 0.9981 1.0195 1.0689 -0.0509 0.0209  -0.0549 62  PHE A CE2 
363  C CZ  . PHE A 62  ? 0.9941 1.0290 1.0995 -0.0495 0.0234  -0.0642 62  PHE A CZ  
364  N N   . LYS A 63  ? 0.9775 1.0200 0.9229 -0.0308 -0.0669 -0.0145 63  LYS A N   
365  C CA  . LYS A 63  ? 1.0707 1.1037 0.9789 -0.0241 -0.0796 0.0096  63  LYS A CA  
366  C C   . LYS A 63  ? 1.1029 1.1035 1.0016 -0.0264 -0.0635 0.0283  63  LYS A C   
367  O O   . LYS A 63  ? 0.9905 0.9830 0.8992 -0.0345 -0.0437 0.0208  63  LYS A O   
368  C CB  . LYS A 63  ? 1.0186 1.0665 0.8852 -0.0307 -0.0838 0.0057  63  LYS A CB  
369  C CG  . LYS A 63  ? 1.2917 1.3317 1.1453 -0.0444 -0.0588 -0.0051 63  LYS A CG  
370  C CD  . LYS A 63  ? 1.4990 1.5569 1.3135 -0.0508 -0.0616 -0.0158 63  LYS A CD  
371  C CE  . LYS A 63  ? 1.5437 1.5922 1.3494 -0.0619 -0.0345 -0.0267 63  LYS A CE  
372  N NZ  . LYS A 63  ? 1.7301 1.7968 1.4991 -0.0687 -0.0344 -0.0438 63  LYS A NZ  
373  N N   . THR A 64  ? 1.2100 1.1925 1.0915 -0.0191 -0.0723 0.0530  64  THR A N   
374  C CA  . THR A 64  ? 1.1523 1.1049 1.0321 -0.0232 -0.0583 0.0681  64  THR A CA  
375  C C   . THR A 64  ? 1.2306 1.1673 1.0708 -0.0268 -0.0570 0.0932  64  THR A C   
376  O O   . THR A 64  ? 1.4282 1.3619 1.2481 -0.0177 -0.0730 0.1114  64  THR A O   
377  C CB  . THR A 64  ? 1.2593 1.1949 1.1707 -0.0129 -0.0637 0.0718  64  THR A CB  
378  O OG1 . THR A 64  ? 1.2990 1.2458 1.2441 -0.0137 -0.0556 0.0497  64  THR A OG1 
379  C CG2 . THR A 64  ? 1.2704 1.1738 1.1761 -0.0181 -0.0535 0.0880  64  THR A CG2 
380  N N   . ARG A 65  ? 1.3103 1.2389 1.1406 -0.0397 -0.0372 0.0954  65  ARG A N   
381  C CA  . ARG A 65  ? 1.3231 1.2342 1.1243 -0.0465 -0.0295 0.1196  65  ARG A CA  
382  C C   . ARG A 65  ? 1.2841 1.1712 1.1093 -0.0531 -0.0182 0.1251  65  ARG A C   
383  O O   . ARG A 65  ? 1.2603 1.1508 1.1161 -0.0537 -0.0140 0.1079  65  ARG A O   
384  C CB  . ARG A 65  ? 1.3207 1.2487 1.0930 -0.0575 -0.0143 0.1150  65  ARG A CB  
385  C CG  . ARG A 65  ? 1.6227 1.5607 1.4190 -0.0655 0.0038  0.0951  65  ARG A CG  
386  C CD  . ARG A 65  ? 1.8117 1.7697 1.5860 -0.0716 0.0168  0.0835  65  ARG A CD  
387  N NE  . ARG A 65  ? 1.7045 1.6805 1.4809 -0.0670 0.0085  0.0604  65  ARG A NE  
388  C CZ  . ARG A 65  ? 1.8109 1.8036 1.5697 -0.0713 0.0174  0.0435  65  ARG A CZ  
389  N NH1 . ARG A 65  ? 1.8460 1.8414 1.5824 -0.0785 0.0358  0.0481  65  ARG A NH1 
390  N NH2 . ARG A 65  ? 1.9847 1.9919 1.7510 -0.0693 0.0093  0.0199  65  ARG A NH2 
391  N N   . THR A 66  ? 1.4481 1.3116 1.2587 -0.0591 -0.0129 0.1489  66  THR A N   
392  C CA  . THR A 66  ? 1.4774 1.3184 1.3120 -0.0686 -0.0026 0.1520  66  THR A CA  
393  C C   . THR A 66  ? 1.4195 1.2670 1.2447 -0.0864 0.0179  0.1573  66  THR A C   
394  O O   . THR A 66  ? 1.6817 1.5274 1.4756 -0.0916 0.0247  0.1759  66  THR A O   
395  C CB  . THR A 66  ? 1.5295 1.3320 1.3669 -0.0629 -0.0107 0.1741  66  THR A CB  
396  O OG1 . THR A 66  ? 1.4873 1.2671 1.3493 -0.0760 0.0008  0.1733  66  THR A OG1 
397  C CG2 . THR A 66  ? 1.4735 1.2646 1.2700 -0.0621 -0.0118 0.2053  66  THR A CG2 
398  N N   . ILE A 67  ? 1.2671 1.1261 1.1194 -0.0952 0.0281  0.1411  67  ILE A N   
399  C CA  . ILE A 67  ? 1.4213 1.2904 1.2745 -0.1117 0.0470  0.1456  67  ILE A CA  
400  C C   . ILE A 67  ? 1.6484 1.4964 1.5278 -0.1246 0.0514  0.1502  67  ILE A C   
401  O O   . ILE A 67  ? 1.6772 1.5296 1.5860 -0.1258 0.0479  0.1327  67  ILE A O   
402  C CB  . ILE A 67  ? 1.5386 1.4422 1.4053 -0.1124 0.0559  0.1253  67  ILE A CB  
403  C CG1 . ILE A 67  ? 1.4746 1.3950 1.3183 -0.1023 0.0542  0.1173  67  ILE A CG1 
404  C CG2 . ILE A 67  ? 1.5900 1.5089 1.4644 -0.1277 0.0751  0.1297  67  ILE A CG2 
405  C CD1 . ILE A 67  ? 1.3970 1.3450 1.2547 -0.1012 0.0655  0.0991  67  ILE A CD1 
406  N N   . ASP A 68  ? 1.6870 1.5119 1.5536 -0.1351 0.0598  0.1739  68  ASP A N   
407  C CA  . ASP A 68  ? 1.7160 1.5148 1.6079 -0.1508 0.0663  0.1797  68  ASP A CA  
408  C C   . ASP A 68  ? 1.6935 1.4660 1.6054 -0.1403 0.0503  0.1692  68  ASP A C   
409  O O   . ASP A 68  ? 1.7133 1.4579 1.6129 -0.1264 0.0393  0.1822  68  ASP A O   
410  C CB  . ASP A 68  ? 1.8197 1.6486 1.7427 -0.1682 0.0790  0.1632  68  ASP A CB  
411  C CG  . ASP A 68  ? 2.0253 1.8318 1.9794 -0.1890 0.0861  0.1647  68  ASP A CG  
412  O OD1 . ASP A 68  ? 2.2421 2.0048 2.1990 -0.1875 0.0799  0.1729  68  ASP A OD1 
413  O OD2 . ASP A 68  ? 1.9290 1.7633 1.9098 -0.2060 0.0969  0.1544  68  ASP A OD2 
414  N N   . LYS A 69  ? 1.7580 1.5441 1.7010 -0.1457 0.0488  0.1443  69  LYS A N   
415  C CA  . LYS A 69  ? 1.7864 1.5529 1.7510 -0.1387 0.0375  0.1276  69  LYS A CA  
416  C C   . LYS A 69  ? 1.6651 1.4425 1.6203 -0.1161 0.0242  0.1184  69  LYS A C   
417  O O   . LYS A 69  ? 1.6065 1.3598 1.5664 -0.1026 0.0142  0.1183  69  LYS A O   
418  C CB  . LYS A 69  ? 1.8994 1.6883 1.8924 -0.1518 0.0400  0.1023  69  LYS A CB  
419  C CG  . LYS A 69  ? 1.9715 1.7893 1.9697 -0.1695 0.0533  0.1065  69  LYS A CG  
420  C CD  . LYS A 69  ? 1.9437 1.7995 1.9656 -0.1757 0.0511  0.0822  69  LYS A CD  
421  C CE  . LYS A 69  ? 1.9009 1.7863 1.9403 -0.1951 0.0640  0.0847  69  LYS A CE  
422  N NZ  . LYS A 69  ? 1.7668 1.6661 1.7847 -0.1920 0.0765  0.1041  69  LYS A NZ  
423  N N   . LEU A 70  ? 1.4348 1.2499 1.3806 -0.1125 0.0258  0.1104  70  LEU A N   
424  C CA  . LEU A 70  ? 1.3003 1.1343 1.2482 -0.0974 0.0176  0.0936  70  LEU A CA  
425  C C   . LEU A 70  ? 1.4081 1.2460 1.3361 -0.0827 0.0099  0.1010  70  LEU A C   
426  O O   . LEU A 70  ? 1.3506 1.1919 1.2547 -0.0843 0.0125  0.1161  70  LEU A O   
427  C CB  . LEU A 70  ? 1.3333 1.2032 1.2873 -0.1018 0.0245  0.0800  70  LEU A CB  
428  C CG  . LEU A 70  ? 1.3955 1.2732 1.3713 -0.1067 0.0234  0.0617  70  LEU A CG  
429  C CD1 . LEU A 70  ? 1.4058 1.3203 1.3863 -0.1096 0.0292  0.0551  70  LEU A CD1 
430  C CD2 . LEU A 70  ? 1.4941 1.3649 1.4750 -0.0933 0.0152  0.0476  70  LEU A CD2 
431  N N   . LEU A 71  ? 1.4891 1.3300 1.4281 -0.0691 0.0007  0.0881  71  LEU A N   
432  C CA  . LEU A 71  ? 1.4310 1.2850 1.3602 -0.0563 -0.0079 0.0878  71  LEU A CA  
433  C C   . LEU A 71  ? 1.4229 1.3070 1.3536 -0.0574 -0.0009 0.0722  71  LEU A C   
434  O O   . LEU A 71  ? 1.6250 1.5170 1.5728 -0.0568 0.0030  0.0578  71  LEU A O   
435  C CB  . LEU A 71  ? 1.3641 1.2075 1.3119 -0.0413 -0.0198 0.0819  71  LEU A CB  
436  C CG  . LEU A 71  ? 1.4566 1.2934 1.3953 -0.0278 -0.0348 0.0968  71  LEU A CG  
437  C CD1 . LEU A 71  ? 1.5084 1.3144 1.4294 -0.0309 -0.0357 0.1237  71  LEU A CD1 
438  C CD2 . LEU A 71  ? 1.4281 1.2628 1.3959 -0.0115 -0.0446 0.0860  71  LEU A CD2 
439  N N   . VAL A 72  ? 1.2727 1.1720 1.1843 -0.0591 0.0020  0.0753  72  VAL A N   
440  C CA  . VAL A 72  ? 1.3475 1.2693 1.2635 -0.0595 0.0102  0.0608  72  VAL A CA  
441  C C   . VAL A 72  ? 1.3046 1.2383 1.2161 -0.0524 0.0025  0.0527  72  VAL A C   
442  O O   . VAL A 72  ? 1.0959 1.0285 0.9892 -0.0495 -0.0081 0.0610  72  VAL A O   
443  C CB  . VAL A 72  ? 1.2591 1.1915 1.1644 -0.0688 0.0246  0.0642  72  VAL A CB  
444  C CG1 . VAL A 72  ? 1.2467 1.1713 1.1591 -0.0782 0.0298  0.0729  72  VAL A CG1 
445  C CG2 . VAL A 72  ? 1.2410 1.1774 1.1180 -0.0710 0.0254  0.0713  72  VAL A CG2 
446  N N   . THR A 73  ? 1.2996 1.2458 1.2281 -0.0503 0.0074  0.0369  73  THR A N   
447  C CA  . THR A 73  ? 1.1837 1.1429 1.1193 -0.0457 0.0000  0.0246  73  THR A CA  
448  C C   . THR A 73  ? 1.1369 1.1086 1.0647 -0.0514 0.0095  0.0132  73  THR A C   
449  O O   . THR A 73  ? 1.2184 1.1888 1.1453 -0.0555 0.0249  0.0128  73  THR A O   
450  C CB  . THR A 73  ? 1.1496 1.1123 1.1155 -0.0407 0.0012  0.0132  73  THR A CB  
451  O OG1 . THR A 73  ? 1.2728 1.2215 1.2461 -0.0367 -0.0015 0.0197  73  THR A OG1 
452  C CG2 . THR A 73  ? 1.1208 1.0987 1.1016 -0.0356 -0.0109 0.0023  73  THR A CG2 
453  N N   . ALA A 74  ? 0.9973 0.9824 0.9217 -0.0508 -0.0003 0.0025  74  ALA A N   
454  C CA  . ALA A 74  ? 0.9778 0.9736 0.8976 -0.0572 0.0083  -0.0144 74  ALA A CA  
455  C C   . ALA A 74  ? 0.9764 0.9885 0.9186 -0.0578 -0.0001 -0.0345 74  ALA A C   
456  O O   . ALA A 74  ? 1.1809 1.2022 1.1344 -0.0516 -0.0172 -0.0331 74  ALA A O   
457  C CB  . ALA A 74  ? 0.7522 0.7525 0.6339 -0.0607 0.0060  -0.0102 74  ALA A CB  
458  N N   . PHE A 75  ? 1.1622 1.1778 1.1154 -0.0652 0.0128  -0.0539 75  PHE A N   
459  C CA  . PHE A 75  ? 1.0104 1.0438 0.9876 -0.0700 0.0061  -0.0769 75  PHE A CA  
460  C C   . PHE A 75  ? 1.0508 1.1064 1.0032 -0.0711 -0.0152 -0.0855 75  PHE A C   
461  O O   . PHE A 75  ? 1.1667 1.2210 1.0818 -0.0730 -0.0140 -0.0828 75  PHE A O   
462  C CB  . PHE A 75  ? 0.8664 0.8917 0.8638 -0.0794 0.0281  -0.0957 75  PHE A CB  
463  C CG  . PHE A 75  ? 0.9307 0.9381 0.9536 -0.0772 0.0470  -0.0863 75  PHE A CG  
464  C CD1 . PHE A 75  ? 0.9000 0.9136 0.9551 -0.0772 0.0467  -0.0890 75  PHE A CD1 
465  C CD2 . PHE A 75  ? 0.9533 0.9412 0.9677 -0.0744 0.0652  -0.0743 75  PHE A CD2 
466  C CE1 . PHE A 75  ? 0.8552 0.8537 0.9267 -0.0751 0.0651  -0.0788 75  PHE A CE1 
467  C CE2 . PHE A 75  ? 0.9128 0.8873 0.9453 -0.0707 0.0802  -0.0633 75  PHE A CE2 
468  C CZ  . PHE A 75  ? 0.9876 0.9664 1.0453 -0.0715 0.0807  -0.0651 75  PHE A CZ  
469  N N   . GLN A 76  ? 1.0525 1.1322 1.0257 -0.0692 -0.0346 -0.0957 76  GLN A N   
470  C CA  . GLN A 76  ? 1.1174 1.2248 1.0674 -0.0680 -0.0598 -0.1030 76  GLN A CA  
471  C C   . GLN A 76  ? 1.1842 1.3126 1.1461 -0.0822 -0.0589 -0.1391 76  GLN A C   
472  O O   . GLN A 76  ? 1.3945 1.5423 1.3996 -0.0874 -0.0638 -0.1588 76  GLN A O   
473  C CB  . GLN A 76  ? 0.9929 1.1195 0.9610 -0.0550 -0.0855 -0.0927 76  GLN A CB  
474  C CG  . GLN A 76  ? 1.0313 1.1940 0.9809 -0.0511 -0.1161 -0.0997 76  GLN A CG  
475  C CD  . GLN A 76  ? 1.2513 1.4096 1.1375 -0.0512 -0.1201 -0.0881 76  GLN A CD  
476  O OE1 . GLN A 76  ? 1.5790 1.7467 1.4435 -0.0634 -0.1141 -0.1103 76  GLN A OE1 
477  N NE2 . GLN A 76  ? 1.1130 1.2553 0.9694 -0.0383 -0.1281 -0.0539 76  GLN A NE2 
478  N N   . SER A 77  ? 1.1359 1.2611 1.0615 -0.0894 -0.0512 -0.1498 77  SER A N   
479  C CA  . SER A 77  ? 1.2724 1.4099 1.2079 -0.1048 -0.0450 -0.1882 77  SER A CA  
480  C C   . SER A 77  ? 1.1853 1.3673 1.1270 -0.1090 -0.0750 -0.2121 77  SER A C   
481  O O   . SER A 77  ? 1.1140 1.3106 1.0731 -0.1243 -0.0725 -0.2493 77  SER A O   
482  C CB  . SER A 77  ? 1.1583 1.2832 1.0497 -0.1095 -0.0294 -0.1950 77  SER A CB  
483  O OG  . SER A 77  ? 1.3180 1.4553 1.1543 -0.1015 -0.0460 -0.1764 77  SER A OG  
484  N N   . SER A 78  ? 1.1591 1.3633 1.0892 -0.0951 -0.1036 -0.1916 78  SER A N   
485  C CA  . SER A 78  ? 1.2546 1.5077 1.1952 -0.0952 -0.1366 -0.2106 78  SER A CA  
486  C C   . SER A 78  ? 1.3011 1.5712 1.3147 -0.1024 -0.1357 -0.2312 78  SER A C   
487  O O   . SER A 78  ? 1.3204 1.6329 1.3593 -0.1112 -0.1548 -0.2617 78  SER A O   
488  C CB  . SER A 78  ? 1.2389 1.5077 1.1498 -0.0742 -0.1669 -0.1774 78  SER A CB  
489  O OG  . SER A 78  ? 1.4121 1.6666 1.2541 -0.0697 -0.1659 -0.1572 78  SER A OG  
490  N N   . VAL A 79  ? 1.2767 1.5162 1.3238 -0.0994 -0.1131 -0.2151 79  VAL A N   
491  C CA  . VAL A 79  ? 1.2164 1.4672 1.3312 -0.1068 -0.1049 -0.2307 79  VAL A CA  
492  C C   . VAL A 79  ? 1.2080 1.4319 1.3461 -0.1268 -0.0709 -0.2526 79  VAL A C   
493  O O   . VAL A 79  ? 1.1567 1.3378 1.2793 -0.1250 -0.0446 -0.2355 79  VAL A O   
494  C CB  . VAL A 79  ? 1.1302 1.3654 1.2668 -0.0911 -0.0991 -0.2008 79  VAL A CB  
495  C CG1 . VAL A 79  ? 1.2142 1.4638 1.4190 -0.0996 -0.0869 -0.2172 79  VAL A CG1 
496  C CG2 . VAL A 79  ? 0.9069 1.1613 1.0245 -0.0695 -0.1307 -0.1776 79  VAL A CG2 
497  N N   . PRO A 80  ? 1.1113 1.3606 1.2891 -0.1457 -0.0719 -0.2906 80  PRO A N   
498  C CA  . PRO A 80  ? 1.1416 1.3634 1.3461 -0.1663 -0.0396 -0.3145 80  PRO A CA  
499  C C   . PRO A 80  ? 1.1528 1.3335 1.3837 -0.1644 -0.0061 -0.2919 80  PRO A C   
500  O O   . PRO A 80  ? 1.2504 1.3898 1.4752 -0.1703 0.0227  -0.2910 80  PRO A O   
501  C CB  . PRO A 80  ? 1.0579 1.3234 1.3156 -0.1857 -0.0518 -0.3553 80  PRO A CB  
502  C CG  . PRO A 80  ? 0.9261 1.2441 1.1590 -0.1758 -0.0952 -0.3599 80  PRO A CG  
503  C CD  . PRO A 80  ? 0.9946 1.3030 1.1954 -0.1485 -0.1059 -0.3140 80  PRO A CD  
504  N N   . ALA A 81  ? 1.0932 1.2864 1.3518 -0.1549 -0.0099 -0.2739 81  ALA A N   
505  C CA  . ALA A 81  ? 1.1320 1.2916 1.4085 -0.1517 0.0199  -0.2513 81  ALA A CA  
506  C C   . ALA A 81  ? 1.1170 1.2363 1.3427 -0.1373 0.0305  -0.2203 81  ALA A C   
507  O O   . ALA A 81  ? 1.1012 1.1840 1.3281 -0.1392 0.0590  -0.2091 81  ALA A O   
508  C CB  . ALA A 81  ? 0.9510 1.1366 1.2612 -0.1424 0.0119  -0.2407 81  ALA A CB  
509  N N   . ALA A 82  ? 1.1245 1.2522 1.3074 -0.1229 0.0073  -0.2054 82  ALA A N   
510  C CA  . ALA A 82  ? 0.9954 1.0912 1.1330 -0.1114 0.0153  -0.1785 82  ALA A CA  
511  C C   . ALA A 82  ? 1.0815 1.1545 1.1985 -0.1198 0.0322  -0.1896 82  ALA A C   
512  O O   . ALA A 82  ? 0.9712 1.0121 1.0805 -0.1163 0.0547  -0.1744 82  ALA A O   
513  C CB  . ALA A 82  ? 0.8257 0.9351 0.9258 -0.0970 -0.0118 -0.1612 82  ALA A CB  
514  N N   . LYS A 83  ? 1.1302 1.2226 1.2396 -0.1299 0.0208  -0.2177 83  LYS A N   
515  C CA  . LYS A 83  ? 1.0909 1.1646 1.1827 -0.1384 0.0369  -0.2356 83  LYS A CA  
516  C C   . LYS A 83  ? 1.1902 1.2295 1.3187 -0.1471 0.0703  -0.2419 83  LYS A C   
517  O O   . LYS A 83  ? 1.3014 1.3097 1.4163 -0.1438 0.0914  -0.2362 83  LYS A O   
518  C CB  . LYS A 83  ? 1.0853 1.1910 1.1698 -0.1509 0.0184  -0.2724 83  LYS A CB  
519  C CG  . LYS A 83  ? 1.0274 1.1266 1.0643 -0.1521 0.0222  -0.2844 83  LYS A CG  
520  C CD  . LYS A 83  ? 0.9385 1.0740 0.9669 -0.1657 0.0024  -0.3250 83  LYS A CD  
521  C CE  . LYS A 83  ? 1.1777 1.3108 1.1516 -0.1664 0.0066  -0.3384 83  LYS A CE  
522  N NZ  . LYS A 83  ? 1.4559 1.5899 1.3754 -0.1491 -0.0024 -0.3011 83  LYS A NZ  
523  N N   . ARG A 84  ? 1.1927 1.2382 1.3699 -0.1573 0.0759  -0.2520 84  ARG A N   
524  C CA  . ARG A 84  ? 1.2092 1.2200 1.4234 -0.1665 0.1089  -0.2545 84  ARG A CA  
525  C C   . ARG A 84  ? 1.1818 1.1602 1.3847 -0.1508 0.1277  -0.2155 84  ARG A C   
526  O O   . ARG A 84  ? 1.1768 1.1187 1.3833 -0.1497 0.1533  -0.2095 84  ARG A O   
527  C CB  . ARG A 84  ? 1.1348 1.1639 1.4045 -0.1821 0.1115  -0.2712 84  ARG A CB  
528  C CG  . ARG A 84  ? 1.1022 1.1562 1.3972 -0.2036 0.1018  -0.3171 84  ARG A CG  
529  C CD  . ARG A 84  ? 1.0668 1.1371 1.4266 -0.2222 0.1103  -0.3342 84  ARG A CD  
530  N NE  . ARG A 84  ? 1.2171 1.3336 1.5911 -0.2150 0.0859  -0.3263 84  ARG A NE  
531  C CZ  . ARG A 84  ? 1.1609 1.3304 1.5442 -0.2192 0.0530  -0.3507 84  ARG A CZ  
532  N NH1 . ARG A 84  ? 1.3017 1.4864 1.6765 -0.2324 0.0398  -0.3863 84  ARG A NH1 
533  N NH2 . ARG A 84  ? 0.9504 1.1593 1.3514 -0.2089 0.0328  -0.3404 84  ARG A NH2 
534  N N   . VAL A 85  ? 1.2110 1.2036 1.4010 -0.1378 0.1142  -0.1901 85  VAL A N   
535  C CA  . VAL A 85  ? 1.1646 1.1340 1.3395 -0.1232 0.1271  -0.1558 85  VAL A CA  
536  C C   . VAL A 85  ? 1.1177 1.0737 1.2528 -0.1122 0.1264  -0.1436 85  VAL A C   
537  O O   . VAL A 85  ? 1.1546 1.0844 1.2860 -0.1045 0.1453  -0.1264 85  VAL A O   
538  C CB  . VAL A 85  ? 0.9932 0.9823 1.1652 -0.1136 0.1124  -0.1376 85  VAL A CB  
539  C CG1 . VAL A 85  ? 0.9372 0.9074 1.0851 -0.0990 0.1206  -0.1063 85  VAL A CG1 
540  C CG2 . VAL A 85  ? 0.7888 0.7910 1.0049 -0.1230 0.1198  -0.1467 85  VAL A CG2 
541  N N   . SER A 86  ? 1.1267 1.1033 1.2333 -0.1108 0.1048  -0.1516 86  SER A N   
542  C CA  . SER A 86  ? 1.0477 1.0173 1.1171 -0.1027 0.1047  -0.1421 86  SER A CA  
543  C C   . SER A 86  ? 1.1027 1.0480 1.1780 -0.1056 0.1286  -0.1549 86  SER A C   
544  O O   . SER A 86  ? 1.1909 1.1234 1.2505 -0.0956 0.1391  -0.1404 86  SER A O   
545  C CB  . SER A 86  ? 1.0946 1.0907 1.1320 -0.1038 0.0800  -0.1512 86  SER A CB  
546  O OG  . SER A 86  ? 1.0920 1.0836 1.0928 -0.0965 0.0814  -0.1379 86  SER A OG  
547  N N   . SER A 87  ? 1.2425 1.1822 1.3453 -0.1193 0.1378  -0.1834 87  SER A N   
548  C CA  . SER A 87  ? 1.1310 1.0447 1.2434 -0.1232 0.1610  -0.2021 87  SER A CA  
549  C C   . SER A 87  ? 0.9728 0.8493 1.1084 -0.1142 0.1884  -0.1807 87  SER A C   
550  O O   . SER A 87  ? 1.2035 1.0557 1.3425 -0.1092 0.2079  -0.1857 87  SER A O   
551  C CB  . SER A 87  ? 1.2057 1.1241 1.3439 -0.1434 0.1618  -0.2430 87  SER A CB  
552  O OG  . SER A 87  ? 1.2506 1.2060 1.3618 -0.1498 0.1354  -0.2644 87  SER A OG  
553  N N   . THR A 88  ? 1.0413 0.9140 1.1920 -0.1107 0.1904  -0.1565 88  THR A N   
554  C CA  . THR A 88  ? 1.0664 0.9064 1.2334 -0.1005 0.2143  -0.1310 88  THR A CA  
555  C C   . THR A 88  ? 1.1853 1.0195 1.3297 -0.0812 0.2174  -0.1089 88  THR A C   
556  O O   . THR A 88  ? 1.3594 1.1654 1.5175 -0.0705 0.2381  -0.0947 88  THR A O   
557  C CB  . THR A 88  ? 1.1415 0.9864 1.3164 -0.0985 0.2133  -0.1065 88  THR A CB  
558  O OG1 . THR A 88  ? 1.3065 1.1747 1.4505 -0.0865 0.1934  -0.0860 88  THR A OG1 
559  C CG2 . THR A 88  ? 1.0513 0.9124 1.2522 -0.1169 0.2080  -0.1282 88  THR A CG2 
560  N N   . PHE A 89  ? 1.1551 1.0168 1.2678 -0.0766 0.1970  -0.1052 89  PHE A N   
561  C CA  . PHE A 89  ? 1.0988 0.9639 1.1932 -0.0609 0.1976  -0.0857 89  PHE A CA  
562  C C   . PHE A 89  ? 1.1756 1.0307 1.2708 -0.0581 0.2122  -0.1032 89  PHE A C   
563  O O   . PHE A 89  ? 1.3720 1.2249 1.4665 -0.0434 0.2207  -0.0880 89  PHE A O   
564  C CB  . PHE A 89  ? 1.0836 0.9789 1.1471 -0.0602 0.1735  -0.0767 89  PHE A CB  
565  C CG  . PHE A 89  ? 1.1028 1.0068 1.1652 -0.0583 0.1614  -0.0571 89  PHE A CG  
566  C CD1 . PHE A 89  ? 1.0522 0.9646 1.1221 -0.0684 0.1510  -0.0675 89  PHE A CD1 
567  C CD2 . PHE A 89  ? 0.8142 0.7211 0.8700 -0.0462 0.1603  -0.0308 89  PHE A CD2 
568  C CE1 . PHE A 89  ? 0.8509 0.7713 0.9211 -0.0656 0.1427  -0.0523 89  PHE A CE1 
569  C CE2 . PHE A 89  ? 0.9423 0.8571 0.9947 -0.0449 0.1505  -0.0170 89  PHE A CE2 
570  C CZ  . PHE A 89  ? 0.9387 0.8586 0.9980 -0.0542 0.1431  -0.0279 89  PHE A CZ  
571  N N   . ASP A 90  ? 1.2183 1.0707 1.3165 -0.0721 0.2148  -0.1375 90  ASP A N   
572  C CA  . ASP A 90  ? 1.3152 1.1594 1.4113 -0.0709 0.2298  -0.1609 90  ASP A CA  
573  C C   . ASP A 90  ? 1.2557 1.0626 1.3855 -0.0589 0.2581  -0.1549 90  ASP A C   
574  O O   . ASP A 90  ? 1.3991 1.2000 1.5307 -0.0481 0.2727  -0.1606 90  ASP A O   
575  C CB  . ASP A 90  ? 1.5431 1.3939 1.6345 -0.0902 0.2252  -0.2028 90  ASP A CB  
576  C CG  . ASP A 90  ? 1.8781 1.7667 1.9356 -0.0988 0.1954  -0.2056 90  ASP A CG  
577  O OD1 . ASP A 90  ? 2.0114 1.9190 2.0396 -0.0901 0.1839  -0.1839 90  ASP A OD1 
578  O OD2 . ASP A 90  ? 1.9511 1.8509 2.0140 -0.1140 0.1835  -0.2292 90  ASP A OD2 
579  N N   . GLY A 91  ? 1.3313 1.1132 1.4888 -0.0597 0.2670  -0.1420 91  GLY A N   
580  C CA  . GLY A 91  ? 1.2041 0.9470 1.3924 -0.0454 0.2930  -0.1269 91  GLY A CA  
581  C C   . GLY A 91  ? 1.1943 0.9478 1.3746 -0.0213 0.2902  -0.0886 91  GLY A C   
582  O O   . GLY A 91  ? 1.2466 0.9820 1.4448 -0.0032 0.3075  -0.0798 91  GLY A O   
583  N N   . LEU A 92  ? 1.0941 0.8787 1.2501 -0.0207 0.2677  -0.0676 92  LEU A N   
584  C CA  . LEU A 92  ? 1.1544 0.9559 1.3024 -0.0012 0.2609  -0.0340 92  LEU A CA  
585  C C   . LEU A 92  ? 1.1649 0.9871 1.3066 0.0080  0.2612  -0.0403 92  LEU A C   
586  O O   . LEU A 92  ? 1.2747 1.1031 1.4276 0.0277  0.2655  -0.0189 92  LEU A O   
587  C CB  . LEU A 92  ? 0.9782 0.8074 1.1024 -0.0063 0.2372  -0.0176 92  LEU A CB  
588  C CG  . LEU A 92  ? 1.1090 0.9251 1.2385 -0.0131 0.2379  -0.0073 92  LEU A CG  
589  C CD1 . LEU A 92  ? 0.9152 0.7598 1.0215 -0.0135 0.2164  0.0090  92  LEU A CD1 
590  C CD2 . LEU A 92  ? 1.1501 0.9339 1.3013 0.0005  0.2592  0.0156  92  LEU A CD2 
591  N N   . ARG A 93  ? 1.1327 0.9690 1.2565 -0.0059 0.2566  -0.0691 93  ARG A N   
592  C CA  . ARG A 93  ? 1.0690 0.9268 1.1840 0.0000  0.2603  -0.0771 93  ARG A CA  
593  C C   . ARG A 93  ? 1.1014 0.9383 1.2481 0.0173  0.2864  -0.0816 93  ARG A C   
594  O O   . ARG A 93  ? 1.0691 0.9244 1.2253 0.0334  0.2910  -0.0688 93  ARG A O   
595  C CB  . ARG A 93  ? 1.2453 1.1169 1.3314 -0.0183 0.2544  -0.1085 93  ARG A CB  
596  C CG  . ARG A 93  ? 1.4599 1.3526 1.5341 -0.0138 0.2635  -0.1182 93  ARG A CG  
597  C CD  . ARG A 93  ? 1.7311 1.6380 1.7687 -0.0313 0.2579  -0.1472 93  ARG A CD  
598  N NE  . ARG A 93  ? 1.7759 1.7003 1.7835 -0.0438 0.2309  -0.1371 93  ARG A NE  
599  C CZ  . ARG A 93  ? 1.7102 1.6357 1.6992 -0.0588 0.2181  -0.1575 93  ARG A CZ  
600  N NH1 . ARG A 93  ? 1.8067 1.7178 1.8029 -0.0662 0.2295  -0.1920 93  ARG A NH1 
601  N NH2 . ARG A 93  ? 1.6572 1.5993 1.6234 -0.0659 0.1934  -0.1448 93  ARG A NH2 
602  N N   . ASP A 94  ? 1.3259 1.1246 1.4935 0.0138  0.3041  -0.1009 94  ASP A N   
603  C CA  . ASP A 94  ? 1.4100 1.1790 1.6133 0.0314  0.3313  -0.1057 94  ASP A CA  
604  C C   . ASP A 94  ? 1.2885 1.0511 1.5148 0.0563  0.3327  -0.0627 94  ASP A C   
605  O O   . ASP A 94  ? 1.3212 1.0865 1.5709 0.0792  0.3447  -0.0528 94  ASP A O   
606  C CB  . ASP A 94  ? 1.5750 1.2990 1.7981 0.0190  0.3495  -0.1352 94  ASP A CB  
607  C CG  . ASP A 94  ? 1.6842 1.3739 1.9432 0.0347  0.3804  -0.1510 94  ASP A CG  
608  O OD1 . ASP A 94  ? 1.9163 1.6061 2.1968 0.0617  0.3890  -0.1251 94  ASP A OD1 
609  O OD2 . ASP A 94  ? 1.8403 1.5040 2.1083 0.0205  0.3958  -0.1915 94  ASP A OD2 
610  N N   . ALA A 95  ? 1.3097 1.0680 1.5283 0.0527  0.3198  -0.0374 95  ALA A N   
611  C CA  . ALA A 95  ? 1.2523 1.0064 1.4842 0.0752  0.3187  0.0047  95  ALA A CA  
612  C C   . ALA A 95  ? 1.2622 1.0631 1.4880 0.0912  0.3031  0.0253  95  ALA A C   
613  O O   . ALA A 95  ? 1.1886 0.9922 1.4335 0.1161  0.3050  0.0545  95  ALA A O   
614  C CB  . ALA A 95  ? 1.0869 0.8333 1.3038 0.0646  0.3081  0.0235  95  ALA A CB  
615  N N   . ILE A 96  ? 1.2887 1.1271 1.4896 0.0767  0.2875  0.0107  96  ILE A N   
616  C CA  . ILE A 96  ? 1.1617 1.0465 1.3583 0.0857  0.2721  0.0275  96  ILE A CA  
617  C C   . ILE A 96  ? 1.1298 1.0319 1.3508 0.0998  0.2869  0.0172  96  ILE A C   
618  O O   . ILE A 96  ? 1.0251 0.9562 1.2663 0.1189  0.2826  0.0378  96  ILE A O   
619  C CB  . ILE A 96  ? 1.0562 0.9702 1.2171 0.0632  0.2503  0.0201  96  ILE A CB  
620  C CG1 . ILE A 96  ? 1.0391 0.9427 1.1814 0.0535  0.2355  0.0327  96  ILE A CG1 
621  C CG2 . ILE A 96  ? 0.9846 0.9444 1.1459 0.0684  0.2377  0.0328  96  ILE A CG2 
622  C CD1 . ILE A 96  ? 0.9257 0.8541 1.0376 0.0352  0.2138  0.0286  96  ILE A CD1 
623  N N   . GLN A 97  ? 1.1572 1.0451 1.3773 0.0905  0.3043  -0.0162 97  GLN A N   
624  C CA  . GLN A 97  ? 1.2044 1.1058 1.4487 0.1038  0.3239  -0.0307 97  GLN A CA  
625  C C   . GLN A 97  ? 1.1584 1.0447 1.4494 0.1359  0.3383  -0.0114 97  GLN A C   
626  O O   . GLN A 97  ? 1.3956 1.3130 1.7143 0.1550  0.3436  -0.0043 97  GLN A O   
627  C CB  . GLN A 97  ? 1.4241 1.3037 1.6584 0.0897  0.3433  -0.0729 97  GLN A CB  
628  C CG  . GLN A 97  ? 1.5428 1.4439 1.7306 0.0623  0.3309  -0.0929 97  GLN A CG  
629  C CD  . GLN A 97  ? 1.6338 1.5240 1.8103 0.0522  0.3509  -0.1356 97  GLN A CD  
630  O OE1 . GLN A 97  ? 1.5985 1.4543 1.7728 0.0421  0.3570  -0.1592 97  GLN A OE1 
631  N NE2 . GLN A 97  ? 1.5049 1.4265 1.6748 0.0537  0.3621  -0.1474 97  GLN A NE2 
632  N N   . GLN A 98  ? 1.1849 1.0240 1.4865 0.1419  0.3452  -0.0015 98  GLN A N   
633  C CA  . GLN A 98  ? 1.2865 1.0992 1.6313 0.1734  0.3616  0.0187  98  GLN A CA  
634  C C   . GLN A 98  ? 1.2131 1.0489 1.5626 0.1936  0.3414  0.0653  98  GLN A C   
635  O O   . GLN A 98  ? 1.3389 1.1552 1.7196 0.2225  0.3501  0.0913  98  GLN A O   
636  C CB  . GLN A 98  ? 1.3409 1.0867 1.6962 0.1690  0.3818  0.0087  98  GLN A CB  
637  C CG  . GLN A 98  ? 1.4265 1.1536 1.7658 0.1406  0.3935  -0.0400 98  GLN A CG  
638  C CD  . GLN A 98  ? 1.7043 1.3774 2.0793 0.1481  0.4264  -0.0656 98  GLN A CD  
639  O OE1 . GLN A 98  ? 1.9701 1.6410 2.3796 0.1730  0.4448  -0.0683 98  GLN A OE1 
640  N NE2 . GLN A 98  ? 1.5814 1.2112 1.9527 0.1263  0.4347  -0.0866 98  GLN A NE2 
641  N N   . GLY A 99  ? 1.1084 0.9854 1.4259 0.1789  0.3143  0.0754  99  GLY A N   
642  C CA  . GLY A 99  ? 1.1233 1.0292 1.4386 0.1943  0.2922  0.1140  99  GLY A CA  
643  C C   . GLY A 99  ? 1.1913 1.0560 1.4988 0.2019  0.2933  0.1417  99  GLY A C   
644  O O   . GLY A 99  ? 1.1968 1.0723 1.5129 0.2264  0.2843  0.1777  99  GLY A O   
645  N N   . TYR A 100 ? 1.1984 1.0189 1.4897 0.1804  0.3043  0.1255  100 TYR A N   
646  C CA  . TYR A 100 ? 1.2625 1.0392 1.5489 0.1835  0.3116  0.1494  100 TYR A CA  
647  C C   . TYR A 100 ? 1.1873 0.9838 1.4335 0.1682  0.2893  0.1646  100 TYR A C   
648  O O   . TYR A 100 ? 1.3252 1.1126 1.5623 0.1807  0.2866  0.1989  100 TYR A O   
649  C CB  . TYR A 100 ? 1.2242 0.9434 1.5216 0.1666  0.3374  0.1220  100 TYR A CB  
650  C CG  . TYR A 100 ? 1.3011 0.9860 1.6407 0.1834  0.3650  0.1077  100 TYR A CG  
651  C CD1 . TYR A 100 ? 1.2955 0.9930 1.6656 0.2182  0.3684  0.1294  100 TYR A CD1 
652  C CD2 . TYR A 100 ? 1.3369 0.9781 1.6887 0.1649  0.3875  0.0703  100 TYR A CD2 
653  C CE1 . TYR A 100 ? 1.2314 0.8956 1.6439 0.2357  0.3957  0.1146  100 TYR A CE1 
654  C CE2 . TYR A 100 ? 1.3669 0.9736 1.7580 0.1797  0.4146  0.0528  100 TYR A CE2 
655  C CZ  . TYR A 100 ? 1.2979 0.9143 1.7196 0.2159  0.4198  0.0754  100 TYR A CZ  
656  O OH  . TYR A 100 ? 1.2142 0.7948 1.6787 0.2327  0.4488  0.0563  100 TYR A OH  
657  N N   . LEU A 101 ? 1.0331 0.8562 1.2543 0.1422  0.2745  0.1395  101 LEU A N   
658  C CA  . LEU A 101 ? 1.0837 0.9207 1.2700 0.1254  0.2565  0.1462  101 LEU A CA  
659  C C   . LEU A 101 ? 1.0445 0.9277 1.2150 0.1377  0.2323  0.1716  101 LEU A C   
660  O O   . LEU A 101 ? 1.1665 1.0909 1.3411 0.1395  0.2185  0.1648  101 LEU A O   
661  C CB  . LEU A 101 ? 1.1201 0.9681 1.2884 0.0963  0.2485  0.1117  101 LEU A CB  
662  C CG  . LEU A 101 ? 1.0262 0.8835 1.1642 0.0779  0.2329  0.1122  101 LEU A CG  
663  C CD1 . LEU A 101 ? 1.0613 0.8808 1.2008 0.0748  0.2477  0.1229  101 LEU A CD1 
664  C CD2 . LEU A 101 ? 0.9124 0.7811 1.0370 0.0541  0.2241  0.0805  101 LEU A CD2 
665  N N   . ARG A 102 ? 0.9995 0.8774 1.1515 0.1444  0.2279  0.1994  102 ARG A N   
666  C CA  . ARG A 102 ? 0.9359 0.8587 1.0680 0.1546  0.2036  0.2209  102 ARG A CA  
667  C C   . ARG A 102 ? 1.1082 1.0479 1.2050 0.1315  0.1878  0.2096  102 ARG A C   
668  O O   . ARG A 102 ? 1.1915 1.1723 1.2782 0.1245  0.1666  0.2001  102 ARG A O   
669  C CB  . ARG A 102 ? 0.9936 0.9054 1.1227 0.1813  0.2075  0.2620  102 ARG A CB  
670  C CG  . ARG A 102 ? 0.9306 0.8880 1.0286 0.1886  0.1816  0.2824  102 ARG A CG  
671  C CD  . ARG A 102 ? 0.9996 1.0132 1.1147 0.2009  0.1595  0.2807  102 ARG A CD  
672  N NE  . ARG A 102 ? 1.3640 1.3760 1.5152 0.2324  0.1671  0.3021  102 ARG A NE  
673  C CZ  . ARG A 102 ? 1.3975 1.4489 1.5830 0.2439  0.1585  0.2949  102 ARG A CZ  
674  N NH1 . ARG A 102 ? 1.3407 1.4336 1.5270 0.2239  0.1432  0.2678  102 ARG A NH1 
675  N NH2 . ARG A 102 ? 1.3397 1.3879 1.5615 0.2756  0.1669  0.3153  102 ARG A NH2 
676  N N   . GLU A 103 ? 1.1110 1.0184 1.1929 0.1195  0.1996  0.2099  103 GLU A N   
677  C CA  . GLU A 103 ? 1.1539 1.0744 1.2073 0.0993  0.1879  0.1974  103 GLU A CA  
678  C C   . GLU A 103 ? 1.0882 0.9780 1.1473 0.0771  0.2018  0.1733  103 GLU A C   
679  O O   . GLU A 103 ? 1.2244 1.0759 1.2991 0.0770  0.2240  0.1767  103 GLU A O   
680  C CB  . GLU A 103 ? 1.1837 1.1110 1.2076 0.1079  0.1846  0.2245  103 GLU A CB  
681  C CG  . GLU A 103 ? 1.0996 1.0427 1.0953 0.0892  0.1738  0.2096  103 GLU A CG  
682  C CD  . GLU A 103 ? 1.4110 1.3678 1.3721 0.0983  0.1700  0.2336  103 GLU A CD  
683  O OE1 . GLU A 103 ? 1.6292 1.6010 1.5828 0.1200  0.1638  0.2608  103 GLU A OE1 
684  O OE2 . GLU A 103 ? 1.4095 1.3650 1.3503 0.0847  0.1730  0.2249  103 GLU A OE2 
685  N N   . PHE A 104 ? 1.0218 0.9290 1.0708 0.0586  0.1881  0.1488  104 PHE A N   
686  C CA  . PHE A 104 ? 1.0279 0.9169 1.0804 0.0384  0.1952  0.1264  104 PHE A CA  
687  C C   . PHE A 104 ? 0.9247 0.8308 0.9544 0.0289  0.1835  0.1239  104 PHE A C   
688  O O   . PHE A 104 ? 1.0337 0.9670 1.0495 0.0261  0.1639  0.1172  104 PHE A O   
689  C CB  . PHE A 104 ? 0.9513 0.8437 1.0142 0.0267  0.1902  0.0984  104 PHE A CB  
690  C CG  . PHE A 104 ? 0.9626 0.8518 1.0237 0.0069  0.1870  0.0751  104 PHE A CG  
691  C CD1 . PHE A 104 ? 1.1815 1.0448 1.2607 -0.0028 0.2033  0.0629  104 PHE A CD1 
692  C CD2 . PHE A 104 ? 0.9808 0.8934 1.0259 -0.0018 0.1672  0.0649  104 PHE A CD2 
693  C CE1 . PHE A 104 ? 1.3201 1.1878 1.4021 -0.0199 0.1977  0.0408  104 PHE A CE1 
694  C CE2 . PHE A 104 ? 1.0336 0.9456 1.0799 -0.0164 0.1624  0.0457  104 PHE A CE2 
695  C CZ  . PHE A 104 ? 1.1046 0.9976 1.1698 -0.0250 0.1764  0.0334  104 PHE A CZ  
696  N N   . ALA A 105 ? 0.9409 0.8302 0.9695 0.0233  0.1976  0.1281  105 ALA A N   
697  C CA  . ALA A 105 ? 1.0105 0.9164 1.0186 0.0171  0.1906  0.1265  105 ALA A CA  
698  C C   . ALA A 105 ? 1.1778 1.0743 1.2003 -0.0002 0.1993  0.1066  105 ALA A C   
699  O O   . ALA A 105 ? 1.2356 1.1076 1.2803 -0.0065 0.2186  0.1044  105 ALA A O   
700  C CB  . ALA A 105 ? 0.9940 0.9006 0.9801 0.0300  0.1990  0.1557  105 ALA A CB  
701  N N   . ILE A 106 ? 1.2537 1.1706 1.2672 -0.0077 0.1846  0.0910  106 ILE A N   
702  C CA  . ILE A 106 ? 1.0642 0.9812 1.0928 -0.0209 0.1903  0.0735  106 ILE A CA  
703  C C   . ILE A 106 ? 1.0467 0.9712 1.0594 -0.0190 0.2006  0.0837  106 ILE A C   
704  O O   . ILE A 106 ? 1.0965 1.0394 1.0837 -0.0131 0.1882  0.0860  106 ILE A O   
705  C CB  . ILE A 106 ? 0.8577 0.7912 0.8897 -0.0278 0.1687  0.0505  106 ILE A CB  
706  C CG1 . ILE A 106 ? 0.9712 0.9000 1.0110 -0.0299 0.1595  0.0415  106 ILE A CG1 
707  C CG2 . ILE A 106 ? 0.8201 0.7587 0.8733 -0.0384 0.1731  0.0331  106 ILE A CG2 
708  C CD1 . ILE A 106 ? 0.9346 0.8781 0.9691 -0.0338 0.1375  0.0269  106 ILE A CD1 
709  N N   . VAL A 107 ? 1.0405 0.9512 1.0683 -0.0253 0.2247  0.0885  107 VAL A N   
710  C CA  . VAL A 107 ? 1.0828 1.0007 1.0930 -0.0239 0.2396  0.0999  107 VAL A CA  
711  C C   . VAL A 107 ? 1.0476 0.9757 1.0838 -0.0376 0.2487  0.0785  107 VAL A C   
712  O O   . VAL A 107 ? 1.1344 1.0562 1.2079 -0.0494 0.2530  0.0625  107 VAL A O   
713  C CB  . VAL A 107 ? 1.0509 0.9454 1.0530 -0.0183 0.2656  0.1310  107 VAL A CB  
714  C CG1 . VAL A 107 ? 1.0300 0.9238 1.0027 0.0002  0.2546  0.1556  107 VAL A CG1 
715  C CG2 . VAL A 107 ? 1.1976 1.0626 1.2400 -0.0293 0.2848  0.1274  107 VAL A CG2 
716  N N   . PHE A 108 ? 0.9909 0.9382 1.0090 -0.0356 0.2513  0.0761  108 PHE A N   
717  C CA  . PHE A 108 ? 0.9290 0.8911 0.9743 -0.0457 0.2619  0.0563  108 PHE A CA  
718  C C   . PHE A 108 ? 1.0062 0.9672 1.0424 -0.0484 0.2945  0.0721  108 PHE A C   
719  O O   . PHE A 108 ? 1.1274 1.0884 1.1199 -0.0385 0.3004  0.0933  108 PHE A O   
720  C CB  . PHE A 108 ? 0.9860 0.9715 1.0242 -0.0412 0.2408  0.0353  108 PHE A CB  
721  C CG  . PHE A 108 ? 0.9784 0.9650 1.0309 -0.0411 0.2122  0.0195  108 PHE A CG  
722  C CD1 . PHE A 108 ? 1.1113 1.0858 1.1875 -0.0474 0.2082  0.0171  108 PHE A CD1 
723  C CD2 . PHE A 108 ? 1.3053 1.3035 1.3460 -0.0350 0.1908  0.0070  108 PHE A CD2 
724  C CE1 . PHE A 108 ? 1.0422 1.0193 1.1249 -0.0471 0.1832  0.0045  108 PHE A CE1 
725  C CE2 . PHE A 108 ? 1.2942 1.2907 1.3449 -0.0349 0.1667  -0.0030 108 PHE A CE2 
726  C CZ  . PHE A 108 ? 1.0140 1.0016 1.0831 -0.0406 0.1629  -0.0032 108 PHE A CZ  
727  N N   . TYR A 109 ? 0.9613 0.9241 1.0387 -0.0624 0.3157  0.0619  109 TYR A N   
728  C CA  . TYR A 109 ? 1.1306 1.0929 1.2052 -0.0682 0.3516  0.0763  109 TYR A CA  
729  C C   . TYR A 109 ? 1.1369 1.1216 1.2631 -0.0827 0.3651  0.0504  109 TYR A C   
730  O O   . TYR A 109 ? 1.0668 1.0642 1.2327 -0.0878 0.3457  0.0242  109 TYR A O   
731  C CB  . TYR A 109 ? 1.0546 0.9814 1.1300 -0.0722 0.3756  0.1057  109 TYR A CB  
732  C CG  . TYR A 109 ? 0.9912 0.9010 1.1214 -0.0873 0.3781  0.0913  109 TYR A CG  
733  C CD1 . TYR A 109 ? 0.9392 0.8357 1.0738 -0.0830 0.3534  0.0846  109 TYR A CD1 
734  C CD2 . TYR A 109 ? 1.1210 1.0309 1.2994 -0.1072 0.4059  0.0817  109 TYR A CD2 
735  C CE1 . TYR A 109 ? 0.9856 0.8685 1.1663 -0.0975 0.3554  0.0672  109 TYR A CE1 
736  C CE2 . TYR A 109 ? 1.0854 0.9826 1.3148 -0.1231 0.4066  0.0637  109 TYR A CE2 
737  C CZ  . TYR A 109 ? 1.0165 0.8998 1.2443 -0.1178 0.3808  0.0557  109 TYR A CZ  
738  O OH  . TYR A 109 ? 1.0073 0.8797 1.2819 -0.1342 0.3815  0.0340  109 TYR A OH  
739  N N   . LYS A 110 ? 0.9962 0.9888 1.1218 -0.0886 0.3987  0.0587  110 LYS A N   
740  C CA  . LYS A 110 ? 1.1490 1.1658 1.3314 -0.1038 0.4174  0.0360  110 LYS A CA  
741  C C   . LYS A 110 ? 1.3109 1.3061 1.5343 -0.1234 0.4455  0.0454  110 LYS A C   
742  O O   . LYS A 110 ? 1.4492 1.4152 1.6467 -0.1250 0.4722  0.0776  110 LYS A O   
743  C CB  . LYS A 110 ? 1.1018 1.1437 1.2658 -0.1010 0.4417  0.0354  110 LYS A CB  
744  C CG  . LYS A 110 ? 1.1238 1.1881 1.2589 -0.0843 0.4162  0.0173  110 LYS A CG  
745  C CD  . LYS A 110 ? 1.4494 1.5365 1.5609 -0.0813 0.4441  0.0152  110 LYS A CD  
746  C CE  . LYS A 110 ? 1.6238 1.7297 1.7115 -0.0657 0.4200  -0.0079 110 LYS A CE  
747  N NZ  . LYS A 110 ? 1.6408 1.7660 1.7883 -0.0647 0.3985  -0.0408 110 LYS A NZ  
748  N N   . LYS A 111 ? 1.2097 1.2186 1.4969 -0.1381 0.4385  0.0175  111 LYS A N   
749  C CA  . LYS A 111 ? 1.0401 1.0321 1.3766 -0.1610 0.4656  0.0183  111 LYS A CA  
750  C C   . LYS A 111 ? 1.1363 1.1313 1.4789 -0.1723 0.5130  0.0348  111 LYS A C   
751  O O   . LYS A 111 ? 1.1782 1.2109 1.5292 -0.1710 0.5219  0.0221  111 LYS A O   
752  C CB  . LYS A 111 ? 0.8509 0.8721 1.2575 -0.1757 0.4482  -0.0210 111 LYS A CB  
753  C CG  . LYS A 111 ? 0.9615 0.9902 1.3584 -0.1631 0.4006  -0.0392 111 LYS A CG  
754  C CD  . LYS A 111 ? 1.2439 1.2965 1.7050 -0.1791 0.3843  -0.0737 111 LYS A CD  
755  C CE  . LYS A 111 ? 1.3382 1.3543 1.8076 -0.1916 0.3848  -0.0741 111 LYS A CE  
756  N NZ  . LYS A 111 ? 1.1878 1.2270 1.6894 -0.1975 0.3510  -0.1079 111 LYS A NZ  
757  N N   . PRO A 112 ? 1.2059 1.1596 1.5443 -0.1827 0.5455  0.0642  112 PRO A N   
758  C CA  . PRO A 112 ? 1.3570 1.2621 1.6867 -0.1817 0.5386  0.0801  112 PRO A CA  
759  C C   . PRO A 112 ? 1.5149 1.3814 1.7744 -0.1627 0.5482  0.1270  112 PRO A C   
760  O O   . PRO A 112 ? 1.5493 1.3711 1.8078 -0.1627 0.5552  0.1468  112 PRO A O   
761  C CB  . PRO A 112 ? 1.3509 1.2390 1.7373 -0.2048 0.5582  0.0706  112 PRO A CB  
762  C CG  . PRO A 112 ? 0.9797 0.8860 1.3627 -0.2092 0.5854  0.0803  112 PRO A CG  
763  C CD  . PRO A 112 ? 1.0002 0.9538 1.3586 -0.1965 0.5778  0.0714  112 PRO A CD  
764  N N   . ASN A 113 ? 1.5013 1.3871 1.7009 -0.1430 0.5392  0.1403  113 ASN A N   
765  C CA  . ASN A 113 ? 1.4406 1.2990 1.5714 -0.1232 0.5432  0.1839  113 ASN A CA  
766  C C   . ASN A 113 ? 1.4081 1.2542 1.5138 -0.1042 0.5030  0.1850  113 ASN A C   
767  O O   . ASN A 113 ? 1.6298 1.4976 1.6895 -0.0861 0.4759  0.1845  113 ASN A O   
768  C CB  . ASN A 113 ? 1.2967 1.1852 1.3713 -0.1114 0.5501  0.1945  113 ASN A CB  
769  C CG  . ASN A 113 ? 1.4530 1.3600 1.5483 -0.1266 0.5805  0.1888  113 ASN A CG  
770  O OD1 . ASN A 113 ? 1.4733 1.3575 1.6008 -0.1406 0.5997  0.1973  113 ASN A OD1 
771  N ND2 . ASN A 113 ? 1.5422 1.4909 1.6205 -0.1233 0.5840  0.1721  113 ASN A ND2 
772  N N   . GLU A 114 ? 1.2668 1.0784 1.4052 -0.1096 0.5014  0.1850  114 GLU A N   
773  C CA  . GLU A 114 ? 1.2031 1.0066 1.3319 -0.0954 0.4654  0.1780  114 GLU A CA  
774  C C   . GLU A 114 ? 1.3392 1.1347 1.4056 -0.0686 0.4521  0.2126  114 GLU A C   
775  O O   . GLU A 114 ? 1.4871 1.2852 1.5428 -0.0556 0.4212  0.2062  114 GLU A O   
776  C CB  . GLU A 114 ? 1.2639 1.0291 1.4406 -0.1074 0.4739  0.1708  114 GLU A CB  
777  C CG  . GLU A 114 ? 1.2304 1.0109 1.4719 -0.1340 0.4772  0.1293  114 GLU A CG  
778  C CD  . GLU A 114 ? 1.4863 1.2317 1.7714 -0.1463 0.4812  0.1151  114 GLU A CD  
779  O OE1 . GLU A 114 ? 1.7612 1.4691 2.0274 -0.1320 0.4809  0.1365  114 GLU A OE1 
780  O OE2 . GLU A 114 ? 1.2933 1.0508 1.6333 -0.1698 0.4843  0.0804  114 GLU A OE2 
781  N N   . GLU A 115 ? 1.3808 1.1699 1.4062 -0.0606 0.4751  0.2491  115 GLU A N   
782  C CA  . GLU A 115 ? 1.4100 1.1990 1.3746 -0.0344 0.4603  0.2825  115 GLU A CA  
783  C C   . GLU A 115 ? 1.4354 1.2684 1.3486 -0.0265 0.4488  0.2787  115 GLU A C   
784  O O   . GLU A 115 ? 1.4856 1.3303 1.3457 -0.0061 0.4318  0.2998  115 GLU A O   
785  C CB  . GLU A 115 ? 1.4797 1.2258 1.4276 -0.0262 0.4915  0.3329  115 GLU A CB  
786  C CG  . GLU A 115 ? 1.4794 1.1786 1.4848 -0.0374 0.5070  0.3301  115 GLU A CG  
787  C CD  . GLU A 115 ? 1.5776 1.2673 1.6125 -0.0338 0.4832  0.3090  115 GLU A CD  
788  O OE1 . GLU A 115 ? 1.6810 1.3838 1.6839 -0.0110 0.4540  0.3178  115 GLU A OE1 
789  O OE2 . GLU A 115 ? 1.5149 1.1896 1.6054 -0.0537 0.4895  0.2787  115 GLU A OE2 
790  N N   . ASP A 116 ? 1.5846 1.4438 1.5163 -0.0423 0.4580  0.2495  116 ASP A N   
791  C CA  . ASP A 116 ? 1.6287 1.5290 1.5191 -0.0364 0.4477  0.2364  116 ASP A CA  
792  C C   . ASP A 116 ? 1.5437 1.4688 1.4458 -0.0332 0.4069  0.1986  116 ASP A C   
793  O O   . ASP A 116 ? 1.5925 1.5355 1.5327 -0.0448 0.4031  0.1638  116 ASP A O   
794  C CB  . ASP A 116 ? 1.8428 1.7596 1.7497 -0.0528 0.4813  0.2242  116 ASP A CB  
795  C CG  . ASP A 116 ? 2.0974 2.0541 1.9597 -0.0457 0.4757  0.2095  116 ASP A CG  
796  O OD1 . ASP A 116 ? 2.0821 2.0466 1.8806 -0.0288 0.4629  0.2286  116 ASP A OD1 
797  O OD2 . ASP A 116 ? 2.2582 2.2402 2.1511 -0.0565 0.4837  0.1772  116 ASP A OD2 
798  N N   . ILE A 117 ? 1.4351 1.3618 1.3065 -0.0168 0.3769  0.2073  117 ILE A N   
799  C CA  . ILE A 117 ? 1.3430 1.2863 1.2268 -0.0145 0.3398  0.1770  117 ILE A CA  
800  C C   . ILE A 117 ? 1.2868 1.2648 1.1467 -0.0130 0.3261  0.1515  117 ILE A C   
801  O O   . ILE A 117 ? 1.4296 1.4237 1.2393 -0.0047 0.3299  0.1628  117 ILE A O   
802  C CB  . ILE A 117 ? 1.4426 1.3786 1.3068 0.0012  0.3150  0.1947  117 ILE A CB  
803  C CG1 . ILE A 117 ? 1.4059 1.3036 1.2957 0.0021  0.3305  0.2186  117 ILE A CG1 
804  C CG2 . ILE A 117 ? 1.4196 1.3705 1.2993 0.0007  0.2807  0.1649  117 ILE A CG2 
805  C CD1 . ILE A 117 ? 1.4156 1.2969 1.3641 -0.0144 0.3339  0.1929  117 ILE A CD1 
806  N N   . ASN A 118 ? 1.1530 1.1417 1.0484 -0.0204 0.3101  0.1168  118 ASN A N   
807  C CA  . ASN A 118 ? 0.9880 1.0034 0.8702 -0.0186 0.2967  0.0893  118 ASN A CA  
808  C C   . ASN A 118 ? 1.0871 1.1073 0.9624 -0.0124 0.2598  0.0764  118 ASN A C   
809  O O   . ASN A 118 ? 1.2453 1.2833 1.0930 -0.0077 0.2461  0.0621  118 ASN A O   
810  C CB  . ASN A 118 ? 1.0366 1.0615 0.9667 -0.0293 0.3068  0.0607  118 ASN A CB  
811  C CG  . ASN A 118 ? 1.1296 1.1567 1.0701 -0.0377 0.3460  0.0691  118 ASN A CG  
812  O OD1 . ASN A 118 ? 1.2072 1.2398 1.1041 -0.0338 0.3658  0.0864  118 ASN A OD1 
813  N ND2 . ASN A 118 ? 1.3250 1.3506 1.3232 -0.0503 0.3576  0.0570  118 ASN A ND2 
814  N N   . GLU A 119 ? 1.1513 1.1555 1.0526 -0.0137 0.2459  0.0799  119 GLU A N   
815  C CA  . GLU A 119 ? 0.9364 0.9441 0.8381 -0.0104 0.2144  0.0683  119 GLU A CA  
816  C C   . GLU A 119 ? 1.0158 1.0060 0.9298 -0.0083 0.2073  0.0845  119 GLU A C   
817  O O   . GLU A 119 ? 0.9443 0.9163 0.8851 -0.0135 0.2228  0.0912  119 GLU A O   
818  C CB  . GLU A 119 ? 0.9766 0.9889 0.9111 -0.0169 0.2028  0.0380  119 GLU A CB  
819  C CG  . GLU A 119 ? 1.1393 1.1537 1.0715 -0.0150 0.1734  0.0260  119 GLU A CG  
820  C CD  . GLU A 119 ? 1.1286 1.1466 1.0858 -0.0180 0.1640  -0.0003 119 GLU A CD  
821  O OE1 . GLU A 119 ? 1.2494 1.2780 1.1968 -0.0159 0.1677  -0.0151 119 GLU A OE1 
822  O OE2 . GLU A 119 ? 0.9599 0.9703 0.9455 -0.0213 0.1529  -0.0062 119 GLU A OE2 
823  N N   . VAL A 120 ? 1.0509 1.0478 0.9487 -0.0013 0.1853  0.0886  120 VAL A N   
824  C CA  . VAL A 120 ? 1.0143 0.9980 0.9258 0.0023  0.1794  0.1015  120 VAL A CA  
825  C C   . VAL A 120 ? 0.9804 0.9754 0.8925 0.0031  0.1528  0.0906  120 VAL A C   
826  O O   . VAL A 120 ? 1.0098 1.0246 0.8996 0.0059  0.1379  0.0861  120 VAL A O   
827  C CB  . VAL A 120 ? 1.0772 1.0550 0.9678 0.0150  0.1903  0.1345  120 VAL A CB  
828  C CG1 . VAL A 120 ? 1.0815 1.0861 0.9302 0.0252  0.1772  0.1434  120 VAL A CG1 
829  C CG2 . VAL A 120 ? 1.0930 1.0559 1.0041 0.0206  0.1866  0.1452  120 VAL A CG2 
830  N N   . PHE A 121 ? 0.9788 0.9619 0.9172 -0.0012 0.1482  0.0846  121 PHE A N   
831  C CA  . PHE A 121 ? 1.0060 0.9974 0.9467 -0.0005 0.1286  0.0803  121 PHE A CA  
832  C C   . PHE A 121 ? 1.1234 1.1066 1.0728 0.0077  0.1341  0.0979  121 PHE A C   
833  O O   . PHE A 121 ? 1.1102 1.0733 1.0803 0.0048  0.1465  0.0969  121 PHE A O   
834  C CB  . PHE A 121 ? 0.9158 0.9022 0.8752 -0.0109 0.1189  0.0594  121 PHE A CB  
835  C CG  . PHE A 121 ? 1.0114 1.0035 0.9682 -0.0159 0.1130  0.0424  121 PHE A CG  
836  C CD1 . PHE A 121 ? 1.0859 1.0733 1.0554 -0.0193 0.1253  0.0342  121 PHE A CD1 
837  C CD2 . PHE A 121 ? 0.9083 0.9104 0.8549 -0.0176 0.0964  0.0332  121 PHE A CD2 
838  C CE1 . PHE A 121 ? 0.9479 0.9414 0.9198 -0.0212 0.1210  0.0176  121 PHE A CE1 
839  C CE2 . PHE A 121 ? 0.8634 0.8662 0.8109 -0.0206 0.0926  0.0162  121 PHE A CE2 
840  C CZ  . PHE A 121 ? 0.9834 0.9824 0.9436 -0.0209 0.1048  0.0087  121 PHE A CZ  
841  N N   . ALA A 122 ? 1.0176 1.0181 0.9539 0.0184  0.1249  0.1121  122 ALA A N   
842  C CA  . ALA A 122 ? 0.9320 0.9269 0.8790 0.0307  0.1310  0.1311  122 ALA A CA  
843  C C   . ALA A 122 ? 1.0201 1.0302 0.9812 0.0310  0.1168  0.1246  122 ALA A C   
844  O O   . ALA A 122 ? 1.1150 1.1493 1.0690 0.0264  0.0992  0.1155  122 ALA A O   
845  C CB  . ALA A 122 ? 0.9848 0.9908 0.9099 0.0469  0.1328  0.1576  122 ALA A CB  
846  N N   . PHE A 123 ? 1.0213 1.0166 1.0043 0.0354  0.1270  0.1278  123 PHE A N   
847  C CA  . PHE A 123 ? 0.9567 0.9673 0.9554 0.0369  0.1190  0.1230  123 PHE A CA  
848  C C   . PHE A 123 ? 1.0134 1.0270 1.0264 0.0570  0.1260  0.1437  123 PHE A C   
849  O O   . PHE A 123 ? 1.1190 1.1041 1.1462 0.0633  0.1445  0.1495  123 PHE A O   
850  C CB  . PHE A 123 ? 0.9782 0.9717 0.9904 0.0243  0.1250  0.1033  123 PHE A CB  
851  C CG  . PHE A 123 ? 1.0343 1.0255 1.0359 0.0079  0.1162  0.0855  123 PHE A CG  
852  C CD1 . PHE A 123 ? 1.1899 1.1643 1.1879 0.0023  0.1230  0.0803  123 PHE A CD1 
853  C CD2 . PHE A 123 ? 1.1850 1.1907 1.1839 -0.0013 0.1025  0.0751  123 PHE A CD2 
854  C CE1 . PHE A 123 ? 1.2070 1.1817 1.2003 -0.0094 0.1142  0.0646  123 PHE A CE1 
855  C CE2 . PHE A 123 ? 1.1552 1.1553 1.1462 -0.0133 0.0944  0.0619  123 PHE A CE2 
856  C CZ  . PHE A 123 ? 1.0416 1.0274 1.0307 -0.0159 0.0993  0.0564  123 PHE A CZ  
857  N N   . ARG A 124 ? 0.9668 1.0155 0.9795 0.0672  0.1111  0.1539  124 ARG A N   
858  C CA  . ARG A 124 ? 0.9800 1.0376 1.0094 0.0903  0.1147  0.1761  124 ARG A CA  
859  C C   . ARG A 124 ? 1.0183 1.0980 1.0777 0.0927  0.1118  0.1675  124 ARG A C   
860  O O   . ARG A 124 ? 1.0615 1.1695 1.1226 0.0798  0.0978  0.1529  124 ARG A O   
861  C CB  . ARG A 124 ? 0.9795 1.0675 0.9887 0.1043  0.0993  0.1970  124 ARG A CB  
862  C CG  . ARG A 124 ? 1.0187 1.0833 0.9974 0.1065  0.1087  0.2116  124 ARG A CG  
863  C CD  . ARG A 124 ? 1.1533 1.2477 1.1071 0.1247  0.0954  0.2371  124 ARG A CD  
864  N NE  . ARG A 124 ? 1.1479 1.2486 1.1210 0.1518  0.0968  0.2651  124 ARG A NE  
865  C CZ  . ARG A 124 ? 1.3576 1.4187 1.3390 0.1672  0.1189  0.2892  124 ARG A CZ  
866  N NH1 . ARG A 124 ? 1.5784 1.5932 1.5517 0.1553  0.1418  0.2871  124 ARG A NH1 
867  N NH2 . ARG A 124 ? 1.2974 1.3653 1.2996 0.1947  0.1186  0.3151  124 ARG A NH2 
868  N N   . PHE A 125 ? 1.1422 1.2073 1.2274 0.1089  0.1276  0.1764  125 PHE A N   
869  C CA  . PHE A 125 ? 1.0165 1.0977 1.1330 0.1115  0.1321  0.1656  125 PHE A CA  
870  C C   . PHE A 125 ? 1.0242 1.1434 1.1673 0.1362  0.1245  0.1843  125 PHE A C   
871  O O   . PHE A 125 ? 1.1394 1.2589 1.2797 0.1576  0.1216  0.2103  125 PHE A O   
872  C CB  . PHE A 125 ? 0.9060 0.9448 1.0376 0.1116  0.1575  0.1549  125 PHE A CB  
873  C CG  . PHE A 125 ? 0.9987 1.0132 1.1125 0.0863  0.1623  0.1302  125 PHE A CG  
874  C CD1 . PHE A 125 ? 1.1198 1.1118 1.2100 0.0753  0.1609  0.1300  125 PHE A CD1 
875  C CD2 . PHE A 125 ? 0.9458 0.9628 1.0669 0.0746  0.1686  0.1078  125 PHE A CD2 
876  C CE1 . PHE A 125 ? 1.0671 1.0422 1.1457 0.0545  0.1628  0.1078  125 PHE A CE1 
877  C CE2 . PHE A 125 ? 1.0364 1.0348 1.1390 0.0537  0.1701  0.0873  125 PHE A CE2 
878  C CZ  . PHE A 125 ? 0.9590 0.9374 1.0425 0.0443  0.1658  0.0873  125 PHE A CZ  
879  N N   . ALA A 126 ? 0.9458 1.0988 1.1158 0.1336  0.1219  0.1721  126 ALA A N   
880  C CA  . ALA A 126 ? 0.8699 1.0635 1.0773 0.1576  0.1174  0.1857  126 ALA A CA  
881  C C   . ALA A 126 ? 0.9437 1.1452 1.1859 0.1558  0.1345  0.1677  126 ALA A C   
882  O O   . ALA A 126 ? 1.0118 1.2271 1.2509 0.1322  0.1337  0.1471  126 ALA A O   
883  C CB  . ALA A 126 ? 0.8068 1.0587 1.0131 0.1555  0.0886  0.1902  126 ALA A CB  
884  N N   . TYR A 127 ? 1.0209 1.2118 1.2959 0.1811  0.1516  0.1762  127 TYR A N   
885  C CA  . TYR A 127 ? 1.0225 1.2170 1.3300 0.1820  0.1730  0.1571  127 TYR A CA  
886  C C   . TYR A 127 ? 1.0776 1.3337 1.4334 0.1999  0.1670  0.1629  127 TYR A C   
887  O O   . TYR A 127 ? 0.9467 1.2238 1.3241 0.2281  0.1561  0.1873  127 TYR A O   
888  C CB  . TYR A 127 ? 0.9135 1.0537 1.2325 0.1978  0.2005  0.1559  127 TYR A CB  
889  C CG  . TYR A 127 ? 0.9291 1.0107 1.2104 0.1803  0.2090  0.1477  127 TYR A CG  
890  C CD1 . TYR A 127 ? 0.8848 0.9412 1.1431 0.1850  0.2010  0.1697  127 TYR A CD1 
891  C CD2 . TYR A 127 ? 0.9307 0.9857 1.2002 0.1593  0.2257  0.1178  127 TYR A CD2 
892  C CE1 . TYR A 127 ? 1.0184 1.0261 1.2494 0.1681  0.2103  0.1610  127 TYR A CE1 
893  C CE2 . TYR A 127 ? 1.0147 1.0229 1.2556 0.1432  0.2314  0.1084  127 TYR A CE2 
894  C CZ  . TYR A 127 ? 1.0402 1.0255 1.2654 0.1472  0.2243  0.1296  127 TYR A CZ  
895  O OH  . TYR A 127 ? 1.0822 1.0257 1.2856 0.1302  0.2313  0.1193  127 TYR A OH  
896  N N   . GLY A 128 ? 1.1074 1.3937 1.4806 0.1838  0.1746  0.1415  128 GLY A N   
897  C CA  . GLY A 128 ? 1.0325 1.3792 1.4602 0.1982  0.1754  0.1416  128 GLY A CA  
898  C C   . GLY A 128 ? 1.4069 1.8051 1.8612 0.2214  0.1486  0.1660  128 GLY A C   
899  O O   . GLY A 128 ? 1.5737 1.9886 2.0706 0.2554  0.1527  0.1807  128 GLY A O   
900  N N   . ASP A 129 ? 1.5057 1.9290 1.9344 0.2037  0.1206  0.1693  129 ASP A N   
901  C CA  . ASP A 129 ? 1.7042 2.1811 2.1467 0.2206  0.0895  0.1892  129 ASP A CA  
902  C C   . ASP A 129 ? 1.7312 2.1979 2.1830 0.2622  0.0858  0.2208  129 ASP A C   
903  O O   . ASP A 129 ? 1.4404 1.9627 1.9354 0.2890  0.0716  0.2358  129 ASP A O   
904  C CB  . ASP A 129 ? 1.6940 2.2512 2.1929 0.2182  0.0804  0.1792  129 ASP A CB  
905  C CG  . ASP A 129 ? 1.6872 2.2598 2.2444 0.2396  0.1063  0.1753  129 ASP A CG  
906  O OD1 . ASP A 129 ? 1.6011 2.1761 2.1875 0.2784  0.1080  0.1957  129 ASP A OD1 
907  O OD2 . ASP A 129 ? 1.7929 2.3743 2.3667 0.2184  0.1267  0.1521  129 ASP A OD2 
908  N N   . GLU A 130 ? 1.8107 2.2084 2.2243 0.2678  0.0982  0.2325  130 GLU A N   
909  C CA  . GLU A 130 ? 1.6483 2.0322 2.0597 0.3038  0.0919  0.2682  130 GLU A CA  
910  C C   . GLU A 130 ? 1.6309 2.0762 2.0309 0.3103  0.0539  0.2853  130 GLU A C   
911  O O   . GLU A 130 ? 1.6470 2.1085 2.0121 0.2811  0.0363  0.2710  130 GLU A O   
912  C CB  . GLU A 130 ? 1.5977 1.9028 1.9616 0.3002  0.1070  0.2784  130 GLU A CB  
913  C CG  . GLU A 130 ? 1.5874 1.8294 1.9521 0.2869  0.1411  0.2566  130 GLU A CG  
914  C CD  . GLU A 130 ? 1.5357 1.7202 1.8471 0.2646  0.1470  0.2538  130 GLU A CD  
915  O OE1 . GLU A 130 ? 1.2996 1.4772 1.5873 0.2316  0.1478  0.2268  130 GLU A OE1 
916  O OE2 . GLU A 130 ? 1.5408 1.6883 1.8355 0.2806  0.1512  0.2802  130 GLU A OE2 
917  N N   . GLY A 131 ? 1.6992 2.1795 2.1299 0.3493  0.0411  0.3145  131 GLY A N   
918  C CA  . GLY A 131 ? 1.8590 2.4023 2.2783 0.3606  0.0029  0.3329  131 GLY A CA  
919  C C   . GLY A 131 ? 1.8965 2.4115 2.2419 0.3423  -0.0091 0.3386  131 GLY A C   
920  O O   . GLY A 131 ? 1.8709 2.4103 2.1921 0.3099  -0.0247 0.3143  131 GLY A O   
921  N N   . GLU A 132 ? 1.8904 2.3531 2.2009 0.3622  0.0000  0.3701  132 GLU A N   
922  C CA  . GLU A 132 ? 1.8206 2.2623 2.0618 0.3455  -0.0094 0.3755  132 GLU A CA  
923  C C   . GLU A 132 ? 1.8235 2.1786 2.0311 0.3487  0.0203  0.3938  132 GLU A C   
924  O O   . GLU A 132 ? 1.8927 2.2053 2.1284 0.3721  0.0438  0.4119  132 GLU A O   
925  C CB  . GLU A 132 ? 1.8414 2.3434 2.0589 0.3669  -0.0456 0.4022  132 GLU A CB  
926  C CG  . GLU A 132 ? 1.9097 2.4353 2.1620 0.4164  -0.0531 0.4433  132 GLU A CG  
927  C CD  . GLU A 132 ? 2.2546 2.8652 2.5754 0.4309  -0.0751 0.4339  132 GLU A CD  
928  O OE1 . GLU A 132 ? 2.1992 2.8455 2.5473 0.4008  -0.0790 0.3942  132 GLU A OE1 
929  O OE2 . GLU A 132 ? 2.2172 2.8597 2.5651 0.4740  -0.0884 0.4691  132 GLU A OE2 
930  N N   . ILE A 133 ? 1.7219 2.0527 1.8723 0.3248  0.0196  0.3879  133 ILE A N   
931  C CA  . ILE A 133 ? 1.6780 1.9313 1.7970 0.3189  0.0483  0.3985  133 ILE A CA  
932  C C   . ILE A 133 ? 1.8133 2.0628 1.8763 0.3313  0.0399  0.4329  133 ILE A C   
933  O O   . ILE A 133 ? 1.8125 2.1056 1.8374 0.3203  0.0151  0.4261  133 ILE A O   
934  C CB  . ILE A 133 ? 1.5002 1.7233 1.6035 0.2772  0.0611  0.3583  133 ILE A CB  
935  C CG1 . ILE A 133 ? 1.2728 1.5047 1.4234 0.2643  0.0683  0.3259  133 ILE A CG1 
936  C CG2 . ILE A 133 ? 1.4025 1.5501 1.4828 0.2695  0.0914  0.3655  133 ILE A CG2 
937  C CD1 . ILE A 133 ? 1.2980 1.5181 1.4332 0.2254  0.0716  0.2881  133 ILE A CD1 
938  N N   . PHE A 134 ? 1.9085 2.1042 1.9655 0.3533  0.0623  0.4692  134 PHE A N   
939  C CA  . PHE A 134 ? 2.0227 2.2099 2.0237 0.3662  0.0594  0.5073  134 PHE A CA  
940  C C   . PHE A 134 ? 2.0419 2.2092 1.9921 0.3312  0.0671  0.4861  134 PHE A C   
941  O O   . PHE A 134 ? 2.0768 2.1854 2.0308 0.3111  0.0965  0.4725  134 PHE A O   
942  C CB  . PHE A 134 ? 2.0022 2.1258 2.0128 0.3947  0.0878  0.5516  134 PHE A CB  
943  C CG  . PHE A 134 ? 2.0886 2.1943 2.0385 0.4061  0.0916  0.5947  134 PHE A CG  
944  C CD1 . PHE A 134 ? 2.1700 2.3322 2.0851 0.4327  0.0608  0.6281  134 PHE A CD1 
945  C CD2 . PHE A 134 ? 2.1419 2.1770 2.0697 0.3899  0.1266  0.6021  134 PHE A CD2 
946  C CE1 . PHE A 134 ? 2.2675 2.4133 2.1229 0.4377  0.0661  0.6605  134 PHE A CE1 
947  C CE2 . PHE A 134 ? 2.2611 2.2795 2.1324 0.3992  0.1343  0.6434  134 PHE A CE2 
948  C CZ  . PHE A 134 ? 2.3139 2.3875 2.1487 0.4191  0.1039  0.6657  134 PHE A CZ  
949  N N   . VAL A 135 ? 1.9703 2.1900 1.8762 0.3238  0.0400  0.4804  135 VAL A N   
950  C CA  . VAL A 135 ? 1.8745 2.0788 1.7294 0.2961  0.0474  0.4642  135 VAL A CA  
951  C C   . VAL A 135 ? 1.9529 2.1040 1.7726 0.3076  0.0750  0.5047  135 VAL A C   
952  O O   . VAL A 135 ? 2.0360 2.2078 1.8105 0.3280  0.0648  0.5403  135 VAL A O   
953  C CB  . VAL A 135 ? 1.7366 2.0096 1.5491 0.2890  0.0128  0.4498  135 VAL A CB  
954  C CG1 . VAL A 135 ? 1.7078 1.9648 1.4774 0.2579  0.0226  0.4231  135 VAL A CG1 
955  C CG2 . VAL A 135 ? 1.8621 2.1926 1.7158 0.2818  -0.0156 0.4175  135 VAL A CG2 
956  N N   . SER A 136 ? 2.0127 2.0966 1.8535 0.2945  0.1102  0.5000  136 SER A N   
957  C CA  . SER A 136 ? 2.1048 2.1346 1.9169 0.2984  0.1411  0.5342  136 SER A CA  
958  C C   . SER A 136 ? 2.0194 2.0669 1.7696 0.2792  0.1394  0.5262  136 SER A C   
959  O O   . SER A 136 ? 1.8045 1.8761 1.5511 0.2525  0.1283  0.4822  136 SER A O   
960  C CB  . SER A 136 ? 2.1184 2.0780 1.9736 0.2827  0.1777  0.5212  136 SER A CB  
961  O OG  . SER A 136 ? 2.2184 2.1253 2.0514 0.2811  0.2101  0.5506  136 SER A OG  
962  N N   . LEU A 137 ? 2.2141 2.2493 1.9154 0.2934  0.1514  0.5689  137 LEU A N   
963  C CA  . LEU A 137 ? 2.1994 2.2663 1.8355 0.2805  0.1451  0.5622  137 LEU A CA  
964  C C   . LEU A 137 ? 2.1665 2.1873 1.7726 0.2642  0.1838  0.5730  137 LEU A C   
965  O O   . LEU A 137 ? 2.2028 2.2483 1.7628 0.2485  0.1825  0.5561  137 LEU A O   
966  C CB  . LEU A 137 ? 2.2060 2.3290 1.7911 0.3098  0.1146  0.5961  137 LEU A CB  
967  C CG  . LEU A 137 ? 2.1400 2.2503 1.7259 0.3390  0.1134  0.6392  137 LEU A CG  
968  C CD1 . LEU A 137 ? 2.2257 2.3297 1.7507 0.3391  0.1230  0.6619  137 LEU A CD1 
969  C CD2 . LEU A 137 ? 2.0927 2.2684 1.6911 0.3635  0.0702  0.6422  137 LEU A CD2 
970  N N   . ASN A 138 ? 2.0763 2.0318 1.7138 0.2638  0.2191  0.5934  138 ASN A N   
971  C CA  . ASN A 138 ? 1.9609 1.8788 1.5851 0.2392  0.2543  0.5882  138 ASN A CA  
972  C C   . ASN A 138 ? 1.8887 1.7870 1.5498 0.2067  0.2711  0.5432  138 ASN A C   
973  O O   . ASN A 138 ? 1.8724 1.7552 1.5209 0.1851  0.2968  0.5336  138 ASN A O   
974  C CB  . ASN A 138 ? 2.1002 1.9614 1.7438 0.2465  0.2822  0.6203  138 ASN A CB  
975  C CG  . ASN A 138 ? 2.3956 2.2722 1.9858 0.2639  0.2758  0.6562  138 ASN A CG  
976  O OD1 . ASN A 138 ? 2.5231 2.4554 2.0693 0.2779  0.2437  0.6605  138 ASN A OD1 
977  N ND2 . ASN A 138 ? 2.4378 2.2654 2.0312 0.2608  0.3070  0.6806  138 ASN A ND2 
978  N N   . ASN A 139 ? 1.7751 1.6782 1.4872 0.2010  0.2541  0.5089  139 ASN A N   
979  C CA  . ASN A 139 ? 1.6859 1.5824 1.4311 0.1695  0.2596  0.4581  139 ASN A CA  
980  C C   . ASN A 139 ? 1.5367 1.4722 1.3031 0.1632  0.2260  0.4168  139 ASN A C   
981  O O   . ASN A 139 ? 1.5376 1.5111 1.2959 0.1809  0.1973  0.4233  139 ASN A O   
982  C CB  . ASN A 139 ? 1.6828 1.5186 1.4804 0.1580  0.2920  0.4558  139 ASN A CB  
983  C CG  . ASN A 139 ? 1.6454 1.4603 1.4880 0.1746  0.2873  0.4622  139 ASN A CG  
984  O OD1 . ASN A 139 ? 1.6767 1.5269 1.5269 0.1866  0.2578  0.4517  139 ASN A OD1 
985  N ND2 . ASN A 139 ? 1.6549 1.4115 1.5314 0.1739  0.3187  0.4768  139 ASN A ND2 
986  N N   . GLY A 140 ? 1.3335 1.2608 1.1285 0.1375  0.2303  0.3754  140 GLY A N   
987  C CA  . GLY A 140 ? 1.2031 1.1583 1.0202 0.1279  0.2042  0.3369  140 GLY A CA  
988  C C   . GLY A 140 ? 1.2534 1.2566 1.0358 0.1213  0.1794  0.3157  140 GLY A C   
989  O O   . GLY A 140 ? 1.4150 1.4334 1.1526 0.1235  0.1822  0.3269  140 GLY A O   
990  N N   . ILE A 141 ? 1.2168 1.2428 1.0198 0.1124  0.1567  0.2842  141 ILE A N   
991  C CA  . ILE A 141 ? 1.2211 1.2889 0.9999 0.1042  0.1325  0.2594  141 ILE A CA  
992  C C   . ILE A 141 ? 1.3632 1.4731 1.1389 0.1192  0.1034  0.2668  141 ILE A C   
993  O O   . ILE A 141 ? 1.3965 1.5461 1.1509 0.1146  0.0809  0.2494  141 ILE A O   
994  C CB  . ILE A 141 ? 1.1077 1.1706 0.9133 0.0815  0.1281  0.2185  141 ILE A CB  
995  C CG1 . ILE A 141 ? 1.0158 1.1074 0.7940 0.0704  0.1135  0.1923  141 ILE A CG1 
996  C CG2 . ILE A 141 ? 0.9865 1.0540 0.8298 0.0813  0.1141  0.2084  141 ILE A CG2 
997  C CD1 . ILE A 141 ? 1.0342 1.1193 0.8387 0.0513  0.1076  0.1563  141 ILE A CD1 
998  N N   . ASP A 142 ? 1.3914 1.4932 1.1925 0.1371  0.1048  0.2910  142 ASP A N   
999  C CA  . ASP A 142 ? 1.5530 1.6969 1.3652 0.1529  0.0786  0.2981  142 ASP A CA  
1000 C C   . ASP A 142 ? 1.5009 1.6900 1.2674 0.1678  0.0583  0.3160  142 ASP A C   
1001 O O   . ASP A 142 ? 1.5378 1.7157 1.2689 0.1822  0.0700  0.3484  142 ASP A O   
1002 C CB  . ASP A 142 ? 1.7828 1.9044 1.6323 0.1732  0.0895  0.3237  142 ASP A CB  
1003 C CG  . ASP A 142 ? 1.8421 2.0091 1.7184 0.1880  0.0645  0.3252  142 ASP A CG  
1004 O OD1 . ASP A 142 ? 1.7326 1.9403 1.6120 0.1742  0.0420  0.2973  142 ASP A OD1 
1005 O OD2 . ASP A 142 ? 1.8984 2.0600 1.7965 0.2133  0.0687  0.3539  142 ASP A OD2 
1006 N N   . THR A 143 ? 1.4271 1.6681 1.1936 0.1631  0.0281  0.2945  143 THR A N   
1007 C CA  . THR A 143 ? 1.4058 1.7002 1.1318 0.1762  0.0027  0.3057  143 THR A CA  
1008 C C   . THR A 143 ? 1.5851 1.9296 1.3443 0.1908  -0.0255 0.3097  143 THR A C   
1009 O O   . THR A 143 ? 1.6108 1.9499 1.4227 0.1856  -0.0244 0.2967  143 THR A O   
1010 C CB  . THR A 143 ? 1.3810 1.7004 1.0722 0.1539  -0.0096 0.2689  143 THR A CB  
1011 O OG1 . THR A 143 ? 1.5568 1.9035 1.2835 0.1363  -0.0301 0.2321  143 THR A OG1 
1012 C CG2 . THR A 143 ? 1.5246 1.7962 1.2011 0.1358  0.0192  0.2550  143 THR A CG2 
1013 N N   . ASN A 144 ? 1.6641 2.0610 1.3926 0.2091  -0.0508 0.3271  144 ASN A N   
1014 C CA  . ASN A 144 ? 1.6433 2.0990 1.4055 0.2244  -0.0809 0.3310  144 ASN A CA  
1015 C C   . ASN A 144 ? 1.6344 2.1224 1.4359 0.1977  -0.0981 0.2843  144 ASN A C   
1016 O O   . ASN A 144 ? 1.5923 2.0979 1.4496 0.2014  -0.1040 0.2811  144 ASN A O   
1017 C CB  . ASN A 144 ? 1.6727 2.1866 1.3874 0.2459  -0.1093 0.3533  144 ASN A CB  
1018 C CG  . ASN A 144 ? 1.7897 2.2976 1.5022 0.2860  -0.1058 0.4102  144 ASN A CG  
1019 O OD1 . ASN A 144 ? 1.8311 2.2754 1.5551 0.2952  -0.0736 0.4359  144 ASN A OD1 
1020 N ND2 . ASN A 144 ? 1.8391 2.4138 1.5390 0.3104  -0.1395 0.4297  144 ASN A ND2 
1021 N N   . GLU A 145 ? 1.6495 2.1435 1.4230 0.1709  -0.1039 0.2484  145 GLU A N   
1022 C CA  . GLU A 145 ? 1.4976 2.0173 1.3052 0.1434  -0.1189 0.2046  145 GLU A CA  
1023 C C   . GLU A 145 ? 1.4070 1.8778 1.2610 0.1271  -0.0955 0.1910  145 GLU A C   
1024 O O   . GLU A 145 ? 1.3056 1.7972 1.2050 0.1134  -0.1041 0.1701  145 GLU A O   
1025 C CB  . GLU A 145 ? 1.5733 2.1031 1.3392 0.1199  -0.1277 0.1691  145 GLU A CB  
1026 C CG  . GLU A 145 ? 1.9439 2.4934 1.6406 0.1341  -0.1349 0.1846  145 GLU A CG  
1027 C CD  . GLU A 145 ? 2.1883 2.6772 1.8463 0.1369  -0.1014 0.2018  145 GLU A CD  
1028 O OE1 . GLU A 145 ? 2.2573 2.7024 1.9241 0.1153  -0.0813 0.1768  145 GLU A OE1 
1029 O OE2 . GLU A 145 ? 2.2533 2.7397 1.8741 0.1611  -0.0949 0.2415  145 GLU A OE2 
1030 N N   . SER A 146 ? 1.4037 1.8123 1.2459 0.1278  -0.0658 0.2028  146 SER A N   
1031 C CA  . SER A 146 ? 1.2979 1.6606 1.1770 0.1135  -0.0443 0.1905  146 SER A CA  
1032 C C   . SER A 146 ? 1.2941 1.6661 1.2240 0.1272  -0.0426 0.2043  146 SER A C   
1033 O O   . SER A 146 ? 1.3478 1.7255 1.3160 0.1120  -0.0431 0.1838  146 SER A O   
1034 C CB  . SER A 146 ? 1.2865 1.5878 1.1449 0.1137  -0.0148 0.2018  146 SER A CB  
1035 O OG  . SER A 146 ? 1.5127 1.7927 1.3806 0.1377  0.0002  0.2370  146 SER A OG  
1036 N N   . SER A 147 ? 1.2306 1.6036 1.1608 0.1568  -0.0390 0.2401  147 SER A N   
1037 C CA  . SER A 147 ? 1.2426 1.6203 1.2227 0.1746  -0.0335 0.2548  147 SER A CA  
1038 C C   . SER A 147 ? 1.2462 1.6940 1.2627 0.1769  -0.0605 0.2448  147 SER A C   
1039 O O   . SER A 147 ? 1.1628 1.6208 1.2295 0.1829  -0.0552 0.2443  147 SER A O   
1040 C CB  . SER A 147 ? 1.2502 1.6070 1.2223 0.2080  -0.0223 0.2976  147 SER A CB  
1041 O OG  . SER A 147 ? 1.3034 1.7001 1.2388 0.2261  -0.0441 0.3198  147 SER A OG  
1042 N N   . GLN A 148 ? 1.3053 1.8038 1.2980 0.1712  -0.0886 0.2347  148 GLN A N   
1043 C CA  . GLN A 148 ? 1.1897 1.7589 1.2202 0.1660  -0.1156 0.2176  148 GLN A CA  
1044 C C   . GLN A 148 ? 1.2266 1.7858 1.2919 0.1331  -0.1069 0.1821  148 GLN A C   
1045 O O   . GLN A 148 ? 1.4306 2.0148 1.5494 0.1327  -0.1057 0.1773  148 GLN A O   
1046 C CB  . GLN A 148 ? 1.2045 1.8281 1.1981 0.1624  -0.1477 0.2078  148 GLN A CB  
1047 C CG  . GLN A 148 ? 1.4144 2.0882 1.3963 0.1982  -0.1703 0.2420  148 GLN A CG  
1048 C CD  . GLN A 148 ? 1.5619 2.2839 1.6105 0.2183  -0.1808 0.2537  148 GLN A CD  
1049 O OE1 . GLN A 148 ? 1.4829 2.1964 1.5439 0.2528  -0.1736 0.2914  148 GLN A OE1 
1050 N NE2 . GLN A 148 ? 1.6363 2.4086 1.7316 0.1967  -0.1961 0.2212  148 GLN A NE2 
1051 N N   . GLU A 149 ? 1.0293 1.5513 1.0638 0.1066  -0.0993 0.1590  149 GLU A N   
1052 C CA  . GLU A 149 ? 1.0363 1.5391 1.0949 0.0755  -0.0897 0.1292  149 GLU A CA  
1053 C C   . GLU A 149 ? 1.1272 1.5950 1.2194 0.0788  -0.0638 0.1373  149 GLU A C   
1054 O O   . GLU A 149 ? 1.2601 1.7396 1.3905 0.0629  -0.0598 0.1219  149 GLU A O   
1055 C CB  . GLU A 149 ? 0.9922 1.4504 1.0094 0.0544  -0.0824 0.1102  149 GLU A CB  
1056 C CG  . GLU A 149 ? 1.1331 1.6198 1.1101 0.0509  -0.1037 0.0985  149 GLU A CG  
1057 C CD  . GLU A 149 ? 1.3802 1.8189 1.3172 0.0362  -0.0915 0.0830  149 GLU A CD  
1058 O OE1 . GLU A 149 ? 1.4615 1.8468 1.4029 0.0305  -0.0685 0.0844  149 GLU A OE1 
1059 O OE2 . GLU A 149 ? 1.3786 1.8359 1.2804 0.0309  -0.1051 0.0681  149 GLU A OE2 
1060 N N   . LEU A 150 ? 1.0169 1.4417 1.0939 0.0984  -0.0448 0.1604  150 LEU A N   
1061 C CA  . LEU A 150 ? 1.0165 1.4069 1.1216 0.1032  -0.0196 0.1660  150 LEU A CA  
1062 C C   . LEU A 150 ? 1.0427 1.4782 1.1993 0.1195  -0.0230 0.1738  150 LEU A C   
1063 O O   . LEU A 150 ? 1.1378 1.5711 1.3284 0.1104  -0.0089 0.1625  150 LEU A O   
1064 C CB  . LEU A 150 ? 0.9900 1.3275 1.0717 0.1208  0.0004  0.1879  150 LEU A CB  
1065 C CG  . LEU A 150 ? 0.9221 1.2206 1.0301 0.1264  0.0272  0.1905  150 LEU A CG  
1066 C CD1 . LEU A 150 ? 0.9512 1.2349 1.0693 0.0988  0.0365  0.1632  150 LEU A CD1 
1067 C CD2 . LEU A 150 ? 0.7643 1.0070 0.8484 0.1366  0.0469  0.2066  150 LEU A CD2 
1068 N N   . LEU A 151 ? 1.0236 1.5027 1.1854 0.1447  -0.0414 0.1940  151 LEU A N   
1069 C CA  . LEU A 151 ? 0.9841 1.5147 1.1998 0.1645  -0.0478 0.2029  151 LEU A CA  
1070 C C   . LEU A 151 ? 0.9863 1.5711 1.2410 0.1402  -0.0603 0.1755  151 LEU A C   
1071 O O   . LEU A 151 ? 1.0138 1.6175 1.3186 0.1410  -0.0486 0.1702  151 LEU A O   
1072 C CB  . LEU A 151 ? 1.0556 1.6263 1.2644 0.1977  -0.0701 0.2321  151 LEU A CB  
1073 C CG  . LEU A 151 ? 1.1471 1.7835 1.4151 0.2230  -0.0831 0.2433  151 LEU A CG  
1074 C CD1 . LEU A 151 ? 1.1864 1.7995 1.5037 0.2307  -0.0535 0.2423  151 LEU A CD1 
1075 C CD2 . LEU A 151 ? 1.0353 1.6934 1.2886 0.2627  -0.1005 0.2813  151 LEU A CD2 
1076 N N   . GLN A 152 ? 1.0108 1.6189 1.2436 0.1176  -0.0817 0.1567  152 GLN A N   
1077 C CA  . GLN A 152 ? 1.1211 1.7822 1.3923 0.0922  -0.0954 0.1302  152 GLN A CA  
1078 C C   . GLN A 152 ? 1.1052 1.7289 1.3882 0.0607  -0.0722 0.1090  152 GLN A C   
1079 O O   . GLN A 152 ? 1.1732 1.8335 1.5031 0.0443  -0.0708 0.0943  152 GLN A O   
1080 C CB  . GLN A 152 ? 1.2781 1.9726 1.5210 0.0774  -0.1253 0.1139  152 GLN A CB  
1081 C CG  . GLN A 152 ? 1.4294 2.1699 1.6543 0.1075  -0.1520 0.1347  152 GLN A CG  
1082 C CD  . GLN A 152 ? 1.5489 2.3129 1.7315 0.0920  -0.1783 0.1158  152 GLN A CD  
1083 O OE1 . GLN A 152 ? 1.6387 2.3820 1.8104 0.0587  -0.1757 0.0855  152 GLN A OE1 
1084 N NE2 . GLN A 152 ? 1.5320 2.3388 1.6892 0.1170  -0.2034 0.1336  152 GLN A NE2 
1085 N N   . ALA A 153 ? 1.0660 1.6194 1.3071 0.0524  -0.0541 0.1085  153 ALA A N   
1086 C CA  . ALA A 153 ? 1.0591 1.5729 1.3033 0.0259  -0.0330 0.0929  153 ALA A CA  
1087 C C   . ALA A 153 ? 1.0906 1.6142 1.3788 0.0320  -0.0120 0.0971  153 ALA A C   
1088 O O   . ALA A 153 ? 1.1283 1.6473 1.4264 0.0597  -0.0017 0.1145  153 ALA A O   
1089 C CB  . ALA A 153 ? 0.8979 1.3405 1.0935 0.0234  -0.0185 0.0955  153 ALA A CB  
1090 N N   . LYS A 154 ? 0.9640 1.4998 1.2790 0.0060  -0.0038 0.0809  154 LYS A N   
1091 C CA  . LYS A 154 ? 0.9013 1.4536 1.2586 0.0090  0.0181  0.0821  154 LYS A CA  
1092 C C   . LYS A 154 ? 0.8200 1.3290 1.1639 -0.0162 0.0423  0.0726  154 LYS A C   
1093 O O   . LYS A 154 ? 0.7149 1.2053 1.0409 -0.0433 0.0378  0.0615  154 LYS A O   
1094 C CB  . LYS A 154 ? 0.8242 1.4553 1.2416 0.0049  0.0061  0.0750  154 LYS A CB  
1095 C CG  . LYS A 154 ? 0.9216 1.6058 1.3608 0.0365  -0.0169 0.0882  154 LYS A CG  
1096 C CD  . LYS A 154 ? 1.1032 1.7731 1.5529 0.0726  0.0005  0.1084  154 LYS A CD  
1097 C CE  . LYS A 154 ? 1.1107 1.8288 1.5798 0.1080  -0.0228 0.1274  154 LYS A CE  
1098 N NZ  . LYS A 154 ? 1.1893 1.8851 1.6711 0.1447  -0.0040 0.1483  154 LYS A NZ  
1099 N N   . PHE A 155 ? 0.8848 1.3772 1.2363 -0.0059 0.0680  0.0771  155 PHE A N   
1100 C CA  . PHE A 155 ? 0.8576 1.3209 1.1985 -0.0281 0.0916  0.0696  155 PHE A CA  
1101 C C   . PHE A 155 ? 0.9436 1.4554 1.3289 -0.0509 0.0957  0.0606  155 PHE A C   
1102 O O   . PHE A 155 ? 1.0632 1.6348 1.5002 -0.0409 0.0925  0.0602  155 PHE A O   
1103 C CB  . PHE A 155 ? 0.9223 1.3617 1.2595 -0.0111 0.1182  0.0729  155 PHE A CB  
1104 C CG  . PHE A 155 ? 0.9616 1.3780 1.2836 -0.0322 0.1426  0.0657  155 PHE A CG  
1105 C CD1 . PHE A 155 ? 0.9482 1.3137 1.2208 -0.0497 0.1421  0.0642  155 PHE A CD1 
1106 C CD2 . PHE A 155 ? 0.6888 1.1369 1.0452 -0.0333 0.1664  0.0613  155 PHE A CD2 
1107 C CE1 . PHE A 155 ? 0.7316 1.0774 0.9850 -0.0672 0.1627  0.0611  155 PHE A CE1 
1108 C CE2 . PHE A 155 ? 0.8262 1.2543 1.1616 -0.0526 0.1900  0.0565  155 PHE A CE2 
1109 C CZ  . PHE A 155 ? 0.8361 1.2126 1.1176 -0.0693 0.1871  0.0578  155 PHE A CZ  
1110 N N   . VAL A 156 ? 0.9946 1.4812 1.3627 -0.0813 0.1032  0.0545  156 VAL A N   
1111 C CA  . VAL A 156 ? 0.9209 1.4462 1.3303 -0.1080 0.1106  0.0468  156 VAL A CA  
1112 C C   . VAL A 156 ? 0.9510 1.4540 1.3506 -0.1213 0.1439  0.0494  156 VAL A C   
1113 O O   . VAL A 156 ? 1.0164 1.5589 1.4551 -0.1198 0.1644  0.0481  156 VAL A O   
1114 C CB  . VAL A 156 ? 0.8102 1.3264 1.2127 -0.1358 0.0918  0.0379  156 VAL A CB  
1115 C CG1 . VAL A 156 ? 0.6342 1.1749 1.0754 -0.1689 0.1061  0.0312  156 VAL A CG1 
1116 C CG2 . VAL A 156 ? 0.7331 1.2860 1.1489 -0.1248 0.0592  0.0316  156 VAL A CG2 
1117 N N   . ASP A 157 ? 0.8946 1.3368 1.2412 -0.1331 0.1491  0.0534  157 ASP A N   
1118 C CA  . ASP A 157 ? 0.9670 1.3817 1.2879 -0.1418 0.1779  0.0583  157 ASP A CA  
1119 C C   . ASP A 157 ? 1.0211 1.3697 1.2781 -0.1399 0.1731  0.0635  157 ASP A C   
1120 O O   . ASP A 157 ? 1.1127 1.4384 1.3515 -0.1354 0.1500  0.0626  157 ASP A O   
1121 C CB  . ASP A 157 ? 0.9284 1.3586 1.2717 -0.1742 0.1944  0.0593  157 ASP A CB  
1122 C CG  . ASP A 157 ? 1.2306 1.6339 1.5645 -0.1986 0.1776  0.0592  157 ASP A CG  
1123 O OD1 . ASP A 157 ? 1.3716 1.7173 1.6553 -0.2039 0.1767  0.0668  157 ASP A OD1 
1124 O OD2 . ASP A 157 ? 1.1873 1.6284 1.5665 -0.2124 0.1651  0.0501  157 ASP A OD2 
1125 N N   . THR A 158 ? 0.8613 1.1836 1.0848 -0.1430 0.1947  0.0679  158 THR A N   
1126 C CA  . THR A 158 ? 0.9245 1.1915 1.0904 -0.1394 0.1894  0.0719  158 THR A CA  
1127 C C   . THR A 158 ? 0.9331 1.1666 1.0794 -0.1579 0.1741  0.0781  158 THR A C   
1128 O O   . THR A 158 ? 0.8434 1.0448 0.9644 -0.1500 0.1554  0.0774  158 THR A O   
1129 C CB  . THR A 158 ? 1.0649 1.3172 1.1967 -0.1410 0.2147  0.0742  158 THR A CB  
1130 O OG1 . THR A 158 ? 0.8797 1.1540 1.0263 -0.1207 0.2288  0.0643  158 THR A OG1 
1131 C CG2 . THR A 158 ? 0.9293 1.1304 1.0038 -0.1396 0.2052  0.0784  158 THR A CG2 
1132 N N   . ASP A 159 ? 0.8983 1.1384 1.0601 -0.1825 0.1838  0.0837  159 ASP A N   
1133 C CA  . ASP A 159 ? 0.8423 1.0457 0.9903 -0.2007 0.1727  0.0899  159 ASP A CA  
1134 C C   . ASP A 159 ? 0.9244 1.1346 1.0963 -0.2003 0.1467  0.0781  159 ASP A C   
1135 O O   . ASP A 159 ? 0.9544 1.1265 1.1074 -0.2055 0.1328  0.0785  159 ASP A O   
1136 C CB  . ASP A 159 ? 0.8040 1.0107 0.9671 -0.2290 0.1932  0.0997  159 ASP A CB  
1137 C CG  . ASP A 159 ? 1.0000 1.1853 1.1205 -0.2317 0.2171  0.1156  159 ASP A CG  
1138 O OD1 . ASP A 159 ? 1.0486 1.2257 1.1341 -0.2117 0.2178  0.1140  159 ASP A OD1 
1139 O OD2 . ASP A 159 ? 0.9412 1.1179 1.0620 -0.2547 0.2354  0.1293  159 ASP A OD2 
1140 N N   . ASN A 160 ? 0.7830 1.0432 0.9957 -0.1928 0.1398  0.0674  160 ASN A N   
1141 C CA  . ASN A 160 ? 0.7760 1.0472 1.0019 -0.1879 0.1133  0.0556  160 ASN A CA  
1142 C C   . ASN A 160 ? 0.9229 1.1656 1.1109 -0.1635 0.1001  0.0561  160 ASN A C   
1143 O O   . ASN A 160 ? 1.0917 1.3156 1.2668 -0.1629 0.0819  0.0498  160 ASN A O   
1144 C CB  . ASN A 160 ? 0.9393 1.2766 1.2162 -0.1831 0.1070  0.0466  160 ASN A CB  
1145 C CG  . ASN A 160 ? 0.9939 1.3471 1.2763 -0.1758 0.0781  0.0351  160 ASN A CG  
1146 O OD1 . ASN A 160 ? 1.1748 1.5202 1.4621 -0.1949 0.0657  0.0242  160 ASN A OD1 
1147 N ND2 . ASN A 160 ? 0.8231 1.1963 1.1026 -0.1480 0.0686  0.0374  160 ASN A ND2 
1148 N N   . THR A 161 ? 0.8788 1.1189 1.0514 -0.1445 0.1114  0.0619  161 THR A N   
1149 C CA  . THR A 161 ? 0.8803 1.0932 1.0214 -0.1235 0.1032  0.0624  161 THR A CA  
1150 C C   . THR A 161 ? 0.8760 1.0373 0.9773 -0.1303 0.1000  0.0656  161 THR A C   
1151 O O   . THR A 161 ? 0.8751 1.0142 0.9573 -0.1207 0.0869  0.0627  161 THR A O   
1152 C CB  . THR A 161 ? 0.9363 1.1562 1.0752 -0.1044 0.1189  0.0648  161 THR A CB  
1153 O OG1 . THR A 161 ? 0.9874 1.2533 1.1657 -0.0913 0.1180  0.0633  161 THR A OG1 
1154 C CG2 . THR A 161 ? 0.8526 1.0376 0.9591 -0.0880 0.1138  0.0646  161 THR A CG2 
1155 N N   . LYS A 162 ? 0.9353 1.0796 1.0256 -0.1463 0.1126  0.0729  162 LYS A N   
1156 C CA  . LYS A 162 ? 0.8679 0.9657 0.9244 -0.1522 0.1081  0.0793  162 LYS A CA  
1157 C C   . LYS A 162 ? 0.9079 0.9895 0.9713 -0.1587 0.0901  0.0729  162 LYS A C   
1158 O O   . LYS A 162 ? 1.0484 1.0968 1.0889 -0.1521 0.0800  0.0727  162 LYS A O   
1159 C CB  . LYS A 162 ? 0.7058 0.7907 0.7514 -0.1696 0.1249  0.0926  162 LYS A CB  
1160 C CG  . LYS A 162 ? 0.7552 0.8479 0.7799 -0.1640 0.1440  0.0981  162 LYS A CG  
1161 C CD  . LYS A 162 ? 0.7613 0.8314 0.7602 -0.1800 0.1575  0.1153  162 LYS A CD  
1162 C CE  . LYS A 162 ? 0.8997 0.9864 0.8793 -0.1789 0.1808  0.1188  162 LYS A CE  
1163 N NZ  . LYS A 162 ? 1.1302 1.1996 1.0851 -0.1967 0.1968  0.1391  162 LYS A NZ  
1164 N N   . GLN A 163 ? 1.0181 1.1260 1.1158 -0.1719 0.0866  0.0651  163 GLN A N   
1165 C CA  . GLN A 163 ? 0.9765 1.0724 1.0832 -0.1808 0.0709  0.0536  163 GLN A CA  
1166 C C   . GLN A 163 ? 1.0058 1.1155 1.1078 -0.1628 0.0544  0.0419  163 GLN A C   
1167 O O   . GLN A 163 ? 1.0884 1.1730 1.1767 -0.1604 0.0432  0.0340  163 GLN A O   
1168 C CB  . GLN A 163 ? 1.0155 1.1385 1.1625 -0.2043 0.0727  0.0458  163 GLN A CB  
1169 C CG  . GLN A 163 ? 1.2173 1.3293 1.3717 -0.2244 0.0935  0.0597  163 GLN A CG  
1170 C CD  . GLN A 163 ? 1.3720 1.5101 1.5728 -0.2515 0.0967  0.0501  163 GLN A CD  
1171 O OE1 . GLN A 163 ? 1.3409 1.5334 1.5766 -0.2541 0.0995  0.0437  163 GLN A OE1 
1172 N NE2 . GLN A 163 ? 1.3746 1.4745 1.5803 -0.2717 0.0968  0.0483  163 GLN A NE2 
1173 N N   . MET A 164 ? 1.0435 1.1925 1.1573 -0.1492 0.0545  0.0420  164 MET A N   
1174 C CA  . MET A 164 ? 1.0454 1.2070 1.1507 -0.1301 0.0418  0.0369  164 MET A CA  
1175 C C   . MET A 164 ? 0.9713 1.0932 1.0424 -0.1166 0.0427  0.0410  164 MET A C   
1176 O O   . MET A 164 ? 1.0828 1.1954 1.1405 -0.1095 0.0323  0.0342  164 MET A O   
1177 C CB  . MET A 164 ? 1.0598 1.2638 1.1837 -0.1146 0.0450  0.0423  164 MET A CB  
1178 C CG  . MET A 164 ? 1.1432 1.3994 1.3059 -0.1230 0.0370  0.0353  164 MET A CG  
1179 S SD  . MET A 164 ? 1.1679 1.4366 1.3295 -0.1313 0.0122  0.0173  164 MET A SD  
1180 C CE  . MET A 164 ? 1.1375 1.3972 1.2637 -0.1024 0.0041  0.0237  164 MET A CE  
1181 N N   . PHE A 165 ? 0.9625 1.0648 1.0203 -0.1139 0.0557  0.0505  165 PHE A N   
1182 C CA  . PHE A 165 ? 0.9011 0.9693 0.9310 -0.1043 0.0560  0.0528  165 PHE A CA  
1183 C C   . PHE A 165 ? 1.0653 1.1028 1.0851 -0.1115 0.0464  0.0480  165 PHE A C   
1184 O O   . PHE A 165 ? 1.0208 1.0471 1.0310 -0.1024 0.0389  0.0416  165 PHE A O   
1185 C CB  . PHE A 165 ? 0.9240 0.9809 0.9407 -0.1044 0.0696  0.0611  165 PHE A CB  
1186 C CG  . PHE A 165 ? 1.0394 1.0666 1.0302 -0.0967 0.0673  0.0615  165 PHE A CG  
1187 C CD1 . PHE A 165 ? 1.0462 1.0740 1.0322 -0.0823 0.0690  0.0574  165 PHE A CD1 
1188 C CD2 . PHE A 165 ? 1.0948 1.0945 1.0693 -0.1037 0.0634  0.0666  165 PHE A CD2 
1189 C CE1 . PHE A 165 ? 1.0404 1.0467 1.0088 -0.0773 0.0663  0.0549  165 PHE A CE1 
1190 C CE2 . PHE A 165 ? 1.1354 1.1153 1.0905 -0.0954 0.0585  0.0663  165 PHE A CE2 
1191 C CZ  . PHE A 165 ? 0.9317 0.9173 0.8851 -0.0834 0.0597  0.0587  165 PHE A CZ  
1192 N N   . ALA A 166 ? 1.1877 1.2109 1.2120 -0.1277 0.0489  0.0518  166 ALA A N   
1193 C CA  . ALA A 166 ? 1.0772 1.0662 1.0971 -0.1343 0.0417  0.0486  166 ALA A CA  
1194 C C   . ALA A 166 ? 1.0515 1.0462 1.0801 -0.1335 0.0301  0.0309  166 ALA A C   
1195 O O   . ALA A 166 ? 1.0253 0.9976 1.0437 -0.1257 0.0242  0.0243  166 ALA A O   
1196 C CB  . ALA A 166 ? 0.9551 0.9300 0.9851 -0.1541 0.0487  0.0566  166 ALA A CB  
1197 N N   . SER A 167 ? 1.0832 1.1121 1.1312 -0.1411 0.0267  0.0220  167 SER A N   
1198 C CA  . SER A 167 ? 0.9460 0.9894 0.9976 -0.1404 0.0146  0.0034  167 SER A CA  
1199 C C   . SER A 167 ? 1.0110 1.0573 1.0413 -0.1198 0.0116  0.0026  167 SER A C   
1200 O O   . SER A 167 ? 1.1742 1.2067 1.1943 -0.1162 0.0063  -0.0098 167 SER A O   
1201 C CB  . SER A 167 ? 0.9457 1.0365 1.0211 -0.1492 0.0093  -0.0037 167 SER A CB  
1202 O OG  . SER A 167 ? 1.3311 1.4427 1.4028 -0.1464 -0.0044 -0.0214 167 SER A OG  
1203 N N   . THR A 168 ? 1.0190 1.0818 1.0446 -0.1068 0.0174  0.0154  168 THR A N   
1204 C CA  . THR A 168 ? 1.0229 1.0889 1.0322 -0.0887 0.0178  0.0175  168 THR A CA  
1205 C C   . THR A 168 ? 1.1264 1.1575 1.1207 -0.0828 0.0213  0.0168  168 THR A C   
1206 O O   . THR A 168 ? 1.2105 1.2370 1.1946 -0.0764 0.0188  0.0085  168 THR A O   
1207 C CB  . THR A 168 ? 0.9704 1.0548 0.9831 -0.0768 0.0260  0.0315  168 THR A CB  
1208 O OG1 . THR A 168 ? 1.0424 1.1634 1.0757 -0.0805 0.0229  0.0330  168 THR A OG1 
1209 C CG2 . THR A 168 ? 0.9901 1.0768 0.9889 -0.0598 0.0277  0.0355  168 THR A CG2 
1210 N N   . ILE A 169 ? 1.0621 1.0727 1.0553 -0.0848 0.0270  0.0252  169 ILE A N   
1211 C CA  . ILE A 169 ? 1.0004 0.9842 0.9837 -0.0784 0.0277  0.0250  169 ILE A CA  
1212 C C   . ILE A 169 ? 1.1608 1.1249 1.1460 -0.0814 0.0208  0.0135  169 ILE A C   
1213 O O   . ILE A 169 ? 1.3613 1.3143 1.3431 -0.0726 0.0203  0.0077  169 ILE A O   
1214 C CB  . ILE A 169 ? 0.9619 0.9318 0.9404 -0.0810 0.0317  0.0361  169 ILE A CB  
1215 C CG1 . ILE A 169 ? 0.9437 0.9301 0.9198 -0.0756 0.0409  0.0422  169 ILE A CG1 
1216 C CG2 . ILE A 169 ? 0.9500 0.8966 0.9216 -0.0747 0.0275  0.0355  169 ILE A CG2 
1217 C CD1 . ILE A 169 ? 1.0698 1.0620 1.0450 -0.0634 0.0444  0.0385  169 ILE A CD1 
1218 N N   . LYS A 170 ? 1.0056 0.9660 1.0001 -0.0943 0.0168  0.0082  170 LYS A N   
1219 C CA  . LYS A 170 ? 1.0378 0.9765 1.0374 -0.0977 0.0119  -0.0063 170 LYS A CA  
1220 C C   . LYS A 170 ? 1.0223 0.9754 1.0155 -0.0906 0.0098  -0.0235 170 LYS A C   
1221 O O   . LYS A 170 ? 1.2721 1.2083 1.2642 -0.0832 0.0104  -0.0334 170 LYS A O   
1222 C CB  . LYS A 170 ? 1.1311 1.0634 1.1456 -0.1161 0.0097  -0.0113 170 LYS A CB  
1223 C CG  . LYS A 170 ? 1.2205 1.1188 1.2395 -0.1227 0.0131  0.0032  170 LYS A CG  
1224 C CD  . LYS A 170 ? 1.3335 1.2315 1.3701 -0.1441 0.0155  0.0023  170 LYS A CD  
1225 C CE  . LYS A 170 ? 1.3497 1.2151 1.3864 -0.1514 0.0224  0.0235  170 LYS A CE  
1226 N NZ  . LYS A 170 ? 1.2901 1.1614 1.3468 -0.1749 0.0290  0.0246  170 LYS A NZ  
1227 N N   . LYS A 171 ? 1.0301 1.0167 1.0189 -0.0916 0.0078  -0.0262 171 LYS A N   
1228 C CA  . LYS A 171 ? 0.9362 0.9402 0.9111 -0.0846 0.0063  -0.0394 171 LYS A CA  
1229 C C   . LYS A 171 ? 1.1637 1.1639 1.1271 -0.0691 0.0150  -0.0319 171 LYS A C   
1230 O O   . LYS A 171 ? 1.1690 1.1723 1.1211 -0.0628 0.0182  -0.0430 171 LYS A O   
1231 C CB  . LYS A 171 ? 0.9696 1.0140 0.9405 -0.0864 0.0000  -0.0387 171 LYS A CB  
1232 C CG  . LYS A 171 ? 1.1746 1.2402 1.1246 -0.0806 -0.0037 -0.0524 171 LYS A CG  
1233 C CD  . LYS A 171 ? 1.2467 1.3544 1.1959 -0.0857 -0.0163 -0.0569 171 LYS A CD  
1234 C CE  . LYS A 171 ? 1.3322 1.4660 1.2508 -0.0756 -0.0198 -0.0632 171 LYS A CE  
1235 N NZ  . LYS A 171 ? 1.4733 1.6549 1.3885 -0.0723 -0.0328 -0.0558 171 LYS A NZ  
1236 N N   . LEU A 172 ? 1.2106 1.2051 1.1777 -0.0644 0.0203  -0.0148 172 LEU A N   
1237 C CA  . LEU A 172 ? 1.0204 1.0096 0.9835 -0.0532 0.0291  -0.0096 172 LEU A CA  
1238 C C   . LEU A 172 ? 0.9973 0.9648 0.9678 -0.0505 0.0294  -0.0203 172 LEU A C   
1239 O O   . LEU A 172 ? 1.1643 1.1340 1.1333 -0.0429 0.0366  -0.0262 172 LEU A O   
1240 C CB  . LEU A 172 ? 0.8980 0.8857 0.8654 -0.0512 0.0338  0.0059  172 LEU A CB  
1241 C CG  . LEU A 172 ? 0.9250 0.9081 0.8937 -0.0429 0.0431  0.0088  172 LEU A CG  
1242 C CD1 . LEU A 172 ? 0.8147 0.8113 0.7742 -0.0360 0.0521  0.0113  172 LEU A CD1 
1243 C CD2 . LEU A 172 ? 0.7140 0.6937 0.6869 -0.0433 0.0466  0.0182  172 LEU A CD2 
1244 N N   . HIS A 173 ? 1.0624 1.0093 1.0429 -0.0559 0.0227  -0.0213 173 HIS A N   
1245 C CA  . HIS A 173 ? 0.9796 0.9045 0.9715 -0.0504 0.0211  -0.0293 173 HIS A CA  
1246 C C   . HIS A 173 ? 1.0129 0.9362 1.0056 -0.0493 0.0229  -0.0509 173 HIS A C   
1247 O O   . HIS A 173 ? 0.9361 0.8574 0.9355 -0.0398 0.0283  -0.0607 173 HIS A O   
1248 C CB  . HIS A 173 ? 1.0533 0.9529 1.0533 -0.0553 0.0138  -0.0206 173 HIS A CB  
1249 C CG  . HIS A 173 ? 1.1462 1.0472 1.1411 -0.0551 0.0127  -0.0017 173 HIS A CG  
1250 N ND1 . HIS A 173 ? 1.4025 1.2824 1.3991 -0.0545 0.0068  0.0103  173 HIS A ND1 
1251 C CD2 . HIS A 173 ? 1.2401 1.1604 1.2267 -0.0549 0.0174  0.0064  173 HIS A CD2 
1252 C CE1 . HIS A 173 ? 1.5051 1.3946 1.4908 -0.0550 0.0074  0.0232  173 HIS A CE1 
1253 N NE2 . HIS A 173 ? 1.2727 1.1855 1.2546 -0.0554 0.0144  0.0193  173 HIS A NE2 
1254 N N   . ARG A 174 ? 0.9596 0.8866 0.9470 -0.0597 0.0190  -0.0606 174 ARG A N   
1255 C CA  . ARG A 174 ? 1.1076 1.0363 1.0911 -0.0609 0.0203  -0.0857 174 ARG A CA  
1256 C C   . ARG A 174 ? 1.0958 1.0481 1.0624 -0.0514 0.0297  -0.0912 174 ARG A C   
1257 O O   . ARG A 174 ? 1.1672 1.1153 1.1346 -0.0455 0.0367  -0.1095 174 ARG A O   
1258 C CB  . ARG A 174 ? 0.9685 0.9087 0.9472 -0.0759 0.0127  -0.0960 174 ARG A CB  
1259 C CG  . ARG A 174 ? 1.2175 1.1273 1.2164 -0.0884 0.0078  -0.1037 174 ARG A CG  
1260 C CD  . ARG A 174 ? 1.4468 1.3724 1.4448 -0.1048 0.0012  -0.1248 174 ARG A CD  
1261 N NE  . ARG A 174 ? 1.5255 1.4862 1.5188 -0.1121 -0.0048 -0.1114 174 ARG A NE  
1262 C CZ  . ARG A 174 ? 1.4906 1.4478 1.5002 -0.1235 -0.0066 -0.0966 174 ARG A CZ  
1263 N NH1 . ARG A 174 ? 1.5347 1.4522 1.5614 -0.1295 -0.0031 -0.0904 174 ARG A NH1 
1264 N NH2 . ARG A 174 ? 1.3578 1.3518 1.3672 -0.1277 -0.0109 -0.0866 174 ARG A NH2 
1265 N N   . CYS A 175 ? 0.9901 0.9657 0.9422 -0.0496 0.0319  -0.0745 175 CYS A N   
1266 C CA  . CYS A 175 ? 0.9899 0.9862 0.9227 -0.0416 0.0427  -0.0734 175 CYS A CA  
1267 C C   . CYS A 175 ? 1.0603 1.0480 1.0054 -0.0325 0.0555  -0.0740 175 CYS A C   
1268 O O   . CYS A 175 ? 1.2276 1.2225 1.1650 -0.0277 0.0665  -0.0873 175 CYS A O   
1269 C CB  . CYS A 175 ? 1.1105 1.1264 1.0312 -0.0399 0.0429  -0.0507 175 CYS A CB  
1270 S SG  . CYS A 175 ? 1.3117 1.3484 1.2057 -0.0298 0.0578  -0.0413 175 CYS A SG  
1271 N N   . ILE A 176 ? 0.8985 0.8744 0.8631 -0.0306 0.0542  -0.0609 176 ILE A N   
1272 C CA  . ILE A 176 ? 0.9982 0.9720 0.9811 -0.0233 0.0637  -0.0618 176 ILE A CA  
1273 C C   . ILE A 176 ? 1.1051 1.0667 1.1066 -0.0180 0.0633  -0.0816 176 ILE A C   
1274 O O   . ILE A 176 ? 1.1856 1.1547 1.2006 -0.0110 0.0750  -0.0908 176 ILE A O   
1275 C CB  . ILE A 176 ? 0.9819 0.9497 0.9797 -0.0237 0.0586  -0.0461 176 ILE A CB  
1276 C CG1 . ILE A 176 ? 0.9972 0.9763 0.9824 -0.0259 0.0656  -0.0300 176 ILE A CG1 
1277 C CG2 . ILE A 176 ? 0.7843 0.7524 0.8087 -0.0172 0.0622  -0.0515 176 ILE A CG2 
1278 C CD1 . ILE A 176 ? 1.0211 0.9948 1.0163 -0.0281 0.0612  -0.0187 176 ILE A CD1 
1279 N N   . LYS A 177 ? 1.2807 1.2233 1.2863 -0.0215 0.0517  -0.0884 177 LYS A N   
1280 C CA  . LYS A 177 ? 1.1039 1.0285 1.1284 -0.0155 0.0517  -0.1079 177 LYS A CA  
1281 C C   . LYS A 177 ? 1.0450 0.9826 1.0598 -0.0124 0.0656  -0.1317 177 LYS A C   
1282 O O   . LYS A 177 ? 1.1465 1.0792 1.1822 -0.0027 0.0733  -0.1480 177 LYS A O   
1283 C CB  . LYS A 177 ? 1.2059 1.1041 1.2331 -0.0232 0.0397  -0.1108 177 LYS A CB  
1284 C CG  . LYS A 177 ? 1.3982 1.2682 1.4504 -0.0170 0.0307  -0.1004 177 LYS A CG  
1285 C CD  . LYS A 177 ? 1.6176 1.4603 1.6691 -0.0286 0.0220  -0.0968 177 LYS A CD  
1286 C CE  . LYS A 177 ? 1.6844 1.5182 1.7343 -0.0362 0.0257  -0.1249 177 LYS A CE  
1287 N NZ  . LYS A 177 ? 1.5657 1.3799 1.6160 -0.0532 0.0189  -0.1228 177 LYS A NZ  
1288 N N   . LYS A 178 ? 1.0683 1.0250 1.0508 -0.0195 0.0689  -0.1333 178 LYS A N   
1289 C CA  . LYS A 178 ? 1.1748 1.1471 1.1371 -0.0179 0.0817  -0.1554 178 LYS A CA  
1290 C C   . LYS A 178 ? 1.2749 1.2711 1.2257 -0.0123 0.0999  -0.1459 178 LYS A C   
1291 O O   . LYS A 178 ? 1.3564 1.3712 1.2786 -0.0120 0.1121  -0.1564 178 LYS A O   
1292 C CB  . LYS A 178 ? 1.1502 1.1339 1.0803 -0.0284 0.0729  -0.1637 178 LYS A CB  
1293 C CG  . LYS A 178 ? 1.5430 1.5076 1.4811 -0.0347 0.0659  -0.1931 178 LYS A CG  
1294 C CD  . LYS A 178 ? 1.6152 1.5996 1.5233 -0.0471 0.0557  -0.2047 178 LYS A CD  
1295 C CE  . LYS A 178 ? 1.5232 1.4954 1.4325 -0.0532 0.0557  -0.2450 178 LYS A CE  
1296 N NZ  . LYS A 178 ? 1.4983 1.5054 1.3660 -0.0599 0.0529  -0.2646 178 LYS A NZ  
1297 N N   . MET A 179 ? 1.1561 1.1520 1.1284 -0.0091 0.1026  -0.1265 179 MET A N   
1298 C CA  . MET A 179 ? 1.0711 1.0857 1.0402 -0.0064 0.1222  -0.1168 179 MET A CA  
1299 C C   . MET A 179 ? 1.0781 1.0970 1.0816 0.0012  0.1365  -0.1315 179 MET A C   
1300 O O   . MET A 179 ? 1.2813 1.2888 1.3213 0.0064  0.1269  -0.1358 179 MET A O   
1301 C CB  . MET A 179 ? 1.0207 1.0351 0.9950 -0.0097 0.1189  -0.0896 179 MET A CB  
1302 C CG  . MET A 179 ? 1.0482 1.0680 0.9885 -0.0141 0.1136  -0.0718 179 MET A CG  
1303 S SD  . MET A 179 ? 1.1516 1.1666 1.1026 -0.0164 0.1130  -0.0441 179 MET A SD  
1304 C CE  . MET A 179 ? 0.9830 1.0083 0.8963 -0.0166 0.1073  -0.0265 179 MET A CE  
1305 N N   . GLU A 180 ? 1.0544 1.0922 1.0460 0.0027  0.1600  -0.1380 180 GLU A N   
1306 C CA  . GLU A 180 ? 0.9912 1.0412 1.0193 0.0089  0.1784  -0.1508 180 GLU A CA  
1307 C C   . GLU A 180 ? 1.0487 1.1029 1.1118 0.0067  0.1777  -0.1332 180 GLU A C   
1308 O O   . GLU A 180 ? 1.1025 1.1526 1.1503 -0.0005 0.1732  -0.1109 180 GLU A O   
1309 C CB  . GLU A 180 ? 1.0571 1.1283 1.0584 0.0084  0.2073  -0.1585 180 GLU A CB  
1310 C CG  . GLU A 180 ? 1.3760 1.4470 1.3390 0.0099  0.2073  -0.1812 180 GLU A CG  
1311 C CD  . GLU A 180 ? 1.5747 1.6693 1.5037 0.0099  0.2367  -0.1890 180 GLU A CD  
1312 O OE1 . GLU A 180 ? 1.4344 1.5403 1.3370 0.0052  0.2499  -0.1637 180 GLU A OE1 
1313 O OE2 . GLU A 180 ? 1.7092 1.8095 1.6366 0.0149  0.2481  -0.2201 180 GLU A OE2 
1314 N N   . PRO A 181 ? 1.0510 1.1151 1.1639 0.0132  0.1814  -0.1450 181 PRO A N   
1315 C CA  . PRO A 181 ? 0.9973 1.0693 1.1478 0.0102  0.1761  -0.1336 181 PRO A CA  
1316 C C   . PRO A 181 ? 1.1146 1.1969 1.2563 -0.0016 0.1960  -0.1173 181 PRO A C   
1317 O O   . PRO A 181 ? 1.0382 1.1312 1.1620 -0.0043 0.2220  -0.1179 181 PRO A O   
1318 C CB  . PRO A 181 ? 0.8210 0.9123 1.0262 0.0205  0.1817  -0.1535 181 PRO A CB  
1319 C CG  . PRO A 181 ? 1.0211 1.1019 1.2189 0.0317  0.1813  -0.1735 181 PRO A CG  
1320 C CD  . PRO A 181 ? 0.9621 1.0344 1.1013 0.0243  0.1914  -0.1718 181 PRO A CD  
1321 N N   . LEU A 182 ? 0.8139 0.8910 0.9666 -0.0084 0.1852  -0.1029 182 LEU A N   
1322 C CA  . LEU A 182 ? 0.8911 0.9716 1.0427 -0.0200 0.2045  -0.0880 182 LEU A CA  
1323 C C   . LEU A 182 ? 0.9974 1.1035 1.1959 -0.0243 0.2275  -0.0994 182 LEU A C   
1324 O O   . LEU A 182 ? 0.9673 1.0887 1.2144 -0.0244 0.2171  -0.1105 182 LEU A O   
1325 C CB  . LEU A 182 ? 0.8037 0.8709 0.9587 -0.0263 0.1873  -0.0753 182 LEU A CB  
1326 C CG  . LEU A 182 ? 0.9262 0.9869 1.0766 -0.0378 0.2072  -0.0588 182 LEU A CG  
1327 C CD1 . LEU A 182 ? 0.7380 0.7844 0.8361 -0.0358 0.2173  -0.0393 182 LEU A CD1 
1328 C CD2 . LEU A 182 ? 0.7924 0.8437 0.9578 -0.0443 0.1919  -0.0551 182 LEU A CD2 
1329 N N   . PRO A 183 ? 0.9405 1.0548 1.1246 -0.0283 0.2592  -0.0961 183 PRO A N   
1330 C CA  . PRO A 183 ? 0.9438 1.0856 1.1725 -0.0337 0.2871  -0.1076 183 PRO A CA  
1331 C C   . PRO A 183 ? 0.9831 1.1322 1.2590 -0.0476 0.2903  -0.1047 183 PRO A C   
1332 O O   . PRO A 183 ? 1.1920 1.3204 1.4505 -0.0575 0.2930  -0.0860 183 PRO A O   
1333 C CB  . PRO A 183 ? 0.8978 1.0383 1.0834 -0.0375 0.3207  -0.0952 183 PRO A CB  
1334 C CG  . PRO A 183 ? 0.9788 1.0908 1.1070 -0.0374 0.3090  -0.0708 183 PRO A CG  
1335 C CD  . PRO A 183 ? 1.0164 1.1164 1.1395 -0.0287 0.2709  -0.0783 183 PRO A CD  
1336 N N   . GLN A 184 ? 1.0182 1.1983 1.3568 -0.0477 0.2896  -0.1253 184 GLN A N   
1337 C CA  . GLN A 184 ? 0.9269 1.1214 1.3178 -0.0617 0.2873  -0.1299 184 GLN A CA  
1338 C C   . GLN A 184 ? 1.0311 1.2191 1.4249 -0.0815 0.3235  -0.1165 184 GLN A C   
1339 O O   . GLN A 184 ? 0.9492 1.1345 1.3180 -0.0831 0.3552  -0.1067 184 GLN A O   
1340 C CB  . GLN A 184 ? 0.7771 1.0151 1.2380 -0.0566 0.2817  -0.1555 184 GLN A CB  
1341 C CG  . GLN A 184 ? 0.7478 1.0000 1.2485 -0.0587 0.2489  -0.1649 184 GLN A CG  
1342 C CD  . GLN A 184 ? 0.8334 1.0629 1.2978 -0.0435 0.2100  -0.1587 184 GLN A CD  
1343 O OE1 . GLN A 184 ? 1.0100 1.2180 1.4325 -0.0300 0.2056  -0.1524 184 GLN A OE1 
1344 N NE2 . GLN A 184 ? 1.0270 1.2620 1.5071 -0.0470 0.1824  -0.1616 184 GLN A NE2 
1345 N N   . GLY A 185 ? 0.9287 1.1125 1.3513 -0.0969 0.3194  -0.1162 185 GLY A N   
1346 C CA  . GLY A 185 ? 0.8793 1.0472 1.3068 -0.1166 0.3531  -0.1018 185 GLY A CA  
1347 C C   . GLY A 185 ? 1.1068 1.2282 1.4698 -0.1142 0.3538  -0.0729 185 GLY A C   
1348 O O   . GLY A 185 ? 1.2162 1.3157 1.5658 -0.1245 0.3846  -0.0522 185 GLY A O   
1349 N N   . SER A 186 ? 1.0583 1.1653 1.3834 -0.0997 0.3203  -0.0700 186 SER A N   
1350 C CA  . SER A 186 ? 1.0848 1.1539 1.3554 -0.0954 0.3163  -0.0449 186 SER A CA  
1351 C C   . SER A 186 ? 1.0405 1.0928 1.3268 -0.1032 0.2995  -0.0476 186 SER A C   
1352 O O   . SER A 186 ? 1.0987 1.1710 1.4282 -0.1096 0.2835  -0.0703 186 SER A O   
1353 C CB  . SER A 186 ? 1.0463 1.1111 1.2660 -0.0767 0.2932  -0.0404 186 SER A CB  
1354 O OG  . SER A 186 ? 1.0483 1.1254 1.2455 -0.0698 0.3103  -0.0394 186 SER A OG  
1355 N N   . ASP A 187 ? 1.0305 1.0486 1.2816 -0.1016 0.3030  -0.0255 187 ASP A N   
1356 C CA  . ASP A 187 ? 0.9856 0.9857 1.2457 -0.1069 0.2883  -0.0296 187 ASP A CA  
1357 C C   . ASP A 187 ? 1.0170 0.9911 1.2254 -0.0930 0.2761  -0.0084 187 ASP A C   
1358 O O   . ASP A 187 ? 0.9817 0.9534 1.1497 -0.0810 0.2788  0.0094  187 ASP A O   
1359 C CB  . ASP A 187 ? 1.1818 1.1649 1.4791 -0.1261 0.3158  -0.0296 187 ASP A CB  
1360 C CG  . ASP A 187 ? 1.1893 1.1683 1.5146 -0.1363 0.2990  -0.0506 187 ASP A CG  
1361 O OD1 . ASP A 187 ? 0.8811 0.8584 1.1814 -0.1259 0.2704  -0.0541 187 ASP A OD1 
1362 O OD2 . ASP A 187 ? 1.2129 1.1918 1.5853 -0.1560 0.3154  -0.0652 187 ASP A OD2 
1363 N N   . ALA A 188 ? 0.9899 0.9486 1.2011 -0.0950 0.2627  -0.0126 188 ALA A N   
1364 C CA  . ALA A 188 ? 0.9806 0.9202 1.1513 -0.0820 0.2503  0.0043  188 ALA A CA  
1365 C C   . ALA A 188 ? 1.0708 0.9790 1.2500 -0.0867 0.2628  0.0115  188 ALA A C   
1366 O O   . ALA A 188 ? 1.0166 0.9195 1.2336 -0.1018 0.2714  -0.0059 188 ALA A O   
1367 C CB  . ALA A 188 ? 0.9031 0.8584 1.0625 -0.0753 0.2169  -0.0095 188 ALA A CB  
1368 N N   . SER A 189 ? 1.1741 1.0629 1.3210 -0.0732 0.2636  0.0352  189 SER A N   
1369 C CA  . SER A 189 ? 0.9680 0.8241 1.1231 -0.0731 0.2764  0.0439  189 SER A CA  
1370 C C   . SER A 189 ? 1.1885 1.0411 1.3167 -0.0577 0.2583  0.0525  189 SER A C   
1371 O O   . SER A 189 ? 1.3257 1.1943 1.4220 -0.0450 0.2435  0.0647  189 SER A O   
1372 C CB  . SER A 189 ? 1.0706 0.8995 1.2239 -0.0712 0.3082  0.0729  189 SER A CB  
1373 O OG  . SER A 189 ? 1.2785 1.0711 1.4407 -0.0672 0.3208  0.0840  189 SER A OG  
1374 N N   . PHE A 190 ? 1.3289 1.1624 1.4727 -0.0600 0.2605  0.0430  190 PHE A N   
1375 C CA  . PHE A 190 ? 1.2232 1.0501 1.3490 -0.0448 0.2515  0.0535  190 PHE A CA  
1376 C C   . PHE A 190 ? 1.2767 1.0712 1.4040 -0.0332 0.2748  0.0823  190 PHE A C   
1377 O O   . PHE A 190 ? 1.2640 1.0279 1.4188 -0.0418 0.2985  0.0807  190 PHE A O   
1378 C CB  . PHE A 190 ? 1.0520 0.8775 1.1916 -0.0518 0.2427  0.0262  190 PHE A CB  
1379 C CG  . PHE A 190 ? 0.8874 0.7444 1.0183 -0.0587 0.2168  0.0043  190 PHE A CG  
1380 C CD1 . PHE A 190 ? 0.9139 0.7950 1.0250 -0.0543 0.2009  0.0114  190 PHE A CD1 
1381 C CD2 . PHE A 190 ? 0.9230 0.7841 1.0641 -0.0687 0.2086  -0.0233 190 PHE A CD2 
1382 C CE1 . PHE A 190 ? 0.9381 0.8427 1.0431 -0.0586 0.1780  -0.0053 190 PHE A CE1 
1383 C CE2 . PHE A 190 ? 0.9229 0.8117 1.0528 -0.0729 0.1843  -0.0386 190 PHE A CE2 
1384 C CZ  . PHE A 190 ? 0.8403 0.7488 0.9539 -0.0671 0.1693  -0.0279 190 PHE A CZ  
1385 N N   . ARG A 191 ? 1.1061 0.9073 1.2059 -0.0136 0.2678  0.1090  191 ARG A N   
1386 C CA  . ARG A 191 ? 1.1391 0.9126 1.2371 0.0023  0.2868  0.1421  191 ARG A CA  
1387 C C   . ARG A 191 ? 1.2617 1.0437 1.3491 0.0233  0.2732  0.1549  191 ARG A C   
1388 O O   . ARG A 191 ? 1.3047 1.1214 1.3697 0.0291  0.2495  0.1539  191 ARG A O   
1389 C CB  . ARG A 191 ? 0.8933 0.6714 0.9665 0.0069  0.2957  0.1699  191 ARG A CB  
1390 C CG  . ARG A 191 ? 0.9249 0.7039 1.0115 -0.0144 0.3091  0.1548  191 ARG A CG  
1391 C CD  . ARG A 191 ? 1.1595 0.9296 1.2293 -0.0123 0.3317  0.1842  191 ARG A CD  
1392 N NE  . ARG A 191 ? 1.1310 0.9014 1.2267 -0.0350 0.3489  0.1658  191 ARG A NE  
1393 C CZ  . ARG A 191 ? 1.2429 1.0147 1.3283 -0.0398 0.3700  0.1816  191 ARG A CZ  
1394 N NH1 . ARG A 191 ? 1.2841 1.0559 1.3269 -0.0229 0.3756  0.2176  191 ARG A NH1 
1395 N NH2 . ARG A 191 ? 1.1746 0.9516 1.2925 -0.0614 0.3856  0.1611  191 ARG A NH2 
1396 N N   . VAL A 192 ? 1.2182 0.9686 1.3263 0.0344  0.2892  0.1653  192 VAL A N   
1397 C CA  . VAL A 192 ? 1.2546 1.0150 1.3631 0.0548  0.2787  0.1736  192 VAL A CA  
1398 C C   . VAL A 192 ? 1.3076 1.0456 1.4185 0.0804  0.2923  0.2134  192 VAL A C   
1399 O O   . VAL A 192 ? 1.1405 0.8357 1.2664 0.0806  0.3183  0.2282  192 VAL A O   
1400 C CB  . VAL A 192 ? 1.2494 0.9987 1.3850 0.0479  0.2822  0.1418  192 VAL A CB  
1401 C CG1 . VAL A 192 ? 1.3474 1.1279 1.4727 0.0290  0.2619  0.1089  192 VAL A CG1 
1402 C CG2 . VAL A 192 ? 1.2636 0.9647 1.4308 0.0376  0.3105  0.1314  192 VAL A CG2 
1403 N N   . SER A 193 ? 1.1587 0.9268 1.2567 0.1021  0.2743  0.2314  193 SER A N   
1404 C CA  . SER A 193 ? 1.0848 0.8402 1.1862 0.1316  0.2814  0.2707  193 SER A CA  
1405 C C   . SER A 193 ? 1.1756 0.9425 1.3034 0.1490  0.2749  0.2644  193 SER A C   
1406 O O   . SER A 193 ? 1.0804 0.8802 1.2097 0.1399  0.2584  0.2368  193 SER A O   
1407 C CB  . SER A 193 ? 1.0901 0.8794 1.1515 0.1448  0.2643  0.3020  193 SER A CB  
1408 O OG  . SER A 193 ? 1.2072 1.0501 1.2581 0.1501  0.2343  0.2928  193 SER A OG  
1409 N N   . TYR A 194 ? 1.3693 1.1089 1.5191 0.1750  0.2895  0.2913  194 TYR A N   
1410 C CA  . TYR A 194 ? 1.3036 1.0438 1.4896 0.1906  0.2925  0.2800  194 TYR A CA  
1411 C C   . TYR A 194 ? 1.2629 1.0404 1.4541 0.2242  0.2757  0.3095  194 TYR A C   
1412 O O   . TYR A 194 ? 1.3209 1.1136 1.4882 0.2409  0.2647  0.3465  194 TYR A O   
1413 C CB  . TYR A 194 ? 1.2857 0.9603 1.5081 0.1941  0.3262  0.2777  194 TYR A CB  
1414 C CG  . TYR A 194 ? 1.3762 1.0183 1.6013 0.1598  0.3422  0.2443  194 TYR A CG  
1415 C CD1 . TYR A 194 ? 1.2358 0.8912 1.4681 0.1379  0.3378  0.1975  194 TYR A CD1 
1416 C CD2 . TYR A 194 ? 1.3993 1.0013 1.6199 0.1492  0.3614  0.2602  194 TYR A CD2 
1417 C CE1 . TYR A 194 ? 1.1954 0.8282 1.4315 0.1076  0.3486  0.1661  194 TYR A CE1 
1418 C CE2 . TYR A 194 ? 1.3861 0.9653 1.6158 0.1170  0.3746  0.2276  194 TYR A CE2 
1419 C CZ  . TYR A 194 ? 1.4062 1.0026 1.6442 0.0970  0.3663  0.1799  194 TYR A CZ  
1420 O OH  . TYR A 194 ? 1.4687 1.0491 1.7172 0.0660  0.3759  0.1467  194 TYR A OH  
1421 N N   . THR A 195 ? 1.2004 0.9961 1.4233 0.2339  0.2739  0.2915  195 THR A N   
1422 C CA  . THR A 195 ? 1.2351 1.0683 1.4776 0.2672  0.2605  0.3150  195 THR A CA  
1423 C C   . THR A 195 ? 1.4030 1.1885 1.6795 0.2990  0.2839  0.3435  195 THR A C   
1424 O O   . THR A 195 ? 1.4738 1.1954 1.7605 0.2912  0.3121  0.3398  195 THR A O   
1425 C CB  . THR A 195 ? 1.1915 1.0679 1.4584 0.2635  0.2518  0.2828  195 THR A CB  
1426 O OG1 . THR A 195 ? 1.3295 1.1656 1.6271 0.2578  0.2790  0.2535  195 THR A OG1 
1427 C CG2 . THR A 195 ? 1.0863 1.0028 1.3213 0.2321  0.2308  0.2567  195 THR A CG2 
1428 N N   . GLU A 196 ? 1.4516 1.2683 1.7496 0.3348  0.2724  0.3714  196 GLU A N   
1429 C CA  . GLU A 196 ? 1.3103 1.0831 1.6435 0.3709  0.2927  0.4037  196 GLU A CA  
1430 C C   . GLU A 196 ? 1.3622 1.0978 1.7468 0.3734  0.3211  0.3716  196 GLU A C   
1431 O O   . GLU A 196 ? 1.3660 1.0416 1.7814 0.3938  0.3478  0.3877  196 GLU A O   
1432 C CB  . GLU A 196 ? 1.4381 1.2637 1.7814 0.4113  0.2681  0.4433  196 GLU A CB  
1433 C CG  . GLU A 196 ? 1.6303 1.4666 1.9260 0.4225  0.2505  0.4906  196 GLU A CG  
1434 C CD  . GLU A 196 ? 1.9882 1.7462 2.2796 0.4366  0.2790  0.5292  196 GLU A CD  
1435 O OE1 . GLU A 196 ? 2.0743 1.8280 2.3816 0.4709  0.2780  0.5654  196 GLU A OE1 
1436 O OE2 . GLU A 196 ? 2.0419 1.7492 2.3128 0.4063  0.3004  0.5164  196 GLU A OE2 
1437 N N   . LYS A 197 ? 1.4834 1.2526 1.8759 0.3525  0.3168  0.3261  197 LYS A N   
1438 C CA  . LYS A 197 ? 1.4991 1.2405 1.9335 0.3519  0.3435  0.2893  197 LYS A CA  
1439 C C   . LYS A 197 ? 1.5332 1.2004 1.9650 0.3270  0.3727  0.2654  197 LYS A C   
1440 O O   . LYS A 197 ? 1.5301 1.1590 1.9974 0.3291  0.3996  0.2377  197 LYS A O   
1441 C CB  . LYS A 197 ? 1.3673 1.1662 1.8011 0.3325  0.3318  0.2483  197 LYS A CB  
1442 C CG  . LYS A 197 ? 1.3138 1.1893 1.7632 0.3538  0.3067  0.2634  197 LYS A CG  
1443 C CD  . LYS A 197 ? 1.3396 1.2664 1.7858 0.3290  0.2990  0.2237  197 LYS A CD  
1444 C CE  . LYS A 197 ? 1.2143 1.1258 1.6988 0.3320  0.3284  0.1880  197 LYS A CE  
1445 N NZ  . LYS A 197 ? 1.2011 1.0544 1.6668 0.3037  0.3512  0.1531  197 LYS A NZ  
1446 N N   . ALA A 198 ? 1.5901 1.2401 1.9821 0.3025  0.3679  0.2733  198 ALA A N   
1447 C CA  . ALA A 198 ? 1.3886 0.9803 1.7783 0.2725  0.3915  0.2463  198 ALA A CA  
1448 C C   . ALA A 198 ? 1.5335 1.0502 1.9474 0.2879  0.4208  0.2745  198 ALA A C   
1449 O O   . ALA A 198 ? 1.6427 1.1513 2.0418 0.3059  0.4165  0.3239  198 ALA A O   
1450 C CB  . ALA A 198 ? 1.4425 1.0539 1.7850 0.2384  0.3745  0.2390  198 ALA A CB  
1451 N N   . PRO A 199 ? 1.6177 1.0779 2.0676 0.2802  0.4516  0.2427  199 PRO A N   
1452 C CA  . PRO A 199 ? 1.5558 0.9452 2.0287 0.2821  0.4803  0.2579  199 PRO A CA  
1453 C C   . PRO A 199 ? 1.6534 1.0238 2.0940 0.2619  0.4809  0.2839  199 PRO A C   
1454 O O   . PRO A 199 ? 1.4736 0.8666 1.8828 0.2372  0.4681  0.2720  199 PRO A O   
1455 C CB  . PRO A 199 ? 1.4837 0.8406 1.9837 0.2555  0.5029  0.1977  199 PRO A CB  
1456 C CG  . PRO A 199 ? 1.6048 1.0081 2.0924 0.2431  0.4888  0.1552  199 PRO A CG  
1457 C CD  . PRO A 199 ? 1.5397 1.0125 2.0071 0.2663  0.4579  0.1862  199 PRO A CD  
1458 N N   . LYS A 200 ? 1.8706 1.2074 2.3173 0.2700  0.4945  0.3164  200 LYS A N   
1459 C CA  . LYS A 200 ? 1.8529 1.1761 2.2696 0.2542  0.4979  0.3448  200 LYS A CA  
1460 C C   . LYS A 200 ? 1.7666 1.0637 2.1877 0.2093  0.5142  0.3031  200 LYS A C   
1461 O O   . LYS A 200 ? 1.7012 0.9928 2.1006 0.1906  0.5182  0.3176  200 LYS A O   
1462 C CB  . LYS A 200 ? 1.9080 1.1986 2.3342 0.2750  0.5120  0.3871  200 LYS A CB  
1463 C CG  . LYS A 200 ? 2.0548 1.3433 2.4424 0.2695  0.5120  0.4281  200 LYS A CG  
1464 C CD  . LYS A 200 ? 2.1272 1.3801 2.5250 0.2920  0.5271  0.4698  200 LYS A CD  
1465 C CE  . LYS A 200 ? 2.0079 1.2524 2.3689 0.2815  0.5334  0.5043  200 LYS A CE  
1466 N NZ  . LYS A 200 ? 1.9809 1.1933 2.3554 0.2392  0.5577  0.4706  200 LYS A NZ  
1467 N N   . ASP A 201 ? 1.7541 1.0413 2.2030 0.1919  0.5223  0.2491  201 ASP A N   
1468 C CA  . ASP A 201 ? 1.7719 1.0379 2.2323 0.1498  0.5365  0.2042  201 ASP A CA  
1469 C C   . ASP A 201 ? 1.7010 0.9959 2.1498 0.1264  0.5221  0.1571  201 ASP A C   
1470 O O   . ASP A 201 ? 1.6682 0.9534 2.1289 0.0920  0.5298  0.1127  201 ASP A O   
1471 C CB  . ASP A 201 ? 2.0147 1.2375 2.5198 0.1439  0.5621  0.1759  201 ASP A CB  
1472 C CG  . ASP A 201 ? 2.2377 1.4632 2.7648 0.1719  0.5620  0.1657  201 ASP A CG  
1473 O OD1 . ASP A 201 ? 2.4219 1.6715 2.9381 0.2071  0.5476  0.2034  201 ASP A OD1 
1474 O OD2 . ASP A 201 ? 2.2783 1.4864 2.8337 0.1585  0.5756  0.1183  201 ASP A OD2 
1475 N N   . TYR A 202 ? 1.7025 1.0430 2.1267 0.1435  0.4976  0.1645  202 TYR A N   
1476 C CA  . TYR A 202 ? 1.6055 0.9997 2.0093 0.1194  0.4747  0.1169  202 TYR A CA  
1477 C C   . TYR A 202 ? 1.5595 0.9835 1.9316 0.0887  0.4582  0.1109  202 TYR A C   
1478 O O   . TYR A 202 ? 1.5392 0.9823 1.8838 0.0948  0.4466  0.1491  202 TYR A O   
1479 C CB  . TYR A 202 ? 1.5540 1.0078 1.9392 0.1421  0.4487  0.1228  202 TYR A CB  
1480 C CG  . TYR A 202 ? 1.4071 0.9104 1.7707 0.1187  0.4284  0.0772  202 TYR A CG  
1481 C CD1 . TYR A 202 ? 1.3372 0.8282 1.7189 0.1057  0.4410  0.0274  202 TYR A CD1 
1482 C CD2 . TYR A 202 ? 1.1593 0.7198 1.4828 0.1097  0.3976  0.0839  202 TYR A CD2 
1483 C CE1 . TYR A 202 ? 1.1824 0.7184 1.5388 0.0855  0.4227  -0.0102 202 TYR A CE1 
1484 C CE2 . TYR A 202 ? 1.1262 0.7273 1.4293 0.0898  0.3802  0.0469  202 TYR A CE2 
1485 C CZ  . TYR A 202 ? 1.2129 0.8023 1.5306 0.0782  0.3925  0.0020  202 TYR A CZ  
1486 O OH  . TYR A 202 ? 1.1719 0.8015 1.4640 0.0597  0.3753  -0.0310 202 TYR A OH  
1487 N N   . THR A 203 ? 1.5496 0.9795 1.9261 0.0566  0.4571  0.0609  203 THR A N   
1488 C CA  . THR A 203 ? 1.4821 0.9499 1.8329 0.0288  0.4376  0.0470  203 THR A CA  
1489 C C   . THR A 203 ? 1.3186 0.8214 1.6610 0.0101  0.4210  -0.0050 203 THR A C   
1490 O O   . THR A 203 ? 1.4724 0.9502 1.8396 -0.0009 0.4360  -0.0439 203 THR A O   
1491 C CB  . THR A 203 ? 1.4883 0.9191 1.8603 0.0041  0.4587  0.0459  203 THR A CB  
1492 O OG1 . THR A 203 ? 1.5406 0.9660 1.8965 0.0163  0.4625  0.0978  203 THR A OG1 
1493 C CG2 . THR A 203 ? 1.4464 0.9136 1.8109 -0.0295 0.4424  0.0066  203 THR A CG2 
1494 N N   . PRO A 204 ? 1.1613 0.7210 1.4668 0.0070  0.3903  -0.0055 204 PRO A N   
1495 C CA  . PRO A 204 ? 1.3403 0.9359 1.6301 -0.0083 0.3726  -0.0475 204 PRO A CA  
1496 C C   . PRO A 204 ? 1.3669 0.9594 1.6676 -0.0408 0.3733  -0.0864 204 PRO A C   
1497 O O   . PRO A 204 ? 1.3725 0.9523 1.6857 -0.0534 0.3797  -0.0763 204 PRO A O   
1498 C CB  . PRO A 204 ? 1.1940 0.8432 1.4446 -0.0025 0.3420  -0.0279 204 PRO A CB  
1499 C CG  . PRO A 204 ? 1.0211 0.6647 1.2677 0.0193  0.3438  0.0212  204 PRO A CG  
1500 C CD  . PRO A 204 ? 1.1054 0.6968 1.3807 0.0169  0.3715  0.0332  204 PRO A CD  
1501 N N   . GLU A 205 ? 1.1816 0.7890 1.4779 -0.0541 0.3671  -0.1305 205 GLU A N   
1502 C CA  . GLU A 205 ? 1.1139 0.7304 1.4181 -0.0846 0.3613  -0.1710 205 GLU A CA  
1503 C C   . GLU A 205 ? 1.3597 1.0136 1.6472 -0.0953 0.3379  -0.1579 205 GLU A C   
1504 O O   . GLU A 205 ? 1.2598 0.9511 1.5130 -0.0853 0.3146  -0.1401 205 GLU A O   
1505 C CB  . GLU A 205 ? 1.3319 0.9733 1.6174 -0.0933 0.3502  -0.2152 205 GLU A CB  
1506 C CG  . GLU A 205 ? 1.6732 1.2761 1.9840 -0.0941 0.3766  -0.2491 205 GLU A CG  
1507 C CD  . GLU A 205 ? 1.9800 1.6136 2.2630 -0.1027 0.3652  -0.2930 205 GLU A CD  
1508 O OE1 . GLU A 205 ? 2.1642 1.8471 2.4075 -0.1061 0.3367  -0.2910 205 GLU A OE1 
1509 O OE2 . GLU A 205 ? 1.8766 1.4840 2.1763 -0.1059 0.3858  -0.3293 205 GLU A OE2 
1510 N N   . GLY A 206 ? 1.2761 0.9190 1.5918 -0.1160 0.3460  -0.1677 206 GLY A N   
1511 C CA  . GLY A 206 ? 1.1597 0.8388 1.4675 -0.1265 0.3268  -0.1600 206 GLY A CA  
1512 C C   . GLY A 206 ? 1.1849 0.8513 1.4943 -0.1160 0.3375  -0.1147 206 GLY A C   
1513 O O   . GLY A 206 ? 1.1540 0.8438 1.4646 -0.1255 0.3293  -0.1088 206 GLY A O   
1514 N N   . TYR A 207 ? 1.1873 0.8190 1.4959 -0.0950 0.3558  -0.0826 207 TYR A N   
1515 C CA  . TYR A 207 ? 1.2236 0.8418 1.5278 -0.0829 0.3671  -0.0371 207 TYR A CA  
1516 C C   . TYR A 207 ? 1.3038 0.8650 1.6463 -0.0887 0.4037  -0.0276 207 TYR A C   
1517 O O   . TYR A 207 ? 1.3091 0.8362 1.6809 -0.0957 0.4205  -0.0530 207 TYR A O   
1518 C CB  . TYR A 207 ? 1.1806 0.8072 1.4527 -0.0524 0.3575  -0.0012 207 TYR A CB  
1519 C CG  . TYR A 207 ? 1.1881 0.8677 1.4227 -0.0478 0.3248  0.0003  207 TYR A CG  
1520 C CD1 . TYR A 207 ? 1.0817 0.7903 1.3052 -0.0555 0.3045  -0.0318 207 TYR A CD1 
1521 C CD2 . TYR A 207 ? 1.2168 0.9157 1.4257 -0.0360 0.3152  0.0336  207 TYR A CD2 
1522 C CE1 . TYR A 207 ? 1.0355 0.7861 1.2270 -0.0518 0.2770  -0.0279 207 TYR A CE1 
1523 C CE2 . TYR A 207 ? 1.0652 0.8074 1.2439 -0.0332 0.2871  0.0327  207 TYR A CE2 
1524 C CZ  . TYR A 207 ? 1.0121 0.7776 1.1841 -0.0411 0.2687  0.0032  207 TYR A CZ  
1525 O OH  . TYR A 207 ? 0.9015 0.7040 1.0457 -0.0387 0.2431  0.0047  207 TYR A OH  
1526 N N   . LEU A 208 ? 1.1168 0.6664 1.4585 -0.0866 0.4177  0.0083  208 LEU A N   
1527 C CA  . LEU A 208 ? 1.2161 0.7070 1.5902 -0.0899 0.4552  0.0275  208 LEU A CA  
1528 C C   . LEU A 208 ? 1.2369 0.7074 1.5860 -0.0593 0.4645  0.0852  208 LEU A C   
1529 O O   . LEU A 208 ? 1.3386 0.8471 1.6474 -0.0445 0.4441  0.1100  208 LEU A O   
1530 C CB  . LEU A 208 ? 1.3728 0.8639 1.7742 -0.1196 0.4708  0.0185  208 LEU A CB  
1531 C CG  . LEU A 208 ? 1.3990 0.9203 1.8291 -0.1516 0.4592  -0.0366 208 LEU A CG  
1532 C CD1 . LEU A 208 ? 1.1489 0.6584 1.6206 -0.1798 0.4851  -0.0405 208 LEU A CD1 
1533 C CD2 . LEU A 208 ? 1.4728 0.9759 1.9245 -0.1589 0.4590  -0.0794 208 LEU A CD2 
1534 N N   . LEU A 209 ? 1.4579 0.8683 1.8318 -0.0495 0.4947  0.1059  209 LEU A N   
1535 C CA  . LEU A 209 ? 1.5345 0.9223 1.8870 -0.0181 0.5044  0.1640  209 LEU A CA  
1536 C C   . LEU A 209 ? 1.4379 0.8404 1.7657 -0.0221 0.5096  0.1977  209 LEU A C   
1537 O O   . LEU A 209 ? 1.5329 0.9367 1.8801 -0.0478 0.5221  0.1810  209 LEU A O   
1538 C CB  . LEU A 209 ? 1.5124 0.8521 1.8955 -0.0047 0.5273  0.1715  209 LEU A CB  
1539 C CG  . LEU A 209 ? 1.5999 0.9227 1.9646 0.0315  0.5331  0.2286  209 LEU A CG  
1540 C CD1 . LEU A 209 ? 1.4863 0.8395 1.8130 0.0602  0.5086  0.2567  209 LEU A CD1 
1541 C CD2 . LEU A 209 ? 1.8010 1.0800 2.2026 0.0445  0.5523  0.2255  209 LEU A CD2 
1542 N N   . SER A 210 ? 1.4905 0.9103 1.7748 0.0040  0.4985  0.2422  210 SER A N   
1543 C CA  . SER A 210 ? 1.5128 0.9514 1.7643 0.0042  0.5019  0.2743  210 SER A CA  
1544 C C   . SER A 210 ? 1.5436 0.9851 1.7542 0.0410  0.4945  0.3273  210 SER A C   
1545 O O   . SER A 210 ? 1.6447 1.0999 1.8414 0.0638  0.4752  0.3364  210 SER A O   
1546 C CB  . SER A 210 ? 1.3941 0.8889 1.6231 -0.0128 0.4806  0.2522  210 SER A CB  
1547 O OG  . SER A 210 ? 1.5457 1.0542 1.7418 -0.0124 0.4893  0.2840  210 SER A OG  
1548 N N   . PRO A 211 ? 1.5204 0.9533 1.7123 0.0470  0.5083  0.3612  211 PRO A N   
1549 C CA  . PRO A 211 ? 1.5310 0.9736 1.6791 0.0809  0.4986  0.4118  211 PRO A CA  
1550 C C   . PRO A 211 ? 1.6367 1.1325 1.7303 0.0846  0.4766  0.4238  211 PRO A C   
1551 O O   . PRO A 211 ? 1.6139 1.1298 1.6653 0.1115  0.4624  0.4609  211 PRO A O   
1552 C CB  . PRO A 211 ? 1.5329 0.9434 1.6833 0.0797  0.5247  0.4380  211 PRO A CB  
1553 C CG  . PRO A 211 ? 1.4333 0.8426 1.6075 0.0419  0.5420  0.4048  211 PRO A CG  
1554 C CD  . PRO A 211 ? 1.4193 0.8324 1.6328 0.0224  0.5344  0.3536  211 PRO A CD  
1555 N N   . MET A 212 ? 1.6170 1.1381 1.7128 0.0578  0.4731  0.3903  212 MET A N   
1556 C CA  . MET A 212 ? 1.5306 1.1032 1.5782 0.0575  0.4552  0.3941  212 MET A CA  
1557 C C   . MET A 212 ? 1.5985 1.2202 1.6453 0.0557  0.4164  0.3523  212 MET A C   
1558 O O   . MET A 212 ? 1.7200 1.3439 1.8019 0.0349  0.4126  0.3092  212 MET A O   
1559 C CB  . MET A 212 ? 1.5443 1.1253 1.5925 0.0300  0.4739  0.3807  212 MET A CB  
1560 C CG  . MET A 212 ? 1.6206 1.1761 1.6625 0.0317  0.4976  0.4092  212 MET A CG  
1561 S SD  . MET A 212 ? 1.8356 1.4040 1.8895 -0.0023 0.5209  0.3879  212 MET A SD  
1562 C CE  . MET A 212 ? 1.3152 0.8600 1.4475 -0.0322 0.5313  0.3375  212 MET A CE  
1563 N N   . PHE A 213 ? 1.5995 1.2616 1.6059 0.0770  0.3877  0.3659  213 PHE A N   
1564 C CA  . PHE A 213 ? 1.4375 1.1482 1.4373 0.0734  0.3526  0.3306  213 PHE A CA  
1565 C C   . PHE A 213 ? 1.3845 1.1285 1.3609 0.0555  0.3477  0.3124  213 PHE A C   
1566 O O   . PHE A 213 ? 1.4993 1.2349 1.5010 0.0318  0.3623  0.2877  213 PHE A O   
1567 C CB  . PHE A 213 ? 1.3704 1.1121 1.3434 0.1013  0.3247  0.3500  213 PHE A CB  
1568 C CG  . PHE A 213 ? 1.2632 1.0408 1.2461 0.0981  0.2943  0.3148  213 PHE A CG  
1569 C CD1 . PHE A 213 ? 1.3475 1.1136 1.3674 0.0800  0.2960  0.2772  213 PHE A CD1 
1570 C CD2 . PHE A 213 ? 1.1252 0.9492 1.0799 0.1122  0.2644  0.3195  213 PHE A CD2 
1571 C CE1 . PHE A 213 ? 1.1806 0.9778 1.2055 0.0770  0.2705  0.2489  213 PHE A CE1 
1572 C CE2 . PHE A 213 ? 0.9783 0.8326 0.9443 0.1072  0.2398  0.2891  213 PHE A CE2 
1573 C CZ  . PHE A 213 ? 0.8961 0.7356 0.8955 0.0901  0.2439  0.2558  213 PHE A CZ  
1574 N N   . TYR A 214 ? 1.3207 1.1045 1.2515 0.0673  0.3272  0.3227  214 TYR A N   
1575 C CA  . TYR A 214 ? 1.2636 1.0764 1.1673 0.0545  0.3265  0.3098  214 TYR A CA  
1576 C C   . TYR A 214 ? 1.3607 1.2035 1.2064 0.0730  0.3147  0.3371  214 TYR A C   
1577 O O   . TYR A 214 ? 1.3387 1.1941 1.1690 0.0942  0.2949  0.3556  214 TYR A O   
1578 C CB  . TYR A 214 ? 1.1666 1.0085 1.0859 0.0393  0.3033  0.2636  214 TYR A CB  
1579 C CG  . TYR A 214 ? 1.2594 1.1341 1.1633 0.0511  0.2681  0.2546  214 TYR A CG  
1580 C CD1 . TYR A 214 ? 1.2866 1.1995 1.1504 0.0558  0.2494  0.2522  214 TYR A CD1 
1581 C CD2 . TYR A 214 ? 1.2741 1.1428 1.2054 0.0558  0.2553  0.2458  214 TYR A CD2 
1582 C CE1 . TYR A 214 ? 1.2221 1.1654 1.0772 0.0634  0.2185  0.2421  214 TYR A CE1 
1583 C CE2 . TYR A 214 ? 1.4055 1.3061 1.3272 0.0642  0.2260  0.2377  214 TYR A CE2 
1584 C CZ  . TYR A 214 ? 1.3203 1.2579 1.2059 0.0671  0.2074  0.2361  214 TYR A CZ  
1585 O OH  . TYR A 214 ? 1.1533 1.1229 1.0347 0.0725  0.1794  0.2263  214 TYR A OH  
1586 N N   . THR A 215 ? 1.5296 1.3873 1.3440 0.0650  0.3268  0.3380  215 THR A N   
1587 C CA  . THR A 215 ? 1.5642 1.4535 1.3172 0.0804  0.3167  0.3600  215 THR A CA  
1588 C C   . THR A 215 ? 1.5427 1.4703 1.2730 0.0676  0.3070  0.3262  215 THR A C   
1589 O O   . THR A 215 ? 1.5938 1.5163 1.3490 0.0480  0.3230  0.3005  215 THR A O   
1590 C CB  . THR A 215 ? 1.4654 1.3302 1.1874 0.0890  0.3488  0.4074  215 THR A CB  
1591 O OG1 . THR A 215 ? 1.7026 1.5435 1.4481 0.0664  0.3846  0.3988  215 THR A OG1 
1592 C CG2 . THR A 215 ? 1.2471 1.0743 0.9853 0.1083  0.3549  0.4464  215 THR A CG2 
1593 N N   . LEU A 216 ? 1.4547 1.4220 1.1409 0.0791  0.2804  0.3246  216 LEU A N   
1594 C CA  . LEU A 216 ? 1.4064 1.4085 1.0715 0.0685  0.2693  0.2892  216 LEU A CA  
1595 C C   . LEU A 216 ? 1.5344 1.5614 1.1329 0.0763  0.2768  0.3061  216 LEU A C   
1596 O O   . LEU A 216 ? 1.6110 1.6452 1.1698 0.0952  0.2716  0.3430  216 LEU A O   
1597 C CB  . LEU A 216 ? 1.3004 1.3305 0.9742 0.0699  0.2303  0.2608  216 LEU A CB  
1598 C CG  . LEU A 216 ? 1.3387 1.3503 1.0707 0.0615  0.2208  0.2403  216 LEU A CG  
1599 C CD1 . LEU A 216 ? 1.2622 1.3024 0.9969 0.0641  0.1850  0.2203  216 LEU A CD1 
1600 C CD2 . LEU A 216 ? 1.3652 1.3632 1.1310 0.0416  0.2358  0.2101  216 LEU A CD2 
1601 N N   . ASN A 217 ? 1.5029 1.5448 1.0888 0.0629  0.2892  0.2788  217 ASN A N   
1602 C CA  . ASN A 217 ? 1.6218 1.6935 1.1404 0.0683  0.2949  0.2848  217 ASN A CA  
1603 C C   . ASN A 217 ? 1.6589 1.7706 1.1393 0.0804  0.2551  0.2764  217 ASN A C   
1604 O O   . ASN A 217 ? 1.5876 1.7067 1.1007 0.0784  0.2258  0.2528  217 ASN A O   
1605 C CB  . ASN A 217 ? 1.7566 1.8392 1.2784 0.0516  0.3141  0.2478  217 ASN A CB  
1606 C CG  . ASN A 217 ? 2.0083 2.0599 1.5730 0.0379  0.3534  0.2532  217 ASN A CG  
1607 O OD1 . ASN A 217 ? 2.1314 2.1816 1.7432 0.0234  0.3585  0.2179  217 ASN A OD1 
1608 N ND2 . ASN A 217 ? 1.9842 2.0114 1.5352 0.0424  0.3812  0.2980  217 ASN A ND2 
1609 N N   . GLN A 218 ? 1.7654 1.9051 1.1765 0.0920  0.2543  0.2954  218 GLN A N   
1610 C CA  . GLN A 218 ? 1.9253 2.1095 1.2985 0.1027  0.2151  0.2866  218 GLN A CA  
1611 C C   . GLN A 218 ? 1.9649 2.1764 1.3388 0.0876  0.1987  0.2289  218 GLN A C   
1612 O O   . GLN A 218 ? 1.8202 2.0562 1.2036 0.0875  0.1635  0.2059  218 GLN A O   
1613 C CB  . GLN A 218 ? 2.1053 2.3148 1.3988 0.1203  0.2178  0.3245  218 GLN A CB  
1614 C CG  . GLN A 218 ? 2.2371 2.5015 1.4876 0.1314  0.1751  0.3142  218 GLN A CG  
1615 C CD  . GLN A 218 ? 2.2628 2.5338 1.5538 0.1435  0.1410  0.3256  218 GLN A CD  
1616 O OE1 . GLN A 218 ? 2.2637 2.4964 1.6037 0.1486  0.1510  0.3504  218 GLN A OE1 
1617 N NE2 . GLN A 218 ? 2.2767 2.5986 1.5497 0.1472  0.1013  0.3047  218 GLN A NE2 
1618 N N   . ASP A 219 ? 2.1705 2.3763 1.5394 0.0747  0.2262  0.2053  219 ASP A N   
1619 C CA  . ASP A 219 ? 2.2841 2.5125 1.6486 0.0626  0.2166  0.1514  219 ASP A CA  
1620 C C   . ASP A 219 ? 2.2118 2.4243 1.6452 0.0505  0.1996  0.1150  219 ASP A C   
1621 O O   . ASP A 219 ? 2.2970 2.5229 1.7341 0.0414  0.1884  0.0709  219 ASP A O   
1622 C CB  . ASP A 219 ? 2.3243 2.5503 1.6698 0.0546  0.2552  0.1384  219 ASP A CB  
1623 C CG  . ASP A 219 ? 2.2698 2.4599 1.6840 0.0428  0.2812  0.1307  219 ASP A CG  
1624 O OD1 . ASP A 219 ? 2.3265 2.4871 1.7760 0.0444  0.2892  0.1624  219 ASP A OD1 
1625 O OD2 . ASP A 219 ? 2.1507 2.3436 1.5860 0.0326  0.2926  0.0913  219 ASP A OD2 
1626 N N   . ILE A 220 ? 2.0358 2.2183 1.5221 0.0506  0.1989  0.1334  220 ILE A N   
1627 C CA  . ILE A 220 ? 1.8179 1.9810 1.3677 0.0389  0.1900  0.1039  220 ILE A CA  
1628 C C   . ILE A 220 ? 1.7530 1.9330 1.3137 0.0373  0.1522  0.0826  220 ILE A C   
1629 O O   . ILE A 220 ? 1.7832 1.9827 1.3260 0.0468  0.1309  0.1010  220 ILE A O   
1630 C CB  . ILE A 220 ? 1.7656 1.8924 1.3657 0.0380  0.2036  0.1278  220 ILE A CB  
1631 C CG1 . ILE A 220 ? 1.6985 1.8069 1.3572 0.0252  0.2017  0.0964  220 ILE A CG1 
1632 C CG2 . ILE A 220 ? 1.7837 1.9081 1.3883 0.0496  0.1848  0.1577  220 ILE A CG2 
1633 C CD1 . ILE A 220 ? 1.6002 1.6773 1.3067 0.0224  0.2123  0.1131  220 ILE A CD1 
1634 N N   . ARG A 221 ? 1.7288 1.9021 1.3219 0.0253  0.1451  0.0439  221 ARG A N   
1635 C CA  . ARG A 221 ? 1.5625 1.7460 1.1734 0.0195  0.1141  0.0202  221 ARG A CA  
1636 C C   . ARG A 221 ? 1.4656 1.6300 1.1234 0.0192  0.1035  0.0357  221 ARG A C   
1637 O O   . ARG A 221 ? 1.2797 1.4150 0.9769 0.0147  0.1158  0.0359  221 ARG A O   
1638 C CB  . ARG A 221 ? 1.6407 1.8165 1.2693 0.0079  0.1150  -0.0235 221 ARG A CB  
1639 C CG  . ARG A 221 ? 1.7945 1.9492 1.4402 0.0069  0.1458  -0.0257 221 ARG A CG  
1640 C CD  . ARG A 221 ? 1.9804 2.1341 1.6327 0.0009  0.1523  -0.0671 221 ARG A CD  
1641 N NE  . ARG A 221 ? 2.0953 2.2778 1.6951 0.0013  0.1471  -0.0856 221 ARG A NE  
1642 C CZ  . ARG A 221 ? 2.1295 2.3174 1.7192 -0.0023 0.1556  -0.1237 221 ARG A CZ  
1643 N NH1 . ARG A 221 ? 2.2061 2.3726 1.8373 -0.0041 0.1716  -0.1439 221 ARG A NH1 
1644 N NH2 . ARG A 221 ? 2.0931 2.3105 1.6296 -0.0026 0.1488  -0.1418 221 ARG A NH2 
1645 N N   . LYS A 222 ? 1.6129 1.7981 1.2665 0.0239  0.0801  0.0466  222 LYS A N   
1646 C CA  . LYS A 222 ? 1.5684 1.7412 1.2628 0.0248  0.0707  0.0606  222 LYS A CA  
1647 C C   . LYS A 222 ? 1.5994 1.7749 1.3234 0.0115  0.0505  0.0310  222 LYS A C   
1648 O O   . LYS A 222 ? 1.6931 1.8775 1.4072 0.0020  0.0431  -0.0001 222 LYS A O   
1649 C CB  . LYS A 222 ? 1.4390 1.6340 1.1181 0.0403  0.0602  0.0935  222 LYS A CB  
1650 C CG  . LYS A 222 ? 1.5215 1.7094 1.1689 0.0546  0.0814  0.1283  222 LYS A CG  
1651 C CD  . LYS A 222 ? 1.6043 1.8037 1.2509 0.0729  0.0721  0.1652  222 LYS A CD  
1652 C CE  . LYS A 222 ? 1.6521 1.8446 1.2610 0.0889  0.0917  0.2042  222 LYS A CE  
1653 N NZ  . LYS A 222 ? 1.5157 1.7153 1.1294 0.1103  0.0826  0.2427  222 LYS A NZ  
1654 N N   . ALA A 223 ? 1.5320 1.6974 1.2924 0.0104  0.0438  0.0406  223 ALA A N   
1655 C CA  . ALA A 223 ? 1.3890 1.5544 1.1791 -0.0028 0.0276  0.0187  223 ALA A CA  
1656 C C   . ALA A 223 ? 1.5129 1.6800 1.3330 0.0001  0.0211  0.0368  223 ALA A C   
1657 O O   . ALA A 223 ? 1.6535 1.8009 1.4860 0.0078  0.0348  0.0577  223 ALA A O   
1658 C CB  . ALA A 223 ? 1.2818 1.4141 1.0927 -0.0135 0.0371  -0.0020 223 ALA A CB  
1659 N N   . SER A 224 ? 1.4427 1.6345 1.2767 -0.0071 0.0017  0.0263  224 SER A N   
1660 C CA  . SER A 224 ? 1.1298 1.3271 0.9966 -0.0064 -0.0031 0.0387  224 SER A CA  
1661 C C   . SER A 224 ? 1.1420 1.3171 1.0378 -0.0239 -0.0032 0.0209  224 SER A C   
1662 O O   . SER A 224 ? 1.1895 1.3715 1.0899 -0.0384 -0.0143 -0.0021 224 SER A O   
1663 C CB  . SER A 224 ? 1.0295 1.2761 0.8978 -0.0020 -0.0236 0.0423  224 SER A CB  
1664 O OG  . SER A 224 ? 1.3519 1.6073 1.2580 -0.0036 -0.0269 0.0490  224 SER A OG  
1665 N N   . ILE A 225 ? 1.0060 1.1534 0.9201 -0.0227 0.0094  0.0317  225 ILE A N   
1666 C CA  . ILE A 225 ? 1.0644 1.1867 0.9986 -0.0369 0.0111  0.0197  225 ILE A CA  
1667 C C   . ILE A 225 ? 1.0226 1.1606 0.9828 -0.0448 0.0047  0.0218  225 ILE A C   
1668 O O   . ILE A 225 ? 1.1753 1.3041 1.1490 -0.0604 0.0009  0.0093  225 ILE A O   
1669 C CB  . ILE A 225 ? 1.1830 1.2711 1.1207 -0.0330 0.0267  0.0274  225 ILE A CB  
1670 C CG1 . ILE A 225 ? 1.1338 1.2113 1.0519 -0.0259 0.0360  0.0261  225 ILE A CG1 
1671 C CG2 . ILE A 225 ? 1.2731 1.3368 1.2250 -0.0453 0.0260  0.0171  225 ILE A CG2 
1672 C CD1 . ILE A 225 ? 0.9193 0.9900 0.8294 -0.0334 0.0321  0.0038  225 ILE A CD1 
1673 N N   . GLY A 226 ? 0.9937 1.1546 0.9631 -0.0337 0.0054  0.0386  226 GLY A N   
1674 C CA  . GLY A 226 ? 0.9073 1.0910 0.9052 -0.0400 0.0011  0.0399  226 GLY A CA  
1675 C C   . GLY A 226 ? 1.0759 1.2603 1.0896 -0.0279 0.0131  0.0576  226 GLY A C   
1676 O O   . GLY A 226 ? 1.1203 1.2763 1.1255 -0.0191 0.0267  0.0663  226 GLY A O   
1677 N N   . ILE A 227 ? 0.9988 1.2175 1.0394 -0.0281 0.0088  0.0605  227 ILE A N   
1678 C CA  . ILE A 227 ? 0.8628 1.0864 0.9240 -0.0160 0.0213  0.0740  227 ILE A CA  
1679 C C   . ILE A 227 ? 0.8458 1.0636 0.9262 -0.0319 0.0308  0.0672  227 ILE A C   
1680 O O   . ILE A 227 ? 1.1185 1.3505 1.2109 -0.0501 0.0236  0.0564  227 ILE A O   
1681 C CB  . ILE A 227 ? 0.9788 1.2510 1.0610 0.0000  0.0117  0.0847  227 ILE A CB  
1682 C CG1 . ILE A 227 ? 0.9824 1.2652 1.0385 0.0145  -0.0006 0.0933  227 ILE A CG1 
1683 C CG2 . ILE A 227 ? 0.9518 1.2239 1.0569 0.0170  0.0275  0.0986  227 ILE A CG2 
1684 C CD1 . ILE A 227 ? 1.0177 1.3588 1.0857 0.0185  -0.0231 0.0925  227 ILE A CD1 
1685 N N   . VAL A 228 ? 0.8399 1.0356 0.9216 -0.0262 0.0482  0.0728  228 VAL A N   
1686 C CA  . VAL A 228 ? 0.8515 1.0475 0.9479 -0.0382 0.0599  0.0690  228 VAL A CA  
1687 C C   . VAL A 228 ? 0.8982 1.1120 1.0181 -0.0222 0.0735  0.0763  228 VAL A C   
1688 O O   . VAL A 228 ? 0.9657 1.1697 1.0828 -0.0029 0.0783  0.0844  228 VAL A O   
1689 C CB  . VAL A 228 ? 0.7597 0.9125 0.8315 -0.0485 0.0685  0.0647  228 VAL A CB  
1690 C CG1 . VAL A 228 ? 0.7970 0.9318 0.8520 -0.0620 0.0560  0.0576  228 VAL A CG1 
1691 C CG2 . VAL A 228 ? 1.1151 1.2412 1.1723 -0.0342 0.0779  0.0677  228 VAL A CG2 
1692 N N   . CYS A 229 ? 0.8096 1.0486 0.9550 -0.0302 0.0817  0.0736  229 CYS A N   
1693 C CA  . CYS A 229 ? 0.8839 1.1468 1.0590 -0.0136 0.0952  0.0782  229 CYS A CA  
1694 C C   . CYS A 229 ? 1.0811 1.3367 1.2596 -0.0220 0.1178  0.0721  229 CYS A C   
1695 O O   . CYS A 229 ? 1.3225 1.5816 1.4990 -0.0434 0.1212  0.0676  229 CYS A O   
1696 C CB  . CYS A 229 ? 0.9108 1.2313 1.1259 -0.0092 0.0835  0.0807  229 CYS A CB  
1697 S SG  . CYS A 229 ? 0.9621 1.3021 1.1697 0.0038  0.0556  0.0882  229 CYS A SG  
1698 N N   . GLY A 230 ? 0.9058 1.1491 1.0877 -0.0052 0.1346  0.0721  230 GLY A N   
1699 C CA  . GLY A 230 ? 0.8693 1.1185 1.0613 -0.0079 0.1582  0.0645  230 GLY A CA  
1700 C C   . GLY A 230 ? 0.9904 1.2876 1.2329 0.0080  0.1637  0.0677  230 GLY A C   
1701 O O   . GLY A 230 ? 1.0386 1.3621 1.3026 0.0198  0.1461  0.0768  230 GLY A O   
1702 N N   . GLY A 231 ? 0.9014 1.2137 1.1632 0.0094  0.1876  0.0600  231 GLY A N   
1703 C CA  . GLY A 231 ? 0.8716 1.2336 1.1885 0.0262  0.1950  0.0617  231 GLY A CA  
1704 C C   . GLY A 231 ? 1.0839 1.4422 1.4213 0.0594  0.1918  0.0705  231 GLY A C   
1705 O O   . GLY A 231 ? 1.0569 1.4599 1.4391 0.0773  0.1838  0.0792  231 GLY A O   
1706 N N   . HIS A 232 ? 1.1186 1.4242 1.4251 0.0678  0.1976  0.0695  232 HIS A N   
1707 C CA  . HIS A 232 ? 1.0913 1.3825 1.4168 0.0988  0.2009  0.0790  232 HIS A CA  
1708 C C   . HIS A 232 ? 1.0101 1.2597 1.3014 0.1022  0.1858  0.0905  232 HIS A C   
1709 O O   . HIS A 232 ? 1.0405 1.2751 1.3441 0.1269  0.1867  0.1041  232 HIS A O   
1710 C CB  . HIS A 232 ? 1.2396 1.5058 1.5738 0.1090  0.2320  0.0636  232 HIS A CB  
1711 C CG  . HIS A 232 ? 1.2889 1.5986 1.6623 0.1113  0.2516  0.0528  232 HIS A CG  
1712 N ND1 . HIS A 232 ? 1.2655 1.6003 1.6928 0.1411  0.2638  0.0559  232 HIS A ND1 
1713 C CD2 . HIS A 232 ? 1.2906 1.6242 1.6587 0.0883  0.2629  0.0400  232 HIS A CD2 
1714 C CE1 . HIS A 232 ? 1.3000 1.6754 1.7559 0.1356  0.2825  0.0429  232 HIS A CE1 
1715 N NE2 . HIS A 232 ? 1.3062 1.6811 1.7252 0.1027  0.2831  0.0338  232 HIS A NE2 
1716 N N   . HIS A 233 ? 0.8629 1.0935 1.1133 0.0781  0.1736  0.0864  233 HIS A N   
1717 C CA  . HIS A 233 ? 0.8017 0.9987 1.0214 0.0792  0.1603  0.0958  233 HIS A CA  
1718 C C   . HIS A 233 ? 0.8288 1.0440 1.0295 0.0629  0.1355  0.0997  233 HIS A C   
1719 O O   . HIS A 233 ? 0.9441 1.1710 1.1375 0.0408  0.1321  0.0895  233 HIS A O   
1720 C CB  . HIS A 233 ? 0.8810 1.0265 1.0693 0.0682  0.1730  0.0825  233 HIS A CB  
1721 C CG  . HIS A 233 ? 0.9361 1.0641 1.1391 0.0766  0.1990  0.0690  233 HIS A CG  
1722 N ND1 . HIS A 233 ? 1.0703 1.2085 1.2715 0.0642  0.2132  0.0510  233 HIS A ND1 
1723 C CD2 . HIS A 233 ? 0.8172 0.9164 1.0363 0.0958  0.2150  0.0697  233 HIS A CD2 
1724 C CE1 . HIS A 233 ? 0.9797 1.0989 1.1940 0.0753  0.2363  0.0380  233 HIS A CE1 
1725 N NE2 . HIS A 233 ? 1.0386 1.1320 1.2665 0.0944  0.2379  0.0484  233 HIS A NE2 
1726 N N   . LYS A 234 ? 0.8414 1.0571 1.0333 0.0739  0.1198  0.1145  234 LYS A N   
1727 C CA  . LYS A 234 ? 0.8089 1.0387 0.9800 0.0597  0.0972  0.1148  234 LYS A CA  
1728 C C   . LYS A 234 ? 0.9675 1.1567 1.1020 0.0589  0.0947  0.1189  234 LYS A C   
1729 O O   . LYS A 234 ? 1.1755 1.3512 1.3074 0.0781  0.0978  0.1343  234 LYS A O   
1730 C CB  . LYS A 234 ? 0.6934 0.9757 0.8869 0.0724  0.0780  0.1262  234 LYS A CB  
1731 C CG  . LYS A 234 ? 0.7359 1.0622 0.9775 0.0817  0.0837  0.1258  234 LYS A CG  
1732 C CD  . LYS A 234 ? 0.9942 1.3831 1.2604 0.0861  0.0595  0.1308  234 LYS A CD  
1733 C CE  . LYS A 234 ? 1.0769 1.4759 1.3374 0.1147  0.0451  0.1534  234 LYS A CE  
1734 N NZ  . LYS A 234 ? 0.9868 1.4565 1.2757 0.1222  0.0196  0.1575  234 LYS A NZ  
1735 N N   . ILE A 235 ? 1.0018 1.1714 1.1105 0.0375  0.0905  0.1063  235 ILE A N   
1736 C CA  . ILE A 235 ? 0.8854 1.0187 0.9648 0.0351  0.0911  0.1068  235 ILE A CA  
1737 C C   . ILE A 235 ? 0.8998 1.0437 0.9583 0.0262  0.0725  0.1049  235 ILE A C   
1738 O O   . ILE A 235 ? 1.1037 1.2514 1.1568 0.0079  0.0643  0.0920  235 ILE A O   
1739 C CB  . ILE A 235 ? 0.9510 1.0497 1.0180 0.0207  0.1024  0.0922  235 ILE A CB  
1740 C CG1 . ILE A 235 ? 1.0492 1.1402 1.1340 0.0267  0.1212  0.0878  235 ILE A CG1 
1741 C CG2 . ILE A 235 ? 0.9355 1.0016 0.9825 0.0203  0.1052  0.0923  235 ILE A CG2 
1742 C CD1 . ILE A 235 ? 1.1996 1.2996 1.2847 0.0112  0.1247  0.0750  235 ILE A CD1 
1743 N N   . GLN A 236 ? 0.8920 1.0384 0.9376 0.0395  0.0677  0.1182  236 GLN A N   
1744 C CA  . GLN A 236 ? 0.9775 1.1362 0.9995 0.0335  0.0518  0.1150  236 GLN A CA  
1745 C C   . GLN A 236 ? 1.0856 1.2082 1.0820 0.0286  0.0598  0.1115  236 GLN A C   
1746 O O   . GLN A 236 ? 1.0784 1.1751 1.0728 0.0379  0.0750  0.1220  236 GLN A O   
1747 C CB  . GLN A 236 ? 0.9031 1.0959 0.9224 0.0520  0.0401  0.1323  236 GLN A CB  
1748 C CG  . GLN A 236 ? 0.9939 1.1911 0.9781 0.0519  0.0302  0.1334  236 GLN A CG  
1749 C CD  . GLN A 236 ? 1.1616 1.3903 1.1363 0.0739  0.0199  0.1558  236 GLN A CD  
1750 O OE1 . GLN A 236 ? 1.4245 1.6363 1.3972 0.0933  0.0323  0.1799  236 GLN A OE1 
1751 N NE2 . GLN A 236 ? 0.9742 1.2491 0.9438 0.0710  -0.0032 0.1483  236 GLN A NE2 
1752 N N   . MET A 237 ? 1.1205 1.2413 1.1019 0.0136  0.0508  0.0958  237 MET A N   
1753 C CA  . MET A 237 ? 1.0614 1.1542 1.0238 0.0093  0.0581  0.0903  237 MET A CA  
1754 C C   . MET A 237 ? 1.1280 1.2351 1.0645 0.0124  0.0505  0.0906  237 MET A C   
1755 O O   . MET A 237 ? 1.1170 1.2465 1.0476 0.0049  0.0351  0.0783  237 MET A O   
1756 C CB  . MET A 237 ? 0.9635 1.0381 0.9295 -0.0074 0.0566  0.0717  237 MET A CB  
1757 C CG  . MET A 237 ? 0.9669 1.0126 0.9266 -0.0097 0.0673  0.0666  237 MET A CG  
1758 S SD  . MET A 237 ? 1.2254 1.2566 1.1849 -0.0244 0.0595  0.0467  237 MET A SD  
1759 C CE  . MET A 237 ? 0.7741 0.7988 0.7479 -0.0315 0.0592  0.0465  237 MET A CE  
1760 N N   . LEU A 238 ? 1.1166 1.2103 1.0375 0.0220  0.0631  0.1035  238 LEU A N   
1761 C CA  . LEU A 238 ? 1.0160 1.1219 0.9058 0.0254  0.0604  0.1048  238 LEU A CA  
1762 C C   . LEU A 238 ? 1.0722 1.1509 0.9534 0.0198  0.0768  0.0980  238 LEU A C   
1763 O O   . LEU A 238 ? 1.2344 1.2867 1.1321 0.0190  0.0922  0.1023  238 LEU A O   
1764 C CB  . LEU A 238 ? 1.2416 1.3637 1.1163 0.0447  0.0613  0.1326  238 LEU A CB  
1765 C CG  . LEU A 238 ? 1.3713 1.5242 1.2627 0.0553  0.0465  0.1435  238 LEU A CG  
1766 C CD1 . LEU A 238 ? 1.3476 1.5121 1.2239 0.0786  0.0483  0.1757  238 LEU A CD1 
1767 C CD2 . LEU A 238 ? 1.4986 1.6892 1.3890 0.0446  0.0227  0.1229  238 LEU A CD2 
1768 N N   . ALA A 239 ? 1.1259 1.2136 0.9841 0.0154  0.0739  0.0850  239 ALA A N   
1769 C CA  . ALA A 239 ? 1.0107 1.0786 0.8662 0.0101  0.0899  0.0754  239 ALA A CA  
1770 C C   . ALA A 239 ? 0.9951 1.0765 0.8148 0.0142  0.0965  0.0761  239 ALA A C   
1771 O O   . ALA A 239 ? 1.0520 1.1606 0.8457 0.0176  0.0828  0.0743  239 ALA A O   
1772 C CB  . ALA A 239 ? 0.8765 0.9343 0.7507 -0.0026 0.0827  0.0491  239 ALA A CB  
1773 N N   . ALA A 240 ? 0.9196 0.9850 0.7387 0.0130  0.1181  0.0773  240 ALA A N   
1774 C CA  . ALA A 240 ? 1.0753 1.1519 0.8606 0.0153  0.1303  0.0761  240 ALA A CA  
1775 C C   . ALA A 240 ? 1.1259 1.1867 0.9303 0.0075  0.1502  0.0612  240 ALA A C   
1776 O O   . ALA A 240 ? 1.1089 1.1496 0.9471 0.0036  0.1596  0.0645  240 ALA A O   
1777 C CB  . ALA A 240 ? 1.0660 1.1465 0.8227 0.0278  0.1423  0.1103  240 ALA A CB  
1778 N N   . SER A 241 ? 1.1328 1.2058 0.9179 0.0055  0.1563  0.0426  241 SER A N   
1779 C CA  . SER A 241 ? 1.2577 1.3220 1.0664 -0.0003 0.1751  0.0260  241 SER A CA  
1780 C C   . SER A 241 ? 1.2445 1.3256 1.0226 0.0007  0.1905  0.0126  241 SER A C   
1781 O O   . SER A 241 ? 1.2794 1.3774 1.0265 0.0022  0.1780  -0.0028 241 SER A O   
1782 C CB  . SER A 241 ? 1.2242 1.2789 1.0712 -0.0062 0.1597  0.0009  241 SER A CB  
1783 O OG  . SER A 241 ? 1.2188 1.2700 1.0939 -0.0092 0.1753  -0.0148 241 SER A OG  
1784 N N   . GLN A 242 ? 1.2800 1.3579 1.0686 -0.0014 0.2189  0.0162  242 GLN A N   
1785 C CA  . GLN A 242 ? 1.3500 1.4441 1.1174 -0.0014 0.2391  -0.0004 242 GLN A CA  
1786 C C   . GLN A 242 ? 1.2866 1.3831 1.0803 -0.0035 0.2296  -0.0395 242 GLN A C   
1787 O O   . GLN A 242 ? 1.4504 1.5615 1.2241 -0.0021 0.2393  -0.0622 242 GLN A O   
1788 C CB  . GLN A 242 ? 1.3906 1.4812 1.1742 -0.0052 0.2745  0.0129  242 GLN A CB  
1789 C CG  . GLN A 242 ? 1.5102 1.5892 1.2759 -0.0035 0.2886  0.0540  242 GLN A CG  
1790 C CD  . GLN A 242 ? 1.7768 1.8708 1.4768 0.0034  0.3022  0.0737  242 GLN A CD  
1791 O OE1 . GLN A 242 ? 1.8751 1.9914 1.5363 0.0071  0.2938  0.0548  242 GLN A OE1 
1792 N NE2 . GLN A 242 ? 1.8641 1.9452 1.5502 0.0052  0.3239  0.1117  242 GLN A NE2 
1793 N N   . TYR A 243 ? 1.1170 1.1981 0.9546 -0.0059 0.2113  -0.0467 243 TYR A N   
1794 C CA  . TYR A 243 ? 1.2826 1.3597 1.1554 -0.0059 0.2042  -0.0776 243 TYR A CA  
1795 C C   . TYR A 243 ? 1.3089 1.3813 1.1702 -0.0057 0.1783  -0.0962 243 TYR A C   
1796 O O   . TYR A 243 ? 1.3992 1.4575 1.2945 -0.0057 0.1650  -0.1115 243 TYR A O   
1797 C CB  . TYR A 243 ? 1.2294 1.2934 1.1557 -0.0081 0.1996  -0.0732 243 TYR A CB  
1798 C CG  . TYR A 243 ? 1.1143 1.1819 1.0582 -0.0119 0.2240  -0.0567 243 TYR A CG  
1799 C CD1 . TYR A 243 ? 1.1078 1.1908 1.0482 -0.0124 0.2539  -0.0614 243 TYR A CD1 
1800 C CD2 . TYR A 243 ? 1.0524 1.1076 1.0166 -0.0164 0.2194  -0.0377 243 TYR A CD2 
1801 C CE1 . TYR A 243 ? 1.2149 1.2999 1.1754 -0.0188 0.2789  -0.0460 243 TYR A CE1 
1802 C CE2 . TYR A 243 ? 0.9947 1.0502 0.9791 -0.0225 0.2430  -0.0252 243 TYR A CE2 
1803 C CZ  . TYR A 243 ? 1.1097 1.1796 1.0936 -0.0244 0.2728  -0.0284 243 TYR A CZ  
1804 O OH  . TYR A 243 ? 1.2313 1.3002 1.2394 -0.0333 0.2988  -0.0158 243 TYR A OH  
1805 N N   . LEU A 244 ? 1.4493 1.5342 1.2637 -0.0060 0.1712  -0.0941 244 LEU A N   
1806 C CA  . LEU A 244 ? 1.5431 1.6277 1.3464 -0.0091 0.1487  -0.1157 244 LEU A CA  
1807 C C   . LEU A 244 ? 1.7516 1.8536 1.5195 -0.0083 0.1581  -0.1437 244 LEU A C   
1808 O O   . LEU A 244 ? 1.7970 1.9173 1.5310 -0.0049 0.1784  -0.1368 244 LEU A O   
1809 C CB  . LEU A 244 ? 1.3240 1.4153 1.1074 -0.0115 0.1276  -0.0956 244 LEU A CB  
1810 C CG  . LEU A 244 ? 1.1960 1.2689 1.0152 -0.0137 0.1147  -0.0773 244 LEU A CG  
1811 C CD1 . LEU A 244 ? 1.1654 1.2501 0.9672 -0.0138 0.0988  -0.0559 244 LEU A CD1 
1812 C CD2 . LEU A 244 ? 1.1907 1.2433 1.0442 -0.0185 0.1015  -0.0983 244 LEU A CD2 
1813 N N   . LYS A 245 ? 1.8526 1.9472 1.6276 -0.0121 0.1450  -0.1759 245 LYS A N   
1814 C CA  . LYS A 245 ? 1.9509 2.0592 1.6966 -0.0121 0.1546  -0.2103 245 LYS A CA  
1815 C C   . LYS A 245 ? 2.0031 2.1351 1.6994 -0.0179 0.1368  -0.2169 245 LYS A C   
1816 O O   . LYS A 245 ? 2.0389 2.1951 1.6888 -0.0169 0.1465  -0.2332 245 LYS A O   
1817 C CB  . LYS A 245 ? 1.9183 2.0024 1.7035 -0.0123 0.1540  -0.2468 245 LYS A CB  
1818 N N   . GLN A 246 ? 1.9899 2.1181 1.6973 -0.0241 0.1108  -0.2055 246 GLN A N   
1819 C CA  . GLN A 246 ? 1.7813 1.9389 1.4506 -0.0289 0.0897  -0.2033 246 GLN A CA  
1820 C C   . GLN A 246 ? 1.5982 1.7461 1.3009 -0.0363 0.0651  -0.1911 246 GLN A C   
1821 O O   . GLN A 246 ? 1.5054 1.6572 1.2139 -0.0476 0.0464  -0.2152 246 GLN A O   
1822 C CB  . GLN A 246 ? 1.5811 1.7567 1.2191 -0.0359 0.0844  -0.2477 246 GLN A CB  
1823 N N   . ARG A 277 ? 2.1174 1.6595 2.1652 0.2461  0.3997  0.5595  649 ARG A N   
1824 C CA  . ARG A 277 ? 1.9843 1.4805 2.0907 0.2516  0.4174  0.5460  649 ARG A CA  
1825 C C   . ARG A 277 ? 1.8954 1.3598 2.0398 0.2162  0.4376  0.4971  649 ARG A C   
1826 O O   . ARG A 277 ? 1.8444 1.2703 2.0060 0.1941  0.4641  0.4874  649 ARG A O   
1827 C CB  . ARG A 277 ? 1.6728 1.1956 1.7978 0.2828  0.3947  0.5491  649 ARG A CB  
1828 N N   . HIS A 278 ? 1.5915 1.0752 1.7483 0.2103  0.4239  0.4660  650 HIS A N   
1829 C CA  . HIS A 278 ? 1.4929 0.9486 1.6923 0.1833  0.4388  0.4160  650 HIS A CA  
1830 C C   . HIS A 278 ? 1.5400 1.0532 1.7238 0.1569  0.4120  0.3680  650 HIS A C   
1831 O O   . HIS A 278 ? 1.4445 1.0098 1.6137 0.1683  0.3818  0.3596  650 HIS A O   
1832 C CB  . HIS A 278 ? 1.5946 1.0265 1.8382 0.2052  0.4441  0.4074  650 HIS A CB  
1833 C CG  . HIS A 278 ? 1.7175 1.1378 1.9977 0.1802  0.4511  0.3482  650 HIS A CG  
1834 N ND1 . HIS A 278 ? 1.8554 1.2518 2.1484 0.1429  0.4680  0.3146  650 HIS A ND1 
1835 C CD2 . HIS A 278 ? 1.7035 1.1372 2.0090 0.1878  0.4433  0.3163  650 HIS A CD2 
1836 C CE1 . HIS A 278 ? 1.8956 1.2918 2.2166 0.1285  0.4677  0.2639  650 HIS A CE1 
1837 N NE2 . HIS A 278 ? 1.7530 1.1702 2.0800 0.1550  0.4545  0.2642  650 HIS A NE2 
1838 N N   . TYR A 279 ? 1.6319 1.1357 1.8221 0.1221  0.4233  0.3373  651 TYR A N   
1839 C CA  . TYR A 279 ? 1.5172 1.0732 1.6906 0.0989  0.3984  0.2978  651 TYR A CA  
1840 C C   . TYR A 279 ? 1.3773 0.9200 1.5831 0.0664  0.4075  0.2472  651 TYR A C   
1841 O O   . TYR A 279 ? 1.4412 0.9332 1.6836 0.0563  0.4356  0.2390  651 TYR A O   
1842 C CB  . TYR A 279 ? 1.1942 0.7788 1.3259 0.0916  0.3919  0.3160  651 TYR A CB  
1843 C CG  . TYR A 279 ? 1.3411 0.9479 1.4328 0.1213  0.3788  0.3621  651 TYR A CG  
1844 C CD1 . TYR A 279 ? 1.4417 1.1005 1.5133 0.1369  0.3450  0.3589  651 TYR A CD1 
1845 C CD2 . TYR A 279 ? 1.4425 1.0200 1.5161 0.1331  0.4002  0.4092  651 TYR A CD2 
1846 C CE1 . TYR A 279 ? 1.4029 1.0884 1.4393 0.1632  0.3299  0.3977  651 TYR A CE1 
1847 C CE2 . TYR A 279 ? 1.5189 1.1215 1.5511 0.1614  0.3855  0.4517  651 TYR A CE2 
1848 C CZ  . TYR A 279 ? 1.4606 1.1195 1.4753 0.1763  0.3488  0.4440  651 TYR A CZ  
1849 O OH  . TYR A 279 ? 1.5698 1.2599 1.5447 0.2036  0.3310  0.4831  651 TYR A OH  
1850 N N   . GLY A 280 ? 1.2276 0.8169 1.4199 0.0504  0.3825  0.2135  652 GLY A N   
1851 C CA  . GLY A 280 ? 1.3406 0.9301 1.5567 0.0209  0.3839  0.1659  652 GLY A CA  
1852 C C   . GLY A 280 ? 1.4768 1.1032 1.6747 0.0008  0.3706  0.1528  652 GLY A C   
1853 O O   . GLY A 280 ? 1.4266 1.0824 1.5900 0.0102  0.3571  0.1750  652 GLY A O   
1854 N N   . ARG A 281 ? 1.5871 1.2145 1.8097 -0.0260 0.3735  0.1149  653 ARG A N   
1855 C CA  . ARG A 281 ? 1.4218 1.0813 1.6373 -0.0443 0.3650  0.1027  653 ARG A CA  
1856 C C   . ARG A 281 ? 1.2301 0.9036 1.4736 -0.0703 0.3581  0.0556  653 ARG A C   
1857 O O   . ARG A 281 ? 1.3524 0.9984 1.6295 -0.0827 0.3723  0.0327  653 ARG A O   
1858 C CB  . ARG A 281 ? 1.2985 0.9363 1.5181 -0.0493 0.3927  0.1307  653 ARG A CB  
1859 C CG  . ARG A 281 ? 1.1419 0.8128 1.3601 -0.0672 0.3896  0.1187  653 ARG A CG  
1860 C CD  . ARG A 281 ? 1.2338 0.8839 1.4522 -0.0712 0.4211  0.1496  653 ARG A CD  
1861 N NE  . ARG A 281 ? 1.3319 0.9827 1.5034 -0.0458 0.4201  0.1939  653 ARG A NE  
1862 C CZ  . ARG A 281 ? 1.2826 0.9344 1.4315 -0.0444 0.4380  0.2232  653 ARG A CZ  
1863 N NH1 . ARG A 281 ? 1.1779 0.8294 1.3514 -0.0677 0.4611  0.2133  653 ARG A NH1 
1864 N NH2 . ARG A 281 ? 1.3727 1.0296 1.4744 -0.0201 0.4328  0.2616  653 ARG A NH2 
1865 N N   . VAL A 282 ? 1.1365 0.8539 1.3660 -0.0773 0.3350  0.0408  654 VAL A N   
1866 C CA  . VAL A 282 ? 1.1268 0.8650 1.3835 -0.1012 0.3284  0.0032  654 VAL A CA  
1867 C C   . VAL A 282 ? 1.1189 0.8781 1.3775 -0.1086 0.3335  0.0120  654 VAL A C   
1868 O O   . VAL A 282 ? 1.1593 0.9508 1.3900 -0.0997 0.3140  0.0184  654 VAL A O   
1869 C CB  . VAL A 282 ? 1.0077 0.7813 1.2491 -0.1009 0.2953  -0.0236 654 VAL A CB  
1870 C CG1 . VAL A 282 ? 0.7643 0.5665 1.0314 -0.1222 0.2845  -0.0578 654 VAL A CG1 
1871 C CG2 . VAL A 282 ? 1.0627 0.8179 1.3030 -0.0956 0.2944  -0.0360 654 VAL A CG2 
1872 N N   . SER A 283 ? 1.1654 0.9050 1.4590 -0.1256 0.3620  0.0115  655 SER A N   
1873 C CA  . SER A 283 ? 1.2296 0.9828 1.5258 -0.1314 0.3770  0.0264  655 SER A CA  
1874 C C   . SER A 283 ? 1.1616 0.9671 1.4555 -0.1349 0.3532  0.0066  655 SER A C   
1875 O O   . SER A 283 ? 1.0426 0.8661 1.3089 -0.1245 0.3515  0.0248  655 SER A O   
1876 C CB  . SER A 283 ? 1.1465 0.8737 1.4921 -0.1552 0.4121  0.0205  655 SER A CB  
1877 O OG  . SER A 283 ? 1.3037 0.9774 1.6459 -0.1480 0.4413  0.0530  655 SER A OG  
1878 N N   . SER A 284 ? 1.1497 0.9797 1.4717 -0.1484 0.3345  -0.0309 656 SER A N   
1879 C CA  . SER A 284 ? 1.0929 0.9712 1.4196 -0.1499 0.3120  -0.0488 656 SER A CA  
1880 C C   . SER A 284 ? 1.1003 1.0025 1.4251 -0.1493 0.2772  -0.0771 656 SER A C   
1881 O O   . SER A 284 ? 1.2303 1.1322 1.5840 -0.1644 0.2746  -0.1044 656 SER A O   
1882 C CB  . SER A 284 ? 0.8422 0.7388 1.2200 -0.1710 0.3312  -0.0643 656 SER A CB  
1883 O OG  . SER A 284 ? 1.0626 1.0073 1.4623 -0.1750 0.3053  -0.0929 656 SER A OG  
1884 N N   . ILE A 285 ? 0.8969 0.8196 1.1863 -0.1327 0.2513  -0.0706 657 ILE A N   
1885 C CA  . ILE A 285 ? 1.0224 0.9678 1.3027 -0.1299 0.2184  -0.0908 657 ILE A CA  
1886 C C   . ILE A 285 ? 1.0203 1.0050 1.3394 -0.1415 0.2049  -0.1185 657 ILE A C   
1887 O O   . ILE A 285 ? 0.9608 0.9626 1.2884 -0.1477 0.1844  -0.1425 657 ILE A O   
1888 C CB  . ILE A 285 ? 1.0327 0.9855 1.2681 -0.1101 0.1976  -0.0734 657 ILE A CB  
1889 C CG1 . ILE A 285 ? 1.1292 1.0512 1.3314 -0.0985 0.2076  -0.0483 657 ILE A CG1 
1890 C CG2 . ILE A 285 ? 1.0352 1.0096 1.2598 -0.1074 0.1658  -0.0899 657 ILE A CG2 
1891 C CD1 . ILE A 285 ? 1.5074 1.4371 1.6710 -0.0820 0.1921  -0.0306 657 ILE A CD1 
1892 N N   . LEU A 286 ? 1.0161 1.0181 1.3584 -0.1438 0.2167  -0.1153 658 LEU A N   
1893 C CA  . LEU A 286 ? 1.0195 1.0638 1.4084 -0.1537 0.2067  -0.1409 658 LEU A CA  
1894 C C   . LEU A 286 ? 0.9300 0.9782 1.3645 -0.1773 0.2137  -0.1688 658 LEU A C   
1895 O O   . LEU A 286 ? 0.9568 1.0407 1.4160 -0.1838 0.1894  -0.1963 658 LEU A O   
1896 C CB  . LEU A 286 ? 1.0213 1.0808 1.4314 -0.1532 0.2270  -0.1324 658 LEU A CB  
1897 C CG  . LEU A 286 ? 1.0379 1.1104 1.4179 -0.1321 0.2135  -0.1191 658 LEU A CG  
1898 C CD1 . LEU A 286 ? 0.7877 0.8699 1.1832 -0.1327 0.2412  -0.1112 658 LEU A CD1 
1899 C CD2 . LEU A 286 ? 1.1388 1.2474 1.5315 -0.1239 0.1777  -0.1375 658 LEU A CD2 
1900 N N   . ASP A 287 ? 1.1231 1.1342 1.5687 -0.1899 0.2462  -0.1618 659 ASP A N   
1901 C CA  . ASP A 287 ? 1.0943 1.1009 1.5863 -0.2150 0.2578  -0.1899 659 ASP A CA  
1902 C C   . ASP A 287 ? 1.1496 1.1500 1.6232 -0.2161 0.2356  -0.2108 659 ASP A C   
1903 O O   . ASP A 287 ? 1.3165 1.3406 1.8242 -0.2338 0.2242  -0.2466 659 ASP A O   
1904 C CB  . ASP A 287 ? 0.9524 0.9113 1.4588 -0.2264 0.3014  -0.1724 659 ASP A CB  
1905 C CG  . ASP A 287 ? 1.3017 1.2725 1.8375 -0.2336 0.3285  -0.1596 659 ASP A CG  
1906 O OD1 . ASP A 287 ? 1.3733 1.3940 1.9352 -0.2349 0.3148  -0.1746 659 ASP A OD1 
1907 O OD2 . ASP A 287 ? 1.3437 1.2746 1.8766 -0.2369 0.3644  -0.1336 659 ASP A OD2 
1908 N N   . VAL A 288 ? 1.1646 1.1368 1.5847 -0.1976 0.2299  -0.1900 660 VAL A N   
1909 C CA  . VAL A 288 ? 1.0029 0.9685 1.3991 -0.1965 0.2125  -0.2072 660 VAL A CA  
1910 C C   . VAL A 288 ? 1.1610 1.1763 1.5522 -0.1954 0.1737  -0.2307 660 VAL A C   
1911 O O   . VAL A 288 ? 1.1018 1.1278 1.4954 -0.2059 0.1603  -0.2606 660 VAL A O   
1912 C CB  . VAL A 288 ? 0.8884 0.8223 1.2305 -0.1747 0.2134  -0.1776 660 VAL A CB  
1913 C CG1 . VAL A 288 ? 0.9181 0.8534 1.2327 -0.1721 0.1947  -0.1955 660 VAL A CG1 
1914 C CG2 . VAL A 288 ? 1.0982 0.9828 1.4451 -0.1737 0.2491  -0.1551 660 VAL A CG2 
1915 N N   . ALA A 289 ? 1.1406 1.1861 1.5249 -0.1822 0.1560  -0.2173 661 ALA A N   
1916 C CA  . ALA A 289 ? 0.8070 0.8978 1.1853 -0.1763 0.1183  -0.2319 661 ALA A CA  
1917 C C   . ALA A 289 ? 1.0773 1.2121 1.5122 -0.1947 0.1087  -0.2665 661 ALA A C   
1918 O O   . ALA A 289 ? 1.2449 1.4224 1.6801 -0.1906 0.0753  -0.2815 661 ALA A O   
1919 C CB  . ALA A 289 ? 0.6585 0.7617 1.0163 -0.1549 0.1050  -0.2063 661 ALA A CB  
1920 N N   . GLY A 290 ? 1.1038 1.2293 1.5878 -0.2150 0.1378  -0.2780 662 GLY A N   
1921 C CA  . GLY A 290 ? 0.9670 1.1356 1.5141 -0.2367 0.1325  -0.3134 662 GLY A CA  
1922 C C   . GLY A 290 ? 1.1161 1.2632 1.6913 -0.2640 0.1513  -0.3432 662 GLY A C   
1923 O O   . GLY A 290 ? 1.1373 1.3039 1.7102 -0.2735 0.1295  -0.3755 662 GLY A O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   ALA 2   2   ?   ?   ?   A . n 
A 1 3   THR 3   3   ?   ?   ?   A . n 
A 1 4   LYS 4   4   ?   ?   ?   A . n 
A 1 5   GLU 5   5   ?   ?   ?   A . n 
A 1 6   GLN 6   6   ?   ?   ?   A . n 
A 1 7   ILE 7   7   ?   ?   ?   A . n 
A 1 8   VAL 8   8   ?   ?   ?   A . n 
A 1 9   GLU 9   9   ?   ?   ?   A . n 
A 1 10  HIS 10  10  ?   ?   ?   A . n 
A 1 11  ARG 11  11  ?   ?   ?   A . n 
A 1 12  GLU 12  12  ?   ?   ?   A . n 
A 1 13  SER 13  13  ?   ?   ?   A . n 
A 1 14  GLU 14  14  ?   ?   ?   A . n 
A 1 15  ILE 15  15  ?   ?   ?   A . n 
A 1 16  PRO 16  16  ?   ?   ?   A . n 
A 1 17  ILE 17  17  ?   ?   ?   A . n 
A 1 18  ALA 18  18  ?   ?   ?   A . n 
A 1 19  SER 19  19  19  SER SER A . n 
A 1 20  GLN 20  20  20  GLN GLN A . n 
A 1 21  TRP 21  21  21  TRP TRP A . n 
A 1 22  LYS 22  22  22  LYS LYS A . n 
A 1 23  ALA 23  23  23  ALA ALA A . n 
A 1 24  THR 24  24  24  THR THR A . n 
A 1 25  PHE 25  25  25  PHE PHE A . n 
A 1 26  PRO 26  26  26  PRO PRO A . n 
A 1 27  VAL 27  27  27  VAL VAL A . n 
A 1 28  ASP 28  28  28  ASP ASP A . n 
A 1 29  LEU 29  29  29  LEU LEU A . n 
A 1 30  GLU 30  30  30  GLU GLU A . n 
A 1 31  ILE 31  31  31  ILE ILE A . n 
A 1 32  GLU 32  32  32  GLU GLU A . n 
A 1 33  LYS 33  33  33  LYS LYS A . n 
A 1 34  ASN 34  34  34  ASN ASN A . n 
A 1 35  SER 35  35  35  SER SER A . n 
A 1 36  GLU 36  36  36  GLU GLU A . n 
A 1 37  MET 37  37  37  MET MET A . n 
A 1 38  PHE 38  38  38  PHE PHE A . n 
A 1 39  ALA 39  39  39  ALA ALA A . n 
A 1 40  LEU 40  40  40  LEU LEU A . n 
A 1 41  ARG 41  41  41  ARG ARG A . n 
A 1 42  TYR 42  42  42  TYR TYR A . n 
A 1 43  ILE 43  43  43  ILE ILE A . n 
A 1 44  LYS 44  44  44  LYS LYS A . n 
A 1 45  CYS 45  45  45  CYS CYS A . n 
A 1 46  ALA 46  46  46  ALA ALA A . n 
A 1 47  SER 47  47  47  SER SER A . n 
A 1 48  ALA 48  48  48  ALA ALA A . n 
A 1 49  PHE 49  49  49  PHE PHE A . n 
A 1 50  ILE 50  50  50  ILE ILE A . n 
A 1 51  LEU 51  51  51  LEU LEU A . n 
A 1 52  ASP 52  52  52  ASP ASP A . n 
A 1 53  ARG 53  53  53  ARG ARG A . n 
A 1 54  ARG 54  54  54  ARG ARG A . n 
A 1 55  GLY 55  55  55  GLY GLY A . n 
A 1 56  ILE 56  56  56  ILE ILE A . n 
A 1 57  LEU 57  57  57  LEU LEU A . n 
A 1 58  ASP 58  58  58  ASP ASP A . n 
A 1 59  GLU 59  59  59  GLU GLU A . n 
A 1 60  LYS 60  60  60  LYS LYS A . n 
A 1 61  CYS 61  61  61  CYS CYS A . n 
A 1 62  PHE 62  62  62  PHE PHE A . n 
A 1 63  LYS 63  63  63  LYS LYS A . n 
A 1 64  THR 64  64  64  THR THR A . n 
A 1 65  ARG 65  65  65  ARG ARG A . n 
A 1 66  THR 66  66  66  THR THR A . n 
A 1 67  ILE 67  67  67  ILE ILE A . n 
A 1 68  ASP 68  68  68  ASP ASP A . n 
A 1 69  LYS 69  69  69  LYS LYS A . n 
A 1 70  LEU 70  70  70  LEU LEU A . n 
A 1 71  LEU 71  71  71  LEU LEU A . n 
A 1 72  VAL 72  72  72  VAL VAL A . n 
A 1 73  THR 73  73  73  THR THR A . n 
A 1 74  ALA 74  74  74  ALA ALA A . n 
A 1 75  PHE 75  75  75  PHE PHE A . n 
A 1 76  GLN 76  76  76  GLN GLN A . n 
A 1 77  SER 77  77  77  SER SER A . n 
A 1 78  SER 78  78  78  SER SER A . n 
A 1 79  VAL 79  79  79  VAL VAL A . n 
A 1 80  PRO 80  80  80  PRO PRO A . n 
A 1 81  ALA 81  81  81  ALA ALA A . n 
A 1 82  ALA 82  82  82  ALA ALA A . n 
A 1 83  LYS 83  83  83  LYS LYS A . n 
A 1 84  ARG 84  84  84  ARG ARG A . n 
A 1 85  VAL 85  85  85  VAL VAL A . n 
A 1 86  SER 86  86  86  SER SER A . n 
A 1 87  SER 87  87  87  SER SER A . n 
A 1 88  THR 88  88  88  THR THR A . n 
A 1 89  PHE 89  89  89  PHE PHE A . n 
A 1 90  ASP 90  90  90  ASP ASP A . n 
A 1 91  GLY 91  91  91  GLY GLY A . n 
A 1 92  LEU 92  92  92  LEU LEU A . n 
A 1 93  ARG 93  93  93  ARG ARG A . n 
A 1 94  ASP 94  94  94  ASP ASP A . n 
A 1 95  ALA 95  95  95  ALA ALA A . n 
A 1 96  ILE 96  96  96  ILE ILE A . n 
A 1 97  GLN 97  97  97  GLN GLN A . n 
A 1 98  GLN 98  98  98  GLN GLN A . n 
A 1 99  GLY 99  99  99  GLY GLY A . n 
A 1 100 TYR 100 100 100 TYR TYR A . n 
A 1 101 LEU 101 101 101 LEU LEU A . n 
A 1 102 ARG 102 102 102 ARG ARG A . n 
A 1 103 GLU 103 103 103 GLU GLU A . n 
A 1 104 PHE 104 104 104 PHE PHE A . n 
A 1 105 ALA 105 105 105 ALA ALA A . n 
A 1 106 ILE 106 106 106 ILE ILE A . n 
A 1 107 VAL 107 107 107 VAL VAL A . n 
A 1 108 PHE 108 108 108 PHE PHE A . n 
A 1 109 TYR 109 109 109 TYR TYR A . n 
A 1 110 LYS 110 110 110 LYS LYS A . n 
A 1 111 LYS 111 111 111 LYS LYS A . n 
A 1 112 PRO 112 112 112 PRO PRO A . n 
A 1 113 ASN 113 113 113 ASN ASN A . n 
A 1 114 GLU 114 114 114 GLU GLU A . n 
A 1 115 GLU 115 115 115 GLU GLU A . n 
A 1 116 ASP 116 116 116 ASP ASP A . n 
A 1 117 ILE 117 117 117 ILE ILE A . n 
A 1 118 ASN 118 118 118 ASN ASN A . n 
A 1 119 GLU 119 119 119 GLU GLU A . n 
A 1 120 VAL 120 120 120 VAL VAL A . n 
A 1 121 PHE 121 121 121 PHE PHE A . n 
A 1 122 ALA 122 122 122 ALA ALA A . n 
A 1 123 PHE 123 123 123 PHE PHE A . n 
A 1 124 ARG 124 124 124 ARG ARG A . n 
A 1 125 PHE 125 125 125 PHE PHE A . n 
A 1 126 ALA 126 126 126 ALA ALA A . n 
A 1 127 TYR 127 127 127 TYR TYR A . n 
A 1 128 GLY 128 128 128 GLY GLY A . n 
A 1 129 ASP 129 129 129 ASP ASP A . n 
A 1 130 GLU 130 130 130 GLU GLU A . n 
A 1 131 GLY 131 131 131 GLY GLY A . n 
A 1 132 GLU 132 132 132 GLU GLU A . n 
A 1 133 ILE 133 133 133 ILE ILE A . n 
A 1 134 PHE 134 134 134 PHE PHE A . n 
A 1 135 VAL 135 135 135 VAL VAL A . n 
A 1 136 SER 136 136 136 SER SER A . n 
A 1 137 LEU 137 137 137 LEU LEU A . n 
A 1 138 ASN 138 138 138 ASN ASN A . n 
A 1 139 ASN 139 139 139 ASN ASN A . n 
A 1 140 GLY 140 140 140 GLY GLY A . n 
A 1 141 ILE 141 141 141 ILE ILE A . n 
A 1 142 ASP 142 142 142 ASP ASP A . n 
A 1 143 THR 143 143 143 THR THR A . n 
A 1 144 ASN 144 144 144 ASN ASN A . n 
A 1 145 GLU 145 145 145 GLU GLU A . n 
A 1 146 SER 146 146 146 SER SER A . n 
A 1 147 SER 147 147 147 SER SER A . n 
A 1 148 GLN 148 148 148 GLN GLN A . n 
A 1 149 GLU 149 149 149 GLU GLU A . n 
A 1 150 LEU 150 150 150 LEU LEU A . n 
A 1 151 LEU 151 151 151 LEU LEU A . n 
A 1 152 GLN 152 152 152 GLN GLN A . n 
A 1 153 ALA 153 153 153 ALA ALA A . n 
A 1 154 LYS 154 154 154 LYS LYS A . n 
A 1 155 PHE 155 155 155 PHE PHE A . n 
A 1 156 VAL 156 156 156 VAL VAL A . n 
A 1 157 ASP 157 157 157 ASP ASP A . n 
A 1 158 THR 158 158 158 THR THR A . n 
A 1 159 ASP 159 159 159 ASP ASP A . n 
A 1 160 ASN 160 160 160 ASN ASN A . n 
A 1 161 THR 161 161 161 THR THR A . n 
A 1 162 LYS 162 162 162 LYS LYS A . n 
A 1 163 GLN 163 163 163 GLN GLN A . n 
A 1 164 MET 164 164 164 MET MET A . n 
A 1 165 PHE 165 165 165 PHE PHE A . n 
A 1 166 ALA 166 166 166 ALA ALA A . n 
A 1 167 SER 167 167 167 SER SER A . n 
A 1 168 THR 168 168 168 THR THR A . n 
A 1 169 ILE 169 169 169 ILE ILE A . n 
A 1 170 LYS 170 170 170 LYS LYS A . n 
A 1 171 LYS 171 171 171 LYS LYS A . n 
A 1 172 LEU 172 172 172 LEU LEU A . n 
A 1 173 HIS 173 173 173 HIS HIS A . n 
A 1 174 ARG 174 174 174 ARG ARG A . n 
A 1 175 CYS 175 175 175 CYS CYS A . n 
A 1 176 ILE 176 176 176 ILE ILE A . n 
A 1 177 LYS 177 177 177 LYS LYS A . n 
A 1 178 LYS 178 178 178 LYS LYS A . n 
A 1 179 MET 179 179 179 MET MET A . n 
A 1 180 GLU 180 180 180 GLU GLU A . n 
A 1 181 PRO 181 181 181 PRO PRO A . n 
A 1 182 LEU 182 182 182 LEU LEU A . n 
A 1 183 PRO 183 183 183 PRO PRO A . n 
A 1 184 GLN 184 184 184 GLN GLN A . n 
A 1 185 GLY 185 185 185 GLY GLY A . n 
A 1 186 SER 186 186 186 SER SER A . n 
A 1 187 ASP 187 187 187 ASP ASP A . n 
A 1 188 ALA 188 188 188 ALA ALA A . n 
A 1 189 SER 189 189 189 SER SER A . n 
A 1 190 PHE 190 190 190 PHE PHE A . n 
A 1 191 ARG 191 191 191 ARG ARG A . n 
A 1 192 VAL 192 192 192 VAL VAL A . n 
A 1 193 SER 193 193 193 SER SER A . n 
A 1 194 TYR 194 194 194 TYR TYR A . n 
A 1 195 THR 195 195 195 THR THR A . n 
A 1 196 GLU 196 196 196 GLU GLU A . n 
A 1 197 LYS 197 197 197 LYS LYS A . n 
A 1 198 ALA 198 198 198 ALA ALA A . n 
A 1 199 PRO 199 199 199 PRO PRO A . n 
A 1 200 LYS 200 200 200 LYS LYS A . n 
A 1 201 ASP 201 201 201 ASP ASP A . n 
A 1 202 TYR 202 202 202 TYR TYR A . n 
A 1 203 THR 203 203 203 THR THR A . n 
A 1 204 PRO 204 204 204 PRO PRO A . n 
A 1 205 GLU 205 205 205 GLU GLU A . n 
A 1 206 GLY 206 206 206 GLY GLY A . n 
A 1 207 TYR 207 207 207 TYR TYR A . n 
A 1 208 LEU 208 208 208 LEU LEU A . n 
A 1 209 LEU 209 209 209 LEU LEU A . n 
A 1 210 SER 210 210 210 SER SER A . n 
A 1 211 PRO 211 211 211 PRO PRO A . n 
A 1 212 MET 212 212 212 MET MET A . n 
A 1 213 PHE 213 213 213 PHE PHE A . n 
A 1 214 TYR 214 214 214 TYR TYR A . n 
A 1 215 THR 215 215 215 THR THR A . n 
A 1 216 LEU 216 216 216 LEU LEU A . n 
A 1 217 ASN 217 217 217 ASN ASN A . n 
A 1 218 GLN 218 218 218 GLN GLN A . n 
A 1 219 ASP 219 219 219 ASP ASP A . n 
A 1 220 ILE 220 220 220 ILE ILE A . n 
A 1 221 ARG 221 221 221 ARG ARG A . n 
A 1 222 LYS 222 222 222 LYS LYS A . n 
A 1 223 ALA 223 223 223 ALA ALA A . n 
A 1 224 SER 224 224 224 SER SER A . n 
A 1 225 ILE 225 225 225 ILE ILE A . n 
A 1 226 GLY 226 226 226 GLY GLY A . n 
A 1 227 ILE 227 227 227 ILE ILE A . n 
A 1 228 VAL 228 228 228 VAL VAL A . n 
A 1 229 CYS 229 229 229 CYS CYS A . n 
A 1 230 GLY 230 230 230 GLY GLY A . n 
A 1 231 GLY 231 231 231 GLY GLY A . n 
A 1 232 HIS 232 232 232 HIS HIS A . n 
A 1 233 HIS 233 233 233 HIS HIS A . n 
A 1 234 LYS 234 234 234 LYS LYS A . n 
A 1 235 ILE 235 235 235 ILE ILE A . n 
A 1 236 GLN 236 236 236 GLN GLN A . n 
A 1 237 MET 237 237 237 MET MET A . n 
A 1 238 LEU 238 238 238 LEU LEU A . n 
A 1 239 ALA 239 239 239 ALA ALA A . n 
A 1 240 ALA 240 240 240 ALA ALA A . n 
A 1 241 SER 241 241 241 SER SER A . n 
A 1 242 GLN 242 242 242 GLN GLN A . n 
A 1 243 TYR 243 243 243 TYR TYR A . n 
A 1 244 LEU 244 244 244 LEU LEU A . n 
A 1 245 LYS 245 245 245 LYS LYS A . n 
A 1 246 GLN 246 246 246 GLN GLN A . n 
A 1 247 ASP 247 619 ?   ?   ?   A . n 
A 1 248 PHE 248 620 ?   ?   ?   A . n 
A 1 249 ASP 249 621 ?   ?   ?   A . n 
A 1 250 LEU 250 622 ?   ?   ?   A . n 
A 1 251 ASP 251 623 ?   ?   ?   A . n 
A 1 252 LYS 252 624 ?   ?   ?   A . n 
A 1 253 THR 253 625 ?   ?   ?   A . n 
A 1 254 THR 254 626 ?   ?   ?   A . n 
A 1 255 THR 255 627 ?   ?   ?   A . n 
A 1 256 LEU 256 628 ?   ?   ?   A . n 
A 1 257 ASN 257 629 ?   ?   ?   A . n 
A 1 258 PRO 258 630 ?   ?   ?   A . n 
A 1 259 ASN 259 631 ?   ?   ?   A . n 
A 1 260 MET 260 632 ?   ?   ?   A . n 
A 1 261 SER 261 633 ?   ?   ?   A . n 
A 1 262 ILE 262 634 ?   ?   ?   A . n 
A 1 263 MET 263 635 ?   ?   ?   A . n 
A 1 264 ALA 264 636 ?   ?   ?   A . n 
A 1 265 ASN 265 637 ?   ?   ?   A . n 
A 1 266 GLN 266 638 ?   ?   ?   A . n 
A 1 267 SER 267 639 ?   ?   ?   A . n 
A 1 268 LYS 268 640 ?   ?   ?   A . n 
A 1 269 ARG 269 641 ?   ?   ?   A . n 
A 1 270 LYS 270 642 ?   ?   ?   A . n 
A 1 271 GLY 271 643 ?   ?   ?   A . n 
A 1 272 ARG 272 644 ?   ?   ?   A . n 
A 1 273 ILE 273 645 ?   ?   ?   A . n 
A 1 274 SER 274 646 ?   ?   ?   A . n 
A 1 275 ARG 275 647 ?   ?   ?   A . n 
A 1 276 ASP 276 648 ?   ?   ?   A . n 
A 1 277 ARG 277 649 649 ARG ARG A . n 
A 1 278 HIS 278 650 650 HIS HIS A . n 
A 1 279 TYR 279 651 651 TYR TYR A . n 
A 1 280 GLY 280 652 652 GLY GLY A . n 
A 1 281 ARG 281 653 653 ARG ARG A . n 
A 1 282 VAL 282 654 654 VAL VAL A . n 
A 1 283 SER 283 655 655 SER SER A . n 
A 1 284 SER 284 656 656 SER SER A . n 
A 1 285 ILE 285 657 657 ILE ILE A . n 
A 1 286 LEU 286 658 658 LEU LEU A . n 
A 1 287 ASP 287 659 659 ASP ASP A . n 
A 1 288 VAL 288 660 660 VAL VAL A . n 
A 1 289 ALA 289 661 661 ALA ALA A . n 
A 1 290 GLY 290 662 662 GLY GLY A . n 
A 1 291 SER 291 663 ?   ?   ?   A . n 
A 1 292 LYS 292 664 ?   ?   ?   A . n 
A 1 293 ASP 293 665 ?   ?   ?   A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 0     ? 
1 MORE         0     ? 
1 'SSA (A^2)'  11490 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2014-11-19 
2 'Structure model' 1 1 2014-12-17 
3 'Structure model' 1 2 2017-09-20 
4 'Structure model' 1 3 2019-12-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'        
2 3 'Structure model' 'Author supporting evidence' 
3 3 'Structure model' 'Derived calculations'       
4 3 'Structure model' Other                        
5 3 'Structure model' 'Source and taxonomy'        
6 3 'Structure model' 'Structure summary'          
7 4 'Structure model' 'Author supporting evidence' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' entity_src_gen        
2 3 'Structure model' pdbx_audit_support    
3 3 'Structure model' pdbx_database_status  
4 3 'Structure model' pdbx_struct_oper_list 
5 3 'Structure model' struct_keywords       
6 4 'Structure model' pdbx_audit_support    
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_entity_src_gen.pdbx_alt_source_flag'        
2 3 'Structure model' '_pdbx_audit_support.funding_organization'    
3 3 'Structure model' '_pdbx_database_status.pdb_format_compatible' 
4 3 'Structure model' '_pdbx_struct_oper_list.symmetry_operation'   
5 3 'Structure model' '_struct_keywords.pdbx_keywords'              
6 4 'Structure model' '_pdbx_audit_support.funding_organization'    
# 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         188.226 
_pdbx_refine_tls.origin_y         -8.254 
_pdbx_refine_tls.origin_z         40.796 
_pdbx_refine_tls.T[1][1]          0.5599 
_pdbx_refine_tls.T[2][2]          0.5229 
_pdbx_refine_tls.T[3][3]          0.5693 
_pdbx_refine_tls.T[1][2]          -0.0026 
_pdbx_refine_tls.T[1][3]          0.1284 
_pdbx_refine_tls.T[2][3]          0.0704 
_pdbx_refine_tls.L[1][1]          5.0250 
_pdbx_refine_tls.L[2][2]          3.5908 
_pdbx_refine_tls.L[3][3]          3.2757 
_pdbx_refine_tls.L[1][2]          -0.1084 
_pdbx_refine_tls.L[1][3]          -1.0495 
_pdbx_refine_tls.L[2][3]          0.6593 
_pdbx_refine_tls.S[1][1]          0.3445 
_pdbx_refine_tls.S[2][2]          0.0278 
_pdbx_refine_tls.S[3][3]          -0.3429 
_pdbx_refine_tls.S[1][2]          0.3038 
_pdbx_refine_tls.S[1][3]          0.6064 
_pdbx_refine_tls.S[2][3]          -0.0080 
_pdbx_refine_tls.S[2][1]          -0.1876 
_pdbx_refine_tls.S[3][1]          -0.3465 
_pdbx_refine_tls.S[3][2]          -0.2946 
# 
_pdbx_refine_tls_group.pdbx_refine_id      'X-RAY DIFFRACTION' 
_pdbx_refine_tls_group.id                  1 
_pdbx_refine_tls_group.refine_tls_id       1 
_pdbx_refine_tls_group.beg_auth_asym_id    A 
_pdbx_refine_tls_group.beg_auth_seq_id     19 
_pdbx_refine_tls_group.end_auth_asym_id    A 
_pdbx_refine_tls_group.end_auth_seq_id     246 
_pdbx_refine_tls_group.selection_details   '(CHAIN A AND RESID 19:246)' 
_pdbx_refine_tls_group.beg_label_asym_id   ? 
_pdbx_refine_tls_group.beg_label_seq_id    ? 
_pdbx_refine_tls_group.end_label_asym_id   ? 
_pdbx_refine_tls_group.end_label_seq_id    ? 
_pdbx_refine_tls_group.selection           ? 
# 
_software.citation_id            ? 
_software.classification         refinement 
_software.compiler_name          ? 
_software.compiler_version       ? 
_software.contact_author         ? 
_software.contact_author_email   ? 
_software.date                   ? 
_software.description            ? 
_software.dependencies           ? 
_software.hardware               ? 
_software.language               ? 
_software.location               ? 
_software.mods                   ? 
_software.name                   PHENIX 
_software.os                     ? 
_software.os_version             ? 
_software.type                   ? 
_software.version                '(phenix.refine: 1.9_1692)' 
_software.pdbx_ordinal           1 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 VAL A 27  ? ? -112.53 -167.84 
2 1 LEU A 29  ? ? -68.92  0.01    
3 1 ASP A 68  ? ? 56.60   -106.26 
4 1 VAL A 135 ? ? -64.64  92.51   
5 1 PRO A 199 ? ? -49.36  152.17  
6 1 PHE A 213 ? ? -83.27  -107.55 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 245 ? CG  ? A LYS 245 CG  
2  1 Y 1 A LYS 245 ? CD  ? A LYS 245 CD  
3  1 Y 1 A LYS 245 ? CE  ? A LYS 245 CE  
4  1 Y 1 A LYS 245 ? NZ  ? A LYS 245 NZ  
5  1 Y 1 A GLN 246 ? CG  ? A GLN 246 CG  
6  1 Y 1 A GLN 246 ? CD  ? A GLN 246 CD  
7  1 Y 1 A GLN 246 ? OE1 ? A GLN 246 OE1 
8  1 Y 1 A GLN 246 ? NE2 ? A GLN 246 NE2 
9  1 Y 1 A ARG 649 ? CG  ? A ARG 277 CG  
10 1 Y 1 A ARG 649 ? CD  ? A ARG 277 CD  
11 1 Y 1 A ARG 649 ? NE  ? A ARG 277 NE  
12 1 Y 1 A ARG 649 ? CZ  ? A ARG 277 CZ  
13 1 Y 1 A ARG 649 ? NH1 ? A ARG 277 NH1 
14 1 Y 1 A ARG 649 ? NH2 ? A ARG 277 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A ALA 2   ? A ALA 2   
3  1 Y 1 A THR 3   ? A THR 3   
4  1 Y 1 A LYS 4   ? A LYS 4   
5  1 Y 1 A GLU 5   ? A GLU 5   
6  1 Y 1 A GLN 6   ? A GLN 6   
7  1 Y 1 A ILE 7   ? A ILE 7   
8  1 Y 1 A VAL 8   ? A VAL 8   
9  1 Y 1 A GLU 9   ? A GLU 9   
10 1 Y 1 A HIS 10  ? A HIS 10  
11 1 Y 1 A ARG 11  ? A ARG 11  
12 1 Y 1 A GLU 12  ? A GLU 12  
13 1 Y 1 A SER 13  ? A SER 13  
14 1 Y 1 A GLU 14  ? A GLU 14  
15 1 Y 1 A ILE 15  ? A ILE 15  
16 1 Y 1 A PRO 16  ? A PRO 16  
17 1 Y 1 A ILE 17  ? A ILE 17  
18 1 Y 1 A ALA 18  ? A ALA 18  
19 1 Y 1 A ASP 619 ? A ASP 247 
20 1 Y 1 A PHE 620 ? A PHE 248 
21 1 Y 1 A ASP 621 ? A ASP 249 
22 1 Y 1 A LEU 622 ? A LEU 250 
23 1 Y 1 A ASP 623 ? A ASP 251 
24 1 Y 1 A LYS 624 ? A LYS 252 
25 1 Y 1 A THR 625 ? A THR 253 
26 1 Y 1 A THR 626 ? A THR 254 
27 1 Y 1 A THR 627 ? A THR 255 
28 1 Y 1 A LEU 628 ? A LEU 256 
29 1 Y 1 A ASN 629 ? A ASN 257 
30 1 Y 1 A PRO 630 ? A PRO 258 
31 1 Y 1 A ASN 631 ? A ASN 259 
32 1 Y 1 A MET 632 ? A MET 260 
33 1 Y 1 A SER 633 ? A SER 261 
34 1 Y 1 A ILE 634 ? A ILE 262 
35 1 Y 1 A MET 635 ? A MET 263 
36 1 Y 1 A ALA 636 ? A ALA 264 
37 1 Y 1 A ASN 637 ? A ASN 265 
38 1 Y 1 A GLN 638 ? A GLN 266 
39 1 Y 1 A SER 639 ? A SER 267 
40 1 Y 1 A LYS 640 ? A LYS 268 
41 1 Y 1 A ARG 641 ? A ARG 269 
42 1 Y 1 A LYS 642 ? A LYS 270 
43 1 Y 1 A GLY 643 ? A GLY 271 
44 1 Y 1 A ARG 644 ? A ARG 272 
45 1 Y 1 A ILE 645 ? A ILE 273 
46 1 Y 1 A SER 646 ? A SER 274 
47 1 Y 1 A ARG 647 ? A ARG 275 
48 1 Y 1 A ASP 648 ? A ASP 276 
49 1 Y 1 A SER 663 ? A SER 291 
50 1 Y 1 A LYS 664 ? A LYS 292 
51 1 Y 1 A ASP 665 ? A ASP 293 
# 
_pdbx_audit_support.funding_organization   
'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 
_pdbx_audit_support.country                'United States' 
_pdbx_audit_support.grant_number           R01GM104141 
_pdbx_audit_support.ordinal                1 
#