data_4TZM
# 
_entry.id   4TZM 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4TZM         
WWPDB D_1000202531 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB . 4TZL unspecified 
PDB . 4TZJ unspecified 
PDB . 4TZN unspecified 
PDB . 4TZO unspecified 
PDB . 4TZQ unspecified 
PDB . 4TZS unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4TZM 
_pdbx_database_status.recvd_initial_deposition_date   2014-07-10 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Rosenberg, S.C.' 1 
'Corbett, K.D.'   2 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Dev.Cell 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1534-5807 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            31 
_citation.language                  ? 
_citation.page_first                487 
_citation.page_last                 502 
_citation.title                     
'The Chromosome Axis Controls Meiotic Events through a Hierarchical Assembly of HORMA Domain Proteins.' 
_citation.year                      2014 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.devcel.2014.09.013 
_citation.pdbx_database_id_PubMed   25446517 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Kim, Y.'         1 ? 
primary 'Rosenberg, S.C.' 2 ? 
primary 'Kugel, C.L.'     3 ? 
primary 'Kostow, N.'      4 ? 
primary 'Rog, O.'         5 ? 
primary 'Davydov, V.'     6 ? 
primary 'Su, T.Y.'        7 ? 
primary 'Dernburg, A.F.'  8 ? 
primary 'Corbett, K.D.'   9 ? 
# 
_cell.entry_id           4TZM 
_cell.length_a           47.676 
_cell.length_b           66.005 
_cell.length_c           94.649 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.27 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4TZM 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Protein HTP-2'                   28744.303 2  ? ? 'UNP residues 1-253' ? 
2 polymer man 'C. elegans HTP-3 closure motif1' 1796.038  2  ? ? ?                    ? 
3 water   nat water                             18.015    56 ? ? ?                    ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MAPLENNYNESLNKSKDAIDDKTWSKLFPSIVSDPDRSSNFMIRAIYVVFSAVLRQRNILEKEYFSKNYITENLSCMTLS
FKNLRAHQIAQLLRAAGDATKDGFLKEISLVVTEHDGDVEAIEVFSMKFIYFENGGVVARLSTDNNDQEDPHFAELAQLR
YEGAESVRDQMVTIVRSVQFLCTKVLEPLPAEFTANFRLKYTNDAPSNFRIDGFDDSSTFYTLPDGIQSVTIGHLRPGHH
AAHMQCWSKSMSD
;
;MAPLENNYNESLNKSKDAIDDKTWSKLFPSIVSDPDRSSNFMIRAIYVVFSAVLRQRNILEKEYFSKNYITENLSCMTLS
FKNLRAHQIAQLLRAAGDATKDGFLKEISLVVTEHDGDVEAIEVFSMKFIYFENGGVVARLSTDNNDQEDPHFAELAQLR
YEGAESVRDQMVTIVRSVQFLCTKVLEPLPAEFTANFRLKYTNDAPSNFRIDGFDDSSTFYTLPDGIQSVTIGHLRPGHH
AAHMQCWSKSMSD
;
A,B ? 
2 'polypeptide(L)' no no TARYGVSNTSINRKKP TARYGVSNTSINRKKP C,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   PRO n 
1 4   LEU n 
1 5   GLU n 
1 6   ASN n 
1 7   ASN n 
1 8   TYR n 
1 9   ASN n 
1 10  GLU n 
1 11  SER n 
1 12  LEU n 
1 13  ASN n 
1 14  LYS n 
1 15  SER n 
1 16  LYS n 
1 17  ASP n 
1 18  ALA n 
1 19  ILE n 
1 20  ASP n 
1 21  ASP n 
1 22  LYS n 
1 23  THR n 
1 24  TRP n 
1 25  SER n 
1 26  LYS n 
1 27  LEU n 
1 28  PHE n 
1 29  PRO n 
1 30  SER n 
1 31  ILE n 
1 32  VAL n 
1 33  SER n 
1 34  ASP n 
1 35  PRO n 
1 36  ASP n 
1 37  ARG n 
1 38  SER n 
1 39  SER n 
1 40  ASN n 
1 41  PHE n 
1 42  MET n 
1 43  ILE n 
1 44  ARG n 
1 45  ALA n 
1 46  ILE n 
1 47  TYR n 
1 48  VAL n 
1 49  VAL n 
1 50  PHE n 
1 51  SER n 
1 52  ALA n 
1 53  VAL n 
1 54  LEU n 
1 55  ARG n 
1 56  GLN n 
1 57  ARG n 
1 58  ASN n 
1 59  ILE n 
1 60  LEU n 
1 61  GLU n 
1 62  LYS n 
1 63  GLU n 
1 64  TYR n 
1 65  PHE n 
1 66  SER n 
1 67  LYS n 
1 68  ASN n 
1 69  TYR n 
1 70  ILE n 
1 71  THR n 
1 72  GLU n 
1 73  ASN n 
1 74  LEU n 
1 75  SER n 
1 76  CYS n 
1 77  MET n 
1 78  THR n 
1 79  LEU n 
1 80  SER n 
1 81  PHE n 
1 82  LYS n 
1 83  ASN n 
1 84  LEU n 
1 85  ARG n 
1 86  ALA n 
1 87  HIS n 
1 88  GLN n 
1 89  ILE n 
1 90  ALA n 
1 91  GLN n 
1 92  LEU n 
1 93  LEU n 
1 94  ARG n 
1 95  ALA n 
1 96  ALA n 
1 97  GLY n 
1 98  ASP n 
1 99  ALA n 
1 100 THR n 
1 101 LYS n 
1 102 ASP n 
1 103 GLY n 
1 104 PHE n 
1 105 LEU n 
1 106 LYS n 
1 107 GLU n 
1 108 ILE n 
1 109 SER n 
1 110 LEU n 
1 111 VAL n 
1 112 VAL n 
1 113 THR n 
1 114 GLU n 
1 115 HIS n 
1 116 ASP n 
1 117 GLY n 
1 118 ASP n 
1 119 VAL n 
1 120 GLU n 
1 121 ALA n 
1 122 ILE n 
1 123 GLU n 
1 124 VAL n 
1 125 PHE n 
1 126 SER n 
1 127 MET n 
1 128 LYS n 
1 129 PHE n 
1 130 ILE n 
1 131 TYR n 
1 132 PHE n 
1 133 GLU n 
1 134 ASN n 
1 135 GLY n 
1 136 GLY n 
1 137 VAL n 
1 138 VAL n 
1 139 ALA n 
1 140 ARG n 
1 141 LEU n 
1 142 SER n 
1 143 THR n 
1 144 ASP n 
1 145 ASN n 
1 146 ASN n 
1 147 ASP n 
1 148 GLN n 
1 149 GLU n 
1 150 ASP n 
1 151 PRO n 
1 152 HIS n 
1 153 PHE n 
1 154 ALA n 
1 155 GLU n 
1 156 LEU n 
1 157 ALA n 
1 158 GLN n 
1 159 LEU n 
1 160 ARG n 
1 161 TYR n 
1 162 GLU n 
1 163 GLY n 
1 164 ALA n 
1 165 GLU n 
1 166 SER n 
1 167 VAL n 
1 168 ARG n 
1 169 ASP n 
1 170 GLN n 
1 171 MET n 
1 172 VAL n 
1 173 THR n 
1 174 ILE n 
1 175 VAL n 
1 176 ARG n 
1 177 SER n 
1 178 VAL n 
1 179 GLN n 
1 180 PHE n 
1 181 LEU n 
1 182 CYS n 
1 183 THR n 
1 184 LYS n 
1 185 VAL n 
1 186 LEU n 
1 187 GLU n 
1 188 PRO n 
1 189 LEU n 
1 190 PRO n 
1 191 ALA n 
1 192 GLU n 
1 193 PHE n 
1 194 THR n 
1 195 ALA n 
1 196 ASN n 
1 197 PHE n 
1 198 ARG n 
1 199 LEU n 
1 200 LYS n 
1 201 TYR n 
1 202 THR n 
1 203 ASN n 
1 204 ASP n 
1 205 ALA n 
1 206 PRO n 
1 207 SER n 
1 208 ASN n 
1 209 PHE n 
1 210 ARG n 
1 211 ILE n 
1 212 ASP n 
1 213 GLY n 
1 214 PHE n 
1 215 ASP n 
1 216 ASP n 
1 217 SER n 
1 218 SER n 
1 219 THR n 
1 220 PHE n 
1 221 TYR n 
1 222 THR n 
1 223 LEU n 
1 224 PRO n 
1 225 ASP n 
1 226 GLY n 
1 227 ILE n 
1 228 GLN n 
1 229 SER n 
1 230 VAL n 
1 231 THR n 
1 232 ILE n 
1 233 GLY n 
1 234 HIS n 
1 235 LEU n 
1 236 ARG n 
1 237 PRO n 
1 238 GLY n 
1 239 HIS n 
1 240 HIS n 
1 241 ALA n 
1 242 ALA n 
1 243 HIS n 
1 244 MET n 
1 245 GLN n 
1 246 CYS n 
1 247 TRP n 
1 248 SER n 
1 249 LYS n 
1 250 SER n 
1 251 MET n 
1 252 SER n 
1 253 ASP n 
2 1   THR n 
2 2   ALA n 
2 3   ARG n 
2 4   TYR n 
2 5   GLY n 
2 6   VAL n 
2 7   SER n 
2 8   ASN n 
2 9   THR n 
2 10  SER n 
2 11  ILE n 
2 12  ASN n 
2 13  ARG n 
2 14  LYS n 
2 15  LYS n 
2 16  PRO n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 253 ? ? 'htp-2, CELE_Y73B6BL.2, Y73B6BL.2' ? ? ? ? ? ? 'Caenorhabditis elegans' 6239 ? ? ? ? ? 
? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 'Rosetta 2 pLysS' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 16  ? ? HTP-3                              ? ? ? ? ? ? 'Caenorhabditis elegans' 6239 ? ? ? ? ? 
? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 'Rosetta 2 pLysS' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP Q95XC8_CAEEL Q95XC8 1 
;MAPLENNYNESLNKSKDAIDDKTWSKLFPSIVSDPDRSSNFMIRAIYVVFSAVLRQRNILEKEYFSKNYITENLSCMTLS
FKNLRAHQIAQLLRAAGDATKDGFLKEISLVVTEHDGDVEAIEVFSMKFIYFENGGVVARLSTDNNDQEDPHFAELAQLR
YEGAESVRDQMVTIVRSVQFLCTKVLEPLPAEFTANFRLKYTNDAPSNFRIDGFDDSSTFYTLPDGIQSVTIGHLRPGHH
AAHMQCWSKSMSD
;
1 ? 
2 PDB 4TZM         4TZM   2 ? 1 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4TZM A 1 ? 253 ? Q95XC8 1   ? 253 ? 1   253 
2 1 4TZM B 1 ? 253 ? Q95XC8 1   ? 253 ? 1   253 
3 2 4TZM C 1 ? 16  ? 4TZM   486 ? 501 ? 486 501 
4 2 4TZM D 1 ? 16  ? 4TZM   486 ? 501 ? 486 501 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4TZM 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.44 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         49.55 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            298.15 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '15-22% PEG 3350' 
_exptl_crystal_grow.pdbx_pH_range   7.5-8.0 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315r' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2013-07-14 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ALS BEAMLINE 8.2.1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.0 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   8.2.1 
_diffrn_source.pdbx_synchrotron_site       ALS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         4TZM 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.3 
_reflns.d_resolution_low                 30 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       24989 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             93.8 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.3 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  0.087 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            14.5 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 4TZM 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.3 
_refine.ls_d_res_low                             28.465 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     24692 
_refine.ls_number_reflns_R_free                  1269 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    92.65 
_refine.ls_percent_reflns_R_free                 5.14 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2036 
_refine.ls_R_factor_R_free                       0.2164 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2029 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.37 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4TZL 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 31.35 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.26 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3944 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             56 
_refine_hist.number_atoms_total               4000 
_refine_hist.d_res_high                       2.3 
_refine_hist.d_res_low                        28.465 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.003  ? 4025 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.647  ? 5431 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 12.950 ? 1478 ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.027  ? 600  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.003  ? 700  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
'X-RAY DIFFRACTION' 2.3    2.3809  . . 100 1967 70.00  . . . 0.3392 . 0.2725 . . . . . . . . 
'X-RAY DIFFRACTION' 2.3809 2.4892  . . 130 2226 81.00  . . . 0.3099 . 0.2701 . . . . . . . . 
'X-RAY DIFFRACTION' 2.4892 2.6204  . . 123 2485 88.00  . . . 0.3528 . 0.2585 . . . . . . . . 
'X-RAY DIFFRACTION' 2.6204 2.7844  . . 173 2688 97.00  . . . 0.2935 . 0.2446 . . . . . . . . 
'X-RAY DIFFRACTION' 2.7844 2.9992  . . 129 2798 99.00  . . . 0.2814 . 0.2431 . . . . . . . . 
'X-RAY DIFFRACTION' 2.9992 3.3006  . . 161 2781 100.00 . . . 0.3042 . 0.2396 . . . . . . . . 
'X-RAY DIFFRACTION' 3.3006 3.7773  . . 136 2812 100.00 . . . 0.2224 . 0.2026 . . . . . . . . 
'X-RAY DIFFRACTION' 3.7773 4.7554  . . 149 2824 99.00  . . . 0.1798 . 0.1659 . . . . . . . . 
'X-RAY DIFFRACTION' 4.7554 28.4670 . . 168 2842 99.00  . . . 0.1618 . 0.1834 . . . . . . . . 
# 
_struct.entry_id                     4TZM 
_struct.title                        'C. elegans HTP-2 bound to HTP-3 closure motif 1' 
_struct.pdbx_descriptor              'Protein HTP-2,  C. elegans HTP-3 closure motif1' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4TZM 
_struct_keywords.text            'HORMA domain, Meiosis, Chromosome axis, Peptide binding protein' 
_struct_keywords.pdbx_keywords   'PEPTIDE BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 THR A 23  ? LEU A 27  ? THR A 23  LEU A 27  5 ? 5  
HELX_P HELX_P2  AA2 ASP A 34  ? ARG A 57  ? ASP A 34  ARG A 57  1 ? 24 
HELX_P HELX_P3  AA3 GLU A 61  ? GLU A 63  ? GLU A 61  GLU A 63  5 ? 3  
HELX_P HELX_P4  AA4 ASN A 83  ? GLY A 103 ? ASN A 83  GLY A 103 1 ? 21 
HELX_P HELX_P5  AA5 HIS A 152 ? LEU A 159 ? HIS A 152 LEU A 159 1 ? 8  
HELX_P HELX_P6  AA6 GLY A 163 ? VAL A 185 ? GLY A 163 VAL A 185 1 ? 23 
HELX_P HELX_P7  AA7 THR B 23  ? PHE B 28  ? THR B 23  PHE B 28  1 ? 6  
HELX_P HELX_P8  AA8 ASP B 34  ? ARG B 57  ? ASP B 34  ARG B 57  1 ? 24 
HELX_P HELX_P9  AA9 GLU B 61  ? GLU B 63  ? GLU B 61  GLU B 63  5 ? 3  
HELX_P HELX_P10 AB1 ASN B 83  ? GLY B 103 ? ASN B 83  GLY B 103 1 ? 21 
HELX_P HELX_P11 AB2 HIS B 152 ? LEU B 159 ? HIS B 152 LEU B 159 1 ? 8  
HELX_P HELX_P12 AB3 GLY B 163 ? VAL B 185 ? GLY B 163 VAL B 185 1 ? 23 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ASP 116 B . ? ASP 116 B GLY 117 B ? GLY 117 B 1 1.07  
2 GLU 133 B . ? GLU 133 B ASN 134 B ? ASN 134 B 1 -1.22 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 6 ? 
AA3 ? 6 ? 
AA4 ? 2 ? 
AA5 ? 7 ? 
AA6 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA2 5 6 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA3 4 5 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA5 4 5 ? anti-parallel 
AA5 5 6 ? anti-parallel 
AA5 6 7 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 PHE A 65  ? TYR A 69  ? PHE A 65  TYR A 69  
AA1 2 SER A 75  ? LEU A 79  ? SER A 75  LEU A 79  
AA2 1 VAL A 138 ? ALA A 139 ? VAL A 138 ALA A 139 
AA2 2 GLU A 123 ? GLU A 133 ? GLU A 123 GLU A 133 
AA2 3 LEU A 105 ? THR A 113 ? LEU A 105 THR A 113 
AA2 4 PHE A 193 ? TYR A 201 ? PHE A 193 TYR A 201 
AA2 5 HIS A 240 ? SER A 248 ? HIS A 240 SER A 248 
AA2 6 GLN A 228 ? LEU A 235 ? GLN A 228 LEU A 235 
AA3 1 PHE A 214 ? SER A 217 ? PHE A 214 SER A 217 
AA3 2 TYR C 4   ? SER C 7   ? TYR C 489 SER C 492 
AA3 3 PHE A 193 ? TYR A 201 ? PHE A 193 TYR A 201 
AA3 4 LEU A 105 ? THR A 113 ? LEU A 105 THR A 113 
AA3 5 GLU A 123 ? GLU A 133 ? GLU A 123 GLU A 133 
AA3 6 ILE C 11  ? ARG C 13  ? ILE C 496 ARG C 498 
AA4 1 PHE B 65  ? TYR B 69  ? PHE B 65  TYR B 69  
AA4 2 SER B 75  ? LEU B 79  ? SER B 75  LEU B 79  
AA5 1 PHE B 214 ? SER B 217 ? PHE B 214 SER B 217 
AA5 2 TYR D 4   ? SER D 7   ? TYR D 489 SER D 492 
AA5 3 PHE B 193 ? TYR B 201 ? PHE B 193 TYR B 201 
AA5 4 LEU B 105 ? THR B 113 ? LEU B 105 THR B 113 
AA5 5 GLU B 123 ? TYR B 131 ? GLU B 123 TYR B 131 
AA5 6 HIS B 240 ? SER B 248 ? HIS B 240 SER B 248 
AA5 7 GLN B 228 ? LEU B 235 ? GLN B 228 LEU B 235 
AA6 1 PHE B 214 ? SER B 217 ? PHE B 214 SER B 217 
AA6 2 TYR D 4   ? SER D 7   ? TYR D 489 SER D 492 
AA6 3 PHE B 193 ? TYR B 201 ? PHE B 193 TYR B 201 
AA6 4 ILE D 11  ? ARG D 13  ? ILE D 496 ARG D 498 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ASN A 68  ? N ASN A 68  O CYS A 76  ? O CYS A 76  
AA2 1 2 O VAL A 138 ? O VAL A 138 N GLU A 133 ? N GLU A 133 
AA2 2 3 O GLU A 123 ? O GLU A 123 N VAL A 112 ? N VAL A 112 
AA2 3 4 N THR A 113 ? N THR A 113 O THR A 194 ? O THR A 194 
AA2 5 6 O MET A 244 ? O MET A 244 N GLY A 233 ? N GLY A 233 
AA3 1 2 N ASP A 215 ? N ASP A 215 O VAL C 6   ? O VAL C 491 
AA3 2 3 O GLY C 5   ? O GLY C 490 N LEU A 199 ? N LEU A 199 
AA3 3 4 O THR A 194 ? O THR A 194 N THR A 113 ? N THR A 113 
AA3 4 5 N VAL A 112 ? N VAL A 112 O GLU A 123 ? O GLU A 123 
AA4 1 2 N SER B 66  ? N SER B 66  O THR B 78  ? O THR B 78  
AA5 1 2 N ASP B 215 ? N ASP B 215 O VAL D 6   ? O VAL D 491 
AA5 2 3 O GLY D 5   ? O GLY D 490 N LEU B 199 ? N LEU B 199 
AA5 3 4 O ASN B 196 ? O ASN B 196 N VAL B 111 ? N VAL B 111 
AA5 4 5 N VAL B 112 ? N VAL B 112 O GLU B 123 ? O GLU B 123 
AA5 5 6 N VAL B 124 ? N VAL B 124 O TRP B 247 ? O TRP B 247 
AA5 6 7 O MET B 244 ? O MET B 244 N GLY B 233 ? N GLY B 233 
AA6 1 2 N ASP B 215 ? N ASP B 215 O VAL D 6   ? O VAL D 491 
AA6 2 3 O GLY D 5   ? O GLY D 490 N LEU B 199 ? N LEU B 199 
AA6 3 4 N ALA B 195 ? N ALA B 195 O ILE D 11  ? O ILE D 496 
# 
_atom_sites.entry_id                    4TZM 
_atom_sites.fract_transf_matrix[1][1]   0.020975 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000100 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015150 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010565 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASN A 1 6   ? -159.403 56.485 113.128 1.00 109.45 ? 6   ASN A N   1 
ATOM   2    C CA  . ASN A 1 6   ? -158.728 55.195 113.050 1.00 107.89 ? 6   ASN A CA  1 
ATOM   3    C C   . ASN A 1 6   ? -159.372 54.175 113.980 1.00 109.17 ? 6   ASN A C   1 
ATOM   4    O O   . ASN A 1 6   ? -159.392 52.978 113.688 1.00 113.31 ? 6   ASN A O   1 
ATOM   5    C CB  . ASN A 1 6   ? -157.242 55.349 113.382 1.00 104.12 ? 6   ASN A CB  1 
ATOM   6    C CG  . ASN A 1 6   ? -156.593 56.488 112.621 1.00 102.74 ? 6   ASN A CG  1 
ATOM   7    O OD1 . ASN A 1 6   ? -157.120 56.948 111.609 1.00 105.29 ? 6   ASN A OD1 1 
ATOM   8    N ND2 . ASN A 1 6   ? -155.444 56.950 113.105 1.00 98.86  ? 6   ASN A ND2 1 
ATOM   9    N N   . ASN A 1 7   ? -159.892 54.656 115.105 1.00 102.35 ? 7   ASN A N   1 
ATOM   10   C CA  . ASN A 1 7   ? -160.639 53.809 116.027 1.00 101.09 ? 7   ASN A CA  1 
ATOM   11   C C   . ASN A 1 7   ? -162.138 53.967 115.796 1.00 100.76 ? 7   ASN A C   1 
ATOM   12   O O   . ASN A 1 7   ? -162.742 54.945 116.236 1.00 99.69  ? 7   ASN A O   1 
ATOM   13   C CB  . ASN A 1 7   ? -160.283 54.143 117.478 1.00 99.28  ? 7   ASN A CB  1 
ATOM   14   C CG  . ASN A 1 7   ? -160.950 53.208 118.476 1.00 103.25 ? 7   ASN A CG  1 
ATOM   15   O OD1 . ASN A 1 7   ? -161.494 52.166 118.106 1.00 107.13 ? 7   ASN A OD1 1 
ATOM   16   N ND2 . ASN A 1 7   ? -160.903 53.576 119.751 1.00 102.01 ? 7   ASN A ND2 1 
ATOM   17   N N   . TYR A 1 8   ? -162.732 53.001 115.102 1.00 101.63 ? 8   TYR A N   1 
ATOM   18   C CA  . TYR A 1 8   ? -164.138 53.093 114.726 1.00 102.99 ? 8   TYR A CA  1 
ATOM   19   C C   . TYR A 1 8   ? -165.065 52.503 115.782 1.00 103.54 ? 8   TYR A C   1 
ATOM   20   O O   . TYR A 1 8   ? -166.282 52.461 115.597 1.00 105.81 ? 8   TYR A O   1 
ATOM   21   C CB  . TYR A 1 8   ? -164.373 52.412 113.376 1.00 106.29 ? 8   TYR A CB  1 
ATOM   22   C CG  . TYR A 1 8   ? -163.736 53.145 112.220 1.00 104.22 ? 8   TYR A CG  1 
ATOM   23   C CD1 . TYR A 1 8   ? -164.102 54.451 111.918 1.00 103.49 ? 8   TYR A CD1 1 
ATOM   24   C CD2 . TYR A 1 8   ? -162.771 52.536 111.431 1.00 102.92 ? 8   TYR A CD2 1 
ATOM   25   C CE1 . TYR A 1 8   ? -163.523 55.130 110.864 1.00 101.94 ? 8   TYR A CE1 1 
ATOM   26   C CE2 . TYR A 1 8   ? -162.187 53.206 110.373 1.00 101.65 ? 8   TYR A CE2 1 
ATOM   27   C CZ  . TYR A 1 8   ? -162.567 54.503 110.095 1.00 101.55 ? 8   TYR A CZ  1 
ATOM   28   O OH  . TYR A 1 8   ? -161.989 55.175 109.043 1.00 100.95 ? 8   TYR A OH  1 
ATOM   29   N N   . ASN A 1 9   ? -164.486 52.057 116.890 1.00 101.66 ? 9   ASN A N   1 
ATOM   30   C CA  . ASN A 1 9   ? -165.277 51.572 118.013 1.00 104.03 ? 9   ASN A CA  1 
ATOM   31   C C   . ASN A 1 9   ? -165.800 52.724 118.866 1.00 103.50 ? 9   ASN A C   1 
ATOM   32   O O   . ASN A 1 9   ? -166.651 52.531 119.730 1.00 105.68 ? 9   ASN A O   1 
ATOM   33   C CB  . ASN A 1 9   ? -164.456 50.609 118.877 1.00 100.37 ? 9   ASN A CB  1 
ATOM   34   C CG  . ASN A 1 9   ? -164.370 49.214 118.283 1.00 101.13 ? 9   ASN A CG  1 
ATOM   35   O OD1 . ASN A 1 9   ? -165.294 48.752 117.616 1.00 104.74 ? 9   ASN A OD1 1 
ATOM   36   N ND2 . ASN A 1 9   ? -163.258 48.533 118.533 1.00 98.87  ? 9   ASN A ND2 1 
ATOM   37   N N   . GLU A 1 10  ? -165.288 53.926 118.619 1.00 102.07 ? 10  GLU A N   1 
ATOM   38   C CA  . GLU A 1 10  ? -165.697 55.091 119.396 1.00 105.79 ? 10  GLU A CA  1 
ATOM   39   C C   . GLU A 1 10  ? -165.963 56.330 118.537 1.00 104.47 ? 10  GLU A C   1 
ATOM   40   O O   . GLU A 1 10  ? -166.605 57.274 118.998 1.00 104.40 ? 10  GLU A O   1 
ATOM   41   C CB  . GLU A 1 10  ? -164.640 55.419 120.463 1.00 104.34 ? 10  GLU A CB  1 
ATOM   42   C CG  . GLU A 1 10  ? -164.773 54.616 121.761 1.00 109.81 ? 10  GLU A CG  1 
ATOM   43   C CD  . GLU A 1 10  ? -164.036 53.287 121.726 1.00 113.85 ? 10  GLU A CD  1 
ATOM   44   O OE1 . GLU A 1 10  ? -162.936 53.230 121.137 1.00 112.84 ? 10  GLU A OE1 1 
ATOM   45   O OE2 . GLU A 1 10  ? -164.557 52.299 122.289 1.00 116.53 ? 10  GLU A OE2 1 
ATOM   46   N N   . SER A 1 11  ? -165.488 56.323 117.295 1.00 101.76 ? 11  SER A N   1 
ATOM   47   C CA  . SER A 1 11  ? -165.636 57.490 116.427 1.00 100.02 ? 11  SER A CA  1 
ATOM   48   C C   . SER A 1 11  ? -165.536 57.160 114.936 1.00 104.88 ? 11  SER A C   1 
ATOM   49   O O   . SER A 1 11  ? -164.721 56.335 114.524 1.00 100.47 ? 11  SER A O   1 
ATOM   50   C CB  . SER A 1 11  ? -164.584 58.543 116.784 1.00 91.38  ? 11  SER A CB  1 
ATOM   51   O OG  . SER A 1 11  ? -164.676 59.664 115.923 1.00 89.64  ? 11  SER A OG  1 
ATOM   52   N N   . LEU A 1 12  ? -166.372 57.818 114.136 1.00 112.85 ? 12  LEU A N   1 
ATOM   53   C CA  . LEU A 1 12  ? -166.331 57.682 112.682 1.00 117.79 ? 12  LEU A CA  1 
ATOM   54   C C   . LEU A 1 12  ? -165.415 58.732 112.058 1.00 114.83 ? 12  LEU A C   1 
ATOM   55   O O   . LEU A 1 12  ? -165.080 58.657 110.875 1.00 84.63  ? 12  LEU A O   1 
ATOM   56   C CB  . LEU A 1 12  ? -167.735 57.804 112.092 1.00 93.50  ? 12  LEU A CB  1 
ATOM   57   C CG  . LEU A 1 12  ? -168.733 56.709 112.461 1.00 98.55  ? 12  LEU A CG  1 
ATOM   58   C CD1 . LEU A 1 12  ? -170.139 57.206 112.216 1.00 103.75 ? 12  LEU A CD1 1 
ATOM   59   C CD2 . LEU A 1 12  ? -168.463 55.443 111.662 1.00 100.98 ? 12  LEU A CD2 1 
ATOM   60   N N   . ASN A 1 13  ? -165.026 59.717 112.860 1.00 109.42 ? 13  ASN A N   1 
ATOM   61   C CA  . ASN A 1 13  ? -164.116 60.761 112.406 1.00 103.86 ? 13  ASN A CA  1 
ATOM   62   C C   . ASN A 1 13  ? -162.670 60.279 112.460 1.00 101.12 ? 13  ASN A C   1 
ATOM   63   O O   . ASN A 1 13  ? -162.329 59.411 113.265 1.00 98.28  ? 13  ASN A O   1 
ATOM   64   C CB  . ASN A 1 13  ? -164.286 62.026 113.252 1.00 97.77  ? 13  ASN A CB  1 
ATOM   65   C CG  . ASN A 1 13  ? -165.706 62.571 113.214 1.00 101.30 ? 13  ASN A CG  1 
ATOM   66   O OD1 . ASN A 1 13  ? -166.671 61.820 113.062 1.00 104.81 ? 13  ASN A OD1 1 
ATOM   67   N ND2 . ASN A 1 13  ? -165.837 63.885 113.351 1.00 101.04 ? 13  ASN A ND2 1 
ATOM   68   N N   . LYS A 1 14  ? -161.823 60.831 111.597 1.00 103.05 ? 14  LYS A N   1 
ATOM   69   C CA  . LYS A 1 14  ? -160.407 60.479 111.601 1.00 104.20 ? 14  LYS A CA  1 
ATOM   70   C C   . LYS A 1 14  ? -159.742 60.987 112.875 1.00 105.30 ? 14  LYS A C   1 
ATOM   71   O O   . LYS A 1 14  ? -160.065 62.073 113.360 1.00 103.34 ? 14  LYS A O   1 
ATOM   72   C CB  . LYS A 1 14  ? -159.699 61.050 110.369 1.00 104.01 ? 14  LYS A CB  1 
ATOM   73   C CG  . LYS A 1 14  ? -160.163 60.455 109.048 1.00 110.08 ? 14  LYS A CG  1 
ATOM   74   C CD  . LYS A 1 14  ? -159.427 61.075 107.869 1.00 110.75 ? 14  LYS A CD  1 
ATOM   75   C CE  . LYS A 1 14  ? -159.887 60.467 106.552 1.00 115.94 ? 14  LYS A CE  1 
ATOM   76   N NZ  . LYS A 1 14  ? -159.192 61.073 105.381 1.00 115.88 ? 14  LYS A NZ  1 
ATOM   77   N N   . SER A 1 15  ? -158.821 60.196 113.419 1.00 107.84 ? 15  SER A N   1 
ATOM   78   C CA  . SER A 1 15  ? -158.108 60.577 114.635 1.00 106.19 ? 15  SER A CA  1 
ATOM   79   C C   . SER A 1 15  ? -157.160 61.743 114.372 1.00 104.51 ? 15  SER A C   1 
ATOM   80   O O   . SER A 1 15  ? -156.521 61.813 113.323 1.00 106.36 ? 15  SER A O   1 
ATOM   81   C CB  . SER A 1 15  ? -157.330 59.387 115.205 1.00 105.89 ? 15  SER A CB  1 
ATOM   82   O OG  . SER A 1 15  ? -158.203 58.409 115.745 1.00 109.58 ? 15  SER A OG  1 
ATOM   83   N N   . LYS A 1 16  ? -157.084 62.662 115.328 1.00 97.05  ? 16  LYS A N   1 
ATOM   84   C CA  . LYS A 1 16  ? -156.157 63.784 115.245 1.00 90.56  ? 16  LYS A CA  1 
ATOM   85   C C   . LYS A 1 16  ? -155.174 63.763 116.407 1.00 82.21  ? 16  LYS A C   1 
ATOM   86   O O   . LYS A 1 16  ? -155.580 63.615 117.559 1.00 81.67  ? 16  LYS A O   1 
ATOM   87   C CB  . LYS A 1 16  ? -156.916 65.114 115.235 1.00 93.56  ? 16  LYS A CB  1 
ATOM   88   C CG  . LYS A 1 16  ? -157.315 65.608 113.854 1.00 98.68  ? 16  LYS A CG  1 
ATOM   89   C CD  . LYS A 1 16  ? -157.835 67.035 113.918 1.00 100.09 ? 16  LYS A CD  1 
ATOM   90   C CE  . LYS A 1 16  ? -158.048 67.613 112.529 1.00 102.64 ? 16  LYS A CE  1 
ATOM   91   N NZ  . LYS A 1 16  ? -158.500 69.033 112.586 1.00 103.37 ? 16  LYS A NZ  1 
ATOM   92   N N   . ASP A 1 17  ? -153.885 63.917 116.114 1.00 74.27  ? 17  ASP A N   1 
ATOM   93   C CA  . ASP A 1 17  ? -152.890 63.990 117.177 1.00 68.91  ? 17  ASP A CA  1 
ATOM   94   C C   . ASP A 1 17  ? -153.096 65.276 117.970 1.00 68.04  ? 17  ASP A C   1 
ATOM   95   O O   . ASP A 1 17  ? -152.419 66.281 117.748 1.00 66.99  ? 17  ASP A O   1 
ATOM   96   C CB  . ASP A 1 17  ? -151.471 63.936 116.618 1.00 64.78  ? 17  ASP A CB  1 
ATOM   97   C CG  . ASP A 1 17  ? -150.414 64.084 117.698 1.00 60.57  ? 17  ASP A CG  1 
ATOM   98   O OD1 . ASP A 1 17  ? -150.687 63.698 118.852 1.00 62.17  ? 17  ASP A OD1 1 
ATOM   99   O OD2 . ASP A 1 17  ? -149.315 64.599 117.396 1.00 56.61  ? 17  ASP A OD2 1 
ATOM   100  N N   . ALA A 1 18  ? -154.050 65.233 118.891 1.00 68.01  ? 18  ALA A N   1 
ATOM   101  C CA  . ALA A 1 18  ? -154.382 66.374 119.726 1.00 67.61  ? 18  ALA A CA  1 
ATOM   102  C C   . ALA A 1 18  ? -155.092 65.899 120.980 1.00 68.69  ? 18  ALA A C   1 
ATOM   103  O O   . ALA A 1 18  ? -155.724 64.844 120.984 1.00 69.31  ? 18  ALA A O   1 
ATOM   104  C CB  . ALA A 1 18  ? -155.248 67.361 118.961 1.00 67.43  ? 18  ALA A CB  1 
ATOM   105  N N   . ILE A 1 19  ? -154.986 66.678 122.047 1.00 69.46  ? 19  ILE A N   1 
ATOM   106  C CA  . ILE A 1 19  ? -155.625 66.311 123.300 1.00 75.51  ? 19  ILE A CA  1 
ATOM   107  C C   . ILE A 1 19  ? -157.055 66.838 123.362 1.00 88.52  ? 19  ILE A C   1 
ATOM   108  O O   . ILE A 1 19  ? -157.296 68.038 123.223 1.00 90.81  ? 19  ILE A O   1 
ATOM   109  C CB  . ILE A 1 19  ? -154.820 66.826 124.506 1.00 69.57  ? 19  ILE A CB  1 
ATOM   110  C CG1 . ILE A 1 19  ? -153.519 66.029 124.635 1.00 66.85  ? 19  ILE A CG1 1 
ATOM   111  C CG2 . ILE A 1 19  ? -155.636 66.717 125.790 1.00 66.71  ? 19  ILE A CG2 1 
ATOM   112  C CD1 . ILE A 1 19  ? -152.427 66.749 125.386 1.00 64.04  ? 19  ILE A CD1 1 
ATOM   113  N N   . ASP A 1 20  ? -158.002 65.926 123.553 1.00 98.45  ? 20  ASP A N   1 
ATOM   114  C CA  . ASP A 1 20  ? -159.401 66.299 123.703 1.00 104.16 ? 20  ASP A CA  1 
ATOM   115  C C   . ASP A 1 20  ? -159.778 66.272 125.179 1.00 104.55 ? 20  ASP A C   1 
ATOM   116  O O   . ASP A 1 20  ? -160.359 65.302 125.667 1.00 107.68 ? 20  ASP A O   1 
ATOM   117  C CB  . ASP A 1 20  ? -160.304 65.362 122.900 1.00 110.24 ? 20  ASP A CB  1 
ATOM   118  C CG  . ASP A 1 20  ? -161.662 65.972 122.607 1.00 117.46 ? 20  ASP A CG  1 
ATOM   119  O OD1 . ASP A 1 20  ? -161.726 67.200 122.386 1.00 118.75 ? 20  ASP A OD1 1 
ATOM   120  O OD2 . ASP A 1 20  ? -162.663 65.225 122.596 1.00 121.76 ? 20  ASP A OD2 1 
ATOM   121  N N   . ASP A 1 21  ? -159.428 67.342 125.886 1.00 97.12  ? 21  ASP A N   1 
ATOM   122  C CA  . ASP A 1 21  ? -159.695 67.447 127.316 1.00 92.79  ? 21  ASP A CA  1 
ATOM   123  C C   . ASP A 1 21  ? -159.896 68.909 127.711 1.00 86.48  ? 21  ASP A C   1 
ATOM   124  O O   . ASP A 1 21  ? -159.047 69.759 127.436 1.00 83.45  ? 21  ASP A O   1 
ATOM   125  C CB  . ASP A 1 21  ? -158.552 66.820 128.122 1.00 91.78  ? 21  ASP A CB  1 
ATOM   126  C CG  . ASP A 1 21  ? -158.808 66.845 129.618 1.00 93.41  ? 21  ASP A CG  1 
ATOM   127  O OD1 . ASP A 1 21  ? -158.444 67.847 130.266 1.00 91.21  ? 21  ASP A OD1 1 
ATOM   128  O OD2 . ASP A 1 21  ? -159.369 65.862 130.147 1.00 96.42  ? 21  ASP A OD2 1 
ATOM   129  N N   . LYS A 1 22  ? -161.025 69.190 128.354 1.00 85.30  ? 22  LYS A N   1 
ATOM   130  C CA  . LYS A 1 22  ? -161.397 70.553 128.720 1.00 81.22  ? 22  LYS A CA  1 
ATOM   131  C C   . LYS A 1 22  ? -160.441 71.143 129.758 1.00 77.16  ? 22  LYS A C   1 
ATOM   132  O O   . LYS A 1 22  ? -160.065 72.316 129.680 1.00 76.32  ? 22  LYS A O   1 
ATOM   133  C CB  . LYS A 1 22  ? -162.835 70.580 129.246 1.00 84.52  ? 22  LYS A CB  1 
ATOM   134  C CG  . LYS A 1 22  ? -163.473 71.961 129.266 1.00 86.23  ? 22  LYS A CG  1 
ATOM   135  C CD  . LYS A 1 22  ? -163.377 72.633 127.904 1.00 83.03  ? 22  LYS A CD  1 
ATOM   136  C CE  . LYS A 1 22  ? -164.314 73.828 127.808 1.00 81.94  ? 22  LYS A CE  1 
ATOM   137  N NZ  . LYS A 1 22  ? -165.738 73.420 127.971 1.00 84.91  ? 22  LYS A NZ  1 
ATOM   138  N N   . THR A 1 23  ? -160.045 70.316 130.721 1.00 75.08  ? 23  THR A N   1 
ATOM   139  C CA  . THR A 1 23  ? -159.157 70.741 131.798 1.00 72.35  ? 23  THR A CA  1 
ATOM   140  C C   . THR A 1 23  ? -157.753 71.053 131.288 1.00 69.07  ? 23  THR A C   1 
ATOM   141  O O   . THR A 1 23  ? -157.157 72.064 131.664 1.00 67.06  ? 23  THR A O   1 
ATOM   142  C CB  . THR A 1 23  ? -159.058 69.667 132.896 1.00 72.74  ? 23  THR A CB  1 
ATOM   143  O OG1 . THR A 1 23  ? -160.374 69.287 133.322 1.00 77.83  ? 23  THR A OG1 1 
ATOM   144  C CG2 . THR A 1 23  ? -158.269 70.193 134.081 1.00 70.42  ? 23  THR A CG2 1 
ATOM   145  N N   . TRP A 1 24  ? -157.231 70.178 130.433 1.00 68.82  ? 24  TRP A N   1 
ATOM   146  C CA  . TRP A 1 24  ? -155.901 70.357 129.857 1.00 62.76  ? 24  TRP A CA  1 
ATOM   147  C C   . TRP A 1 24  ? -155.794 71.662 129.071 1.00 58.53  ? 24  TRP A C   1 
ATOM   148  O O   . TRP A 1 24  ? -154.781 72.357 129.142 1.00 53.26  ? 24  TRP A O   1 
ATOM   149  C CB  . TRP A 1 24  ? -155.546 69.169 128.954 1.00 59.90  ? 24  TRP A CB  1 
ATOM   150  C CG  . TRP A 1 24  ? -154.243 69.334 128.222 1.00 55.11  ? 24  TRP A CG  1 
ATOM   151  C CD1 . TRP A 1 24  ? -154.067 69.823 126.960 1.00 56.59  ? 24  TRP A CD1 1 
ATOM   152  C CD2 . TRP A 1 24  ? -152.935 69.009 128.712 1.00 52.39  ? 24  TRP A CD2 1 
ATOM   153  N NE1 . TRP A 1 24  ? -152.730 69.824 126.634 1.00 54.87  ? 24  TRP A NE1 1 
ATOM   154  C CE2 . TRP A 1 24  ? -152.013 69.328 127.693 1.00 50.94  ? 24  TRP A CE2 1 
ATOM   155  C CE3 . TRP A 1 24  ? -152.451 68.480 129.914 1.00 52.97  ? 24  TRP A CE3 1 
ATOM   156  C CZ2 . TRP A 1 24  ? -150.637 69.136 127.838 1.00 48.07  ? 24  TRP A CZ2 1 
ATOM   157  C CZ3 . TRP A 1 24  ? -151.085 68.289 130.057 1.00 52.77  ? 24  TRP A CZ3 1 
ATOM   158  C CH2 . TRP A 1 24  ? -150.194 68.617 129.025 1.00 51.10  ? 24  TRP A CH2 1 
ATOM   159  N N   . SER A 1 25  ? -156.848 71.998 128.335 1.00 63.90  ? 25  SER A N   1 
ATOM   160  C CA  . SER A 1 25  ? -156.828 73.171 127.465 1.00 70.93  ? 25  SER A CA  1 
ATOM   161  C C   . SER A 1 25  ? -156.805 74.483 128.247 1.00 73.43  ? 25  SER A C   1 
ATOM   162  O O   . SER A 1 25  ? -156.539 75.542 127.683 1.00 75.39  ? 25  SER A O   1 
ATOM   163  C CB  . SER A 1 25  ? -158.033 73.154 126.522 1.00 75.93  ? 25  SER A CB  1 
ATOM   164  O OG  . SER A 1 25  ? -157.986 72.035 125.656 1.00 77.91  ? 25  SER A OG  1 
ATOM   165  N N   . LYS A 1 26  ? -157.076 74.406 129.544 1.00 74.48  ? 26  LYS A N   1 
ATOM   166  C CA  . LYS A 1 26  ? -157.114 75.593 130.387 1.00 75.63  ? 26  LYS A CA  1 
ATOM   167  C C   . LYS A 1 26  ? -155.713 76.139 130.663 1.00 69.26  ? 26  LYS A C   1 
ATOM   168  O O   . LYS A 1 26  ? -155.546 77.323 130.957 1.00 69.46  ? 26  LYS A O   1 
ATOM   169  C CB  . LYS A 1 26  ? -157.824 75.280 131.707 1.00 82.69  ? 26  LYS A CB  1 
ATOM   170  C CG  . LYS A 1 26  ? -158.126 76.506 132.546 1.00 89.98  ? 26  LYS A CG  1 
ATOM   171  C CD  . LYS A 1 26  ? -158.497 76.138 133.972 1.00 95.99  ? 26  LYS A CD  1 
ATOM   172  C CE  . LYS A 1 26  ? -158.685 77.390 134.816 1.00 100.05 ? 26  LYS A CE  1 
ATOM   173  N NZ  . LYS A 1 26  ? -158.936 77.068 136.248 1.00 102.72 ? 26  LYS A NZ  1 
ATOM   174  N N   . LEU A 1 27  ? -154.706 75.275 130.562 1.00 64.87  ? 27  LEU A N   1 
ATOM   175  C CA  . LEU A 1 27  ? -153.328 75.671 130.848 1.00 58.43  ? 27  LEU A CA  1 
ATOM   176  C C   . LEU A 1 27  ? -152.365 75.435 129.685 1.00 52.90  ? 27  LEU A C   1 
ATOM   177  O O   . LEU A 1 27  ? -151.338 76.109 129.579 1.00 49.98  ? 27  LEU A O   1 
ATOM   178  C CB  . LEU A 1 27  ? -152.811 74.924 132.079 1.00 57.00  ? 27  LEU A CB  1 
ATOM   179  C CG  . LEU A 1 27  ? -153.330 75.390 133.435 1.00 59.02  ? 27  LEU A CG  1 
ATOM   180  C CD1 . LEU A 1 27  ? -152.909 74.416 134.520 1.00 57.81  ? 27  LEU A CD1 1 
ATOM   181  C CD2 . LEU A 1 27  ? -152.811 76.783 133.736 1.00 62.22  ? 27  LEU A CD2 1 
ATOM   182  N N   . PHE A 1 28  ? -152.696 74.482 128.819 1.00 52.97  ? 28  PHE A N   1 
ATOM   183  C CA  . PHE A 1 28  ? -151.769 74.033 127.783 1.00 50.13  ? 28  PHE A CA  1 
ATOM   184  C C   . PHE A 1 28  ? -152.390 74.007 126.387 1.00 50.67  ? 28  PHE A C   1 
ATOM   185  O O   . PHE A 1 28  ? -153.605 73.872 126.253 1.00 54.54  ? 28  PHE A O   1 
ATOM   186  C CB  . PHE A 1 28  ? -151.254 72.637 128.121 1.00 46.50  ? 28  PHE A CB  1 
ATOM   187  C CG  . PHE A 1 28  ? -150.477 72.563 129.402 1.00 45.70  ? 28  PHE A CG  1 
ATOM   188  C CD1 . PHE A 1 28  ? -149.146 72.965 129.455 1.00 45.92  ? 28  PHE A CD1 1 
ATOM   189  C CD2 . PHE A 1 28  ? -151.068 72.071 130.552 1.00 45.87  ? 28  PHE A CD2 1 
ATOM   190  C CE1 . PHE A 1 28  ? -148.422 72.885 130.644 1.00 44.85  ? 28  PHE A CE1 1 
ATOM   191  C CE2 . PHE A 1 28  ? -150.354 71.989 131.740 1.00 47.86  ? 28  PHE A CE2 1 
ATOM   192  C CZ  . PHE A 1 28  ? -149.029 72.395 131.785 1.00 47.48  ? 28  PHE A CZ  1 
ATOM   193  N N   . PRO A 1 29  ? -151.552 74.120 125.339 1.00 49.33  ? 29  PRO A N   1 
ATOM   194  C CA  . PRO A 1 29  ? -152.055 73.940 123.971 1.00 50.56  ? 29  PRO A CA  1 
ATOM   195  C C   . PRO A 1 29  ? -152.470 72.490 123.726 1.00 55.07  ? 29  PRO A C   1 
ATOM   196  O O   . PRO A 1 29  ? -151.826 71.584 124.255 1.00 53.89  ? 29  PRO A O   1 
ATOM   197  C CB  . PRO A 1 29  ? -150.857 74.331 123.096 1.00 43.99  ? 29  PRO A CB  1 
ATOM   198  C CG  . PRO A 1 29  ? -149.658 74.107 123.969 1.00 44.71  ? 29  PRO A CG  1 
ATOM   199  C CD  . PRO A 1 29  ? -150.110 74.431 125.366 1.00 45.39  ? 29  PRO A CD  1 
ATOM   200  N N   . SER A 1 30  ? -153.530 72.276 122.949 1.00 58.87  ? 30  SER A N   1 
ATOM   201  C CA  . SER A 1 30  ? -154.031 70.926 122.694 1.00 60.72  ? 30  SER A CA  1 
ATOM   202  C C   . SER A 1 30  ? -153.222 70.227 121.609 1.00 59.50  ? 30  SER A C   1 
ATOM   203  O O   . SER A 1 30  ? -153.207 68.997 121.524 1.00 60.92  ? 30  SER A O   1 
ATOM   204  C CB  . SER A 1 30  ? -155.508 70.964 122.299 1.00 65.16  ? 30  SER A CB  1 
ATOM   205  O OG  . SER A 1 30  ? -156.314 71.409 123.374 1.00 71.03  ? 30  SER A OG  1 
ATOM   206  N N   . ILE A 1 31  ? -152.560 71.020 120.773 1.00 56.96  ? 31  ILE A N   1 
ATOM   207  C CA  . ILE A 1 31  ? -151.666 70.492 119.752 1.00 54.18  ? 31  ILE A CA  1 
ATOM   208  C C   . ILE A 1 31  ? -150.252 71.001 120.013 1.00 52.10  ? 31  ILE A C   1 
ATOM   209  O O   . ILE A 1 31  ? -150.051 72.192 120.243 1.00 56.27  ? 31  ILE A O   1 
ATOM   210  C CB  . ILE A 1 31  ? -152.120 70.894 118.334 1.00 56.34  ? 31  ILE A CB  1 
ATOM   211  C CG1 . ILE A 1 31  ? -153.539 70.385 118.069 1.00 58.95  ? 31  ILE A CG1 1 
ATOM   212  C CG2 . ILE A 1 31  ? -151.159 70.352 117.287 1.00 56.83  ? 31  ILE A CG2 1 
ATOM   213  C CD1 . ILE A 1 31  ? -154.033 70.636 116.659 1.00 61.88  ? 31  ILE A CD1 1 
ATOM   214  N N   . VAL A 1 32  ? -149.279 70.095 119.992 1.00 48.49  ? 32  VAL A N   1 
ATOM   215  C CA  . VAL A 1 32  ? -147.895 70.444 120.295 1.00 45.42  ? 32  VAL A CA  1 
ATOM   216  C C   . VAL A 1 32  ? -146.928 69.903 119.246 1.00 44.37  ? 32  VAL A C   1 
ATOM   217  O O   . VAL A 1 32  ? -145.720 69.860 119.476 1.00 43.31  ? 32  VAL A O   1 
ATOM   218  C CB  . VAL A 1 32  ? -147.467 69.903 121.679 1.00 45.42  ? 32  VAL A CB  1 
ATOM   219  C CG1 . VAL A 1 32  ? -148.292 70.540 122.784 1.00 42.01  ? 32  VAL A CG1 1 
ATOM   220  C CG2 . VAL A 1 32  ? -147.593 68.380 121.717 1.00 46.21  ? 32  VAL A CG2 1 
ATOM   221  N N   . SER A 1 33  ? -147.461 69.492 118.098 1.00 46.54  ? 33  SER A N   1 
ATOM   222  C CA  . SER A 1 33  ? -146.657 68.832 117.070 1.00 50.37  ? 33  SER A CA  1 
ATOM   223  C C   . SER A 1 33  ? -145.899 69.811 116.168 1.00 53.60  ? 33  SER A C   1 
ATOM   224  O O   . SER A 1 33  ? -144.822 69.487 115.664 1.00 52.30  ? 33  SER A O   1 
ATOM   225  C CB  . SER A 1 33  ? -147.547 67.921 116.219 1.00 52.38  ? 33  SER A CB  1 
ATOM   226  O OG  . SER A 1 33  ? -148.682 68.622 115.740 1.00 57.06  ? 33  SER A OG  1 
ATOM   227  N N   . ASP A 1 34  ? -146.458 71.001 115.966 1.00 53.81  ? 34  ASP A N   1 
ATOM   228  C CA  . ASP A 1 34  ? -145.830 72.011 115.116 1.00 57.22  ? 34  ASP A CA  1 
ATOM   229  C C   . ASP A 1 34  ? -144.876 72.892 115.937 1.00 54.23  ? 34  ASP A C   1 
ATOM   230  O O   . ASP A 1 34  ? -145.048 73.020 117.147 1.00 53.00  ? 34  ASP A O   1 
ATOM   231  C CB  . ASP A 1 34  ? -146.903 72.859 114.419 1.00 63.13  ? 34  ASP A CB  1 
ATOM   232  C CG  . ASP A 1 34  ? -147.716 73.679 115.390 1.00 67.92  ? 34  ASP A CG  1 
ATOM   233  O OD1 . ASP A 1 34  ? -148.719 73.153 115.915 1.00 73.14  ? 34  ASP A OD1 1 
ATOM   234  O OD2 . ASP A 1 34  ? -147.354 74.851 115.623 1.00 67.56  ? 34  ASP A OD2 1 
ATOM   235  N N   . PRO A 1 35  ? -143.861 73.490 115.281 1.00 50.10  ? 35  PRO A N   1 
ATOM   236  C CA  . PRO A 1 35  ? -142.787 74.232 115.962 1.00 47.28  ? 35  PRO A CA  1 
ATOM   237  C C   . PRO A 1 35  ? -143.247 75.328 116.925 1.00 50.47  ? 35  PRO A C   1 
ATOM   238  O O   . PRO A 1 35  ? -142.698 75.431 118.022 1.00 51.41  ? 35  PRO A O   1 
ATOM   239  C CB  . PRO A 1 35  ? -142.012 74.860 114.802 1.00 45.46  ? 35  PRO A CB  1 
ATOM   240  C CG  . PRO A 1 35  ? -142.227 73.922 113.663 1.00 45.27  ? 35  PRO A CG  1 
ATOM   241  C CD  . PRO A 1 35  ? -143.637 73.427 113.823 1.00 46.99  ? 35  PRO A CD  1 
ATOM   242  N N   . ASP A 1 36  ? -144.213 76.145 116.518 1.00 50.57  ? 36  ASP A N   1 
ATOM   243  C CA  . ASP A 1 36  ? -144.677 77.236 117.365 1.00 51.45  ? 36  ASP A CA  1 
ATOM   244  C C   . ASP A 1 36  ? -145.431 76.731 118.594 1.00 50.19  ? 36  ASP A C   1 
ATOM   245  O O   . ASP A 1 36  ? -145.215 77.219 119.703 1.00 45.66  ? 36  ASP A O   1 
ATOM   246  C CB  . ASP A 1 36  ? -145.560 78.198 116.566 1.00 59.02  ? 36  ASP A CB  1 
ATOM   247  C CG  . ASP A 1 36  ? -144.749 79.196 115.756 1.00 72.93  ? 36  ASP A CG  1 
ATOM   248  O OD1 . ASP A 1 36  ? -143.587 79.457 116.130 1.00 76.67  ? 36  ASP A OD1 1 
ATOM   249  O OD2 . ASP A 1 36  ? -145.274 79.721 114.750 1.00 78.34  ? 36  ASP A OD2 1 
ATOM   250  N N   . ARG A 1 37  ? -146.311 75.754 118.399 1.00 49.35  ? 37  ARG A N   1 
ATOM   251  C CA  . ARG A 1 37  ? -147.103 75.236 119.508 1.00 51.12  ? 37  ARG A CA  1 
ATOM   252  C C   . ARG A 1 37  ? -146.288 74.289 120.393 1.00 49.92  ? 37  ARG A C   1 
ATOM   253  O O   . ARG A 1 37  ? -146.607 74.099 121.566 1.00 52.64  ? 37  ARG A O   1 
ATOM   254  C CB  . ARG A 1 37  ? -148.367 74.549 118.984 1.00 54.37  ? 37  ARG A CB  1 
ATOM   255  C CG  . ARG A 1 37  ? -149.544 75.509 118.840 1.00 59.23  ? 37  ARG A CG  1 
ATOM   256  C CD  . ARG A 1 37  ? -150.791 74.835 118.290 1.00 63.24  ? 37  ARG A CD  1 
ATOM   257  N NE  . ARG A 1 37  ? -150.677 74.545 116.864 1.00 66.98  ? 37  ARG A NE  1 
ATOM   258  C CZ  . ARG A 1 37  ? -151.671 74.084 116.112 1.00 72.37  ? 37  ARG A CZ  1 
ATOM   259  N NH1 . ARG A 1 37  ? -152.862 73.858 116.649 1.00 74.52  ? 37  ARG A NH1 1 
ATOM   260  N NH2 . ARG A 1 37  ? -151.476 73.848 114.821 1.00 74.53  ? 37  ARG A NH2 1 
ATOM   261  N N   . SER A 1 38  ? -145.230 73.713 119.830 1.00 47.70  ? 38  SER A N   1 
ATOM   262  C CA  . SER A 1 38  ? -144.278 72.915 120.599 1.00 44.99  ? 38  SER A CA  1 
ATOM   263  C C   . SER A 1 38  ? -143.532 73.818 121.571 1.00 43.94  ? 38  SER A C   1 
ATOM   264  O O   . SER A 1 38  ? -143.215 73.432 122.702 1.00 40.00  ? 38  SER A O   1 
ATOM   265  C CB  . SER A 1 38  ? -143.292 72.209 119.668 1.00 39.82  ? 38  SER A CB  1 
ATOM   266  O OG  . SER A 1 38  ? -142.172 71.709 120.377 1.00 41.04  ? 38  SER A OG  1 
ATOM   267  N N   . SER A 1 39  ? -143.265 75.030 121.096 1.00 43.69  ? 39  SER A N   1 
ATOM   268  C CA  . SER A 1 39  ? -142.558 76.057 121.840 1.00 44.78  ? 39  SER A CA  1 
ATOM   269  C C   . SER A 1 39  ? -143.490 76.733 122.844 1.00 42.95  ? 39  SER A C   1 
ATOM   270  O O   . SER A 1 39  ? -143.091 77.051 123.967 1.00 41.88  ? 39  SER A O   1 
ATOM   271  C CB  . SER A 1 39  ? -141.979 77.087 120.872 1.00 52.63  ? 39  SER A CB  1 
ATOM   272  O OG  . SER A 1 39  ? -141.066 77.938 121.530 1.00 60.00  ? 39  SER A OG  1 
ATOM   273  N N   . ASN A 1 40  ? -144.737 76.946 122.434 1.00 40.40  ? 40  ASN A N   1 
ATOM   274  C CA  . ASN A 1 40  ? -145.743 77.482 123.338 1.00 35.89  ? 40  ASN A CA  1 
ATOM   275  C C   . ASN A 1 40  ? -145.975 76.533 124.493 1.00 40.42  ? 40  ASN A C   1 
ATOM   276  O O   . ASN A 1 40  ? -146.283 76.958 125.606 1.00 42.37  ? 40  ASN A O   1 
ATOM   277  C CB  . ASN A 1 40  ? -147.058 77.742 122.603 1.00 40.44  ? 40  ASN A CB  1 
ATOM   278  C CG  . ASN A 1 40  ? -146.999 78.980 121.735 1.00 49.62  ? 40  ASN A CG  1 
ATOM   279  O OD1 . ASN A 1 40  ? -146.244 79.903 122.021 1.00 53.51  ? 40  ASN A OD1 1 
ATOM   280  N ND2 . ASN A 1 40  ? -147.793 79.005 120.667 1.00 52.84  ? 40  ASN A ND2 1 
ATOM   281  N N   . PHE A 1 41  ? -145.828 75.238 124.233 1.00 35.76  ? 41  PHE A N   1 
ATOM   282  C CA  . PHE A 1 41  ? -146.001 74.281 125.304 1.00 35.24  ? 41  PHE A CA  1 
ATOM   283  C C   . PHE A 1 41  ? -144.888 74.401 126.349 1.00 30.89  ? 41  PHE A C   1 
ATOM   284  O O   . PHE A 1 41  ? -145.154 74.323 127.543 1.00 41.08  ? 41  PHE A O   1 
ATOM   285  C CB  . PHE A 1 41  ? -146.058 72.845 124.777 1.00 41.03  ? 41  PHE A CB  1 
ATOM   286  C CG  . PHE A 1 41  ? -146.061 71.832 125.875 1.00 37.76  ? 41  PHE A CG  1 
ATOM   287  C CD1 . PHE A 1 41  ? -147.234 71.523 126.537 1.00 39.86  ? 41  PHE A CD1 1 
ATOM   288  C CD2 . PHE A 1 41  ? -144.883 71.239 126.293 1.00 36.44  ? 41  PHE A CD2 1 
ATOM   289  C CE1 . PHE A 1 41  ? -147.239 70.617 127.575 1.00 41.36  ? 41  PHE A CE1 1 
ATOM   290  C CE2 . PHE A 1 41  ? -144.882 70.337 127.328 1.00 40.02  ? 41  PHE A CE2 1 
ATOM   291  C CZ  . PHE A 1 41  ? -146.062 70.024 127.972 1.00 41.58  ? 41  PHE A CZ  1 
ATOM   292  N N   . MET A 1 42  ? -143.645 74.577 125.906 1.00 28.30  ? 42  MET A N   1 
ATOM   293  C CA  . MET A 1 42  ? -142.524 74.680 126.841 1.00 26.29  ? 42  MET A CA  1 
ATOM   294  C C   . MET A 1 42  ? -142.670 75.909 127.739 1.00 37.91  ? 42  MET A C   1 
ATOM   295  O O   . MET A 1 42  ? -142.327 75.872 128.920 1.00 41.84  ? 42  MET A O   1 
ATOM   296  C CB  . MET A 1 42  ? -141.187 74.739 126.094 1.00 25.49  ? 42  MET A CB  1 
ATOM   297  C CG  . MET A 1 42  ? -140.793 73.453 125.376 1.00 30.83  ? 42  MET A CG  1 
ATOM   298  S SD  . MET A 1 42  ? -140.842 72.002 126.447 1.00 41.79  ? 42  MET A SD  1 
ATOM   299  C CE  . MET A 1 42  ? -139.594 70.978 125.690 1.00 63.49  ? 42  MET A CE  1 
ATOM   300  N N   . ILE A 1 43  ? -143.175 76.995 127.162 1.00 39.31  ? 43  ILE A N   1 
ATOM   301  C CA  . ILE A 1 43  ? -143.448 78.219 127.908 1.00 42.18  ? 43  ILE A CA  1 
ATOM   302  C C   . ILE A 1 43  ? -144.433 77.956 129.047 1.00 42.70  ? 43  ILE A C   1 
ATOM   303  O O   . ILE A 1 43  ? -144.204 78.376 130.181 1.00 41.64  ? 43  ILE A O   1 
ATOM   304  C CB  . ILE A 1 43  ? -144.002 79.323 126.980 1.00 43.99  ? 43  ILE A CB  1 
ATOM   305  C CG1 . ILE A 1 43  ? -143.001 79.612 125.857 1.00 45.61  ? 43  ILE A CG1 1 
ATOM   306  C CG2 . ILE A 1 43  ? -144.313 80.587 127.764 1.00 45.67  ? 43  ILE A CG2 1 
ATOM   307  C CD1 . ILE A 1 43  ? -143.394 80.750 124.947 1.00 46.45  ? 43  ILE A CD1 1 
ATOM   308  N N   . ARG A 1 44  ? -145.519 77.251 128.742 1.00 46.77  ? 44  ARG A N   1 
ATOM   309  C CA  . ARG A 1 44  ? -146.512 76.903 129.749 1.00 49.07  ? 44  ARG A CA  1 
ATOM   310  C C   . ARG A 1 44  ? -145.935 75.906 130.751 1.00 47.88  ? 44  ARG A C   1 
ATOM   311  O O   . ARG A 1 44  ? -146.253 75.961 131.934 1.00 51.89  ? 44  ARG A O   1 
ATOM   312  C CB  . ARG A 1 44  ? -147.776 76.332 129.096 1.00 53.19  ? 44  ARG A CB  1 
ATOM   313  C CG  . ARG A 1 44  ? -148.369 77.200 127.987 1.00 58.71  ? 44  ARG A CG  1 
ATOM   314  C CD  . ARG A 1 44  ? -148.698 78.620 128.449 1.00 65.14  ? 44  ARG A CD  1 
ATOM   315  N NE  . ARG A 1 44  ? -149.844 78.674 129.355 1.00 73.54  ? 44  ARG A NE  1 
ATOM   316  C CZ  . ARG A 1 44  ? -149.807 79.202 130.575 1.00 77.80  ? 44  ARG A CZ  1 
ATOM   317  N NH1 . ARG A 1 44  ? -148.679 79.726 131.034 1.00 77.88  ? 44  ARG A NH1 1 
ATOM   318  N NH2 . ARG A 1 44  ? -150.894 79.212 131.336 1.00 80.17  ? 44  ARG A NH2 1 
ATOM   319  N N   . ALA A 1 45  ? -145.075 75.008 130.276 1.00 42.99  ? 45  ALA A N   1 
ATOM   320  C CA  . ALA A 1 45  ? -144.438 74.017 131.143 1.00 42.60  ? 45  ALA A CA  1 
ATOM   321  C C   . ALA A 1 45  ? -143.512 74.666 132.173 1.00 40.92  ? 45  ALA A C   1 
ATOM   322  O O   . ALA A 1 45  ? -143.508 74.283 133.342 1.00 42.45  ? 45  ALA A O   1 
ATOM   323  C CB  . ALA A 1 45  ? -143.665 73.000 130.310 1.00 39.26  ? 45  ALA A CB  1 
ATOM   324  N N   . ILE A 1 46  ? -142.724 75.644 131.736 1.00 43.18  ? 46  ILE A N   1 
ATOM   325  C CA  . ILE A 1 46  ? -141.852 76.382 132.642 1.00 43.59  ? 46  ILE A CA  1 
ATOM   326  C C   . ILE A 1 46  ? -142.679 77.061 133.726 1.00 42.18  ? 46  ILE A C   1 
ATOM   327  O O   . ILE A 1 46  ? -142.341 77.004 134.908 1.00 41.75  ? 46  ILE A O   1 
ATOM   328  C CB  . ILE A 1 46  ? -141.017 77.447 131.895 1.00 45.97  ? 46  ILE A CB  1 
ATOM   329  C CG1 . ILE A 1 46  ? -140.061 76.784 130.899 1.00 46.18  ? 46  ILE A CG1 1 
ATOM   330  C CG2 . ILE A 1 46  ? -140.232 78.298 132.877 1.00 44.50  ? 46  ILE A CG2 1 
ATOM   331  C CD1 . ILE A 1 46  ? -139.320 77.772 130.003 1.00 41.19  ? 46  ILE A CD1 1 
ATOM   332  N N   . TYR A 1 47  ? -143.773 77.693 133.314 1.00 44.44  ? 47  TYR A N   1 
ATOM   333  C CA  . TYR A 1 47  ? -144.650 78.413 134.234 1.00 45.50  ? 47  TYR A CA  1 
ATOM   334  C C   . TYR A 1 47  ? -145.282 77.484 135.267 1.00 48.68  ? 47  TYR A C   1 
ATOM   335  O O   . TYR A 1 47  ? -145.356 77.814 136.452 1.00 47.64  ? 47  TYR A O   1 
ATOM   336  C CB  . TYR A 1 47  ? -145.739 79.153 133.444 1.00 42.38  ? 47  TYR A CB  1 
ATOM   337  C CG  . TYR A 1 47  ? -146.883 79.704 134.278 1.00 46.03  ? 47  TYR A CG  1 
ATOM   338  C CD1 . TYR A 1 47  ? -146.763 80.912 134.962 1.00 47.69  ? 47  TYR A CD1 1 
ATOM   339  C CD2 . TYR A 1 47  ? -148.092 79.024 134.362 1.00 47.03  ? 47  TYR A CD2 1 
ATOM   340  C CE1 . TYR A 1 47  ? -147.816 81.418 135.720 1.00 44.25  ? 47  TYR A CE1 1 
ATOM   341  C CE2 . TYR A 1 47  ? -149.143 79.517 135.112 1.00 47.40  ? 47  TYR A CE2 1 
ATOM   342  C CZ  . TYR A 1 47  ? -149.003 80.714 135.788 1.00 48.47  ? 47  TYR A CZ  1 
ATOM   343  O OH  . TYR A 1 47  ? -150.054 81.202 136.534 1.00 47.82  ? 47  TYR A OH  1 
ATOM   344  N N   . VAL A 1 48  ? -145.729 76.317 134.816 1.00 47.70  ? 48  VAL A N   1 
ATOM   345  C CA  . VAL A 1 48  ? -146.443 75.397 135.690 1.00 46.03  ? 48  VAL A CA  1 
ATOM   346  C C   . VAL A 1 48  ? -145.500 74.679 136.646 1.00 43.59  ? 48  VAL A C   1 
ATOM   347  O O   . VAL A 1 48  ? -145.754 74.626 137.847 1.00 47.38  ? 48  VAL A O   1 
ATOM   348  C CB  . VAL A 1 48  ? -147.239 74.362 134.882 1.00 44.28  ? 48  VAL A CB  1 
ATOM   349  C CG1 . VAL A 1 48  ? -147.790 73.275 135.799 1.00 47.22  ? 48  VAL A CG1 1 
ATOM   350  C CG2 . VAL A 1 48  ? -148.368 75.045 134.125 1.00 40.95  ? 48  VAL A CG2 1 
ATOM   351  N N   . VAL A 1 49  ? -144.405 74.141 136.123 1.00 43.17  ? 49  VAL A N   1 
ATOM   352  C CA  . VAL A 1 49  ? -143.494 73.363 136.952 1.00 47.85  ? 49  VAL A CA  1 
ATOM   353  C C   . VAL A 1 49  ? -142.797 74.238 137.990 1.00 46.07  ? 49  VAL A C   1 
ATOM   354  O O   . VAL A 1 49  ? -142.749 73.883 139.163 1.00 49.30  ? 49  VAL A O   1 
ATOM   355  C CB  . VAL A 1 49  ? -142.448 72.617 136.092 1.00 49.88  ? 49  VAL A CB  1 
ATOM   356  C CG1 . VAL A 1 49  ? -141.492 71.841 136.980 1.00 52.74  ? 49  VAL A CG1 1 
ATOM   357  C CG2 . VAL A 1 49  ? -143.148 71.672 135.135 1.00 46.69  ? 49  VAL A CG2 1 
ATOM   358  N N   . PHE A 1 50  ? -142.286 75.393 137.576 1.00 46.84  ? 50  PHE A N   1 
ATOM   359  C CA  . PHE A 1 50  ? -141.599 76.270 138.524 1.00 47.92  ? 50  PHE A CA  1 
ATOM   360  C C   . PHE A 1 50  ? -142.544 76.902 139.536 1.00 47.24  ? 50  PHE A C   1 
ATOM   361  O O   . PHE A 1 50  ? -142.129 77.229 140.647 1.00 51.38  ? 50  PHE A O   1 
ATOM   362  C CB  . PHE A 1 50  ? -140.806 77.347 137.784 1.00 46.75  ? 50  PHE A CB  1 
ATOM   363  C CG  . PHE A 1 50  ? -139.498 76.849 137.264 1.00 49.31  ? 50  PHE A CG  1 
ATOM   364  C CD1 . PHE A 1 50  ? -138.519 76.419 138.144 1.00 52.65  ? 50  PHE A CD1 1 
ATOM   365  C CD2 . PHE A 1 50  ? -139.253 76.776 135.907 1.00 49.49  ? 50  PHE A CD2 1 
ATOM   366  C CE1 . PHE A 1 50  ? -137.309 75.940 137.680 1.00 53.54  ? 50  PHE A CE1 1 
ATOM   367  C CE2 . PHE A 1 50  ? -138.042 76.300 135.434 1.00 51.61  ? 50  PHE A CE2 1 
ATOM   368  C CZ  . PHE A 1 50  ? -137.070 75.880 136.324 1.00 52.27  ? 50  PHE A CZ  1 
ATOM   369  N N   . SER A 1 51  ? -143.811 77.058 139.166 1.00 45.17  ? 51  SER A N   1 
ATOM   370  C CA  . SER A 1 51  ? -144.825 77.476 140.130 1.00 46.21  ? 51  SER A CA  1 
ATOM   371  C C   . SER A 1 51  ? -145.007 76.410 141.195 1.00 46.27  ? 51  SER A C   1 
ATOM   372  O O   . SER A 1 51  ? -145.055 76.709 142.390 1.00 49.04  ? 51  SER A O   1 
ATOM   373  C CB  . SER A 1 51  ? -146.162 77.750 139.445 1.00 48.68  ? 51  SER A CB  1 
ATOM   374  O OG  . SER A 1 51  ? -146.111 78.948 138.700 1.00 48.19  ? 51  SER A OG  1 
ATOM   375  N N   . ALA A 1 52  ? -145.119 75.163 140.747 1.00 47.44  ? 52  ALA A N   1 
ATOM   376  C CA  . ALA A 1 52  ? -145.254 74.028 141.645 1.00 44.46  ? 52  ALA A CA  1 
ATOM   377  C C   . ALA A 1 52  ? -144.064 73.943 142.595 1.00 46.08  ? 52  ALA A C   1 
ATOM   378  O O   . ALA A 1 52  ? -144.238 73.730 143.790 1.00 52.65  ? 52  ALA A O   1 
ATOM   379  C CB  . ALA A 1 52  ? -145.399 72.736 140.850 1.00 41.65  ? 52  ALA A CB  1 
ATOM   380  N N   . VAL A 1 53  ? -142.857 74.130 142.069 1.00 44.37  ? 53  VAL A N   1 
ATOM   381  C CA  . VAL A 1 53  ? -141.660 74.060 142.903 1.00 49.38  ? 53  VAL A CA  1 
ATOM   382  C C   . VAL A 1 53  ? -141.648 75.161 143.959 1.00 55.74  ? 53  VAL A C   1 
ATOM   383  O O   . VAL A 1 53  ? -141.405 74.891 145.137 1.00 57.31  ? 53  VAL A O   1 
ATOM   384  C CB  . VAL A 1 53  ? -140.372 74.164 142.071 1.00 50.86  ? 53  VAL A CB  1 
ATOM   385  C CG1 . VAL A 1 53  ? -139.159 74.175 142.990 1.00 52.74  ? 53  VAL A CG1 1 
ATOM   386  C CG2 . VAL A 1 53  ? -140.284 73.015 141.083 1.00 49.60  ? 53  VAL A CG2 1 
ATOM   387  N N   . LEU A 1 54  ? -141.913 76.396 143.536 1.00 56.48  ? 54  LEU A N   1 
ATOM   388  C CA  . LEU A 1 54  ? -141.955 77.528 144.459 1.00 56.86  ? 54  LEU A CA  1 
ATOM   389  C C   . LEU A 1 54  ? -142.962 77.302 145.586 1.00 54.48  ? 54  LEU A C   1 
ATOM   390  O O   . LEU A 1 54  ? -142.664 77.559 146.751 1.00 49.80  ? 54  LEU A O   1 
ATOM   391  C CB  . LEU A 1 54  ? -142.290 78.823 143.712 1.00 58.00  ? 54  LEU A CB  1 
ATOM   392  C CG  . LEU A 1 54  ? -141.214 79.442 142.815 1.00 57.93  ? 54  LEU A CG  1 
ATOM   393  C CD1 . LEU A 1 54  ? -141.790 80.609 142.030 1.00 60.00  ? 54  LEU A CD1 1 
ATOM   394  C CD2 . LEU A 1 54  ? -140.014 79.893 143.631 1.00 58.51  ? 54  LEU A CD2 1 
ATOM   395  N N   . ARG A 1 55  ? -144.148 76.809 145.244 1.00 57.24  ? 55  ARG A N   1 
ATOM   396  C CA  . ARG A 1 55  ? -145.186 76.595 146.248 1.00 61.15  ? 55  ARG A CA  1 
ATOM   397  C C   . ARG A 1 55  ? -144.869 75.395 147.140 1.00 61.17  ? 55  ARG A C   1 
ATOM   398  O O   . ARG A 1 55  ? -144.852 75.512 148.364 1.00 59.31  ? 55  ARG A O   1 
ATOM   399  C CB  . ARG A 1 55  ? -146.550 76.406 145.580 1.00 62.68  ? 55  ARG A CB  1 
ATOM   400  C CG  . ARG A 1 55  ? -147.655 75.967 146.533 1.00 64.66  ? 55  ARG A CG  1 
ATOM   401  C CD  . ARG A 1 55  ? -148.014 77.052 147.540 1.00 72.90  ? 55  ARG A CD  1 
ATOM   402  N NE  . ARG A 1 55  ? -148.340 76.468 148.837 1.00 84.30  ? 55  ARG A NE  1 
ATOM   403  C CZ  . ARG A 1 55  ? -147.592 76.606 149.927 1.00 86.50  ? 55  ARG A CZ  1 
ATOM   404  N NH1 . ARG A 1 55  ? -146.483 77.334 149.886 1.00 82.85  ? 55  ARG A NH1 1 
ATOM   405  N NH2 . ARG A 1 55  ? -147.959 76.027 151.062 1.00 92.14  ? 55  ARG A NH2 1 
ATOM   406  N N   . GLN A 1 56  ? -144.606 74.250 146.516 1.00 63.44  ? 56  GLN A N   1 
ATOM   407  C CA  . GLN A 1 56  ? -144.411 72.993 147.240 1.00 67.66  ? 56  GLN A CA  1 
ATOM   408  C C   . GLN A 1 56  ? -143.205 73.030 148.184 1.00 67.06  ? 56  GLN A C   1 
ATOM   409  O O   . GLN A 1 56  ? -143.210 72.381 149.228 1.00 72.32  ? 56  GLN A O   1 
ATOM   410  C CB  . GLN A 1 56  ? -144.269 71.835 146.245 1.00 72.44  ? 56  GLN A CB  1 
ATOM   411  C CG  . GLN A 1 56  ? -145.150 70.626 146.546 1.00 80.82  ? 56  GLN A CG  1 
ATOM   412  C CD  . GLN A 1 56  ? -146.633 70.952 146.531 1.00 85.03  ? 56  GLN A CD  1 
ATOM   413  O OE1 . GLN A 1 56  ? -147.127 71.628 145.627 1.00 86.56  ? 56  GLN A OE1 1 
ATOM   414  N NE2 . GLN A 1 56  ? -147.352 70.472 147.538 1.00 87.35  ? 56  GLN A NE2 1 
ATOM   415  N N   . ARG A 1 57  ? -142.178 73.793 147.821 1.00 66.12  ? 57  ARG A N   1 
ATOM   416  C CA  . ARG A 1 57  ? -141.009 73.950 148.684 1.00 66.72  ? 57  ARG A CA  1 
ATOM   417  C C   . ARG A 1 57  ? -141.210 75.093 149.675 1.00 69.23  ? 57  ARG A C   1 
ATOM   418  O O   . ARG A 1 57  ? -140.307 75.421 150.451 1.00 71.27  ? 57  ARG A O   1 
ATOM   419  C CB  . ARG A 1 57  ? -139.744 74.183 147.850 1.00 65.03  ? 57  ARG A CB  1 
ATOM   420  C CG  . ARG A 1 57  ? -139.209 72.926 147.185 1.00 63.76  ? 57  ARG A CG  1 
ATOM   421  C CD  . ARG A 1 57  ? -138.915 71.845 148.214 1.00 64.56  ? 57  ARG A CD  1 
ATOM   422  N NE  . ARG A 1 57  ? -137.608 72.006 148.842 1.00 64.72  ? 57  ARG A NE  1 
ATOM   423  C CZ  . ARG A 1 57  ? -137.296 71.537 150.046 1.00 67.82  ? 57  ARG A CZ  1 
ATOM   424  N NH1 . ARG A 1 57  ? -138.203 70.888 150.763 1.00 66.52  ? 57  ARG A NH1 1 
ATOM   425  N NH2 . ARG A 1 57  ? -136.079 71.724 150.540 1.00 72.18  ? 57  ARG A NH2 1 
ATOM   426  N N   . ASN A 1 58  ? -142.398 75.691 149.638 1.00 68.03  ? 58  ASN A N   1 
ATOM   427  C CA  . ASN A 1 58  ? -142.781 76.749 150.570 1.00 74.77  ? 58  ASN A CA  1 
ATOM   428  C C   . ASN A 1 58  ? -141.856 77.965 150.466 1.00 70.89  ? 58  ASN A C   1 
ATOM   429  O O   . ASN A 1 58  ? -141.602 78.658 151.448 1.00 64.99  ? 58  ASN A O   1 
ATOM   430  C CB  . ASN A 1 58  ? -142.815 76.208 152.008 1.00 81.51  ? 58  ASN A CB  1 
ATOM   431  C CG  . ASN A 1 58  ? -143.609 77.099 152.953 1.00 91.88  ? 58  ASN A CG  1 
ATOM   432  O OD1 . ASN A 1 58  ? -143.039 77.881 153.716 1.00 94.10  ? 58  ASN A OD1 1 
ATOM   433  N ND2 . ASN A 1 58  ? -144.931 76.982 152.905 1.00 97.05  ? 58  ASN A ND2 1 
ATOM   434  N N   . ILE A 1 59  ? -141.355 78.210 149.259 1.00 69.62  ? 59  ILE A N   1 
ATOM   435  C CA  . ILE A 1 59  ? -140.507 79.362 148.994 1.00 66.75  ? 59  ILE A CA  1 
ATOM   436  C C   . ILE A 1 59  ? -141.375 80.613 148.946 1.00 66.18  ? 59  ILE A C   1 
ATOM   437  O O   . ILE A 1 59  ? -140.976 81.683 149.406 1.00 61.97  ? 59  ILE A O   1 
ATOM   438  C CB  . ILE A 1 59  ? -139.726 79.188 147.679 1.00 61.82  ? 59  ILE A CB  1 
ATOM   439  C CG1 . ILE A 1 59  ? -138.827 77.952 147.766 1.00 64.18  ? 59  ILE A CG1 1 
ATOM   440  C CG2 . ILE A 1 59  ? -138.900 80.423 147.363 1.00 61.81  ? 59  ILE A CG2 1 
ATOM   441  C CD1 . ILE A 1 59  ? -137.968 77.720 146.531 1.00 62.59  ? 59  ILE A CD1 1 
ATOM   442  N N   . LEU A 1 60  ? -142.574 80.459 148.395 1.00 68.18  ? 60  LEU A N   1 
ATOM   443  C CA  . LEU A 1 60  ? -143.587 81.508 148.424 1.00 69.14  ? 60  LEU A CA  1 
ATOM   444  C C   . LEU A 1 60  ? -144.874 80.973 149.042 1.00 72.53  ? 60  LEU A C   1 
ATOM   445  O O   . LEU A 1 60  ? -145.288 79.851 148.742 1.00 74.21  ? 60  LEU A O   1 
ATOM   446  C CB  . LEU A 1 60  ? -143.861 82.040 147.018 1.00 65.10  ? 60  LEU A CB  1 
ATOM   447  C CG  . LEU A 1 60  ? -142.748 82.841 146.345 1.00 63.74  ? 60  LEU A CG  1 
ATOM   448  C CD1 . LEU A 1 60  ? -143.165 83.228 144.938 1.00 63.19  ? 60  LEU A CD1 1 
ATOM   449  C CD2 . LEU A 1 60  ? -142.401 84.073 147.165 1.00 65.36  ? 60  LEU A CD2 1 
ATOM   450  N N   . GLU A 1 61  ? -145.500 81.775 149.900 1.00 74.33  ? 61  GLU A N   1 
ATOM   451  C CA  . GLU A 1 61  ? -146.741 81.385 150.570 1.00 80.43  ? 61  GLU A CA  1 
ATOM   452  C C   . GLU A 1 61  ? -147.882 81.201 149.575 1.00 78.15  ? 61  GLU A C   1 
ATOM   453  O O   . GLU A 1 61  ? -147.851 81.757 148.477 1.00 75.13  ? 61  GLU A O   1 
ATOM   454  C CB  . GLU A 1 61  ? -147.142 82.426 151.622 1.00 88.19  ? 61  GLU A CB  1 
ATOM   455  C CG  . GLU A 1 61  ? -146.112 82.655 152.718 1.00 97.06  ? 61  GLU A CG  1 
ATOM   456  C CD  . GLU A 1 61  ? -145.046 83.658 152.318 1.00 104.13 ? 61  GLU A CD  1 
ATOM   457  O OE1 . GLU A 1 61  ? -143.919 83.579 152.849 1.00 108.95 ? 61  GLU A OE1 1 
ATOM   458  O OE2 . GLU A 1 61  ? -145.340 84.532 151.477 1.00 104.60 ? 61  GLU A OE2 1 
ATOM   459  N N   . LYS A 1 62  ? -148.896 80.438 149.978 1.00 79.97  ? 62  LYS A N   1 
ATOM   460  C CA  . LYS A 1 62  ? -150.030 80.104 149.114 1.00 81.25  ? 62  LYS A CA  1 
ATOM   461  C C   . LYS A 1 62  ? -150.807 81.320 148.593 1.00 81.88  ? 62  LYS A C   1 
ATOM   462  O O   . LYS A 1 62  ? -151.605 81.193 147.665 1.00 81.51  ? 62  LYS A O   1 
ATOM   463  C CB  . LYS A 1 62  ? -150.992 79.170 149.857 1.00 85.25  ? 62  LYS A CB  1 
ATOM   464  C CG  . LYS A 1 62  ? -151.525 79.756 151.156 1.00 91.06  ? 62  LYS A CG  1 
ATOM   465  C CD  . LYS A 1 62  ? -152.652 78.915 151.736 1.00 96.58  ? 62  LYS A CD  1 
ATOM   466  C CE  . LYS A 1 62  ? -153.267 79.602 152.947 1.00 103.48 ? 62  LYS A CE  1 
ATOM   467  N NZ  . LYS A 1 62  ? -154.450 78.870 153.482 1.00 107.96 ? 62  LYS A NZ  1 
ATOM   468  N N   . GLU A 1 63  ? -150.582 82.485 149.194 1.00 84.86  ? 63  GLU A N   1 
ATOM   469  C CA  . GLU A 1 63  ? -151.239 83.720 148.762 1.00 87.72  ? 63  GLU A CA  1 
ATOM   470  C C   . GLU A 1 63  ? -150.796 84.143 147.356 1.00 82.57  ? 63  GLU A C   1 
ATOM   471  O O   . GLU A 1 63  ? -151.561 84.756 146.605 1.00 79.43  ? 63  GLU A O   1 
ATOM   472  C CB  . GLU A 1 63  ? -150.959 84.852 149.758 1.00 94.17  ? 63  GLU A CB  1 
ATOM   473  C CG  . GLU A 1 63  ? -152.028 85.037 150.836 1.00 103.23 ? 63  GLU A CG  1 
ATOM   474  C CD  . GLU A 1 63  ? -152.186 83.825 151.739 1.00 107.81 ? 63  GLU A CD  1 
ATOM   475  O OE1 . GLU A 1 63  ? -153.329 83.348 151.898 1.00 112.00 ? 63  GLU A OE1 1 
ATOM   476  O OE2 . GLU A 1 63  ? -151.174 83.354 152.299 1.00 107.27 ? 63  GLU A OE2 1 
ATOM   477  N N   . TYR A 1 64  ? -149.559 83.804 147.007 1.00 79.24  ? 64  TYR A N   1 
ATOM   478  C CA  . TYR A 1 64  ? -148.985 84.157 145.712 1.00 74.56  ? 64  TYR A CA  1 
ATOM   479  C C   . TYR A 1 64  ? -149.452 83.234 144.588 1.00 70.57  ? 64  TYR A C   1 
ATOM   480  O O   . TYR A 1 64  ? -149.120 83.449 143.420 1.00 69.21  ? 64  TYR A O   1 
ATOM   481  C CB  . TYR A 1 64  ? -147.459 84.128 145.796 1.00 73.44  ? 64  TYR A CB  1 
ATOM   482  C CG  . TYR A 1 64  ? -146.885 85.152 146.745 1.00 76.92  ? 64  TYR A CG  1 
ATOM   483  C CD1 . TYR A 1 64  ? -147.227 86.495 146.638 1.00 81.11  ? 64  TYR A CD1 1 
ATOM   484  C CD2 . TYR A 1 64  ? -146.016 84.776 147.759 1.00 76.86  ? 64  TYR A CD2 1 
ATOM   485  C CE1 . TYR A 1 64  ? -146.709 87.438 147.507 1.00 81.43  ? 64  TYR A CE1 1 
ATOM   486  C CE2 . TYR A 1 64  ? -145.493 85.711 148.633 1.00 79.04  ? 64  TYR A CE2 1 
ATOM   487  C CZ  . TYR A 1 64  ? -145.843 87.041 148.503 1.00 80.92  ? 64  TYR A CZ  1 
ATOM   488  O OH  . TYR A 1 64  ? -145.329 87.978 149.368 1.00 82.28  ? 64  TYR A OH  1 
ATOM   489  N N   . PHE A 1 65  ? -150.230 82.217 144.941 1.00 68.49  ? 65  PHE A N   1 
ATOM   490  C CA  . PHE A 1 65  ? -150.638 81.203 143.977 1.00 62.39  ? 65  PHE A CA  1 
ATOM   491  C C   . PHE A 1 65  ? -152.148 81.071 143.851 1.00 65.96  ? 65  PHE A C   1 
ATOM   492  O O   . PHE A 1 65  ? -152.903 81.626 144.643 1.00 68.91  ? 65  PHE A O   1 
ATOM   493  C CB  . PHE A 1 65  ? -150.055 79.851 144.363 1.00 55.38  ? 65  PHE A CB  1 
ATOM   494  C CG  . PHE A 1 65  ? -148.561 79.842 144.463 1.00 52.20  ? 65  PHE A CG  1 
ATOM   495  C CD1 . PHE A 1 65  ? -147.776 79.541 143.356 1.00 49.54  ? 65  PHE A CD1 1 
ATOM   496  C CD2 . PHE A 1 65  ? -147.938 80.133 145.667 1.00 53.56  ? 65  PHE A CD2 1 
ATOM   497  C CE1 . PHE A 1 65  ? -146.390 79.529 143.455 1.00 50.24  ? 65  PHE A CE1 1 
ATOM   498  C CE2 . PHE A 1 65  ? -146.558 80.125 145.775 1.00 53.80  ? 65  PHE A CE2 1 
ATOM   499  C CZ  . PHE A 1 65  ? -145.781 79.824 144.671 1.00 51.09  ? 65  PHE A CZ  1 
ATOM   500  N N   . SER A 1 66  ? -152.578 80.322 142.843 1.00 69.44  ? 66  SER A N   1 
ATOM   501  C CA  . SER A 1 66  ? -153.987 80.003 142.668 1.00 75.57  ? 66  SER A CA  1 
ATOM   502  C C   . SER A 1 66  ? -154.138 78.530 142.300 1.00 71.77  ? 66  SER A C   1 
ATOM   503  O O   . SER A 1 66  ? -153.208 77.917 141.774 1.00 65.96  ? 66  SER A O   1 
ATOM   504  C CB  . SER A 1 66  ? -154.619 80.893 141.599 1.00 80.68  ? 66  SER A CB  1 
ATOM   505  O OG  . SER A 1 66  ? -156.020 80.688 141.551 1.00 87.31  ? 66  SER A OG  1 
ATOM   506  N N   . LYS A 1 67  ? -155.303 77.959 142.590 1.00 75.70  ? 67  LYS A N   1 
ATOM   507  C CA  . LYS A 1 67  ? -155.513 76.542 142.331 1.00 78.55  ? 67  LYS A CA  1 
ATOM   508  C C   . LYS A 1 67  ? -155.874 76.289 140.874 1.00 80.12  ? 67  LYS A C   1 
ATOM   509  O O   . LYS A 1 67  ? -156.793 76.900 140.327 1.00 82.26  ? 67  LYS A O   1 
ATOM   510  C CB  . LYS A 1 67  ? -156.597 75.967 143.247 1.00 80.89  ? 67  LYS A CB  1 
ATOM   511  C CG  . LYS A 1 67  ? -156.700 74.445 143.163 1.00 82.67  ? 67  LYS A CG  1 
ATOM   512  C CD  . LYS A 1 67  ? -157.653 73.878 144.204 1.00 89.67  ? 67  LYS A CD  1 
ATOM   513  C CE  . LYS A 1 67  ? -157.652 72.355 144.185 1.00 92.22  ? 67  LYS A CE  1 
ATOM   514  N NZ  . LYS A 1 67  ? -158.563 71.781 145.217 1.00 98.53  ? 67  LYS A NZ  1 
ATOM   515  N N   . ASN A 1 68  ? -155.124 75.385 140.254 1.00 79.68  ? 68  ASN A N   1 
ATOM   516  C CA  . ASN A 1 68  ? -155.393 74.954 138.892 1.00 81.73  ? 68  ASN A CA  1 
ATOM   517  C C   . ASN A 1 68  ? -155.417 73.436 138.811 1.00 79.65  ? 68  ASN A C   1 
ATOM   518  O O   . ASN A 1 68  ? -155.023 72.751 139.755 1.00 77.71  ? 68  ASN A O   1 
ATOM   519  C CB  . ASN A 1 68  ? -154.347 75.513 137.927 1.00 80.89  ? 68  ASN A CB  1 
ATOM   520  C CG  . ASN A 1 68  ? -154.708 76.888 137.407 1.00 86.05  ? 68  ASN A CG  1 
ATOM   521  O OD1 . ASN A 1 68  ? -155.502 77.022 136.476 1.00 86.86  ? 68  ASN A OD1 1 
ATOM   522  N ND2 . ASN A 1 68  ? -154.120 77.921 138.000 1.00 89.55  ? 68  ASN A ND2 1 
ATOM   523  N N   . TYR A 1 69  ? -155.885 72.918 137.679 1.00 78.89  ? 69  TYR A N   1 
ATOM   524  C CA  . TYR A 1 69  ? -155.904 71.482 137.434 1.00 79.71  ? 69  TYR A CA  1 
ATOM   525  C C   . TYR A 1 69  ? -155.227 71.158 136.108 1.00 77.16  ? 69  TYR A C   1 
ATOM   526  O O   . TYR A 1 69  ? -155.398 71.877 135.123 1.00 78.13  ? 69  TYR A O   1 
ATOM   527  C CB  . TYR A 1 69  ? -157.337 70.946 137.422 1.00 82.45  ? 69  TYR A CB  1 
ATOM   528  C CG  . TYR A 1 69  ? -158.023 70.898 138.769 1.00 86.30  ? 69  TYR A CG  1 
ATOM   529  C CD1 . TYR A 1 69  ? -158.541 72.048 139.353 1.00 88.93  ? 69  TYR A CD1 1 
ATOM   530  C CD2 . TYR A 1 69  ? -158.175 69.695 139.446 1.00 87.54  ? 69  TYR A CD2 1 
ATOM   531  C CE1 . TYR A 1 69  ? -159.179 72.003 140.583 1.00 92.40  ? 69  TYR A CE1 1 
ATOM   532  C CE2 . TYR A 1 69  ? -158.810 69.639 140.674 1.00 91.63  ? 69  TYR A CE2 1 
ATOM   533  C CZ  . TYR A 1 69  ? -159.311 70.796 141.238 1.00 94.30  ? 69  TYR A CZ  1 
ATOM   534  O OH  . TYR A 1 69  ? -159.945 70.747 142.461 1.00 99.45  ? 69  TYR A OH  1 
ATOM   535  N N   . ILE A 1 70  ? -154.457 70.078 136.096 1.00 75.52  ? 70  ILE A N   1 
ATOM   536  C CA  . ILE A 1 70  ? -153.851 69.569 134.873 1.00 73.86  ? 70  ILE A CA  1 
ATOM   537  C C   . ILE A 1 70  ? -154.725 68.461 134.306 1.00 74.54  ? 70  ILE A C   1 
ATOM   538  O O   . ILE A 1 70  ? -154.932 68.367 133.097 1.00 74.45  ? 70  ILE A O   1 
ATOM   539  C CB  . ILE A 1 70  ? -152.437 69.039 135.130 1.00 73.22  ? 70  ILE A CB  1 
ATOM   540  C CG1 . ILE A 1 70  ? -151.615 70.096 135.864 1.00 73.48  ? 70  ILE A CG1 1 
ATOM   541  C CG2 . ILE A 1 70  ? -151.767 68.638 133.824 1.00 70.25  ? 70  ILE A CG2 1 
ATOM   542  C CD1 . ILE A 1 70  ? -150.406 69.542 136.550 1.00 75.48  ? 70  ILE A CD1 1 
ATOM   543  N N   . THR A 1 71  ? -155.222 67.610 135.198 1.00 75.87  ? 71  THR A N   1 
ATOM   544  C CA  . THR A 1 71  ? -156.265 66.648 134.866 1.00 79.29  ? 71  THR A CA  1 
ATOM   545  C C   . THR A 1 71  ? -157.357 66.770 135.921 1.00 87.21  ? 71  THR A C   1 
ATOM   546  O O   . THR A 1 71  ? -157.220 67.542 136.868 1.00 89.44  ? 71  THR A O   1 
ATOM   547  C CB  . THR A 1 71  ? -155.740 65.200 134.811 1.00 75.66  ? 71  THR A CB  1 
ATOM   548  O OG1 . THR A 1 71  ? -155.546 64.703 136.139 1.00 76.48  ? 71  THR A OG1 1 
ATOM   549  C CG2 . THR A 1 71  ? -154.426 65.133 134.055 1.00 72.14  ? 71  THR A CG2 1 
ATOM   550  N N   . GLU A 1 72  ? -158.438 66.017 135.761 1.00 91.55  ? 72  GLU A N   1 
ATOM   551  C CA  . GLU A 1 72  ? -159.532 66.060 136.725 1.00 96.58  ? 72  GLU A CA  1 
ATOM   552  C C   . GLU A 1 72  ? -159.074 65.547 138.084 1.00 95.93  ? 72  GLU A C   1 
ATOM   553  O O   . GLU A 1 72  ? -159.588 65.961 139.124 1.00 98.66  ? 72  GLU A O   1 
ATOM   554  C CB  . GLU A 1 72  ? -160.720 65.238 136.229 1.00 103.09 ? 72  GLU A CB  1 
ATOM   555  C CG  . GLU A 1 72  ? -161.388 65.784 134.981 1.00 108.29 ? 72  GLU A CG  1 
ATOM   556  C CD  . GLU A 1 72  ? -162.536 64.909 134.519 1.00 116.69 ? 72  GLU A CD  1 
ATOM   557  O OE1 . GLU A 1 72  ? -162.655 63.771 135.021 1.00 119.29 ? 72  GLU A OE1 1 
ATOM   558  O OE2 . GLU A 1 72  ? -163.321 65.357 133.657 1.00 120.59 ? 72  GLU A OE2 1 
ATOM   559  N N   . ASN A 1 73  ? -158.093 64.651 138.060 1.00 92.77  ? 73  ASN A N   1 
ATOM   560  C CA  . ASN A 1 73  ? -157.589 64.004 139.265 1.00 93.27  ? 73  ASN A CA  1 
ATOM   561  C C   . ASN A 1 73  ? -156.456 64.782 139.933 1.00 86.83  ? 73  ASN A C   1 
ATOM   562  O O   . ASN A 1 73  ? -156.223 64.640 141.134 1.00 88.62  ? 73  ASN A O   1 
ATOM   563  C CB  . ASN A 1 73  ? -157.101 62.592 138.926 1.00 98.10  ? 73  ASN A CB  1 
ATOM   564  C CG  . ASN A 1 73  ? -157.472 61.571 139.983 1.00 104.39 ? 73  ASN A CG  1 
ATOM   565  O OD1 . ASN A 1 73  ? -156.911 61.562 141.079 1.00 107.51 ? 73  ASN A OD1 1 
ATOM   566  N ND2 . ASN A 1 73  ? -158.415 60.695 139.653 1.00 106.68 ? 73  ASN A ND2 1 
ATOM   567  N N   . LEU A 1 74  ? -155.753 65.598 139.151 1.00 78.13  ? 74  LEU A N   1 
ATOM   568  C CA  . LEU A 1 74  ? -154.514 66.222 139.613 1.00 74.26  ? 74  LEU A CA  1 
ATOM   569  C C   . LEU A 1 74  ? -154.551 67.748 139.579 1.00 75.12  ? 74  LEU A C   1 
ATOM   570  O O   . LEU A 1 74  ? -154.872 68.357 138.556 1.00 71.89  ? 74  LEU A O   1 
ATOM   571  C CB  . LEU A 1 74  ? -153.333 65.721 138.776 1.00 70.23  ? 74  LEU A CB  1 
ATOM   572  C CG  . LEU A 1 74  ? -151.968 66.341 139.083 1.00 66.99  ? 74  LEU A CG  1 
ATOM   573  C CD1 . LEU A 1 74  ? -151.445 65.875 140.435 1.00 64.78  ? 74  LEU A CD1 1 
ATOM   574  C CD2 . LEU A 1 74  ? -150.972 66.030 137.974 1.00 64.10  ? 74  LEU A CD2 1 
ATOM   575  N N   . SER A 1 75  ? -154.203 68.354 140.709 1.00 75.33  ? 75  SER A N   1 
ATOM   576  C CA  . SER A 1 75  ? -154.200 69.803 140.839 1.00 70.44  ? 75  SER A CA  1 
ATOM   577  C C   . SER A 1 75  ? -152.812 70.326 141.180 1.00 68.63  ? 75  SER A C   1 
ATOM   578  O O   . SER A 1 75  ? -151.940 69.574 141.612 1.00 68.01  ? 75  SER A O   1 
ATOM   579  C CB  . SER A 1 75  ? -155.190 70.246 141.913 1.00 71.97  ? 75  SER A CB  1 
ATOM   580  O OG  . SER A 1 75  ? -154.674 69.992 143.209 1.00 71.89  ? 75  SER A OG  1 
ATOM   581  N N   . CYS A 1 76  ? -152.619 71.626 140.996 1.00 68.56  ? 76  CYS A N   1 
ATOM   582  C CA  . CYS A 1 76  ? -151.350 72.266 141.312 1.00 67.86  ? 76  CYS A CA  1 
ATOM   583  C C   . CYS A 1 76  ? -151.576 73.745 141.589 1.00 67.67  ? 76  CYS A C   1 
ATOM   584  O O   . CYS A 1 76  ? -152.646 74.282 141.291 1.00 67.50  ? 76  CYS A O   1 
ATOM   585  C CB  . CYS A 1 76  ? -150.350 72.083 140.170 1.00 68.76  ? 76  CYS A CB  1 
ATOM   586  S SG  . CYS A 1 76  ? -150.934 72.672 138.567 1.00 67.28  ? 76  CYS A SG  1 
ATOM   587  N N   . MET A 1 77  ? -150.571 74.397 142.163 1.00 68.20  ? 77  MET A N   1 
ATOM   588  C CA  . MET A 1 77  ? -150.651 75.825 142.448 1.00 67.17  ? 77  MET A CA  1 
ATOM   589  C C   . MET A 1 77  ? -149.813 76.623 141.450 1.00 61.11  ? 77  MET A C   1 
ATOM   590  O O   . MET A 1 77  ? -148.592 76.483 141.403 1.00 56.41  ? 77  MET A O   1 
ATOM   591  C CB  . MET A 1 77  ? -150.189 76.114 143.879 1.00 70.12  ? 77  MET A CB  1 
ATOM   592  C CG  . MET A 1 77  ? -150.969 75.369 144.958 1.00 72.90  ? 77  MET A CG  1 
ATOM   593  S SD  . MET A 1 77  ? -152.740 75.728 144.958 1.00 80.95  ? 77  MET A SD  1 
ATOM   594  C CE  . MET A 1 77  ? -152.764 77.397 145.605 1.00 57.97  ? 77  MET A CE  1 
ATOM   595  N N   . THR A 1 78  ? -150.476 77.453 140.648 1.00 61.64  ? 78  THR A N   1 
ATOM   596  C CA  . THR A 1 78  ? -149.791 78.314 139.683 1.00 57.57  ? 78  THR A CA  1 
ATOM   597  C C   . THR A 1 78  ? -149.762 79.759 140.165 1.00 58.77  ? 78  THR A C   1 
ATOM   598  O O   . THR A 1 78  ? -150.718 80.227 140.783 1.00 63.92  ? 78  THR A O   1 
ATOM   599  C CB  . THR A 1 78  ? -150.463 78.272 138.297 1.00 54.60  ? 78  THR A CB  1 
ATOM   600  O OG1 . THR A 1 78  ? -151.816 78.735 138.405 1.00 56.34  ? 78  THR A OG1 1 
ATOM   601  C CG2 . THR A 1 78  ? -150.441 76.856 137.732 1.00 46.01  ? 78  THR A CG2 1 
ATOM   602  N N   . LEU A 1 79  ? -148.670 80.463 139.877 1.00 57.08  ? 79  LEU A N   1 
ATOM   603  C CA  . LEU A 1 79  ? -148.516 81.852 140.300 1.00 57.23  ? 79  LEU A CA  1 
ATOM   604  C C   . LEU A 1 79  ? -149.688 82.710 139.822 1.00 60.38  ? 79  LEU A C   1 
ATOM   605  O O   . LEU A 1 79  ? -150.141 82.577 138.685 1.00 63.57  ? 79  LEU A O   1 
ATOM   606  C CB  . LEU A 1 79  ? -147.188 82.419 139.789 1.00 52.40  ? 79  LEU A CB  1 
ATOM   607  C CG  . LEU A 1 79  ? -145.926 81.947 140.522 1.00 45.78  ? 79  LEU A CG  1 
ATOM   608  C CD1 . LEU A 1 79  ? -144.684 82.204 139.684 1.00 43.78  ? 79  LEU A CD1 1 
ATOM   609  C CD2 . LEU A 1 79  ? -145.802 82.626 141.883 1.00 47.45  ? 79  LEU A CD2 1 
ATOM   610  N N   . SER A 1 80  ? -150.186 83.572 140.703 1.00 59.64  ? 80  SER A N   1 
ATOM   611  C CA  . SER A 1 80  ? -151.361 84.385 140.406 1.00 66.71  ? 80  SER A CA  1 
ATOM   612  C C   . SER A 1 80  ? -150.972 85.721 139.781 1.00 70.13  ? 80  SER A C   1 
ATOM   613  O O   . SER A 1 80  ? -150.060 86.396 140.259 1.00 69.91  ? 80  SER A O   1 
ATOM   614  C CB  . SER A 1 80  ? -152.183 84.619 141.675 1.00 71.32  ? 80  SER A CB  1 
ATOM   615  O OG  . SER A 1 80  ? -153.353 85.365 141.391 1.00 74.60  ? 80  SER A OG  1 
ATOM   616  N N   . PHE A 1 81  ? -151.671 86.096 138.713 1.00 71.79  ? 81  PHE A N   1 
ATOM   617  C CA  . PHE A 1 81  ? -151.375 87.332 137.996 1.00 77.95  ? 81  PHE A CA  1 
ATOM   618  C C   . PHE A 1 81  ? -152.017 88.549 138.658 1.00 81.26  ? 81  PHE A C   1 
ATOM   619  O O   . PHE A 1 81  ? -151.759 89.683 138.260 1.00 82.49  ? 81  PHE A O   1 
ATOM   620  C CB  . PHE A 1 81  ? -151.834 87.226 136.540 1.00 78.79  ? 81  PHE A CB  1 
ATOM   621  C CG  . PHE A 1 81  ? -150.977 86.322 135.700 1.00 77.81  ? 81  PHE A CG  1 
ATOM   622  C CD1 . PHE A 1 81  ? -149.835 86.806 135.082 1.00 77.78  ? 81  PHE A CD1 1 
ATOM   623  C CD2 . PHE A 1 81  ? -151.309 84.986 135.529 1.00 75.93  ? 81  PHE A CD2 1 
ATOM   624  C CE1 . PHE A 1 81  ? -149.039 85.977 134.308 1.00 73.58  ? 81  PHE A CE1 1 
ATOM   625  C CE2 . PHE A 1 81  ? -150.520 84.155 134.758 1.00 71.40  ? 81  PHE A CE2 1 
ATOM   626  C CZ  . PHE A 1 81  ? -149.383 84.651 134.147 1.00 70.48  ? 81  PHE A CZ  1 
ATOM   627  N N   . LYS A 1 82  ? -152.853 88.307 139.664 1.00 83.81  ? 82  LYS A N   1 
ATOM   628  C CA  . LYS A 1 82  ? -153.492 89.385 140.413 1.00 85.29  ? 82  LYS A CA  1 
ATOM   629  C C   . LYS A 1 82  ? -152.563 89.917 141.504 1.00 82.78  ? 82  LYS A C   1 
ATOM   630  O O   . LYS A 1 82  ? -152.560 91.111 141.801 1.00 87.75  ? 82  LYS A O   1 
ATOM   631  C CB  . LYS A 1 82  ? -154.814 88.910 141.021 1.00 89.85  ? 82  LYS A CB  1 
ATOM   632  C CG  . LYS A 1 82  ? -155.917 88.663 139.998 1.00 95.25  ? 82  LYS A CG  1 
ATOM   633  C CD  . LYS A 1 82  ? -157.098 87.930 140.621 1.00 104.47 ? 82  LYS A CD  1 
ATOM   634  C CE  . LYS A 1 82  ? -158.102 87.489 139.563 1.00 108.42 ? 82  LYS A CE  1 
ATOM   635  N NZ  . LYS A 1 82  ? -159.089 86.506 140.096 1.00 112.02 ? 82  LYS A NZ  1 
ATOM   636  N N   . ASN A 1 83  ? -151.780 89.026 142.103 1.00 73.95  ? 83  ASN A N   1 
ATOM   637  C CA  . ASN A 1 83  ? -150.728 89.435 143.026 1.00 70.56  ? 83  ASN A CA  1 
ATOM   638  C C   . ASN A 1 83  ? -149.549 90.001 142.240 1.00 66.10  ? 83  ASN A C   1 
ATOM   639  O O   . ASN A 1 83  ? -149.029 89.342 141.336 1.00 64.57  ? 83  ASN A O   1 
ATOM   640  C CB  . ASN A 1 83  ? -150.282 88.257 143.895 1.00 69.72  ? 83  ASN A CB  1 
ATOM   641  C CG  . ASN A 1 83  ? -149.306 88.668 144.984 1.00 68.52  ? 83  ASN A CG  1 
ATOM   642  O OD1 . ASN A 1 83  ? -148.157 89.020 144.709 1.00 66.72  ? 83  ASN A OD1 1 
ATOM   643  N ND2 . ASN A 1 83  ? -149.754 88.608 146.230 1.00 70.70  ? 83  ASN A ND2 1 
ATOM   644  N N   . LEU A 1 84  ? -149.128 91.215 142.586 1.00 61.56  ? 84  LEU A N   1 
ATOM   645  C CA  . LEU A 1 84  ? -148.137 91.938 141.794 1.00 60.96  ? 84  LEU A CA  1 
ATOM   646  C C   . LEU A 1 84  ? -146.753 91.297 141.817 1.00 59.83  ? 84  LEU A C   1 
ATOM   647  O O   . LEU A 1 84  ? -146.104 91.203 140.775 1.00 58.03  ? 84  LEU A O   1 
ATOM   648  C CB  . LEU A 1 84  ? -148.042 93.393 142.259 1.00 61.95  ? 84  LEU A CB  1 
ATOM   649  C CG  . LEU A 1 84  ? -149.055 94.361 141.637 1.00 63.92  ? 84  LEU A CG  1 
ATOM   650  C CD1 . LEU A 1 84  ? -148.976 95.740 142.282 1.00 64.98  ? 84  LEU A CD1 1 
ATOM   651  C CD2 . LEU A 1 84  ? -148.832 94.458 140.136 1.00 60.30  ? 84  LEU A CD2 1 
ATOM   652  N N   . ARG A 1 85  ? -146.298 90.856 142.986 1.00 61.94  ? 85  ARG A N   1 
ATOM   653  C CA  . ARG A 1 85  ? -144.989 90.206 143.066 1.00 66.50  ? 85  ARG A CA  1 
ATOM   654  C C   . ARG A 1 85  ? -144.990 88.841 142.391 1.00 59.82  ? 85  ARG A C   1 
ATOM   655  O O   . ARG A 1 85  ? -143.990 88.436 141.804 1.00 56.96  ? 85  ARG A O   1 
ATOM   656  C CB  . ARG A 1 85  ? -144.521 90.054 144.516 1.00 73.75  ? 85  ARG A CB  1 
ATOM   657  C CG  . ARG A 1 85  ? -143.026 89.766 144.588 1.00 77.24  ? 85  ARG A CG  1 
ATOM   658  C CD  . ARG A 1 85  ? -142.602 89.157 145.906 1.00 85.48  ? 85  ARG A CD  1 
ATOM   659  N NE  . ARG A 1 85  ? -141.147 89.084 146.006 1.00 90.38  ? 85  ARG A NE  1 
ATOM   660  C CZ  . ARG A 1 85  ? -140.488 88.568 147.038 1.00 92.96  ? 85  ARG A CZ  1 
ATOM   661  N NH1 . ARG A 1 85  ? -141.148 88.064 148.072 1.00 92.51  ? 85  ARG A NH1 1 
ATOM   662  N NH2 . ARG A 1 85  ? -139.163 88.553 147.035 1.00 95.06  ? 85  ARG A NH2 1 
ATOM   663  N N   . ALA A 1 86  ? -146.110 88.132 142.483 1.00 62.16  ? 86  ALA A N   1 
ATOM   664  C CA  . ALA A 1 86  ? -146.228 86.828 141.842 1.00 55.80  ? 86  ALA A CA  1 
ATOM   665  C C   . ALA A 1 86  ? -146.262 87.033 140.340 1.00 53.07  ? 86  ALA A C   1 
ATOM   666  O O   . ALA A 1 86  ? -145.705 86.248 139.585 1.00 51.33  ? 86  ALA A O   1 
ATOM   667  C CB  . ALA A 1 86  ? -147.469 86.099 142.314 1.00 52.57  ? 86  ALA A CB  1 
ATOM   668  N N   . HIS A 1 87  ? -146.905 88.119 139.919 1.00 55.65  ? 87  HIS A N   1 
ATOM   669  C CA  . HIS A 1 87  ? -146.990 88.487 138.510 1.00 56.26  ? 87  HIS A CA  1 
ATOM   670  C C   . HIS A 1 87  ? -145.605 88.795 137.925 1.00 59.75  ? 87  HIS A C   1 
ATOM   671  O O   . HIS A 1 87  ? -145.312 88.445 136.780 1.00 60.57  ? 87  HIS A O   1 
ATOM   672  C CB  . HIS A 1 87  ? -147.929 89.691 138.344 1.00 56.98  ? 87  HIS A CB  1 
ATOM   673  C CG  . HIS A 1 87  ? -148.294 89.997 136.923 1.00 59.61  ? 87  HIS A CG  1 
ATOM   674  N ND1 . HIS A 1 87  ? -149.276 90.905 136.589 1.00 62.45  ? 87  HIS A ND1 1 
ATOM   675  C CD2 . HIS A 1 87  ? -147.810 89.521 135.752 1.00 58.47  ? 87  HIS A CD2 1 
ATOM   676  C CE1 . HIS A 1 87  ? -149.380 90.977 135.274 1.00 60.25  ? 87  HIS A CE1 1 
ATOM   677  N NE2 . HIS A 1 87  ? -148.500 90.147 134.743 1.00 61.53  ? 87  HIS A NE2 1 
ATOM   678  N N   . GLN A 1 88  ? -144.753 89.436 138.720 1.00 61.33  ? 88  GLN A N   1 
ATOM   679  C CA  . GLN A 1 88  ? -143.409 89.803 138.282 1.00 60.42  ? 88  GLN A CA  1 
ATOM   680  C C   . GLN A 1 88  ? -142.547 88.562 138.082 1.00 55.70  ? 88  GLN A C   1 
ATOM   681  O O   . GLN A 1 88  ? -141.715 88.515 137.179 1.00 56.25  ? 88  GLN A O   1 
ATOM   682  C CB  . GLN A 1 88  ? -142.761 90.744 139.300 1.00 65.36  ? 88  GLN A CB  1 
ATOM   683  C CG  . GLN A 1 88  ? -141.415 91.335 138.895 1.00 69.00  ? 88  GLN A CG  1 
ATOM   684  C CD  . GLN A 1 88  ? -140.925 92.384 139.889 1.00 78.79  ? 88  GLN A CD  1 
ATOM   685  O OE1 . GLN A 1 88  ? -141.510 92.568 140.960 1.00 82.41  ? 88  GLN A OE1 1 
ATOM   686  N NE2 . GLN A 1 88  ? -139.851 93.077 139.533 1.00 80.19  ? 88  GLN A NE2 1 
ATOM   687  N N   . ILE A 1 89  ? -142.747 87.557 138.928 1.00 57.10  ? 89  ILE A N   1 
ATOM   688  C CA  . ILE A 1 89  ? -142.061 86.280 138.768 1.00 52.73  ? 89  ILE A CA  1 
ATOM   689  C C   . ILE A 1 89  ? -142.554 85.554 137.518 1.00 48.72  ? 89  ILE A C   1 
ATOM   690  O O   . ILE A 1 89  ? -141.754 85.006 136.759 1.00 52.11  ? 89  ILE A O   1 
ATOM   691  C CB  . ILE A 1 89  ? -142.248 85.382 140.000 1.00 58.71  ? 89  ILE A CB  1 
ATOM   692  C CG1 . ILE A 1 89  ? -141.641 86.053 141.231 1.00 58.03  ? 89  ILE A CG1 1 
ATOM   693  C CG2 . ILE A 1 89  ? -141.601 84.028 139.760 1.00 58.20  ? 89  ILE A CG2 1 
ATOM   694  C CD1 . ILE A 1 89  ? -142.319 85.692 142.517 1.00 63.18  ? 89  ILE A CD1 1 
ATOM   695  N N   . ALA A 1 90  ? -143.865 85.555 137.293 1.00 47.29  ? 90  ALA A N   1 
ATOM   696  C CA  . ALA A 1 90  ? -144.420 84.893 136.112 1.00 46.58  ? 90  ALA A CA  1 
ATOM   697  C C   . ALA A 1 90  ? -143.849 85.485 134.826 1.00 50.00  ? 90  ALA A C   1 
ATOM   698  O O   . ALA A 1 90  ? -143.613 84.763 133.854 1.00 50.80  ? 90  ALA A O   1 
ATOM   699  C CB  . ALA A 1 90  ? -145.942 84.986 136.111 1.00 45.69  ? 90  ALA A CB  1 
ATOM   700  N N   . GLN A 1 91  ? -143.618 86.795 134.826 1.00 51.02  ? 91  GLN A N   1 
ATOM   701  C CA  . GLN A 1 91  ? -143.051 87.459 133.658 1.00 51.36  ? 91  GLN A CA  1 
ATOM   702  C C   . GLN A 1 91  ? -141.606 87.047 133.427 1.00 45.78  ? 91  GLN A C   1 
ATOM   703  O O   . GLN A 1 91  ? -141.188 86.878 132.284 1.00 45.80  ? 91  GLN A O   1 
ATOM   704  C CB  . GLN A 1 91  ? -143.175 88.980 133.795 1.00 57.78  ? 91  GLN A CB  1 
ATOM   705  C CG  . GLN A 1 91  ? -144.552 89.490 133.415 1.00 62.46  ? 91  GLN A CG  1 
ATOM   706  C CD  . GLN A 1 91  ? -144.569 90.976 133.123 1.00 71.33  ? 91  GLN A CD  1 
ATOM   707  O OE1 . GLN A 1 91  ? -143.520 91.605 132.997 1.00 74.86  ? 91  GLN A OE1 1 
ATOM   708  N NE2 . GLN A 1 91  ? -145.765 91.548 133.014 1.00 74.09  ? 91  GLN A NE2 1 
ATOM   709  N N   . LEU A 1 92  ? -140.860 86.878 134.514 1.00 45.41  ? 92  LEU A N   1 
ATOM   710  C CA  . LEU A 1 92  ? -139.547 86.257 134.452 1.00 53.67  ? 92  LEU A CA  1 
ATOM   711  C C   . LEU A 1 92  ? -139.633 84.945 133.686 1.00 49.20  ? 92  LEU A C   1 
ATOM   712  O O   . LEU A 1 92  ? -138.893 84.722 132.730 1.00 49.55  ? 92  LEU A O   1 
ATOM   713  C CB  . LEU A 1 92  ? -138.996 85.996 135.853 1.00 62.76  ? 92  LEU A CB  1 
ATOM   714  C CG  . LEU A 1 92  ? -138.566 87.196 136.682 1.00 74.93  ? 92  LEU A CG  1 
ATOM   715  C CD1 . LEU A 1 92  ? -138.153 86.728 138.063 1.00 80.76  ? 92  LEU A CD1 1 
ATOM   716  C CD2 . LEU A 1 92  ? -137.415 87.898 135.989 1.00 79.92  ? 92  LEU A CD2 1 
ATOM   717  N N   . LEU A 1 93  ? -140.566 84.096 134.104 1.00 45.80  ? 93  LEU A N   1 
ATOM   718  C CA  . LEU A 1 93  ? -140.712 82.768 133.531 1.00 47.02  ? 93  LEU A CA  1 
ATOM   719  C C   . LEU A 1 93  ? -141.175 82.837 132.082 1.00 47.34  ? 93  LEU A C   1 
ATOM   720  O O   . LEU A 1 93  ? -140.791 82.001 131.269 1.00 45.19  ? 93  LEU A O   1 
ATOM   721  C CB  . LEU A 1 93  ? -141.688 81.935 134.362 1.00 40.02  ? 93  LEU A CB  1 
ATOM   722  C CG  . LEU A 1 93  ? -141.272 81.780 135.822 1.00 44.34  ? 93  LEU A CG  1 
ATOM   723  C CD1 . LEU A 1 93  ? -142.317 80.995 136.600 1.00 39.96  ? 93  LEU A CD1 1 
ATOM   724  C CD2 . LEU A 1 93  ? -139.906 81.114 135.906 1.00 48.61  ? 93  LEU A CD2 1 
ATOM   725  N N   . ARG A 1 94  ? -141.986 83.843 131.759 1.00 49.68  ? 94  ARG A N   1 
ATOM   726  C CA  . ARG A 1 94  ? -142.498 84.007 130.402 1.00 51.14  ? 94  ARG A CA  1 
ATOM   727  C C   . ARG A 1 94  ? -141.383 84.473 129.475 1.00 51.62  ? 94  ARG A C   1 
ATOM   728  O O   . ARG A 1 94  ? -141.292 84.036 128.325 1.00 52.54  ? 94  ARG A O   1 
ATOM   729  C CB  . ARG A 1 94  ? -143.661 84.999 130.373 1.00 56.99  ? 94  ARG A CB  1 
ATOM   730  C CG  . ARG A 1 94  ? -144.196 85.287 128.975 1.00 59.14  ? 94  ARG A CG  1 
ATOM   731  C CD  . ARG A 1 94  ? -144.903 84.070 128.388 1.00 57.41  ? 94  ARG A CD  1 
ATOM   732  N NE  . ARG A 1 94  ? -145.310 84.281 127.000 1.00 59.83  ? 94  ARG A NE  1 
ATOM   733  C CZ  . ARG A 1 94  ? -146.413 84.929 126.634 1.00 67.16  ? 94  ARG A CZ  1 
ATOM   734  N NH1 . ARG A 1 94  ? -147.222 85.439 127.555 1.00 68.88  ? 94  ARG A NH1 1 
ATOM   735  N NH2 . ARG A 1 94  ? -146.705 85.075 125.347 1.00 68.60  ? 94  ARG A NH2 1 
ATOM   736  N N   . ALA A 1 95  ? -140.533 85.360 129.985 1.00 48.45  ? 95  ALA A N   1 
ATOM   737  C CA  . ALA A 1 95  ? -139.397 85.856 129.215 1.00 50.86  ? 95  ALA A CA  1 
ATOM   738  C C   . ALA A 1 95  ? -138.445 84.723 128.857 1.00 51.73  ? 95  ALA A C   1 
ATOM   739  O O   . ALA A 1 95  ? -137.975 84.638 127.726 1.00 48.70  ? 95  ALA A O   1 
ATOM   740  C CB  . ALA A 1 95  ? -138.658 86.941 129.988 1.00 51.53  ? 95  ALA A CB  1 
ATOM   741  N N   . ALA A 1 96  ? -138.158 83.864 129.830 1.00 52.50  ? 96  ALA A N   1 
ATOM   742  C CA  . ALA A 1 96  ? -137.258 82.737 129.615 1.00 51.07  ? 96  ALA A CA  1 
ATOM   743  C C   . ALA A 1 96  ? -137.880 81.747 128.637 1.00 49.43  ? 96  ALA A C   1 
ATOM   744  O O   . ALA A 1 96  ? -137.204 81.225 127.748 1.00 48.62  ? 96  ALA A O   1 
ATOM   745  C CB  . ALA A 1 96  ? -136.933 82.058 130.930 1.00 44.82  ? 96  ALA A CB  1 
ATOM   746  N N   . GLY A 1 97  ? -139.177 81.505 128.805 1.00 47.79  ? 97  GLY A N   1 
ATOM   747  C CA  . GLY A 1 97  ? -139.931 80.682 127.880 1.00 46.90  ? 97  GLY A CA  1 
ATOM   748  C C   . GLY A 1 97  ? -139.955 81.221 126.461 1.00 48.44  ? 97  GLY A C   1 
ATOM   749  O O   . GLY A 1 97  ? -139.885 80.450 125.503 1.00 48.94  ? 97  GLY A O   1 
ATOM   750  N N   . ASP A 1 98  ? -140.054 82.539 126.310 1.00 48.20  ? 98  ASP A N   1 
ATOM   751  C CA  . ASP A 1 98  ? -140.093 83.131 124.973 1.00 47.81  ? 98  ASP A CA  1 
ATOM   752  C C   . ASP A 1 98  ? -138.785 82.890 124.233 1.00 47.07  ? 98  ASP A C   1 
ATOM   753  O O   . ASP A 1 98  ? -138.753 82.857 123.004 1.00 47.91  ? 98  ASP A O   1 
ATOM   754  C CB  . ASP A 1 98  ? -140.388 84.632 125.040 1.00 52.14  ? 98  ASP A CB  1 
ATOM   755  C CG  . ASP A 1 98  ? -141.864 84.930 125.249 1.00 59.19  ? 98  ASP A CG  1 
ATOM   756  O OD1 . ASP A 1 98  ? -142.706 84.097 124.854 1.00 61.06  ? 98  ASP A OD1 1 
ATOM   757  O OD2 . ASP A 1 98  ? -142.184 86.001 125.806 1.00 66.32  ? 98  ASP A OD2 1 
ATOM   758  N N   . ALA A 1 99  ? -137.709 82.708 124.989 1.00 49.02  ? 99  ALA A N   1 
ATOM   759  C CA  . ALA A 1 99  ? -136.400 82.456 124.405 1.00 49.92  ? 99  ALA A CA  1 
ATOM   760  C C   . ALA A 1 99  ? -136.276 81.055 123.791 1.00 52.74  ? 99  ALA A C   1 
ATOM   761  O O   . ALA A 1 99  ? -135.310 80.782 123.080 1.00 52.05  ? 99  ALA A O   1 
ATOM   762  C CB  . ALA A 1 99  ? -135.316 82.669 125.449 1.00 46.22  ? 99  ALA A CB  1 
ATOM   763  N N   . THR A 1 100 ? -137.235 80.167 124.049 1.00 53.29  ? 100 THR A N   1 
ATOM   764  C CA  . THR A 1 100 ? -137.189 78.852 123.405 1.00 54.54  ? 100 THR A CA  1 
ATOM   765  C C   . THR A 1 100 ? -137.702 78.942 121.970 1.00 58.84  ? 100 THR A C   1 
ATOM   766  O O   . THR A 1 100 ? -137.402 78.077 121.148 1.00 58.09  ? 100 THR A O   1 
ATOM   767  C CB  . THR A 1 100 ? -138.003 77.765 124.164 1.00 41.01  ? 100 THR A CB  1 
ATOM   768  O OG1 . THR A 1 100 ? -139.402 78.071 124.123 1.00 43.21  ? 100 THR A OG1 1 
ATOM   769  C CG2 . THR A 1 100 ? -137.543 77.638 125.606 1.00 37.44  ? 100 THR A CG2 1 
ATOM   770  N N   . LYS A 1 101 ? -138.468 79.987 121.667 1.00 64.55  ? 101 LYS A N   1 
ATOM   771  C CA  . LYS A 1 101 ? -138.933 80.205 120.299 1.00 71.24  ? 101 LYS A CA  1 
ATOM   772  C C   . LYS A 1 101 ? -137.762 80.573 119.404 1.00 72.52  ? 101 LYS A C   1 
ATOM   773  O O   . LYS A 1 101 ? -137.615 80.045 118.301 1.00 75.53  ? 101 LYS A O   1 
ATOM   774  C CB  . LYS A 1 101 ? -139.999 81.294 120.247 1.00 75.78  ? 101 LYS A CB  1 
ATOM   775  C CG  . LYS A 1 101 ? -141.254 80.922 120.997 1.00 81.60  ? 101 LYS A CG  1 
ATOM   776  C CD  . LYS A 1 101 ? -142.353 81.930 120.798 1.00 89.60  ? 101 LYS A CD  1 
ATOM   777  C CE  . LYS A 1 101 ? -143.653 81.376 121.333 1.00 93.98  ? 101 LYS A CE  1 
ATOM   778  N NZ  . LYS A 1 101 ? -144.701 82.424 121.451 1.00 99.38  ? 101 LYS A NZ  1 
ATOM   779  N N   . ASP A 1 102 ? -136.927 81.482 119.890 1.00 71.16  ? 102 ASP A N   1 
ATOM   780  C CA  . ASP A 1 102 ? -135.712 81.855 119.182 1.00 74.48  ? 102 ASP A CA  1 
ATOM   781  C C   . ASP A 1 102 ? -134.707 80.704 119.204 1.00 67.79  ? 102 ASP A C   1 
ATOM   782  O O   . ASP A 1 102 ? -133.851 80.601 118.329 1.00 72.08  ? 102 ASP A O   1 
ATOM   783  C CB  . ASP A 1 102 ? -135.092 83.109 119.802 1.00 84.32  ? 102 ASP A CB  1 
ATOM   784  C CG  . ASP A 1 102 ? -136.069 84.272 119.890 1.00 89.85  ? 102 ASP A CG  1 
ATOM   785  O OD1 . ASP A 1 102 ? -137.280 84.030 120.074 1.00 90.55  ? 102 ASP A OD1 1 
ATOM   786  O OD2 . ASP A 1 102 ? -135.621 85.434 119.784 1.00 92.64  ? 102 ASP A OD2 1 
ATOM   787  N N   . GLY A 1 103 ? -134.818 79.844 120.213 1.00 56.75  ? 103 GLY A N   1 
ATOM   788  C CA  . GLY A 1 103 ? -133.905 78.728 120.381 1.00 49.89  ? 103 GLY A CA  1 
ATOM   789  C C   . GLY A 1 103 ? -132.622 79.114 121.094 1.00 51.18  ? 103 GLY A C   1 
ATOM   790  O O   . GLY A 1 103 ? -131.562 78.552 120.820 1.00 52.37  ? 103 GLY A O   1 
ATOM   791  N N   . PHE A 1 104 ? -132.720 80.059 122.025 1.00 52.29  ? 104 PHE A N   1 
ATOM   792  C CA  . PHE A 1 104 ? -131.534 80.649 122.642 1.00 54.44  ? 104 PHE A CA  1 
ATOM   793  C C   . PHE A 1 104 ? -131.325 80.223 124.092 1.00 52.27  ? 104 PHE A C   1 
ATOM   794  O O   . PHE A 1 104 ? -130.272 80.490 124.673 1.00 54.08  ? 104 PHE A O   1 
ATOM   795  C CB  . PHE A 1 104 ? -131.610 82.177 122.571 1.00 58.20  ? 104 PHE A CB  1 
ATOM   796  C CG  . PHE A 1 104 ? -131.535 82.728 121.174 1.00 61.67  ? 104 PHE A CG  1 
ATOM   797  C CD1 . PHE A 1 104 ? -131.029 81.963 120.130 1.00 62.83  ? 104 PHE A CD1 1 
ATOM   798  C CD2 . PHE A 1 104 ? -131.962 84.018 120.904 1.00 64.03  ? 104 PHE A CD2 1 
ATOM   799  C CE1 . PHE A 1 104 ? -130.958 82.475 118.843 1.00 64.41  ? 104 PHE A CE1 1 
ATOM   800  C CE2 . PHE A 1 104 ? -131.895 84.536 119.621 1.00 64.56  ? 104 PHE A CE2 1 
ATOM   801  C CZ  . PHE A 1 104 ? -131.393 83.764 118.590 1.00 64.23  ? 104 PHE A CZ  1 
ATOM   802  N N   . LEU A 1 105 ? -132.321 79.564 124.674 1.00 48.45  ? 105 LEU A N   1 
ATOM   803  C CA  . LEU A 1 105 ? -132.253 79.171 126.080 1.00 47.38  ? 105 LEU A CA  1 
ATOM   804  C C   . LEU A 1 105 ? -131.730 77.747 126.257 1.00 44.90  ? 105 LEU A C   1 
ATOM   805  O O   . LEU A 1 105 ? -132.331 76.795 125.762 1.00 44.65  ? 105 LEU A O   1 
ATOM   806  C CB  . LEU A 1 105 ? -133.629 79.298 126.737 1.00 46.72  ? 105 LEU A CB  1 
ATOM   807  C CG  . LEU A 1 105 ? -133.635 78.987 128.233 1.00 46.43  ? 105 LEU A CG  1 
ATOM   808  C CD1 . LEU A 1 105 ? -132.867 80.059 128.992 1.00 49.94  ? 105 LEU A CD1 1 
ATOM   809  C CD2 . LEU A 1 105 ? -135.056 78.855 128.756 1.00 45.11  ? 105 LEU A CD2 1 
ATOM   810  N N   . LYS A 1 106 ? -130.617 77.608 126.975 1.00 45.81  ? 106 LYS A N   1 
ATOM   811  C CA  . LYS A 1 106 ? -130.015 76.301 127.242 1.00 48.23  ? 106 LYS A CA  1 
ATOM   812  C C   . LYS A 1 106 ? -130.581 75.665 128.516 1.00 51.01  ? 106 LYS A C   1 
ATOM   813  O O   . LYS A 1 106 ? -130.996 74.502 128.517 1.00 51.36  ? 106 LYS A O   1 
ATOM   814  C CB  . LYS A 1 106 ? -128.490 76.433 127.347 1.00 53.22  ? 106 LYS A CB  1 
ATOM   815  C CG  . LYS A 1 106 ? -127.764 75.178 127.819 1.00 60.81  ? 106 LYS A CG  1 
ATOM   816  C CD  . LYS A 1 106 ? -127.815 74.059 126.788 1.00 63.40  ? 106 LYS A CD  1 
ATOM   817  C CE  . LYS A 1 106 ? -126.994 72.852 127.237 1.00 68.50  ? 106 LYS A CE  1 
ATOM   818  N NZ  . LYS A 1 106 ? -127.442 72.308 128.554 1.00 69.55  ? 106 LYS A NZ  1 
ATOM   819  N N   . GLU A 1 107 ? -130.605 76.442 129.593 1.00 52.34  ? 107 GLU A N   1 
ATOM   820  C CA  . GLU A 1 107 ? -131.074 75.966 130.887 1.00 51.50  ? 107 GLU A CA  1 
ATOM   821  C C   . GLU A 1 107 ? -131.624 77.108 131.728 1.00 52.14  ? 107 GLU A C   1 
ATOM   822  O O   . GLU A 1 107 ? -131.008 78.167 131.810 1.00 54.82  ? 107 GLU A O   1 
ATOM   823  C CB  . GLU A 1 107 ? -129.939 75.281 131.651 1.00 55.05  ? 107 GLU A CB  1 
ATOM   824  C CG  . GLU A 1 107 ? -130.288 74.954 133.098 1.00 58.24  ? 107 GLU A CG  1 
ATOM   825  C CD  . GLU A 1 107 ? -129.131 74.353 133.877 1.00 63.14  ? 107 GLU A CD  1 
ATOM   826  O OE1 . GLU A 1 107 ? -128.093 74.025 133.265 1.00 65.65  ? 107 GLU A OE1 1 
ATOM   827  O OE2 . GLU A 1 107 ? -129.262 74.208 135.110 1.00 63.93  ? 107 GLU A OE2 1 
ATOM   828  N N   . ILE A 1 108 ? -132.781 76.905 132.351 1.00 48.66  ? 108 ILE A N   1 
ATOM   829  C CA  . ILE A 1 108 ? -133.231 77.830 133.385 1.00 48.15  ? 108 ILE A CA  1 
ATOM   830  C C   . ILE A 1 108 ? -133.342 77.093 134.716 1.00 51.86  ? 108 ILE A C   1 
ATOM   831  O O   . ILE A 1 108 ? -133.939 76.016 134.801 1.00 50.84  ? 108 ILE A O   1 
ATOM   832  C CB  . ILE A 1 108 ? -134.577 78.508 133.034 1.00 46.98  ? 108 ILE A CB  1 
ATOM   833  C CG1 . ILE A 1 108 ? -135.051 79.357 134.216 1.00 53.06  ? 108 ILE A CG1 1 
ATOM   834  C CG2 . ILE A 1 108 ? -135.629 77.483 132.639 1.00 42.05  ? 108 ILE A CG2 1 
ATOM   835  C CD1 . ILE A 1 108 ? -136.269 80.200 133.931 1.00 54.29  ? 108 ILE A CD1 1 
ATOM   836  N N   . SER A 1 109 ? -132.741 77.666 135.753 1.00 53.32  ? 109 SER A N   1 
ATOM   837  C CA  . SER A 1 109 ? -132.708 77.013 137.053 1.00 54.23  ? 109 SER A CA  1 
ATOM   838  C C   . SER A 1 109 ? -133.226 77.900 138.175 1.00 54.48  ? 109 SER A C   1 
ATOM   839  O O   . SER A 1 109 ? -132.959 79.107 138.213 1.00 53.70  ? 109 SER A O   1 
ATOM   840  C CB  . SER A 1 109 ? -131.285 76.552 137.378 1.00 59.16  ? 109 SER A CB  1 
ATOM   841  O OG  . SER A 1 109 ? -130.890 75.492 136.528 1.00 61.10  ? 109 SER A OG  1 
ATOM   842  N N   . LEU A 1 110 ? -133.987 77.286 139.073 1.00 51.02  ? 110 LEU A N   1 
ATOM   843  C CA  . LEU A 1 110 ? -134.350 77.908 140.334 1.00 52.72  ? 110 LEU A CA  1 
ATOM   844  C C   . LEU A 1 110 ? -133.265 77.574 141.349 1.00 57.41  ? 110 LEU A C   1 
ATOM   845  O O   . LEU A 1 110 ? -133.094 76.414 141.721 1.00 58.51  ? 110 LEU A O   1 
ATOM   846  C CB  . LEU A 1 110 ? -135.714 77.420 140.817 1.00 51.08  ? 110 LEU A CB  1 
ATOM   847  C CG  . LEU A 1 110 ? -136.092 77.894 142.219 1.00 57.25  ? 110 LEU A CG  1 
ATOM   848  C CD1 . LEU A 1 110 ? -135.957 79.406 142.314 1.00 60.73  ? 110 LEU A CD1 1 
ATOM   849  C CD2 . LEU A 1 110 ? -137.500 77.459 142.581 1.00 56.91  ? 110 LEU A CD2 1 
ATOM   850  N N   . VAL A 1 111 ? -132.533 78.591 141.790 1.00 58.70  ? 111 VAL A N   1 
ATOM   851  C CA  . VAL A 1 111 ? -131.351 78.382 142.615 1.00 64.32  ? 111 VAL A CA  1 
ATOM   852  C C   . VAL A 1 111 ? -131.524 78.924 144.031 1.00 69.60  ? 111 VAL A C   1 
ATOM   853  O O   . VAL A 1 111 ? -131.824 80.102 144.221 1.00 70.23  ? 111 VAL A O   1 
ATOM   854  C CB  . VAL A 1 111 ? -130.117 79.039 141.966 1.00 67.29  ? 111 VAL A CB  1 
ATOM   855  C CG1 . VAL A 1 111 ? -128.926 78.995 142.907 1.00 70.48  ? 111 VAL A CG1 1 
ATOM   856  C CG2 . VAL A 1 111 ? -129.792 78.359 140.645 1.00 66.73  ? 111 VAL A CG2 1 
ATOM   857  N N   . VAL A 1 112 ? -131.331 78.058 145.022 1.00 69.48  ? 112 VAL A N   1 
ATOM   858  C CA  . VAL A 1 112 ? -131.461 78.461 146.417 1.00 69.54  ? 112 VAL A CA  1 
ATOM   859  C C   . VAL A 1 112 ? -130.103 78.489 147.116 1.00 74.36  ? 112 VAL A C   1 
ATOM   860  O O   . VAL A 1 112 ? -129.358 77.510 147.096 1.00 74.15  ? 112 VAL A O   1 
ATOM   861  C CB  . VAL A 1 112 ? -132.410 77.528 147.185 1.00 68.04  ? 112 VAL A CB  1 
ATOM   862  C CG1 . VAL A 1 112 ? -132.600 78.024 148.610 1.00 71.77  ? 112 VAL A CG1 1 
ATOM   863  C CG2 . VAL A 1 112 ? -133.749 77.435 146.468 1.00 64.36  ? 112 VAL A CG2 1 
ATOM   864  N N   . THR A 1 113 ? -129.787 79.629 147.723 1.00 79.95  ? 113 THR A N   1 
ATOM   865  C CA  . THR A 1 113 ? -128.536 79.808 148.454 1.00 87.31  ? 113 THR A CA  1 
ATOM   866  C C   . THR A 1 113 ? -128.814 80.351 149.850 1.00 92.71  ? 113 THR A C   1 
ATOM   867  O O   . THR A 1 113 ? -129.854 80.965 150.079 1.00 95.09  ? 113 THR A O   1 
ATOM   868  C CB  . THR A 1 113 ? -127.580 80.775 147.730 1.00 88.31  ? 113 THR A CB  1 
ATOM   869  O OG1 . THR A 1 113 ? -128.224 82.045 147.554 1.00 88.04  ? 113 THR A OG1 1 
ATOM   870  C CG2 . THR A 1 113 ? -127.176 80.223 146.372 1.00 85.71  ? 113 THR A CG2 1 
ATOM   871  N N   . GLU A 1 114 ? -127.887 80.136 150.778 1.00 95.96  ? 114 GLU A N   1 
ATOM   872  C CA  . GLU A 1 114 ? -128.039 80.669 152.129 1.00 101.82 ? 114 GLU A CA  1 
ATOM   873  C C   . GLU A 1 114 ? -127.857 82.188 152.142 1.00 102.84 ? 114 GLU A C   1 
ATOM   874  O O   . GLU A 1 114 ? -128.619 82.908 152.787 1.00 102.18 ? 114 GLU A O   1 
ATOM   875  C CB  . GLU A 1 114 ? -127.051 80.000 153.091 1.00 109.89 ? 114 GLU A CB  1 
ATOM   876  C CG  . GLU A 1 114 ? -125.600 80.029 152.639 1.00 115.32 ? 114 GLU A CG  1 
ATOM   877  C CD  . GLU A 1 114 ? -124.655 79.474 153.687 1.00 122.54 ? 114 GLU A CD  1 
ATOM   878  O OE1 . GLU A 1 114 ? -125.122 79.151 154.802 1.00 124.93 ? 114 GLU A OE1 1 
ATOM   879  O OE2 . GLU A 1 114 ? -123.444 79.360 153.398 1.00 125.48 ? 114 GLU A OE2 1 
ATOM   880  N N   . HIS A 1 115 ? -126.857 82.672 151.413 1.00 103.94 ? 115 HIS A N   1 
ATOM   881  C CA  . HIS A 1 115 ? -126.594 84.105 151.345 1.00 106.03 ? 115 HIS A CA  1 
ATOM   882  C C   . HIS A 1 115 ? -126.820 84.644 149.936 1.00 104.45 ? 115 HIS A C   1 
ATOM   883  O O   . HIS A 1 115 ? -126.513 83.979 148.945 1.00 101.24 ? 115 HIS A O   1 
ATOM   884  C CB  . HIS A 1 115 ? -125.167 84.415 151.808 1.00 109.26 ? 115 HIS A CB  1 
ATOM   885  C CG  . HIS A 1 115 ? -124.853 83.897 153.178 1.00 112.73 ? 115 HIS A CG  1 
ATOM   886  N ND1 . HIS A 1 115 ? -125.794 83.828 154.182 1.00 112.80 ? 115 HIS A ND1 1 
ATOM   887  C CD2 . HIS A 1 115 ? -123.704 83.411 153.702 1.00 115.69 ? 115 HIS A CD2 1 
ATOM   888  C CE1 . HIS A 1 115 ? -125.236 83.326 155.270 1.00 116.18 ? 115 HIS A CE1 1 
ATOM   889  N NE2 . HIS A 1 115 ? -123.970 83.065 155.007 1.00 118.15 ? 115 HIS A NE2 1 
ATOM   890  N N   . ASP A 1 116 ? -127.361 85.855 149.861 1.00 106.25 ? 116 ASP A N   1 
ATOM   891  C CA  . ASP A 1 116 ? -127.659 86.490 148.584 1.00 103.24 ? 116 ASP A CA  1 
ATOM   892  C C   . ASP A 1 116 ? -126.383 86.723 147.778 1.00 102.64 ? 116 ASP A C   1 
ATOM   893  O O   . ASP A 1 116 ? -125.468 87.409 148.233 1.00 104.18 ? 116 ASP A O   1 
ATOM   894  C CB  . ASP A 1 116 ? -128.393 87.814 148.811 1.00 105.63 ? 116 ASP A CB  1 
ATOM   895  C CG  . ASP A 1 116 ? -129.138 88.293 147.577 1.00 105.75 ? 116 ASP A CG  1 
ATOM   896  O OD1 . ASP A 1 116 ? -128.734 87.933 146.451 1.00 106.34 ? 116 ASP A OD1 1 
ATOM   897  O OD2 . ASP A 1 116 ? -130.132 89.032 147.738 1.00 105.49 ? 116 ASP A OD2 1 
ATOM   898  N N   . GLY A 1 117 ? -126.326 86.140 146.585 1.00 100.16 ? 117 GLY A N   1 
ATOM   899  C CA  . GLY A 1 117 ? -125.195 86.337 145.696 1.00 101.90 ? 117 GLY A CA  1 
ATOM   900  C C   . GLY A 1 117 ? -124.249 85.154 145.598 1.00 103.36 ? 117 GLY A C   1 
ATOM   901  O O   . GLY A 1 117 ? -123.276 85.198 144.844 1.00 104.75 ? 117 GLY A O   1 
ATOM   902  N N   . ASP A 1 118 ? -124.529 84.096 146.353 1.00 102.82 ? 118 ASP A N   1 
ATOM   903  C CA  . ASP A 1 118 ? -123.678 82.911 146.347 1.00 103.45 ? 118 ASP A CA  1 
ATOM   904  C C   . ASP A 1 118 ? -123.677 82.226 144.983 1.00 98.74  ? 118 ASP A C   1 
ATOM   905  O O   . ASP A 1 118 ? -124.709 82.133 144.323 1.00 94.21  ? 118 ASP A O   1 
ATOM   906  C CB  . ASP A 1 118 ? -124.122 81.918 147.426 1.00 104.99 ? 118 ASP A CB  1 
ATOM   907  C CG  . ASP A 1 118 ? -123.657 82.315 148.816 1.00 111.58 ? 118 ASP A CG  1 
ATOM   908  O OD1 . ASP A 1 118 ? -122.663 83.063 148.921 1.00 116.22 ? 118 ASP A OD1 1 
ATOM   909  O OD2 . ASP A 1 118 ? -124.282 81.872 149.805 1.00 111.90 ? 118 ASP A OD2 1 
ATOM   910  N N   . VAL A 1 119 ? -122.507 81.753 144.568 1.00 100.77 ? 119 VAL A N   1 
ATOM   911  C CA  . VAL A 1 119 ? -122.374 81.006 143.326 1.00 99.86  ? 119 VAL A CA  1 
ATOM   912  C C   . VAL A 1 119 ? -122.548 79.516 143.616 1.00 100.92 ? 119 VAL A C   1 
ATOM   913  O O   . VAL A 1 119 ? -122.741 78.707 142.709 1.00 98.69  ? 119 VAL A O   1 
ATOM   914  C CB  . VAL A 1 119 ? -121.007 81.269 142.656 1.00 102.40 ? 119 VAL A CB  1 
ATOM   915  C CG1 . VAL A 1 119 ? -120.950 80.642 141.272 1.00 99.33  ? 119 VAL A CG1 1 
ATOM   916  C CG2 . VAL A 1 119 ? -120.743 82.764 142.565 1.00 105.24 ? 119 VAL A CG2 1 
ATOM   917  N N   . GLU A 1 120 ? -122.487 79.162 144.896 1.00 102.72 ? 120 GLU A N   1 
ATOM   918  C CA  . GLU A 1 120 ? -122.712 77.787 145.322 1.00 101.86 ? 120 GLU A CA  1 
ATOM   919  C C   . GLU A 1 120 ? -124.089 77.657 145.960 1.00 97.84  ? 120 GLU A C   1 
ATOM   920  O O   . GLU A 1 120 ? -124.410 78.372 146.908 1.00 99.93  ? 120 GLU A O   1 
ATOM   921  C CB  . GLU A 1 120 ? -121.632 77.335 146.304 1.00 107.77 ? 120 GLU A CB  1 
ATOM   922  C CG  . GLU A 1 120 ? -121.752 75.878 146.718 1.00 110.24 ? 120 GLU A CG  1 
ATOM   923  C CD  . GLU A 1 120 ? -120.670 75.452 147.686 1.00 119.56 ? 120 GLU A CD  1 
ATOM   924  O OE1 . GLU A 1 120 ? -119.848 76.306 148.078 1.00 125.61 ? 120 GLU A OE1 1 
ATOM   925  O OE2 . GLU A 1 120 ? -120.644 74.259 148.054 1.00 121.64 ? 120 GLU A OE2 1 
ATOM   926  N N   . ALA A 1 121 ? -124.900 76.741 145.443 1.00 91.23  ? 121 ALA A N   1 
ATOM   927  C CA  . ALA A 1 121 ? -126.270 76.597 145.920 1.00 86.65  ? 121 ALA A CA  1 
ATOM   928  C C   . ALA A 1 121 ? -126.422 75.461 146.923 1.00 84.60  ? 121 ALA A C   1 
ATOM   929  O O   . ALA A 1 121 ? -125.569 74.579 147.021 1.00 85.19  ? 121 ALA A O   1 
ATOM   930  C CB  . ALA A 1 121 ? -127.209 76.385 144.749 1.00 83.30  ? 121 ALA A CB  1 
ATOM   931  N N   . ILE A 1 122 ? -127.522 75.499 147.669 1.00 82.33  ? 122 ILE A N   1 
ATOM   932  C CA  . ILE A 1 122 ? -127.862 74.437 148.604 1.00 79.07  ? 122 ILE A CA  1 
ATOM   933  C C   . ILE A 1 122 ? -129.019 73.614 148.040 1.00 74.64  ? 122 ILE A C   1 
ATOM   934  O O   . ILE A 1 122 ? -129.313 72.520 148.524 1.00 77.28  ? 122 ILE A O   1 
ATOM   935  C CB  . ILE A 1 122 ? -128.239 74.996 149.993 1.00 78.94  ? 122 ILE A CB  1 
ATOM   936  C CG1 . ILE A 1 122 ? -129.581 75.732 149.938 1.00 75.94  ? 122 ILE A CG1 1 
ATOM   937  C CG2 . ILE A 1 122 ? -127.142 75.918 150.512 1.00 79.00  ? 122 ILE A CG2 1 
ATOM   938  C CD1 . ILE A 1 122 ? -130.215 75.947 151.304 1.00 76.49  ? 122 ILE A CD1 1 
ATOM   939  N N   . GLU A 1 123 ? -129.664 74.151 147.006 1.00 70.82  ? 123 GLU A N   1 
ATOM   940  C CA  . GLU A 1 123 ? -130.748 73.459 146.311 1.00 68.21  ? 123 GLU A CA  1 
ATOM   941  C C   . GLU A 1 123 ? -130.964 74.043 144.914 1.00 65.24  ? 123 GLU A C   1 
ATOM   942  O O   . GLU A 1 123 ? -131.002 75.262 144.746 1.00 65.81  ? 123 GLU A O   1 
ATOM   943  C CB  . GLU A 1 123 ? -132.044 73.539 147.121 1.00 69.95  ? 123 GLU A CB  1 
ATOM   944  C CG  . GLU A 1 123 ? -133.219 72.802 146.500 1.00 71.83  ? 123 GLU A CG  1 
ATOM   945  C CD  . GLU A 1 123 ? -134.350 72.573 147.486 1.00 77.85  ? 123 GLU A CD  1 
ATOM   946  O OE1 . GLU A 1 123 ? -134.227 71.673 148.347 1.00 80.10  ? 123 GLU A OE1 1 
ATOM   947  O OE2 . GLU A 1 123 ? -135.364 73.295 147.400 1.00 77.88  ? 123 GLU A OE2 1 
ATOM   948  N N   . VAL A 1 124 ? -131.099 73.173 143.915 1.00 61.57  ? 124 VAL A N   1 
ATOM   949  C CA  . VAL A 1 124 ? -131.310 73.611 142.536 1.00 60.30  ? 124 VAL A CA  1 
ATOM   950  C C   . VAL A 1 124 ? -132.389 72.800 141.824 1.00 60.32  ? 124 VAL A C   1 
ATOM   951  O O   . VAL A 1 124 ? -132.358 71.571 141.829 1.00 66.27  ? 124 VAL A O   1 
ATOM   952  C CB  . VAL A 1 124 ? -130.012 73.515 141.700 1.00 61.95  ? 124 VAL A CB  1 
ATOM   953  C CG1 . VAL A 1 124 ? -130.299 73.794 140.232 1.00 57.76  ? 124 VAL A CG1 1 
ATOM   954  C CG2 . VAL A 1 124 ? -128.959 74.474 142.223 1.00 66.29  ? 124 VAL A CG2 1 
ATOM   955  N N   . PHE A 1 125 ? -133.343 73.495 141.215 1.00 57.57  ? 125 PHE A N   1 
ATOM   956  C CA  . PHE A 1 125 ? -134.281 72.865 140.296 1.00 55.18  ? 125 PHE A CA  1 
ATOM   957  C C   . PHE A 1 125 ? -133.997 73.355 138.881 1.00 57.00  ? 125 PHE A C   1 
ATOM   958  O O   . PHE A 1 125 ? -134.230 74.523 138.567 1.00 55.31  ? 125 PHE A O   1 
ATOM   959  C CB  . PHE A 1 125 ? -135.725 73.166 140.696 1.00 55.11  ? 125 PHE A CB  1 
ATOM   960  C CG  . PHE A 1 125 ? -136.207 72.356 141.862 1.00 64.15  ? 125 PHE A CG  1 
ATOM   961  C CD1 . PHE A 1 125 ? -135.939 72.758 143.162 1.00 68.56  ? 125 PHE A CD1 1 
ATOM   962  C CD2 . PHE A 1 125 ? -136.925 71.186 141.660 1.00 65.41  ? 125 PHE A CD2 1 
ATOM   963  C CE1 . PHE A 1 125 ? -136.382 72.008 144.242 1.00 71.30  ? 125 PHE A CE1 1 
ATOM   964  C CE2 . PHE A 1 125 ? -137.371 70.431 142.733 1.00 67.87  ? 125 PHE A CE2 1 
ATOM   965  C CZ  . PHE A 1 125 ? -137.100 70.843 144.027 1.00 70.86  ? 125 PHE A CZ  1 
ATOM   966  N N   . SER A 1 126 ? -133.487 72.465 138.034 1.00 54.97  ? 126 SER A N   1 
ATOM   967  C CA  . SER A 1 126 ? -133.017 72.861 136.709 1.00 54.56  ? 126 SER A CA  1 
ATOM   968  C C   . SER A 1 126 ? -133.851 72.267 135.580 1.00 47.25  ? 126 SER A C   1 
ATOM   969  O O   . SER A 1 126 ? -134.293 71.118 135.651 1.00 48.61  ? 126 SER A O   1 
ATOM   970  C CB  . SER A 1 126 ? -131.552 72.460 136.528 1.00 60.26  ? 126 SER A CB  1 
ATOM   971  O OG  . SER A 1 126 ? -131.388 71.059 136.639 1.00 68.79  ? 126 SER A OG  1 
ATOM   972  N N   . MET A 1 127 ? -134.068 73.066 134.542 1.00 40.78  ? 127 MET A N   1 
ATOM   973  C CA  . MET A 1 127 ? -134.740 72.598 133.337 1.00 40.77  ? 127 MET A CA  1 
ATOM   974  C C   . MET A 1 127 ? -133.855 72.867 132.118 1.00 45.35  ? 127 MET A C   1 
ATOM   975  O O   . MET A 1 127 ? -133.704 74.011 131.688 1.00 49.84  ? 127 MET A O   1 
ATOM   976  C CB  . MET A 1 127 ? -136.108 73.273 133.181 1.00 39.46  ? 127 MET A CB  1 
ATOM   977  C CG  . MET A 1 127 ? -137.000 72.630 132.123 1.00 42.15  ? 127 MET A CG  1 
ATOM   978  S SD  . MET A 1 127 ? -138.695 73.264 132.104 1.00 58.62  ? 127 MET A SD  1 
ATOM   979  C CE  . MET A 1 127 ? -139.105 73.216 133.845 1.00 56.91  ? 127 MET A CE  1 
ATOM   980  N N   . LYS A 1 128 ? -133.263 71.806 131.575 1.00 45.50  ? 128 LYS A N   1 
ATOM   981  C CA  . LYS A 1 128 ? -132.340 71.927 130.449 1.00 47.44  ? 128 LYS A CA  1 
ATOM   982  C C   . LYS A 1 128 ? -133.026 71.556 129.143 1.00 45.68  ? 128 LYS A C   1 
ATOM   983  O O   . LYS A 1 128 ? -133.834 70.631 129.098 1.00 44.57  ? 128 LYS A O   1 
ATOM   984  C CB  . LYS A 1 128 ? -131.108 71.047 130.664 1.00 50.98  ? 128 LYS A CB  1 
ATOM   985  C CG  . LYS A 1 128 ? -130.291 71.412 131.894 1.00 56.89  ? 128 LYS A CG  1 
ATOM   986  C CD  . LYS A 1 128 ? -129.196 70.390 132.159 1.00 60.26  ? 128 LYS A CD  1 
ATOM   987  C CE  . LYS A 1 128 ? -128.369 70.770 133.378 1.00 63.75  ? 128 LYS A CE  1 
ATOM   988  N NZ  . LYS A 1 128 ? -127.288 69.785 133.666 1.00 68.32  ? 128 LYS A NZ  1 
ATOM   989  N N   . PHE A 1 129 ? -132.690 72.271 128.076 1.00 47.25  ? 129 PHE A N   1 
ATOM   990  C CA  . PHE A 1 129 ? -133.431 72.145 126.830 1.00 44.82  ? 129 PHE A CA  1 
ATOM   991  C C   . PHE A 1 129 ? -132.606 71.563 125.680 1.00 45.05  ? 129 PHE A C   1 
ATOM   992  O O   . PHE A 1 129 ? -131.377 71.647 125.663 1.00 45.91  ? 129 PHE A O   1 
ATOM   993  C CB  . PHE A 1 129 ? -134.007 73.513 126.437 1.00 42.43  ? 129 PHE A CB  1 
ATOM   994  C CG  . PHE A 1 129 ? -135.074 74.008 127.378 1.00 42.29  ? 129 PHE A CG  1 
ATOM   995  C CD1 . PHE A 1 129 ? -134.742 74.747 128.506 1.00 46.62  ? 129 PHE A CD1 1 
ATOM   996  C CD2 . PHE A 1 129 ? -136.411 73.717 127.144 1.00 40.75  ? 129 PHE A CD2 1 
ATOM   997  C CE1 . PHE A 1 129 ? -135.725 75.192 129.379 1.00 45.94  ? 129 PHE A CE1 1 
ATOM   998  C CE2 . PHE A 1 129 ? -137.398 74.159 128.010 1.00 41.00  ? 129 PHE A CE2 1 
ATOM   999  C CZ  . PHE A 1 129 ? -137.054 74.896 129.128 1.00 43.35  ? 129 PHE A CZ  1 
ATOM   1000 N N   . ILE A 1 130 ? -133.307 70.940 124.738 1.00 40.60  ? 130 ILE A N   1 
ATOM   1001 C CA  . ILE A 1 130 ? -132.715 70.466 123.496 1.00 37.81  ? 130 ILE A CA  1 
ATOM   1002 C C   . ILE A 1 130 ? -133.601 70.927 122.356 1.00 38.06  ? 130 ILE A C   1 
ATOM   1003 O O   . ILE A 1 130 ? -134.824 70.816 122.430 1.00 37.02  ? 130 ILE A O   1 
ATOM   1004 C CB  . ILE A 1 130 ? -132.581 68.929 123.454 1.00 36.87  ? 130 ILE A CB  1 
ATOM   1005 C CG1 . ILE A 1 130 ? -131.752 68.424 124.635 1.00 37.63  ? 130 ILE A CG1 1 
ATOM   1006 C CG2 . ILE A 1 130 ? -131.959 68.475 122.133 1.00 38.50  ? 130 ILE A CG2 1 
ATOM   1007 C CD1 . ILE A 1 130 ? -131.710 66.916 124.755 1.00 39.84  ? 130 ILE A CD1 1 
ATOM   1008 N N   . TYR A 1 131 ? -132.986 71.454 121.306 1.00 40.19  ? 131 TYR A N   1 
ATOM   1009 C CA  . TYR A 1 131 ? -133.733 71.940 120.162 1.00 39.63  ? 131 TYR A CA  1 
ATOM   1010 C C   . TYR A 1 131 ? -133.566 70.975 118.995 1.00 40.69  ? 131 TYR A C   1 
ATOM   1011 O O   . TYR A 1 131 ? -132.481 70.441 118.778 1.00 42.17  ? 131 TYR A O   1 
ATOM   1012 C CB  . TYR A 1 131 ? -133.272 73.355 119.805 1.00 40.32  ? 131 TYR A CB  1 
ATOM   1013 C CG  . TYR A 1 131 ? -133.535 74.332 120.929 1.00 40.32  ? 131 TYR A CG  1 
ATOM   1014 C CD1 . TYR A 1 131 ? -134.782 74.923 121.077 1.00 39.38  ? 131 TYR A CD1 1 
ATOM   1015 C CD2 . TYR A 1 131 ? -132.550 74.636 121.865 1.00 40.54  ? 131 TYR A CD2 1 
ATOM   1016 C CE1 . TYR A 1 131 ? -135.038 75.803 122.110 1.00 40.03  ? 131 TYR A CE1 1 
ATOM   1017 C CE2 . TYR A 1 131 ? -132.801 75.516 122.904 1.00 41.41  ? 131 TYR A CE2 1 
ATOM   1018 C CZ  . TYR A 1 131 ? -134.048 76.097 123.020 1.00 43.52  ? 131 TYR A CZ  1 
ATOM   1019 O OH  . TYR A 1 131 ? -134.314 76.977 124.049 1.00 47.07  ? 131 TYR A OH  1 
ATOM   1020 N N   . PHE A 1 132 ? -134.650 70.718 118.271 1.00 43.06  ? 132 PHE A N   1 
ATOM   1021 C CA  . PHE A 1 132 ? -134.590 69.805 117.135 1.00 45.00  ? 132 PHE A CA  1 
ATOM   1022 C C   . PHE A 1 132 ? -134.872 70.521 115.825 1.00 51.06  ? 132 PHE A C   1 
ATOM   1023 O O   . PHE A 1 132 ? -135.536 71.562 115.790 1.00 51.38  ? 132 PHE A O   1 
ATOM   1024 C CB  . PHE A 1 132 ? -135.575 68.648 117.307 1.00 40.90  ? 132 PHE A CB  1 
ATOM   1025 C CG  . PHE A 1 132 ? -135.241 67.728 118.445 1.00 41.28  ? 132 PHE A CG  1 
ATOM   1026 C CD1 . PHE A 1 132 ? -135.646 68.029 119.738 1.00 38.10  ? 132 PHE A CD1 1 
ATOM   1027 C CD2 . PHE A 1 132 ? -134.532 66.553 118.224 1.00 36.87  ? 132 PHE A CD2 1 
ATOM   1028 C CE1 . PHE A 1 132 ? -135.345 67.181 120.793 1.00 38.95  ? 132 PHE A CE1 1 
ATOM   1029 C CE2 . PHE A 1 132 ? -134.225 65.700 119.275 1.00 34.51  ? 132 PHE A CE2 1 
ATOM   1030 C CZ  . PHE A 1 132 ? -134.634 66.015 120.561 1.00 36.87  ? 132 PHE A CZ  1 
ATOM   1031 N N   . GLU A 1 133 ? -134.360 69.939 114.750 1.00 56.50  ? 133 GLU A N   1 
ATOM   1032 C CA  . GLU A 1 133 ? -134.547 70.463 113.408 1.00 60.49  ? 133 GLU A CA  1 
ATOM   1033 C C   . GLU A 1 133 ? -134.987 69.326 112.499 1.00 59.67  ? 133 GLU A C   1 
ATOM   1034 O O   . GLU A 1 133 ? -135.079 68.181 112.947 1.00 57.04  ? 133 GLU A O   1 
ATOM   1035 C CB  . GLU A 1 133 ? -133.254 71.089 112.897 1.00 67.36  ? 133 GLU A CB  1 
ATOM   1036 C CG  . GLU A 1 133 ? -132.129 70.079 112.740 1.00 77.56  ? 133 GLU A CG  1 
ATOM   1037 C CD  . GLU A 1 133 ? -130.759 70.707 112.869 1.00 87.56  ? 133 GLU A CD  1 
ATOM   1038 O OE1 . GLU A 1 133 ? -130.683 71.949 112.966 1.00 91.03  ? 133 GLU A OE1 1 
ATOM   1039 O OE2 . GLU A 1 133 ? -129.759 69.957 112.877 1.00 91.14  ? 133 GLU A OE2 1 
ATOM   1040 N N   . ASN A 1 134 ? -135.254 69.641 111.233 1.00 57.45  ? 134 ASN A N   1 
ATOM   1041 C CA  . ASN A 1 134 ? -135.647 68.637 110.248 1.00 54.23  ? 134 ASN A CA  1 
ATOM   1042 C C   . ASN A 1 134 ? -136.838 67.810 110.725 1.00 54.13  ? 134 ASN A C   1 
ATOM   1043 O O   . ASN A 1 134 ? -136.691 66.640 111.079 1.00 53.12  ? 134 ASN A O   1 
ATOM   1044 C CB  . ASN A 1 134 ? -134.457 67.727 109.925 1.00 55.68  ? 134 ASN A CB  1 
ATOM   1045 C CG  . ASN A 1 134 ? -134.689 66.873 108.698 1.00 56.93  ? 134 ASN A CG  1 
ATOM   1046 O OD1 . ASN A 1 134 ? -135.651 67.072 107.956 1.00 57.33  ? 134 ASN A OD1 1 
ATOM   1047 N ND2 . ASN A 1 134 ? -133.798 65.917 108.471 1.00 59.47  ? 134 ASN A ND2 1 
ATOM   1048 N N   . GLY A 1 135 ? -138.011 68.436 110.756 1.00 53.96  ? 135 GLY A N   1 
ATOM   1049 C CA  . GLY A 1 135 ? -139.225 67.772 111.196 1.00 52.67  ? 135 GLY A CA  1 
ATOM   1050 C C   . GLY A 1 135 ? -139.241 67.459 112.682 1.00 50.84  ? 135 GLY A C   1 
ATOM   1051 O O   . GLY A 1 135 ? -140.025 66.628 113.134 1.00 46.99  ? 135 GLY A O   1 
ATOM   1052 N N   . GLY A 1 136 ? -138.375 68.124 113.442 1.00 49.96  ? 136 GLY A N   1 
ATOM   1053 C CA  . GLY A 1 136 ? -138.282 67.905 114.875 1.00 45.48  ? 136 GLY A CA  1 
ATOM   1054 C C   . GLY A 1 136 ? -137.651 66.573 115.245 1.00 46.54  ? 136 GLY A C   1 
ATOM   1055 O O   . GLY A 1 136 ? -137.920 66.028 116.317 1.00 43.50  ? 136 GLY A O   1 
ATOM   1056 N N   . VAL A 1 137 ? -136.796 66.056 114.364 1.00 47.56  ? 137 VAL A N   1 
ATOM   1057 C CA  . VAL A 1 137 ? -136.187 64.737 114.547 1.00 44.79  ? 137 VAL A CA  1 
ATOM   1058 C C   . VAL A 1 137 ? -134.715 64.803 114.974 1.00 46.45  ? 137 VAL A C   1 
ATOM   1059 O O   . VAL A 1 137 ? -134.282 64.062 115.863 1.00 47.15  ? 137 VAL A O   1 
ATOM   1060 C CB  . VAL A 1 137 ? -136.288 63.900 113.250 1.00 47.77  ? 137 VAL A CB  1 
ATOM   1061 C CG1 . VAL A 1 137 ? -135.495 62.601 113.374 1.00 45.64  ? 137 VAL A CG1 1 
ATOM   1062 C CG2 . VAL A 1 137 ? -137.745 63.617 112.913 1.00 47.79  ? 137 VAL A CG2 1 
ATOM   1063 N N   . VAL A 1 138 ? -133.955 65.691 114.340 1.00 49.63  ? 138 VAL A N   1 
ATOM   1064 C CA  . VAL A 1 138 ? -132.512 65.774 114.556 1.00 51.80  ? 138 VAL A CA  1 
ATOM   1065 C C   . VAL A 1 138 ? -132.133 66.879 115.545 1.00 54.65  ? 138 VAL A C   1 
ATOM   1066 O O   . VAL A 1 138 ? -132.462 68.047 115.341 1.00 55.87  ? 138 VAL A O   1 
ATOM   1067 C CB  . VAL A 1 138 ? -131.768 66.017 113.225 1.00 51.89  ? 138 VAL A CB  1 
ATOM   1068 C CG1 . VAL A 1 138 ? -130.265 66.028 113.450 1.00 52.33  ? 138 VAL A CG1 1 
ATOM   1069 C CG2 . VAL A 1 138 ? -132.148 64.958 112.193 1.00 55.84  ? 138 VAL A CG2 1 
ATOM   1070 N N   . ALA A 1 139 ? -131.427 66.504 116.607 1.00 54.87  ? 139 ALA A N   1 
ATOM   1071 C CA  . ALA A 1 139 ? -131.006 67.452 117.635 1.00 55.47  ? 139 ALA A CA  1 
ATOM   1072 C C   . ALA A 1 139 ? -129.883 68.373 117.153 1.00 61.82  ? 139 ALA A C   1 
ATOM   1073 O O   . ALA A 1 139 ? -128.946 67.931 116.491 1.00 63.52  ? 139 ALA A O   1 
ATOM   1074 C CB  . ALA A 1 139 ? -130.567 66.703 118.884 1.00 53.39  ? 139 ALA A CB  1 
ATOM   1075 N N   . ARG A 1 140 ? -129.980 69.655 117.495 1.00 66.35  ? 140 ARG A N   1 
ATOM   1076 C CA  . ARG A 1 140 ? -128.933 70.614 117.157 1.00 72.59  ? 140 ARG A CA  1 
ATOM   1077 C C   . ARG A 1 140 ? -127.753 70.497 118.116 1.00 79.07  ? 140 ARG A C   1 
ATOM   1078 O O   . ARG A 1 140 ? -127.939 70.246 119.309 1.00 79.98  ? 140 ARG A O   1 
ATOM   1079 C CB  . ARG A 1 140 ? -129.471 72.047 117.186 1.00 70.86  ? 140 ARG A CB  1 
ATOM   1080 C CG  . ARG A 1 140 ? -130.589 72.329 116.197 1.00 72.99  ? 140 ARG A CG  1 
ATOM   1081 C CD  . ARG A 1 140 ? -130.513 73.763 115.679 1.00 75.13  ? 140 ARG A CD  1 
ATOM   1082 N NE  . ARG A 1 140 ? -130.745 74.756 116.725 1.00 73.46  ? 140 ARG A NE  1 
ATOM   1083 C CZ  . ARG A 1 140 ? -131.897 75.393 116.906 1.00 73.13  ? 140 ARG A CZ  1 
ATOM   1084 N NH1 . ARG A 1 140 ? -132.926 75.143 116.107 1.00 74.79  ? 140 ARG A NH1 1 
ATOM   1085 N NH2 . ARG A 1 140 ? -132.024 76.282 117.883 1.00 70.22  ? 140 ARG A NH2 1 
ATOM   1086 N N   . LEU A 1 141 ? -126.541 70.677 117.595 1.00 83.27  ? 141 LEU A N   1 
ATOM   1087 C CA  . LEU A 1 141 ? -125.352 70.770 118.441 1.00 84.68  ? 141 LEU A CA  1 
ATOM   1088 C C   . LEU A 1 141 ? -124.212 71.487 117.722 1.00 84.40  ? 141 LEU A C   1 
ATOM   1089 O O   . LEU A 1 141 ? -123.266 71.956 118.355 1.00 83.98  ? 141 LEU A O   1 
ATOM   1090 C CB  . LEU A 1 141 ? -124.903 69.380 118.909 1.00 86.25  ? 141 LEU A CB  1 
ATOM   1091 C CG  . LEU A 1 141 ? -124.554 68.295 117.892 1.00 90.65  ? 141 LEU A CG  1 
ATOM   1092 C CD1 . LEU A 1 141 ? -123.104 68.401 117.427 1.00 96.08  ? 141 LEU A CD1 1 
ATOM   1093 C CD2 . LEU A 1 141 ? -124.828 66.918 118.470 1.00 90.49  ? 141 LEU A CD2 1 
ATOM   1094 N N   . GLU A 1 149 ? -121.164 65.867 126.982 1.00 111.93 ? 149 GLU A N   1 
ATOM   1095 C CA  . GLU A 1 149 ? -121.054 66.859 128.045 1.00 112.65 ? 149 GLU A CA  1 
ATOM   1096 C C   . GLU A 1 149 ? -121.962 66.503 129.221 1.00 112.88 ? 149 GLU A C   1 
ATOM   1097 O O   . GLU A 1 149 ? -121.495 66.053 130.270 1.00 115.65 ? 149 GLU A O   1 
ATOM   1098 C CB  . GLU A 1 149 ? -121.404 68.253 127.517 1.00 109.21 ? 149 GLU A CB  1 
ATOM   1099 C CG  . GLU A 1 149 ? -121.475 68.355 126.000 1.00 107.45 ? 149 GLU A CG  1 
ATOM   1100 C CD  . GLU A 1 149 ? -122.721 69.081 125.526 1.00 102.71 ? 149 GLU A CD  1 
ATOM   1101 O OE1 . GLU A 1 149 ? -122.588 70.093 124.806 1.00 100.75 ? 149 GLU A OE1 1 
ATOM   1102 O OE2 . GLU A 1 149 ? -123.836 68.636 125.872 1.00 100.75 ? 149 GLU A OE2 1 
ATOM   1103 N N   . ASP A 1 150 ? -123.264 66.706 129.027 1.00 108.62 ? 150 ASP A N   1 
ATOM   1104 C CA  . ASP A 1 150 ? -124.272 66.431 130.049 1.00 104.08 ? 150 ASP A CA  1 
ATOM   1105 C C   . ASP A 1 150 ? -124.851 65.022 129.896 1.00 100.93 ? 150 ASP A C   1 
ATOM   1106 O O   . ASP A 1 150 ? -125.125 64.580 128.780 1.00 100.47 ? 150 ASP A O   1 
ATOM   1107 C CB  . ASP A 1 150 ? -125.393 67.470 129.976 1.00 103.30 ? 150 ASP A CB  1 
ATOM   1108 C CG  . ASP A 1 150 ? -124.884 68.888 130.134 1.00 107.14 ? 150 ASP A CG  1 
ATOM   1109 O OD1 . ASP A 1 150 ? -123.957 69.100 130.944 1.00 112.79 ? 150 ASP A OD1 1 
ATOM   1110 O OD2 . ASP A 1 150 ? -125.412 69.788 129.446 1.00 104.60 ? 150 ASP A OD2 1 
ATOM   1111 N N   . PRO A 1 151 ? -125.055 64.320 131.023 1.00 97.89  ? 151 PRO A N   1 
ATOM   1112 C CA  . PRO A 1 151 ? -125.452 62.904 131.036 1.00 95.50  ? 151 PRO A CA  1 
ATOM   1113 C C   . PRO A 1 151 ? -126.801 62.625 130.370 1.00 88.72  ? 151 PRO A C   1 
ATOM   1114 O O   . PRO A 1 151 ? -127.003 61.538 129.823 1.00 88.11  ? 151 PRO A O   1 
ATOM   1115 C CB  . PRO A 1 151 ? -125.519 62.575 132.532 1.00 97.64  ? 151 PRO A CB  1 
ATOM   1116 C CG  . PRO A 1 151 ? -125.757 63.883 133.198 1.00 97.05  ? 151 PRO A CG  1 
ATOM   1117 C CD  . PRO A 1 151 ? -124.994 64.882 132.384 1.00 97.88  ? 151 PRO A CD  1 
ATOM   1118 N N   . HIS A 1 152 ? -127.707 63.596 130.415 1.00 82.99  ? 152 HIS A N   1 
ATOM   1119 C CA  . HIS A 1 152 ? -129.062 63.414 129.905 1.00 76.91  ? 152 HIS A CA  1 
ATOM   1120 C C   . HIS A 1 152 ? -129.138 63.489 128.384 1.00 73.43  ? 152 HIS A C   1 
ATOM   1121 O O   . HIS A 1 152 ? -130.004 62.865 127.772 1.00 71.18  ? 152 HIS A O   1 
ATOM   1122 C CB  . HIS A 1 152 ? -129.994 64.469 130.506 1.00 74.21  ? 152 HIS A CB  1 
ATOM   1123 C CG  . HIS A 1 152 ? -129.746 65.853 129.988 1.00 71.82  ? 152 HIS A CG  1 
ATOM   1124 N ND1 . HIS A 1 152 ? -128.741 66.659 130.468 1.00 73.79  ? 152 HIS A ND1 1 
ATOM   1125 C CD2 . HIS A 1 152 ? -130.374 66.567 129.020 1.00 68.78  ? 152 HIS A CD2 1 
ATOM   1126 C CE1 . HIS A 1 152 ? -128.758 67.816 129.824 1.00 72.03  ? 152 HIS A CE1 1 
ATOM   1127 N NE2 . HIS A 1 152 ? -129.739 67.783 128.941 1.00 68.83  ? 152 HIS A NE2 1 
ATOM   1128 N N   . PHE A 1 153 ? -128.230 64.257 127.786 1.00 73.53  ? 153 PHE A N   1 
ATOM   1129 C CA  . PHE A 1 153 ? -128.329 64.634 126.377 1.00 73.43  ? 153 PHE A CA  1 
ATOM   1130 C C   . PHE A 1 153 ? -128.422 63.433 125.438 1.00 72.94  ? 153 PHE A C   1 
ATOM   1131 O O   . PHE A 1 153 ? -129.355 63.345 124.643 1.00 71.81  ? 153 PHE A O   1 
ATOM   1132 C CB  . PHE A 1 153 ? -127.140 65.517 125.977 1.00 75.24  ? 153 PHE A CB  1 
ATOM   1133 C CG  . PHE A 1 153 ? -127.241 66.081 124.582 1.00 78.21  ? 153 PHE A CG  1 
ATOM   1134 C CD1 . PHE A 1 153 ? -126.703 65.398 123.498 1.00 82.42  ? 153 PHE A CD1 1 
ATOM   1135 C CD2 . PHE A 1 153 ? -127.868 67.298 124.355 1.00 77.88  ? 153 PHE A CD2 1 
ATOM   1136 C CE1 . PHE A 1 153 ? -126.794 65.916 122.213 1.00 83.14  ? 153 PHE A CE1 1 
ATOM   1137 C CE2 . PHE A 1 153 ? -127.962 67.823 123.074 1.00 78.78  ? 153 PHE A CE2 1 
ATOM   1138 C CZ  . PHE A 1 153 ? -127.425 67.131 122.002 1.00 81.03  ? 153 PHE A CZ  1 
ATOM   1139 N N   . ALA A 1 154 ? -127.462 62.517 125.539 1.00 74.52  ? 154 ALA A N   1 
ATOM   1140 C CA  . ALA A 1 154 ? -127.390 61.362 124.645 1.00 77.29  ? 154 ALA A CA  1 
ATOM   1141 C C   . ALA A 1 154 ? -128.719 60.614 124.548 1.00 76.55  ? 154 ALA A C   1 
ATOM   1142 O O   . ALA A 1 154 ? -129.166 60.270 123.456 1.00 77.04  ? 154 ALA A O   1 
ATOM   1143 C CB  . ALA A 1 154 ? -126.286 60.414 125.096 1.00 81.22  ? 154 ALA A CB  1 
ATOM   1144 N N   . GLU A 1 155 ? -129.358 60.379 125.688 1.00 77.20  ? 155 GLU A N   1 
ATOM   1145 C CA  . GLU A 1 155 ? -130.636 59.679 125.697 1.00 77.78  ? 155 GLU A CA  1 
ATOM   1146 C C   . GLU A 1 155 ? -131.768 60.563 125.170 1.00 67.88  ? 155 GLU A C   1 
ATOM   1147 O O   . GLU A 1 155 ? -132.471 60.186 124.232 1.00 63.84  ? 155 GLU A O   1 
ATOM   1148 C CB  . GLU A 1 155 ? -130.968 59.189 127.106 1.00 88.23  ? 155 GLU A CB  1 
ATOM   1149 C CG  . GLU A 1 155 ? -132.273 58.417 127.198 1.00 100.09 ? 155 GLU A CG  1 
ATOM   1150 C CD  . GLU A 1 155 ? -132.553 57.910 128.598 1.00 109.77 ? 155 GLU A CD  1 
ATOM   1151 O OE1 . GLU A 1 155 ? -131.786 58.260 129.522 1.00 115.17 ? 155 GLU A OE1 1 
ATOM   1152 O OE2 . GLU A 1 155 ? -133.537 57.160 128.776 1.00 110.85 ? 155 GLU A OE2 1 
ATOM   1153 N N   . LEU A 1 156 ? -131.931 61.739 125.772 1.00 62.24  ? 156 LEU A N   1 
ATOM   1154 C CA  . LEU A 1 156 ? -133.031 62.641 125.432 1.00 59.87  ? 156 LEU A CA  1 
ATOM   1155 C C   . LEU A 1 156 ? -133.002 63.105 123.974 1.00 57.96  ? 156 LEU A C   1 
ATOM   1156 O O   . LEU A 1 156 ? -134.050 63.367 123.381 1.00 56.57  ? 156 LEU A O   1 
ATOM   1157 C CB  . LEU A 1 156 ? -133.019 63.861 126.359 1.00 57.89  ? 156 LEU A CB  1 
ATOM   1158 C CG  . LEU A 1 156 ? -134.320 64.666 126.386 1.00 58.43  ? 156 LEU A CG  1 
ATOM   1159 C CD1 . LEU A 1 156 ? -135.481 63.766 126.788 1.00 58.75  ? 156 LEU A CD1 1 
ATOM   1160 C CD2 . LEU A 1 156 ? -134.216 65.870 127.318 1.00 55.78  ? 156 LEU A CD2 1 
ATOM   1161 N N   . ALA A 1 157 ? -131.806 63.209 123.402 1.00 56.91  ? 157 ALA A N   1 
ATOM   1162 C CA  . ALA A 1 157 ? -131.661 63.615 122.007 1.00 57.48  ? 157 ALA A CA  1 
ATOM   1163 C C   . ALA A 1 157 ? -132.236 62.558 121.073 1.00 61.66  ? 157 ALA A C   1 
ATOM   1164 O O   . ALA A 1 157 ? -132.818 62.881 120.037 1.00 63.39  ? 157 ALA A O   1 
ATOM   1165 C CB  . ALA A 1 157 ? -130.200 63.876 121.676 1.00 57.79  ? 157 ALA A CB  1 
ATOM   1166 N N   . GLN A 1 158 ? -132.069 61.295 121.451 1.00 65.84  ? 158 GLN A N   1 
ATOM   1167 C CA  . GLN A 1 158 ? -132.577 60.174 120.668 1.00 68.46  ? 158 GLN A CA  1 
ATOM   1168 C C   . GLN A 1 158 ? -134.084 59.988 120.850 1.00 66.18  ? 158 GLN A C   1 
ATOM   1169 O O   . GLN A 1 158 ? -134.734 59.315 120.050 1.00 69.95  ? 158 GLN A O   1 
ATOM   1170 C CB  . GLN A 1 158 ? -131.853 58.878 121.052 1.00 72.69  ? 158 GLN A CB  1 
ATOM   1171 C CG  . GLN A 1 158 ? -130.380 58.810 120.660 1.00 78.13  ? 158 GLN A CG  1 
ATOM   1172 C CD  . GLN A 1 158 ? -129.761 57.449 120.951 1.00 86.74  ? 158 GLN A CD  1 
ATOM   1173 O OE1 . GLN A 1 158 ? -130.018 56.842 121.993 1.00 89.59  ? 158 GLN A OE1 1 
ATOM   1174 N NE2 . GLN A 1 158 ? -128.947 56.959 120.021 1.00 90.14  ? 158 GLN A NE2 1 
ATOM   1175 N N   . LEU A 1 159 ? -134.634 60.582 121.906 1.00 59.33  ? 159 LEU A N   1 
ATOM   1176 C CA  . LEU A 1 159 ? -136.045 60.396 122.238 1.00 56.19  ? 159 LEU A CA  1 
ATOM   1177 C C   . LEU A 1 159 ? -136.985 60.987 121.186 1.00 56.23  ? 159 LEU A C   1 
ATOM   1178 O O   . LEU A 1 159 ? -136.881 62.160 120.830 1.00 53.27  ? 159 LEU A O   1 
ATOM   1179 C CB  . LEU A 1 159 ? -136.357 61.008 123.603 1.00 55.35  ? 159 LEU A CB  1 
ATOM   1180 C CG  . LEU A 1 159 ? -137.805 60.781 124.035 1.00 53.46  ? 159 LEU A CG  1 
ATOM   1181 C CD1 . LEU A 1 159 ? -138.124 59.293 124.025 1.00 53.16  ? 159 LEU A CD1 1 
ATOM   1182 C CD2 . LEU A 1 159 ? -138.062 61.380 125.401 1.00 50.15  ? 159 LEU A CD2 1 
ATOM   1183 N N   . ARG A 1 160 ? -137.910 60.159 120.708 1.00 56.84  ? 160 ARG A N   1 
ATOM   1184 C CA  . ARG A 1 160 ? -138.840 60.529 119.645 1.00 57.06  ? 160 ARG A CA  1 
ATOM   1185 C C   . ARG A 1 160 ? -140.037 61.313 120.166 1.00 54.70  ? 160 ARG A C   1 
ATOM   1186 O O   . ARG A 1 160 ? -140.417 61.186 121.329 1.00 52.16  ? 160 ARG A O   1 
ATOM   1187 C CB  . ARG A 1 160 ? -139.352 59.277 118.935 1.00 61.57  ? 160 ARG A CB  1 
ATOM   1188 C CG  . ARG A 1 160 ? -138.966 59.130 117.472 1.00 68.49  ? 160 ARG A CG  1 
ATOM   1189 C CD  . ARG A 1 160 ? -139.698 57.933 116.869 1.00 73.16  ? 160 ARG A CD  1 
ATOM   1190 N NE  . ARG A 1 160 ? -138.963 57.297 115.778 1.00 77.27  ? 160 ARG A NE  1 
ATOM   1191 C CZ  . ARG A 1 160 ? -139.313 56.138 115.226 1.00 82.23  ? 160 ARG A CZ  1 
ATOM   1192 N NH1 . ARG A 1 160 ? -140.386 55.494 115.666 1.00 83.77  ? 160 ARG A NH1 1 
ATOM   1193 N NH2 . ARG A 1 160 ? -138.594 55.618 114.239 1.00 83.33  ? 160 ARG A NH2 1 
ATOM   1194 N N   . TYR A 1 161 ? -140.641 62.113 119.294 1.00 53.14  ? 161 TYR A N   1 
ATOM   1195 C CA  . TYR A 1 161 ? -141.934 62.707 119.601 1.00 47.40  ? 161 TYR A CA  1 
ATOM   1196 C C   . TYR A 1 161 ? -143.012 61.651 119.369 1.00 46.51  ? 161 TYR A C   1 
ATOM   1197 O O   . TYR A 1 161 ? -143.143 61.122 118.267 1.00 49.51  ? 161 TYR A O   1 
ATOM   1198 C CB  . TYR A 1 161 ? -142.193 63.959 118.756 1.00 43.94  ? 161 TYR A CB  1 
ATOM   1199 C CG  . TYR A 1 161 ? -143.649 64.353 118.737 1.00 40.04  ? 161 TYR A CG  1 
ATOM   1200 C CD1 . TYR A 1 161 ? -144.241 64.938 119.847 1.00 33.72  ? 161 TYR A CD1 1 
ATOM   1201 C CD2 . TYR A 1 161 ? -144.436 64.128 117.615 1.00 41.01  ? 161 TYR A CD2 1 
ATOM   1202 C CE1 . TYR A 1 161 ? -145.575 65.293 119.839 1.00 35.93  ? 161 TYR A CE1 1 
ATOM   1203 C CE2 . TYR A 1 161 ? -145.773 64.480 117.597 1.00 40.31  ? 161 TYR A CE2 1 
ATOM   1204 C CZ  . TYR A 1 161 ? -146.335 65.061 118.711 1.00 41.63  ? 161 TYR A CZ  1 
ATOM   1205 O OH  . TYR A 1 161 ? -147.666 65.413 118.696 1.00 48.82  ? 161 TYR A OH  1 
ATOM   1206 N N   . GLU A 1 162 ? -143.776 61.344 120.413 1.00 46.26  ? 162 GLU A N   1 
ATOM   1207 C CA  . GLU A 1 162 ? -144.704 60.219 120.365 1.00 48.46  ? 162 GLU A CA  1 
ATOM   1208 C C   . GLU A 1 162 ? -146.175 60.617 120.475 1.00 50.67  ? 162 GLU A C   1 
ATOM   1209 O O   . GLU A 1 162 ? -147.031 59.772 120.745 1.00 53.24  ? 162 GLU A O   1 
ATOM   1210 C CB  . GLU A 1 162 ? -144.355 59.211 121.471 1.00 47.02  ? 162 GLU A CB  1 
ATOM   1211 C CG  . GLU A 1 162 ? -142.955 58.614 121.370 1.00 53.16  ? 162 GLU A CG  1 
ATOM   1212 C CD  . GLU A 1 162 ? -142.815 57.581 120.259 1.00 64.02  ? 162 GLU A CD  1 
ATOM   1213 O OE1 . GLU A 1 162 ? -143.763 57.414 119.463 1.00 66.73  ? 162 GLU A OE1 1 
ATOM   1214 O OE2 . GLU A 1 162 ? -141.751 56.927 120.189 1.00 69.56  ? 162 GLU A OE2 1 
ATOM   1215 N N   . GLY A 1 163 ? -146.467 61.896 120.266 1.00 47.61  ? 163 GLY A N   1 
ATOM   1216 C CA  . GLY A 1 163 ? -147.845 62.345 120.235 1.00 47.61  ? 163 GLY A CA  1 
ATOM   1217 C C   . GLY A 1 163 ? -148.220 63.246 121.394 1.00 47.45  ? 163 GLY A C   1 
ATOM   1218 O O   . GLY A 1 163 ? -147.492 63.339 122.383 1.00 46.03  ? 163 GLY A O   1 
ATOM   1219 N N   . ALA A 1 164 ? -149.368 63.906 121.272 1.00 49.44  ? 164 ALA A N   1 
ATOM   1220 C CA  . ALA A 1 164 ? -149.837 64.828 122.298 1.00 49.04  ? 164 ALA A CA  1 
ATOM   1221 C C   . ALA A 1 164 ? -150.149 64.111 123.609 1.00 49.70  ? 164 ALA A C   1 
ATOM   1222 O O   . ALA A 1 164 ? -149.836 64.617 124.687 1.00 49.56  ? 164 ALA A O   1 
ATOM   1223 C CB  . ALA A 1 164 ? -151.060 65.586 121.802 1.00 50.01  ? 164 ALA A CB  1 
ATOM   1224 N N   . GLU A 1 165 ? -150.766 62.938 123.521 1.00 51.98  ? 165 GLU A N   1 
ATOM   1225 C CA  . GLU A 1 165 ? -151.145 62.212 124.726 1.00 53.34  ? 165 GLU A CA  1 
ATOM   1226 C C   . GLU A 1 165 ? -149.912 61.814 125.534 1.00 50.58  ? 165 GLU A C   1 
ATOM   1227 O O   . GLU A 1 165 ? -149.941 61.853 126.762 1.00 51.84  ? 165 GLU A O   1 
ATOM   1228 C CB  . GLU A 1 165 ? -151.992 60.982 124.379 1.00 60.70  ? 165 GLU A CB  1 
ATOM   1229 C CG  . GLU A 1 165 ? -153.420 61.309 123.941 1.00 66.65  ? 165 GLU A CG  1 
ATOM   1230 C CD  . GLU A 1 165 ? -154.317 61.747 125.092 1.00 71.71  ? 165 GLU A CD  1 
ATOM   1231 O OE1 . GLU A 1 165 ? -153.911 61.589 126.263 1.00 74.16  ? 165 GLU A OE1 1 
ATOM   1232 O OE2 . GLU A 1 165 ? -155.432 62.246 124.825 1.00 73.49  ? 165 GLU A OE2 1 
ATOM   1233 N N   . SER A 1 166 ? -148.827 61.456 124.853 1.00 49.06  ? 166 SER A N   1 
ATOM   1234 C CA  . SER A 1 166 ? -147.584 61.122 125.546 1.00 46.87  ? 166 SER A CA  1 
ATOM   1235 C C   . SER A 1 166 ? -147.012 62.345 126.262 1.00 44.61  ? 166 SER A C   1 
ATOM   1236 O O   . SER A 1 166 ? -146.473 62.225 127.361 1.00 44.53  ? 166 SER A O   1 
ATOM   1237 C CB  . SER A 1 166 ? -146.550 60.542 124.574 1.00 47.11  ? 166 SER A CB  1 
ATOM   1238 O OG  . SER A 1 166 ? -146.067 61.539 123.688 1.00 53.37  ? 166 SER A OG  1 
ATOM   1239 N N   . VAL A 1 167 ? -147.141 63.519 125.649 1.00 42.86  ? 167 VAL A N   1 
ATOM   1240 C CA  . VAL A 1 167 ? -146.682 64.755 126.280 1.00 41.18  ? 167 VAL A CA  1 
ATOM   1241 C C   . VAL A 1 167 ? -147.484 65.038 127.551 1.00 42.75  ? 167 VAL A C   1 
ATOM   1242 O O   . VAL A 1 167 ? -146.915 65.386 128.591 1.00 45.66  ? 167 VAL A O   1 
ATOM   1243 C CB  . VAL A 1 167 ? -146.784 65.966 125.321 1.00 42.11  ? 167 VAL A CB  1 
ATOM   1244 C CG1 . VAL A 1 167 ? -146.329 67.228 126.016 1.00 39.20  ? 167 VAL A CG1 1 
ATOM   1245 C CG2 . VAL A 1 167 ? -145.953 65.730 124.069 1.00 42.16  ? 167 VAL A CG2 1 
ATOM   1246 N N   . ARG A 1 168 ? -148.804 64.878 127.471 1.00 43.56  ? 168 ARG A N   1 
ATOM   1247 C CA  . ARG A 1 168 ? -149.672 65.034 128.642 1.00 49.14  ? 168 ARG A CA  1 
ATOM   1248 C C   . ARG A 1 168 ? -149.285 64.063 129.761 1.00 52.63  ? 168 ARG A C   1 
ATOM   1249 O O   . ARG A 1 168 ? -149.290 64.430 130.935 1.00 52.49  ? 168 ARG A O   1 
ATOM   1250 C CB  . ARG A 1 168 ? -151.144 64.834 128.253 1.00 53.52  ? 168 ARG A CB  1 
ATOM   1251 C CG  . ARG A 1 168 ? -152.144 64.881 129.419 1.00 53.79  ? 168 ARG A CG  1 
ATOM   1252 C CD  . ARG A 1 168 ? -153.561 64.568 128.932 1.00 59.90  ? 168 ARG A CD  1 
ATOM   1253 N NE  . ARG A 1 168 ? -154.543 64.484 130.012 1.00 68.39  ? 168 ARG A NE  1 
ATOM   1254 C CZ  . ARG A 1 168 ? -154.844 63.365 130.666 1.00 74.97  ? 168 ARG A CZ  1 
ATOM   1255 N NH1 . ARG A 1 168 ? -154.232 62.229 130.359 1.00 76.61  ? 168 ARG A NH1 1 
ATOM   1256 N NH2 . ARG A 1 168 ? -155.754 63.379 131.630 1.00 76.10  ? 168 ARG A NH2 1 
ATOM   1257 N N   . ASP A 1 169 ? -148.946 62.829 129.391 1.00 51.07  ? 169 ASP A N   1 
ATOM   1258 C CA  . ASP A 1 169 ? -148.479 61.840 130.362 1.00 52.24  ? 169 ASP A CA  1 
ATOM   1259 C C   . ASP A 1 169 ? -147.169 62.279 131.006 1.00 48.53  ? 169 ASP A C   1 
ATOM   1260 O O   . ASP A 1 169 ? -146.961 62.089 132.205 1.00 46.05  ? 169 ASP A O   1 
ATOM   1261 C CB  . ASP A 1 169 ? -148.279 60.468 129.709 1.00 54.20  ? 169 ASP A CB  1 
ATOM   1262 C CG  . ASP A 1 169 ? -149.584 59.803 129.314 1.00 62.14  ? 169 ASP A CG  1 
ATOM   1263 O OD1 . ASP A 1 169 ? -150.657 60.246 129.776 1.00 66.51  ? 169 ASP A OD1 1 
ATOM   1264 O OD2 . ASP A 1 169 ? -149.533 58.819 128.543 1.00 65.94  ? 169 ASP A OD2 1 
ATOM   1265 N N   . GLN A 1 170 ? -146.278 62.846 130.198 1.00 46.09  ? 170 GLN A N   1 
ATOM   1266 C CA  . GLN A 1 170 ? -144.984 63.302 130.690 1.00 46.78  ? 170 GLN A CA  1 
ATOM   1267 C C   . GLN A 1 170 ? -145.151 64.497 131.621 1.00 45.22  ? 170 GLN A C   1 
ATOM   1268 O O   . GLN A 1 170 ? -144.400 64.652 132.583 1.00 44.87  ? 170 GLN A O   1 
ATOM   1269 C CB  . GLN A 1 170 ? -144.060 63.665 129.523 1.00 48.04  ? 170 GLN A CB  1 
ATOM   1270 C CG  . GLN A 1 170 ? -143.541 62.472 128.724 1.00 43.91  ? 170 GLN A CG  1 
ATOM   1271 C CD  . GLN A 1 170 ? -142.972 62.875 127.372 1.00 46.72  ? 170 GLN A CD  1 
ATOM   1272 O OE1 . GLN A 1 170 ? -143.101 64.024 126.949 1.00 44.03  ? 170 GLN A OE1 1 
ATOM   1273 N NE2 . GLN A 1 170 ? -142.341 61.928 126.688 1.00 50.75  ? 170 GLN A NE2 1 
ATOM   1274 N N   . MET A 1 171 ? -146.142 65.337 131.334 1.00 43.85  ? 171 MET A N   1 
ATOM   1275 C CA  . MET A 1 171 ? -146.399 66.527 132.146 1.00 45.85  ? 171 MET A CA  1 
ATOM   1276 C C   . MET A 1 171 ? -147.034 66.153 133.482 1.00 49.00  ? 171 MET A C   1 
ATOM   1277 O O   . MET A 1 171 ? -146.679 66.703 134.525 1.00 50.20  ? 171 MET A O   1 
ATOM   1278 C CB  . MET A 1 171 ? -147.297 67.507 131.391 1.00 42.05  ? 171 MET A CB  1 
ATOM   1279 C CG  . MET A 1 171 ? -147.781 68.683 132.225 1.00 46.72  ? 171 MET A CG  1 
ATOM   1280 S SD  . MET A 1 171 ? -146.424 69.661 132.898 1.00 61.24  ? 171 MET A SD  1 
ATOM   1281 C CE  . MET A 1 171 ? -145.583 70.137 131.404 1.00 30.05  ? 171 MET A CE  1 
ATOM   1282 N N   . VAL A 1 172 ? -147.975 65.216 133.439 1.00 47.77  ? 172 VAL A N   1 
ATOM   1283 C CA  . VAL A 1 172 ? -148.605 64.691 134.643 1.00 46.37  ? 172 VAL A CA  1 
ATOM   1284 C C   . VAL A 1 172 ? -147.569 64.033 135.556 1.00 43.52  ? 172 VAL A C   1 
ATOM   1285 O O   . VAL A 1 172 ? -147.592 64.220 136.773 1.00 39.80  ? 172 VAL A O   1 
ATOM   1286 C CB  . VAL A 1 172 ? -149.718 63.688 134.282 1.00 48.79  ? 172 VAL A CB  1 
ATOM   1287 C CG1 . VAL A 1 172 ? -150.062 62.800 135.472 1.00 51.19  ? 172 VAL A CG1 1 
ATOM   1288 C CG2 . VAL A 1 172 ? -150.948 64.429 133.772 1.00 47.07  ? 172 VAL A CG2 1 
ATOM   1289 N N   . THR A 1 173 ? -146.650 63.283 134.957 1.00 47.37  ? 173 THR A N   1 
ATOM   1290 C CA  . THR A 1 173 ? -145.571 62.631 135.700 1.00 48.63  ? 173 THR A CA  1 
ATOM   1291 C C   . THR A 1 173 ? -144.656 63.635 136.405 1.00 47.01  ? 173 THR A C   1 
ATOM   1292 O O   . THR A 1 173 ? -144.284 63.443 137.563 1.00 49.56  ? 173 THR A O   1 
ATOM   1293 C CB  . THR A 1 173 ? -144.717 61.744 134.768 1.00 46.29  ? 173 THR A CB  1 
ATOM   1294 O OG1 . THR A 1 173 ? -145.469 60.581 134.401 1.00 52.08  ? 173 THR A OG1 1 
ATOM   1295 C CG2 . THR A 1 173 ? -143.426 61.315 135.455 1.00 42.72  ? 173 THR A CG2 1 
ATOM   1296 N N   . ILE A 1 174 ? -144.298 64.707 135.705 1.00 42.38  ? 174 ILE A N   1 
ATOM   1297 C CA  . ILE A 1 174 ? -143.387 65.708 136.252 1.00 42.27  ? 174 ILE A CA  1 
ATOM   1298 C C   . ILE A 1 174 ? -143.991 66.387 137.481 1.00 41.71  ? 174 ILE A C   1 
ATOM   1299 O O   . ILE A 1 174 ? -143.341 66.484 138.525 1.00 44.51  ? 174 ILE A O   1 
ATOM   1300 C CB  . ILE A 1 174 ? -143.012 66.773 135.194 1.00 42.49  ? 174 ILE A CB  1 
ATOM   1301 C CG1 . ILE A 1 174 ? -141.915 66.234 134.274 1.00 46.90  ? 174 ILE A CG1 1 
ATOM   1302 C CG2 . ILE A 1 174 ? -142.542 68.062 135.861 1.00 41.08  ? 174 ILE A CG2 1 
ATOM   1303 C CD1 . ILE A 1 174 ? -141.510 67.194 133.176 1.00 49.46  ? 174 ILE A CD1 1 
ATOM   1304 N N   . VAL A 1 175 ? -145.242 66.823 137.356 1.00 37.70  ? 175 VAL A N   1 
ATOM   1305 C CA  . VAL A 1 175 ? -145.933 67.530 138.430 1.00 43.22  ? 175 VAL A CA  1 
ATOM   1306 C C   . VAL A 1 175 ? -146.200 66.629 139.635 1.00 48.01  ? 175 VAL A C   1 
ATOM   1307 O O   . VAL A 1 175 ? -146.073 67.062 140.783 1.00 46.00  ? 175 VAL A O   1 
ATOM   1308 C CB  . VAL A 1 175 ? -147.250 68.131 137.924 1.00 48.87  ? 175 VAL A CB  1 
ATOM   1309 C CG1 . VAL A 1 175 ? -147.964 68.870 139.046 1.00 51.77  ? 175 VAL A CG1 1 
ATOM   1310 C CG2 . VAL A 1 175 ? -146.963 69.066 136.755 1.00 46.57  ? 175 VAL A CG2 1 
ATOM   1311 N N   . ARG A 1 176 ? -146.546 65.372 139.377 1.00 54.87  ? 176 ARG A N   1 
ATOM   1312 C CA  . ARG A 1 176 ? -146.702 64.401 140.454 1.00 58.12  ? 176 ARG A CA  1 
ATOM   1313 C C   . ARG A 1 176 ? -145.375 64.172 141.167 1.00 57.08  ? 176 ARG A C   1 
ATOM   1314 O O   . ARG A 1 176 ? -145.320 64.157 142.393 1.00 62.44  ? 176 ARG A O   1 
ATOM   1315 C CB  . ARG A 1 176 ? -147.251 63.073 139.923 1.00 64.49  ? 176 ARG A CB  1 
ATOM   1316 C CG  . ARG A 1 176 ? -148.771 63.004 139.883 1.00 70.99  ? 176 ARG A CG  1 
ATOM   1317 C CD  . ARG A 1 176 ? -149.260 61.573 139.693 1.00 80.95  ? 176 ARG A CD  1 
ATOM   1318 N NE  . ARG A 1 176 ? -150.597 61.378 140.251 1.00 91.38  ? 176 ARG A NE  1 
ATOM   1319 C CZ  . ARG A 1 176 ? -151.722 61.434 139.544 1.00 95.42  ? 176 ARG A CZ  1 
ATOM   1320 N NH1 . ARG A 1 176 ? -151.680 61.671 138.240 1.00 92.93  ? 176 ARG A NH1 1 
ATOM   1321 N NH2 . ARG A 1 176 ? -152.891 61.246 140.142 1.00 98.96  ? 176 ARG A NH2 1 
ATOM   1322 N N   . SER A 1 177 ? -144.306 64.005 140.397 1.00 54.53  ? 177 SER A N   1 
ATOM   1323 C CA  . SER A 1 177 ? -142.988 63.774 140.979 1.00 53.96  ? 177 SER A CA  1 
ATOM   1324 C C   . SER A 1 177 ? -142.514 64.981 141.786 1.00 54.03  ? 177 SER A C   1 
ATOM   1325 O O   . SER A 1 177 ? -141.924 64.823 142.850 1.00 56.63  ? 177 SER A O   1 
ATOM   1326 C CB  . SER A 1 177 ? -141.970 63.429 139.889 1.00 57.76  ? 177 SER A CB  1 
ATOM   1327 O OG  . SER A 1 177 ? -142.197 62.125 139.376 1.00 66.21  ? 177 SER A OG  1 
ATOM   1328 N N   . VAL A 1 178 ? -142.780 66.184 141.284 1.00 49.56  ? 178 VAL A N   1 
ATOM   1329 C CA  . VAL A 1 178 ? -142.432 67.399 142.012 1.00 48.15  ? 178 VAL A CA  1 
ATOM   1330 C C   . VAL A 1 178 ? -143.169 67.456 143.347 1.00 49.25  ? 178 VAL A C   1 
ATOM   1331 O O   . VAL A 1 178 ? -142.547 67.616 144.400 1.00 50.42  ? 178 VAL A O   1 
ATOM   1332 C CB  . VAL A 1 178 ? -142.745 68.670 141.190 1.00 44.01  ? 178 VAL A CB  1 
ATOM   1333 C CG1 . VAL A 1 178 ? -142.757 69.899 142.086 1.00 42.90  ? 178 VAL A CG1 1 
ATOM   1334 C CG2 . VAL A 1 178 ? -141.731 68.837 140.076 1.00 42.62  ? 178 VAL A CG2 1 
ATOM   1335 N N   . GLN A 1 179 ? -144.490 67.308 143.303 1.00 48.90  ? 179 GLN A N   1 
ATOM   1336 C CA  . GLN A 1 179 ? -145.291 67.316 144.523 1.00 51.95  ? 179 GLN A CA  1 
ATOM   1337 C C   . GLN A 1 179 ? -144.865 66.216 145.486 1.00 57.03  ? 179 GLN A C   1 
ATOM   1338 O O   . GLN A 1 179 ? -144.862 66.418 146.695 1.00 62.99  ? 179 GLN A O   1 
ATOM   1339 C CB  . GLN A 1 179 ? -146.774 67.170 144.191 1.00 55.06  ? 179 GLN A CB  1 
ATOM   1340 C CG  . GLN A 1 179 ? -147.336 68.353 143.424 1.00 59.95  ? 179 GLN A CG  1 
ATOM   1341 C CD  . GLN A 1 179 ? -148.770 68.143 142.997 1.00 63.53  ? 179 GLN A CD  1 
ATOM   1342 O OE1 . GLN A 1 179 ? -149.299 67.035 143.086 1.00 62.87  ? 179 GLN A OE1 1 
ATOM   1343 N NE2 . GLN A 1 179 ? -149.412 69.210 142.529 1.00 63.34  ? 179 GLN A NE2 1 
ATOM   1344 N N   . PHE A 1 180 ? -144.495 65.056 144.954 1.00 56.44  ? 180 PHE A N   1 
ATOM   1345 C CA  . PHE A 1 180 ? -144.060 63.957 145.808 1.00 57.92  ? 180 PHE A CA  1 
ATOM   1346 C C   . PHE A 1 180 ? -142.668 64.220 146.386 1.00 58.94  ? 180 PHE A C   1 
ATOM   1347 O O   . PHE A 1 180 ? -142.435 64.008 147.577 1.00 62.74  ? 180 PHE A O   1 
ATOM   1348 C CB  . PHE A 1 180 ? -144.074 62.635 145.044 1.00 54.88  ? 180 PHE A CB  1 
ATOM   1349 C CG  . PHE A 1 180 ? -143.410 61.511 145.782 1.00 58.02  ? 180 PHE A CG  1 
ATOM   1350 C CD1 . PHE A 1 180 ? -144.041 60.894 146.849 1.00 57.99  ? 180 PHE A CD1 1 
ATOM   1351 C CD2 . PHE A 1 180 ? -142.148 61.077 145.414 1.00 56.60  ? 180 PHE A CD2 1 
ATOM   1352 C CE1 . PHE A 1 180 ? -143.425 59.864 147.533 1.00 57.41  ? 180 PHE A CE1 1 
ATOM   1353 C CE2 . PHE A 1 180 ? -141.528 60.047 146.094 1.00 56.72  ? 180 PHE A CE2 1 
ATOM   1354 C CZ  . PHE A 1 180 ? -142.166 59.441 147.155 1.00 57.53  ? 180 PHE A CZ  1 
ATOM   1355 N N   . LEU A 1 181 ? -141.751 64.681 145.537 1.00 54.85  ? 181 LEU A N   1 
ATOM   1356 C CA  . LEU A 1 181 ? -140.386 65.011 145.949 1.00 57.48  ? 181 LEU A CA  1 
ATOM   1357 C C   . LEU A 1 181 ? -140.347 66.065 147.056 1.00 62.53  ? 181 LEU A C   1 
ATOM   1358 O O   . LEU A 1 181 ? -139.667 65.895 148.072 1.00 63.67  ? 181 LEU A O   1 
ATOM   1359 C CB  . LEU A 1 181 ? -139.576 65.511 144.749 1.00 52.06  ? 181 LEU A CB  1 
ATOM   1360 C CG  . LEU A 1 181 ? -138.179 66.084 144.997 1.00 50.40  ? 181 LEU A CG  1 
ATOM   1361 C CD1 . LEU A 1 181 ? -137.264 65.021 145.577 1.00 52.78  ? 181 LEU A CD1 1 
ATOM   1362 C CD2 . LEU A 1 181 ? -137.595 66.657 143.713 1.00 44.60  ? 181 LEU A CD2 1 
ATOM   1363 N N   . CYS A 1 182 ? -141.078 67.156 146.856 1.00 61.90  ? 182 CYS A N   1 
ATOM   1364 C CA  . CYS A 1 182 ? -141.007 68.287 147.776 1.00 66.11  ? 182 CYS A CA  1 
ATOM   1365 C C   . CYS A 1 182 ? -141.716 68.015 149.098 1.00 71.91  ? 182 CYS A C   1 
ATOM   1366 O O   . CYS A 1 182 ? -141.347 68.575 150.129 1.00 78.28  ? 182 CYS A O   1 
ATOM   1367 C CB  . CYS A 1 182 ? -141.588 69.539 147.115 1.00 57.92  ? 182 CYS A CB  1 
ATOM   1368 S SG  . CYS A 1 182 ? -140.676 70.091 145.662 1.00 63.86  ? 182 CYS A SG  1 
ATOM   1369 N N   . THR A 1 183 ? -142.730 67.156 149.060 1.00 69.75  ? 183 THR A N   1 
ATOM   1370 C CA  . THR A 1 183 ? -143.540 66.857 150.240 1.00 74.30  ? 183 THR A CA  1 
ATOM   1371 C C   . THR A 1 183 ? -143.032 65.659 151.048 1.00 71.38  ? 183 THR A C   1 
ATOM   1372 O O   . THR A 1 183 ? -142.900 65.745 152.269 1.00 70.17  ? 183 THR A O   1 
ATOM   1373 C CB  . THR A 1 183 ? -145.006 66.591 149.842 1.00 79.91  ? 183 THR A CB  1 
ATOM   1374 O OG1 . THR A 1 183 ? -145.538 67.750 149.189 1.00 83.32  ? 183 THR A OG1 1 
ATOM   1375 C CG2 . THR A 1 183 ? -145.852 66.262 151.063 1.00 82.64  ? 183 THR A CG2 1 
ATOM   1376 N N   . LYS A 1 184 ? -142.738 64.551 150.368 1.00 70.80  ? 184 LYS A N   1 
ATOM   1377 C CA  . LYS A 1 184 ? -142.433 63.286 151.046 1.00 70.35  ? 184 LYS A CA  1 
ATOM   1378 C C   . LYS A 1 184 ? -140.950 62.896 151.047 1.00 67.33  ? 184 LYS A C   1 
ATOM   1379 O O   . LYS A 1 184 ? -140.559 61.985 151.770 1.00 70.52  ? 184 LYS A O   1 
ATOM   1380 C CB  . LYS A 1 184 ? -143.241 62.147 150.413 1.00 69.25  ? 184 LYS A CB  1 
ATOM   1381 C CG  . LYS A 1 184 ? -144.738 62.391 150.341 1.00 69.75  ? 184 LYS A CG  1 
ATOM   1382 C CD  . LYS A 1 184 ? -145.391 62.287 151.706 1.00 77.25  ? 184 LYS A CD  1 
ATOM   1383 C CE  . LYS A 1 184 ? -146.905 62.379 151.598 1.00 82.01  ? 184 LYS A CE  1 
ATOM   1384 N NZ  . LYS A 1 184 ? -147.579 61.995 152.871 1.00 87.29  ? 184 LYS A NZ  1 
ATOM   1385 N N   . VAL A 1 185 ? -140.129 63.570 150.246 1.00 64.84  ? 185 VAL A N   1 
ATOM   1386 C CA  . VAL A 1 185 ? -138.721 63.184 150.123 1.00 68.97  ? 185 VAL A CA  1 
ATOM   1387 C C   . VAL A 1 185 ? -137.749 64.226 150.673 1.00 72.51  ? 185 VAL A C   1 
ATOM   1388 O O   . VAL A 1 185 ? -136.909 63.915 151.518 1.00 71.45  ? 185 VAL A O   1 
ATOM   1389 C CB  . VAL A 1 185 ? -138.338 62.900 148.654 1.00 66.23  ? 185 VAL A CB  1 
ATOM   1390 C CG1 . VAL A 1 185 ? -136.857 62.558 148.552 1.00 67.06  ? 185 VAL A CG1 1 
ATOM   1391 C CG2 . VAL A 1 185 ? -139.189 61.774 148.092 1.00 64.88  ? 185 VAL A CG2 1 
ATOM   1392 N N   . LEU A 1 186 ? -137.861 65.459 150.187 1.00 75.50  ? 186 LEU A N   1 
ATOM   1393 C CA  . LEU A 1 186 ? -136.961 66.530 150.603 1.00 73.39  ? 186 LEU A CA  1 
ATOM   1394 C C   . LEU A 1 186 ? -137.225 66.986 152.035 1.00 74.77  ? 186 LEU A C   1 
ATOM   1395 O O   . LEU A 1 186 ? -138.372 67.030 152.486 1.00 73.89  ? 186 LEU A O   1 
ATOM   1396 C CB  . LEU A 1 186 ? -137.077 67.727 149.657 1.00 68.33  ? 186 LEU A CB  1 
ATOM   1397 C CG  . LEU A 1 186 ? -136.561 67.535 148.231 1.00 66.28  ? 186 LEU A CG  1 
ATOM   1398 C CD1 . LEU A 1 186 ? -136.682 68.828 147.434 1.00 59.58  ? 186 LEU A CD1 1 
ATOM   1399 C CD2 . LEU A 1 186 ? -135.123 67.042 148.251 1.00 68.38  ? 186 LEU A CD2 1 
ATOM   1400 N N   . GLU A 1 187 ? -136.151 67.314 152.747 1.00 76.99  ? 187 GLU A N   1 
ATOM   1401 C CA  . GLU A 1 187 ? -136.257 67.995 154.030 1.00 83.43  ? 187 GLU A CA  1 
ATOM   1402 C C   . GLU A 1 187 ? -136.737 69.422 153.787 1.00 77.67  ? 187 GLU A C   1 
ATOM   1403 O O   . GLU A 1 187 ? -136.579 69.947 152.682 1.00 74.47  ? 187 GLU A O   1 
ATOM   1404 C CB  . GLU A 1 187 ? -134.911 68.011 154.759 1.00 92.90  ? 187 GLU A CB  1 
ATOM   1405 C CG  . GLU A 1 187 ? -134.775 67.003 155.891 1.00 104.38 ? 187 GLU A CG  1 
ATOM   1406 C CD  . GLU A 1 187 ? -133.585 67.306 156.783 1.00 115.04 ? 187 GLU A CD  1 
ATOM   1407 O OE1 . GLU A 1 187 ? -132.838 68.258 156.472 1.00 117.81 ? 187 GLU A OE1 1 
ATOM   1408 O OE2 . GLU A 1 187 ? -133.399 66.599 157.796 1.00 118.92 ? 187 GLU A OE2 1 
ATOM   1409 N N   . PRO A 1 188 ? -137.336 70.055 154.811 1.00 77.33  ? 188 PRO A N   1 
ATOM   1410 C CA  . PRO A 1 188 ? -137.707 71.470 154.682 1.00 74.29  ? 188 PRO A CA  1 
ATOM   1411 C C   . PRO A 1 188 ? -136.484 72.353 154.459 1.00 77.30  ? 188 PRO A C   1 
ATOM   1412 O O   . PRO A 1 188 ? -135.403 72.017 154.943 1.00 78.56  ? 188 PRO A O   1 
ATOM   1413 C CB  . PRO A 1 188 ? -138.364 71.790 156.028 1.00 77.53  ? 188 PRO A CB  1 
ATOM   1414 C CG  . PRO A 1 188 ? -138.821 70.446 156.568 1.00 76.68  ? 188 PRO A CG  1 
ATOM   1415 C CD  . PRO A 1 188 ? -137.794 69.466 156.084 1.00 76.39  ? 188 PRO A CD  1 
ATOM   1416 N N   . LEU A 1 189 ? -136.652 73.458 153.737 1.00 76.26  ? 189 LEU A N   1 
ATOM   1417 C CA  . LEU A 1 189 ? -135.569 74.414 153.545 1.00 77.48  ? 189 LEU A CA  1 
ATOM   1418 C C   . LEU A 1 189 ? -135.213 75.075 154.874 1.00 83.03  ? 189 LEU A C   1 
ATOM   1419 O O   . LEU A 1 189 ? -136.066 75.197 155.756 1.00 81.97  ? 189 LEU A O   1 
ATOM   1420 C CB  . LEU A 1 189 ? -135.956 75.472 152.506 1.00 74.30  ? 189 LEU A CB  1 
ATOM   1421 C CG  . LEU A 1 189 ? -135.857 75.055 151.037 1.00 72.25  ? 189 LEU A CG  1 
ATOM   1422 C CD1 . LEU A 1 189 ? -136.372 76.157 150.121 1.00 71.91  ? 189 LEU A CD1 1 
ATOM   1423 C CD2 . LEU A 1 189 ? -134.422 74.695 150.689 1.00 72.34  ? 189 LEU A CD2 1 
ATOM   1424 N N   . PRO A 1 190 ? -133.941 75.485 155.031 1.00 87.79  ? 190 PRO A N   1 
ATOM   1425 C CA  . PRO A 1 190 ? -133.505 76.192 156.241 1.00 89.63  ? 190 PRO A CA  1 
ATOM   1426 C C   . PRO A 1 190 ? -134.288 77.484 156.477 1.00 87.75  ? 190 PRO A C   1 
ATOM   1427 O O   . PRO A 1 190 ? -134.988 77.954 155.577 1.00 82.51  ? 190 PRO A O   1 
ATOM   1428 C CB  . PRO A 1 190 ? -132.029 76.495 155.958 1.00 92.29  ? 190 PRO A CB  1 
ATOM   1429 C CG  . PRO A 1 190 ? -131.608 75.438 154.999 1.00 89.86  ? 190 PRO A CG  1 
ATOM   1430 C CD  . PRO A 1 190 ? -132.811 75.195 154.129 1.00 85.91  ? 190 PRO A CD  1 
ATOM   1431 N N   . ALA A 1 191 ? -134.165 78.049 157.675 1.00 92.87  ? 191 ALA A N   1 
ATOM   1432 C CA  . ALA A 1 191 ? -134.931 79.234 158.052 1.00 97.29  ? 191 ALA A CA  1 
ATOM   1433 C C   . ALA A 1 191 ? -134.522 80.461 157.246 1.00 98.28  ? 191 ALA A C   1 
ATOM   1434 O O   . ALA A 1 191 ? -135.322 81.375 157.045 1.00 99.57  ? 191 ALA A O   1 
ATOM   1435 C CB  . ALA A 1 191 ? -134.778 79.509 159.544 1.00 102.42 ? 191 ALA A CB  1 
ATOM   1436 N N   . GLU A 1 192 ? -133.276 80.478 156.787 1.00 100.00 ? 192 GLU A N   1 
ATOM   1437 C CA  . GLU A 1 192 ? -132.770 81.600 156.009 1.00 103.75 ? 192 GLU A CA  1 
ATOM   1438 C C   . GLU A 1 192 ? -132.202 81.139 154.674 1.00 100.54 ? 192 GLU A C   1 
ATOM   1439 O O   . GLU A 1 192 ? -131.363 80.237 154.624 1.00 102.06 ? 192 GLU A O   1 
ATOM   1440 C CB  . GLU A 1 192 ? -131.703 82.359 156.797 1.00 111.08 ? 192 GLU A CB  1 
ATOM   1441 C CG  . GLU A 1 192 ? -132.214 82.994 158.077 1.00 121.01 ? 192 GLU A CG  1 
ATOM   1442 C CD  . GLU A 1 192 ? -131.132 83.750 158.819 1.00 133.34 ? 192 GLU A CD  1 
ATOM   1443 O OE1 . GLU A 1 192 ? -129.940 83.526 158.520 1.00 136.82 ? 192 GLU A OE1 1 
ATOM   1444 O OE2 . GLU A 1 192 ? -131.473 84.574 159.696 1.00 139.24 ? 192 GLU A OE2 1 
ATOM   1445 N N   . PHE A 1 193 ? -132.667 81.759 153.594 1.00 92.21  ? 193 PHE A N   1 
ATOM   1446 C CA  . PHE A 1 193 ? -132.166 81.440 152.264 1.00 85.84  ? 193 PHE A CA  1 
ATOM   1447 C C   . PHE A 1 193 ? -132.491 82.530 151.248 1.00 81.58  ? 193 PHE A C   1 
ATOM   1448 O O   . PHE A 1 193 ? -133.372 83.361 151.470 1.00 80.05  ? 193 PHE A O   1 
ATOM   1449 C CB  . PHE A 1 193 ? -132.727 80.094 151.781 1.00 80.68  ? 193 PHE A CB  1 
ATOM   1450 C CG  . PHE A 1 193 ? -134.230 80.040 151.721 1.00 78.42  ? 193 PHE A CG  1 
ATOM   1451 C CD1 . PHE A 1 193 ? -134.919 80.545 150.626 1.00 77.84  ? 193 PHE A CD1 1 
ATOM   1452 C CD2 . PHE A 1 193 ? -134.953 79.464 152.752 1.00 78.54  ? 193 PHE A CD2 1 
ATOM   1453 C CE1 . PHE A 1 193 ? -136.302 80.490 150.571 1.00 78.02  ? 193 PHE A CE1 1 
ATOM   1454 C CE2 . PHE A 1 193 ? -136.335 79.403 152.703 1.00 78.51  ? 193 PHE A CE2 1 
ATOM   1455 C CZ  . PHE A 1 193 ? -137.011 79.916 151.613 1.00 78.62  ? 193 PHE A CZ  1 
ATOM   1456 N N   . THR A 1 194 ? -131.763 82.512 150.136 1.00 78.61  ? 194 THR A N   1 
ATOM   1457 C CA  . THR A 1 194 ? -132.038 83.381 148.999 1.00 75.52  ? 194 THR A CA  1 
ATOM   1458 C C   . THR A 1 194 ? -132.411 82.534 147.787 1.00 71.02  ? 194 THR A C   1 
ATOM   1459 O O   . THR A 1 194 ? -131.636 81.676 147.367 1.00 66.10  ? 194 THR A O   1 
ATOM   1460 C CB  . THR A 1 194 ? -130.828 84.263 148.644 1.00 75.89  ? 194 THR A CB  1 
ATOM   1461 O OG1 . THR A 1 194 ? -130.528 85.132 149.742 1.00 79.94  ? 194 THR A OG1 1 
ATOM   1462 C CG2 . THR A 1 194 ? -131.122 85.100 147.411 1.00 75.04  ? 194 THR A CG2 1 
ATOM   1463 N N   . ALA A 1 195 ? -133.598 82.764 147.234 1.00 71.50  ? 195 ALA A N   1 
ATOM   1464 C CA  . ALA A 1 195 ? -134.025 82.040 146.041 1.00 70.85  ? 195 ALA A CA  1 
ATOM   1465 C C   . ALA A 1 195 ? -133.802 82.890 144.794 1.00 68.04  ? 195 ALA A C   1 
ATOM   1466 O O   . ALA A 1 195 ? -134.110 84.080 144.784 1.00 66.84  ? 195 ALA A O   1 
ATOM   1467 C CB  . ALA A 1 195 ? -135.484 81.626 146.156 1.00 69.07  ? 195 ALA A CB  1 
ATOM   1468 N N   . ASN A 1 196 ? -133.280 82.262 143.744 1.00 69.06  ? 196 ASN A N   1 
ATOM   1469 C CA  . ASN A 1 196 ? -132.854 82.967 142.541 1.00 68.92  ? 196 ASN A CA  1 
ATOM   1470 C C   . ASN A 1 196 ? -133.214 82.207 141.263 1.00 64.51  ? 196 ASN A C   1 
ATOM   1471 O O   . ASN A 1 196 ? -133.256 80.976 141.255 1.00 65.21  ? 196 ASN A O   1 
ATOM   1472 C CB  . ASN A 1 196 ? -131.344 83.202 142.597 1.00 73.46  ? 196 ASN A CB  1 
ATOM   1473 C CG  . ASN A 1 196 ? -130.929 84.503 141.955 1.00 80.68  ? 196 ASN A CG  1 
ATOM   1474 O OD1 . ASN A 1 196 ? -129.801 84.642 141.485 1.00 85.23  ? 196 ASN A OD1 1 
ATOM   1475 N ND2 . ASN A 1 196 ? -131.838 85.468 141.933 1.00 84.03  ? 196 ASN A ND2 1 
ATOM   1476 N N   . PHE A 1 197 ? -133.489 82.946 140.193 1.00 62.86  ? 197 PHE A N   1 
ATOM   1477 C CA  . PHE A 1 197 ? -133.634 82.362 138.864 1.00 60.68  ? 197 PHE A CA  1 
ATOM   1478 C C   . PHE A 1 197 ? -132.410 82.701 138.025 1.00 62.12  ? 197 PHE A C   1 
ATOM   1479 O O   . PHE A 1 197 ? -132.101 83.871 137.811 1.00 66.30  ? 197 PHE A O   1 
ATOM   1480 C CB  . PHE A 1 197 ? -134.901 82.865 138.175 1.00 58.25  ? 197 PHE A CB  1 
ATOM   1481 C CG  . PHE A 1 197 ? -136.145 82.136 138.588 1.00 59.61  ? 197 PHE A CG  1 
ATOM   1482 C CD1 . PHE A 1 197 ? -136.378 80.841 138.156 1.00 57.87  ? 197 PHE A CD1 1 
ATOM   1483 C CD2 . PHE A 1 197 ? -137.085 82.745 139.404 1.00 63.23  ? 197 PHE A CD2 1 
ATOM   1484 C CE1 . PHE A 1 197 ? -137.523 80.164 138.531 1.00 56.88  ? 197 PHE A CE1 1 
ATOM   1485 C CE2 . PHE A 1 197 ? -138.233 82.072 139.783 1.00 62.07  ? 197 PHE A CE2 1 
ATOM   1486 C CZ  . PHE A 1 197 ? -138.451 80.781 139.346 1.00 58.78  ? 197 PHE A CZ  1 
ATOM   1487 N N   . ARG A 1 198 ? -131.708 81.673 137.563 1.00 58.52  ? 198 ARG A N   1 
ATOM   1488 C CA  . ARG A 1 198 ? -130.488 81.866 136.788 1.00 57.83  ? 198 ARG A CA  1 
ATOM   1489 C C   . ARG A 1 198 ? -130.534 81.018 135.525 1.00 59.41  ? 198 ARG A C   1 
ATOM   1490 O O   . ARG A 1 198 ? -130.970 79.869 135.559 1.00 59.27  ? 198 ARG A O   1 
ATOM   1491 C CB  . ARG A 1 198 ? -129.256 81.513 137.626 1.00 55.24  ? 198 ARG A CB  1 
ATOM   1492 C CG  . ARG A 1 198 ? -129.233 82.171 138.999 1.00 54.06  ? 198 ARG A CG  1 
ATOM   1493 C CD  . ARG A 1 198 ? -128.014 81.760 139.808 1.00 55.99  ? 198 ARG A CD  1 
ATOM   1494 N NE  . ARG A 1 198 ? -128.119 82.198 141.197 1.00 59.04  ? 198 ARG A NE  1 
ATOM   1495 C CZ  . ARG A 1 198 ? -127.158 82.052 142.103 1.00 64.59  ? 198 ARG A CZ  1 
ATOM   1496 N NH1 . ARG A 1 198 ? -126.008 81.482 141.770 1.00 65.33  ? 198 ARG A NH1 1 
ATOM   1497 N NH2 . ARG A 1 198 ? -127.346 82.480 143.344 1.00 70.19  ? 198 ARG A NH2 1 
ATOM   1498 N N   . LEU A 1 199 ? -130.087 81.581 134.408 1.00 60.29  ? 199 LEU A N   1 
ATOM   1499 C CA  . LEU A 1 199 ? -130.193 80.871 133.143 1.00 57.74  ? 199 LEU A CA  1 
ATOM   1500 C C   . LEU A 1 199 ? -128.895 80.878 132.342 1.00 59.63  ? 199 LEU A C   1 
ATOM   1501 O O   . LEU A 1 199 ? -127.973 81.643 132.623 1.00 60.26  ? 199 LEU A O   1 
ATOM   1502 C CB  . LEU A 1 199 ? -131.349 81.447 132.309 1.00 54.55  ? 199 LEU A CB  1 
ATOM   1503 C CG  . LEU A 1 199 ? -131.398 82.926 131.924 1.00 54.26  ? 199 LEU A CG  1 
ATOM   1504 C CD1 . LEU A 1 199 ? -130.528 83.220 130.716 1.00 53.95  ? 199 LEU A CD1 1 
ATOM   1505 C CD2 . LEU A 1 199 ? -132.831 83.342 131.644 1.00 52.29  ? 199 LEU A CD2 1 
ATOM   1506 N N   . LYS A 1 200 ? -128.838 80.004 131.345 1.00 58.59  ? 200 LYS A N   1 
ATOM   1507 C CA  . LYS A 1 200 ? -127.678 79.896 130.482 1.00 60.41  ? 200 LYS A CA  1 
ATOM   1508 C C   . LYS A 1 200 ? -128.116 80.002 129.030 1.00 58.37  ? 200 LYS A C   1 
ATOM   1509 O O   . LYS A 1 200 ? -129.000 79.271 128.587 1.00 54.20  ? 200 LYS A O   1 
ATOM   1510 C CB  . LYS A 1 200 ? -126.944 78.578 130.729 1.00 63.18  ? 200 LYS A CB  1 
ATOM   1511 C CG  . LYS A 1 200 ? -125.741 78.336 129.837 1.00 68.03  ? 200 LYS A CG  1 
ATOM   1512 C CD  . LYS A 1 200 ? -125.119 76.978 130.129 1.00 72.62  ? 200 LYS A CD  1 
ATOM   1513 C CE  . LYS A 1 200 ? -123.921 76.702 129.235 1.00 78.84  ? 200 LYS A CE  1 
ATOM   1514 N NZ  . LYS A 1 200 ? -123.384 75.331 129.460 1.00 81.75  ? 200 LYS A NZ  1 
ATOM   1515 N N   . TYR A 1 201 ? -127.508 80.927 128.299 1.00 62.16  ? 201 TYR A N   1 
ATOM   1516 C CA  . TYR A 1 201 ? -127.815 81.107 126.888 1.00 60.55  ? 201 TYR A CA  1 
ATOM   1517 C C   . TYR A 1 201 ? -127.127 80.023 126.066 1.00 59.89  ? 201 TYR A C   1 
ATOM   1518 O O   . TYR A 1 201 ? -126.128 79.445 126.497 1.00 60.99  ? 201 TYR A O   1 
ATOM   1519 C CB  . TYR A 1 201 ? -127.377 82.493 126.411 1.00 61.17  ? 201 TYR A CB  1 
ATOM   1520 C CG  . TYR A 1 201 ? -128.099 83.657 127.062 1.00 61.29  ? 201 TYR A CG  1 
ATOM   1521 C CD1 . TYR A 1 201 ? -127.643 84.208 128.254 1.00 63.63  ? 201 TYR A CD1 1 
ATOM   1522 C CD2 . TYR A 1 201 ? -129.223 84.222 126.471 1.00 61.53  ? 201 TYR A CD2 1 
ATOM   1523 C CE1 . TYR A 1 201 ? -128.292 85.280 128.845 1.00 64.58  ? 201 TYR A CE1 1 
ATOM   1524 C CE2 . TYR A 1 201 ? -129.880 85.295 127.055 1.00 63.17  ? 201 TYR A CE2 1 
ATOM   1525 C CZ  . TYR A 1 201 ? -129.411 85.819 128.241 1.00 65.95  ? 201 TYR A CZ  1 
ATOM   1526 O OH  . TYR A 1 201 ? -130.064 86.886 128.821 1.00 68.15  ? 201 TYR A OH  1 
ATOM   1527 N N   . THR A 1 202 ? -127.668 79.740 124.887 1.00 60.73  ? 202 THR A N   1 
ATOM   1528 C CA  . THR A 1 202 ? -127.027 78.817 123.958 1.00 63.98  ? 202 THR A CA  1 
ATOM   1529 C C   . THR A 1 202 ? -125.903 79.527 123.206 1.00 72.32  ? 202 THR A C   1 
ATOM   1530 O O   . THR A 1 202 ? -125.773 80.751 123.283 1.00 72.19  ? 202 THR A O   1 
ATOM   1531 C CB  . THR A 1 202 ? -128.032 78.237 122.947 1.00 58.19  ? 202 THR A CB  1 
ATOM   1532 O OG1 . THR A 1 202 ? -128.638 79.302 122.205 1.00 54.20  ? 202 THR A OG1 1 
ATOM   1533 C CG2 . THR A 1 202 ? -129.116 77.444 123.664 1.00 55.11  ? 202 THR A CG2 1 
ATOM   1534 N N   . ASN A 1 203 ? -125.093 78.760 122.482 1.00 81.11  ? 203 ASN A N   1 
ATOM   1535 C CA  . ASN A 1 203 ? -123.998 79.326 121.697 1.00 89.44  ? 203 ASN A CA  1 
ATOM   1536 C C   . ASN A 1 203 ? -124.515 80.142 120.517 1.00 93.16  ? 203 ASN A C   1 
ATOM   1537 O O   . ASN A 1 203 ? -123.859 81.081 120.062 1.00 93.62  ? 203 ASN A O   1 
ATOM   1538 C CB  . ASN A 1 203 ? -123.067 78.220 121.190 1.00 92.68  ? 203 ASN A CB  1 
ATOM   1539 C CG  . ASN A 1 203 ? -122.578 77.308 122.299 1.00 96.90  ? 203 ASN A CG  1 
ATOM   1540 O OD1 . ASN A 1 203 ? -122.583 77.677 123.474 1.00 98.75  ? 203 ASN A OD1 1 
ATOM   1541 N ND2 . ASN A 1 203 ? -122.148 76.107 121.929 1.00 98.97  ? 203 ASN A ND2 1 
ATOM   1542 N N   . ASP A 1 204 ? -125.697 79.775 120.028 1.00 96.13  ? 204 ASP A N   1 
ATOM   1543 C CA  . ASP A 1 204 ? -126.312 80.444 118.885 1.00 97.49  ? 204 ASP A CA  1 
ATOM   1544 C C   . ASP A 1 204 ? -126.786 81.850 119.242 1.00 94.22  ? 204 ASP A C   1 
ATOM   1545 O O   . ASP A 1 204 ? -126.912 82.711 118.372 1.00 95.43  ? 204 ASP A O   1 
ATOM   1546 C CB  . ASP A 1 204 ? -127.494 79.626 118.353 1.00 99.66  ? 204 ASP A CB  1 
ATOM   1547 C CG  . ASP A 1 204 ? -127.374 78.146 118.665 1.00 101.92 ? 204 ASP A CG  1 
ATOM   1548 O OD1 . ASP A 1 204 ? -126.269 77.696 119.035 1.00 104.45 ? 204 ASP A OD1 1 
ATOM   1549 O OD2 . ASP A 1 204 ? -128.390 77.429 118.537 1.00 100.60 ? 204 ASP A OD2 1 
ATOM   1550 N N   . ALA A 1 205 ? -127.053 82.070 120.526 1.00 89.20  ? 205 ALA A N   1 
ATOM   1551 C CA  . ALA A 1 205 ? -127.576 83.343 121.010 1.00 86.83  ? 205 ALA A CA  1 
ATOM   1552 C C   . ALA A 1 205 ? -126.634 84.506 120.712 1.00 88.91  ? 205 ALA A C   1 
ATOM   1553 O O   . ALA A 1 205 ? -125.455 84.462 121.063 1.00 92.62  ? 205 ALA A O   1 
ATOM   1554 C CB  . ALA A 1 205 ? -127.849 83.262 122.504 1.00 86.21  ? 205 ALA A CB  1 
ATOM   1555 N N   . PRO A 1 206 ? -127.158 85.554 120.056 1.00 87.36  ? 206 PRO A N   1 
ATOM   1556 C CA  . PRO A 1 206 ? -126.385 86.769 119.776 1.00 88.75  ? 206 PRO A CA  1 
ATOM   1557 C C   . PRO A 1 206 ? -126.037 87.515 121.059 1.00 89.29  ? 206 PRO A C   1 
ATOM   1558 O O   . PRO A 1 206 ? -126.688 87.305 122.083 1.00 83.93  ? 206 PRO A O   1 
ATOM   1559 C CB  . PRO A 1 206 ? -127.333 87.605 118.905 1.00 87.73  ? 206 PRO A CB  1 
ATOM   1560 C CG  . PRO A 1 206 ? -128.366 86.641 118.403 1.00 85.69  ? 206 PRO A CG  1 
ATOM   1561 C CD  . PRO A 1 206 ? -128.513 85.621 119.484 1.00 84.21  ? 206 PRO A CD  1 
ATOM   1562 N N   . SER A 1 207 ? -125.029 88.379 121.001 1.00 94.91  ? 207 SER A N   1 
ATOM   1563 C CA  . SER A 1 207 ? -124.595 89.114 122.184 1.00 97.55  ? 207 SER A CA  1 
ATOM   1564 C C   . SER A 1 207 ? -125.578 90.223 122.553 1.00 95.71  ? 207 SER A C   1 
ATOM   1565 O O   . SER A 1 207 ? -125.699 90.585 123.724 1.00 93.26  ? 207 SER A O   1 
ATOM   1566 C CB  . SER A 1 207 ? -123.198 89.699 121.967 1.00 104.68 ? 207 SER A CB  1 
ATOM   1567 O OG  . SER A 1 207 ? -122.219 88.674 121.943 1.00 108.06 ? 207 SER A OG  1 
ATOM   1568 N N   . ASN A 1 208 ? -126.284 90.752 121.557 1.00 98.06  ? 208 ASN A N   1 
ATOM   1569 C CA  . ASN A 1 208 ? -127.240 91.831 121.798 1.00 98.88  ? 208 ASN A CA  1 
ATOM   1570 C C   . ASN A 1 208 ? -128.597 91.317 122.284 1.00 91.52  ? 208 ASN A C   1 
ATOM   1571 O O   . ASN A 1 208 ? -129.405 92.082 122.814 1.00 92.77  ? 208 ASN A O   1 
ATOM   1572 C CB  . ASN A 1 208 ? -127.426 92.681 120.536 1.00 104.06 ? 208 ASN A CB  1 
ATOM   1573 C CG  . ASN A 1 208 ? -128.105 91.922 119.414 1.00 105.64 ? 208 ASN A CG  1 
ATOM   1574 O OD1 . ASN A 1 208 ? -127.817 90.751 119.180 1.00 106.72 ? 208 ASN A OD1 1 
ATOM   1575 N ND2 . ASN A 1 208 ? -129.018 92.589 118.715 1.00 105.97 ? 208 ASN A ND2 1 
ATOM   1576 N N   . PHE A 1 209 ? -128.843 90.022 122.109 1.00 84.09  ? 209 PHE A N   1 
ATOM   1577 C CA  . PHE A 1 209 ? -130.073 89.415 122.606 1.00 76.66  ? 209 PHE A CA  1 
ATOM   1578 C C   . PHE A 1 209 ? -129.969 89.156 124.102 1.00 72.96  ? 209 PHE A C   1 
ATOM   1579 O O   . PHE A 1 209 ? -129.072 88.450 124.556 1.00 69.69  ? 209 PHE A O   1 
ATOM   1580 C CB  . PHE A 1 209 ? -130.381 88.108 121.870 1.00 73.34  ? 209 PHE A CB  1 
ATOM   1581 C CG  . PHE A 1 209 ? -131.567 87.367 122.429 1.00 70.17  ? 209 PHE A CG  1 
ATOM   1582 C CD1 . PHE A 1 209 ? -132.853 87.695 122.031 1.00 69.10  ? 209 PHE A CD1 1 
ATOM   1583 C CD2 . PHE A 1 209 ? -131.396 86.351 123.362 1.00 64.26  ? 209 PHE A CD2 1 
ATOM   1584 C CE1 . PHE A 1 209 ? -133.950 87.020 122.548 1.00 64.16  ? 209 PHE A CE1 1 
ATOM   1585 C CE2 . PHE A 1 209 ? -132.488 85.673 123.884 1.00 59.76  ? 209 PHE A CE2 1 
ATOM   1586 C CZ  . PHE A 1 209 ? -133.767 86.008 123.476 1.00 60.11  ? 209 PHE A CZ  1 
ATOM   1587 N N   . ARG A 1 210 ? -130.892 89.726 124.867 1.00 73.24  ? 210 ARG A N   1 
ATOM   1588 C CA  . ARG A 1 210 ? -130.916 89.505 126.305 1.00 71.89  ? 210 ARG A CA  1 
ATOM   1589 C C   . ARG A 1 210 ? -132.336 89.224 126.763 1.00 63.87  ? 210 ARG A C   1 
ATOM   1590 O O   . ARG A 1 210 ? -133.285 89.866 126.312 1.00 64.27  ? 210 ARG A O   1 
ATOM   1591 C CB  . ARG A 1 210 ? -130.344 90.709 127.054 1.00 81.13  ? 210 ARG A CB  1 
ATOM   1592 C CG  . ARG A 1 210 ? -130.247 90.508 128.558 1.00 86.00  ? 210 ARG A CG  1 
ATOM   1593 C CD  . ARG A 1 210 ? -129.746 91.760 129.258 1.00 94.56  ? 210 ARG A CD  1 
ATOM   1594 N NE  . ARG A 1 210 ? -130.652 92.891 129.079 1.00 98.78  ? 210 ARG A NE  1 
ATOM   1595 C CZ  . ARG A 1 210 ? -131.687 93.151 129.872 1.00 100.02 ? 210 ARG A CZ  1 
ATOM   1596 N NH1 . ARG A 1 210 ? -131.955 92.356 130.900 1.00 98.08  ? 210 ARG A NH1 1 
ATOM   1597 N NH2 . ARG A 1 210 ? -132.458 94.204 129.636 1.00 101.69 ? 210 ARG A NH2 1 
ATOM   1598 N N   . ILE A 1 211 ? -132.484 88.254 127.654 1.00 56.20  ? 211 ILE A N   1 
ATOM   1599 C CA  . ILE A 1 211 ? -133.800 87.916 128.157 1.00 55.51  ? 211 ILE A CA  1 
ATOM   1600 C C   . ILE A 1 211 ? -134.230 88.953 129.195 1.00 61.92  ? 211 ILE A C   1 
ATOM   1601 O O   . ILE A 1 211 ? -133.468 89.298 130.104 1.00 62.64  ? 211 ILE A O   1 
ATOM   1602 C CB  . ILE A 1 211 ? -133.815 86.491 128.732 1.00 53.59  ? 211 ILE A CB  1 
ATOM   1603 C CG1 . ILE A 1 211 ? -133.468 85.500 127.612 1.00 50.15  ? 211 ILE A CG1 1 
ATOM   1604 C CG2 . ILE A 1 211 ? -135.173 86.165 129.334 1.00 50.26  ? 211 ILE A CG2 1 
ATOM   1605 C CD1 . ILE A 1 211 ? -133.223 84.090 128.076 1.00 49.73  ? 211 ILE A CD1 1 
ATOM   1606 N N   . ASP A 1 212 ? -135.442 89.475 129.023 1.00 63.11  ? 212 ASP A N   1 
ATOM   1607 C CA  . ASP A 1 212 ? -135.947 90.536 129.883 1.00 67.55  ? 212 ASP A CA  1 
ATOM   1608 C C   . ASP A 1 212 ? -136.070 90.054 131.323 1.00 67.13  ? 212 ASP A C   1 
ATOM   1609 O O   . ASP A 1 212 ? -136.711 89.039 131.598 1.00 63.96  ? 212 ASP A O   1 
ATOM   1610 C CB  . ASP A 1 212 ? -137.301 91.044 129.378 1.00 74.68  ? 212 ASP A CB  1 
ATOM   1611 C CG  . ASP A 1 212 ? -137.648 92.427 129.919 1.00 88.71  ? 212 ASP A CG  1 
ATOM   1612 O OD1 . ASP A 1 212 ? -136.715 93.209 130.208 1.00 93.32  ? 212 ASP A OD1 1 
ATOM   1613 O OD2 . ASP A 1 212 ? -138.851 92.741 130.049 1.00 93.41  ? 212 ASP A OD2 1 
ATOM   1614 N N   . GLY A 1 213 ? -135.445 90.785 132.240 1.00 67.79  ? 213 GLY A N   1 
ATOM   1615 C CA  . GLY A 1 213 ? -135.512 90.456 133.650 1.00 68.11  ? 213 GLY A CA  1 
ATOM   1616 C C   . GLY A 1 213 ? -134.239 89.804 134.146 1.00 69.53  ? 213 GLY A C   1 
ATOM   1617 O O   . GLY A 1 213 ? -134.025 89.674 135.349 1.00 72.57  ? 213 GLY A O   1 
ATOM   1618 N N   . PHE A 1 214 ? -133.389 89.395 133.211 1.00 70.64  ? 214 PHE A N   1 
ATOM   1619 C CA  . PHE A 1 214 ? -132.149 88.707 133.549 1.00 70.53  ? 214 PHE A CA  1 
ATOM   1620 C C   . PHE A 1 214 ? -130.931 89.524 133.128 1.00 74.86  ? 214 PHE A C   1 
ATOM   1621 O O   . PHE A 1 214 ? -130.623 89.634 131.939 1.00 76.22  ? 214 PHE A O   1 
ATOM   1622 C CB  . PHE A 1 214 ? -132.101 87.325 132.888 1.00 63.99  ? 214 PHE A CB  1 
ATOM   1623 C CG  . PHE A 1 214 ? -133.158 86.368 133.379 1.00 56.67  ? 214 PHE A CG  1 
ATOM   1624 C CD1 . PHE A 1 214 ? -134.437 86.382 132.841 1.00 52.70  ? 214 PHE A CD1 1 
ATOM   1625 C CD2 . PHE A 1 214 ? -132.862 85.436 134.364 1.00 52.27  ? 214 PHE A CD2 1 
ATOM   1626 C CE1 . PHE A 1 214 ? -135.404 85.493 133.287 1.00 49.05  ? 214 PHE A CE1 1 
ATOM   1627 C CE2 . PHE A 1 214 ? -133.823 84.544 134.813 1.00 46.68  ? 214 PHE A CE2 1 
ATOM   1628 C CZ  . PHE A 1 214 ? -135.095 84.573 134.275 1.00 44.93  ? 214 PHE A CZ  1 
ATOM   1629 N N   . ASP A 1 215 ? -130.244 90.099 134.110 1.00 76.94  ? 215 ASP A N   1 
ATOM   1630 C CA  . ASP A 1 215 ? -128.995 90.808 133.862 1.00 80.57  ? 215 ASP A CA  1 
ATOM   1631 C C   . ASP A 1 215 ? -127.893 89.799 133.562 1.00 77.21  ? 215 ASP A C   1 
ATOM   1632 O O   . ASP A 1 215 ? -127.854 88.725 134.161 1.00 72.91  ? 215 ASP A O   1 
ATOM   1633 C CB  . ASP A 1 215 ? -128.609 91.669 135.068 1.00 88.22  ? 215 ASP A CB  1 
ATOM   1634 C CG  . ASP A 1 215 ? -129.778 92.463 135.614 1.00 91.43  ? 215 ASP A CG  1 
ATOM   1635 O OD1 . ASP A 1 215 ? -130.608 92.922 134.800 1.00 90.23  ? 215 ASP A OD1 1 
ATOM   1636 O OD2 . ASP A 1 215 ? -129.871 92.625 136.851 1.00 93.74  ? 215 ASP A OD2 1 
ATOM   1637 N N   . ASP A 1 216 ? -126.996 90.145 132.643 1.00 80.28  ? 216 ASP A N   1 
ATOM   1638 C CA  . ASP A 1 216 ? -125.913 89.242 132.260 1.00 84.46  ? 216 ASP A CA  1 
ATOM   1639 C C   . ASP A 1 216 ? -124.969 88.966 133.424 1.00 87.58  ? 216 ASP A C   1 
ATOM   1640 O O   . ASP A 1 216 ? -124.803 89.798 134.316 1.00 90.73  ? 216 ASP A O   1 
ATOM   1641 C CB  . ASP A 1 216 ? -125.132 89.809 131.072 1.00 90.30  ? 216 ASP A CB  1 
ATOM   1642 C CG  . ASP A 1 216 ? -125.802 89.515 129.743 1.00 91.10  ? 216 ASP A CG  1 
ATOM   1643 O OD1 . ASP A 1 216 ? -126.713 90.275 129.352 1.00 93.16  ? 216 ASP A OD1 1 
ATOM   1644 O OD2 . ASP A 1 216 ? -125.418 88.522 129.089 1.00 89.93  ? 216 ASP A OD2 1 
ATOM   1645 N N   . SER A 1 217 ? -124.357 87.788 133.406 1.00 88.04  ? 217 SER A N   1 
ATOM   1646 C CA  . SER A 1 217 ? -123.494 87.354 134.498 1.00 90.78  ? 217 SER A CA  1 
ATOM   1647 C C   . SER A 1 217 ? -122.366 86.460 133.999 1.00 91.95  ? 217 SER A C   1 
ATOM   1648 O O   . SER A 1 217 ? -122.533 85.704 133.041 1.00 91.01  ? 217 SER A O   1 
ATOM   1649 C CB  . SER A 1 217 ? -124.312 86.614 135.558 1.00 90.85  ? 217 SER A CB  1 
ATOM   1650 O OG  . SER A 1 217 ? -123.484 86.074 136.574 1.00 93.52  ? 217 SER A OG  1 
ATOM   1651 N N   . SER A 1 218 ? -121.217 86.556 134.657 1.00 95.17  ? 218 SER A N   1 
ATOM   1652 C CA  . SER A 1 218 ? -120.089 85.683 134.368 1.00 97.17  ? 218 SER A CA  1 
ATOM   1653 C C   . SER A 1 218 ? -120.080 84.506 135.337 1.00 97.27  ? 218 SER A C   1 
ATOM   1654 O O   . SER A 1 218 ? -119.093 83.777 135.440 1.00 100.78 ? 218 SER A O   1 
ATOM   1655 C CB  . SER A 1 218 ? -118.775 86.459 134.453 1.00 102.06 ? 218 SER A CB  1 
ATOM   1656 O OG  . SER A 1 218 ? -118.688 87.184 135.668 1.00 104.75 ? 218 SER A OG  1 
ATOM   1657 N N   . THR A 1 219 ? -121.191 84.331 136.047 1.00 93.71  ? 219 THR A N   1 
ATOM   1658 C CA  . THR A 1 219 ? -121.328 83.250 137.016 1.00 91.71  ? 219 THR A CA  1 
ATOM   1659 C C   . THR A 1 219 ? -122.714 82.610 136.952 1.00 85.86  ? 219 THR A C   1 
ATOM   1660 O O   . THR A 1 219 ? -123.733 83.304 136.922 1.00 82.41  ? 219 THR A O   1 
ATOM   1661 C CB  . THR A 1 219 ? -121.064 83.744 138.456 1.00 94.17  ? 219 THR A CB  1 
ATOM   1662 O OG1 . THR A 1 219 ? -121.648 85.040 138.634 1.00 94.77  ? 219 THR A OG1 1 
ATOM   1663 C CG2 . THR A 1 219 ? -119.570 83.836 138.725 1.00 97.59  ? 219 THR A CG2 1 
ATOM   1664 N N   . PHE A 1 220 ? -122.737 81.280 136.930 1.00 84.43  ? 220 PHE A N   1 
ATOM   1665 C CA  . PHE A 1 220 ? -123.980 80.514 136.924 1.00 79.97  ? 220 PHE A CA  1 
ATOM   1666 C C   . PHE A 1 220 ? -124.283 80.045 138.345 1.00 79.75  ? 220 PHE A C   1 
ATOM   1667 O O   . PHE A 1 220 ? -124.594 80.853 139.221 1.00 79.42  ? 220 PHE A O   1 
ATOM   1668 C CB  . PHE A 1 220 ? -123.867 79.318 135.974 1.00 78.23  ? 220 PHE A CB  1 
ATOM   1669 C CG  . PHE A 1 220 ? -125.191 78.792 135.481 1.00 73.62  ? 220 PHE A CG  1 
ATOM   1670 C CD1 . PHE A 1 220 ? -126.345 79.549 135.592 1.00 71.18  ? 220 PHE A CD1 1 
ATOM   1671 C CD2 . PHE A 1 220 ? -125.276 77.532 134.905 1.00 71.73  ? 220 PHE A CD2 1 
ATOM   1672 C CE1 . PHE A 1 220 ? -127.557 79.061 135.134 1.00 66.13  ? 220 PHE A CE1 1 
ATOM   1673 C CE2 . PHE A 1 220 ? -126.485 77.041 134.447 1.00 67.42  ? 220 PHE A CE2 1 
ATOM   1674 C CZ  . PHE A 1 220 ? -127.625 77.806 134.562 1.00 63.58  ? 220 PHE A CZ  1 
ATOM   1675 N N   . TYR A 1 221 ? -124.188 78.737 138.566 1.00 79.68  ? 221 TYR A N   1 
ATOM   1676 C CA  . TYR A 1 221 ? -124.223 78.181 139.916 1.00 80.54  ? 221 TYR A CA  1 
ATOM   1677 C C   . TYR A 1 221 ? -123.277 76.989 140.018 1.00 84.78  ? 221 TYR A C   1 
ATOM   1678 O O   . TYR A 1 221 ? -122.985 76.329 139.022 1.00 85.79  ? 221 TYR A O   1 
ATOM   1679 C CB  . TYR A 1 221 ? -125.648 77.771 140.318 1.00 75.13  ? 221 TYR A CB  1 
ATOM   1680 C CG  . TYR A 1 221 ? -126.252 76.652 139.490 1.00 70.38  ? 221 TYR A CG  1 
ATOM   1681 C CD1 . TYR A 1 221 ? -125.988 75.317 139.784 1.00 69.96  ? 221 TYR A CD1 1 
ATOM   1682 C CD2 . TYR A 1 221 ? -127.100 76.932 138.428 1.00 66.57  ? 221 TYR A CD2 1 
ATOM   1683 C CE1 . TYR A 1 221 ? -126.537 74.298 139.032 1.00 66.47  ? 221 TYR A CE1 1 
ATOM   1684 C CE2 . TYR A 1 221 ? -127.656 75.918 137.673 1.00 64.46  ? 221 TYR A CE2 1 
ATOM   1685 C CZ  . TYR A 1 221 ? -127.371 74.604 137.979 1.00 63.97  ? 221 TYR A CZ  1 
ATOM   1686 O OH  . TYR A 1 221 ? -127.923 73.593 137.228 1.00 62.97  ? 221 TYR A OH  1 
ATOM   1687 N N   . THR A 1 222 ? -122.799 76.720 141.227 1.00 88.73  ? 222 THR A N   1 
ATOM   1688 C CA  . THR A 1 222 ? -121.941 75.569 141.471 1.00 91.16  ? 222 THR A CA  1 
ATOM   1689 C C   . THR A 1 222 ? -122.583 74.694 142.545 1.00 89.19  ? 222 THR A C   1 
ATOM   1690 O O   . THR A 1 222 ? -123.395 75.172 143.338 1.00 86.71  ? 222 THR A O   1 
ATOM   1691 C CB  . THR A 1 222 ? -120.522 76.002 141.902 1.00 98.57  ? 222 THR A CB  1 
ATOM   1692 O OG1 . THR A 1 222 ? -120.036 77.012 141.009 1.00 98.18  ? 222 THR A OG1 1 
ATOM   1693 C CG2 . THR A 1 222 ? -119.561 74.820 141.895 1.00 102.45 ? 222 THR A CG2 1 
ATOM   1694 N N   . LEU A 1 223 ? -122.235 73.412 142.556 1.00 90.63  ? 223 LEU A N   1 
ATOM   1695 C CA  . LEU A 1 223 ? -122.798 72.475 143.514 1.00 92.41  ? 223 LEU A CA  1 
ATOM   1696 C C   . LEU A 1 223 ? -121.751 72.044 144.531 1.00 100.14 ? 223 LEU A C   1 
ATOM   1697 O O   . LEU A 1 223 ? -120.552 72.158 144.278 1.00 103.94 ? 223 LEU A O   1 
ATOM   1698 C CB  . LEU A 1 223 ? -123.361 71.249 142.791 1.00 88.34  ? 223 LEU A CB  1 
ATOM   1699 C CG  . LEU A 1 223 ? -124.330 71.507 141.638 1.00 81.41  ? 223 LEU A CG  1 
ATOM   1700 C CD1 . LEU A 1 223 ? -124.689 70.206 140.936 1.00 76.84  ? 223 LEU A CD1 1 
ATOM   1701 C CD2 . LEU A 1 223 ? -125.576 72.212 142.147 1.00 79.54  ? 223 LEU A CD2 1 
ATOM   1702 N N   . PRO A 1 224 ? -122.202 71.563 145.699 1.00 102.53 ? 224 PRO A N   1 
ATOM   1703 C CA  . PRO A 1 224 ? -121.296 70.860 146.610 1.00 107.97 ? 224 PRO A CA  1 
ATOM   1704 C C   . PRO A 1 224 ? -120.805 69.568 145.967 1.00 112.82 ? 224 PRO A C   1 
ATOM   1705 O O   . PRO A 1 224 ? -121.353 69.150 144.946 1.00 110.49 ? 224 PRO A O   1 
ATOM   1706 C CB  . PRO A 1 224 ? -122.172 70.571 147.833 1.00 106.05 ? 224 PRO A CB  1 
ATOM   1707 C CG  . PRO A 1 224 ? -123.254 71.593 147.767 1.00 102.30 ? 224 PRO A CG  1 
ATOM   1708 C CD  . PRO A 1 224 ? -123.521 71.800 146.310 1.00 99.72  ? 224 PRO A CD  1 
ATOM   1709 N N   . ASP A 1 225 ? -119.796 68.938 146.556 1.00 120.10 ? 225 ASP A N   1 
ATOM   1710 C CA  . ASP A 1 225 ? -119.219 67.736 145.964 1.00 122.62 ? 225 ASP A CA  1 
ATOM   1711 C C   . ASP A 1 225 ? -120.003 66.476 146.325 1.00 121.03 ? 225 ASP A C   1 
ATOM   1712 O O   . ASP A 1 225 ? -119.950 65.477 145.608 1.00 121.31 ? 225 ASP A O   1 
ATOM   1713 C CB  . ASP A 1 225 ? -117.757 67.586 146.387 1.00 129.48 ? 225 ASP A CB  1 
ATOM   1714 C CG  . ASP A 1 225 ? -116.869 68.665 145.795 1.00 133.12 ? 225 ASP A CG  1 
ATOM   1715 O OD1 . ASP A 1 225 ? -116.561 68.587 144.586 1.00 133.14 ? 225 ASP A OD1 1 
ATOM   1716 O OD2 . ASP A 1 225 ? -116.476 69.589 146.538 1.00 135.59 ? 225 ASP A OD2 1 
ATOM   1717 N N   . GLY A 1 226 ? -120.740 66.529 147.429 1.00 120.12 ? 226 GLY A N   1 
ATOM   1718 C CA  . GLY A 1 226 ? -121.490 65.374 147.886 1.00 118.53 ? 226 GLY A CA  1 
ATOM   1719 C C   . GLY A 1 226 ? -122.992 65.559 147.801 1.00 113.15 ? 226 GLY A C   1 
ATOM   1720 O O   . GLY A 1 226 ? -123.750 64.811 148.421 1.00 112.54 ? 226 GLY A O   1 
ATOM   1721 N N   . ILE A 1 227 ? -123.428 66.551 147.032 1.00 108.26 ? 227 ILE A N   1 
ATOM   1722 C CA  . ILE A 1 227 ? -124.851 66.842 146.923 1.00 102.08 ? 227 ILE A CA  1 
ATOM   1723 C C   . ILE A 1 227 ? -125.551 65.780 146.074 1.00 97.16  ? 227 ILE A C   1 
ATOM   1724 O O   . ILE A 1 227 ? -124.997 65.288 145.090 1.00 96.36  ? 227 ILE A O   1 
ATOM   1725 C CB  . ILE A 1 227 ? -125.094 68.266 146.345 1.00 88.75  ? 227 ILE A CB  1 
ATOM   1726 C CG1 . ILE A 1 227 ? -126.561 68.672 146.514 1.00 86.25  ? 227 ILE A CG1 1 
ATOM   1727 C CG2 . ILE A 1 227 ? -124.639 68.363 144.892 1.00 86.25  ? 227 ILE A CG2 1 
ATOM   1728 C CD1 . ILE A 1 227 ? -126.804 70.156 146.349 1.00 85.31  ? 227 ILE A CD1 1 
ATOM   1729 N N   . GLN A 1 228 ? -126.760 65.408 146.483 1.00 95.49  ? 228 GLN A N   1 
ATOM   1730 C CA  . GLN A 1 228 ? -127.511 64.357 145.805 1.00 94.56  ? 228 GLN A CA  1 
ATOM   1731 C C   . GLN A 1 228 ? -128.271 64.887 144.594 1.00 90.65  ? 228 GLN A C   1 
ATOM   1732 O O   . GLN A 1 228 ? -128.614 66.066 144.532 1.00 90.14  ? 228 GLN A O   1 
ATOM   1733 C CB  . GLN A 1 228 ? -128.477 63.679 146.780 1.00 97.60  ? 228 GLN A CB  1 
ATOM   1734 C CG  . GLN A 1 228 ? -127.802 62.739 147.771 1.00 103.21 ? 228 GLN A CG  1 
ATOM   1735 C CD  . GLN A 1 228 ? -127.122 61.561 147.091 1.00 104.70 ? 228 GLN A CD  1 
ATOM   1736 O OE1 . GLN A 1 228 ? -127.493 61.166 145.985 1.00 103.57 ? 228 GLN A OE1 1 
ATOM   1737 N NE2 . GLN A 1 228 ? -126.117 60.997 147.751 1.00 107.95 ? 228 GLN A NE2 1 
ATOM   1738 N N   . SER A 1 229 ? -128.534 63.998 143.640 1.00 87.93  ? 229 SER A N   1 
ATOM   1739 C CA  . SER A 1 229 ? -129.154 64.373 142.372 1.00 83.09  ? 229 SER A CA  1 
ATOM   1740 C C   . SER A 1 229 ? -130.280 63.420 141.981 1.00 78.98  ? 229 SER A C   1 
ATOM   1741 O O   . SER A 1 229 ? -130.064 62.215 141.853 1.00 84.19  ? 229 SER A O   1 
ATOM   1742 C CB  . SER A 1 229 ? -128.100 64.409 141.262 1.00 83.67  ? 229 SER A CB  1 
ATOM   1743 O OG  . SER A 1 229 ? -128.701 64.481 139.981 1.00 80.98  ? 229 SER A OG  1 
ATOM   1744 N N   . VAL A 1 230 ? -131.477 63.962 141.779 1.00 70.29  ? 230 VAL A N   1 
ATOM   1745 C CA  . VAL A 1 230 ? -132.622 63.146 141.390 1.00 64.56  ? 230 VAL A CA  1 
ATOM   1746 C C   . VAL A 1 230 ? -133.317 63.715 140.145 1.00 60.75  ? 230 VAL A C   1 
ATOM   1747 O O   . VAL A 1 230 ? -133.414 64.926 139.966 1.00 61.96  ? 230 VAL A O   1 
ATOM   1748 C CB  . VAL A 1 230 ? -133.636 63.008 142.563 1.00 80.70  ? 230 VAL A CB  1 
ATOM   1749 C CG1 . VAL A 1 230 ? -134.306 64.338 142.876 1.00 81.68  ? 230 VAL A CG1 1 
ATOM   1750 C CG2 . VAL A 1 230 ? -134.674 61.931 142.264 1.00 80.29  ? 230 VAL A CG2 1 
ATOM   1751 N N   . THR A 1 231 ? -133.777 62.821 139.275 1.00 60.67  ? 231 THR A N   1 
ATOM   1752 C CA  . THR A 1 231 ? -134.439 63.202 138.033 1.00 56.91  ? 231 THR A CA  1 
ATOM   1753 C C   . THR A 1 231 ? -135.954 63.263 138.216 1.00 54.33  ? 231 THR A C   1 
ATOM   1754 O O   . THR A 1 231 ? -136.569 62.312 138.688 1.00 58.15  ? 231 THR A O   1 
ATOM   1755 C CB  . THR A 1 231 ? -134.092 62.213 136.895 1.00 58.10  ? 231 THR A CB  1 
ATOM   1756 O OG1 . THR A 1 231 ? -132.681 62.242 136.647 1.00 60.47  ? 231 THR A OG1 1 
ATOM   1757 C CG2 . THR A 1 231 ? -134.834 62.569 135.615 1.00 54.24  ? 231 THR A CG2 1 
ATOM   1758 N N   . ILE A 1 232 ? -136.550 64.390 137.848 1.00 53.27  ? 232 ILE A N   1 
ATOM   1759 C CA  . ILE A 1 232 ? -137.989 64.585 137.996 1.00 52.75  ? 232 ILE A CA  1 
ATOM   1760 C C   . ILE A 1 232 ? -138.728 64.037 136.783 1.00 52.35  ? 232 ILE A C   1 
ATOM   1761 O O   . ILE A 1 232 ? -139.798 63.437 136.911 1.00 53.55  ? 232 ILE A O   1 
ATOM   1762 C CB  . ILE A 1 232 ? -138.343 66.082 138.189 1.00 46.24  ? 232 ILE A CB  1 
ATOM   1763 C CG1 . ILE A 1 232 ? -137.934 66.556 139.583 1.00 53.57  ? 232 ILE A CG1 1 
ATOM   1764 C CG2 . ILE A 1 232 ? -139.830 66.333 137.990 1.00 44.87  ? 232 ILE A CG2 1 
ATOM   1765 C CD1 . ILE A 1 232 ? -136.503 67.006 139.678 1.00 60.64  ? 232 ILE A CD1 1 
ATOM   1766 N N   . GLY A 1 233 ? -138.147 64.245 135.605 1.00 51.92  ? 233 GLY A N   1 
ATOM   1767 C CA  . GLY A 1 233 ? -138.754 63.792 134.369 1.00 51.37  ? 233 GLY A CA  1 
ATOM   1768 C C   . GLY A 1 233 ? -138.345 64.615 133.161 1.00 50.72  ? 233 GLY A C   1 
ATOM   1769 O O   . GLY A 1 233 ? -137.495 65.502 133.255 1.00 47.12  ? 233 GLY A O   1 
ATOM   1770 N N   . HIS A 1 234 ? -138.961 64.315 132.022 1.00 49.48  ? 234 HIS A N   1 
ATOM   1771 C CA  . HIS A 1 234 ? -138.648 64.986 130.769 1.00 46.65  ? 234 HIS A CA  1 
ATOM   1772 C C   . HIS A 1 234 ? -139.910 65.352 129.991 1.00 43.51  ? 234 HIS A C   1 
ATOM   1773 O O   . HIS A 1 234 ? -141.012 64.915 130.322 1.00 43.18  ? 234 HIS A O   1 
ATOM   1774 C CB  . HIS A 1 234 ? -137.744 64.104 129.907 1.00 53.39  ? 234 HIS A CB  1 
ATOM   1775 C CG  . HIS A 1 234 ? -138.388 62.825 129.472 1.00 61.91  ? 234 HIS A CG  1 
ATOM   1776 N ND1 . HIS A 1 234 ? -138.320 61.665 130.215 1.00 67.03  ? 234 HIS A ND1 1 
ATOM   1777 C CD2 . HIS A 1 234 ? -139.119 62.525 128.373 1.00 64.18  ? 234 HIS A CD2 1 
ATOM   1778 C CE1 . HIS A 1 234 ? -138.978 60.705 129.589 1.00 66.43  ? 234 HIS A CE1 1 
ATOM   1779 N NE2 . HIS A 1 234 ? -139.471 61.200 128.469 1.00 65.17  ? 234 HIS A NE2 1 
ATOM   1780 N N   . LEU A 1 235 ? -139.730 66.165 128.956 1.00 41.77  ? 235 LEU A N   1 
ATOM   1781 C CA  . LEU A 1 235 ? -140.814 66.590 128.081 1.00 39.30  ? 235 LEU A CA  1 
ATOM   1782 C C   . LEU A 1 235 ? -140.337 66.483 126.639 1.00 39.21  ? 235 LEU A C   1 
ATOM   1783 O O   . LEU A 1 235 ? -139.208 66.864 126.328 1.00 39.71  ? 235 LEU A O   1 
ATOM   1784 C CB  . LEU A 1 235 ? -141.253 68.026 128.407 1.00 37.80  ? 235 LEU A CB  1 
ATOM   1785 C CG  . LEU A 1 235 ? -141.950 68.256 129.753 1.00 37.40  ? 235 LEU A CG  1 
ATOM   1786 C CD1 . LEU A 1 235 ? -142.074 69.742 130.081 1.00 38.66  ? 235 LEU A CD1 1 
ATOM   1787 C CD2 . LEU A 1 235 ? -143.319 67.592 129.772 1.00 33.22  ? 235 LEU A CD2 1 
ATOM   1788 N N   . ARG A 1 236 ? -141.179 65.940 125.765 1.00 39.88  ? 236 ARG A N   1 
ATOM   1789 C CA  . ARG A 1 236 ? -140.820 65.806 124.358 1.00 39.76  ? 236 ARG A CA  1 
ATOM   1790 C C   . ARG A 1 236 ? -142.003 66.175 123.471 1.00 43.14  ? 236 ARG A C   1 
ATOM   1791 O O   . ARG A 1 236 ? -142.708 65.297 122.968 1.00 45.95  ? 236 ARG A O   1 
ATOM   1792 C CB  . ARG A 1 236 ? -140.342 64.378 124.054 1.00 40.24  ? 236 ARG A CB  1 
ATOM   1793 C CG  . ARG A 1 236 ? -139.837 64.125 122.620 1.00 43.84  ? 236 ARG A CG  1 
ATOM   1794 C CD  . ARG A 1 236 ? -138.762 65.118 122.203 1.00 47.58  ? 236 ARG A CD  1 
ATOM   1795 N NE  . ARG A 1 236 ? -138.001 64.690 121.028 1.00 52.63  ? 236 ARG A NE  1 
ATOM   1796 C CZ  . ARG A 1 236 ? -138.207 65.130 119.788 1.00 51.42  ? 236 ARG A CZ  1 
ATOM   1797 N NH1 . ARG A 1 236 ? -139.166 66.011 119.538 1.00 54.00  ? 236 ARG A NH1 1 
ATOM   1798 N NH2 . ARG A 1 236 ? -137.451 64.687 118.794 1.00 46.35  ? 236 ARG A NH2 1 
ATOM   1799 N N   . PRO A 1 237 ? -142.243 67.484 123.293 1.00 41.55  ? 237 PRO A N   1 
ATOM   1800 C CA  . PRO A 1 237 ? -143.204 67.906 122.272 1.00 40.54  ? 237 PRO A CA  1 
ATOM   1801 C C   . PRO A 1 237 ? -142.612 67.767 120.871 1.00 42.21  ? 237 PRO A C   1 
ATOM   1802 O O   . PRO A 1 237 ? -141.575 67.122 120.704 1.00 40.17  ? 237 PRO A O   1 
ATOM   1803 C CB  . PRO A 1 237 ? -143.480 69.370 122.624 1.00 40.18  ? 237 PRO A CB  1 
ATOM   1804 C CG  . PRO A 1 237 ? -142.307 69.809 123.408 1.00 40.09  ? 237 PRO A CG  1 
ATOM   1805 C CD  . PRO A 1 237 ? -141.809 68.604 124.145 1.00 40.83  ? 237 PRO A CD  1 
ATOM   1806 N N   . GLY A 1 238 ? -143.265 68.366 119.881 1.00 42.36  ? 238 GLY A N   1 
ATOM   1807 C CA  . GLY A 1 238 ? -142.870 68.206 118.494 1.00 39.30  ? 238 GLY A CA  1 
ATOM   1808 C C   . GLY A 1 238 ? -141.433 68.555 118.145 1.00 38.83  ? 238 GLY A C   1 
ATOM   1809 O O   . GLY A 1 238 ? -140.787 67.832 117.387 1.00 42.02  ? 238 GLY A O   1 
ATOM   1810 N N   . HIS A 1 239 ? -140.918 69.658 118.677 1.00 36.98  ? 239 HIS A N   1 
ATOM   1811 C CA  . HIS A 1 239 ? -139.639 70.163 118.187 1.00 38.48  ? 239 HIS A CA  1 
ATOM   1812 C C   . HIS A 1 239 ? -138.690 70.585 119.295 1.00 36.39  ? 239 HIS A C   1 
ATOM   1813 O O   . HIS A 1 239 ? -137.656 71.202 119.037 1.00 38.01  ? 239 HIS A O   1 
ATOM   1814 C CB  . HIS A 1 239 ? -139.888 71.328 117.225 1.00 34.81  ? 239 HIS A CB  1 
ATOM   1815 C CG  . HIS A 1 239 ? -140.746 70.954 116.057 1.00 35.06  ? 239 HIS A CG  1 
ATOM   1816 N ND1 . HIS A 1 239 ? -140.229 70.661 114.816 1.00 40.24  ? 239 HIS A ND1 1 
ATOM   1817 C CD2 . HIS A 1 239 ? -142.086 70.788 115.958 1.00 37.52  ? 239 HIS A CD2 1 
ATOM   1818 C CE1 . HIS A 1 239 ? -141.214 70.347 113.995 1.00 41.31  ? 239 HIS A CE1 1 
ATOM   1819 N NE2 . HIS A 1 239 ? -142.351 70.415 114.661 1.00 37.76  ? 239 HIS A NE2 1 
ATOM   1820 N N   . HIS A 1 240 ? -139.035 70.235 120.527 1.00 37.48  ? 240 HIS A N   1 
ATOM   1821 C CA  . HIS A 1 240 ? -138.222 70.605 121.670 1.00 40.82  ? 240 HIS A CA  1 
ATOM   1822 C C   . HIS A 1 240 ? -138.171 69.460 122.668 1.00 40.76  ? 240 HIS A C   1 
ATOM   1823 O O   . HIS A 1 240 ? -139.013 68.563 122.638 1.00 41.42  ? 240 HIS A O   1 
ATOM   1824 C CB  . HIS A 1 240 ? -138.779 71.859 122.354 1.00 35.14  ? 240 HIS A CB  1 
ATOM   1825 C CG  . HIS A 1 240 ? -138.908 73.042 121.448 1.00 40.21  ? 240 HIS A CG  1 
ATOM   1826 N ND1 . HIS A 1 240 ? -139.948 73.184 120.555 1.00 44.86  ? 240 HIS A ND1 1 
ATOM   1827 C CD2 . HIS A 1 240 ? -138.124 74.137 121.289 1.00 43.50  ? 240 HIS A CD2 1 
ATOM   1828 C CE1 . HIS A 1 240 ? -139.801 74.316 119.884 1.00 46.17  ? 240 HIS A CE1 1 
ATOM   1829 N NE2 . HIS A 1 240 ? -138.701 74.910 120.313 1.00 46.20  ? 240 HIS A NE2 1 
ATOM   1830 N N   . ALA A 1 241 ? -137.176 69.494 123.546 1.00 41.82  ? 241 ALA A N   1 
ATOM   1831 C CA  . ALA A 1 241 ? -137.107 68.561 124.660 1.00 41.97  ? 241 ALA A CA  1 
ATOM   1832 C C   . ALA A 1 241 ? -136.588 69.283 125.895 1.00 41.02  ? 241 ALA A C   1 
ATOM   1833 O O   . ALA A 1 241 ? -135.781 70.206 125.787 1.00 38.83  ? 241 ALA A O   1 
ATOM   1834 C CB  . ALA A 1 241 ? -136.223 67.363 124.318 1.00 39.57  ? 241 ALA A CB  1 
ATOM   1835 N N   . ALA A 1 242 ? -137.064 68.864 127.063 1.00 38.19  ? 242 ALA A N   1 
ATOM   1836 C CA  . ALA A 1 242 ? -136.616 69.442 128.320 1.00 40.08  ? 242 ALA A CA  1 
ATOM   1837 C C   . ALA A 1 242 ? -136.283 68.346 129.334 1.00 42.41  ? 242 ALA A C   1 
ATOM   1838 O O   . ALA A 1 242 ? -136.929 67.295 129.358 1.00 34.52  ? 242 ALA A O   1 
ATOM   1839 C CB  . ALA A 1 242 ? -137.672 70.378 128.877 1.00 40.13  ? 242 ALA A CB  1 
ATOM   1840 N N   . HIS A 1 243 ? -135.267 68.587 130.158 1.00 45.44  ? 243 HIS A N   1 
ATOM   1841 C CA  . HIS A 1 243 ? -134.906 67.654 131.220 1.00 46.53  ? 243 HIS A CA  1 
ATOM   1842 C C   . HIS A 1 243 ? -134.918 68.359 132.576 1.00 45.03  ? 243 HIS A C   1 
ATOM   1843 O O   . HIS A 1 243 ? -134.183 69.327 132.787 1.00 48.43  ? 243 HIS A O   1 
ATOM   1844 C CB  . HIS A 1 243 ? -133.534 67.041 130.957 1.00 47.24  ? 243 HIS A CB  1 
ATOM   1845 C CG  . HIS A 1 243 ? -133.163 65.963 131.926 1.00 54.91  ? 243 HIS A CG  1 
ATOM   1846 N ND1 . HIS A 1 243 ? -132.110 66.087 132.806 1.00 59.10  ? 243 HIS A ND1 1 
ATOM   1847 C CD2 . HIS A 1 243 ? -133.708 64.746 132.158 1.00 55.81  ? 243 HIS A CD2 1 
ATOM   1848 C CE1 . HIS A 1 243 ? -132.018 64.986 133.535 1.00 57.28  ? 243 HIS A CE1 1 
ATOM   1849 N NE2 . HIS A 1 243 ? -132.977 64.160 133.162 1.00 57.23  ? 243 HIS A NE2 1 
ATOM   1850 N N   . MET A 1 244 ? -135.760 67.868 133.482 1.00 38.40  ? 244 MET A N   1 
ATOM   1851 C CA  . MET A 1 244 ? -135.926 68.456 134.810 1.00 42.47  ? 244 MET A CA  1 
ATOM   1852 C C   . MET A 1 244 ? -135.133 67.666 135.857 1.00 50.47  ? 244 MET A C   1 
ATOM   1853 O O   . MET A 1 244 ? -135.232 66.437 135.937 1.00 52.66  ? 244 MET A O   1 
ATOM   1854 C CB  . MET A 1 244 ? -137.416 68.511 135.179 1.00 46.29  ? 244 MET A CB  1 
ATOM   1855 C CG  . MET A 1 244 ? -137.747 69.327 136.427 1.00 55.64  ? 244 MET A CG  1 
ATOM   1856 S SD  . MET A 1 244 ? -137.486 71.106 136.238 1.00 107.89 ? 244 MET A SD  1 
ATOM   1857 C CE  . MET A 1 244 ? -137.911 71.699 137.876 1.00 64.68  ? 244 MET A CE  1 
ATOM   1858 N N   . GLN A 1 245 ? -134.338 68.377 136.648 1.00 52.62  ? 245 GLN A N   1 
ATOM   1859 C CA  . GLN A 1 245 ? -133.459 67.750 137.628 1.00 57.48  ? 245 GLN A CA  1 
ATOM   1860 C C   . GLN A 1 245 ? -133.488 68.508 138.947 1.00 60.12  ? 245 GLN A C   1 
ATOM   1861 O O   . GLN A 1 245 ? -133.819 69.691 138.983 1.00 58.48  ? 245 GLN A O   1 
ATOM   1862 C CB  . GLN A 1 245 ? -132.025 67.689 137.097 1.00 63.46  ? 245 GLN A CB  1 
ATOM   1863 C CG  . GLN A 1 245 ? -131.529 66.296 136.765 1.00 72.58  ? 245 GLN A CG  1 
ATOM   1864 C CD  . GLN A 1 245 ? -130.245 66.309 135.954 1.00 79.92  ? 245 GLN A CD  1 
ATOM   1865 O OE1 . GLN A 1 245 ? -129.839 67.347 135.431 1.00 79.83  ? 245 GLN A OE1 1 
ATOM   1866 N NE2 . GLN A 1 245 ? -129.602 65.151 135.842 1.00 84.98  ? 245 GLN A NE2 1 
ATOM   1867 N N   . CYS A 1 246 ? -133.145 67.824 140.033 1.00 64.50  ? 246 CYS A N   1 
ATOM   1868 C CA  . CYS A 1 246 ? -133.067 68.470 141.335 1.00 66.25  ? 246 CYS A CA  1 
ATOM   1869 C C   . CYS A 1 246 ? -131.808 68.048 142.073 1.00 69.26  ? 246 CYS A C   1 
ATOM   1870 O O   . CYS A 1 246 ? -131.590 66.863 142.321 1.00 69.60  ? 246 CYS A O   1 
ATOM   1871 C CB  . CYS A 1 246 ? -134.302 68.151 142.183 1.00 66.20  ? 246 CYS A CB  1 
ATOM   1872 S SG  . CYS A 1 246 ? -134.264 68.824 143.870 1.00 68.00  ? 246 CYS A SG  1 
ATOM   1873 N N   . TRP A 1 247 ? -130.970 69.028 142.389 1.00 71.29  ? 247 TRP A N   1 
ATOM   1874 C CA  . TRP A 1 247 ? -129.872 68.842 143.326 1.00 76.20  ? 247 TRP A CA  1 
ATOM   1875 C C   . TRP A 1 247 ? -130.302 69.460 144.647 1.00 76.76  ? 247 TRP A C   1 
ATOM   1876 O O   . TRP A 1 247 ? -130.933 70.517 144.656 1.00 75.70  ? 247 TRP A O   1 
ATOM   1877 C CB  . TRP A 1 247 ? -128.585 69.494 142.820 1.00 79.90  ? 247 TRP A CB  1 
ATOM   1878 C CG  . TRP A 1 247 ? -127.930 68.772 141.684 1.00 81.45  ? 247 TRP A CG  1 
ATOM   1879 C CD1 . TRP A 1 247 ? -127.122 67.676 141.769 1.00 84.43  ? 247 TRP A CD1 1 
ATOM   1880 C CD2 . TRP A 1 247 ? -128.008 69.106 140.293 1.00 80.37  ? 247 TRP A CD2 1 
ATOM   1881 N NE1 . TRP A 1 247 ? -126.699 67.301 140.517 1.00 83.76  ? 247 TRP A NE1 1 
ATOM   1882 C CE2 . TRP A 1 247 ? -127.229 68.163 139.593 1.00 81.85  ? 247 TRP A CE2 1 
ATOM   1883 C CE3 . TRP A 1 247 ? -128.664 70.108 139.571 1.00 78.77  ? 247 TRP A CE3 1 
ATOM   1884 C CZ2 . TRP A 1 247 ? -127.089 68.193 138.205 1.00 80.13  ? 247 TRP A CZ2 1 
ATOM   1885 C CZ3 . TRP A 1 247 ? -128.523 70.137 138.193 1.00 75.99  ? 247 TRP A CZ3 1 
ATOM   1886 C CH2 . TRP A 1 247 ? -127.742 69.186 137.526 1.00 77.37  ? 247 TRP A CH2 1 
ATOM   1887 N N   . SER A 1 248 ? -129.982 68.815 145.763 1.00 77.79  ? 248 SER A N   1 
ATOM   1888 C CA  . SER A 1 248 ? -130.444 69.334 147.045 1.00 81.61  ? 248 SER A CA  1 
ATOM   1889 C C   . SER A 1 248 ? -129.618 68.871 148.241 1.00 83.94  ? 248 SER A C   1 
ATOM   1890 O O   . SER A 1 248 ? -129.204 67.716 148.322 1.00 83.85  ? 248 SER A O   1 
ATOM   1891 C CB  . SER A 1 248 ? -131.913 68.953 147.260 1.00 82.28  ? 248 SER A CB  1 
ATOM   1892 O OG  . SER A 1 248 ? -132.461 69.657 148.361 1.00 86.20  ? 248 SER A OG  1 
ATOM   1893 N N   . LYS A 1 249 ? -129.385 69.796 149.165 1.00 86.57  ? 249 LYS A N   1 
ATOM   1894 C CA  . LYS A 1 249 ? -128.794 69.472 150.454 1.00 87.57  ? 249 LYS A CA  1 
ATOM   1895 C C   . LYS A 1 249 ? -129.829 68.770 151.323 1.00 86.77  ? 249 LYS A C   1 
ATOM   1896 O O   . LYS A 1 249 ? -129.488 68.025 152.242 1.00 90.65  ? 249 LYS A O   1 
ATOM   1897 C CB  . LYS A 1 249 ? -128.293 70.734 151.159 1.00 88.84  ? 249 LYS A CB  1 
ATOM   1898 C CG  . LYS A 1 249 ? -126.970 71.279 150.647 1.00 89.18  ? 249 LYS A CG  1 
ATOM   1899 C CD  . LYS A 1 249 ? -125.836 70.302 150.906 1.00 93.67  ? 249 LYS A CD  1 
ATOM   1900 C CE  . LYS A 1 249 ? -124.502 71.026 151.010 1.00 99.08  ? 249 LYS A CE  1 
ATOM   1901 N NZ  . LYS A 1 249 ? -123.356 70.084 151.150 1.00 102.73 ? 249 LYS A NZ  1 
ATOM   1902 N N   . SER A 1 250 ? -131.099 69.011 151.013 1.00 83.30  ? 250 SER A N   1 
ATOM   1903 C CA  . SER A 1 250 ? -132.209 68.537 151.834 1.00 85.58  ? 250 SER A CA  1 
ATOM   1904 C C   . SER A 1 250 ? -132.626 67.102 151.504 1.00 85.03  ? 250 SER A C   1 
ATOM   1905 O O   . SER A 1 250 ? -133.683 66.641 151.941 1.00 81.40  ? 250 SER A O   1 
ATOM   1906 C CB  . SER A 1 250 ? -133.410 69.473 151.674 1.00 83.28  ? 250 SER A CB  1 
ATOM   1907 O OG  . SER A 1 250 ? -133.042 70.824 151.894 1.00 85.19  ? 250 SER A OG  1 
ATOM   1908 N N   . MET A 1 251 ? -131.793 66.399 150.740 1.00 85.16  ? 251 MET A N   1 
ATOM   1909 C CA  . MET A 1 251 ? -132.108 65.038 150.314 1.00 84.67  ? 251 MET A CA  1 
ATOM   1910 C C   . MET A 1 251 ? -131.358 64.002 151.149 1.00 86.97  ? 251 MET A C   1 
ATOM   1911 O O   . MET A 1 251 ? -130.152 63.808 150.986 1.00 86.68  ? 251 MET A O   1 
ATOM   1912 C CB  . MET A 1 251 ? -131.779 64.856 148.829 1.00 84.98  ? 251 MET A CB  1 
ATOM   1913 C CG  . MET A 1 251 ? -132.538 63.722 148.151 1.00 82.61  ? 251 MET A CG  1 
ATOM   1914 S SD  . MET A 1 251 ? -132.063 63.506 146.424 1.00 111.76 ? 251 MET A SD  1 
ATOM   1915 C CE  . MET A 1 251 ? -132.141 65.192 145.821 1.00 81.58  ? 251 MET A CE  1 
ATOM   1916 N N   . LYS B 1 16  ? -115.967 37.425 124.511 1.00 112.19 ? 16  LYS B N   1 
ATOM   1917 C CA  . LYS B 1 16  ? -116.530 38.688 124.046 1.00 111.17 ? 16  LYS B CA  1 
ATOM   1918 C C   . LYS B 1 16  ? -117.161 38.549 122.661 1.00 106.26 ? 16  LYS B C   1 
ATOM   1919 O O   . LYS B 1 16  ? -116.530 38.042 121.733 1.00 105.77 ? 16  LYS B O   1 
ATOM   1920 C CB  . LYS B 1 16  ? -115.452 39.774 124.014 1.00 115.31 ? 16  LYS B CB  1 
ATOM   1921 C CG  . LYS B 1 16  ? -114.875 40.123 125.374 1.00 122.55 ? 16  LYS B CG  1 
ATOM   1922 C CD  . LYS B 1 16  ? -113.841 41.235 125.265 1.00 123.37 ? 16  LYS B CD  1 
ATOM   1923 C CE  . LYS B 1 16  ? -113.307 41.633 126.634 1.00 129.30 ? 16  LYS B CE  1 
ATOM   1924 N NZ  . LYS B 1 16  ? -112.277 42.704 126.538 1.00 130.39 ? 16  LYS B NZ  1 
ATOM   1925 N N   . ASP B 1 17  ? -118.409 38.993 122.525 1.00 99.18  ? 17  ASP B N   1 
ATOM   1926 C CA  . ASP B 1 17  ? -119.078 38.988 121.227 1.00 92.08  ? 17  ASP B CA  1 
ATOM   1927 C C   . ASP B 1 17  ? -118.627 40.196 120.417 1.00 88.64  ? 17  ASP B C   1 
ATOM   1928 O O   . ASP B 1 17  ? -119.407 41.105 120.133 1.00 87.30  ? 17  ASP B O   1 
ATOM   1929 C CB  . ASP B 1 17  ? -120.600 38.988 121.389 1.00 89.66  ? 17  ASP B CB  1 
ATOM   1930 C CG  . ASP B 1 17  ? -121.332 38.999 120.057 1.00 83.45  ? 17  ASP B CG  1 
ATOM   1931 O OD1 . ASP B 1 17  ? -120.793 38.449 119.076 1.00 84.02  ? 17  ASP B OD1 1 
ATOM   1932 O OD2 . ASP B 1 17  ? -122.439 39.573 119.987 1.00 78.01  ? 17  ASP B OD2 1 
ATOM   1933 N N   . ALA B 1 18  ? -117.352 40.199 120.054 1.00 88.18  ? 18  ALA B N   1 
ATOM   1934 C CA  . ALA B 1 18  ? -116.779 41.281 119.277 1.00 85.92  ? 18  ALA B CA  1 
ATOM   1935 C C   . ALA B 1 18  ? -115.735 40.727 118.327 1.00 86.81  ? 18  ALA B C   1 
ATOM   1936 O O   . ALA B 1 18  ? -115.049 39.757 118.638 1.00 90.24  ? 18  ALA B O   1 
ATOM   1937 C CB  . ALA B 1 18  ? -116.169 42.327 120.188 1.00 87.56  ? 18  ALA B CB  1 
ATOM   1938 N N   . ILE B 1 19  ? -115.622 41.343 117.160 1.00 84.81  ? 19  ILE B N   1 
ATOM   1939 C CA  . ILE B 1 19  ? -114.612 40.935 116.199 1.00 87.13  ? 19  ILE B CA  1 
ATOM   1940 C C   . ILE B 1 19  ? -113.233 41.407 116.630 1.00 94.46  ? 19  ILE B C   1 
ATOM   1941 O O   . ILE B 1 19  ? -113.017 42.598 116.853 1.00 97.41  ? 19  ILE B O   1 
ATOM   1942 C CB  . ILE B 1 19  ? -114.914 41.480 114.801 1.00 79.57  ? 19  ILE B CB  1 
ATOM   1943 C CG1 . ILE B 1 19  ? -116.216 40.880 114.276 1.00 76.03  ? 19  ILE B CG1 1 
ATOM   1944 C CG2 . ILE B 1 19  ? -113.766 41.174 113.857 1.00 79.57  ? 19  ILE B CG2 1 
ATOM   1945 C CD1 . ILE B 1 19  ? -116.749 41.562 113.045 1.00 73.88  ? 19  ILE B CD1 1 
ATOM   1946 N N   . ASP B 1 20  ? -112.306 40.465 116.751 1.00 98.72  ? 20  ASP B N   1 
ATOM   1947 C CA  . ASP B 1 20  ? -110.930 40.790 117.088 1.00 104.98 ? 20  ASP B CA  1 
ATOM   1948 C C   . ASP B 1 20  ? -110.051 40.708 115.849 1.00 105.54 ? 20  ASP B C   1 
ATOM   1949 O O   . ASP B 1 20  ? -109.154 39.869 115.757 1.00 109.98 ? 20  ASP B O   1 
ATOM   1950 C CB  . ASP B 1 20  ? -110.408 39.860 118.181 1.00 113.17 ? 20  ASP B CB  1 
ATOM   1951 C CG  . ASP B 1 20  ? -110.987 40.187 119.540 1.00 118.11 ? 20  ASP B CG  1 
ATOM   1952 O OD1 . ASP B 1 20  ? -111.478 41.322 119.711 1.00 117.44 ? 20  ASP B OD1 1 
ATOM   1953 O OD2 . ASP B 1 20  ? -110.951 39.320 120.438 1.00 122.70 ? 20  ASP B OD2 1 
ATOM   1954 N N   . ASP B 1 21  ? -110.331 41.584 114.892 1.00 102.18 ? 21  ASP B N   1 
ATOM   1955 C CA  . ASP B 1 21  ? -109.537 41.695 113.677 1.00 103.11 ? 21  ASP B CA  1 
ATOM   1956 C C   . ASP B 1 21  ? -109.237 43.167 113.428 1.00 100.57 ? 21  ASP B C   1 
ATOM   1957 O O   . ASP B 1 21  ? -110.155 43.971 113.260 1.00 97.95  ? 21  ASP B O   1 
ATOM   1958 C CB  . ASP B 1 21  ? -110.279 41.077 112.487 1.00 102.25 ? 21  ASP B CB  1 
ATOM   1959 C CG  . ASP B 1 21  ? -109.415 40.976 111.239 1.00 102.64 ? 21  ASP B CG  1 
ATOM   1960 O OD1 . ASP B 1 21  ? -108.178 40.869 111.369 1.00 105.90 ? 21  ASP B OD1 1 
ATOM   1961 O OD2 . ASP B 1 21  ? -109.979 40.995 110.124 1.00 99.58  ? 21  ASP B OD2 1 
ATOM   1962 N N   . LYS B 1 22  ? -107.954 43.518 113.417 1.00 102.13 ? 22  LYS B N   1 
ATOM   1963 C CA  . LYS B 1 22  ? -107.540 44.911 113.272 1.00 100.68 ? 22  LYS B CA  1 
ATOM   1964 C C   . LYS B 1 22  ? -107.960 45.482 111.920 1.00 94.80  ? 22  LYS B C   1 
ATOM   1965 O O   . LYS B 1 22  ? -108.309 46.658 111.818 1.00 93.07  ? 22  LYS B O   1 
ATOM   1966 C CB  . LYS B 1 22  ? -106.023 45.048 113.452 1.00 105.68 ? 22  LYS B CB  1 
ATOM   1967 C CG  . LYS B 1 22  ? -105.201 44.199 112.493 1.00 108.39 ? 22  LYS B CG  1 
ATOM   1968 C CD  . LYS B 1 22  ? -103.746 44.636 112.449 1.00 113.79 ? 22  LYS B CD  1 
ATOM   1969 C CE  . LYS B 1 22  ? -102.979 43.877 111.367 1.00 116.61 ? 22  LYS B CE  1 
ATOM   1970 N NZ  . LYS B 1 22  ? -101.565 44.325 111.211 1.00 121.40 ? 22  LYS B NZ  1 
ATOM   1971 N N   . THR B 1 23  ? -107.932 44.640 110.891 1.00 91.99  ? 23  THR B N   1 
ATOM   1972 C CA  . THR B 1 23  ? -108.286 45.057 109.539 1.00 87.05  ? 23  THR B CA  1 
ATOM   1973 C C   . THR B 1 23  ? -109.780 45.364 109.428 1.00 82.68  ? 23  THR B C   1 
ATOM   1974 O O   . THR B 1 23  ? -110.179 46.310 108.749 1.00 80.16  ? 23  THR B O   1 
ATOM   1975 C CB  . THR B 1 23  ? -107.897 43.981 108.504 1.00 85.86  ? 23  THR B CB  1 
ATOM   1976 O OG1 . THR B 1 23  ? -106.478 43.791 108.525 1.00 90.62  ? 23  THR B OG1 1 
ATOM   1977 C CG2 . THR B 1 23  ? -108.317 44.397 107.106 1.00 81.62  ? 23  THR B CG2 1 
ATOM   1978 N N   . TRP B 1 24  ? -110.602 44.566 110.102 1.00 81.08  ? 24  TRP B N   1 
ATOM   1979 C CA  . TRP B 1 24  ? -112.046 44.781 110.102 1.00 75.32  ? 24  TRP B CA  1 
ATOM   1980 C C   . TRP B 1 24  ? -112.411 46.136 110.698 1.00 74.01  ? 24  TRP B C   1 
ATOM   1981 O O   . TRP B 1 24  ? -113.277 46.839 110.178 1.00 71.98  ? 24  TRP B O   1 
ATOM   1982 C CB  . TRP B 1 24  ? -112.755 43.668 110.878 1.00 73.54  ? 24  TRP B CB  1 
ATOM   1983 C CG  . TRP B 1 24  ? -114.216 43.943 111.153 1.00 68.57  ? 24  TRP B CG  1 
ATOM   1984 C CD1 . TRP B 1 24  ? -114.752 44.502 112.281 1.00 65.61  ? 24  TRP B CD1 1 
ATOM   1985 C CD2 . TRP B 1 24  ? -115.320 43.667 110.282 1.00 65.40  ? 24  TRP B CD2 1 
ATOM   1986 N NE1 . TRP B 1 24  ? -116.120 44.594 112.161 1.00 62.67  ? 24  TRP B NE1 1 
ATOM   1987 C CE2 . TRP B 1 24  ? -116.494 44.088 110.940 1.00 62.63  ? 24  TRP B CE2 1 
ATOM   1988 C CE3 . TRP B 1 24  ? -115.431 43.105 109.005 1.00 62.38  ? 24  TRP B CE3 1 
ATOM   1989 C CZ2 . TRP B 1 24  ? -117.763 43.956 110.371 1.00 59.40  ? 24  TRP B CZ2 1 
ATOM   1990 C CZ3 . TRP B 1 24  ? -116.691 42.980 108.437 1.00 57.90  ? 24  TRP B CZ3 1 
ATOM   1991 C CH2 . TRP B 1 24  ? -117.839 43.404 109.120 1.00 56.38  ? 24  TRP B CH2 1 
ATOM   1992 N N   . SER B 1 25  ? -111.741 46.498 111.789 1.00 76.96  ? 25  SER B N   1 
ATOM   1993 C CA  . SER B 1 25  ? -112.055 47.727 112.510 1.00 76.63  ? 25  SER B CA  1 
ATOM   1994 C C   . SER B 1 25  ? -111.582 48.975 111.774 1.00 78.02  ? 25  SER B C   1 
ATOM   1995 O O   . SER B 1 25  ? -111.860 50.096 112.201 1.00 78.95  ? 25  SER B O   1 
ATOM   1996 C CB  . SER B 1 25  ? -111.451 47.691 113.913 1.00 79.82  ? 25  SER B CB  1 
ATOM   1997 O OG  . SER B 1 25  ? -112.327 47.049 114.822 1.00 80.34  ? 25  SER B OG  1 
ATOM   1998 N N   . LYS B 1 26  ? -110.869 48.778 110.671 1.00 77.94  ? 26  LYS B N   1 
ATOM   1999 C CA  . LYS B 1 26  ? -110.456 49.888 109.826 1.00 77.58  ? 26  LYS B CA  1 
ATOM   2000 C C   . LYS B 1 26  ? -111.671 50.529 109.164 1.00 72.35  ? 26  LYS B C   1 
ATOM   2001 O O   . LYS B 1 26  ? -111.748 51.752 109.039 1.00 72.28  ? 26  LYS B O   1 
ATOM   2002 C CB  . LYS B 1 26  ? -109.460 49.418 108.763 1.00 83.05  ? 26  LYS B CB  1 
ATOM   2003 C CG  . LYS B 1 26  ? -108.142 48.896 109.321 1.00 90.44  ? 26  LYS B CG  1 
ATOM   2004 C CD  . LYS B 1 26  ? -107.224 48.413 108.207 1.00 95.32  ? 26  LYS B CD  1 
ATOM   2005 C CE  . LYS B 1 26  ? -105.900 47.899 108.753 1.00 100.74 ? 26  LYS B CE  1 
ATOM   2006 N NZ  . LYS B 1 26  ? -105.009 47.409 107.661 1.00 103.45 ? 26  LYS B NZ  1 
ATOM   2007 N N   . LEU B 1 27  ? -112.622 49.694 108.753 1.00 69.30  ? 27  LEU B N   1 
ATOM   2008 C CA  . LEU B 1 27  ? -113.816 50.166 108.057 1.00 65.04  ? 27  LEU B CA  1 
ATOM   2009 C C   . LEU B 1 27  ? -115.098 50.017 108.876 1.00 63.18  ? 27  LEU B C   1 
ATOM   2010 O O   . LEU B 1 27  ? -116.067 50.743 108.658 1.00 63.07  ? 27  LEU B O   1 
ATOM   2011 C CB  . LEU B 1 27  ? -113.982 49.418 106.730 1.00 63.00  ? 27  LEU B CB  1 
ATOM   2012 C CG  . LEU B 1 27  ? -112.988 49.734 105.613 1.00 63.76  ? 27  LEU B CG  1 
ATOM   2013 C CD1 . LEU B 1 27  ? -113.283 48.892 104.379 1.00 62.38  ? 27  LEU B CD1 1 
ATOM   2014 C CD2 . LEU B 1 27  ? -113.030 51.214 105.278 1.00 63.30  ? 27  LEU B CD2 1 
ATOM   2015 N N   . PHE B 1 28  ? -115.101 49.073 109.811 1.00 64.62  ? 28  PHE B N   1 
ATOM   2016 C CA  . PHE B 1 28  ? -116.326 48.698 110.510 1.00 62.83  ? 28  PHE B CA  1 
ATOM   2017 C C   . PHE B 1 28  ? -116.173 48.667 112.027 1.00 64.06  ? 28  PHE B C   1 
ATOM   2018 O O   . PHE B 1 28  ? -115.068 48.499 112.539 1.00 67.65  ? 28  PHE B O   1 
ATOM   2019 C CB  . PHE B 1 28  ? -116.801 47.323 110.034 1.00 58.73  ? 28  PHE B CB  1 
ATOM   2020 C CG  . PHE B 1 28  ? -117.257 47.290 108.604 1.00 53.94  ? 28  PHE B CG  1 
ATOM   2021 C CD1 . PHE B 1 28  ? -118.502 47.791 108.245 1.00 51.53  ? 28  PHE B CD1 1 
ATOM   2022 C CD2 . PHE B 1 28  ? -116.452 46.737 107.620 1.00 53.33  ? 28  PHE B CD2 1 
ATOM   2023 C CE1 . PHE B 1 28  ? -118.931 47.752 106.925 1.00 51.31  ? 28  PHE B CE1 1 
ATOM   2024 C CE2 . PHE B 1 28  ? -116.873 46.693 106.298 1.00 53.56  ? 28  PHE B CE2 1 
ATOM   2025 C CZ  . PHE B 1 28  ? -118.114 47.202 105.951 1.00 52.55  ? 28  PHE B CZ  1 
ATOM   2026 N N   . PRO B 1 29  ? -117.291 48.822 112.753 1.00 61.27  ? 29  PRO B N   1 
ATOM   2027 C CA  . PRO B 1 29  ? -117.270 48.636 114.208 1.00 64.91  ? 29  PRO B CA  1 
ATOM   2028 C C   . PRO B 1 29  ? -117.149 47.156 114.590 1.00 71.35  ? 29  PRO B C   1 
ATOM   2029 O O   . PRO B 1 29  ? -117.771 46.305 113.951 1.00 71.30  ? 29  PRO B O   1 
ATOM   2030 C CB  . PRO B 1 29  ? -118.613 49.223 114.657 1.00 60.17  ? 29  PRO B CB  1 
ATOM   2031 C CG  . PRO B 1 29  ? -119.494 49.137 113.464 1.00 59.16  ? 29  PRO B CG  1 
ATOM   2032 C CD  . PRO B 1 29  ? -118.597 49.308 112.271 1.00 57.69  ? 29  PRO B CD  1 
ATOM   2033 N N   . SER B 1 30  ? -116.351 46.862 115.614 1.00 75.62  ? 30  SER B N   1 
ATOM   2034 C CA  . SER B 1 30  ? -116.127 45.484 116.047 1.00 76.94  ? 30  SER B CA  1 
ATOM   2035 C C   . SER B 1 30  ? -117.346 44.910 116.752 1.00 75.49  ? 30  SER B C   1 
ATOM   2036 O O   . SER B 1 30  ? -117.568 43.700 116.740 1.00 79.48  ? 30  SER B O   1 
ATOM   2037 C CB  . SER B 1 30  ? -114.910 45.396 116.971 1.00 82.97  ? 30  SER B CB  1 
ATOM   2038 O OG  . SER B 1 30  ? -113.714 45.658 116.263 1.00 87.65  ? 30  SER B OG  1 
ATOM   2039 N N   . ILE B 1 31  ? -118.130 45.783 117.372 1.00 72.01  ? 31  ILE B N   1 
ATOM   2040 C CA  . ILE B 1 31  ? -119.328 45.359 118.081 1.00 71.98  ? 31  ILE B CA  1 
ATOM   2041 C C   . ILE B 1 31  ? -120.568 45.848 117.347 1.00 68.38  ? 31  ILE B C   1 
ATOM   2042 O O   . ILE B 1 31  ? -120.596 46.970 116.847 1.00 66.94  ? 31  ILE B O   1 
ATOM   2043 C CB  . ILE B 1 31  ? -119.335 45.880 119.526 1.00 74.69  ? 31  ILE B CB  1 
ATOM   2044 C CG1 . ILE B 1 31  ? -118.007 45.546 120.204 1.00 77.90  ? 31  ILE B CG1 1 
ATOM   2045 C CG2 . ILE B 1 31  ? -120.500 45.287 120.305 1.00 75.84  ? 31  ILE B CG2 1 
ATOM   2046 C CD1 . ILE B 1 31  ? -117.622 46.513 121.299 1.00 79.40  ? 31  ILE B CD1 1 
ATOM   2047 N N   . VAL B 1 32  ? -121.583 44.993 117.267 1.00 67.29  ? 32  VAL B N   1 
ATOM   2048 C CA  . VAL B 1 32  ? -122.812 45.320 116.556 1.00 61.89  ? 32  VAL B CA  1 
ATOM   2049 C C   . VAL B 1 32  ? -124.053 44.827 117.298 1.00 66.54  ? 32  VAL B C   1 
ATOM   2050 O O   . VAL B 1 32  ? -125.128 44.731 116.710 1.00 67.34  ? 32  VAL B O   1 
ATOM   2051 C CB  . VAL B 1 32  ? -122.810 44.714 115.131 1.00 56.36  ? 32  VAL B CB  1 
ATOM   2052 C CG1 . VAL B 1 32  ? -121.737 45.357 114.270 1.00 53.64  ? 32  VAL B CG1 1 
ATOM   2053 C CG2 . VAL B 1 32  ? -122.609 43.205 115.196 1.00 54.46  ? 32  VAL B CG2 1 
ATOM   2054 N N   . SER B 1 33  ? -123.908 44.530 118.588 1.00 67.97  ? 33  SER B N   1 
ATOM   2055 C CA  . SER B 1 33  ? -124.994 43.930 119.365 1.00 70.62  ? 33  SER B CA  1 
ATOM   2056 C C   . SER B 1 33  ? -126.029 44.932 119.882 1.00 71.79  ? 33  SER B C   1 
ATOM   2057 O O   . SER B 1 33  ? -127.224 44.652 119.865 1.00 73.98  ? 33  SER B O   1 
ATOM   2058 C CB  . SER B 1 33  ? -124.416 43.132 120.541 1.00 72.59  ? 33  SER B CB  1 
ATOM   2059 O OG  . SER B 1 33  ? -123.479 43.901 121.266 1.00 75.90  ? 33  SER B OG  1 
ATOM   2060 N N   . ASP B 1 34  ? -125.572 46.090 120.347 1.00 70.34  ? 34  ASP B N   1 
ATOM   2061 C CA  . ASP B 1 34  ? -126.467 47.107 120.900 1.00 72.24  ? 34  ASP B CA  1 
ATOM   2062 C C   . ASP B 1 34  ? -126.899 48.106 119.814 1.00 69.63  ? 34  ASP B C   1 
ATOM   2063 O O   . ASP B 1 34  ? -126.181 48.290 118.832 1.00 68.23  ? 34  ASP B O   1 
ATOM   2064 C CB  . ASP B 1 34  ? -125.781 47.834 122.058 1.00 75.25  ? 34  ASP B CB  1 
ATOM   2065 C CG  . ASP B 1 34  ? -124.559 48.600 121.614 1.00 77.38  ? 34  ASP B CG  1 
ATOM   2066 O OD1 . ASP B 1 34  ? -124.715 49.753 121.156 1.00 76.83  ? 34  ASP B OD1 1 
ATOM   2067 O OD2 . ASP B 1 34  ? -123.444 48.049 121.717 1.00 78.85  ? 34  ASP B OD2 1 
ATOM   2068 N N   . PRO B 1 35  ? -128.067 48.760 119.994 1.00 68.95  ? 35  PRO B N   1 
ATOM   2069 C CA  . PRO B 1 35  ? -128.720 49.556 118.942 1.00 68.04  ? 35  PRO B CA  1 
ATOM   2070 C C   . PRO B 1 35  ? -127.868 50.637 118.268 1.00 67.90  ? 35  PRO B C   1 
ATOM   2071 O O   . PRO B 1 35  ? -128.102 50.927 117.095 1.00 64.74  ? 35  PRO B O   1 
ATOM   2072 C CB  . PRO B 1 35  ? -129.886 50.213 119.687 1.00 67.21  ? 35  PRO B CB  1 
ATOM   2073 C CG  . PRO B 1 35  ? -130.199 49.280 120.778 1.00 68.35  ? 35  PRO B CG  1 
ATOM   2074 C CD  . PRO B 1 35  ? -128.878 48.736 121.226 1.00 70.47  ? 35  PRO B CD  1 
ATOM   2075 N N   . ASP B 1 36  ? -126.914 51.227 118.980 1.00 71.21  ? 36  ASP B N   1 
ATOM   2076 C CA  . ASP B 1 36  ? -126.145 52.331 118.412 1.00 70.99  ? 36  ASP B CA  1 
ATOM   2077 C C   . ASP B 1 36  ? -125.005 51.852 117.516 1.00 64.94  ? 36  ASP B C   1 
ATOM   2078 O O   . ASP B 1 36  ? -124.696 52.490 116.514 1.00 63.73  ? 36  ASP B O   1 
ATOM   2079 C CB  . ASP B 1 36  ? -125.597 53.229 119.524 1.00 79.58  ? 36  ASP B CB  1 
ATOM   2080 C CG  . ASP B 1 36  ? -126.588 54.297 119.950 1.00 87.31  ? 36  ASP B CG  1 
ATOM   2081 O OD1 . ASP B 1 36  ? -127.179 54.940 119.057 1.00 87.96  ? 36  ASP B OD1 1 
ATOM   2082 O OD2 . ASP B 1 36  ? -126.779 54.488 121.170 1.00 91.88  ? 36  ASP B OD2 1 
ATOM   2083 N N   . ARG B 1 37  ? -124.379 50.738 117.884 1.00 64.51  ? 37  ARG B N   1 
ATOM   2084 C CA  . ARG B 1 37  ? -123.345 50.133 117.050 1.00 66.01  ? 37  ARG B CA  1 
ATOM   2085 C C   . ARG B 1 37  ? -123.982 49.430 115.861 1.00 61.25  ? 37  ARG B C   1 
ATOM   2086 O O   . ARG B 1 37  ? -123.408 49.366 114.776 1.00 60.61  ? 37  ARG B O   1 
ATOM   2087 C CB  . ARG B 1 37  ? -122.512 49.128 117.843 1.00 72.11  ? 37  ARG B CB  1 
ATOM   2088 C CG  . ARG B 1 37  ? -122.332 49.451 119.299 1.00 80.21  ? 37  ARG B CG  1 
ATOM   2089 C CD  . ARG B 1 37  ? -121.294 50.513 119.548 1.00 85.04  ? 37  ARG B CD  1 
ATOM   2090 N NE  . ARG B 1 37  ? -121.117 50.771 120.977 1.00 89.83  ? 37  ARG B NE  1 
ATOM   2091 C CZ  . ARG B 1 37  ? -120.150 50.240 121.720 1.00 91.70  ? 37  ARG B CZ  1 
ATOM   2092 N NH1 . ARG B 1 37  ? -119.264 49.419 121.176 1.00 91.65  ? 37  ARG B NH1 1 
ATOM   2093 N NH2 . ARG B 1 37  ? -120.065 50.534 123.010 1.00 94.22  ? 37  ARG B NH2 1 
ATOM   2094 N N   . SER B 1 38  ? -125.175 48.892 116.093 1.00 58.45  ? 38  SER B N   1 
ATOM   2095 C CA  . SER B 1 38  ? -125.930 48.174 115.077 1.00 53.64  ? 38  SER B CA  1 
ATOM   2096 C C   . SER B 1 38  ? -126.312 49.091 113.921 1.00 53.34  ? 38  SER B C   1 
ATOM   2097 O O   . SER B 1 38  ? -126.217 48.710 112.756 1.00 50.11  ? 38  SER B O   1 
ATOM   2098 C CB  . SER B 1 38  ? -127.185 47.555 115.694 1.00 51.02  ? 38  SER B CB  1 
ATOM   2099 O OG  . SER B 1 38  ? -127.971 46.919 114.707 1.00 50.45  ? 38  SER B OG  1 
ATOM   2100 N N   . SER B 1 39  ? -126.743 50.305 114.250 1.00 53.79  ? 39  SER B N   1 
ATOM   2101 C CA  . SER B 1 39  ? -127.113 51.273 113.230 1.00 51.40  ? 39  SER B CA  1 
ATOM   2102 C C   . SER B 1 39  ? -125.852 51.879 112.636 1.00 48.86  ? 39  SER B C   1 
ATOM   2103 O O   . SER B 1 39  ? -125.812 52.219 111.453 1.00 48.53  ? 39  SER B O   1 
ATOM   2104 C CB  . SER B 1 39  ? -128.025 52.355 113.808 1.00 54.84  ? 39  SER B CB  1 
ATOM   2105 O OG  . SER B 1 39  ? -127.535 52.825 115.049 1.00 61.57  ? 39  SER B OG  1 
ATOM   2106 N N   . ASN B 1 40  ? -124.819 51.998 113.464 1.00 47.30  ? 40  ASN B N   1 
ATOM   2107 C CA  . ASN B 1 40  ? -123.511 52.442 112.996 1.00 48.15  ? 40  ASN B CA  1 
ATOM   2108 C C   . ASN B 1 40  ? -122.953 51.520 111.922 1.00 46.39  ? 40  ASN B C   1 
ATOM   2109 O O   . ASN B 1 40  ? -122.408 51.985 110.921 1.00 48.71  ? 40  ASN B O   1 
ATOM   2110 C CB  . ASN B 1 40  ? -122.527 52.532 114.162 1.00 53.64  ? 40  ASN B CB  1 
ATOM   2111 C CG  . ASN B 1 40  ? -122.461 53.924 114.764 1.00 59.03  ? 40  ASN B CG  1 
ATOM   2112 O OD1 . ASN B 1 40  ? -123.217 54.814 114.384 1.00 60.08  ? 40  ASN B OD1 1 
ATOM   2113 N ND2 . ASN B 1 40  ? -121.552 54.116 115.712 1.00 62.12  ? 40  ASN B ND2 1 
ATOM   2114 N N   . PHE B 1 41  ? -123.086 50.213 112.134 1.00 43.42  ? 41  PHE B N   1 
ATOM   2115 C CA  . PHE B 1 41  ? -122.616 49.239 111.158 1.00 42.78  ? 41  PHE B CA  1 
ATOM   2116 C C   . PHE B 1 41  ? -123.360 49.384 109.840 1.00 39.87  ? 41  PHE B C   1 
ATOM   2117 O O   . PHE B 1 41  ? -122.765 49.280 108.768 1.00 48.18  ? 41  PHE B O   1 
ATOM   2118 C CB  . PHE B 1 41  ? -122.776 47.808 111.679 1.00 48.54  ? 41  PHE B CB  1 
ATOM   2119 C CG  . PHE B 1 41  ? -122.543 46.765 110.626 1.00 46.72  ? 41  PHE B CG  1 
ATOM   2120 C CD1 . PHE B 1 41  ? -121.256 46.389 110.282 1.00 46.20  ? 41  PHE B CD1 1 
ATOM   2121 C CD2 . PHE B 1 41  ? -123.608 46.180 109.957 1.00 48.07  ? 41  PHE B CD2 1 
ATOM   2122 C CE1 . PHE B 1 41  ? -121.034 45.439 109.299 1.00 45.12  ? 41  PHE B CE1 1 
ATOM   2123 C CE2 . PHE B 1 41  ? -123.391 45.232 108.972 1.00 46.88  ? 41  PHE B CE2 1 
ATOM   2124 C CZ  . PHE B 1 41  ? -122.102 44.862 108.643 1.00 44.79  ? 41  PHE B CZ  1 
ATOM   2125 N N   . MET B 1 42  ? -124.667 49.603 109.927 1.00 36.31  ? 42  MET B N   1 
ATOM   2126 C CA  . MET B 1 42  ? -125.499 49.770 108.741 1.00 39.41  ? 42  MET B CA  1 
ATOM   2127 C C   . MET B 1 42  ? -125.071 50.997 107.940 1.00 43.48  ? 42  MET B C   1 
ATOM   2128 O O   . MET B 1 42  ? -125.047 50.973 106.712 1.00 44.80  ? 42  MET B O   1 
ATOM   2129 C CB  . MET B 1 42  ? -126.971 49.882 109.134 1.00 39.68  ? 42  MET B CB  1 
ATOM   2130 C CG  . MET B 1 42  ? -127.582 48.573 109.595 1.00 43.55  ? 42  MET B CG  1 
ATOM   2131 S SD  . MET B 1 42  ? -127.345 47.256 108.376 1.00 52.58  ? 42  MET B SD  1 
ATOM   2132 C CE  . MET B 1 42  ? -128.774 46.238 108.711 1.00 44.08  ? 42  MET B CE  1 
ATOM   2133 N N   . ILE B 1 43  ? -124.728 52.067 108.648 1.00 43.53  ? 43  ILE B N   1 
ATOM   2134 C CA  . ILE B 1 43  ? -124.235 53.278 108.014 1.00 43.77  ? 43  ILE B CA  1 
ATOM   2135 C C   . ILE B 1 43  ? -122.938 52.989 107.265 1.00 46.46  ? 43  ILE B C   1 
ATOM   2136 O O   . ILE B 1 43  ? -122.774 53.393 106.112 1.00 45.38  ? 43  ILE B O   1 
ATOM   2137 C CB  . ILE B 1 43  ? -124.028 54.391 109.052 1.00 40.24  ? 43  ILE B CB  1 
ATOM   2138 C CG1 . ILE B 1 43  ? -125.379 54.762 109.671 1.00 45.83  ? 43  ILE B CG1 1 
ATOM   2139 C CG2 . ILE B 1 43  ? -123.377 55.608 108.416 1.00 37.58  ? 43  ILE B CG2 1 
ATOM   2140 C CD1 . ILE B 1 43  ? -125.320 55.838 110.740 1.00 48.91  ? 43  ILE B CD1 1 
ATOM   2141 N N   . ARG B 1 44  ? -122.028 52.271 107.915 1.00 47.65  ? 44  ARG B N   1 
ATOM   2142 C CA  . ARG B 1 44  ? -120.774 51.874 107.286 1.00 47.68  ? 44  ARG B CA  1 
ATOM   2143 C C   . ARG B 1 44  ? -121.006 50.879 106.155 1.00 47.32  ? 44  ARG B C   1 
ATOM   2144 O O   . ARG B 1 44  ? -120.259 50.850 105.180 1.00 48.25  ? 44  ARG B O   1 
ATOM   2145 C CB  . ARG B 1 44  ? -119.829 51.271 108.323 1.00 50.89  ? 44  ARG B CB  1 
ATOM   2146 C CG  . ARG B 1 44  ? -119.490 52.213 109.460 1.00 56.94  ? 44  ARG B CG  1 
ATOM   2147 C CD  . ARG B 1 44  ? -118.837 53.464 108.919 1.00 60.41  ? 44  ARG B CD  1 
ATOM   2148 N NE  . ARG B 1 44  ? -117.724 53.129 108.036 1.00 63.98  ? 44  ARG B NE  1 
ATOM   2149 C CZ  . ARG B 1 44  ? -117.042 54.016 107.323 1.00 64.01  ? 44  ARG B CZ  1 
ATOM   2150 N NH1 . ARG B 1 44  ? -117.358 55.300 107.385 1.00 60.92  ? 44  ARG B NH1 1 
ATOM   2151 N NH2 . ARG B 1 44  ? -116.044 53.618 106.546 1.00 67.64  ? 44  ARG B NH2 1 
ATOM   2152 N N   . ALA B 1 45  ? -122.044 50.062 106.295 1.00 48.49  ? 45  ALA B N   1 
ATOM   2153 C CA  . ALA B 1 45  ? -122.349 49.041 105.298 1.00 47.41  ? 45  ALA B CA  1 
ATOM   2154 C C   . ALA B 1 45  ? -122.879 49.677 104.020 1.00 42.35  ? 45  ALA B C   1 
ATOM   2155 O O   . ALA B 1 45  ? -122.454 49.327 102.918 1.00 41.06  ? 45  ALA B O   1 
ATOM   2156 C CB  . ALA B 1 45  ? -123.355 48.034 105.853 1.00 43.33  ? 45  ALA B CB  1 
ATOM   2157 N N   . ILE B 1 46  ? -123.811 50.611 104.178 1.00 43.95  ? 46  ILE B N   1 
ATOM   2158 C CA  . ILE B 1 46  ? -124.343 51.375 103.055 1.00 44.78  ? 46  ILE B CA  1 
ATOM   2159 C C   . ILE B 1 46  ? -123.213 52.027 102.266 1.00 42.63  ? 46  ILE B C   1 
ATOM   2160 O O   . ILE B 1 46  ? -123.193 51.991 101.034 1.00 46.78  ? 46  ILE B O   1 
ATOM   2161 C CB  . ILE B 1 46  ? -125.328 52.458 103.536 1.00 45.84  ? 46  ILE B CB  1 
ATOM   2162 C CG1 . ILE B 1 46  ? -126.608 51.817 104.072 1.00 43.34  ? 46  ILE B CG1 1 
ATOM   2163 C CG2 . ILE B 1 46  ? -125.664 53.424 102.411 1.00 50.87  ? 46  ILE B CG2 1 
ATOM   2164 C CD1 . ILE B 1 46  ? -127.504 52.780 104.839 1.00 41.49  ? 46  ILE B CD1 1 
ATOM   2165 N N   . TYR B 1 47  ? -122.257 52.599 102.988 1.00 44.09  ? 47  TYR B N   1 
ATOM   2166 C CA  . TYR B 1 47  ? -121.131 53.296 102.374 1.00 46.93  ? 47  TYR B CA  1 
ATOM   2167 C C   . TYR B 1 47  ? -120.206 52.344 101.615 1.00 47.20  ? 47  TYR B C   1 
ATOM   2168 O O   . TYR B 1 47  ? -119.840 52.610 100.470 1.00 47.71  ? 47  TYR B O   1 
ATOM   2169 C CB  . TYR B 1 47  ? -120.347 54.064 103.446 1.00 41.71  ? 47  TYR B CB  1 
ATOM   2170 C CG  . TYR B 1 47  ? -118.993 54.581 103.000 1.00 45.84  ? 47  TYR B CG  1 
ATOM   2171 C CD1 . TYR B 1 47  ? -118.887 55.723 102.218 1.00 44.89  ? 47  TYR B CD1 1 
ATOM   2172 C CD2 . TYR B 1 47  ? -117.820 53.938 103.381 1.00 51.91  ? 47  TYR B CD2 1 
ATOM   2173 C CE1 . TYR B 1 47  ? -117.652 56.202 101.815 1.00 46.21  ? 47  TYR B CE1 1 
ATOM   2174 C CE2 . TYR B 1 47  ? -116.580 54.409 102.982 1.00 52.03  ? 47  TYR B CE2 1 
ATOM   2175 C CZ  . TYR B 1 47  ? -116.503 55.540 102.201 1.00 49.53  ? 47  TYR B CZ  1 
ATOM   2176 O OH  . TYR B 1 47  ? -115.268 56.004 101.808 1.00 52.68  ? 47  TYR B OH  1 
ATOM   2177 N N   . VAL B 1 48  ? -119.836 51.235 102.250 1.00 48.40  ? 48  VAL B N   1 
ATOM   2178 C CA  . VAL B 1 48  ? -118.907 50.277 101.651 1.00 46.80  ? 48  VAL B CA  1 
ATOM   2179 C C   . VAL B 1 48  ? -119.533 49.513 100.488 1.00 44.50  ? 48  VAL B C   1 
ATOM   2180 O O   . VAL B 1 48  ? -118.887 49.296 99.460  1.00 46.42  ? 48  VAL B O   1 
ATOM   2181 C CB  . VAL B 1 48  ? -118.395 49.269 102.693 1.00 43.58  ? 48  VAL B CB  1 
ATOM   2182 C CG1 . VAL B 1 48  ? -117.602 48.150 102.022 1.00 43.45  ? 48  VAL B CG1 1 
ATOM   2183 C CG2 . VAL B 1 48  ? -117.543 49.978 103.731 1.00 42.52  ? 48  VAL B CG2 1 
ATOM   2184 N N   . VAL B 1 49  ? -120.787 49.108 100.644 1.00 43.74  ? 49  VAL B N   1 
ATOM   2185 C CA  . VAL B 1 49  ? -121.428 48.315 99.605  1.00 47.46  ? 49  VAL B CA  1 
ATOM   2186 C C   . VAL B 1 49  ? -121.677 49.140 98.347  1.00 49.39  ? 49  VAL B C   1 
ATOM   2187 O O   . VAL B 1 49  ? -121.296 48.731 97.256  1.00 50.68  ? 49  VAL B O   1 
ATOM   2188 C CB  . VAL B 1 49  ? -122.755 47.692 100.097 1.00 49.53  ? 49  VAL B CB  1 
ATOM   2189 C CG1 . VAL B 1 49  ? -123.489 47.038 98.939  1.00 50.36  ? 49  VAL B CG1 1 
ATOM   2190 C CG2 . VAL B 1 49  ? -122.476 46.659 101.181 1.00 49.08  ? 49  VAL B CG2 1 
ATOM   2191 N N   . PHE B 1 50  ? -122.281 50.313 98.494  1.00 52.02  ? 50  PHE B N   1 
ATOM   2192 C CA  . PHE B 1 50  ? -122.626 51.112 97.320  1.00 50.85  ? 50  PHE B CA  1 
ATOM   2193 C C   . PHE B 1 50  ? -121.399 51.712 96.640  1.00 50.67  ? 50  PHE B C   1 
ATOM   2194 O O   . PHE B 1 50  ? -121.410 51.937 95.431  1.00 53.49  ? 50  PHE B O   1 
ATOM   2195 C CB  . PHE B 1 50  ? -123.647 52.188 97.696  1.00 47.61  ? 50  PHE B CB  1 
ATOM   2196 C CG  . PHE B 1 50  ? -125.054 51.667 97.734  1.00 47.71  ? 50  PHE B CG  1 
ATOM   2197 C CD1 . PHE B 1 50  ? -125.746 51.429 96.555  1.00 48.40  ? 50  PHE B CD1 1 
ATOM   2198 C CD2 . PHE B 1 50  ? -125.672 51.375 98.937  1.00 47.64  ? 50  PHE B CD2 1 
ATOM   2199 C CE1 . PHE B 1 50  ? -127.039 50.934 96.575  1.00 48.62  ? 50  PHE B CE1 1 
ATOM   2200 C CE2 . PHE B 1 50  ? -126.965 50.880 98.964  1.00 49.64  ? 50  PHE B CE2 1 
ATOM   2201 C CZ  . PHE B 1 50  ? -127.649 50.660 97.780  1.00 49.65  ? 50  PHE B CZ  1 
ATOM   2202 N N   . SER B 1 51  ? -120.338 51.938 97.407  1.00 48.95  ? 51  SER B N   1 
ATOM   2203 C CA  . SER B 1 51  ? -119.041 52.274 96.825  1.00 48.44  ? 51  SER B CA  1 
ATOM   2204 C C   . SER B 1 51  ? -118.581 51.182 95.868  1.00 44.81  ? 51  SER B C   1 
ATOM   2205 O O   . SER B 1 51  ? -118.236 51.456 94.717  1.00 47.17  ? 51  SER B O   1 
ATOM   2206 C CB  . SER B 1 51  ? -117.986 52.479 97.915  1.00 52.80  ? 51  SER B CB  1 
ATOM   2207 O OG  . SER B 1 51  ? -118.062 53.776 98.476  1.00 53.29  ? 51  SER B OG  1 
ATOM   2208 N N   . ALA B 1 52  ? -118.576 49.942 96.353  1.00 48.82  ? 52  ALA B N   1 
ATOM   2209 C CA  . ALA B 1 52  ? -118.158 48.798 95.547  1.00 46.15  ? 52  ALA B CA  1 
ATOM   2210 C C   . ALA B 1 52  ? -118.987 48.702 94.273  1.00 46.30  ? 52  ALA B C   1 
ATOM   2211 O O   . ALA B 1 52  ? -118.438 48.527 93.188  1.00 51.58  ? 52  ALA B O   1 
ATOM   2212 C CB  . ALA B 1 52  ? -118.265 47.502 96.352  1.00 47.39  ? 52  ALA B CB  1 
ATOM   2213 N N   . VAL B 1 53  ? -120.304 48.832 94.407  1.00 45.47  ? 53  VAL B N   1 
ATOM   2214 C CA  . VAL B 1 53  ? -121.197 48.787 93.252  1.00 48.96  ? 53  VAL B CA  1 
ATOM   2215 C C   . VAL B 1 53  ? -120.879 49.900 92.251  1.00 54.33  ? 53  VAL B C   1 
ATOM   2216 O O   . VAL B 1 53  ? -120.848 49.662 91.041  1.00 60.53  ? 53  VAL B O   1 
ATOM   2217 C CB  . VAL B 1 53  ? -122.674 48.894 93.676  1.00 47.93  ? 53  VAL B CB  1 
ATOM   2218 C CG1 . VAL B 1 53  ? -123.573 48.862 92.458  1.00 51.90  ? 53  VAL B CG1 1 
ATOM   2219 C CG2 . VAL B 1 53  ? -123.031 47.766 94.625  1.00 46.29  ? 53  VAL B CG2 1 
ATOM   2220 N N   . LEU B 1 54  ? -120.630 51.108 92.751  1.00 49.69  ? 54  LEU B N   1 
ATOM   2221 C CA  . LEU B 1 54  ? -120.270 52.229 91.883  1.00 51.91  ? 54  LEU B CA  1 
ATOM   2222 C C   . LEU B 1 54  ? -118.986 51.965 91.098  1.00 51.87  ? 54  LEU B C   1 
ATOM   2223 O O   . LEU B 1 54  ? -118.909 52.249 89.901  1.00 49.94  ? 54  LEU B O   1 
ATOM   2224 C CB  . LEU B 1 54  ? -120.115 53.515 92.698  1.00 54.64  ? 54  LEU B CB  1 
ATOM   2225 C CG  . LEU B 1 54  ? -121.402 54.220 93.130  1.00 55.76  ? 54  LEU B CG  1 
ATOM   2226 C CD1 . LEU B 1 54  ? -121.101 55.303 94.151  1.00 56.69  ? 54  LEU B CD1 1 
ATOM   2227 C CD2 . LEU B 1 54  ? -122.121 54.801 91.920  1.00 53.14  ? 54  LEU B CD2 1 
ATOM   2228 N N   . ARG B 1 55  ? -117.978 51.422 91.770  1.00 54.54  ? 55  ARG B N   1 
ATOM   2229 C CA  . ARG B 1 55  ? -116.691 51.193 91.124  1.00 62.59  ? 55  ARG B CA  1 
ATOM   2230 C C   . ARG B 1 55  ? -116.736 49.966 90.213  1.00 63.39  ? 55  ARG B C   1 
ATOM   2231 O O   . ARG B 1 55  ? -116.143 49.963 89.134  1.00 64.00  ? 55  ARG B O   1 
ATOM   2232 C CB  . ARG B 1 55  ? -115.587 51.032 92.172  1.00 65.70  ? 55  ARG B CB  1 
ATOM   2233 C CG  . ARG B 1 55  ? -114.199 50.832 91.581  1.00 70.18  ? 55  ARG B CG  1 
ATOM   2234 C CD  . ARG B 1 55  ? -113.764 52.039 90.755  1.00 76.39  ? 55  ARG B CD  1 
ATOM   2235 N NE  . ARG B 1 55  ? -112.975 51.634 89.596  1.00 89.15  ? 55  ARG B NE  1 
ATOM   2236 C CZ  . ARG B 1 55  ? -113.441 51.598 88.352  1.00 95.52  ? 55  ARG B CZ  1 
ATOM   2237 N NH1 . ARG B 1 55  ? -114.691 51.961 88.100  1.00 96.82  ? 55  ARG B NH1 1 
ATOM   2238 N NH2 . ARG B 1 55  ? -112.656 51.208 87.357  1.00 100.81 ? 55  ARG B NH2 1 
ATOM   2239 N N   . GLN B 1 56  ? -117.457 48.935 90.642  1.00 64.77  ? 56  GLN B N   1 
ATOM   2240 C CA  . GLN B 1 56  ? -117.457 47.654 89.940  1.00 64.72  ? 56  GLN B CA  1 
ATOM   2241 C C   . GLN B 1 56  ? -118.315 47.688 88.676  1.00 62.71  ? 56  GLN B C   1 
ATOM   2242 O O   . GLN B 1 56  ? -118.034 46.979 87.711  1.00 69.31  ? 56  GLN B O   1 
ATOM   2243 C CB  . GLN B 1 56  ? -117.933 46.540 90.875  1.00 62.70  ? 56  GLN B CB  1 
ATOM   2244 C CG  . GLN B 1 56  ? -116.985 45.356 90.958  1.00 70.49  ? 56  GLN B CG  1 
ATOM   2245 C CD  . GLN B 1 56  ? -115.604 45.731 91.468  1.00 75.49  ? 56  GLN B CD  1 
ATOM   2246 O OE1 . GLN B 1 56  ? -115.460 46.573 92.354  1.00 80.42  ? 56  GLN B OE1 1 
ATOM   2247 N NE2 . GLN B 1 56  ? -114.580 45.102 90.906  1.00 78.99  ? 56  GLN B NE2 1 
ATOM   2248 N N   . ARG B 1 57  ? -119.355 48.514 88.674  1.00 59.72  ? 57  ARG B N   1 
ATOM   2249 C CA  . ARG B 1 57  ? -120.143 48.717 87.463  1.00 60.47  ? 57  ARG B CA  1 
ATOM   2250 C C   . ARG B 1 57  ? -119.528 49.826 86.620  1.00 67.20  ? 57  ARG B C   1 
ATOM   2251 O O   . ARG B 1 57  ? -120.066 50.197 85.571  1.00 71.23  ? 57  ARG B O   1 
ATOM   2252 C CB  . ARG B 1 57  ? -121.597 49.046 87.802  1.00 58.07  ? 57  ARG B CB  1 
ATOM   2253 C CG  . ARG B 1 57  ? -122.356 47.867 88.369  1.00 55.13  ? 57  ARG B CG  1 
ATOM   2254 C CD  . ARG B 1 57  ? -122.194 46.658 87.462  1.00 55.14  ? 57  ARG B CD  1 
ATOM   2255 N NE  . ARG B 1 57  ? -123.142 46.661 86.353  1.00 54.10  ? 57  ARG B NE  1 
ATOM   2256 C CZ  . ARG B 1 57  ? -122.867 46.207 85.135  1.00 59.18  ? 57  ARG B CZ  1 
ATOM   2257 N NH1 . ARG B 1 57  ? -121.662 45.727 84.857  1.00 56.07  ? 57  ARG B NH1 1 
ATOM   2258 N NH2 . ARG B 1 57  ? -123.796 46.243 84.190  1.00 65.50  ? 57  ARG B NH2 1 
ATOM   2259 N N   . ASN B 1 58  ? -118.393 50.338 87.089  1.00 67.12  ? 58  ASN B N   1 
ATOM   2260 C CA  . ASN B 1 58  ? -117.663 51.396 86.405  1.00 74.72  ? 58  ASN B CA  1 
ATOM   2261 C C   . ASN B 1 58  ? -118.552 52.613 86.176  1.00 71.27  ? 58  ASN B C   1 
ATOM   2262 O O   . ASN B 1 58  ? -118.498 53.250 85.127  1.00 73.80  ? 58  ASN B O   1 
ATOM   2263 C CB  . ASN B 1 58  ? -117.088 50.882 85.078  1.00 81.78  ? 58  ASN B CB  1 
ATOM   2264 C CG  . ASN B 1 58  ? -115.966 51.753 84.553  1.00 88.82  ? 58  ASN B CG  1 
ATOM   2265 O OD1 . ASN B 1 58  ? -114.821 51.640 84.992  1.00 91.79  ? 58  ASN B OD1 1 
ATOM   2266 N ND2 . ASN B 1 58  ? -116.286 52.623 83.603  1.00 93.44  ? 58  ASN B ND2 1 
ATOM   2267 N N   . ILE B 1 59  ? -119.387 52.913 87.165  1.00 68.59  ? 59  ILE B N   1 
ATOM   2268 C CA  . ILE B 1 59  ? -120.249 54.085 87.111  1.00 67.79  ? 59  ILE B CA  1 
ATOM   2269 C C   . ILE B 1 59  ? -119.409 55.323 87.407  1.00 69.33  ? 59  ILE B C   1 
ATOM   2270 O O   . ILE B 1 59  ? -119.638 56.393 86.847  1.00 65.83  ? 59  ILE B O   1 
ATOM   2271 C CB  . ILE B 1 59  ? -121.426 53.957 88.098  1.00 60.37  ? 59  ILE B CB  1 
ATOM   2272 C CG1 . ILE B 1 59  ? -122.380 52.855 87.630  1.00 58.40  ? 59  ILE B CG1 1 
ATOM   2273 C CG2 . ILE B 1 59  ? -122.176 55.273 88.232  1.00 64.69  ? 59  ILE B CG2 1 
ATOM   2274 C CD1 . ILE B 1 59  ? -123.456 52.493 88.638  1.00 55.94  ? 59  ILE B CD1 1 
ATOM   2275 N N   . LEU B 1 60  ? -118.413 55.151 88.269  1.00 71.07  ? 60  LEU B N   1 
ATOM   2276 C CA  . LEU B 1 60  ? -117.426 56.189 88.535  1.00 72.86  ? 60  LEU B CA  1 
ATOM   2277 C C   . LEU B 1 60  ? -116.012 55.680 88.282  1.00 75.15  ? 60  LEU B C   1 
ATOM   2278 O O   . LEU B 1 60  ? -115.730 54.496 88.456  1.00 76.53  ? 60  LEU B O   1 
ATOM   2279 C CB  . LEU B 1 60  ? -117.544 56.688 89.972  1.00 70.05  ? 60  LEU B CB  1 
ATOM   2280 C CG  . LEU B 1 60  ? -118.586 57.758 90.274  1.00 66.24  ? 60  LEU B CG  1 
ATOM   2281 C CD1 . LEU B 1 60  ? -118.741 57.901 91.776  1.00 60.44  ? 60  LEU B CD1 1 
ATOM   2282 C CD2 . LEU B 1 60  ? -118.181 59.080 89.638  1.00 67.44  ? 60  LEU B CD2 1 
ATOM   2283 N N   . GLU B 1 61  ? -115.128 56.590 87.885  1.00 79.82  ? 61  GLU B N   1 
ATOM   2284 C CA  . GLU B 1 61  ? -113.739 56.258 87.582  1.00 81.93  ? 61  GLU B CA  1 
ATOM   2285 C C   . GLU B 1 61  ? -112.943 55.854 88.818  1.00 76.92  ? 61  GLU B C   1 
ATOM   2286 O O   . GLU B 1 61  ? -113.313 56.171 89.946  1.00 74.60  ? 61  GLU B O   1 
ATOM   2287 C CB  . GLU B 1 61  ? -113.039 57.442 86.902  1.00 87.36  ? 61  GLU B CB  1 
ATOM   2288 C CG  . GLU B 1 61  ? -113.428 57.667 85.451  1.00 94.60  ? 61  GLU B CG  1 
ATOM   2289 C CD  . GLU B 1 61  ? -114.690 58.491 85.299  1.00 104.33 ? 61  GLU B CD  1 
ATOM   2290 O OE1 . GLU B 1 61  ? -114.658 59.703 85.614  1.00 113.28 ? 61  GLU B OE1 1 
ATOM   2291 O OE2 . GLU B 1 61  ? -115.709 57.927 84.854  1.00 102.60 ? 61  GLU B OE2 1 
ATOM   2292 N N   . LYS B 1 62  ? -111.834 55.166 88.577  1.00 79.37  ? 62  LYS B N   1 
ATOM   2293 C CA  . LYS B 1 62  ? -110.928 54.687 89.615  1.00 81.75  ? 62  LYS B CA  1 
ATOM   2294 C C   . LYS B 1 62  ? -110.330 55.810 90.477  1.00 81.87  ? 62  LYS B C   1 
ATOM   2295 O O   . LYS B 1 62  ? -109.984 55.590 91.638  1.00 79.03  ? 62  LYS B O   1 
ATOM   2296 C CB  . LYS B 1 62  ? -109.825 53.851 88.944  1.00 91.23  ? 62  LYS B CB  1 
ATOM   2297 C CG  . LYS B 1 62  ? -108.534 53.655 89.723  1.00 96.56  ? 62  LYS B CG  1 
ATOM   2298 C CD  . LYS B 1 62  ? -107.672 52.591 89.041  1.00 100.38 ? 62  LYS B CD  1 
ATOM   2299 C CE  . LYS B 1 62  ? -106.187 52.792 89.308  1.00 104.46 ? 62  LYS B CE  1 
ATOM   2300 N NZ  . LYS B 1 62  ? -105.647 53.959 88.559  1.00 108.96 ? 62  LYS B NZ  1 
ATOM   2301 N N   . GLU B 1 63  ? -110.233 57.014 89.919  1.00 87.36  ? 63  GLU B N   1 
ATOM   2302 C CA  . GLU B 1 63  ? -109.651 58.151 90.641  1.00 90.79  ? 63  GLU B CA  1 
ATOM   2303 C C   . GLU B 1 63  ? -110.530 58.639 91.800  1.00 82.68  ? 63  GLU B C   1 
ATOM   2304 O O   . GLU B 1 63  ? -110.042 59.290 92.727  1.00 79.75  ? 63  GLU B O   1 
ATOM   2305 C CB  . GLU B 1 63  ? -109.376 59.317 89.680  1.00 100.97 ? 63  GLU B CB  1 
ATOM   2306 C CG  . GLU B 1 63  ? -108.182 59.113 88.749  1.00 110.36 ? 63  GLU B CG  1 
ATOM   2307 C CD  . GLU B 1 63  ? -108.469 58.130 87.630  1.00 114.50 ? 63  GLU B CD  1 
ATOM   2308 O OE1 . GLU B 1 63  ? -109.561 58.212 87.030  1.00 113.79 ? 63  GLU B OE1 1 
ATOM   2309 O OE2 . GLU B 1 63  ? -107.604 57.272 87.353  1.00 118.63 ? 63  GLU B OE2 1 
ATOM   2310 N N   . TYR B 1 64  ? -111.820 58.320 91.743  1.00 77.85  ? 64  TYR B N   1 
ATOM   2311 C CA  . TYR B 1 64  ? -112.765 58.729 92.780  1.00 71.92  ? 64  TYR B CA  1 
ATOM   2312 C C   . TYR B 1 64  ? -112.741 57.837 94.015  1.00 68.06  ? 64  TYR B C   1 
ATOM   2313 O O   . TYR B 1 64  ? -113.328 58.180 95.038  1.00 66.87  ? 64  TYR B O   1 
ATOM   2314 C CB  . TYR B 1 64  ? -114.186 58.761 92.216  1.00 67.42  ? 64  TYR B CB  1 
ATOM   2315 C CG  . TYR B 1 64  ? -114.375 59.810 91.155  1.00 69.75  ? 64  TYR B CG  1 
ATOM   2316 C CD1 . TYR B 1 64  ? -114.627 61.132 91.500  1.00 68.57  ? 64  TYR B CD1 1 
ATOM   2317 C CD2 . TYR B 1 64  ? -114.288 59.485 89.809  1.00 70.80  ? 64  TYR B CD2 1 
ATOM   2318 C CE1 . TYR B 1 64  ? -114.795 62.102 90.531  1.00 70.18  ? 64  TYR B CE1 1 
ATOM   2319 C CE2 . TYR B 1 64  ? -114.455 60.450 88.831  1.00 74.91  ? 64  TYR B CE2 1 
ATOM   2320 C CZ  . TYR B 1 64  ? -114.708 61.758 89.199  1.00 74.69  ? 64  TYR B CZ  1 
ATOM   2321 O OH  . TYR B 1 64  ? -114.876 62.725 88.233  1.00 76.84  ? 64  TYR B OH  1 
ATOM   2322 N N   . PHE B 1 65  ? -112.070 56.694 93.926  1.00 69.91  ? 65  PHE B N   1 
ATOM   2323 C CA  . PHE B 1 65  ? -112.108 55.728 95.019  1.00 68.02  ? 65  PHE B CA  1 
ATOM   2324 C C   . PHE B 1 65  ? -110.745 55.491 95.650  1.00 73.71  ? 65  PHE B C   1 
ATOM   2325 O O   . PHE B 1 65  ? -109.712 55.866 95.094  1.00 79.11  ? 65  PHE B O   1 
ATOM   2326 C CB  . PHE B 1 65  ? -112.674 54.389 94.538  1.00 62.23  ? 65  PHE B CB  1 
ATOM   2327 C CG  . PHE B 1 65  ? -114.047 54.485 93.935  1.00 54.38  ? 65  PHE B CG  1 
ATOM   2328 C CD1 . PHE B 1 65  ? -114.214 54.930 92.632  1.00 52.08  ? 65  PHE B CD1 1 
ATOM   2329 C CD2 . PHE B 1 65  ? -115.168 54.111 94.659  1.00 49.71  ? 65  PHE B CD2 1 
ATOM   2330 C CE1 . PHE B 1 65  ? -115.472 55.014 92.064  1.00 48.67  ? 65  PHE B CE1 1 
ATOM   2331 C CE2 . PHE B 1 65  ? -116.435 54.190 94.093  1.00 49.16  ? 65  PHE B CE2 1 
ATOM   2332 C CZ  . PHE B 1 65  ? -116.585 54.644 92.791  1.00 42.34  ? 65  PHE B CZ  1 
ATOM   2333 N N   . SER B 1 66  ? -110.761 54.859 96.818  1.00 73.61  ? 66  SER B N   1 
ATOM   2334 C CA  . SER B 1 66  ? -109.543 54.482 97.519  1.00 80.12  ? 66  SER B CA  1 
ATOM   2335 C C   . SER B 1 66  ? -109.608 53.006 97.898  1.00 80.73  ? 66  SER B C   1 
ATOM   2336 O O   . SER B 1 66  ? -110.656 52.505 98.307  1.00 76.95  ? 66  SER B O   1 
ATOM   2337 C CB  . SER B 1 66  ? -109.345 55.346 98.764  1.00 82.02  ? 66  SER B CB  1 
ATOM   2338 O OG  . SER B 1 66  ? -108.111 55.053 99.398  1.00 86.86  ? 66  SER B OG  1 
ATOM   2339 N N   . LYS B 1 67  ? -108.487 52.308 97.758  1.00 85.13  ? 67  LYS B N   1 
ATOM   2340 C CA  . LYS B 1 67  ? -108.451 50.877 98.027  1.00 84.79  ? 67  LYS B CA  1 
ATOM   2341 C C   . LYS B 1 67  ? -108.382 50.583 99.520  1.00 84.99  ? 67  LYS B C   1 
ATOM   2342 O O   . LYS B 1 67  ? -107.567 51.157 100.240 1.00 85.66  ? 67  LYS B O   1 
ATOM   2343 C CB  . LYS B 1 67  ? -107.266 50.232 97.306  1.00 88.37  ? 67  LYS B CB  1 
ATOM   2344 C CG  . LYS B 1 67  ? -107.114 48.739 97.558  1.00 90.04  ? 67  LYS B CG  1 
ATOM   2345 C CD  . LYS B 1 67  ? -106.166 48.123 96.544  1.00 94.94  ? 67  LYS B CD  1 
ATOM   2346 C CE  . LYS B 1 67  ? -105.778 46.707 96.924  1.00 95.35  ? 67  LYS B CE  1 
ATOM   2347 N NZ  . LYS B 1 67  ? -104.906 46.100 95.882  1.00 98.54  ? 67  LYS B NZ  1 
ATOM   2348 N N   . ASN B 1 68  ? -109.248 49.680 99.971  1.00 85.30  ? 68  ASN B N   1 
ATOM   2349 C CA  . ASN B 1 68  ? -109.287 49.269 101.370 1.00 86.60  ? 68  ASN B CA  1 
ATOM   2350 C C   . ASN B 1 68  ? -109.475 47.768 101.522 1.00 84.25  ? 68  ASN B C   1 
ATOM   2351 O O   . ASN B 1 68  ? -109.859 47.081 100.576 1.00 83.98  ? 68  ASN B O   1 
ATOM   2352 C CB  . ASN B 1 68  ? -110.404 50.002 102.112 1.00 86.65  ? 68  ASN B CB  1 
ATOM   2353 C CG  . ASN B 1 68  ? -109.991 51.384 102.564 1.00 90.18  ? 68  ASN B CG  1 
ATOM   2354 O OD1 . ASN B 1 68  ? -109.593 51.577 103.712 1.00 93.47  ? 68  ASN B OD1 1 
ATOM   2355 N ND2 . ASN B 1 68  ? -110.078 52.355 101.662 1.00 89.50  ? 68  ASN B ND2 1 
ATOM   2356 N N   . TYR B 1 69  ? -109.208 47.266 102.724 1.00 84.36  ? 69  TYR B N   1 
ATOM   2357 C CA  . TYR B 1 69  ? -109.377 45.848 103.021 1.00 83.52  ? 69  TYR B CA  1 
ATOM   2358 C C   . TYR B 1 69  ? -110.471 45.614 104.060 1.00 80.65  ? 69  TYR B C   1 
ATOM   2359 O O   . TYR B 1 69  ? -110.447 46.197 105.146 1.00 81.61  ? 69  TYR B O   1 
ATOM   2360 C CB  . TYR B 1 69  ? -108.063 45.242 103.518 1.00 86.33  ? 69  TYR B CB  1 
ATOM   2361 C CG  . TYR B 1 69  ? -106.998 45.064 102.455 1.00 89.17  ? 69  TYR B CG  1 
ATOM   2362 C CD1 . TYR B 1 69  ? -106.110 46.089 102.152 1.00 92.06  ? 69  TYR B CD1 1 
ATOM   2363 C CD2 . TYR B 1 69  ? -106.869 43.863 101.769 1.00 89.55  ? 69  TYR B CD2 1 
ATOM   2364 C CE1 . TYR B 1 69  ? -105.130 45.924 101.187 1.00 94.87  ? 69  TYR B CE1 1 
ATOM   2365 C CE2 . TYR B 1 69  ? -105.893 43.689 100.805 1.00 91.41  ? 69  TYR B CE2 1 
ATOM   2366 C CZ  . TYR B 1 69  ? -105.027 44.722 100.517 1.00 94.03  ? 69  TYR B CZ  1 
ATOM   2367 O OH  . TYR B 1 69  ? -104.055 44.551 99.557  1.00 96.65  ? 69  TYR B OH  1 
ATOM   2368 N N   . ILE B 1 70  ? -111.433 44.767 103.709 1.00 77.18  ? 70  ILE B N   1 
ATOM   2369 C CA  . ILE B 1 70  ? -112.407 44.258 104.665 1.00 73.81  ? 70  ILE B CA  1 
ATOM   2370 C C   . ILE B 1 70  ? -111.750 43.154 105.481 1.00 76.15  ? 70  ILE B C   1 
ATOM   2371 O O   . ILE B 1 70  ? -111.832 43.129 106.709 1.00 76.66  ? 70  ILE B O   1 
ATOM   2372 C CB  . ILE B 1 70  ? -113.658 43.711 103.966 1.00 70.18  ? 70  ILE B CB  1 
ATOM   2373 C CG1 . ILE B 1 70  ? -114.204 44.745 102.985 1.00 70.04  ? 70  ILE B CG1 1 
ATOM   2374 C CG2 . ILE B 1 70  ? -114.713 43.314 104.989 1.00 65.95  ? 70  ILE B CG2 1 
ATOM   2375 C CD1 . ILE B 1 70  ? -115.160 44.164 101.987 1.00 71.21  ? 70  ILE B CD1 1 
ATOM   2376 N N   . THR B 1 71  ? -111.103 42.233 104.775 1.00 77.80  ? 71  THR B N   1 
ATOM   2377 C CA  . THR B 1 71  ? -110.252 41.227 105.395 1.00 81.75  ? 71  THR B CA  1 
ATOM   2378 C C   . THR B 1 71  ? -108.910 41.220 104.679 1.00 88.72  ? 71  THR B C   1 
ATOM   2379 O O   . THR B 1 71  ? -108.668 42.038 103.790 1.00 89.46  ? 71  THR B O   1 
ATOM   2380 C CB  . THR B 1 71  ? -110.868 39.816 105.342 1.00 78.10  ? 71  THR B CB  1 
ATOM   2381 O OG1 . THR B 1 71  ? -110.826 39.321 103.998 1.00 74.86  ? 71  THR B OG1 1 
ATOM   2382 C CG2 . THR B 1 71  ? -112.307 39.840 105.829 1.00 74.65  ? 71  THR B CG2 1 
ATOM   2383 N N   . GLU B 1 72  ? -108.038 40.299 105.066 1.00 92.72  ? 72  GLU B N   1 
ATOM   2384 C CA  . GLU B 1 72  ? -106.735 40.192 104.431 1.00 98.15  ? 72  GLU B CA  1 
ATOM   2385 C C   . GLU B 1 72  ? -106.863 39.691 102.996 1.00 97.67  ? 72  GLU B C   1 
ATOM   2386 O O   . GLU B 1 72  ? -106.139 40.140 102.111 1.00 97.67  ? 72  GLU B O   1 
ATOM   2387 C CB  . GLU B 1 72  ? -105.822 39.272 105.240 1.00 105.28 ? 72  GLU B CB  1 
ATOM   2388 C CG  . GLU B 1 72  ? -105.473 39.810 106.619 1.00 109.90 ? 72  GLU B CG  1 
ATOM   2389 C CD  . GLU B 1 72  ? -104.568 38.876 107.395 1.00 117.25 ? 72  GLU B CD  1 
ATOM   2390 O OE1 . GLU B 1 72  ? -104.393 37.717 106.958 1.00 120.55 ? 72  GLU B OE1 1 
ATOM   2391 O OE2 . GLU B 1 72  ? -104.032 39.298 108.442 1.00 119.71 ? 72  GLU B OE2 1 
ATOM   2392 N N   . ASN B 1 73  ? -107.792 38.769 102.764 1.00 97.94  ? 73  ASN B N   1 
ATOM   2393 C CA  . ASN B 1 73  ? -107.982 38.208 101.429 1.00 97.75  ? 73  ASN B CA  1 
ATOM   2394 C C   . ASN B 1 73  ? -108.799 39.112 100.512 1.00 94.44  ? 73  ASN B C   1 
ATOM   2395 O O   . ASN B 1 73  ? -108.714 39.008 99.287  1.00 98.71  ? 73  ASN B O   1 
ATOM   2396 C CB  . ASN B 1 73  ? -108.663 36.839 101.514 1.00 96.45  ? 73  ASN B CB  1 
ATOM   2397 C CG  . ASN B 1 73  ? -107.850 35.826 102.293 1.00 99.08  ? 73  ASN B CG  1 
ATOM   2398 O OD1 . ASN B 1 73  ? -108.398 35.012 103.037 1.00 97.48  ? 73  ASN B OD1 1 
ATOM   2399 N ND2 . ASN B 1 73  ? -106.534 35.871 102.127 1.00 101.48 ? 73  ASN B ND2 1 
ATOM   2400 N N   . LEU B 1 74  ? -109.586 40.001 101.109 1.00 84.00  ? 74  LEU B N   1 
ATOM   2401 C CA  . LEU B 1 74  ? -110.625 40.712 100.373 1.00 74.46  ? 74  LEU B CA  1 
ATOM   2402 C C   . LEU B 1 74  ? -110.421 42.226 100.369 1.00 77.11  ? 74  LEU B C   1 
ATOM   2403 O O   . LEU B 1 74  ? -110.376 42.860 101.423 1.00 78.41  ? 74  LEU B O   1 
ATOM   2404 C CB  . LEU B 1 74  ? -111.992 40.362 100.966 1.00 65.90  ? 74  LEU B CB  1 
ATOM   2405 C CG  . LEU B 1 74  ? -113.258 40.824 100.253 1.00 59.17  ? 74  LEU B CG  1 
ATOM   2406 C CD1 . LEU B 1 74  ? -113.282 40.310 98.827  1.00 54.79  ? 74  LEU B CD1 1 
ATOM   2407 C CD2 . LEU B 1 74  ? -114.479 40.342 101.016 1.00 56.94  ? 74  LEU B CD2 1 
ATOM   2408 N N   . SER B 1 75  ? -110.304 42.799 99.173  1.00 77.17  ? 75  SER B N   1 
ATOM   2409 C CA  . SER B 1 75  ? -110.134 44.240 99.024  1.00 76.19  ? 75  SER B CA  1 
ATOM   2410 C C   . SER B 1 75  ? -111.355 44.868 98.361  1.00 75.98  ? 75  SER B C   1 
ATOM   2411 O O   . SER B 1 75  ? -112.134 44.181 97.704  1.00 76.23  ? 75  SER B O   1 
ATOM   2412 C CB  . SER B 1 75  ? -108.878 44.560 98.210  1.00 77.91  ? 75  SER B CB  1 
ATOM   2413 O OG  . SER B 1 75  ? -109.106 44.401 96.821  1.00 77.85  ? 75  SER B OG  1 
ATOM   2414 N N   . CYS B 1 76  ? -111.518 46.176 98.536  1.00 74.60  ? 76  CYS B N   1 
ATOM   2415 C CA  . CYS B 1 76  ? -112.651 46.892 97.957  1.00 71.31  ? 76  CYS B CA  1 
ATOM   2416 C C   . CYS B 1 76  ? -112.323 48.369 97.757  1.00 71.48  ? 76  CYS B C   1 
ATOM   2417 O O   . CYS B 1 76  ? -111.359 48.882 98.327  1.00 72.20  ? 76  CYS B O   1 
ATOM   2418 C CB  . CYS B 1 76  ? -113.893 46.739 98.842  1.00 68.39  ? 76  CYS B CB  1 
ATOM   2419 S SG  . CYS B 1 76  ? -113.769 47.540 100.459 1.00 81.51  ? 76  CYS B SG  1 
ATOM   2420 N N   . MET B 1 77  ? -113.128 49.048 96.944  1.00 69.34  ? 77  MET B N   1 
ATOM   2421 C CA  . MET B 1 77  ? -112.890 50.456 96.642  1.00 70.53  ? 77  MET B CA  1 
ATOM   2422 C C   . MET B 1 77  ? -113.958 51.352 97.266  1.00 65.56  ? 77  MET B C   1 
ATOM   2423 O O   . MET B 1 77  ? -115.132 51.290 96.901  1.00 63.18  ? 77  MET B O   1 
ATOM   2424 C CB  . MET B 1 77  ? -112.829 50.677 95.127  1.00 71.90  ? 77  MET B CB  1 
ATOM   2425 C CG  . MET B 1 77  ? -111.712 49.908 94.428  1.00 74.32  ? 77  MET B CG  1 
ATOM   2426 S SD  . MET B 1 77  ? -110.057 50.555 94.760  1.00 81.26  ? 77  MET B SD  1 
ATOM   2427 C CE  . MET B 1 77  ? -109.995 51.945 93.629  1.00 67.14  ? 77  MET B CE  1 
ATOM   2428 N N   . THR B 1 78  ? -113.539 52.184 98.212  1.00 63.87  ? 78  THR B N   1 
ATOM   2429 C CA  . THR B 1 78  ? -114.445 53.116 98.873  1.00 60.77  ? 78  THR B CA  1 
ATOM   2430 C C   . THR B 1 78  ? -114.242 54.538 98.349  1.00 59.63  ? 78  THR B C   1 
ATOM   2431 O O   . THR B 1 78  ? -113.125 54.922 98.003  1.00 59.36  ? 78  THR B O   1 
ATOM   2432 C CB  . THR B 1 78  ? -114.246 53.094 100.397 1.00 59.45  ? 78  THR B CB  1 
ATOM   2433 O OG1 . THR B 1 78  ? -112.845 53.141 100.694 1.00 62.95  ? 78  THR B OG1 1 
ATOM   2434 C CG2 . THR B 1 78  ? -114.823 51.820 100.986 1.00 54.20  ? 78  THR B CG2 1 
ATOM   2435 N N   . LEU B 1 79  ? -115.327 55.307 98.286  1.00 58.07  ? 79  LEU B N   1 
ATOM   2436 C CA  . LEU B 1 79  ? -115.269 56.687 97.813  1.00 61.32  ? 79  LEU B CA  1 
ATOM   2437 C C   . LEU B 1 79  ? -114.304 57.501 98.668  1.00 65.37  ? 79  LEU B C   1 
ATOM   2438 O O   . LEU B 1 79  ? -114.269 57.349 99.890  1.00 66.47  ? 79  LEU B O   1 
ATOM   2439 C CB  . LEU B 1 79  ? -116.662 57.324 97.829  1.00 59.90  ? 79  LEU B CB  1 
ATOM   2440 C CG  . LEU B 1 79  ? -117.723 56.710 96.912  1.00 56.97  ? 79  LEU B CG  1 
ATOM   2441 C CD1 . LEU B 1 79  ? -119.119 57.057 97.399  1.00 55.13  ? 79  LEU B CD1 1 
ATOM   2442 C CD2 . LEU B 1 79  ? -117.536 57.182 95.483  1.00 57.99  ? 79  LEU B CD2 1 
ATOM   2443 N N   . SER B 1 80  ? -113.514 58.354 98.024  1.00 67.43  ? 80  SER B N   1 
ATOM   2444 C CA  . SER B 1 80  ? -112.514 59.145 98.730  1.00 74.70  ? 80  SER B CA  1 
ATOM   2445 C C   . SER B 1 80  ? -113.039 60.537 99.064  1.00 76.29  ? 80  SER B C   1 
ATOM   2446 O O   . SER B 1 80  ? -113.733 61.162 98.261  1.00 76.28  ? 80  SER B O   1 
ATOM   2447 C CB  . SER B 1 80  ? -111.234 59.259 97.903  1.00 81.13  ? 80  SER B CB  1 
ATOM   2448 O OG  . SER B 1 80  ? -111.382 60.221 96.874  1.00 85.90  ? 80  SER B OG  1 
ATOM   2449 N N   . PHE B 1 81  ? -112.695 61.017 100.254 1.00 75.10  ? 81  PHE B N   1 
ATOM   2450 C CA  . PHE B 1 81  ? -113.153 62.318 100.721 1.00 74.99  ? 81  PHE B CA  1 
ATOM   2451 C C   . PHE B 1 81  ? -112.167 63.414 100.339 1.00 77.49  ? 81  PHE B C   1 
ATOM   2452 O O   . PHE B 1 81  ? -112.290 64.553 100.784 1.00 83.64  ? 81  PHE B O   1 
ATOM   2453 C CB  . PHE B 1 81  ? -113.364 62.291 102.237 1.00 73.25  ? 81  PHE B CB  1 
ATOM   2454 C CG  . PHE B 1 81  ? -114.501 61.408 102.675 1.00 68.06  ? 81  PHE B CG  1 
ATOM   2455 C CD1 . PHE B 1 81  ? -114.385 60.026 102.634 1.00 67.51  ? 81  PHE B CD1 1 
ATOM   2456 C CD2 . PHE B 1 81  ? -115.686 61.961 103.128 1.00 66.59  ? 81  PHE B CD2 1 
ATOM   2457 C CE1 . PHE B 1 81  ? -115.434 59.211 103.033 1.00 61.17  ? 81  PHE B CE1 1 
ATOM   2458 C CE2 . PHE B 1 81  ? -116.738 61.153 103.531 1.00 63.26  ? 81  PHE B CE2 1 
ATOM   2459 C CZ  . PHE B 1 81  ? -116.611 59.777 103.483 1.00 60.48  ? 81  PHE B CZ  1 
ATOM   2460 N N   . LYS B 1 82  ? -111.184 63.057 99.518  1.00 79.44  ? 82  LYS B N   1 
ATOM   2461 C CA  . LYS B 1 82  ? -110.242 64.025 98.965  1.00 83.41  ? 82  LYS B CA  1 
ATOM   2462 C C   . LYS B 1 82  ? -110.827 64.655 97.708  1.00 82.58  ? 82  LYS B C   1 
ATOM   2463 O O   . LYS B 1 82  ? -110.538 65.806 97.375  1.00 84.81  ? 82  LYS B O   1 
ATOM   2464 C CB  . LYS B 1 82  ? -108.904 63.364 98.637  1.00 88.46  ? 82  LYS B CB  1 
ATOM   2465 C CG  . LYS B 1 82  ? -108.120 62.871 99.842  1.00 94.02  ? 82  LYS B CG  1 
ATOM   2466 C CD  . LYS B 1 82  ? -106.861 62.142 99.395  1.00 102.01 ? 82  LYS B CD  1 
ATOM   2467 C CE  . LYS B 1 82  ? -106.034 61.669 100.580 1.00 105.97 ? 82  LYS B CE  1 
ATOM   2468 N NZ  . LYS B 1 82  ? -104.815 60.930 100.139 1.00 110.04 ? 82  LYS B NZ  1 
ATOM   2469 N N   . ASN B 1 83  ? -111.649 63.881 97.010  1.00 77.85  ? 83  ASN B N   1 
ATOM   2470 C CA  . ASN B 1 83  ? -112.307 64.340 95.796  1.00 73.61  ? 83  ASN B CA  1 
ATOM   2471 C C   . ASN B 1 83  ? -113.696 64.889 96.113  1.00 69.19  ? 83  ASN B C   1 
ATOM   2472 O O   . ASN B 1 83  ? -114.526 64.189 96.697  1.00 63.86  ? 83  ASN B O   1 
ATOM   2473 C CB  . ASN B 1 83  ? -112.402 63.194 94.793  1.00 70.45  ? 83  ASN B CB  1 
ATOM   2474 C CG  . ASN B 1 83  ? -112.878 63.644 93.431  1.00 71.18  ? 83  ASN B CG  1 
ATOM   2475 O OD1 . ASN B 1 83  ? -114.078 63.737 93.180  1.00 67.84  ? 83  ASN B OD1 1 
ATOM   2476 N ND2 . ASN B 1 83  ? -111.936 63.924 92.539  1.00 75.46  ? 83  ASN B ND2 1 
ATOM   2477 N N   . LEU B 1 84  ? -113.945 66.137 95.731  1.00 68.98  ? 84  LEU B N   1 
ATOM   2478 C CA  . LEU B 1 84  ? -115.193 66.825 96.075  1.00 69.08  ? 84  LEU B CA  1 
ATOM   2479 C C   . LEU B 1 84  ? -116.416 66.114 95.506  1.00 67.89  ? 84  LEU B C   1 
ATOM   2480 O O   . LEU B 1 84  ? -117.432 65.963 96.188  1.00 66.88  ? 84  LEU B O   1 
ATOM   2481 C CB  . LEU B 1 84  ? -115.164 68.277 95.584  1.00 58.83  ? 84  LEU B CB  1 
ATOM   2482 C CG  . LEU B 1 84  ? -114.576 69.325 96.535  1.00 60.71  ? 84  LEU B CG  1 
ATOM   2483 C CD1 . LEU B 1 84  ? -114.573 70.710 95.895  1.00 64.84  ? 84  LEU B CD1 1 
ATOM   2484 C CD2 . LEU B 1 84  ? -115.343 69.342 97.853  1.00 57.28  ? 84  LEU B CD2 1 
ATOM   2485 N N   . ARG B 1 85  ? -116.305 65.682 94.254  1.00 68.87  ? 85  ARG B N   1 
ATOM   2486 C CA  . ARG B 1 85  ? -117.367 64.955 93.570  1.00 70.20  ? 85  ARG B CA  1 
ATOM   2487 C C   . ARG B 1 85  ? -117.694 63.646 94.290  1.00 65.66  ? 85  ARG B C   1 
ATOM   2488 O O   . ARG B 1 85  ? -118.863 63.317 94.500  1.00 63.46  ? 85  ARG B O   1 
ATOM   2489 C CB  . ARG B 1 85  ? -116.953 64.693 92.117  1.00 80.43  ? 85  ARG B CB  1 
ATOM   2490 C CG  . ARG B 1 85  ? -117.946 63.903 91.284  1.00 87.17  ? 85  ARG B CG  1 
ATOM   2491 C CD  . ARG B 1 85  ? -119.301 64.585 91.205  1.00 95.07  ? 85  ARG B CD  1 
ATOM   2492 N NE  . ARG B 1 85  ? -120.146 63.972 90.184  1.00 103.68 ? 85  ARG B NE  1 
ATOM   2493 C CZ  . ARG B 1 85  ? -121.469 64.087 90.136  1.00 107.10 ? 85  ARG B CZ  1 
ATOM   2494 N NH1 . ARG B 1 85  ? -122.111 64.792 91.057  1.00 105.84 ? 85  ARG B NH1 1 
ATOM   2495 N NH2 . ARG B 1 85  ? -122.151 63.492 89.167  1.00 109.57 ? 85  ARG B NH2 1 
ATOM   2496 N N   . ALA B 1 86  ? -116.659 62.908 94.679  1.00 63.02  ? 86  ALA B N   1 
ATOM   2497 C CA  . ALA B 1 86  ? -116.858 61.651 95.399  1.00 54.89  ? 86  ALA B CA  1 
ATOM   2498 C C   . ALA B 1 86  ? -117.287 61.900 96.843  1.00 55.50  ? 86  ALA B C   1 
ATOM   2499 O O   . ALA B 1 86  ? -118.067 61.130 97.399  1.00 52.47  ? 86  ALA B O   1 
ATOM   2500 C CB  . ALA B 1 86  ? -115.593 60.801 95.365  1.00 47.15  ? 86  ALA B CB  1 
ATOM   2501 N N   . HIS B 1 87  ? -116.769 62.970 97.445  1.00 59.25  ? 87  HIS B N   1 
ATOM   2502 C CA  . HIS B 1 87  ? -117.120 63.334 98.814  1.00 55.69  ? 87  HIS B CA  1 
ATOM   2503 C C   . HIS B 1 87  ? -118.624 63.583 98.902  1.00 52.69  ? 87  HIS B C   1 
ATOM   2504 O O   . HIS B 1 87  ? -119.284 63.140 99.843  1.00 49.32  ? 87  HIS B O   1 
ATOM   2505 C CB  . HIS B 1 87  ? -116.326 64.568 99.255  1.00 60.15  ? 87  HIS B CB  1 
ATOM   2506 C CG  . HIS B 1 87  ? -116.453 64.899 100.713 1.00 64.69  ? 87  HIS B CG  1 
ATOM   2507 N ND1 . HIS B 1 87  ? -115.604 65.780 101.350 1.00 69.25  ? 87  HIS B ND1 1 
ATOM   2508 C CD2 . HIS B 1 87  ? -117.330 64.478 101.656 1.00 62.76  ? 87  HIS B CD2 1 
ATOM   2509 C CE1 . HIS B 1 87  ? -115.950 65.885 102.621 1.00 66.75  ? 87  HIS B CE1 1 
ATOM   2510 N NE2 . HIS B 1 87  ? -116.995 65.105 102.833 1.00 63.17  ? 87  HIS B NE2 1 
ATOM   2511 N N   . GLN B 1 88  ? -119.158 64.271 97.898  1.00 53.54  ? 88  GLN B N   1 
ATOM   2512 C CA  . GLN B 1 88  ? -120.582 64.590 97.834  1.00 53.18  ? 88  GLN B CA  1 
ATOM   2513 C C   . GLN B 1 88  ? -121.453 63.342 97.794  1.00 49.75  ? 88  GLN B C   1 
ATOM   2514 O O   . GLN B 1 88  ? -122.480 63.266 98.461  1.00 51.81  ? 88  GLN B O   1 
ATOM   2515 C CB  . GLN B 1 88  ? -120.865 65.458 96.609  1.00 56.88  ? 88  GLN B CB  1 
ATOM   2516 C CG  . GLN B 1 88  ? -122.302 65.948 96.489  1.00 58.40  ? 88  GLN B CG  1 
ATOM   2517 C CD  . GLN B 1 88  ? -122.418 67.180 95.606  1.00 67.78  ? 88  GLN B CD  1 
ATOM   2518 O OE1 . GLN B 1 88  ? -121.702 67.322 94.609  1.00 73.22  ? 88  GLN B OE1 1 
ATOM   2519 N NE2 . GLN B 1 88  ? -123.314 68.086 95.977  1.00 66.43  ? 88  GLN B NE2 1 
ATOM   2520 N N   . ILE B 1 89  ? -121.041 62.360 97.004  1.00 55.21  ? 89  ILE B N   1 
ATOM   2521 C CA  . ILE B 1 89  ? -121.809 61.130 96.876  1.00 52.45  ? 89  ILE B CA  1 
ATOM   2522 C C   . ILE B 1 89  ? -121.808 60.352 98.188  1.00 51.49  ? 89  ILE B C   1 
ATOM   2523 O O   . ILE B 1 89  ? -122.828 59.787 98.581  1.00 53.97  ? 89  ILE B O   1 
ATOM   2524 C CB  . ILE B 1 89  ? -121.269 60.266 95.721  1.00 53.95  ? 89  ILE B CB  1 
ATOM   2525 C CG1 . ILE B 1 89  ? -121.481 61.015 94.404  1.00 57.56  ? 89  ILE B CG1 1 
ATOM   2526 C CG2 . ILE B 1 89  ? -121.961 58.903 95.685  1.00 47.39  ? 89  ILE B CG2 1 
ATOM   2527 C CD1 . ILE B 1 89  ? -120.878 60.347 93.205  1.00 62.84  ? 89  ILE B CD1 1 
ATOM   2528 N N   . ALA B 1 90  ? -120.672 60.351 98.877  1.00 49.89  ? 90  ALA B N   1 
ATOM   2529 C CA  . ALA B 1 90  ? -120.571 59.708 100.180 1.00 44.96  ? 90  ALA B CA  1 
ATOM   2530 C C   . ALA B 1 90  ? -121.503 60.366 101.197 1.00 46.40  ? 90  ALA B C   1 
ATOM   2531 O O   . ALA B 1 90  ? -122.017 59.698 102.094 1.00 43.68  ? 90  ALA B O   1 
ATOM   2532 C CB  . ALA B 1 90  ? -119.133 59.745 100.673 1.00 46.87  ? 90  ALA B CB  1 
ATOM   2533 N N   . GLN B 1 91  ? -121.713 61.674 101.053 1.00 47.70  ? 91  GLN B N   1 
ATOM   2534 C CA  . GLN B 1 91  ? -122.590 62.430 101.948 1.00 44.83  ? 91  GLN B CA  1 
ATOM   2535 C C   . GLN B 1 91  ? -124.042 62.014 101.780 1.00 41.22  ? 91  GLN B C   1 
ATOM   2536 O O   . GLN B 1 91  ? -124.797 61.975 102.746 1.00 47.41  ? 91  GLN B O   1 
ATOM   2537 C CB  . GLN B 1 91  ? -122.453 63.935 101.697 1.00 51.93  ? 91  GLN B CB  1 
ATOM   2538 C CG  . GLN B 1 91  ? -121.081 64.504 102.005 1.00 60.36  ? 91  GLN B CG  1 
ATOM   2539 C CD  . GLN B 1 91  ? -120.991 65.107 103.388 1.00 65.98  ? 91  GLN B CD  1 
ATOM   2540 O OE1 . GLN B 1 91  ? -120.576 64.446 104.339 1.00 68.79  ? 91  GLN B OE1 1 
ATOM   2541 N NE2 . GLN B 1 91  ? -121.374 66.374 103.507 1.00 62.82  ? 91  GLN B NE2 1 
ATOM   2542 N N   . LEU B 1 92  ? -124.429 61.726 100.543 1.00 39.91  ? 92  LEU B N   1 
ATOM   2543 C CA  . LEU B 1 92  ? -125.754 61.192 100.262 1.00 46.00  ? 92  LEU B CA  1 
ATOM   2544 C C   . LEU B 1 92  ? -125.946 59.864 100.984 1.00 45.17  ? 92  LEU B C   1 
ATOM   2545 O O   . LEU B 1 92  ? -127.014 59.582 101.527 1.00 43.50  ? 92  LEU B O   1 
ATOM   2546 C CB  . LEU B 1 92  ? -125.955 61.004 98.756  1.00 50.27  ? 92  LEU B CB  1 
ATOM   2547 C CG  . LEU B 1 92  ? -126.094 62.270 97.911  1.00 57.90  ? 92  LEU B CG  1 
ATOM   2548 C CD1 . LEU B 1 92  ? -125.959 61.946 96.430  1.00 58.49  ? 92  LEU B CD1 1 
ATOM   2549 C CD2 . LEU B 1 92  ? -127.429 62.934 98.193  1.00 59.41  ? 92  LEU B CD2 1 
ATOM   2550 N N   . LEU B 1 93  ? -124.894 59.054 100.992 1.00 45.12  ? 93  LEU B N   1 
ATOM   2551 C CA  . LEU B 1 93  ? -124.948 57.740 101.616 1.00 46.53  ? 93  LEU B CA  1 
ATOM   2552 C C   . LEU B 1 93  ? -124.938 57.861 103.134 1.00 46.52  ? 93  LEU B C   1 
ATOM   2553 O O   . LEU B 1 93  ? -125.600 57.091 103.832 1.00 46.09  ? 93  LEU B O   1 
ATOM   2554 C CB  . LEU B 1 93  ? -123.778 56.876 101.147 1.00 41.48  ? 93  LEU B CB  1 
ATOM   2555 C CG  . LEU B 1 93  ? -123.688 56.616 99.641  1.00 45.90  ? 93  LEU B CG  1 
ATOM   2556 C CD1 . LEU B 1 93  ? -122.441 55.804 99.315  1.00 46.59  ? 93  LEU B CD1 1 
ATOM   2557 C CD2 . LEU B 1 93  ? -124.940 55.918 99.130  1.00 47.97  ? 93  LEU B CD2 1 
ATOM   2558 N N   . ARG B 1 94  ? -124.181 58.832 103.635 1.00 47.63  ? 94  ARG B N   1 
ATOM   2559 C CA  . ARG B 1 94  ? -124.107 59.086 105.068 1.00 49.40  ? 94  ARG B CA  1 
ATOM   2560 C C   . ARG B 1 94  ? -125.463 59.530 105.612 1.00 49.51  ? 94  ARG B C   1 
ATOM   2561 O O   . ARG B 1 94  ? -125.911 59.053 106.655 1.00 53.31  ? 94  ARG B O   1 
ATOM   2562 C CB  . ARG B 1 94  ? -123.043 60.144 105.372 1.00 51.77  ? 94  ARG B CB  1 
ATOM   2563 C CG  . ARG B 1 94  ? -122.984 60.560 106.833 1.00 52.12  ? 94  ARG B CG  1 
ATOM   2564 C CD  . ARG B 1 94  ? -122.668 59.373 107.734 1.00 58.01  ? 94  ARG B CD  1 
ATOM   2565 N NE  . ARG B 1 94  ? -122.872 59.701 109.140 1.00 60.87  ? 94  ARG B NE  1 
ATOM   2566 C CZ  . ARG B 1 94  ? -121.945 60.241 109.922 1.00 65.38  ? 94  ARG B CZ  1 
ATOM   2567 N NH1 . ARG B 1 94  ? -120.739 60.509 109.438 1.00 66.35  ? 94  ARG B NH1 1 
ATOM   2568 N NH2 . ARG B 1 94  ? -122.222 60.512 111.190 1.00 67.39  ? 94  ARG B NH2 1 
ATOM   2569 N N   . ALA B 1 95  ? -126.116 60.438 104.895 1.00 48.85  ? 95  ALA B N   1 
ATOM   2570 C CA  . ALA B 1 95  ? -127.405 60.964 105.329 1.00 48.66  ? 95  ALA B CA  1 
ATOM   2571 C C   . ALA B 1 95  ? -128.471 59.872 105.312 1.00 46.56  ? 95  ALA B C   1 
ATOM   2572 O O   . ALA B 1 95  ? -129.296 59.785 106.221 1.00 41.70  ? 95  ALA B O   1 
ATOM   2573 C CB  . ALA B 1 95  ? -127.826 62.135 104.454 1.00 48.48  ? 95  ALA B CB  1 
ATOM   2574 N N   . ALA B 1 96  ? -128.450 59.041 104.275 1.00 47.51  ? 96  ALA B N   1 
ATOM   2575 C CA  . ALA B 1 96  ? -129.366 57.910 104.197 1.00 46.18  ? 96  ALA B CA  1 
ATOM   2576 C C   . ALA B 1 96  ? -129.123 56.962 105.366 1.00 45.02  ? 96  ALA B C   1 
ATOM   2577 O O   . ALA B 1 96  ? -130.066 56.448 105.971 1.00 45.28  ? 96  ALA B O   1 
ATOM   2578 C CB  . ALA B 1 96  ? -129.207 57.183 102.875 1.00 46.77  ? 96  ALA B CB  1 
ATOM   2579 N N   . GLY B 1 97  ? -127.852 56.743 105.686 1.00 45.11  ? 97  GLY B N   1 
ATOM   2580 C CA  . GLY B 1 97  ? -127.488 55.921 106.825 1.00 46.46  ? 97  GLY B CA  1 
ATOM   2581 C C   . GLY B 1 97  ? -127.995 56.502 108.131 1.00 49.10  ? 97  GLY B C   1 
ATOM   2582 O O   . GLY B 1 97  ? -128.439 55.767 109.015 1.00 48.94  ? 97  GLY B O   1 
ATOM   2583 N N   . ASP B 1 98  ? -127.932 57.825 108.251 1.00 48.42  ? 98  ASP B N   1 
ATOM   2584 C CA  . ASP B 1 98  ? -128.395 58.510 109.452 1.00 44.20  ? 98  ASP B CA  1 
ATOM   2585 C C   . ASP B 1 98  ? -129.887 58.280 109.672 1.00 44.81  ? 98  ASP B C   1 
ATOM   2586 O O   . ASP B 1 98  ? -130.350 58.205 110.807 1.00 48.62  ? 98  ASP B O   1 
ATOM   2587 C CB  . ASP B 1 98  ? -128.098 60.009 109.369 1.00 47.98  ? 98  ASP B CB  1 
ATOM   2588 C CG  . ASP B 1 98  ? -126.627 60.324 109.566 1.00 56.08  ? 98  ASP B CG  1 
ATOM   2589 O OD1 . ASP B 1 98  ? -125.864 59.400 109.922 1.00 54.85  ? 98  ASP B OD1 1 
ATOM   2590 O OD2 . ASP B 1 98  ? -126.236 61.498 109.382 1.00 66.66  ? 98  ASP B OD2 1 
ATOM   2591 N N   . ALA B 1 99  ? -130.637 58.159 108.583 1.00 45.14  ? 99  ALA B N   1 
ATOM   2592 C CA  . ALA B 1 99  ? -132.070 57.902 108.678 1.00 48.16  ? 99  ALA B CA  1 
ATOM   2593 C C   . ALA B 1 99  ? -132.368 56.512 109.254 1.00 52.50  ? 99  ALA B C   1 
ATOM   2594 O O   . ALA B 1 99  ? -133.390 56.316 109.916 1.00 55.39  ? 99  ALA B O   1 
ATOM   2595 C CB  . ALA B 1 99  ? -132.723 58.060 107.313 1.00 43.21  ? 99  ALA B CB  1 
ATOM   2596 N N   . THR B 1 100 ? -131.484 55.546 109.012 1.00 52.97  ? 100 THR B N   1 
ATOM   2597 C CA  . THR B 1 100 ? -131.698 54.206 109.561 1.00 57.44  ? 100 THR B CA  1 
ATOM   2598 C C   . THR B 1 100 ? -131.549 54.237 111.074 1.00 59.73  ? 100 THR B C   1 
ATOM   2599 O O   . THR B 1 100 ? -132.224 53.501 111.791 1.00 64.26  ? 100 THR B O   1 
ATOM   2600 C CB  . THR B 1 100 ? -130.724 53.147 108.978 1.00 53.93  ? 100 THR B CB  1 
ATOM   2601 O OG1 . THR B 1 100 ? -129.445 53.258 109.611 1.00 56.38  ? 100 THR B OG1 1 
ATOM   2602 C CG2 . THR B 1 100 ? -130.576 53.303 107.474 1.00 47.91  ? 100 THR B CG2 1 
ATOM   2603 N N   . LYS B 1 101 ? -130.654 55.092 111.550 1.00 58.67  ? 101 LYS B N   1 
ATOM   2604 C CA  . LYS B 1 101 ? -130.460 55.271 112.978 1.00 60.36  ? 101 LYS B CA  1 
ATOM   2605 C C   . LYS B 1 101 ? -131.722 55.844 113.608 1.00 63.74  ? 101 LYS B C   1 
ATOM   2606 O O   . LYS B 1 101 ? -132.056 55.531 114.750 1.00 67.31  ? 101 LYS B O   1 
ATOM   2607 C CB  . LYS B 1 101 ? -129.269 56.189 113.240 1.00 60.88  ? 101 LYS B CB  1 
ATOM   2608 C CG  . LYS B 1 101 ? -128.676 56.079 114.630 1.00 63.82  ? 101 LYS B CG  1 
ATOM   2609 C CD  . LYS B 1 101 ? -127.282 56.677 114.643 1.00 65.95  ? 101 LYS B CD  1 
ATOM   2610 C CE  . LYS B 1 101 ? -126.323 55.837 115.469 1.00 70.13  ? 101 LYS B CE  1 
ATOM   2611 N NZ  . LYS B 1 101 ? -124.910 56.083 115.064 1.00 72.38  ? 101 LYS B NZ  1 
ATOM   2612 N N   . ASP B 1 102 ? -132.416 56.691 112.853 1.00 63.34  ? 102 ASP B N   1 
ATOM   2613 C CA  . ASP B 1 102 ? -133.681 57.266 113.298 1.00 63.87  ? 102 ASP B CA  1 
ATOM   2614 C C   . ASP B 1 102 ? -134.837 56.296 113.061 1.00 58.12  ? 102 ASP B C   1 
ATOM   2615 O O   . ASP B 1 102 ? -135.907 56.438 113.649 1.00 56.96  ? 102 ASP B O   1 
ATOM   2616 C CB  . ASP B 1 102 ? -133.954 58.590 112.575 1.00 67.88  ? 102 ASP B CB  1 
ATOM   2617 C CG  . ASP B 1 102 ? -132.926 59.660 112.899 1.00 71.18  ? 102 ASP B CG  1 
ATOM   2618 O OD1 . ASP B 1 102 ? -132.710 59.934 114.098 1.00 73.50  ? 102 ASP B OD1 1 
ATOM   2619 O OD2 . ASP B 1 102 ? -132.333 60.227 111.955 1.00 71.42  ? 102 ASP B OD2 1 
ATOM   2620 N N   . GLY B 1 103 ? -134.617 55.320 112.184 1.00 52.13  ? 103 GLY B N   1 
ATOM   2621 C CA  . GLY B 1 103 ? -135.628 54.325 111.872 1.00 49.36  ? 103 GLY B CA  1 
ATOM   2622 C C   . GLY B 1 103 ? -136.587 54.729 110.766 1.00 50.25  ? 103 GLY B C   1 
ATOM   2623 O O   . GLY B 1 103 ? -137.707 54.221 110.697 1.00 49.49  ? 103 GLY B O   1 
ATOM   2624 N N   . PHE B 1 104 ? -136.152 55.626 109.885 1.00 50.67  ? 104 PHE B N   1 
ATOM   2625 C CA  . PHE B 1 104 ? -137.057 56.201 108.890 1.00 53.14  ? 104 PHE B CA  1 
ATOM   2626 C C   . PHE B 1 104 ? -136.747 55.799 107.451 1.00 52.11  ? 104 PHE B C   1 
ATOM   2627 O O   . PHE B 1 104 ? -137.468 56.187 106.531 1.00 56.44  ? 104 PHE B O   1 
ATOM   2628 C CB  . PHE B 1 104 ? -137.053 57.729 109.003 1.00 52.51  ? 104 PHE B CB  1 
ATOM   2629 C CG  . PHE B 1 104 ? -137.600 58.234 110.301 1.00 54.46  ? 104 PHE B CG  1 
ATOM   2630 C CD1 . PHE B 1 104 ? -138.615 57.549 110.951 1.00 55.15  ? 104 PHE B CD1 1 
ATOM   2631 C CD2 . PHE B 1 104 ? -137.095 59.385 110.878 1.00 55.17  ? 104 PHE B CD2 1 
ATOM   2632 C CE1 . PHE B 1 104 ? -139.123 58.007 112.152 1.00 56.91  ? 104 PHE B CE1 1 
ATOM   2633 C CE2 . PHE B 1 104 ? -137.595 59.847 112.077 1.00 55.87  ? 104 PHE B CE2 1 
ATOM   2634 C CZ  . PHE B 1 104 ? -138.611 59.155 112.717 1.00 57.47  ? 104 PHE B CZ  1 
ATOM   2635 N N   . LEU B 1 105 ? -135.686 55.025 107.249 1.00 48.43  ? 105 LEU B N   1 
ATOM   2636 C CA  . LEU B 1 105 ? -135.320 54.606 105.898 1.00 48.47  ? 105 LEU B CA  1 
ATOM   2637 C C   . LEU B 1 105 ? -135.825 53.197 105.602 1.00 50.61  ? 105 LEU B C   1 
ATOM   2638 O O   . LEU B 1 105 ? -135.392 52.224 106.222 1.00 50.94  ? 105 LEU B O   1 
ATOM   2639 C CB  . LEU B 1 105 ? -133.803 54.675 105.696 1.00 44.49  ? 105 LEU B CB  1 
ATOM   2640 C CG  . LEU B 1 105 ? -133.315 54.471 104.258 1.00 44.31  ? 105 LEU B CG  1 
ATOM   2641 C CD1 . LEU B 1 105 ? -133.678 55.673 103.393 1.00 46.44  ? 105 LEU B CD1 1 
ATOM   2642 C CD2 . LEU B 1 105 ? -131.819 54.208 104.228 1.00 38.93  ? 105 LEU B CD2 1 
ATOM   2643 N N   . LYS B 1 106 ? -136.752 53.095 104.656 1.00 53.40  ? 106 LYS B N   1 
ATOM   2644 C CA  . LYS B 1 106 ? -137.280 51.801 104.239 1.00 55.12  ? 106 LYS B CA  1 
ATOM   2645 C C   . LYS B 1 106 ? -136.347 51.138 103.231 1.00 54.40  ? 106 LYS B C   1 
ATOM   2646 O O   . LYS B 1 106 ? -136.058 49.946 103.325 1.00 55.24  ? 106 LYS B O   1 
ATOM   2647 C CB  . LYS B 1 106 ? -138.678 51.960 103.638 1.00 60.79  ? 106 LYS B CB  1 
ATOM   2648 C CG  . LYS B 1 106 ? -139.324 50.656 103.197 1.00 68.53  ? 106 LYS B CG  1 
ATOM   2649 C CD  . LYS B 1 106 ? -139.617 49.751 104.383 1.00 74.09  ? 106 LYS B CD  1 
ATOM   2650 C CE  . LYS B 1 106 ? -140.049 48.365 103.930 1.00 79.31  ? 106 LYS B CE  1 
ATOM   2651 N NZ  . LYS B 1 106 ? -138.970 47.662 103.178 1.00 79.45  ? 106 LYS B NZ  1 
ATOM   2652 N N   . GLU B 1 107 ? -135.871 51.920 102.268 1.00 54.18  ? 107 GLU B N   1 
ATOM   2653 C CA  . GLU B 1 107 ? -135.044 51.382 101.197 1.00 54.86  ? 107 GLU B CA  1 
ATOM   2654 C C   . GLU B 1 107 ? -134.202 52.462 100.534 1.00 50.29  ? 107 GLU B C   1 
ATOM   2655 O O   . GLU B 1 107 ? -134.688 53.557 100.282 1.00 48.23  ? 107 GLU B O   1 
ATOM   2656 C CB  . GLU B 1 107 ? -135.923 50.698 100.146 1.00 60.57  ? 107 GLU B CB  1 
ATOM   2657 C CG  . GLU B 1 107 ? -135.179 50.290 98.882  1.00 64.56  ? 107 GLU B CG  1 
ATOM   2658 C CD  . GLU B 1 107 ? -136.104 49.779 97.795  1.00 70.12  ? 107 GLU B CD  1 
ATOM   2659 O OE1 . GLU B 1 107 ? -137.334 49.778 98.009  1.00 74.41  ? 107 GLU B OE1 1 
ATOM   2660 O OE2 . GLU B 1 107 ? -135.600 49.379 96.724  1.00 72.79  ? 107 GLU B OE2 1 
ATOM   2661 N N   . ILE B 1 108 ? -132.938 52.156 100.262 1.00 47.17  ? 108 ILE B N   1 
ATOM   2662 C CA  . ILE B 1 108 ? -132.137 53.015 99.403  1.00 46.74  ? 108 ILE B CA  1 
ATOM   2663 C C   . ILE B 1 108 ? -131.628 52.211 98.207  1.00 49.56  ? 108 ILE B C   1 
ATOM   2664 O O   . ILE B 1 108 ? -131.151 51.084 98.348  1.00 49.10  ? 108 ILE B O   1 
ATOM   2665 C CB  . ILE B 1 108 ? -130.958 53.670 100.162 1.00 44.53  ? 108 ILE B CB  1 
ATOM   2666 C CG1 . ILE B 1 108 ? -130.156 54.564 99.211  1.00 49.91  ? 108 ILE B CG1 1 
ATOM   2667 C CG2 . ILE B 1 108 ? -130.076 52.624 100.821 1.00 40.75  ? 108 ILE B CG2 1 
ATOM   2668 C CD1 . ILE B 1 108 ? -128.947 55.209 99.833  1.00 53.07  ? 108 ILE B CD1 1 
ATOM   2669 N N   . SER B 1 109 ? -131.766 52.793 97.022  1.00 52.94  ? 109 SER B N   1 
ATOM   2670 C CA  . SER B 1 109 ? -131.420 52.103 95.790  1.00 49.63  ? 109 SER B CA  1 
ATOM   2671 C C   . SER B 1 109 ? -130.518 52.944 94.903  1.00 52.39  ? 109 SER B C   1 
ATOM   2672 O O   . SER B 1 109 ? -130.677 54.165 94.817  1.00 54.33  ? 109 SER B O   1 
ATOM   2673 C CB  . SER B 1 109 ? -132.686 51.724 95.018  1.00 51.69  ? 109 SER B CB  1 
ATOM   2674 O OG  . SER B 1 109 ? -133.462 50.788 95.740  1.00 59.60  ? 109 SER B OG  1 
ATOM   2675 N N   . LEU B 1 110 ? -129.563 52.283 94.258  1.00 47.93  ? 110 LEU B N   1 
ATOM   2676 C CA  . LEU B 1 110 ? -128.793 52.903 93.191  1.00 47.55  ? 110 LEU B CA  1 
ATOM   2677 C C   . LEU B 1 110 ? -129.494 52.583 91.882  1.00 52.70  ? 110 LEU B C   1 
ATOM   2678 O O   . LEU B 1 110 ? -129.576 51.421 91.478  1.00 51.73  ? 110 LEU B O   1 
ATOM   2679 C CB  . LEU B 1 110 ? -127.350 52.400 93.181  1.00 47.67  ? 110 LEU B CB  1 
ATOM   2680 C CG  . LEU B 1 110 ? -126.512 52.781 91.963  1.00 54.99  ? 110 LEU B CG  1 
ATOM   2681 C CD1 . LEU B 1 110 ? -126.421 54.293 91.810  1.00 58.88  ? 110 LEU B CD1 1 
ATOM   2682 C CD2 . LEU B 1 110 ? -125.127 52.166 92.071  1.00 55.14  ? 110 LEU B CD2 1 
ATOM   2683 N N   . VAL B 1 111 ? -130.015 53.615 91.231  1.00 55.36  ? 111 VAL B N   1 
ATOM   2684 C CA  . VAL B 1 111 ? -130.846 53.423 90.052  1.00 57.87  ? 111 VAL B CA  1 
ATOM   2685 C C   . VAL B 1 111 ? -130.157 53.923 88.789  1.00 59.43  ? 111 VAL B C   1 
ATOM   2686 O O   . VAL B 1 111 ? -129.762 55.086 88.706  1.00 59.53  ? 111 VAL B O   1 
ATOM   2687 C CB  . VAL B 1 111 ? -132.204 54.134 90.213  1.00 59.38  ? 111 VAL B CB  1 
ATOM   2688 C CG1 . VAL B 1 111 ? -133.004 54.050 88.924  1.00 62.02  ? 111 VAL B CG1 1 
ATOM   2689 C CG2 . VAL B 1 111 ? -132.982 53.524 91.369  1.00 55.90  ? 111 VAL B CG2 1 
ATOM   2690 N N   . VAL B 1 112 ? -130.007 53.035 87.811  1.00 64.54  ? 112 VAL B N   1 
ATOM   2691 C CA  . VAL B 1 112 ? -129.399 53.401 86.537  1.00 62.12  ? 112 VAL B CA  1 
ATOM   2692 C C   . VAL B 1 112 ? -130.465 53.537 85.449  1.00 66.47  ? 112 VAL B C   1 
ATOM   2693 O O   . VAL B 1 112 ? -131.324 52.667 85.302  1.00 65.27  ? 112 VAL B O   1 
ATOM   2694 C CB  . VAL B 1 112 ? -128.344 52.369 86.095  1.00 57.99  ? 112 VAL B CB  1 
ATOM   2695 C CG1 . VAL B 1 112 ? -127.633 52.846 84.833  1.00 59.67  ? 112 VAL B CG1 1 
ATOM   2696 C CG2 . VAL B 1 112 ? -127.342 52.128 87.215  1.00 52.05  ? 112 VAL B CG2 1 
ATOM   2697 N N   . THR B 1 113 ? -130.416 54.641 84.706  1.00 71.22  ? 113 THR B N   1 
ATOM   2698 C CA  . THR B 1 113 ? -131.343 54.889 83.601  1.00 78.10  ? 113 THR B CA  1 
ATOM   2699 C C   . THR B 1 113 ? -130.586 55.313 82.348  1.00 84.80  ? 113 THR B C   1 
ATOM   2700 O O   . THR B 1 113 ? -129.440 55.751 82.433  1.00 85.47  ? 113 THR B O   1 
ATOM   2701 C CB  . THR B 1 113 ? -132.370 55.989 83.947  1.00 76.04  ? 113 THR B CB  1 
ATOM   2702 O OG1 . THR B 1 113 ? -131.684 57.213 84.240  1.00 73.13  ? 113 THR B OG1 1 
ATOM   2703 C CG2 . THR B 1 113 ? -133.217 55.585 85.140  1.00 73.43  ? 113 THR B CG2 1 
ATOM   2704 N N   . GLU B 1 114 ? -131.222 55.190 81.188  1.00 91.32  ? 114 GLU B N   1 
ATOM   2705 C CA  . GLU B 1 114 ? -130.618 55.677 79.951  1.00 100.79 ? 114 GLU B CA  1 
ATOM   2706 C C   . GLU B 1 114 ? -130.725 57.197 79.868  1.00 104.17 ? 114 GLU B C   1 
ATOM   2707 O O   . GLU B 1 114 ? -129.796 57.871 79.426  1.00 107.71 ? 114 GLU B O   1 
ATOM   2708 C CB  . GLU B 1 114 ? -131.275 55.026 78.729  1.00 109.75 ? 114 GLU B CB  1 
ATOM   2709 C CG  . GLU B 1 114 ? -132.779 55.222 78.638  1.00 115.89 ? 114 GLU B CG  1 
ATOM   2710 C CD  . GLU B 1 114 ? -133.364 54.659 77.358  1.00 125.08 ? 114 GLU B CD  1 
ATOM   2711 O OE1 . GLU B 1 114 ? -132.585 54.234 76.475  1.00 128.17 ? 114 GLU B OE1 1 
ATOM   2712 O OE2 . GLU B 1 114 ? -134.607 54.638 77.233  1.00 128.74 ? 114 GLU B OE2 1 
ATOM   2713 N N   . HIS B 1 115 ? -131.857 57.734 80.308  1.00 103.18 ? 115 HIS B N   1 
ATOM   2714 C CA  . HIS B 1 115 ? -132.071 59.175 80.268  1.00 106.85 ? 115 HIS B CA  1 
ATOM   2715 C C   . HIS B 1 115 ? -132.296 59.755 81.662  1.00 105.68 ? 115 HIS B C   1 
ATOM   2716 O O   . HIS B 1 115 ? -132.958 59.144 82.506  1.00 103.47 ? 115 HIS B O   1 
ATOM   2717 C CB  . HIS B 1 115 ? -133.252 59.517 79.349  1.00 111.02 ? 115 HIS B CB  1 
ATOM   2718 C CG  . HIS B 1 115 ? -133.008 59.195 77.906  1.00 113.38 ? 115 HIS B CG  1 
ATOM   2719 N ND1 . HIS B 1 115 ? -131.889 59.626 77.225  1.00 113.75 ? 115 HIS B ND1 1 
ATOM   2720 C CD2 . HIS B 1 115 ? -133.742 58.490 77.012  1.00 116.56 ? 115 HIS B CD2 1 
ATOM   2721 C CE1 . HIS B 1 115 ? -131.941 59.195 75.977  1.00 118.61 ? 115 HIS B CE1 1 
ATOM   2722 N NE2 . HIS B 1 115 ? -133.056 58.504 75.822  1.00 120.05 ? 115 HIS B NE2 1 
ATOM   2723 N N   . ASP B 1 116 ? -131.717 60.929 81.898  1.00 106.90 ? 116 ASP B N   1 
ATOM   2724 C CA  . ASP B 1 116 ? -131.937 61.679 83.130  1.00 103.72 ? 116 ASP B CA  1 
ATOM   2725 C C   . ASP B 1 116 ? -133.160 62.574 82.969  1.00 107.38 ? 116 ASP B C   1 
ATOM   2726 O O   . ASP B 1 116 ? -133.152 63.489 82.143  1.00 114.45 ? 116 ASP B O   1 
ATOM   2727 C CB  . ASP B 1 116 ? -130.705 62.521 83.476  1.00 105.46 ? 116 ASP B CB  1 
ATOM   2728 C CG  . ASP B 1 116 ? -130.974 63.547 84.569  1.00 109.51 ? 116 ASP B CG  1 
ATOM   2729 O OD1 . ASP B 1 116 ? -131.690 63.222 85.538  1.00 108.09 ? 116 ASP B OD1 1 
ATOM   2730 O OD2 . ASP B 1 116 ? -130.466 64.685 84.453  1.00 112.69 ? 116 ASP B OD2 1 
ATOM   2731 N N   . GLY B 1 117 ? -134.206 62.324 83.751  1.00 104.74 ? 117 GLY B N   1 
ATOM   2732 C CA  . GLY B 1 117 ? -134.209 61.266 84.744  1.00 97.39  ? 117 GLY B CA  1 
ATOM   2733 C C   . GLY B 1 117 ? -135.490 60.459 84.687  1.00 95.35  ? 117 GLY B C   1 
ATOM   2734 O O   . GLY B 1 117 ? -136.544 60.906 85.145  1.00 93.15  ? 117 GLY B O   1 
ATOM   2735 N N   . ASP B 1 118 ? -135.394 59.259 84.123  1.00 95.09  ? 118 ASP B N   1 
ATOM   2736 C CA  . ASP B 1 118 ? -136.559 58.416 83.892  1.00 93.77  ? 118 ASP B CA  1 
ATOM   2737 C C   . ASP B 1 118 ? -136.997 57.711 85.169  1.00 85.54  ? 118 ASP B C   1 
ATOM   2738 O O   . ASP B 1 118 ? -136.217 57.565 86.111  1.00 79.63  ? 118 ASP B O   1 
ATOM   2739 C CB  . ASP B 1 118 ? -136.254 57.387 82.801  1.00 98.84  ? 118 ASP B CB  1 
ATOM   2740 C CG  . ASP B 1 118 ? -137.506 56.826 82.158  1.00 104.32 ? 118 ASP B CG  1 
ATOM   2741 O OD1 . ASP B 1 118 ? -138.607 57.016 82.719  1.00 106.75 ? 118 ASP B OD1 1 
ATOM   2742 O OD2 . ASP B 1 118 ? -137.386 56.189 81.090  1.00 106.38 ? 118 ASP B OD2 1 
ATOM   2743 N N   . VAL B 1 119 ? -138.252 57.276 85.190  1.00 86.70  ? 119 VAL B N   1 
ATOM   2744 C CA  . VAL B 1 119 ? -138.790 56.554 86.332  1.00 84.95  ? 119 VAL B CA  1 
ATOM   2745 C C   . VAL B 1 119 ? -138.521 55.057 86.171  1.00 86.89  ? 119 VAL B C   1 
ATOM   2746 O O   . VAL B 1 119 ? -138.469 54.317 87.152  1.00 84.88  ? 119 VAL B O   1 
ATOM   2747 C CB  . VAL B 1 119 ? -140.301 56.820 86.502  1.00 87.07  ? 119 VAL B CB  1 
ATOM   2748 C CG1 . VAL B 1 119 ? -140.796 56.287 87.840  1.00 83.03  ? 119 VAL B CG1 1 
ATOM   2749 C CG2 . VAL B 1 119 ? -140.583 58.314 86.399  1.00 89.07  ? 119 VAL B CG2 1 
ATOM   2750 N N   . GLU B 1 120 ? -138.324 54.620 84.929  1.00 90.44  ? 120 GLU B N   1 
ATOM   2751 C CA  . GLU B 1 120 ? -138.003 53.221 84.656  1.00 90.68  ? 120 GLU B CA  1 
ATOM   2752 C C   . GLU B 1 120 ? -136.490 53.019 84.572  1.00 87.15  ? 120 GLU B C   1 
ATOM   2753 O O   . GLU B 1 120 ? -135.770 53.867 84.039  1.00 86.36  ? 120 GLU B O   1 
ATOM   2754 C CB  . GLU B 1 120 ? -138.670 52.755 83.362  1.00 97.00  ? 120 GLU B CB  1 
ATOM   2755 C CG  . GLU B 1 120 ? -138.847 51.248 83.284  1.00 100.24 ? 120 GLU B CG  1 
ATOM   2756 C CD  . GLU B 1 120 ? -139.198 50.764 81.892  1.00 107.74 ? 120 GLU B CD  1 
ATOM   2757 O OE1 . GLU B 1 120 ? -140.280 51.129 81.388  1.00 113.26 ? 120 GLU B OE1 1 
ATOM   2758 O OE2 . GLU B 1 120 ? -138.389 50.016 81.303  1.00 107.55 ? 120 GLU B OE2 1 
ATOM   2759 N N   . ALA B 1 121 ? -136.015 51.893 85.096  1.00 84.97  ? 121 ALA B N   1 
ATOM   2760 C CA  . ALA B 1 121 ? -134.579 51.649 85.203  1.00 82.66  ? 121 ALA B CA  1 
ATOM   2761 C C   . ALA B 1 121 ? -134.102 50.430 84.417  1.00 83.00  ? 121 ALA B C   1 
ATOM   2762 O O   . ALA B 1 121 ? -134.834 49.459 84.232  1.00 82.85  ? 121 ALA B O   1 
ATOM   2763 C CB  . ALA B 1 121 ? -134.186 51.502 86.661  1.00 77.51  ? 121 ALA B CB  1 
ATOM   2764 N N   . ILE B 1 122 ? -132.854 50.502 83.963  1.00 82.25  ? 122 ILE B N   1 
ATOM   2765 C CA  . ILE B 1 122 ? -132.194 49.390 83.291  1.00 80.79  ? 122 ILE B CA  1 
ATOM   2766 C C   . ILE B 1 122 ? -131.425 48.528 84.292  1.00 79.58  ? 122 ILE B C   1 
ATOM   2767 O O   . ILE B 1 122 ? -131.150 47.355 84.033  1.00 83.08  ? 122 ILE B O   1 
ATOM   2768 C CB  . ILE B 1 122 ? -131.229 49.888 82.196  1.00 79.53  ? 122 ILE B CB  1 
ATOM   2769 C CG1 . ILE B 1 122 ? -130.010 50.558 82.820  1.00 76.04  ? 122 ILE B CG1 1 
ATOM   2770 C CG2 . ILE B 1 122 ? -131.940 50.843 81.247  1.00 81.11  ? 122 ILE B CG2 1 
ATOM   2771 C CD1 . ILE B 1 122 ? -129.008 51.100 81.819  1.00 77.59  ? 122 ILE B CD1 1 
ATOM   2772 N N   . GLU B 1 123 ? -131.080 49.118 85.434  1.00 73.99  ? 123 GLU B N   1 
ATOM   2773 C CA  . GLU B 1 123 ? -130.300 48.433 86.461  1.00 70.84  ? 123 GLU B CA  1 
ATOM   2774 C C   . GLU B 1 123 ? -130.597 49.006 87.849  1.00 71.03  ? 123 GLU B C   1 
ATOM   2775 O O   . GLU B 1 123 ? -130.579 50.224 88.045  1.00 68.68  ? 123 GLU B O   1 
ATOM   2776 C CB  . GLU B 1 123 ? -128.804 48.538 86.145  1.00 70.01  ? 123 GLU B CB  1 
ATOM   2777 C CG  . GLU B 1 123 ? -127.912 47.600 86.942  1.00 70.06  ? 123 GLU B CG  1 
ATOM   2778 C CD  . GLU B 1 123 ? -126.528 47.435 86.326  1.00 74.91  ? 123 GLU B CD  1 
ATOM   2779 O OE1 . GLU B 1 123 ? -126.396 46.741 85.293  1.00 72.19  ? 123 GLU B OE1 1 
ATOM   2780 O OE2 . GLU B 1 123 ? -125.564 47.999 86.881  1.00 78.46  ? 123 GLU B OE2 1 
ATOM   2781 N N   . VAL B 1 124 ? -130.870 48.124 88.808  1.00 69.63  ? 124 VAL B N   1 
ATOM   2782 C CA  . VAL B 1 124 ? -131.227 48.539 90.162  1.00 62.54  ? 124 VAL B CA  1 
ATOM   2783 C C   . VAL B 1 124 ? -130.484 47.741 91.227  1.00 58.36  ? 124 VAL B C   1 
ATOM   2784 O O   . VAL B 1 124 ? -130.576 46.514 91.273  1.00 60.59  ? 124 VAL B O   1 
ATOM   2785 C CB  . VAL B 1 124 ? -132.743 48.393 90.413  1.00 64.79  ? 124 VAL B CB  1 
ATOM   2786 C CG1 . VAL B 1 124 ? -133.061 48.583 91.892  1.00 62.65  ? 124 VAL B CG1 1 
ATOM   2787 C CG2 . VAL B 1 124 ? -133.525 49.379 89.564  1.00 68.75  ? 124 VAL B CG2 1 
ATOM   2788 N N   . PHE B 1 125 ? -129.742 48.446 92.073  1.00 51.88  ? 125 PHE B N   1 
ATOM   2789 C CA  . PHE B 1 125 ? -129.151 47.845 93.261  1.00 50.06  ? 125 PHE B CA  1 
ATOM   2790 C C   . PHE B 1 125 ? -129.872 48.362 94.490  1.00 54.16  ? 125 PHE B C   1 
ATOM   2791 O O   . PHE B 1 125 ? -129.714 49.521 94.867  1.00 54.24  ? 125 PHE B O   1 
ATOM   2792 C CB  . PHE B 1 125 ? -127.659 48.150 93.349  1.00 49.47  ? 125 PHE B CB  1 
ATOM   2793 C CG  . PHE B 1 125 ? -126.837 47.382 92.366  1.00 56.24  ? 125 PHE B CG  1 
ATOM   2794 C CD1 . PHE B 1 125 ? -126.301 46.148 92.707  1.00 59.32  ? 125 PHE B CD1 1 
ATOM   2795 C CD2 . PHE B 1 125 ? -126.616 47.876 91.091  1.00 58.52  ? 125 PHE B CD2 1 
ATOM   2796 C CE1 . PHE B 1 125 ? -125.544 45.422 91.794  1.00 61.66  ? 125 PHE B CE1 1 
ATOM   2797 C CE2 . PHE B 1 125 ? -125.857 47.156 90.173  1.00 60.76  ? 125 PHE B CE2 1 
ATOM   2798 C CZ  . PHE B 1 125 ? -125.322 45.928 90.527  1.00 60.82  ? 125 PHE B CZ  1 
ATOM   2799 N N   . SER B 1 126 ? -130.661 47.494 95.111  1.00 52.90  ? 126 SER B N   1 
ATOM   2800 C CA  . SER B 1 126 ? -131.563 47.915 96.168  1.00 55.10  ? 126 SER B CA  1 
ATOM   2801 C C   . SER B 1 126 ? -131.197 47.327 97.524  1.00 54.06  ? 126 SER B C   1 
ATOM   2802 O O   . SER B 1 126 ? -130.929 46.128 97.643  1.00 52.11  ? 126 SER B O   1 
ATOM   2803 C CB  . SER B 1 126 ? -132.997 47.527 95.807  1.00 63.64  ? 126 SER B CB  1 
ATOM   2804 O OG  . SER B 1 126 ? -133.860 47.671 96.923  1.00 69.56  ? 126 SER B OG  1 
ATOM   2805 N N   . MET B 1 127 ? -131.184 48.180 98.545  1.00 49.39  ? 127 MET B N   1 
ATOM   2806 C CA  . MET B 1 127 ? -130.983 47.725 99.913  1.00 47.68  ? 127 MET B CA  1 
ATOM   2807 C C   . MET B 1 127 ? -132.209 48.062 100.757 1.00 51.39  ? 127 MET B C   1 
ATOM   2808 O O   . MET B 1 127 ? -132.516 49.235 100.976 1.00 53.36  ? 127 MET B O   1 
ATOM   2809 C CB  . MET B 1 127 ? -129.724 48.349 100.520 1.00 48.06  ? 127 MET B CB  1 
ATOM   2810 C CG  . MET B 1 127 ? -129.319 47.725 101.855 1.00 50.00  ? 127 MET B CG  1 
ATOM   2811 S SD  . MET B 1 127 ? -127.758 48.349 102.514 1.00 68.88  ? 127 MET B SD  1 
ATOM   2812 C CE  . MET B 1 127 ? -126.639 48.002 101.163 1.00 50.80  ? 127 MET B CE  1 
ATOM   2813 N N   . LYS B 1 128 ? -132.911 47.033 101.222 1.00 50.42  ? 128 LYS B N   1 
ATOM   2814 C CA  . LYS B 1 128 ? -134.128 47.238 102.002 1.00 51.30  ? 128 LYS B CA  1 
ATOM   2815 C C   . LYS B 1 128 ? -133.914 46.908 103.475 1.00 48.57  ? 128 LYS B C   1 
ATOM   2816 O O   . LYS B 1 128 ? -133.160 45.997 103.813 1.00 46.29  ? 128 LYS B O   1 
ATOM   2817 C CB  . LYS B 1 128 ? -135.276 46.406 101.427 1.00 54.06  ? 128 LYS B CB  1 
ATOM   2818 C CG  . LYS B 1 128 ? -135.672 46.815 100.017 1.00 57.15  ? 128 LYS B CG  1 
ATOM   2819 C CD  . LYS B 1 128 ? -136.624 45.811 99.385  1.00 63.34  ? 128 LYS B CD  1 
ATOM   2820 C CE  . LYS B 1 128 ? -137.052 46.253 97.993  1.00 68.34  ? 128 LYS B CE  1 
ATOM   2821 N NZ  . LYS B 1 128 ? -137.845 45.207 97.289  1.00 72.91  ? 128 LYS B NZ  1 
ATOM   2822 N N   . PHE B 1 129 ? -134.591 47.654 104.345 1.00 46.96  ? 129 PHE B N   1 
ATOM   2823 C CA  . PHE B 1 129 ? -134.323 47.591 105.779 1.00 48.01  ? 129 PHE B CA  1 
ATOM   2824 C C   . PHE B 1 129 ? -135.506 47.126 106.615 1.00 50.18  ? 129 PHE B C   1 
ATOM   2825 O O   . PHE B 1 129 ? -136.666 47.357 106.274 1.00 54.26  ? 129 PHE B O   1 
ATOM   2826 C CB  . PHE B 1 129 ? -133.852 48.960 106.283 1.00 46.54  ? 129 PHE B CB  1 
ATOM   2827 C CG  . PHE B 1 129 ? -132.538 49.378 105.712 1.00 47.77  ? 129 PHE B CG  1 
ATOM   2828 C CD1 . PHE B 1 129 ? -131.358 48.992 106.322 1.00 46.23  ? 129 PHE B CD1 1 
ATOM   2829 C CD2 . PHE B 1 129 ? -132.477 50.125 104.544 1.00 45.36  ? 129 PHE B CD2 1 
ATOM   2830 C CE1 . PHE B 1 129 ? -130.140 49.354 105.792 1.00 42.35  ? 129 PHE B CE1 1 
ATOM   2831 C CE2 . PHE B 1 129 ? -131.263 50.489 104.009 1.00 43.55  ? 129 PHE B CE2 1 
ATOM   2832 C CZ  . PHE B 1 129 ? -130.092 50.102 104.634 1.00 41.69  ? 129 PHE B CZ  1 
ATOM   2833 N N   . ILE B 1 130 ? -135.185 46.468 107.722 1.00 49.00  ? 130 ILE B N   1 
ATOM   2834 C CA  . ILE B 1 130 ? -136.169 46.043 108.706 1.00 52.15  ? 130 ILE B CA  1 
ATOM   2835 C C   . ILE B 1 130 ? -135.678 46.481 110.082 1.00 53.47  ? 130 ILE B C   1 
ATOM   2836 O O   . ILE B 1 130 ? -134.496 46.332 110.394 1.00 50.45  ? 130 ILE B O   1 
ATOM   2837 C CB  . ILE B 1 130 ? -136.386 44.515 108.663 1.00 53.78  ? 130 ILE B CB  1 
ATOM   2838 C CG1 . ILE B 1 130 ? -136.926 44.099 107.291 1.00 57.61  ? 130 ILE B CG1 1 
ATOM   2839 C CG2 . ILE B 1 130 ? -137.332 44.057 109.764 1.00 55.63  ? 130 ILE B CG2 1 
ATOM   2840 C CD1 . ILE B 1 130 ? -137.225 42.609 107.159 1.00 62.92  ? 130 ILE B CD1 1 
ATOM   2841 N N   . TYR B 1 131 ? -136.573 47.033 110.896 1.00 58.49  ? 131 TYR B N   1 
ATOM   2842 C CA  . TYR B 1 131 ? -136.184 47.569 112.199 1.00 62.22  ? 131 TYR B CA  1 
ATOM   2843 C C   . TYR B 1 131 ? -136.749 46.737 113.348 1.00 68.30  ? 131 TYR B C   1 
ATOM   2844 O O   . TYR B 1 131 ? -137.853 46.204 113.252 1.00 71.38  ? 131 TYR B O   1 
ATOM   2845 C CB  . TYR B 1 131 ? -136.632 49.029 112.325 1.00 60.40  ? 131 TYR B CB  1 
ATOM   2846 C CG  . TYR B 1 131 ? -136.016 49.924 111.276 1.00 57.29  ? 131 TYR B CG  1 
ATOM   2847 C CD1 . TYR B 1 131 ? -134.781 50.524 111.487 1.00 55.19  ? 131 TYR B CD1 1 
ATOM   2848 C CD2 . TYR B 1 131 ? -136.658 50.153 110.067 1.00 56.73  ? 131 TYR B CD2 1 
ATOM   2849 C CE1 . TYR B 1 131 ? -134.208 51.332 110.527 1.00 53.57  ? 131 TYR B CE1 1 
ATOM   2850 C CE2 . TYR B 1 131 ? -136.093 50.961 109.101 1.00 54.20  ? 131 TYR B CE2 1 
ATOM   2851 C CZ  . TYR B 1 131 ? -134.868 51.548 109.336 1.00 52.78  ? 131 TYR B CZ  1 
ATOM   2852 O OH  . TYR B 1 131 ? -134.298 52.354 108.378 1.00 52.59  ? 131 TYR B OH  1 
ATOM   2853 N N   . PHE B 1 132 ? -135.982 46.628 114.430 1.00 72.03  ? 132 PHE B N   1 
ATOM   2854 C CA  . PHE B 1 132 ? -136.383 45.823 115.583 1.00 79.64  ? 132 PHE B CA  1 
ATOM   2855 C C   . PHE B 1 132 ? -136.367 46.635 116.876 1.00 88.13  ? 132 PHE B C   1 
ATOM   2856 O O   . PHE B 1 132 ? -135.368 47.278 117.202 1.00 86.23  ? 132 PHE B O   1 
ATOM   2857 C CB  . PHE B 1 132 ? -135.460 44.611 115.746 1.00 77.14  ? 132 PHE B CB  1 
ATOM   2858 C CG  . PHE B 1 132 ? -135.435 43.686 114.560 1.00 73.56  ? 132 PHE B CG  1 
ATOM   2859 C CD1 . PHE B 1 132 ? -134.650 43.975 113.453 1.00 67.84  ? 132 PHE B CD1 1 
ATOM   2860 C CD2 . PHE B 1 132 ? -136.174 42.514 114.565 1.00 74.24  ? 132 PHE B CD2 1 
ATOM   2861 C CE1 . PHE B 1 132 ? -134.620 43.124 112.368 1.00 65.88  ? 132 PHE B CE1 1 
ATOM   2862 C CE2 . PHE B 1 132 ? -136.145 41.655 113.482 1.00 72.50  ? 132 PHE B CE2 1 
ATOM   2863 C CZ  . PHE B 1 132 ? -135.367 41.960 112.383 1.00 70.20  ? 132 PHE B CZ  1 
ATOM   2864 N N   . GLU B 1 133 ? -137.467 46.595 117.620 1.00 98.82  ? 133 GLU B N   1 
ATOM   2865 C CA  . GLU B 1 133 ? -137.513 47.245 118.924 1.00 108.48 ? 133 GLU B CA  1 
ATOM   2866 C C   . GLU B 1 133 ? -138.360 46.438 119.905 1.00 112.07 ? 133 GLU B C   1 
ATOM   2867 O O   . GLU B 1 133 ? -139.410 45.908 119.537 1.00 112.62 ? 133 GLU B O   1 
ATOM   2868 C CB  . GLU B 1 133 ? -138.049 48.678 118.799 1.00 117.52 ? 133 GLU B CB  1 
ATOM   2869 C CG  . GLU B 1 133 ? -139.498 48.792 118.341 1.00 128.24 ? 133 GLU B CG  1 
ATOM   2870 C CD  . GLU B 1 133 ? -140.002 50.225 118.352 1.00 132.28 ? 133 GLU B CD  1 
ATOM   2871 O OE1 . GLU B 1 133 ? -139.237 51.126 118.762 1.00 131.08 ? 133 GLU B OE1 1 
ATOM   2872 O OE2 . GLU B 1 133 ? -141.164 50.453 117.952 1.00 134.56 ? 133 GLU B OE2 1 
ATOM   2873 N N   . ASN B 1 134 ? -137.895 46.327 121.149 1.00 117.16 ? 134 ASN B N   1 
ATOM   2874 C CA  . ASN B 1 134 ? -136.627 46.915 121.574 1.00 113.96 ? 134 ASN B CA  1 
ATOM   2875 C C   . ASN B 1 134 ? -135.584 45.853 121.914 1.00 110.51 ? 134 ASN B C   1 
ATOM   2876 O O   . ASN B 1 134 ? -134.390 46.149 121.979 1.00 108.81 ? 134 ASN B O   1 
ATOM   2877 C CB  . ASN B 1 134 ? -136.845 47.836 122.777 1.00 118.97 ? 134 ASN B CB  1 
ATOM   2878 C CG  . ASN B 1 134 ? -137.767 48.999 122.460 1.00 120.24 ? 134 ASN B CG  1 
ATOM   2879 O OD1 . ASN B 1 134 ? -137.314 50.094 122.128 1.00 118.21 ? 134 ASN B OD1 1 
ATOM   2880 N ND2 . ASN B 1 134 ? -139.070 48.763 122.558 1.00 122.93 ? 134 ASN B ND2 1 
ATOM   2881 N N   . GLY B 1 135 ? -136.039 44.621 122.132 1.00 109.01 ? 135 GLY B N   1 
ATOM   2882 C CA  . GLY B 1 135 ? -135.142 43.515 122.412 1.00 107.12 ? 135 GLY B CA  1 
ATOM   2883 C C   . GLY B 1 135 ? -134.220 43.201 121.248 1.00 101.94 ? 135 GLY B C   1 
ATOM   2884 O O   . GLY B 1 135 ? -133.098 42.733 121.443 1.00 102.62 ? 135 GLY B O   1 
ATOM   2885 N N   . GLY B 1 136 ? -134.694 43.462 120.033 1.00 93.33  ? 136 GLY B N   1 
ATOM   2886 C CA  . GLY B 1 136 ? -133.912 43.205 118.838 1.00 81.53  ? 136 GLY B CA  1 
ATOM   2887 C C   . GLY B 1 136 ? -134.363 41.980 118.059 1.00 73.40  ? 136 GLY B C   1 
ATOM   2888 O O   . GLY B 1 136 ? -133.923 41.764 116.928 1.00 65.68  ? 136 GLY B O   1 
ATOM   2889 N N   . VAL B 1 137 ? -135.243 41.182 118.658 1.00 72.98  ? 137 VAL B N   1 
ATOM   2890 C CA  . VAL B 1 137 ? -135.718 39.949 118.031 1.00 75.85  ? 137 VAL B CA  1 
ATOM   2891 C C   . VAL B 1 137 ? -137.035 40.146 117.272 1.00 74.38  ? 137 VAL B C   1 
ATOM   2892 O O   . VAL B 1 137 ? -137.220 39.595 116.183 1.00 71.13  ? 137 VAL B O   1 
ATOM   2893 C CB  . VAL B 1 137 ? -135.906 38.823 119.078 1.00 85.53  ? 137 VAL B CB  1 
ATOM   2894 C CG1 . VAL B 1 137 ? -136.329 37.523 118.401 1.00 87.53  ? 137 VAL B CG1 1 
ATOM   2895 C CG2 . VAL B 1 137 ? -134.625 38.618 119.879 1.00 86.44  ? 137 VAL B CG2 1 
ATOM   2896 N N   . VAL B 1 138 ? -137.941 40.936 117.844 1.00 77.94  ? 138 VAL B N   1 
ATOM   2897 C CA  . VAL B 1 138 ? -139.266 41.146 117.261 1.00 81.14  ? 138 VAL B CA  1 
ATOM   2898 C C   . VAL B 1 138 ? -139.268 42.286 116.244 1.00 81.76  ? 138 VAL B C   1 
ATOM   2899 O O   . VAL B 1 138 ? -138.853 43.403 116.552 1.00 80.98  ? 138 VAL B O   1 
ATOM   2900 C CB  . VAL B 1 138 ? -140.315 41.446 118.350 1.00 83.45  ? 138 VAL B CB  1 
ATOM   2901 C CG1 . VAL B 1 138 ? -141.692 41.632 117.725 1.00 85.07  ? 138 VAL B CG1 1 
ATOM   2902 C CG2 . VAL B 1 138 ? -140.338 40.329 119.386 1.00 85.43  ? 138 VAL B CG2 1 
ATOM   2903 N N   . ALA B 1 139 ? -139.744 41.999 115.034 1.00 84.20  ? 139 ALA B N   1 
ATOM   2904 C CA  . ALA B 1 139 ? -139.745 42.977 113.947 1.00 83.49  ? 139 ALA B CA  1 
ATOM   2905 C C   . ALA B 1 139 ? -140.807 44.060 114.136 1.00 87.91  ? 139 ALA B C   1 
ATOM   2906 O O   . ALA B 1 139 ? -141.950 43.769 114.485 1.00 90.41  ? 139 ALA B O   1 
ATOM   2907 C CB  . ALA B 1 139 ? -139.946 42.275 112.609 1.00 82.65  ? 139 ALA B CB  1 
ATOM   2908 N N   . ARG B 1 140 ? -140.419 45.310 113.896 1.00 89.83  ? 140 ARG B N   1 
ATOM   2909 C CA  . ARG B 1 140 ? -141.333 46.443 114.005 1.00 94.43  ? 140 ARG B CA  1 
ATOM   2910 C C   . ARG B 1 140 ? -142.225 46.504 112.767 1.00 101.80 ? 140 ARG B C   1 
ATOM   2911 O O   . ARG B 1 140 ? -141.838 46.034 111.694 1.00 101.33 ? 140 ARG B O   1 
ATOM   2912 C CB  . ARG B 1 140 ? -140.549 47.751 114.175 1.00 88.68  ? 140 ARG B CB  1 
ATOM   2913 C CG  . ARG B 1 140 ? -141.359 48.943 114.678 1.00 89.53  ? 140 ARG B CG  1 
ATOM   2914 C CD  . ARG B 1 140 ? -140.554 50.243 114.584 1.00 87.08  ? 140 ARG B CD  1 
ATOM   2915 N NE  . ARG B 1 140 ? -139.266 50.156 115.270 1.00 85.63  ? 140 ARG B NE  1 
ATOM   2916 C CZ  . ARG B 1 140 ? -138.280 51.041 115.141 1.00 83.20  ? 140 ARG B CZ  1 
ATOM   2917 N NH1 . ARG B 1 140 ? -138.421 52.092 114.343 1.00 81.45  ? 140 ARG B NH1 1 
ATOM   2918 N NH2 . ARG B 1 140 ? -137.146 50.871 115.806 1.00 82.22  ? 140 ARG B NH2 1 
ATOM   2919 N N   . LEU B 1 141 ? -143.418 47.073 112.916 1.00 109.23 ? 141 LEU B N   1 
ATOM   2920 C CA  . LEU B 1 141 ? -144.349 47.195 111.799 1.00 111.34 ? 141 LEU B CA  1 
ATOM   2921 C C   . LEU B 1 141 ? -145.444 48.217 112.086 1.00 114.79 ? 141 LEU B C   1 
ATOM   2922 O O   . LEU B 1 141 ? -145.925 48.896 111.177 1.00 115.07 ? 141 LEU B O   1 
ATOM   2923 C CB  . LEU B 1 141 ? -144.974 45.837 111.473 1.00 113.61 ? 141 LEU B CB  1 
ATOM   2924 C CG  . LEU B 1 141 ? -145.881 45.795 110.243 1.00 115.75 ? 141 LEU B CG  1 
ATOM   2925 C CD1 . LEU B 1 141 ? -145.193 46.439 109.052 1.00 112.31 ? 141 LEU B CD1 1 
ATOM   2926 C CD2 . LEU B 1 141 ? -146.283 44.367 109.917 1.00 118.89 ? 141 LEU B CD2 1 
ATOM   2927 N N   . PRO B 1 151 ? -142.083 40.330 100.139 1.00 110.29 ? 151 PRO B N   1 
ATOM   2928 C CA  . PRO B 1 151 ? -141.531 39.256 99.305  1.00 113.35 ? 151 PRO B CA  1 
ATOM   2929 C C   . PRO B 1 151 ? -140.426 38.481 100.022 1.00 116.23 ? 151 PRO B C   1 
ATOM   2930 O O   . PRO B 1 151 ? -140.594 37.299 100.332 1.00 118.98 ? 151 PRO B O   1 
ATOM   2931 C CB  . PRO B 1 151 ? -140.969 40.003 98.090  1.00 109.53 ? 151 PRO B CB  1 
ATOM   2932 C CG  . PRO B 1 151 ? -140.769 41.419 98.561  1.00 105.15 ? 151 PRO B CG  1 
ATOM   2933 C CD  . PRO B 1 151 ? -141.867 41.661 99.546  1.00 106.97 ? 151 PRO B CD  1 
ATOM   2934 N N   . HIS B 1 152 ? -139.303 39.150 100.268 1.00 115.34 ? 152 HIS B N   1 
ATOM   2935 C CA  . HIS B 1 152 ? -138.209 38.578 101.037 1.00 116.31 ? 152 HIS B CA  1 
ATOM   2936 C C   . HIS B 1 152 ? -138.280 39.119 102.459 1.00 113.39 ? 152 HIS B C   1 
ATOM   2937 O O   . HIS B 1 152 ? -137.427 38.821 103.297 1.00 111.97 ? 152 HIS B O   1 
ATOM   2938 C CB  . HIS B 1 152 ? -136.860 38.918 100.405 1.00 116.64 ? 152 HIS B CB  1 
ATOM   2939 C CG  . HIS B 1 152 ? -136.812 38.708 98.922  1.00 120.56 ? 152 HIS B CG  1 
ATOM   2940 N ND1 . HIS B 1 152 ? -136.325 37.553 98.347  1.00 123.17 ? 152 HIS B ND1 1 
ATOM   2941 C CD2 . HIS B 1 152 ? -137.188 39.508 97.897  1.00 121.98 ? 152 HIS B CD2 1 
ATOM   2942 C CE1 . HIS B 1 152 ? -136.405 37.651 97.032  1.00 124.68 ? 152 HIS B CE1 1 
ATOM   2943 N NE2 . HIS B 1 152 ? -136.925 38.827 96.731  1.00 124.29 ? 152 HIS B NE2 1 
ATOM   2944 N N   . PHE B 1 153 ? -139.308 39.924 102.714 1.00 110.91 ? 153 PHE B N   1 
ATOM   2945 C CA  . PHE B 1 153 ? -139.522 40.545 104.016 1.00 108.16 ? 153 PHE B CA  1 
ATOM   2946 C C   . PHE B 1 153 ? -139.710 39.493 105.106 1.00 109.53 ? 153 PHE B C   1 
ATOM   2947 O O   . PHE B 1 153 ? -139.147 39.609 106.196 1.00 107.05 ? 153 PHE B O   1 
ATOM   2948 C CB  . PHE B 1 153 ? -140.739 41.476 103.959 1.00 109.95 ? 153 PHE B CB  1 
ATOM   2949 C CG  . PHE B 1 153 ? -141.059 42.155 105.267 1.00 111.65 ? 153 PHE B CG  1 
ATOM   2950 C CD1 . PHE B 1 153 ? -141.946 41.581 106.167 1.00 116.44 ? 153 PHE B CD1 1 
ATOM   2951 C CD2 . PHE B 1 153 ? -140.486 43.377 105.587 1.00 108.65 ? 153 PHE B CD2 1 
ATOM   2952 C CE1 . PHE B 1 153 ? -142.245 42.207 107.370 1.00 116.89 ? 153 PHE B CE1 1 
ATOM   2953 C CE2 . PHE B 1 153 ? -140.782 44.009 106.785 1.00 109.01 ? 153 PHE B CE2 1 
ATOM   2954 C CZ  . PHE B 1 153 ? -141.662 43.423 107.677 1.00 112.63 ? 153 PHE B CZ  1 
ATOM   2955 N N   . ALA B 1 154 ? -140.502 38.469 104.801 1.00 112.14 ? 154 ALA B N   1 
ATOM   2956 C CA  . ALA B 1 154 ? -140.824 37.428 105.771 1.00 115.12 ? 154 ALA B CA  1 
ATOM   2957 C C   . ALA B 1 154 ? -139.572 36.722 106.277 1.00 111.44 ? 154 ALA B C   1 
ATOM   2958 O O   . ALA B 1 154 ? -139.356 36.614 107.481 1.00 111.47 ? 154 ALA B O   1 
ATOM   2959 C CB  . ALA B 1 154 ? -141.791 36.421 105.164 1.00 120.80 ? 154 ALA B CB  1 
ATOM   2960 N N   . GLU B 1 155 ? -138.745 36.255 105.349 1.00 108.26 ? 155 GLU B N   1 
ATOM   2961 C CA  . GLU B 1 155 ? -137.545 35.502 105.694 1.00 107.30 ? 155 GLU B CA  1 
ATOM   2962 C C   . GLU B 1 155 ? -136.521 36.344 106.464 1.00 100.15 ? 155 GLU B C   1 
ATOM   2963 O O   . GLU B 1 155 ? -135.828 35.832 107.343 1.00 101.57 ? 155 GLU B O   1 
ATOM   2964 C CB  . GLU B 1 155 ? -136.910 34.928 104.425 1.00 112.22 ? 155 GLU B CB  1 
ATOM   2965 C CG  . GLU B 1 155 ? -135.858 33.856 104.672 1.00 118.99 ? 155 GLU B CG  1 
ATOM   2966 C CD  . GLU B 1 155 ? -135.403 33.180 103.390 1.00 124.50 ? 155 GLU B CD  1 
ATOM   2967 O OE1 . GLU B 1 155 ? -136.251 32.963 102.499 1.00 126.79 ? 155 GLU B OE1 1 
ATOM   2968 O OE2 . GLU B 1 155 ? -134.198 32.871 103.270 1.00 125.91 ? 155 GLU B OE2 1 
ATOM   2969 N N   . LEU B 1 156 ? -136.430 37.631 106.143 1.00 93.99  ? 156 LEU B N   1 
ATOM   2970 C CA  . LEU B 1 156 ? -135.457 38.500 106.803 1.00 90.39  ? 156 LEU B CA  1 
ATOM   2971 C C   . LEU B 1 156 ? -135.885 38.839 108.231 1.00 93.07  ? 156 LEU B C   1 
ATOM   2972 O O   . LEU B 1 156 ? -135.050 38.938 109.130 1.00 92.37  ? 156 LEU B O   1 
ATOM   2973 C CB  . LEU B 1 156 ? -135.243 39.787 105.998 1.00 85.62  ? 156 LEU B CB  1 
ATOM   2974 C CG  . LEU B 1 156 ? -134.025 40.628 106.398 1.00 82.27  ? 156 LEU B CG  1 
ATOM   2975 C CD1 . LEU B 1 156 ? -132.742 39.832 106.208 1.00 84.10  ? 156 LEU B CD1 1 
ATOM   2976 C CD2 . LEU B 1 156 ? -133.966 41.934 105.616 1.00 77.36  ? 156 LEU B CD2 1 
ATOM   2977 N N   . ALA B 1 157 ? -137.188 39.013 108.432 1.00 94.39  ? 157 ALA B N   1 
ATOM   2978 C CA  . ALA B 1 157 ? -137.728 39.336 109.749 1.00 94.72  ? 157 ALA B CA  1 
ATOM   2979 C C   . ALA B 1 157 ? -137.579 38.162 110.716 1.00 98.84  ? 157 ALA B C   1 
ATOM   2980 O O   . ALA B 1 157 ? -137.487 38.358 111.929 1.00 99.54  ? 157 ALA B O   1 
ATOM   2981 C CB  . ALA B 1 157 ? -139.187 39.747 109.637 1.00 95.50  ? 157 ALA B CB  1 
ATOM   2982 N N   . GLN B 1 158 ? -137.558 36.946 110.174 1.00 99.66  ? 158 GLN B N   1 
ATOM   2983 C CA  . GLN B 1 158 ? -137.370 35.749 110.990 1.00 105.36 ? 158 GLN B CA  1 
ATOM   2984 C C   . GLN B 1 158 ? -135.897 35.531 111.310 1.00 99.93  ? 158 GLN B C   1 
ATOM   2985 O O   . GLN B 1 158 ? -135.563 34.924 112.328 1.00 103.60 ? 158 GLN B O   1 
ATOM   2986 C CB  . GLN B 1 158 ? -137.931 34.505 110.290 1.00 113.68 ? 158 GLN B CB  1 
ATOM   2987 C CG  . GLN B 1 158 ? -139.375 34.619 109.819 1.00 120.31 ? 158 GLN B CG  1 
ATOM   2988 C CD  . GLN B 1 158 ? -140.329 35.086 110.905 1.00 125.26 ? 158 GLN B CD  1 
ATOM   2989 O OE1 . GLN B 1 158 ? -140.162 34.763 112.081 1.00 127.18 ? 158 GLN B OE1 1 
ATOM   2990 N NE2 . GLN B 1 158 ? -141.340 35.853 110.511 1.00 126.24 ? 158 GLN B NE2 1 
ATOM   2991 N N   . LEU B 1 159 ? -135.023 36.018 110.432 1.00 91.74  ? 159 LEU B N   1 
ATOM   2992 C CA  . LEU B 1 159 ? -133.581 35.873 110.614 1.00 86.89  ? 159 LEU B CA  1 
ATOM   2993 C C   . LEU B 1 159 ? -133.141 36.555 111.903 1.00 86.14  ? 159 LEU B C   1 
ATOM   2994 O O   . LEU B 1 159 ? -133.530 37.691 112.180 1.00 87.10  ? 159 LEU B O   1 
ATOM   2995 C CB  . LEU B 1 159 ? -132.817 36.455 109.420 1.00 81.88  ? 159 LEU B CB  1 
ATOM   2996 C CG  . LEU B 1 159 ? -131.299 36.245 109.400 1.00 82.21  ? 159 LEU B CG  1 
ATOM   2997 C CD1 . LEU B 1 159 ? -130.958 34.811 109.028 1.00 85.93  ? 159 LEU B CD1 1 
ATOM   2998 C CD2 . LEU B 1 159 ? -130.624 37.223 108.451 1.00 82.64  ? 159 LEU B CD2 1 
ATOM   2999 N N   . ARG B 1 160 ? -132.336 35.857 112.694 1.00 85.40  ? 160 ARG B N   1 
ATOM   3000 C CA  . ARG B 1 160 ? -131.927 36.378 113.989 1.00 84.40  ? 160 ARG B CA  1 
ATOM   3001 C C   . ARG B 1 160 ? -130.448 36.731 114.012 1.00 80.36  ? 160 ARG B C   1 
ATOM   3002 O O   . ARG B 1 160 ? -129.679 36.323 113.142 1.00 79.51  ? 160 ARG B O   1 
ATOM   3003 C CB  . ARG B 1 160 ? -132.250 35.370 115.093 1.00 91.88  ? 160 ARG B CB  1 
ATOM   3004 C CG  . ARG B 1 160 ? -133.743 35.123 115.277 1.00 99.48  ? 160 ARG B CG  1 
ATOM   3005 C CD  . ARG B 1 160 ? -134.016 34.109 116.378 1.00 108.54 ? 160 ARG B CD  1 
ATOM   3006 N NE  . ARG B 1 160 ? -135.446 33.898 116.589 1.00 114.72 ? 160 ARG B NE  1 
ATOM   3007 C CZ  . ARG B 1 160 ? -135.953 32.990 117.418 1.00 123.15 ? 160 ARG B CZ  1 
ATOM   3008 N NH1 . ARG B 1 160 ? -135.144 32.203 118.115 1.00 126.79 ? 160 ARG B NH1 1 
ATOM   3009 N NH2 . ARG B 1 160 ? -137.267 32.865 117.549 1.00 127.19 ? 160 ARG B NH2 1 
ATOM   3010 N N   . TYR B 1 161 ? -130.065 37.511 115.014 1.00 79.50  ? 161 TYR B N   1 
ATOM   3011 C CA  . TYR B 1 161 ? -128.682 37.909 115.204 1.00 75.61  ? 161 TYR B CA  1 
ATOM   3012 C C   . TYR B 1 161 ? -127.874 36.717 115.715 1.00 76.94  ? 161 TYR B C   1 
ATOM   3013 O O   . TYR B 1 161 ? -128.244 36.087 116.707 1.00 81.83  ? 161 TYR B O   1 
ATOM   3014 C CB  . TYR B 1 161 ? -128.618 39.096 116.170 1.00 71.78  ? 161 TYR B CB  1 
ATOM   3015 C CG  . TYR B 1 161 ? -127.231 39.507 116.595 1.00 67.41  ? 161 TYR B CG  1 
ATOM   3016 C CD1 . TYR B 1 161 ? -126.336 40.044 115.684 1.00 59.58  ? 161 TYR B CD1 1 
ATOM   3017 C CD2 . TYR B 1 161 ? -126.825 39.378 117.918 1.00 68.82  ? 161 TYR B CD2 1 
ATOM   3018 C CE1 . TYR B 1 161 ? -125.067 40.427 116.076 1.00 61.00  ? 161 TYR B CE1 1 
ATOM   3019 C CE2 . TYR B 1 161 ? -125.560 39.758 118.319 1.00 67.60  ? 161 TYR B CE2 1 
ATOM   3020 C CZ  . TYR B 1 161 ? -124.685 40.282 117.395 1.00 65.48  ? 161 TYR B CZ  1 
ATOM   3021 O OH  . TYR B 1 161 ? -123.424 40.661 117.795 1.00 68.11  ? 161 TYR B OH  1 
ATOM   3022 N N   . GLU B 1 162 ? -126.785 36.398 115.022 1.00 75.64  ? 162 GLU B N   1 
ATOM   3023 C CA  . GLU B 1 162 ? -125.986 35.217 115.345 1.00 80.72  ? 162 GLU B CA  1 
ATOM   3024 C C   . GLU B 1 162 ? -124.552 35.574 115.745 1.00 75.75  ? 162 GLU B C   1 
ATOM   3025 O O   . GLU B 1 162 ? -123.648 34.738 115.649 1.00 73.14  ? 162 GLU B O   1 
ATOM   3026 C CB  . GLU B 1 162 ? -125.966 34.248 114.156 1.00 87.41  ? 162 GLU B CB  1 
ATOM   3027 C CG  . GLU B 1 162 ? -127.341 33.752 113.710 1.00 94.44  ? 162 GLU B CG  1 
ATOM   3028 C CD  . GLU B 1 162 ? -127.289 32.958 112.410 1.00 100.35 ? 162 GLU B CD  1 
ATOM   3029 O OE1 . GLU B 1 162 ? -126.206 32.893 111.788 1.00 102.78 ? 162 GLU B OE1 1 
ATOM   3030 O OE2 . GLU B 1 162 ? -128.332 32.401 112.008 1.00 101.83 ? 162 GLU B OE2 1 
ATOM   3031 N N   . GLY B 1 163 ? -124.347 36.812 116.188 1.00 71.09  ? 163 GLY B N   1 
ATOM   3032 C CA  . GLY B 1 163 ? -123.041 37.241 116.659 1.00 70.66  ? 163 GLY B CA  1 
ATOM   3033 C C   . GLY B 1 163 ? -122.316 38.130 115.669 1.00 69.74  ? 163 GLY B C   1 
ATOM   3034 O O   . GLY B 1 163 ? -122.693 38.205 114.501 1.00 69.18  ? 163 GLY B O   1 
ATOM   3035 N N   . ALA B 1 164 ? -121.265 38.799 116.133 1.00 70.84  ? 164 ALA B N   1 
ATOM   3036 C CA  . ALA B 1 164 ? -120.518 39.726 115.291 1.00 64.68  ? 164 ALA B CA  1 
ATOM   3037 C C   . ALA B 1 164 ? -119.812 38.995 114.153 1.00 68.66  ? 164 ALA B C   1 
ATOM   3038 O O   . ALA B 1 164 ? -119.594 39.559 113.077 1.00 68.85  ? 164 ALA B O   1 
ATOM   3039 C CB  . ALA B 1 164 ? -119.513 40.507 116.124 1.00 61.26  ? 164 ALA B CB  1 
ATOM   3040 N N   . GLU B 1 165 ? -119.459 37.736 114.392 1.00 71.22  ? 165 GLU B N   1 
ATOM   3041 C CA  . GLU B 1 165 ? -118.769 36.942 113.385 1.00 71.54  ? 165 GLU B CA  1 
ATOM   3042 C C   . GLU B 1 165 ? -119.697 36.597 112.225 1.00 66.21  ? 165 GLU B C   1 
ATOM   3043 O O   . GLU B 1 165 ? -119.270 36.578 111.072 1.00 64.05  ? 165 GLU B O   1 
ATOM   3044 C CB  . GLU B 1 165 ? -118.188 35.671 114.008 1.00 79.08  ? 165 GLU B CB  1 
ATOM   3045 C CG  . GLU B 1 165 ? -116.956 35.914 114.876 1.00 85.64  ? 165 GLU B CG  1 
ATOM   3046 C CD  . GLU B 1 165 ? -115.748 36.373 114.073 1.00 88.69  ? 165 GLU B CD  1 
ATOM   3047 O OE1 . GLU B 1 165 ? -115.737 36.177 112.838 1.00 90.29  ? 165 GLU B OE1 1 
ATOM   3048 O OE2 . GLU B 1 165 ? -114.806 36.928 114.677 1.00 89.56  ? 165 GLU B OE2 1 
ATOM   3049 N N   . SER B 1 166 ? -120.965 36.337 112.531 1.00 63.44  ? 166 SER B N   1 
ATOM   3050 C CA  . SER B 1 166 ? -121.960 36.080 111.495 1.00 60.20  ? 166 SER B CA  1 
ATOM   3051 C C   . SER B 1 166 ? -122.154 37.313 110.617 1.00 59.41  ? 166 SER B C   1 
ATOM   3052 O O   . SER B 1 166 ? -122.337 37.199 109.409 1.00 57.64  ? 166 SER B O   1 
ATOM   3053 C CB  . SER B 1 166 ? -123.295 35.664 112.115 1.00 58.79  ? 166 SER B CB  1 
ATOM   3054 O OG  . SER B 1 166 ? -123.857 36.724 112.867 1.00 60.17  ? 166 SER B OG  1 
ATOM   3055 N N   . VAL B 1 167 ? -122.108 38.491 111.232 1.00 60.33  ? 167 VAL B N   1 
ATOM   3056 C CA  . VAL B 1 167 ? -122.296 39.740 110.503 1.00 55.37  ? 167 VAL B CA  1 
ATOM   3057 C C   . VAL B 1 167 ? -121.109 40.004 109.585 1.00 54.44  ? 167 VAL B C   1 
ATOM   3058 O O   . VAL B 1 167 ? -121.271 40.463 108.454 1.00 50.86  ? 167 VAL B O   1 
ATOM   3059 C CB  . VAL B 1 167 ? -122.477 40.932 111.459 1.00 53.45  ? 167 VAL B CB  1 
ATOM   3060 C CG1 . VAL B 1 167 ? -122.867 42.172 110.682 1.00 50.28  ? 167 VAL B CG1 1 
ATOM   3061 C CG2 . VAL B 1 167 ? -123.527 40.614 112.506 1.00 54.49  ? 167 VAL B CG2 1 
ATOM   3062 N N   . ARG B 1 168 ? -119.912 39.708 110.077 1.00 56.19  ? 168 ARG B N   1 
ATOM   3063 C CA  . ARG B 1 168 ? -118.702 39.870 109.281 1.00 55.51  ? 168 ARG B CA  1 
ATOM   3064 C C   . ARG B 1 168 ? -118.708 38.944 108.069 1.00 57.53  ? 168 ARG B C   1 
ATOM   3065 O O   . ARG B 1 168 ? -118.362 39.359 106.962 1.00 54.94  ? 168 ARG B O   1 
ATOM   3066 C CB  . ARG B 1 168 ? -117.465 39.609 110.136 1.00 56.89  ? 168 ARG B CB  1 
ATOM   3067 C CG  . ARG B 1 168 ? -116.163 39.570 109.357 1.00 57.37  ? 168 ARG B CG  1 
ATOM   3068 C CD  . ARG B 1 168 ? -114.991 39.465 110.309 1.00 64.10  ? 168 ARG B CD  1 
ATOM   3069 N NE  . ARG B 1 168 ? -113.714 39.371 109.613 1.00 69.60  ? 168 ARG B NE  1 
ATOM   3070 C CZ  . ARG B 1 168 ? -113.159 38.225 109.236 1.00 78.30  ? 168 ARG B CZ  1 
ATOM   3071 N NH1 . ARG B 1 168 ? -113.773 37.075 109.483 1.00 82.01  ? 168 ARG B NH1 1 
ATOM   3072 N NH2 . ARG B 1 168 ? -111.990 38.228 108.613 1.00 81.43  ? 168 ARG B NH2 1 
ATOM   3073 N N   . ASP B 1 169 ? -119.099 37.690 108.282 1.00 54.72  ? 169 ASP B N   1 
ATOM   3074 C CA  . ASP B 1 169 ? -119.197 36.738 107.182 1.00 58.31  ? 169 ASP B CA  1 
ATOM   3075 C C   . ASP B 1 169 ? -120.238 37.199 106.167 1.00 57.06  ? 169 ASP B C   1 
ATOM   3076 O O   . ASP B 1 169 ? -120.039 37.063 104.960 1.00 56.01  ? 169 ASP B O   1 
ATOM   3077 C CB  . ASP B 1 169 ? -119.546 35.339 107.691 1.00 63.50  ? 169 ASP B CB  1 
ATOM   3078 C CG  . ASP B 1 169 ? -118.477 34.763 108.599 1.00 72.00  ? 169 ASP B CG  1 
ATOM   3079 O OD1 . ASP B 1 169 ? -117.361 35.324 108.640 1.00 73.41  ? 169 ASP B OD1 1 
ATOM   3080 O OD2 . ASP B 1 169 ? -118.752 33.744 109.269 1.00 80.67  ? 169 ASP B OD2 1 
ATOM   3081 N N   . GLN B 1 170 ? -121.347 37.745 106.659 1.00 56.22  ? 170 GLN B N   1 
ATOM   3082 C CA  . GLN B 1 170 ? -122.374 38.287 105.777 1.00 56.31  ? 170 GLN B CA  1 
ATOM   3083 C C   . GLN B 1 170 ? -121.829 39.441 104.934 1.00 52.71  ? 170 GLN B C   1 
ATOM   3084 O O   . GLN B 1 170 ? -122.168 39.569 103.759 1.00 54.07  ? 170 GLN B O   1 
ATOM   3085 C CB  . GLN B 1 170 ? -123.587 38.754 106.584 1.00 56.48  ? 170 GLN B CB  1 
ATOM   3086 C CG  . GLN B 1 170 ? -124.445 37.632 107.155 1.00 51.25  ? 170 GLN B CG  1 
ATOM   3087 C CD  . GLN B 1 170 ? -125.417 38.137 108.211 1.00 56.81  ? 170 GLN B CD  1 
ATOM   3088 O OE1 . GLN B 1 170 ? -125.391 39.312 108.591 1.00 55.02  ? 170 GLN B OE1 1 
ATOM   3089 N NE2 . GLN B 1 170 ? -126.277 37.249 108.693 1.00 57.57  ? 170 GLN B NE2 1 
ATOM   3090 N N   . MET B 1 171 ? -120.979 40.275 105.529 1.00 50.75  ? 171 MET B N   1 
ATOM   3091 C CA  . MET B 1 171 ? -120.419 41.424 104.812 1.00 52.09  ? 171 MET B CA  1 
ATOM   3092 C C   . MET B 1 171 ? -119.383 40.997 103.771 1.00 55.15  ? 171 MET B C   1 
ATOM   3093 O O   . MET B 1 171 ? -119.358 41.520 102.655 1.00 53.14  ? 171 MET B O   1 
ATOM   3094 C CB  . MET B 1 171 ? -119.791 42.424 105.786 1.00 51.56  ? 171 MET B CB  1 
ATOM   3095 C CG  . MET B 1 171 ? -119.064 43.570 105.092 1.00 53.63  ? 171 MET B CG  1 
ATOM   3096 S SD  . MET B 1 171 ? -120.126 44.470 103.943 1.00 64.23  ? 171 MET B SD  1 
ATOM   3097 C CE  . MET B 1 171 ? -121.333 45.153 105.074 1.00 40.43  ? 171 MET B CE  1 
ATOM   3098 N N   . VAL B 1 172 ? -118.528 40.050 104.147 1.00 57.68  ? 172 VAL B N   1 
ATOM   3099 C CA  . VAL B 1 172 ? -117.568 39.460 103.221 1.00 56.76  ? 172 VAL B CA  1 
ATOM   3100 C C   . VAL B 1 172 ? -118.286 38.847 102.023 1.00 55.62  ? 172 VAL B C   1 
ATOM   3101 O O   . VAL B 1 172 ? -117.872 39.031 100.878 1.00 54.17  ? 172 VAL B O   1 
ATOM   3102 C CB  . VAL B 1 172 ? -116.708 38.379 103.913 1.00 58.72  ? 172 VAL B CB  1 
ATOM   3103 C CG1 . VAL B 1 172 ? -115.981 37.522 102.885 1.00 61.60  ? 172 VAL B CG1 1 
ATOM   3104 C CG2 . VAL B 1 172 ? -115.725 39.018 104.883 1.00 60.06  ? 172 VAL B CG2 1 
ATOM   3105 N N   . THR B 1 173 ? -119.370 38.126 102.297 1.00 57.66  ? 173 THR B N   1 
ATOM   3106 C CA  . THR B 1 173 ? -120.165 37.493 101.250 1.00 55.46  ? 173 THR B CA  1 
ATOM   3107 C C   . THR B 1 173 ? -120.725 38.525 100.277 1.00 52.36  ? 173 THR B C   1 
ATOM   3108 O O   . THR B 1 173 ? -120.637 38.366 99.060  1.00 52.45  ? 173 THR B O   1 
ATOM   3109 C CB  . THR B 1 173 ? -121.338 36.689 101.841 1.00 53.04  ? 173 THR B CB  1 
ATOM   3110 O OG1 . THR B 1 173 ? -120.839 35.690 102.741 1.00 57.05  ? 173 THR B OG1 1 
ATOM   3111 C CG2 . THR B 1 173 ? -122.140 36.030 100.728 1.00 50.60  ? 173 THR B CG2 1 
ATOM   3112 N N   . ILE B 1 174 ? -121.295 39.591 100.829 1.00 49.40  ? 174 ILE B N   1 
ATOM   3113 C CA  . ILE B 1 174 ? -121.948 40.618 100.025 1.00 45.48  ? 174 ILE B CA  1 
ATOM   3114 C C   . ILE B 1 174 ? -120.983 41.312 99.062  1.00 45.20  ? 174 ILE B C   1 
ATOM   3115 O O   . ILE B 1 174 ? -121.314 41.531 97.898  1.00 47.87  ? 174 ILE B O   1 
ATOM   3116 C CB  . ILE B 1 174 ? -122.631 41.670 100.923 1.00 41.92  ? 174 ILE B CB  1 
ATOM   3117 C CG1 . ILE B 1 174 ? -123.905 41.083 101.533 1.00 40.96  ? 174 ILE B CG1 1 
ATOM   3118 C CG2 . ILE B 1 174 ? -122.971 42.923 100.130 1.00 42.73  ? 174 ILE B CG2 1 
ATOM   3119 C CD1 . ILE B 1 174 ? -124.726 42.079 102.304 1.00 45.00  ? 174 ILE B CD1 1 
ATOM   3120 N N   . VAL B 1 175 ? -119.786 41.641 99.535  1.00 46.27  ? 175 VAL B N   1 
ATOM   3121 C CA  . VAL B 1 175 ? -118.830 42.359 98.702  1.00 51.21  ? 175 VAL B CA  1 
ATOM   3122 C C   . VAL B 1 175 ? -118.234 41.437 97.641  1.00 55.09  ? 175 VAL B C   1 
ATOM   3123 O O   . VAL B 1 175 ? -118.061 41.841 96.491  1.00 58.09  ? 175 VAL B O   1 
ATOM   3124 C CB  . VAL B 1 175 ? -117.716 42.996 99.551  1.00 51.71  ? 175 VAL B CB  1 
ATOM   3125 C CG1 . VAL B 1 175 ? -116.622 43.572 98.661  1.00 51.58  ? 175 VAL B CG1 1 
ATOM   3126 C CG2 . VAL B 1 175 ? -118.309 44.079 100.438 1.00 48.19  ? 175 VAL B CG2 1 
ATOM   3127 N N   . ARG B 1 176 ? -117.945 40.197 98.024  1.00 59.64  ? 176 ARG B N   1 
ATOM   3128 C CA  . ARG B 1 176 ? -117.490 39.179 97.077  1.00 61.43  ? 176 ARG B CA  1 
ATOM   3129 C C   . ARG B 1 176 ? -118.512 38.952 95.968  1.00 60.77  ? 176 ARG B C   1 
ATOM   3130 O O   . ARG B 1 176 ? -118.152 38.813 94.798  1.00 63.49  ? 176 ARG B O   1 
ATOM   3131 C CB  . ARG B 1 176 ? -117.211 37.853 97.789  1.00 68.89  ? 176 ARG B CB  1 
ATOM   3132 C CG  . ARG B 1 176 ? -115.840 37.766 98.437  1.00 75.04  ? 176 ARG B CG  1 
ATOM   3133 C CD  . ARG B 1 176 ? -115.136 36.463 98.087  1.00 83.44  ? 176 ARG B CD  1 
ATOM   3134 N NE  . ARG B 1 176 ? -113.713 36.518 98.413  1.00 90.94  ? 176 ARG B NE  1 
ATOM   3135 C CZ  . ARG B 1 176 ? -113.191 36.114 99.567  1.00 95.14  ? 176 ARG B CZ  1 
ATOM   3136 N NH1 . ARG B 1 176 ? -113.974 35.613 100.514 1.00 94.69  ? 176 ARG B NH1 1 
ATOM   3137 N NH2 . ARG B 1 176 ? -111.884 36.207 99.774  1.00 98.26  ? 176 ARG B NH2 1 
ATOM   3138 N N   . SER B 1 177 ? -119.786 38.908 96.343  1.00 60.37  ? 177 SER B N   1 
ATOM   3139 C CA  . SER B 1 177 ? -120.858 38.664 95.386  1.00 61.29  ? 177 SER B CA  1 
ATOM   3140 C C   . SER B 1 177 ? -121.031 39.855 94.451  1.00 58.51  ? 177 SER B C   1 
ATOM   3141 O O   . SER B 1 177 ? -121.187 39.684 93.243  1.00 60.22  ? 177 SER B O   1 
ATOM   3142 C CB  . SER B 1 177 ? -122.166 38.368 96.117  1.00 64.25  ? 177 SER B CB  1 
ATOM   3143 O OG  . SER B 1 177 ? -121.998 37.293 97.023  1.00 73.74  ? 177 SER B OG  1 
ATOM   3144 N N   . VAL B 1 178 ? -121.003 41.058 95.019  1.00 48.16  ? 178 VAL B N   1 
ATOM   3145 C CA  . VAL B 1 178 ? -121.043 42.283 94.230  1.00 47.85  ? 178 VAL B CA  1 
ATOM   3146 C C   . VAL B 1 178 ? -119.886 42.319 93.240  1.00 49.83  ? 178 VAL B C   1 
ATOM   3147 O O   . VAL B 1 178 ? -120.090 42.535 92.043  1.00 49.28  ? 178 VAL B O   1 
ATOM   3148 C CB  . VAL B 1 178 ? -120.987 43.537 95.122  1.00 43.68  ? 178 VAL B CB  1 
ATOM   3149 C CG1 . VAL B 1 178 ? -120.648 44.767 94.294  1.00 48.30  ? 178 VAL B CG1 1 
ATOM   3150 C CG2 . VAL B 1 178 ? -122.308 43.729 95.847  1.00 40.46  ? 178 VAL B CG2 1 
ATOM   3151 N N   . GLN B 1 179 ? -118.674 42.099 93.739  1.00 52.85  ? 179 GLN B N   1 
ATOM   3152 C CA  . GLN B 1 179 ? -117.502 42.047 92.873  1.00 55.96  ? 179 GLN B CA  1 
ATOM   3153 C C   . GLN B 1 179 ? -117.660 40.965 91.810  1.00 55.73  ? 179 GLN B C   1 
ATOM   3154 O O   . GLN B 1 179 ? -117.339 41.190 90.651  1.00 61.58  ? 179 GLN B O   1 
ATOM   3155 C CB  . GLN B 1 179 ? -116.227 41.810 93.689  1.00 60.37  ? 179 GLN B CB  1 
ATOM   3156 C CG  . GLN B 1 179 ? -115.822 42.998 94.557  1.00 61.52  ? 179 GLN B CG  1 
ATOM   3157 C CD  . GLN B 1 179 ? -114.561 42.743 95.366  1.00 63.68  ? 179 GLN B CD  1 
ATOM   3158 O OE1 . GLN B 1 179 ? -114.060 41.618 95.426  1.00 64.65  ? 179 GLN B OE1 1 
ATOM   3159 N NE2 . GLN B 1 179 ? -114.041 43.793 95.992  1.00 61.06  ? 179 GLN B NE2 1 
ATOM   3160 N N   . PHE B 1 180 ? -118.179 39.803 92.194  1.00 49.02  ? 180 PHE B N   1 
ATOM   3161 C CA  . PHE B 1 180 ? -118.341 38.709 91.237  1.00 54.03  ? 180 PHE B CA  1 
ATOM   3162 C C   . PHE B 1 180 ? -119.472 38.984 90.244  1.00 53.96  ? 180 PHE B C   1 
ATOM   3163 O O   . PHE B 1 180 ? -119.314 38.751 89.046  1.00 55.32  ? 180 PHE B O   1 
ATOM   3164 C CB  . PHE B 1 180 ? -118.592 37.381 91.957  1.00 52.23  ? 180 PHE B CB  1 
ATOM   3165 C CG  . PHE B 1 180 ? -118.939 36.250 91.029  1.00 56.29  ? 180 PHE B CG  1 
ATOM   3166 C CD1 . PHE B 1 180 ? -117.957 35.625 90.275  1.00 56.58  ? 180 PHE B CD1 1 
ATOM   3167 C CD2 . PHE B 1 180 ? -120.248 35.819 90.905  1.00 57.23  ? 180 PHE B CD2 1 
ATOM   3168 C CE1 . PHE B 1 180 ? -118.276 34.589 89.417  1.00 60.26  ? 180 PHE B CE1 1 
ATOM   3169 C CE2 . PHE B 1 180 ? -120.575 34.785 90.052  1.00 59.48  ? 180 PHE B CE2 1 
ATOM   3170 C CZ  . PHE B 1 180 ? -119.589 34.168 89.304  1.00 62.10  ? 180 PHE B CZ  1 
ATOM   3171 N N   . LEU B 1 181 ? -120.604 39.475 90.742  1.00 50.60  ? 181 LEU B N   1 
ATOM   3172 C CA  . LEU B 1 181 ? -121.752 39.785 89.889  1.00 56.35  ? 181 LEU B CA  1 
ATOM   3173 C C   . LEU B 1 181 ? -121.414 40.853 88.848  1.00 65.85  ? 181 LEU B C   1 
ATOM   3174 O O   . LEU B 1 181 ? -121.784 40.736 87.680  1.00 68.85  ? 181 LEU B O   1 
ATOM   3175 C CB  . LEU B 1 181 ? -122.941 40.249 90.737  1.00 54.36  ? 181 LEU B CB  1 
ATOM   3176 C CG  . LEU B 1 181 ? -124.220 40.690 90.017  1.00 52.51  ? 181 LEU B CG  1 
ATOM   3177 C CD1 . LEU B 1 181 ? -124.902 39.519 89.325  1.00 53.83  ? 181 LEU B CD1 1 
ATOM   3178 C CD2 . LEU B 1 181 ? -125.170 41.366 90.993  1.00 49.01  ? 181 LEU B CD2 1 
ATOM   3179 N N   . CYS B 1 182 ? -120.701 41.891 89.269  1.00 66.84  ? 182 CYS B N   1 
ATOM   3180 C CA  . CYS B 1 182 ? -120.432 43.013 88.377  1.00 69.74  ? 182 CYS B CA  1 
ATOM   3181 C C   . CYS B 1 182 ? -119.331 42.724 87.360  1.00 73.71  ? 182 CYS B C   1 
ATOM   3182 O O   . CYS B 1 182 ? -119.289 43.348 86.298  1.00 76.79  ? 182 CYS B O   1 
ATOM   3183 C CB  . CYS B 1 182 ? -120.065 44.256 89.185  1.00 64.98  ? 182 CYS B CB  1 
ATOM   3184 S SG  . CYS B 1 182 ? -121.378 44.847 90.277  1.00 67.73  ? 182 CYS B SG  1 
ATOM   3185 N N   . THR B 1 183 ? -118.447 41.780 87.670  1.00 71.85  ? 183 THR B N   1 
ATOM   3186 C CA  . THR B 1 183 ? -117.254 41.598 86.852  1.00 71.83  ? 183 THR B CA  1 
ATOM   3187 C C   . THR B 1 183 ? -117.303 40.371 85.939  1.00 77.47  ? 183 THR B C   1 
ATOM   3188 O O   . THR B 1 183 ? -116.594 40.325 84.934  1.00 78.27  ? 183 THR B O   1 
ATOM   3189 C CB  . THR B 1 183 ? -115.984 41.515 87.739  1.00 104.63 ? 183 THR B CB  1 
ATOM   3190 O OG1 . THR B 1 183 ? -114.836 41.885 86.969  1.00 109.64 ? 183 THR B OG1 1 
ATOM   3191 C CG2 . THR B 1 183 ? -115.783 40.112 88.284  1.00 105.50 ? 183 THR B CG2 1 
ATOM   3192 N N   . LYS B 1 184 ? -118.145 39.394 86.269  1.00 79.41  ? 184 LYS B N   1 
ATOM   3193 C CA  . LYS B 1 184 ? -118.144 38.122 85.547  1.00 79.22  ? 184 LYS B CA  1 
ATOM   3194 C C   . LYS B 1 184 ? -119.536 37.558 85.262  1.00 73.79  ? 184 LYS B C   1 
ATOM   3195 O O   . LYS B 1 184 ? -119.661 36.459 84.720  1.00 75.78  ? 184 LYS B O   1 
ATOM   3196 C CB  . LYS B 1 184 ? -117.330 37.084 86.324  1.00 85.55  ? 184 LYS B CB  1 
ATOM   3197 C CG  . LYS B 1 184 ? -115.827 37.237 86.162  1.00 94.83  ? 184 LYS B CG  1 
ATOM   3198 C CD  . LYS B 1 184 ? -115.072 36.675 87.355  1.00 98.67  ? 184 LYS B CD  1 
ATOM   3199 C CE  . LYS B 1 184 ? -113.597 37.042 87.284  1.00 102.44 ? 184 LYS B CE  1 
ATOM   3200 N NZ  . LYS B 1 184 ? -112.843 36.610 88.494  1.00 103.21 ? 184 LYS B NZ  1 
ATOM   3201 N N   . VAL B 1 185 ? -120.576 38.299 85.629  1.00 69.41  ? 185 VAL B N   1 
ATOM   3202 C CA  . VAL B 1 185 ? -121.944 37.875 85.344  1.00 71.43  ? 185 VAL B CA  1 
ATOM   3203 C C   . VAL B 1 185 ? -122.683 38.918 84.507  1.00 73.93  ? 185 VAL B C   1 
ATOM   3204 O O   . VAL B 1 185 ? -123.294 38.588 83.489  1.00 78.10  ? 185 VAL B O   1 
ATOM   3205 C CB  . VAL B 1 185 ? -122.741 37.603 86.640  1.00 71.33  ? 185 VAL B CB  1 
ATOM   3206 C CG1 . VAL B 1 185 ? -124.208 37.340 86.322  1.00 74.75  ? 185 VAL B CG1 1 
ATOM   3207 C CG2 . VAL B 1 185 ? -122.142 36.427 87.396  1.00 68.15  ? 185 VAL B CG2 1 
ATOM   3208 N N   . LEU B 1 186 ? -122.610 40.176 84.932  1.00 71.88  ? 186 LEU B N   1 
ATOM   3209 C CA  . LEU B 1 186 ? -123.318 41.261 84.258  1.00 72.53  ? 186 LEU B CA  1 
ATOM   3210 C C   . LEU B 1 186 ? -122.631 41.721 82.971  1.00 75.08  ? 186 LEU B C   1 
ATOM   3211 O O   . LEU B 1 186 ? -121.402 41.774 82.885  1.00 72.68  ? 186 LEU B O   1 
ATOM   3212 C CB  . LEU B 1 186 ? -123.475 42.457 85.203  1.00 70.68  ? 186 LEU B CB  1 
ATOM   3213 C CG  . LEU B 1 186 ? -124.444 42.313 86.376  1.00 65.42  ? 186 LEU B CG  1 
ATOM   3214 C CD1 . LEU B 1 186 ? -124.370 43.530 87.285  1.00 60.23  ? 186 LEU B CD1 1 
ATOM   3215 C CD2 . LEU B 1 186 ? -125.861 42.112 85.866  1.00 67.36  ? 186 LEU B CD2 1 
ATOM   3216 N N   . GLU B 1 187 ? -123.444 42.046 81.972  1.00 77.64  ? 187 GLU B N   1 
ATOM   3217 C CA  . GLU B 1 187 ? -122.972 42.728 80.775  1.00 82.65  ? 187 GLU B CA  1 
ATOM   3218 C C   . GLU B 1 187 ? -122.574 44.157 81.137  1.00 77.47  ? 187 GLU B C   1 
ATOM   3219 O O   . GLU B 1 187 ? -123.170 44.752 82.036  1.00 72.81  ? 187 GLU B O   1 
ATOM   3220 C CB  . GLU B 1 187 ? -124.058 42.737 79.700  1.00 89.50  ? 187 GLU B CB  1 
ATOM   3221 C CG  . GLU B 1 187 ? -124.270 41.403 79.002  1.00 95.15  ? 187 GLU B CG  1 
ATOM   3222 C CD  . GLU B 1 187 ? -123.287 41.185 77.868  1.00 105.81 ? 187 GLU B CD  1 
ATOM   3223 O OE1 . GLU B 1 187 ? -122.276 40.488 78.085  1.00 107.89 ? 187 GLU B OE1 1 
ATOM   3224 O OE2 . GLU B 1 187 ? -123.527 41.711 76.760  1.00 111.86 ? 187 GLU B OE2 1 
ATOM   3225 N N   . PRO B 1 188 ? -121.560 44.711 80.452  1.00 76.77  ? 188 PRO B N   1 
ATOM   3226 C CA  . PRO B 1 188 ? -121.148 46.099 80.697  1.00 74.55  ? 188 PRO B CA  1 
ATOM   3227 C C   . PRO B 1 188 ? -122.303 47.082 80.546  1.00 75.40  ? 188 PRO B C   1 
ATOM   3228 O O   . PRO B 1 188 ? -123.200 46.851 79.738  1.00 74.89  ? 188 PRO B O   1 
ATOM   3229 C CB  . PRO B 1 188 ? -120.092 46.349 79.617  1.00 78.50  ? 188 PRO B CB  1 
ATOM   3230 C CG  . PRO B 1 188 ? -119.551 44.997 79.299  1.00 76.79  ? 188 PRO B CG  1 
ATOM   3231 C CD  . PRO B 1 188 ? -120.706 44.046 79.453  1.00 75.21  ? 188 PRO B CD  1 
ATOM   3232 N N   . LEU B 1 189 ? -122.283 48.162 81.318  1.00 76.87  ? 189 LEU B N   1 
ATOM   3233 C CA  . LEU B 1 189 ? -123.285 49.211 81.172  1.00 77.93  ? 189 LEU B CA  1 
ATOM   3234 C C   . LEU B 1 189 ? -123.175 49.876 79.804  1.00 82.00  ? 189 LEU B C   1 
ATOM   3235 O O   . LEU B 1 189 ? -122.080 49.958 79.245  1.00 80.83  ? 189 LEU B O   1 
ATOM   3236 C CB  . LEU B 1 189 ? -123.136 50.252 82.279  1.00 73.69  ? 189 LEU B CB  1 
ATOM   3237 C CG  . LEU B 1 189 ? -123.765 49.881 83.621  1.00 71.20  ? 189 LEU B CG  1 
ATOM   3238 C CD1 . LEU B 1 189 ? -123.551 50.996 84.628  1.00 70.31  ? 189 LEU B CD1 1 
ATOM   3239 C CD2 . LEU B 1 189 ? -125.252 49.576 83.464  1.00 71.92  ? 189 LEU B CD2 1 
ATOM   3240 N N   . PRO B 1 190 ? -124.314 50.347 79.257  1.00 85.90  ? 190 PRO B N   1 
ATOM   3241 C CA  . PRO B 1 190 ? -124.339 51.049 77.968  1.00 89.01  ? 190 PRO B CA  1 
ATOM   3242 C C   . PRO B 1 190 ? -123.369 52.223 77.904  1.00 86.25  ? 190 PRO B C   1 
ATOM   3243 O O   . PRO B 1 190 ? -122.865 52.671 78.936  1.00 80.68  ? 190 PRO B O   1 
ATOM   3244 C CB  . PRO B 1 190 ? -125.782 51.550 77.869  1.00 91.32  ? 190 PRO B CB  1 
ATOM   3245 C CG  . PRO B 1 190 ? -126.566 50.577 78.663  1.00 88.86  ? 190 PRO B CG  1 
ATOM   3246 C CD  . PRO B 1 190 ? -125.672 50.174 79.807  1.00 84.37  ? 190 PRO B CD  1 
ATOM   3247 N N   . ALA B 1 191 ? -123.125 52.715 76.695  1.00 89.79  ? 191 ALA B N   1 
ATOM   3248 C CA  . ALA B 1 191 ? -122.222 53.839 76.486  1.00 94.97  ? 191 ALA B CA  1 
ATOM   3249 C C   . ALA B 1 191 ? -122.799 55.128 77.066  1.00 95.50  ? 191 ALA B C   1 
ATOM   3250 O O   . ALA B 1 191 ? -122.058 56.043 77.426  1.00 96.28  ? 191 ALA B O   1 
ATOM   3251 C CB  . ALA B 1 191 ? -121.927 54.009 75.002  1.00 98.40  ? 191 ALA B CB  1 
ATOM   3252 N N   . GLU B 1 192 ? -124.125 55.192 77.150  1.00 96.79  ? 192 GLU B N   1 
ATOM   3253 C CA  . GLU B 1 192 ? -124.813 56.343 77.725  1.00 97.95  ? 192 GLU B CA  1 
ATOM   3254 C C   . GLU B 1 192 ? -125.776 55.916 78.825  1.00 93.41  ? 192 GLU B C   1 
ATOM   3255 O O   . GLU B 1 192 ? -126.589 55.012 78.630  1.00 92.94  ? 192 GLU B O   1 
ATOM   3256 C CB  . GLU B 1 192 ? -125.575 57.113 76.644  1.00 107.11 ? 192 GLU B CB  1 
ATOM   3257 C CG  . GLU B 1 192 ? -124.692 57.797 75.616  1.00 119.51 ? 192 GLU B CG  1 
ATOM   3258 C CD  . GLU B 1 192 ? -125.492 58.555 74.570  1.00 130.94 ? 192 GLU B CD  1 
ATOM   3259 O OE1 . GLU B 1 192 ? -126.717 58.328 74.474  1.00 133.21 ? 192 GLU B OE1 1 
ATOM   3260 O OE2 . GLU B 1 192 ? -124.896 59.380 73.844  1.00 138.47 ? 192 GLU B OE2 1 
ATOM   3261 N N   . PHE B 1 193 ? -125.681 56.566 79.980  1.00 86.80  ? 193 PHE B N   1 
ATOM   3262 C CA  . PHE B 1 193 ? -126.619 56.305 81.060  1.00 82.43  ? 193 PHE B CA  1 
ATOM   3263 C C   . PHE B 1 193 ? -126.662 57.438 82.074  1.00 81.11  ? 193 PHE B C   1 
ATOM   3264 O O   . PHE B 1 193 ? -125.862 58.370 82.025  1.00 80.73  ? 193 PHE B O   1 
ATOM   3265 C CB  . PHE B 1 193 ? -126.277 54.993 81.779  1.00 76.58  ? 193 PHE B CB  1 
ATOM   3266 C CG  . PHE B 1 193 ? -124.955 55.014 82.498  1.00 74.17  ? 193 PHE B CG  1 
ATOM   3267 C CD1 . PHE B 1 193 ? -124.853 55.516 83.788  1.00 69.56  ? 193 PHE B CD1 1 
ATOM   3268 C CD2 . PHE B 1 193 ? -123.817 54.511 81.889  1.00 77.90  ? 193 PHE B CD2 1 
ATOM   3269 C CE1 . PHE B 1 193 ? -123.640 55.533 84.449  1.00 69.17  ? 193 PHE B CE1 1 
ATOM   3270 C CE2 . PHE B 1 193 ? -122.603 54.520 82.546  1.00 77.27  ? 193 PHE B CE2 1 
ATOM   3271 C CZ  . PHE B 1 193 ? -122.512 55.033 83.827  1.00 72.33  ? 193 PHE B CZ  1 
ATOM   3272 N N   . THR B 1 194 ? -127.613 57.340 82.994  1.00 79.77  ? 194 THR B N   1 
ATOM   3273 C CA  . THR B 1 194 ? -127.661 58.212 84.158  1.00 77.97  ? 194 THR B CA  1 
ATOM   3274 C C   . THR B 1 194 ? -127.944 57.385 85.409  1.00 72.16  ? 194 THR B C   1 
ATOM   3275 O O   . THR B 1 194 ? -128.915 56.630 85.461  1.00 71.39  ? 194 THR B O   1 
ATOM   3276 C CB  . THR B 1 194 ? -128.722 59.321 84.000  1.00 77.41  ? 194 THR B CB  1 
ATOM   3277 O OG1 . THR B 1 194 ? -128.157 60.404 83.255  1.00 84.28  ? 194 THR B OG1 1 
ATOM   3278 C CG2 . THR B 1 194 ? -129.165 59.848 85.356  1.00 75.42  ? 194 THR B CG2 1 
ATOM   3279 N N   . ALA B 1 195 ? -127.076 57.516 86.405  1.00 67.52  ? 195 ALA B N   1 
ATOM   3280 C CA  . ALA B 1 195 ? -127.237 56.795 87.658  1.00 62.87  ? 195 ALA B CA  1 
ATOM   3281 C C   . ALA B 1 195 ? -127.779 57.714 88.753  1.00 61.31  ? 195 ALA B C   1 
ATOM   3282 O O   . ALA B 1 195 ? -127.285 58.824 88.937  1.00 60.81  ? 195 ALA B O   1 
ATOM   3283 C CB  . ALA B 1 195 ? -125.912 56.178 88.086  1.00 59.86  ? 195 ALA B CB  1 
ATOM   3284 N N   . ASN B 1 196 ? -128.790 57.240 89.478  1.00 62.07  ? 196 ASN B N   1 
ATOM   3285 C CA  . ASN B 1 196 ? -129.412 58.006 90.556  1.00 62.05  ? 196 ASN B CA  1 
ATOM   3286 C C   . ASN B 1 196 ? -129.492 57.210 91.861  1.00 59.86  ? 196 ASN B C   1 
ATOM   3287 O O   . ASN B 1 196 ? -129.563 55.980 91.839  1.00 58.89  ? 196 ASN B O   1 
ATOM   3288 C CB  . ASN B 1 196 ? -130.819 58.441 90.145  1.00 65.22  ? 196 ASN B CB  1 
ATOM   3289 C CG  . ASN B 1 196 ? -131.092 59.897 90.440  1.00 75.14  ? 196 ASN B CG  1 
ATOM   3290 O OD1 . ASN B 1 196 ? -132.095 60.454 89.992  1.00 82.29  ? 196 ASN B OD1 1 
ATOM   3291 N ND2 . ASN B 1 196 ? -130.195 60.529 91.186  1.00 79.34  ? 196 ASN B ND2 1 
ATOM   3292 N N   . PHE B 1 197 ? -129.465 57.911 92.992  1.00 54.90  ? 197 PHE B N   1 
ATOM   3293 C CA  . PHE B 1 197 ? -129.839 57.314 94.269  1.00 52.28  ? 197 PHE B CA  1 
ATOM   3294 C C   . PHE B 1 197 ? -131.252 57.738 94.621  1.00 54.53  ? 197 PHE B C   1 
ATOM   3295 O O   . PHE B 1 197 ? -131.586 58.922 94.582  1.00 56.12  ? 197 PHE B O   1 
ATOM   3296 C CB  . PHE B 1 197 ? -128.885 57.721 95.386  1.00 51.89  ? 197 PHE B CB  1 
ATOM   3297 C CG  . PHE B 1 197 ? -127.580 56.994 95.362  1.00 53.18  ? 197 PHE B CG  1 
ATOM   3298 C CD1 . PHE B 1 197 ? -127.479 55.704 95.869  1.00 54.85  ? 197 PHE B CD1 1 
ATOM   3299 C CD2 . PHE B 1 197 ? -126.448 57.598 94.840  1.00 52.47  ? 197 PHE B CD2 1 
ATOM   3300 C CE1 . PHE B 1 197 ? -126.270 55.030 95.848  1.00 54.30  ? 197 PHE B CE1 1 
ATOM   3301 C CE2 . PHE B 1 197 ? -125.236 56.932 94.816  1.00 53.93  ? 197 PHE B CE2 1 
ATOM   3302 C CZ  . PHE B 1 197 ? -125.147 55.647 95.320  1.00 54.59  ? 197 PHE B CZ  1 
ATOM   3303 N N   . ARG B 1 198 ? -132.085 56.762 94.951  1.00 54.02  ? 198 ARG B N   1 
ATOM   3304 C CA  . ARG B 1 198 ? -133.484 57.017 95.251  1.00 53.01  ? 198 ARG B CA  1 
ATOM   3305 C C   . ARG B 1 198 ? -133.891 56.208 96.472  1.00 51.63  ? 198 ARG B C   1 
ATOM   3306 O O   . ARG B 1 198 ? -133.467 55.065 96.636  1.00 45.10  ? 198 ARG B O   1 
ATOM   3307 C CB  . ARG B 1 198 ? -134.361 56.670 94.042  1.00 54.76  ? 198 ARG B CB  1 
ATOM   3308 C CG  . ARG B 1 198 ? -133.936 57.383 92.768  1.00 52.13  ? 198 ARG B CG  1 
ATOM   3309 C CD  . ARG B 1 198 ? -134.750 56.974 91.558  1.00 56.18  ? 198 ARG B CD  1 
ATOM   3310 N NE  . ARG B 1 198 ? -134.076 57.381 90.328  1.00 59.37  ? 198 ARG B NE  1 
ATOM   3311 C CZ  . ARG B 1 198 ? -134.611 57.297 89.116  1.00 60.36  ? 198 ARG B CZ  1 
ATOM   3312 N NH1 . ARG B 1 198 ? -135.839 56.823 88.963  1.00 61.55  ? 198 ARG B NH1 1 
ATOM   3313 N NH2 . ARG B 1 198 ? -133.918 57.690 88.056  1.00 62.23  ? 198 ARG B NH2 1 
ATOM   3314 N N   . LEU B 1 199 ? -134.700 56.797 97.342  1.00 55.56  ? 199 LEU B N   1 
ATOM   3315 C CA  . LEU B 1 199 ? -135.054 56.100 98.569  1.00 53.61  ? 199 LEU B CA  1 
ATOM   3316 C C   . LEU B 1 199 ? -136.539 56.167 98.903  1.00 58.01  ? 199 LEU B C   1 
ATOM   3317 O O   . LEU B 1 199 ? -137.287 56.962 98.333  1.00 60.90  ? 199 LEU B O   1 
ATOM   3318 C CB  . LEU B 1 199 ? -134.214 56.638 99.737  1.00 48.16  ? 199 LEU B CB  1 
ATOM   3319 C CG  . LEU B 1 199 ? -134.059 58.145 99.926  1.00 50.63  ? 199 LEU B CG  1 
ATOM   3320 C CD1 . LEU B 1 199 ? -135.271 58.747 100.618 1.00 48.73  ? 199 LEU B CD1 1 
ATOM   3321 C CD2 . LEU B 1 199 ? -132.796 58.440 100.714 1.00 49.83  ? 199 LEU B CD2 1 
ATOM   3322 N N   . LYS B 1 200 ? -136.950 55.304 99.826  1.00 57.86  ? 200 LYS B N   1 
ATOM   3323 C CA  . LYS B 1 200 ? -138.324 55.255 100.297 1.00 58.85  ? 200 LYS B CA  1 
ATOM   3324 C C   . LYS B 1 200 ? -138.346 55.437 101.809 1.00 58.99  ? 200 LYS B C   1 
ATOM   3325 O O   . LYS B 1 200 ? -137.578 54.799 102.530 1.00 56.91  ? 200 LYS B O   1 
ATOM   3326 C CB  . LYS B 1 200 ? -138.983 53.931 99.909  1.00 59.24  ? 200 LYS B CB  1 
ATOM   3327 C CG  . LYS B 1 200 ? -140.402 53.758 100.417 1.00 63.54  ? 200 LYS B CG  1 
ATOM   3328 C CD  . LYS B 1 200 ? -141.009 52.465 99.898  1.00 69.87  ? 200 LYS B CD  1 
ATOM   3329 C CE  . LYS B 1 200 ? -142.460 52.308 100.326 1.00 76.00  ? 200 LYS B CE  1 
ATOM   3330 N NZ  . LYS B 1 200 ? -143.081 51.104 99.704  1.00 80.54  ? 200 LYS B NZ  1 
ATOM   3331 N N   . TYR B 1 201 ? -139.216 56.320 102.284 1.00 61.17  ? 201 TYR B N   1 
ATOM   3332 C CA  . TYR B 1 201 ? -139.359 56.560 103.713 1.00 59.55  ? 201 TYR B CA  1 
ATOM   3333 C C   . TYR B 1 201 ? -140.288 55.527 104.337 1.00 60.31  ? 201 TYR B C   1 
ATOM   3334 O O   . TYR B 1 201 ? -141.208 55.034 103.683 1.00 61.69  ? 201 TYR B O   1 
ATOM   3335 C CB  . TYR B 1 201 ? -139.898 57.966 103.973 1.00 59.67  ? 201 TYR B CB  1 
ATOM   3336 C CG  . TYR B 1 201 ? -138.960 59.091 103.586 1.00 58.40  ? 201 TYR B CG  1 
ATOM   3337 C CD1 . TYR B 1 201 ? -138.098 59.655 104.519 1.00 54.77  ? 201 TYR B CD1 1 
ATOM   3338 C CD2 . TYR B 1 201 ? -138.948 59.599 102.295 1.00 59.25  ? 201 TYR B CD2 1 
ATOM   3339 C CE1 . TYR B 1 201 ? -137.246 60.688 104.173 1.00 53.21  ? 201 TYR B CE1 1 
ATOM   3340 C CE2 . TYR B 1 201 ? -138.101 60.633 101.941 1.00 58.00  ? 201 TYR B CE2 1 
ATOM   3341 C CZ  . TYR B 1 201 ? -137.252 61.173 102.884 1.00 56.06  ? 201 TYR B CZ  1 
ATOM   3342 O OH  . TYR B 1 201 ? -136.404 62.201 102.538 1.00 56.49  ? 201 TYR B OH  1 
ATOM   3343 N N   . THR B 1 202 ? -140.047 55.199 105.602 1.00 61.06  ? 202 THR B N   1 
ATOM   3344 C CA  . THR B 1 202 ? -140.955 54.328 106.342 1.00 65.38  ? 202 THR B CA  1 
ATOM   3345 C C   . THR B 1 202 ? -142.255 55.068 106.632 1.00 69.32  ? 202 THR B C   1 
ATOM   3346 O O   . THR B 1 202 ? -142.319 56.293 106.525 1.00 68.42  ? 202 THR B O   1 
ATOM   3347 C CB  . THR B 1 202 ? -140.349 53.843 107.676 1.00 62.32  ? 202 THR B CB  1 
ATOM   3348 O OG1 . THR B 1 202 ? -140.049 54.970 108.510 1.00 61.88  ? 202 THR B OG1 1 
ATOM   3349 C CG2 . THR B 1 202 ? -139.080 53.037 107.434 1.00 57.62  ? 202 THR B CG2 1 
ATOM   3350 N N   . ASN B 1 203 ? -143.288 54.318 107.000 1.00 74.95  ? 203 ASN B N   1 
ATOM   3351 C CA  . ASN B 1 203 ? -144.574 54.901 107.364 1.00 83.73  ? 203 ASN B CA  1 
ATOM   3352 C C   . ASN B 1 203 ? -144.447 55.816 108.581 1.00 84.33  ? 203 ASN B C   1 
ATOM   3353 O O   . ASN B 1 203 ? -145.228 56.754 108.751 1.00 85.94  ? 203 ASN B O   1 
ATOM   3354 C CB  . ASN B 1 203 ? -145.595 53.797 107.641 1.00 90.74  ? 203 ASN B CB  1 
ATOM   3355 C CG  . ASN B 1 203 ? -146.814 53.891 106.742 1.00 97.63  ? 203 ASN B CG  1 
ATOM   3356 O OD1 . ASN B 1 203 ? -147.230 54.983 106.352 1.00 99.55  ? 203 ASN B OD1 1 
ATOM   3357 N ND2 . ASN B 1 203 ? -147.396 52.744 106.412 1.00 101.19 ? 203 ASN B ND2 1 
ATOM   3358 N N   . ASP B 1 204 ? -143.450 55.530 109.415 1.00 83.92  ? 204 ASP B N   1 
ATOM   3359 C CA  . ASP B 1 204 ? -143.184 56.276 110.644 1.00 83.74  ? 204 ASP B CA  1 
ATOM   3360 C C   . ASP B 1 204 ? -142.736 57.716 110.412 1.00 77.86  ? 204 ASP B C   1 
ATOM   3361 O O   . ASP B 1 204 ? -142.988 58.588 111.241 1.00 78.82  ? 204 ASP B O   1 
ATOM   3362 C CB  . ASP B 1 204 ? -142.108 55.561 111.463 1.00 86.93  ? 204 ASP B CB  1 
ATOM   3363 C CG  . ASP B 1 204 ? -142.678 54.556 112.432 1.00 93.10  ? 204 ASP B CG  1 
ATOM   3364 O OD1 . ASP B 1 204 ? -143.846 54.719 112.843 1.00 97.73  ? 204 ASP B OD1 1 
ATOM   3365 O OD2 . ASP B 1 204 ? -141.947 53.609 112.795 1.00 94.70  ? 204 ASP B OD2 1 
ATOM   3366 N N   . ALA B 1 205 ? -142.050 57.952 109.297 1.00 71.61  ? 205 ALA B N   1 
ATOM   3367 C CA  . ALA B 1 205 ? -141.391 59.235 109.053 1.00 67.01  ? 205 ALA B CA  1 
ATOM   3368 C C   . ALA B 1 205 ? -142.345 60.424 109.107 1.00 65.05  ? 205 ALA B C   1 
ATOM   3369 O O   . ALA B 1 205 ? -143.421 60.395 108.506 1.00 67.38  ? 205 ALA B O   1 
ATOM   3370 C CB  . ALA B 1 205 ? -140.673 59.210 107.710 1.00 65.38  ? 205 ALA B CB  1 
ATOM   3371 N N   . PRO B 1 206 ? -141.951 61.474 109.847 1.00 61.56  ? 206 PRO B N   1 
ATOM   3372 C CA  . PRO B 1 206 ? -142.691 62.742 109.864 1.00 63.77  ? 206 PRO B CA  1 
ATOM   3373 C C   . PRO B 1 206 ? -142.721 63.387 108.480 1.00 67.94  ? 206 PRO B C   1 
ATOM   3374 O O   . PRO B 1 206 ? -141.750 63.262 107.732 1.00 62.63  ? 206 PRO B O   1 
ATOM   3375 C CB  . PRO B 1 206 ? -141.897 63.606 110.854 1.00 56.69  ? 206 PRO B CB  1 
ATOM   3376 C CG  . PRO B 1 206 ? -141.170 62.623 111.724 1.00 55.77  ? 206 PRO B CG  1 
ATOM   3377 C CD  . PRO B 1 206 ? -140.843 61.468 110.820 1.00 57.39  ? 206 PRO B CD  1 
ATOM   3378 N N   . SER B 1 207 ? -143.818 64.064 108.153 1.00 75.70  ? 207 SER B N   1 
ATOM   3379 C CA  . SER B 1 207 ? -143.987 64.705 106.850 1.00 75.88  ? 207 SER B CA  1 
ATOM   3380 C C   . SER B 1 207 ? -142.874 65.702 106.543 1.00 72.95  ? 207 SER B C   1 
ATOM   3381 O O   . SER B 1 207 ? -142.437 65.832 105.398 1.00 70.31  ? 207 SER B O   1 
ATOM   3382 C CB  . SER B 1 207 ? -145.335 65.428 106.784 1.00 82.65  ? 207 SER B CB  1 
ATOM   3383 O OG  . SER B 1 207 ? -146.347 64.704 107.459 1.00 87.76  ? 207 SER B OG  1 
ATOM   3384 N N   . ASN B 1 208 ? -142.425 66.408 107.576 1.00 73.04  ? 208 ASN B N   1 
ATOM   3385 C CA  . ASN B 1 208 ? -141.460 67.485 107.408 1.00 70.61  ? 208 ASN B CA  1 
ATOM   3386 C C   . ASN B 1 208 ? -140.020 67.037 107.633 1.00 64.40  ? 208 ASN B C   1 
ATOM   3387 O O   . ASN B 1 208 ? -139.092 67.843 107.541 1.00 64.67  ? 208 ASN B O   1 
ATOM   3388 C CB  . ASN B 1 208 ? -141.801 68.640 108.348 1.00 74.41  ? 208 ASN B CB  1 
ATOM   3389 C CG  . ASN B 1 208 ? -143.257 69.053 108.254 1.00 83.15  ? 208 ASN B CG  1 
ATOM   3390 O OD1 . ASN B 1 208 ? -143.627 69.883 107.423 1.00 87.52  ? 208 ASN B OD1 1 
ATOM   3391 N ND2 . ASN B 1 208 ? -144.094 68.473 109.107 1.00 86.53  ? 208 ASN B ND2 1 
ATOM   3392 N N   . PHE B 1 209 ? -139.836 65.755 107.935 1.00 59.66  ? 209 PHE B N   1 
ATOM   3393 C CA  . PHE B 1 209 ? -138.496 65.188 108.001 1.00 55.97  ? 209 PHE B CA  1 
ATOM   3394 C C   . PHE B 1 209 ? -138.001 64.826 106.603 1.00 58.47  ? 209 PHE B C   1 
ATOM   3395 O O   . PHE B 1 209 ? -138.663 64.087 105.873 1.00 56.46  ? 209 PHE B O   1 
ATOM   3396 C CB  . PHE B 1 209 ? -138.452 63.949 108.894 1.00 50.66  ? 209 PHE B CB  1 
ATOM   3397 C CG  . PHE B 1 209 ? -137.163 63.186 108.780 1.00 47.38  ? 209 PHE B CG  1 
ATOM   3398 C CD1 . PHE B 1 209 ? -136.024 63.635 109.431 1.00 46.90  ? 209 PHE B CD1 1 
ATOM   3399 C CD2 . PHE B 1 209 ? -137.077 62.044 107.996 1.00 48.81  ? 209 PHE B CD2 1 
ATOM   3400 C CE1 . PHE B 1 209 ? -134.824 62.954 109.320 1.00 47.52  ? 209 PHE B CE1 1 
ATOM   3401 C CE2 . PHE B 1 209 ? -135.876 61.354 107.878 1.00 47.11  ? 209 PHE B CE2 1 
ATOM   3402 C CZ  . PHE B 1 209 ? -134.748 61.812 108.544 1.00 45.82  ? 209 PHE B CZ  1 
ATOM   3403 N N   . ARG B 1 210 ? -136.828 65.337 106.241 1.00 59.25  ? 210 ARG B N   1 
ATOM   3404 C CA  . ARG B 1 210 ? -136.270 65.094 104.919 1.00 56.72  ? 210 ARG B CA  1 
ATOM   3405 C C   . ARG B 1 210 ? -134.785 64.750 105.000 1.00 51.65  ? 210 ARG B C   1 
ATOM   3406 O O   . ARG B 1 210 ? -134.011 65.452 105.651 1.00 51.65  ? 210 ARG B O   1 
ATOM   3407 C CB  . ARG B 1 210 ? -136.478 66.319 104.031 1.00 60.72  ? 210 ARG B CB  1 
ATOM   3408 C CG  . ARG B 1 210 ? -136.323 66.044 102.552 1.00 67.53  ? 210 ARG B CG  1 
ATOM   3409 C CD  . ARG B 1 210 ? -136.200 67.334 101.748 1.00 75.59  ? 210 ARG B CD  1 
ATOM   3410 N NE  . ARG B 1 210 ? -134.917 67.407 101.051 1.00 80.06  ? 210 ARG B NE  1 
ATOM   3411 C CZ  . ARG B 1 210 ? -133.986 68.329 101.276 1.00 80.14  ? 210 ARG B CZ  1 
ATOM   3412 N NH1 . ARG B 1 210 ? -134.194 69.281 102.175 1.00 77.50  ? 210 ARG B NH1 1 
ATOM   3413 N NH2 . ARG B 1 210 ? -132.847 68.305 100.593 1.00 79.38  ? 210 ARG B NH2 1 
ATOM   3414 N N   . ILE B 1 211 ? -134.390 63.669 104.337 1.00 50.17  ? 211 ILE B N   1 
ATOM   3415 C CA  . ILE B 1 211 ? -132.988 63.277 104.286 1.00 49.22  ? 211 ILE B CA  1 
ATOM   3416 C C   . ILE B 1 211 ? -132.202 64.238 103.394 1.00 51.29  ? 211 ILE B C   1 
ATOM   3417 O O   . ILE B 1 211 ? -132.615 64.534 102.271 1.00 52.94  ? 211 ILE B O   1 
ATOM   3418 C CB  . ILE B 1 211 ? -132.837 61.832 103.782 1.00 48.18  ? 211 ILE B CB  1 
ATOM   3419 C CG1 . ILE B 1 211 ? -133.619 60.883 104.695 1.00 45.00  ? 211 ILE B CG1 1 
ATOM   3420 C CG2 . ILE B 1 211 ? -131.366 61.437 103.711 1.00 45.41  ? 211 ILE B CG2 1 
ATOM   3421 C CD1 . ILE B 1 211 ? -133.748 59.482 104.157 1.00 46.52  ? 211 ILE B CD1 1 
ATOM   3422 N N   . ASP B 1 212 ? -131.079 64.732 103.910 1.00 50.30  ? 212 ASP B N   1 
ATOM   3423 C CA  . ASP B 1 212 ? -130.282 65.741 103.219 1.00 52.58  ? 212 ASP B CA  1 
ATOM   3424 C C   . ASP B 1 212 ? -129.731 65.234 101.888 1.00 53.09  ? 212 ASP B C   1 
ATOM   3425 O O   . ASP B 1 212 ? -129.093 64.184 101.825 1.00 52.29  ? 212 ASP B O   1 
ATOM   3426 C CB  . ASP B 1 212 ? -129.127 66.207 104.110 1.00 58.68  ? 212 ASP B CB  1 
ATOM   3427 C CG  . ASP B 1 212 ? -128.467 67.481 103.598 1.00 69.64  ? 212 ASP B CG  1 
ATOM   3428 O OD1 . ASP B 1 212 ? -129.168 68.314 102.983 1.00 72.10  ? 212 ASP B OD1 1 
ATOM   3429 O OD2 . ASP B 1 212 ? -127.248 67.655 103.815 1.00 74.78  ? 212 ASP B OD2 1 
ATOM   3430 N N   . GLY B 1 213 ? -129.977 65.994 100.827 1.00 52.82  ? 213 GLY B N   1 
ATOM   3431 C CA  . GLY B 1 213 ? -129.465 65.661 99.511  1.00 54.35  ? 213 GLY B CA  1 
ATOM   3432 C C   . GLY B 1 213 ? -130.515 64.986 98.656  1.00 52.91  ? 213 GLY B C   1 
ATOM   3433 O O   . GLY B 1 213 ? -130.302 64.738 97.467  1.00 52.57  ? 213 GLY B O   1 
ATOM   3434 N N   . PHE B 1 214 ? -131.656 64.691 99.269  1.00 50.50  ? 214 PHE B N   1 
ATOM   3435 C CA  . PHE B 1 214 ? -132.741 64.008 98.581  1.00 50.03  ? 214 PHE B CA  1 
ATOM   3436 C C   . PHE B 1 214 ? -133.979 64.889 98.507  1.00 57.38  ? 214 PHE B C   1 
ATOM   3437 O O   . PHE B 1 214 ? -134.544 65.272 99.532  1.00 59.32  ? 214 PHE B O   1 
ATOM   3438 C CB  . PHE B 1 214 ? -133.073 62.688 99.282  1.00 42.40  ? 214 PHE B CB  1 
ATOM   3439 C CG  . PHE B 1 214 ? -131.986 61.656 99.178  1.00 41.72  ? 214 PHE B CG  1 
ATOM   3440 C CD1 . PHE B 1 214 ? -130.947 61.624 100.094 1.00 41.30  ? 214 PHE B CD1 1 
ATOM   3441 C CD2 . PHE B 1 214 ? -132.003 60.713 98.160  1.00 43.92  ? 214 PHE B CD2 1 
ATOM   3442 C CE1 . PHE B 1 214 ? -129.944 60.666 99.994  1.00 41.88  ? 214 PHE B CE1 1 
ATOM   3443 C CE2 . PHE B 1 214 ? -131.004 59.758 98.057  1.00 41.28  ? 214 PHE B CE2 1 
ATOM   3444 C CZ  . PHE B 1 214 ? -129.975 59.735 98.974  1.00 38.71  ? 214 PHE B CZ  1 
ATOM   3445 N N   . ASP B 1 215 ? -134.392 65.210 97.286  1.00 62.42  ? 215 ASP B N   1 
ATOM   3446 C CA  . ASP B 1 215 ? -135.612 65.973 97.068  1.00 67.35  ? 215 ASP B CA  1 
ATOM   3447 C C   . ASP B 1 215 ? -136.805 65.025 97.039  1.00 66.29  ? 215 ASP B C   1 
ATOM   3448 O O   . ASP B 1 215 ? -136.716 63.927 96.490  1.00 63.45  ? 215 ASP B O   1 
ATOM   3449 C CB  . ASP B 1 215 ? -135.530 66.772 95.765  1.00 75.41  ? 215 ASP B CB  1 
ATOM   3450 C CG  . ASP B 1 215 ? -134.340 67.716 95.730  1.00 79.55  ? 215 ASP B CG  1 
ATOM   3451 O OD1 . ASP B 1 215 ? -134.404 68.774 96.386  1.00 79.89  ? 215 ASP B OD1 1 
ATOM   3452 O OD2 . ASP B 1 215 ? -133.346 67.405 95.037  1.00 82.82  ? 215 ASP B OD2 1 
ATOM   3453 N N   . ASP B 1 216 ? -137.915 65.446 97.637  1.00 70.49  ? 216 ASP B N   1 
ATOM   3454 C CA  . ASP B 1 216 ? -139.125 64.632 97.647  1.00 74.91  ? 216 ASP B CA  1 
ATOM   3455 C C   . ASP B 1 216 ? -139.663 64.443 96.233  1.00 76.52  ? 216 ASP B C   1 
ATOM   3456 O O   . ASP B 1 216 ? -139.568 65.343 95.400  1.00 75.88  ? 216 ASP B O   1 
ATOM   3457 C CB  . ASP B 1 216 ? -140.194 65.263 98.542  1.00 80.65  ? 216 ASP B CB  1 
ATOM   3458 C CG  . ASP B 1 216 ? -139.850 65.168 100.014 1.00 85.14  ? 216 ASP B CG  1 
ATOM   3459 O OD1 . ASP B 1 216 ? -140.349 64.241 100.686 1.00 85.90  ? 216 ASP B OD1 1 
ATOM   3460 O OD2 . ASP B 1 216 ? -139.079 66.019 100.501 1.00 89.02  ? 216 ASP B OD2 1 
ATOM   3461 N N   . SER B 1 217 ? -140.224 63.267 95.970  1.00 79.49  ? 217 SER B N   1 
ATOM   3462 C CA  . SER B 1 217 ? -140.734 62.936 94.645  1.00 83.40  ? 217 SER B CA  1 
ATOM   3463 C C   . SER B 1 217 ? -141.980 62.059 94.737  1.00 86.14  ? 217 SER B C   1 
ATOM   3464 O O   . SER B 1 217 ? -142.140 61.290 95.686  1.00 83.81  ? 217 SER B O   1 
ATOM   3465 C CB  . SER B 1 217 ? -139.655 62.229 93.821  1.00 83.93  ? 217 SER B CB  1 
ATOM   3466 O OG  . SER B 1 217 ? -140.160 61.797 92.568  1.00 89.01  ? 217 SER B OG  1 
ATOM   3467 N N   . SER B 1 218 ? -142.864 62.180 93.751  1.00 92.56  ? 218 SER B N   1 
ATOM   3468 C CA  . SER B 1 218 ? -144.058 61.345 93.686  1.00 98.59  ? 218 SER B CA  1 
ATOM   3469 C C   . SER B 1 218 ? -143.726 59.963 93.140  1.00 100.05 ? 218 SER B C   1 
ATOM   3470 O O   . SER B 1 218 ? -144.475 59.006 93.341  1.00 103.18 ? 218 SER B O   1 
ATOM   3471 C CB  . SER B 1 218 ? -145.128 62.001 92.813  1.00 105.98 ? 218 SER B CB  1 
ATOM   3472 O OG  . SER B 1 218 ? -145.523 63.252 93.341  1.00 111.36 ? 218 SER B OG  1 
ATOM   3473 N N   . THR B 1 219 ? -142.600 59.866 92.444  1.00 95.94  ? 219 THR B N   1 
ATOM   3474 C CA  . THR B 1 219 ? -142.222 58.622 91.792  1.00 90.10  ? 219 THR B CA  1 
ATOM   3475 C C   . THR B 1 219 ? -140.922 58.053 92.356  1.00 84.06  ? 219 THR B C   1 
ATOM   3476 O O   . THR B 1 219 ? -140.014 58.793 92.736  1.00 80.09  ? 219 THR B O   1 
ATOM   3477 C CB  . THR B 1 219 ? -142.087 58.818 90.271  1.00 90.60  ? 219 THR B CB  1 
ATOM   3478 O OG1 . THR B 1 219 ? -141.177 59.892 90.003  1.00 89.81  ? 219 THR B OG1 1 
ATOM   3479 C CG2 . THR B 1 219 ? -143.441 59.154 89.665  1.00 94.47  ? 219 THR B CG2 1 
ATOM   3480 N N   . PHE B 1 220 ? -140.852 56.728 92.411  1.00 83.58  ? 220 PHE B N   1 
ATOM   3481 C CA  . PHE B 1 220 ? -139.692 56.021 92.937  1.00 77.85  ? 220 PHE B CA  1 
ATOM   3482 C C   . PHE B 1 220 ? -138.835 55.529 91.776  1.00 79.53  ? 220 PHE B C   1 
ATOM   3483 O O   . PHE B 1 220 ? -138.084 56.296 91.170  1.00 77.06  ? 220 PHE B O   1 
ATOM   3484 C CB  . PHE B 1 220 ? -140.141 54.848 93.811  1.00 71.96  ? 220 PHE B CB  1 
ATOM   3485 C CG  . PHE B 1 220 ? -139.069 54.304 94.713  1.00 64.15  ? 220 PHE B CG  1 
ATOM   3486 C CD1 . PHE B 1 220 ? -137.925 55.038 94.984  1.00 58.17  ? 220 PHE B CD1 1 
ATOM   3487 C CD2 . PHE B 1 220 ? -139.208 53.047 95.287  1.00 64.53  ? 220 PHE B CD2 1 
ATOM   3488 C CE1 . PHE B 1 220 ? -136.940 54.531 95.816  1.00 56.67  ? 220 PHE B CE1 1 
ATOM   3489 C CE2 . PHE B 1 220 ? -138.228 52.531 96.119  1.00 61.16  ? 220 PHE B CE2 1 
ATOM   3490 C CZ  . PHE B 1 220 ? -137.093 53.272 96.384  1.00 59.00  ? 220 PHE B CZ  1 
ATOM   3491 N N   . TYR B 1 221 ? -138.954 54.239 91.474  1.00 83.27  ? 221 TYR B N   1 
ATOM   3492 C CA  . TYR B 1 221 ? -138.366 53.676 90.266  1.00 86.98  ? 221 TYR B CA  1 
ATOM   3493 C C   . TYR B 1 221 ? -139.246 52.544 89.745  1.00 91.90  ? 221 TYR B C   1 
ATOM   3494 O O   . TYR B 1 221 ? -139.927 51.868 90.517  1.00 92.53  ? 221 TYR B O   1 
ATOM   3495 C CB  . TYR B 1 221 ? -136.931 53.189 90.518  1.00 85.06  ? 221 TYR B CB  1 
ATOM   3496 C CG  . TYR B 1 221 ? -136.798 51.979 91.424  1.00 84.51  ? 221 TYR B CG  1 
ATOM   3497 C CD1 . TYR B 1 221 ? -136.873 50.688 90.911  1.00 85.59  ? 221 TYR B CD1 1 
ATOM   3498 C CD2 . TYR B 1 221 ? -136.566 52.129 92.785  1.00 82.18  ? 221 TYR B CD2 1 
ATOM   3499 C CE1 . TYR B 1 221 ? -136.743 49.583 91.732  1.00 84.96  ? 221 TYR B CE1 1 
ATOM   3500 C CE2 . TYR B 1 221 ? -136.433 51.028 93.613  1.00 81.90  ? 221 TYR B CE2 1 
ATOM   3501 C CZ  . TYR B 1 221 ? -136.522 49.759 93.081  1.00 83.79  ? 221 TYR B CZ  1 
ATOM   3502 O OH  . TYR B 1 221 ? -136.391 48.660 93.901  1.00 84.25  ? 221 TYR B OH  1 
ATOM   3503 N N   . THR B 1 222 ? -139.235 52.349 88.430  1.00 95.24  ? 222 THR B N   1 
ATOM   3504 C CA  . THR B 1 222 ? -140.058 51.328 87.796  1.00 98.68  ? 222 THR B CA  1 
ATOM   3505 C C   . THR B 1 222 ? -139.188 50.185 87.280  1.00 97.26  ? 222 THR B C   1 
ATOM   3506 O O   . THR B 1 222 ? -138.039 50.397 86.894  1.00 95.59  ? 222 THR B O   1 
ATOM   3507 C CB  . THR B 1 222 ? -140.877 51.913 86.626  1.00 106.76 ? 222 THR B CB  1 
ATOM   3508 O OG1 . THR B 1 222 ? -141.379 53.204 86.990  1.00 110.05 ? 222 THR B OG1 1 
ATOM   3509 C CG2 . THR B 1 222 ? -142.040 51.002 86.265  1.00 111.61 ? 222 THR B CG2 1 
ATOM   3510 N N   . LEU B 1 223 ? -139.737 48.974 87.281  1.00 98.05  ? 223 LEU B N   1 
ATOM   3511 C CA  . LEU B 1 223 ? -139.036 47.818 86.738  1.00 98.58  ? 223 LEU B CA  1 
ATOM   3512 C C   . LEU B 1 223 ? -139.739 47.271 85.502  1.00 103.08 ? 223 LEU B C   1 
ATOM   3513 O O   . LEU B 1 223 ? -140.957 47.090 85.506  1.00 105.63 ? 223 LEU B O   1 
ATOM   3514 C CB  . LEU B 1 223 ? -138.910 46.716 87.792  1.00 96.63  ? 223 LEU B CB  1 
ATOM   3515 C CG  . LEU B 1 223 ? -137.902 46.961 88.916  1.00 92.08  ? 223 LEU B CG  1 
ATOM   3516 C CD1 . LEU B 1 223 ? -137.817 45.756 89.843  1.00 90.26  ? 223 LEU B CD1 1 
ATOM   3517 C CD2 . LEU B 1 223 ? -136.537 47.295 88.338  1.00 91.48  ? 223 LEU B CD2 1 
ATOM   3518 N N   . PRO B 1 224 ? -138.970 47.019 84.430  1.00 104.70 ? 224 PRO B N   1 
ATOM   3519 C CA  . PRO B 1 224 ? -139.498 46.330 83.246  1.00 108.06 ? 224 PRO B CA  1 
ATOM   3520 C C   . PRO B 1 224 ? -140.011 44.943 83.616  1.00 109.38 ? 224 PRO B C   1 
ATOM   3521 O O   . PRO B 1 224 ? -139.517 44.357 84.579  1.00 105.84 ? 224 PRO B O   1 
ATOM   3522 C CB  . PRO B 1 224 ? -138.283 46.236 82.316  1.00 106.82 ? 224 PRO B CB  1 
ATOM   3523 C CG  . PRO B 1 224 ? -137.384 47.342 82.754  1.00 104.55 ? 224 PRO B CG  1 
ATOM   3524 C CD  . PRO B 1 224 ? -137.577 47.459 84.237  1.00 101.95 ? 224 PRO B CD  1 
ATOM   3525 N N   . ASP B 1 225 ? -140.983 44.425 82.871  1.00 115.35 ? 225 ASP B N   1 
ATOM   3526 C CA  . ASP B 1 225 ? -141.560 43.120 83.187  1.00 118.27 ? 225 ASP B CA  1 
ATOM   3527 C C   . ASP B 1 225 ? -140.623 41.975 82.814  1.00 116.00 ? 225 ASP B C   1 
ATOM   3528 O O   . ASP B 1 225 ? -140.788 40.852 83.290  1.00 116.80 ? 225 ASP B O   1 
ATOM   3529 C CB  . ASP B 1 225 ? -142.910 42.942 82.486  1.00 127.33 ? 225 ASP B CB  1 
ATOM   3530 C CG  . ASP B 1 225 ? -143.987 43.850 83.053  1.00 131.56 ? 225 ASP B CG  1 
ATOM   3531 O OD1 . ASP B 1 225 ? -143.780 44.411 84.150  1.00 128.96 ? 225 ASP B OD1 1 
ATOM   3532 O OD2 . ASP B 1 225 ? -145.045 43.994 82.404  1.00 137.61 ? 225 ASP B OD2 1 
ATOM   3533 N N   . GLY B 1 226 ? -139.638 42.262 81.970  1.00 115.34 ? 226 GLY B N   1 
ATOM   3534 C CA  . GLY B 1 226 ? -138.707 41.242 81.523  1.00 116.75 ? 226 GLY B CA  1 
ATOM   3535 C C   . GLY B 1 226 ? -137.386 41.244 82.271  1.00 112.85 ? 226 GLY B C   1 
ATOM   3536 O O   . GLY B 1 226 ? -136.465 40.508 81.914  1.00 111.80 ? 226 GLY B O   1 
ATOM   3537 N N   . ILE B 1 227 ? -137.286 42.064 83.313  1.00 110.22 ? 227 ILE B N   1 
ATOM   3538 C CA  . ILE B 1 227 ? -136.034 42.184 84.047  1.00 107.03 ? 227 ILE B CA  1 
ATOM   3539 C C   . ILE B 1 227 ? -135.871 41.019 85.027  1.00 107.43 ? 227 ILE B C   1 
ATOM   3540 O O   . ILE B 1 227 ? -136.844 40.529 85.603  1.00 108.27 ? 227 ILE B O   1 
ATOM   3541 C CB  . ILE B 1 227 ? -135.935 43.553 84.783  1.00 100.74 ? 227 ILE B CB  1 
ATOM   3542 C CG1 . ILE B 1 227 ? -134.478 44.024 84.853  1.00 98.11  ? 227 ILE B CG1 1 
ATOM   3543 C CG2 . ILE B 1 227 ? -136.577 43.505 86.168  1.00 97.43  ? 227 ILE B CG2 1 
ATOM   3544 C CD1 . ILE B 1 227 ? -134.327 45.453 85.330  1.00 96.53  ? 227 ILE B CD1 1 
ATOM   3545 N N   . GLN B 1 228 ? -134.633 40.557 85.178  1.00 106.98 ? 228 GLN B N   1 
ATOM   3546 C CA  . GLN B 1 228 ? -134.329 39.448 86.075  1.00 105.49 ? 228 GLN B CA  1 
ATOM   3547 C C   . GLN B 1 228 ? -133.469 39.939 87.234  1.00 98.75  ? 228 GLN B C   1 
ATOM   3548 O O   . GLN B 1 228 ? -132.769 40.945 87.110  1.00 94.94  ? 228 GLN B O   1 
ATOM   3549 C CB  . GLN B 1 228 ? -133.622 38.319 85.322  1.00 110.15 ? 228 GLN B CB  1 
ATOM   3550 C CG  . GLN B 1 228 ? -134.425 37.735 84.160  1.00 117.45 ? 228 GLN B CG  1 
ATOM   3551 C CD  . GLN B 1 228 ? -135.716 37.068 84.608  1.00 121.25 ? 228 GLN B CD  1 
ATOM   3552 O OE1 . GLN B 1 228 ? -135.708 35.939 85.101  1.00 121.98 ? 228 GLN B OE1 1 
ATOM   3553 N NE2 . GLN B 1 228 ? -136.834 37.764 84.433  1.00 122.83 ? 228 GLN B NE2 1 
ATOM   3554 N N   . SER B 1 229 ? -133.520 39.228 88.357  1.00 92.82  ? 229 SER B N   1 
ATOM   3555 C CA  . SER B 1 229 ? -132.819 39.662 89.560  1.00 82.73  ? 229 SER B CA  1 
ATOM   3556 C C   . SER B 1 229 ? -132.049 38.541 90.249  1.00 77.26  ? 229 SER B C   1 
ATOM   3557 O O   . SER B 1 229 ? -132.340 37.359 90.057  1.00 78.70  ? 229 SER B O   1 
ATOM   3558 C CB  . SER B 1 229 ? -133.808 40.284 90.548  1.00 80.53  ? 229 SER B CB  1 
ATOM   3559 O OG  . SER B 1 229 ? -134.872 39.394 90.830  1.00 82.50  ? 229 SER B OG  1 
ATOM   3560 N N   . VAL B 1 230 ? -131.059 38.929 91.047  1.00 71.08  ? 230 VAL B N   1 
ATOM   3561 C CA  . VAL B 1 230 ? -130.317 37.985 91.871  1.00 67.60  ? 230 VAL B CA  1 
ATOM   3562 C C   . VAL B 1 230 ? -130.163 38.557 93.278  1.00 62.22  ? 230 VAL B C   1 
ATOM   3563 O O   . VAL B 1 230 ? -130.084 39.772 93.462  1.00 58.32  ? 230 VAL B O   1 
ATOM   3564 C CB  . VAL B 1 230 ? -128.925 37.659 91.270  1.00 71.80  ? 230 VAL B CB  1 
ATOM   3565 C CG1 . VAL B 1 230 ? -127.990 38.852 91.379  1.00 68.05  ? 230 VAL B CG1 1 
ATOM   3566 C CG2 . VAL B 1 230 ? -128.317 36.438 91.953  1.00 75.23  ? 230 VAL B CG2 1 
ATOM   3567 N N   . THR B 1 231 ? -130.150 37.680 94.273  1.00 62.55  ? 231 THR B N   1 
ATOM   3568 C CA  . THR B 1 231 ? -129.975 38.112 95.651  1.00 62.82  ? 231 THR B CA  1 
ATOM   3569 C C   . THR B 1 231 ? -128.492 38.186 96.002  1.00 63.08  ? 231 THR B C   1 
ATOM   3570 O O   . THR B 1 231 ? -127.769 37.194 95.926  1.00 64.25  ? 231 THR B O   1 
ATOM   3571 C CB  . THR B 1 231 ? -130.710 37.178 96.634  1.00 64.71  ? 231 THR B CB  1 
ATOM   3572 O OG1 . THR B 1 231 ? -132.120 37.421 96.548  1.00 66.12  ? 231 THR B OG1 1 
ATOM   3573 C CG2 . THR B 1 231 ? -130.252 37.433 98.064  1.00 60.46  ? 231 THR B CG2 1 
ATOM   3574 N N   . ILE B 1 232 ? -128.044 39.381 96.371  1.00 61.32  ? 232 ILE B N   1 
ATOM   3575 C CA  . ILE B 1 232 ? -126.642 39.611 96.700  1.00 60.41  ? 232 ILE B CA  1 
ATOM   3576 C C   . ILE B 1 232 ? -126.331 39.115 98.114  1.00 60.67  ? 232 ILE B C   1 
ATOM   3577 O O   . ILE B 1 232 ? -125.296 38.490 98.352  1.00 60.97  ? 232 ILE B O   1 
ATOM   3578 C CB  . ILE B 1 232 ? -126.282 41.104 96.550  1.00 57.82  ? 232 ILE B CB  1 
ATOM   3579 C CG1 . ILE B 1 232 ? -126.319 41.498 95.069  1.00 60.24  ? 232 ILE B CG1 1 
ATOM   3580 C CG2 . ILE B 1 232 ? -124.915 41.400 97.143  1.00 55.36  ? 232 ILE B CG2 1 
ATOM   3581 C CD1 . ILE B 1 232 ? -126.180 42.983 94.810  1.00 60.87  ? 232 ILE B CD1 1 
ATOM   3582 N N   . GLY B 1 233 ? -127.241 39.376 99.047  1.00 59.62  ? 233 GLY B N   1 
ATOM   3583 C CA  . GLY B 1 233 ? -127.097 38.860 100.393 1.00 60.58  ? 233 GLY B CA  1 
ATOM   3584 C C   . GLY B 1 233 ? -127.865 39.660 101.421 1.00 61.66  ? 233 GLY B C   1 
ATOM   3585 O O   . GLY B 1 233 ? -128.617 40.575 101.082 1.00 58.68  ? 233 GLY B O   1 
ATOM   3586 N N   . HIS B 1 234 ? -127.675 39.313 102.687 1.00 61.98  ? 234 HIS B N   1 
ATOM   3587 C CA  . HIS B 1 234 ? -128.359 40.011 103.763 1.00 62.74  ? 234 HIS B CA  1 
ATOM   3588 C C   . HIS B 1 234 ? -127.397 40.380 104.885 1.00 58.15  ? 234 HIS B C   1 
ATOM   3589 O O   . HIS B 1 234 ? -126.332 39.777 105.036 1.00 54.00  ? 234 HIS B O   1 
ATOM   3590 C CB  . HIS B 1 234 ? -129.503 39.158 104.306 1.00 70.34  ? 234 HIS B CB  1 
ATOM   3591 C CG  . HIS B 1 234 ? -129.080 37.782 104.719 1.00 77.46  ? 234 HIS B CG  1 
ATOM   3592 N ND1 . HIS B 1 234 ? -128.369 37.538 105.874 1.00 80.17  ? 234 HIS B ND1 1 
ATOM   3593 C CD2 . HIS B 1 234 ? -129.258 36.580 104.124 1.00 82.23  ? 234 HIS B CD2 1 
ATOM   3594 C CE1 . HIS B 1 234 ? -128.133 36.242 105.977 1.00 84.69  ? 234 HIS B CE1 1 
ATOM   3595 N NE2 . HIS B 1 234 ? -128.661 35.638 104.928 1.00 85.58  ? 234 HIS B NE2 1 
ATOM   3596 N N   . LEU B 1 235 ? -127.781 41.386 105.660 1.00 59.15  ? 235 LEU B N   1 
ATOM   3597 C CA  . LEU B 1 235 ? -127.007 41.821 106.812 1.00 56.18  ? 235 LEU B CA  1 
ATOM   3598 C C   . LEU B 1 235 ? -127.880 41.738 108.056 1.00 56.03  ? 235 LEU B C   1 
ATOM   3599 O O   . LEU B 1 235 ? -129.072 42.028 108.005 1.00 55.21  ? 235 LEU B O   1 
ATOM   3600 C CB  . LEU B 1 235 ? -126.484 43.244 106.616 1.00 51.63  ? 235 LEU B CB  1 
ATOM   3601 C CG  . LEU B 1 235 ? -125.377 43.411 105.576 1.00 46.76  ? 235 LEU B CG  1 
ATOM   3602 C CD1 . LEU B 1 235 ? -125.134 44.882 105.270 1.00 42.10  ? 235 LEU B CD1 1 
ATOM   3603 C CD2 . LEU B 1 235 ? -124.091 42.738 106.037 1.00 42.52  ? 235 LEU B CD2 1 
ATOM   3604 N N   . ARG B 1 236 ? -127.288 41.325 109.172 1.00 57.65  ? 236 ARG B N   1 
ATOM   3605 C CA  . ARG B 1 236 ? -128.049 41.159 110.405 1.00 57.48  ? 236 ARG B CA  1 
ATOM   3606 C C   . ARG B 1 236 ? -127.231 41.466 111.651 1.00 59.89  ? 236 ARG B C   1 
ATOM   3607 O O   . ARG B 1 236 ? -126.769 40.557 112.346 1.00 62.18  ? 236 ARG B O   1 
ATOM   3608 C CB  . ARG B 1 236 ? -128.626 39.743 110.485 1.00 60.77  ? 236 ARG B CB  1 
ATOM   3609 C CG  . ARG B 1 236 ? -129.560 39.510 111.671 1.00 63.29  ? 236 ARG B CG  1 
ATOM   3610 C CD  . ARG B 1 236 ? -130.748 40.456 111.653 1.00 62.77  ? 236 ARG B CD  1 
ATOM   3611 N NE  . ARG B 1 236 ? -131.785 40.029 112.588 1.00 66.72  ? 236 ARG B NE  1 
ATOM   3612 C CZ  . ARG B 1 236 ? -131.892 40.460 113.840 1.00 65.05  ? 236 ARG B CZ  1 
ATOM   3613 N NH1 . ARG B 1 236 ? -131.023 41.339 114.324 1.00 66.60  ? 236 ARG B NH1 1 
ATOM   3614 N NH2 . ARG B 1 236 ? -132.872 40.010 114.610 1.00 62.72  ? 236 ARG B NH2 1 
ATOM   3615 N N   . PRO B 1 237 ? -127.048 42.772 111.935 1.00 57.51  ? 237 PRO B N   1 
ATOM   3616 C CA  . PRO B 1 237 ? -126.492 43.168 113.231 1.00 56.18  ? 237 PRO B CA  1 
ATOM   3617 C C   . PRO B 1 237 ? -127.518 43.030 114.347 1.00 55.77  ? 237 PRO B C   1 
ATOM   3618 O O   . PRO B 1 237 ? -128.579 42.445 114.124 1.00 51.86  ? 237 PRO B O   1 
ATOM   3619 C CB  . PRO B 1 237 ? -126.123 44.644 113.022 1.00 52.28  ? 237 PRO B CB  1 
ATOM   3620 C CG  . PRO B 1 237 ? -127.098 45.102 111.994 1.00 52.04  ? 237 PRO B CG  1 
ATOM   3621 C CD  . PRO B 1 237 ? -127.237 43.946 111.062 1.00 54.05  ? 237 PRO B CD  1 
ATOM   3622 N N   . GLY B 1 238 ? -127.208 43.575 115.522 1.00 60.24  ? 238 GLY B N   1 
ATOM   3623 C CA  . GLY B 1 238 ? -128.045 43.419 116.703 1.00 60.23  ? 238 GLY B CA  1 
ATOM   3624 C C   . GLY B 1 238 ? -129.499 43.825 116.564 1.00 60.44  ? 238 GLY B C   1 
ATOM   3625 O O   . GLY B 1 238 ? -130.383 43.085 116.972 1.00 64.53  ? 238 GLY B O   1 
ATOM   3626 N N   . HIS B 1 239 ? -129.759 44.994 115.989 1.00 61.69  ? 239 HIS B N   1 
ATOM   3627 C CA  . HIS B 1 239 ? -131.119 45.534 116.011 1.00 62.30  ? 239 HIS B CA  1 
ATOM   3628 C C   . HIS B 1 239 ? -131.608 46.009 114.650 1.00 57.79  ? 239 HIS B C   1 
ATOM   3629 O O   . HIS B 1 239 ? -132.560 46.785 114.559 1.00 54.59  ? 239 HIS B O   1 
ATOM   3630 C CB  . HIS B 1 239 ? -131.201 46.669 117.037 1.00 63.25  ? 239 HIS B CB  1 
ATOM   3631 C CG  . HIS B 1 239 ? -130.800 46.245 118.415 1.00 69.41  ? 239 HIS B CG  1 
ATOM   3632 N ND1 . HIS B 1 239 ? -131.698 45.746 119.331 1.00 73.27  ? 239 HIS B ND1 1 
ATOM   3633 C CD2 . HIS B 1 239 ? -129.587 46.206 119.016 1.00 70.18  ? 239 HIS B CD2 1 
ATOM   3634 C CE1 . HIS B 1 239 ? -131.059 45.434 120.447 1.00 77.28  ? 239 HIS B CE1 1 
ATOM   3635 N NE2 . HIS B 1 239 ? -129.777 45.704 120.280 1.00 74.52  ? 239 HIS B NE2 1 
ATOM   3636 N N   . HIS B 1 240 ? -130.959 45.530 113.594 1.00 58.90  ? 240 HIS B N   1 
ATOM   3637 C CA  . HIS B 1 240 ? -131.331 45.904 112.234 1.00 59.72  ? 240 HIS B CA  1 
ATOM   3638 C C   . HIS B 1 240 ? -131.151 44.744 111.263 1.00 60.74  ? 240 HIS B C   1 
ATOM   3639 O O   . HIS B 1 240 ? -130.417 43.793 111.535 1.00 63.95  ? 240 HIS B O   1 
ATOM   3640 C CB  . HIS B 1 240 ? -130.512 47.110 111.760 1.00 55.95  ? 240 HIS B CB  1 
ATOM   3641 C CG  . HIS B 1 240 ? -130.679 48.326 112.615 1.00 57.34  ? 240 HIS B CG  1 
ATOM   3642 N ND1 . HIS B 1 240 ? -129.885 48.575 113.714 1.00 60.36  ? 240 HIS B ND1 1 
ATOM   3643 C CD2 . HIS B 1 240 ? -131.561 49.352 112.548 1.00 55.64  ? 240 HIS B CD2 1 
ATOM   3644 C CE1 . HIS B 1 240 ? -130.266 49.708 114.282 1.00 57.37  ? 240 HIS B CE1 1 
ATOM   3645 N NE2 . HIS B 1 240 ? -131.280 50.196 113.592 1.00 56.78  ? 240 HIS B NE2 1 
ATOM   3646 N N   . ALA B 1 241 ? -131.835 44.830 110.129 1.00 58.69  ? 241 ALA B N   1 
ATOM   3647 C CA  . ALA B 1 241 ? -131.736 43.815 109.091 1.00 58.89  ? 241 ALA B CA  1 
ATOM   3648 C C   . ALA B 1 241 ? -131.760 44.471 107.718 1.00 54.49  ? 241 ALA B C   1 
ATOM   3649 O O   . ALA B 1 241 ? -132.509 45.424 107.496 1.00 53.23  ? 241 ALA B O   1 
ATOM   3650 C CB  . ALA B 1 241 ? -132.862 42.813 109.222 1.00 60.14  ? 241 ALA B CB  1 
ATOM   3651 N N   . ALA B 1 242 ? -130.941 43.966 106.800 1.00 51.98  ? 242 ALA B N   1 
ATOM   3652 C CA  . ALA B 1 242 ? -130.893 44.528 105.454 1.00 52.95  ? 242 ALA B CA  1 
ATOM   3653 C C   . ALA B 1 242 ? -130.885 43.447 104.387 1.00 52.64  ? 242 ALA B C   1 
ATOM   3654 O O   . ALA B 1 242 ? -130.252 42.403 104.537 1.00 50.62  ? 242 ALA B O   1 
ATOM   3655 C CB  . ALA B 1 242 ? -129.675 45.435 105.292 1.00 53.75  ? 242 ALA B CB  1 
ATOM   3656 N N   . HIS B 1 243 ? -131.594 43.715 103.299 1.00 56.68  ? 243 HIS B N   1 
ATOM   3657 C CA  . HIS B 1 243 ? -131.645 42.793 102.176 1.00 57.37  ? 243 HIS B CA  1 
ATOM   3658 C C   . HIS B 1 243 ? -131.154 43.478 100.901 1.00 53.02  ? 243 HIS B C   1 
ATOM   3659 O O   . HIS B 1 243 ? -131.613 44.568 100.563 1.00 48.37  ? 243 HIS B O   1 
ATOM   3660 C CB  . HIS B 1 243 ? -133.063 42.264 101.986 1.00 60.67  ? 243 HIS B CB  1 
ATOM   3661 C CG  . HIS B 1 243 ? -133.190 41.288 100.862 1.00 68.10  ? 243 HIS B CG  1 
ATOM   3662 N ND1 . HIS B 1 243 ? -132.397 40.165 100.762 1.00 74.62  ? 243 HIS B ND1 1 
ATOM   3663 C CD2 . HIS B 1 243 ? -134.008 41.269 99.786  1.00 71.72  ? 243 HIS B CD2 1 
ATOM   3664 C CE1 . HIS B 1 243 ? -132.725 39.493 99.673  1.00 77.07  ? 243 HIS B CE1 1 
ATOM   3665 N NE2 . HIS B 1 243 ? -133.701 40.140 99.063  1.00 77.31  ? 243 HIS B NE2 1 
ATOM   3666 N N   . MET B 1 244 ? -130.222 42.839 100.197 1.00 52.01  ? 244 MET B N   1 
ATOM   3667 C CA  . MET B 1 244 ? -129.599 43.445 99.017  1.00 50.99  ? 244 MET B CA  1 
ATOM   3668 C C   . MET B 1 244 ? -129.917 42.660 97.739  1.00 51.32  ? 244 MET B C   1 
ATOM   3669 O O   . MET B 1 244 ? -129.678 41.455 97.660  1.00 49.71  ? 244 MET B O   1 
ATOM   3670 C CB  . MET B 1 244 ? -128.078 43.556 99.219  1.00 53.11  ? 244 MET B CB  1 
ATOM   3671 C CG  . MET B 1 244 ? -127.311 44.253 98.082  1.00 58.41  ? 244 MET B CG  1 
ATOM   3672 S SD  . MET B 1 244 ? -127.358 46.059 98.105  1.00 118.62 ? 244 MET B SD  1 
ATOM   3673 C CE  . MET B 1 244 ? -126.365 46.455 96.662  1.00 67.64  ? 244 MET B CE  1 
ATOM   3674 N N   . GLN B 1 245 ? -130.461 43.353 96.742  1.00 54.60  ? 245 GLN B N   1 
ATOM   3675 C CA  . GLN B 1 245 ? -130.828 42.721 95.477  1.00 60.28  ? 245 GLN B CA  1 
ATOM   3676 C C   . GLN B 1 245 ? -130.322 43.495 94.272  1.00 60.09  ? 245 GLN B C   1 
ATOM   3677 O O   . GLN B 1 245 ? -129.959 44.670 94.377  1.00 58.11  ? 245 GLN B O   1 
ATOM   3678 C CB  . GLN B 1 245 ? -132.340 42.578 95.362  1.00 65.54  ? 245 GLN B CB  1 
ATOM   3679 C CG  . GLN B 1 245 ? -132.945 41.602 96.329  1.00 71.86  ? 245 GLN B CG  1 
ATOM   3680 C CD  . GLN B 1 245 ? -134.453 41.582 96.244  1.00 78.93  ? 245 GLN B CD  1 
ATOM   3681 O OE1 . GLN B 1 245 ? -135.141 42.144 97.096  1.00 79.13  ? 245 GLN B OE1 1 
ATOM   3682 N NE2 . GLN B 1 245 ? -134.978 40.936 95.210  1.00 84.03  ? 245 GLN B NE2 1 
ATOM   3683 N N   . CYS B 1 246 ? -130.324 42.834 93.119  1.00 58.38  ? 246 CYS B N   1 
ATOM   3684 C CA  . CYS B 1 246 ? -129.943 43.478 91.872  1.00 54.78  ? 246 CYS B CA  1 
ATOM   3685 C C   . CYS B 1 246 ? -130.839 43.075 90.710  1.00 58.08  ? 246 CYS B C   1 
ATOM   3686 O O   . CYS B 1 246 ? -130.844 41.920 90.298  1.00 65.89  ? 246 CYS B O   1 
ATOM   3687 C CB  . CYS B 1 246 ? -128.494 43.156 91.522  1.00 52.48  ? 246 CYS B CB  1 
ATOM   3688 S SG  . CYS B 1 246 ? -128.018 43.762 89.886  1.00 65.94  ? 246 CYS B SG  1 
ATOM   3689 N N   . TRP B 1 247 ? -131.591 44.038 90.187  1.00 60.04  ? 247 TRP B N   1 
ATOM   3690 C CA  . TRP B 1 247 ? -132.296 43.876 88.921  1.00 64.61  ? 247 TRP B CA  1 
ATOM   3691 C C   . TRP B 1 247 ? -131.466 44.514 87.819  1.00 68.03  ? 247 TRP B C   1 
ATOM   3692 O O   . TRP B 1 247 ? -130.942 45.613 87.996  1.00 69.58  ? 247 TRP B O   1 
ATOM   3693 C CB  . TRP B 1 247 ? -133.674 44.528 88.961  1.00 69.74  ? 247 TRP B CB  1 
ATOM   3694 C CG  . TRP B 1 247 ? -134.609 43.944 89.959  1.00 73.40  ? 247 TRP B CG  1 
ATOM   3695 C CD1 . TRP B 1 247 ? -135.586 43.025 89.722  1.00 76.63  ? 247 TRP B CD1 1 
ATOM   3696 C CD2 . TRP B 1 247 ? -134.674 44.250 91.356  1.00 72.28  ? 247 TRP B CD2 1 
ATOM   3697 N NE1 . TRP B 1 247 ? -136.252 42.734 90.886  1.00 76.06  ? 247 TRP B NE1 1 
ATOM   3698 C CE2 . TRP B 1 247 ? -135.710 43.473 91.905  1.00 73.54  ? 247 TRP B CE2 1 
ATOM   3699 C CE3 . TRP B 1 247 ? -133.953 45.104 92.196  1.00 70.34  ? 247 TRP B CE3 1 
ATOM   3700 C CZ2 . TRP B 1 247 ? -136.045 43.522 93.254  1.00 74.85  ? 247 TRP B CZ2 1 
ATOM   3701 C CZ3 . TRP B 1 247 ? -134.285 45.152 93.534  1.00 71.92  ? 247 TRP B CZ3 1 
ATOM   3702 C CH2 . TRP B 1 247 ? -135.323 44.366 94.052  1.00 73.74  ? 247 TRP B CH2 1 
ATOM   3703 N N   . SER B 1 248 ? -131.349 43.843 86.680  1.00 72.71  ? 248 SER B N   1 
ATOM   3704 C CA  . SER B 1 248 ? -130.549 44.389 85.589  1.00 74.84  ? 248 SER B CA  1 
ATOM   3705 C C   . SER B 1 248 ? -130.946 43.836 84.223  1.00 79.66  ? 248 SER B C   1 
ATOM   3706 O O   . SER B 1 248 ? -131.238 42.650 84.082  1.00 79.76  ? 248 SER B O   1 
ATOM   3707 C CB  . SER B 1 248 ? -129.064 44.122 85.847  1.00 71.85  ? 248 SER B CB  1 
ATOM   3708 O OG  . SER B 1 248 ? -128.255 44.904 84.988  1.00 73.86  ? 248 SER B OG  1 
ATOM   3709 N N   . LYS B 1 249 ? -130.954 44.714 83.223  1.00 84.59  ? 249 LYS B N   1 
ATOM   3710 C CA  . LYS B 1 249 ? -131.169 44.308 81.839  1.00 87.90  ? 249 LYS B CA  1 
ATOM   3711 C C   . LYS B 1 249 ? -129.875 43.726 81.281  1.00 88.51  ? 249 LYS B C   1 
ATOM   3712 O O   . LYS B 1 249 ? -129.851 43.169 80.183  1.00 92.09  ? 249 LYS B O   1 
ATOM   3713 C CB  . LYS B 1 249 ? -131.629 45.487 80.980  1.00 89.99  ? 249 LYS B CB  1 
ATOM   3714 C CG  . LYS B 1 249 ? -132.873 46.201 81.495  1.00 92.05  ? 249 LYS B CG  1 
ATOM   3715 C CD  . LYS B 1 249 ? -134.116 45.330 81.403  1.00 95.41  ? 249 LYS B CD  1 
ATOM   3716 C CE  . LYS B 1 249 ? -134.462 44.992 79.962  1.00 101.17 ? 249 LYS B CE  1 
ATOM   3717 N NZ  . LYS B 1 249 ? -135.711 44.185 79.875  1.00 102.53 ? 249 LYS B NZ  1 
ATOM   3718 N N   . SER B 1 250 ? -128.799 43.863 82.052  1.00 85.95  ? 250 SER B N   1 
ATOM   3719 C CA  . SER B 1 250 ? -127.485 43.369 81.659  1.00 86.91  ? 250 SER B CA  1 
ATOM   3720 C C   . SER B 1 250 ? -127.266 41.938 82.141  1.00 85.65  ? 250 SER B C   1 
ATOM   3721 O O   . SER B 1 250 ? -126.162 41.404 82.038  1.00 85.92  ? 250 SER B O   1 
ATOM   3722 C CB  . SER B 1 250 ? -126.386 44.274 82.219  1.00 83.89  ? 250 SER B CB  1 
ATOM   3723 O OG  . SER B 1 250 ? -126.717 45.642 82.066  1.00 83.76  ? 250 SER B OG  1 
ATOM   3724 N N   . MET B 1 251 ? -128.320 41.324 82.670  1.00 84.93  ? 251 MET B N   1 
ATOM   3725 C CA  . MET B 1 251 ? -128.216 39.987 83.243  1.00 86.72  ? 251 MET B CA  1 
ATOM   3726 C C   . MET B 1 251 ? -128.756 38.928 82.287  1.00 92.73  ? 251 MET B C   1 
ATOM   3727 O O   . MET B 1 251 ? -129.903 39.004 81.846  1.00 95.96  ? 251 MET B O   1 
ATOM   3728 C CB  . MET B 1 251 ? -128.963 39.923 84.574  1.00 86.62  ? 251 MET B CB  1 
ATOM   3729 C CG  . MET B 1 251 ? -128.389 38.931 85.572  1.00 86.36  ? 251 MET B CG  1 
ATOM   3730 S SD  . MET B 1 251 ? -129.297 38.948 87.131  1.00 110.19 ? 251 MET B SD  1 
ATOM   3731 C CE  . MET B 1 251 ? -129.266 40.696 87.526  1.00 81.10  ? 251 MET B CE  1 
ATOM   3732 N N   . ALA C 2 2   ? -120.443 80.033 128.668 1.00 88.98  ? 487 ALA C N   1 
ATOM   3733 C CA  . ALA C 2 2   ? -119.866 81.310 128.268 1.00 93.00  ? 487 ALA C CA  1 
ATOM   3734 C C   . ALA C 2 2   ? -120.697 82.479 128.791 1.00 94.23  ? 487 ALA C C   1 
ATOM   3735 O O   . ALA C 2 2   ? -120.201 83.313 129.551 1.00 96.81  ? 487 ALA C O   1 
ATOM   3736 C CB  . ALA C 2 2   ? -119.739 81.384 126.750 1.00 92.47  ? 487 ALA C CB  1 
ATOM   3737 N N   . ARG C 2 3   ? -121.964 82.533 128.386 1.00 91.37  ? 488 ARG C N   1 
ATOM   3738 C CA  . ARG C 2 3   ? -122.848 83.630 128.775 1.00 89.01  ? 488 ARG C CA  1 
ATOM   3739 C C   . ARG C 2 3   ? -123.975 83.173 129.703 1.00 84.25  ? 488 ARG C C   1 
ATOM   3740 O O   . ARG C 2 3   ? -124.634 82.164 129.450 1.00 81.45  ? 488 ARG C O   1 
ATOM   3741 C CB  . ARG C 2 3   ? -123.435 84.304 127.532 1.00 85.89  ? 488 ARG C CB  1 
ATOM   3742 C CG  . ARG C 2 3   ? -124.285 85.528 127.836 1.00 81.95  ? 488 ARG C CG  1 
ATOM   3743 C CD  . ARG C 2 3   ? -124.565 86.323 126.577 1.00 78.62  ? 488 ARG C CD  1 
ATOM   3744 N NE  . ARG C 2 3   ? -125.524 87.396 126.814 1.00 73.94  ? 488 ARG C NE  1 
ATOM   3745 C CZ  . ARG C 2 3   ? -126.578 87.634 126.041 1.00 71.64  ? 488 ARG C CZ  1 
ATOM   3746 N NH1 . ARG C 2 3   ? -126.807 86.876 124.976 1.00 72.06  ? 488 ARG C NH1 1 
ATOM   3747 N NH2 . ARG C 2 3   ? -127.402 88.630 126.330 1.00 71.53  ? 488 ARG C NH2 1 
ATOM   3748 N N   . TYR C 2 4   ? -124.193 83.931 130.775 1.00 82.95  ? 489 TYR C N   1 
ATOM   3749 C CA  . TYR C 2 4   ? -125.207 83.592 131.770 1.00 79.44  ? 489 TYR C CA  1 
ATOM   3750 C C   . TYR C 2 4   ? -126.151 84.765 132.045 1.00 78.36  ? 489 TYR C C   1 
ATOM   3751 O O   . TYR C 2 4   ? -125.855 85.908 131.694 1.00 83.15  ? 489 TYR C O   1 
ATOM   3752 C CB  . TYR C 2 4   ? -124.538 83.143 133.072 1.00 80.67  ? 489 TYR C CB  1 
ATOM   3753 C CG  . TYR C 2 4   ? -123.602 81.964 132.907 1.00 81.99  ? 489 TYR C CG  1 
ATOM   3754 C CD1 . TYR C 2 4   ? -124.003 80.824 132.221 1.00 81.82  ? 489 TYR C CD1 1 
ATOM   3755 C CD2 . TYR C 2 4   ? -122.313 81.996 133.425 1.00 85.24  ? 489 TYR C CD2 1 
ATOM   3756 C CE1 . TYR C 2 4   ? -123.152 79.745 132.064 1.00 82.60  ? 489 TYR C CE1 1 
ATOM   3757 C CE2 . TYR C 2 4   ? -121.453 80.921 133.271 1.00 87.10  ? 489 TYR C CE2 1 
ATOM   3758 C CZ  . TYR C 2 4   ? -121.878 79.799 132.590 1.00 85.74  ? 489 TYR C CZ  1 
ATOM   3759 O OH  . TYR C 2 4   ? -121.030 78.726 132.433 1.00 87.13  ? 489 TYR C OH  1 
ATOM   3760 N N   . GLY C 2 5   ? -127.288 84.474 132.673 1.00 74.08  ? 490 GLY C N   1 
ATOM   3761 C CA  . GLY C 2 5   ? -128.242 85.500 133.053 1.00 72.99  ? 490 GLY C CA  1 
ATOM   3762 C C   . GLY C 2 5   ? -128.810 85.251 134.438 1.00 74.11  ? 490 GLY C C   1 
ATOM   3763 O O   . GLY C 2 5   ? -129.253 84.146 134.745 1.00 76.52  ? 490 GLY C O   1 
ATOM   3764 N N   . VAL C 2 6   ? -128.790 86.279 135.279 1.00 74.27  ? 491 VAL C N   1 
ATOM   3765 C CA  . VAL C 2 6   ? -129.312 86.177 136.640 1.00 72.46  ? 491 VAL C CA  1 
ATOM   3766 C C   . VAL C 2 6   ? -130.489 87.127 136.832 1.00 72.88  ? 491 VAL C C   1 
ATOM   3767 O O   . VAL C 2 6   ? -130.398 88.305 136.484 1.00 76.82  ? 491 VAL C O   1 
ATOM   3768 C CB  . VAL C 2 6   ? -128.224 86.496 137.689 1.00 74.42  ? 491 VAL C CB  1 
ATOM   3769 C CG1 . VAL C 2 6   ? -128.814 86.515 139.087 1.00 74.53  ? 491 VAL C CG1 1 
ATOM   3770 C CG2 . VAL C 2 6   ? -127.085 85.495 137.599 1.00 74.56  ? 491 VAL C CG2 1 
ATOM   3771 N N   . SER C 2 7   ? -131.588 86.617 137.383 1.00 70.04  ? 492 SER C N   1 
ATOM   3772 C CA  . SER C 2 7   ? -132.776 87.434 137.614 1.00 74.41  ? 492 SER C CA  1 
ATOM   3773 C C   . SER C 2 7   ? -132.458 88.629 138.509 1.00 85.15  ? 492 SER C C   1 
ATOM   3774 O O   . SER C 2 7   ? -131.656 88.526 139.437 1.00 88.95  ? 492 SER C O   1 
ATOM   3775 C CB  . SER C 2 7   ? -133.896 86.596 138.235 1.00 70.77  ? 492 SER C CB  1 
ATOM   3776 O OG  . SER C 2 7   ? -133.515 86.090 139.501 1.00 71.40  ? 492 SER C OG  1 
ATOM   3777 N N   . ASN C 2 8   ? -133.083 89.764 138.217 1.00 91.04  ? 493 ASN C N   1 
ATOM   3778 C CA  . ASN C 2 8   ? -132.841 90.982 138.981 1.00 97.62  ? 493 ASN C CA  1 
ATOM   3779 C C   . ASN C 2 8   ? -133.608 90.997 140.296 1.00 98.70  ? 493 ASN C C   1 
ATOM   3780 O O   . ASN C 2 8   ? -133.148 91.568 141.286 1.00 103.32 ? 493 ASN C O   1 
ATOM   3781 C CB  . ASN C 2 8   ? -133.204 92.214 138.150 1.00 98.70  ? 493 ASN C CB  1 
ATOM   3782 C CG  . ASN C 2 8   ? -134.436 91.997 137.288 1.00 97.01  ? 493 ASN C CG  1 
ATOM   3783 O OD1 . ASN C 2 8   ? -135.181 91.035 137.480 1.00 95.17  ? 493 ASN C OD1 1 
ATOM   3784 N ND2 . ASN C 2 8   ? -134.654 92.892 136.330 1.00 97.25  ? 493 ASN C ND2 1 
ATOM   3785 N N   . THR C 2 9   ? -134.783 90.379 140.305 1.00 91.57  ? 494 THR C N   1 
ATOM   3786 C CA  . THR C 2 9   ? -135.543 90.261 141.538 1.00 89.64  ? 494 THR C CA  1 
ATOM   3787 C C   . THR C 2 9   ? -135.335 88.863 142.112 1.00 86.49  ? 494 THR C C   1 
ATOM   3788 O O   . THR C 2 9   ? -135.262 87.876 141.378 1.00 84.63  ? 494 THR C O   1 
ATOM   3789 C CB  . THR C 2 9   ? -137.055 90.568 141.323 1.00 80.27  ? 494 THR C CB  1 
ATOM   3790 O OG1 . THR C 2 9   ? -137.696 90.760 142.592 1.00 84.19  ? 494 THR C OG1 1 
ATOM   3791 C CG2 . THR C 2 9   ? -137.753 89.456 140.551 1.00 73.71  ? 494 THR C CG2 1 
ATOM   3792 N N   . SER C 2 10  ? -135.194 88.790 143.430 1.00 86.07  ? 495 SER C N   1 
ATOM   3793 C CA  . SER C 2 10  ? -134.924 87.524 144.091 1.00 81.26  ? 495 SER C CA  1 
ATOM   3794 C C   . SER C 2 10  ? -135.798 87.378 145.327 1.00 81.90  ? 495 SER C C   1 
ATOM   3795 O O   . SER C 2 10  ? -136.453 88.327 145.751 1.00 82.97  ? 495 SER C O   1 
ATOM   3796 C CB  . SER C 2 10  ? -133.443 87.412 144.464 1.00 81.40  ? 495 SER C CB  1 
ATOM   3797 O OG  . SER C 2 10  ? -133.123 88.260 145.551 1.00 85.95  ? 495 SER C OG  1 
ATOM   3798 N N   . ILE C 2 11  ? -135.804 86.183 145.902 1.00 82.37  ? 496 ILE C N   1 
ATOM   3799 C CA  . ILE C 2 11  ? -136.671 85.886 147.032 1.00 82.91  ? 496 ILE C CA  1 
ATOM   3800 C C   . ILE C 2 11  ? -135.851 85.562 148.276 1.00 85.95  ? 496 ILE C C   1 
ATOM   3801 O O   . ILE C 2 11  ? -135.036 84.641 148.268 1.00 85.37  ? 496 ILE C O   1 
ATOM   3802 C CB  . ILE C 2 11  ? -137.611 84.711 146.699 1.00 79.33  ? 496 ILE C CB  1 
ATOM   3803 C CG1 . ILE C 2 11  ? -138.502 85.073 145.506 1.00 75.79  ? 496 ILE C CG1 1 
ATOM   3804 C CG2 . ILE C 2 11  ? -138.446 84.322 147.908 1.00 77.65  ? 496 ILE C CG2 1 
ATOM   3805 C CD1 . ILE C 2 11  ? -139.323 83.910 144.967 1.00 72.73  ? 496 ILE C CD1 1 
ATOM   3806 N N   . ASN C 2 12  ? -136.060 86.327 149.343 1.00 90.80  ? 497 ASN C N   1 
ATOM   3807 C CA  . ASN C 2 12  ? -135.360 86.072 150.599 1.00 94.38  ? 497 ASN C CA  1 
ATOM   3808 C C   . ASN C 2 12  ? -136.298 85.691 151.739 1.00 91.84  ? 497 ASN C C   1 
ATOM   3809 O O   . ASN C 2 12  ? -137.417 86.195 151.834 1.00 91.40  ? 497 ASN C O   1 
ATOM   3810 C CB  . ASN C 2 12  ? -134.531 87.294 151.014 1.00 101.06 ? 497 ASN C CB  1 
ATOM   3811 C CG  . ASN C 2 12  ? -133.269 87.456 150.183 1.00 104.72 ? 497 ASN C CG  1 
ATOM   3812 O OD1 . ASN C 2 12  ? -133.206 88.292 149.279 1.00 105.98 ? 497 ASN C OD1 1 
ATOM   3813 N ND2 . ASN C 2 12  ? -132.256 86.654 150.486 1.00 105.57 ? 497 ASN C ND2 1 
ATOM   3814 N N   . ARG C 2 13  ? -135.832 84.788 152.597 1.00 90.77  ? 498 ARG C N   1 
ATOM   3815 C CA  . ARG C 2 13  ? -136.496 84.522 153.866 1.00 93.31  ? 498 ARG C CA  1 
ATOM   3816 C C   . ARG C 2 13  ? -135.550 84.878 155.009 1.00 95.31  ? 498 ARG C C   1 
ATOM   3817 O O   . ARG C 2 13  ? -134.396 84.447 155.029 1.00 92.77  ? 498 ARG C O   1 
ATOM   3818 C CB  . ARG C 2 13  ? -136.942 83.061 153.975 1.00 92.90  ? 498 ARG C CB  1 
ATOM   3819 C CG  . ARG C 2 13  ? -137.711 82.764 155.259 1.00 98.25  ? 498 ARG C CG  1 
ATOM   3820 C CD  . ARG C 2 13  ? -138.277 81.350 155.288 1.00 101.60 ? 498 ARG C CD  1 
ATOM   3821 N NE  . ARG C 2 13  ? -139.086 81.054 154.108 1.00 102.53 ? 498 ARG C NE  1 
ATOM   3822 C CZ  . ARG C 2 13  ? -140.327 81.494 153.918 1.00 102.73 ? 498 ARG C CZ  1 
ATOM   3823 N NH1 . ARG C 2 13  ? -140.912 82.265 154.826 1.00 105.72 ? 498 ARG C NH1 1 
ATOM   3824 N NH2 . ARG C 2 13  ? -140.981 81.169 152.811 1.00 96.37  ? 498 ARG C NH2 1 
ATOM   3825 N N   . LYS C 2 14  ? -136.043 85.675 155.952 1.00 99.62  ? 499 LYS C N   1 
ATOM   3826 C CA  . LYS C 2 14  ? -135.236 86.129 157.079 1.00 103.57 ? 499 LYS C CA  1 
ATOM   3827 C C   . LYS C 2 14  ? -135.722 85.542 158.399 1.00 105.62 ? 499 LYS C C   1 
ATOM   3828 O O   . LYS C 2 14  ? -136.924 85.386 158.614 1.00 105.45 ? 499 LYS C O   1 
ATOM   3829 C CB  . LYS C 2 14  ? -135.242 87.657 157.158 1.00 106.09 ? 499 LYS C CB  1 
ATOM   3830 C CG  . LYS C 2 14  ? -134.102 88.329 156.411 1.00 106.50 ? 499 LYS C CG  1 
ATOM   3831 C CD  . LYS C 2 14  ? -134.117 89.838 156.616 1.00 110.87 ? 499 LYS C CD  1 
ATOM   3832 C CE  . LYS C 2 14  ? -134.957 90.533 155.561 1.00 109.79 ? 499 LYS C CE  1 
ATOM   3833 N NZ  . LYS C 2 14  ? -134.338 90.412 154.212 1.00 107.62 ? 499 LYS C NZ  1 
ATOM   3834 N N   . ALA D 2 2   ? -146.217 55.808 98.642  1.00 99.74  ? 487 ALA D N   1 
ATOM   3835 C CA  . ALA D 2 2   ? -146.248 56.693 99.801  1.00 99.86  ? 487 ALA D CA  1 
ATOM   3836 C C   . ALA D 2 2   ? -145.315 57.882 99.602  1.00 99.58  ? 487 ALA D C   1 
ATOM   3837 O O   . ALA D 2 2   ? -145.612 58.795 98.830  1.00 102.71 ? 487 ALA D O   1 
ATOM   3838 C CB  . ALA D 2 2   ? -145.876 55.928 101.065 1.00 96.10  ? 487 ALA D CB  1 
ATOM   3839 N N   . ARG D 2 3   ? -144.184 57.868 100.301 1.00 91.93  ? 488 ARG D N   1 
ATOM   3840 C CA  . ARG D 2 3   ? -143.220 58.958 100.204 1.00 84.62  ? 488 ARG D CA  1 
ATOM   3841 C C   . ARG D 2 3   ? -141.867 58.475 99.684  1.00 77.47  ? 488 ARG D C   1 
ATOM   3842 O O   . ARG D 2 3   ? -141.340 57.460 100.144 1.00 73.41  ? 488 ARG D O   1 
ATOM   3843 C CB  . ARG D 2 3   ? -143.055 59.648 101.563 1.00 80.64  ? 488 ARG D CB  1 
ATOM   3844 C CG  . ARG D 2 3   ? -142.071 60.801 101.535 1.00 74.85  ? 488 ARG D CG  1 
ATOM   3845 C CD  . ARG D 2 3   ? -142.435 61.882 102.526 1.00 72.14  ? 488 ARG D CD  1 
ATOM   3846 N NE  . ARG D 2 3   ? -141.403 62.910 102.574 1.00 67.57  ? 488 ARG D NE  1 
ATOM   3847 C CZ  . ARG D 2 3   ? -140.634 63.143 103.631 1.00 62.27  ? 488 ARG D CZ  1 
ATOM   3848 N NH1 . ARG D 2 3   ? -140.793 62.433 104.740 1.00 59.28  ? 488 ARG D NH1 1 
ATOM   3849 N NH2 . ARG D 2 3   ? -139.714 64.097 103.581 1.00 61.07  ? 488 ARG D NH2 1 
ATOM   3850 N N   . TYR D 2 4   ? -141.313 59.207 98.720  1.00 74.62  ? 489 TYR D N   1 
ATOM   3851 C CA  . TYR D 2 4   ? -140.041 58.836 98.105  1.00 68.43  ? 489 TYR D CA  1 
ATOM   3852 C C   . TYR D 2 4   ? -139.072 60.016 98.043  1.00 65.81  ? 489 TYR D C   1 
ATOM   3853 O O   . TYR D 2 4   ? -139.480 61.175 98.146  1.00 66.93  ? 489 TYR D O   1 
ATOM   3854 C CB  . TYR D 2 4   ? -140.268 58.281 96.698  1.00 69.70  ? 489 TYR D CB  1 
ATOM   3855 C CG  . TYR D 2 4   ? -141.303 57.182 96.626  1.00 72.16  ? 489 TYR D CG  1 
ATOM   3856 C CD1 . TYR D 2 4   ? -141.076 55.947 97.220  1.00 72.63  ? 489 TYR D CD1 1 
ATOM   3857 C CD2 . TYR D 2 4   ? -142.504 57.375 95.955  1.00 78.14  ? 489 TYR D CD2 1 
ATOM   3858 C CE1 . TYR D 2 4   ? -142.021 54.936 97.155  1.00 77.77  ? 489 TYR D CE1 1 
ATOM   3859 C CE2 . TYR D 2 4   ? -143.453 56.370 95.883  1.00 83.17  ? 489 TYR D CE2 1 
ATOM   3860 C CZ  . TYR D 2 4   ? -143.206 55.153 96.484  1.00 83.13  ? 489 TYR D CZ  1 
ATOM   3861 O OH  . TYR D 2 4   ? -144.146 54.148 96.417  1.00 87.12  ? 489 TYR D OH  1 
ATOM   3862 N N   . GLY D 2 5   ? -137.789 59.714 97.870  1.00 61.98  ? 490 GLY D N   1 
ATOM   3863 C CA  . GLY D 2 5   ? -136.770 60.743 97.772  1.00 60.57  ? 490 GLY D CA  1 
ATOM   3864 C C   . GLY D 2 5   ? -135.771 60.450 96.671  1.00 62.51  ? 490 GLY D C   1 
ATOM   3865 O O   . GLY D 2 5   ? -135.307 59.319 96.529  1.00 63.51  ? 490 GLY D O   1 
ATOM   3866 N N   . VAL D 2 6   ? -135.444 61.472 95.887  1.00 63.66  ? 491 VAL D N   1 
ATOM   3867 C CA  . VAL D 2 6   ? -134.494 61.337 94.787  1.00 60.17  ? 491 VAL D CA  1 
ATOM   3868 C C   . VAL D 2 6   ? -133.324 62.296 94.993  1.00 57.21  ? 491 VAL D C   1 
ATOM   3869 O O   . VAL D 2 6   ? -133.532 63.478 95.264  1.00 62.37  ? 491 VAL D O   1 
ATOM   3870 C CB  . VAL D 2 6   ? -135.167 61.611 93.423  1.00 62.67  ? 491 VAL D CB  1 
ATOM   3871 C CG1 . VAL D 2 6   ? -134.128 61.713 92.315  1.00 63.01  ? 491 VAL D CG1 1 
ATOM   3872 C CG2 . VAL D 2 6   ? -136.191 60.525 93.111  1.00 62.83  ? 491 VAL D CG2 1 
ATOM   3873 N N   . SER D 2 7   ? -132.099 61.786 94.880  1.00 50.55  ? 492 SER D N   1 
ATOM   3874 C CA  . SER D 2 7   ? -130.909 62.603 95.100  1.00 55.62  ? 492 SER D CA  1 
ATOM   3875 C C   . SER D 2 7   ? -130.848 63.769 94.115  1.00 68.93  ? 492 SER D C   1 
ATOM   3876 O O   . SER D 2 7   ? -131.230 63.631 92.953  1.00 72.56  ? 492 SER D O   1 
ATOM   3877 C CB  . SER D 2 7   ? -129.641 61.760 94.982  1.00 53.27  ? 492 SER D CB  1 
ATOM   3878 O OG  . SER D 2 7   ? -129.419 61.372 93.639  1.00 61.48  ? 492 SER D OG  1 
ATOM   3879 N N   . ASN D 2 8   ? -130.372 64.914 94.592  1.00 73.22  ? 493 ASN D N   1 
ATOM   3880 C CA  . ASN D 2 8   ? -130.276 66.114 93.770  1.00 80.17  ? 493 ASN D CA  1 
ATOM   3881 C C   . ASN D 2 8   ? -129.237 65.978 92.660  1.00 83.83  ? 493 ASN D C   1 
ATOM   3882 O O   . ASN D 2 8   ? -129.526 66.250 91.495  1.00 87.74  ? 493 ASN D O   1 
ATOM   3883 C CB  . ASN D 2 8   ? -129.955 67.329 94.647  1.00 78.62  ? 493 ASN D CB  1 
ATOM   3884 C CG  . ASN D 2 8   ? -128.842 67.055 95.648  1.00 78.18  ? 493 ASN D CG  1 
ATOM   3885 O OD1 . ASN D 2 8   ? -128.356 65.928 95.767  1.00 79.19  ? 493 ASN D OD1 1 
ATOM   3886 N ND2 . ASN D 2 8   ? -128.444 68.086 96.384  1.00 77.00  ? 493 ASN D ND2 1 
ATOM   3887 N N   . THR D 2 9   ? -128.030 65.555 93.022  1.00 80.10  ? 494 THR D N   1 
ATOM   3888 C CA  . THR D 2 9   ? -126.968 65.388 92.040  1.00 82.92  ? 494 THR D CA  1 
ATOM   3889 C C   . THR D 2 9   ? -126.961 63.951 91.517  1.00 84.07  ? 494 THR D C   1 
ATOM   3890 O O   . THR D 2 9   ? -127.153 63.005 92.277  1.00 82.77  ? 494 THR D O   1 
ATOM   3891 C CB  . THR D 2 9   ? -125.586 65.770 92.635  1.00 77.45  ? 494 THR D CB  1 
ATOM   3892 O OG1 . THR D 2 9   ? -124.559 65.593 91.647  1.00 82.56  ? 494 THR D OG1 1 
ATOM   3893 C CG2 . THR D 2 9   ? -125.270 64.933 93.871  1.00 71.50  ? 494 THR D CG2 1 
ATOM   3894 N N   . SER D 2 10  ? -126.767 63.797 90.209  1.00 85.45  ? 495 SER D N   1 
ATOM   3895 C CA  . SER D 2 10  ? -126.769 62.474 89.590  1.00 81.02  ? 495 SER D CA  1 
ATOM   3896 C C   . SER D 2 10  ? -125.564 62.288 88.672  1.00 81.25  ? 495 SER D C   1 
ATOM   3897 O O   . SER D 2 10  ? -124.930 63.258 88.261  1.00 85.94  ? 495 SER D O   1 
ATOM   3898 C CB  . SER D 2 10  ? -128.072 62.240 88.813  1.00 80.96  ? 495 SER D CB  1 
ATOM   3899 O OG  . SER D 2 10  ? -128.140 63.053 87.656  1.00 84.64  ? 495 SER D OG  1 
ATOM   3900 N N   . ILE D 2 11  ? -125.256 61.033 88.362  1.00 79.38  ? 496 ILE D N   1 
ATOM   3901 C CA  . ILE D 2 11  ? -124.099 60.695 87.539  1.00 79.84  ? 496 ILE D CA  1 
ATOM   3902 C C   . ILE D 2 11  ? -124.518 60.319 86.119  1.00 80.67  ? 496 ILE D C   1 
ATOM   3903 O O   . ILE D 2 11  ? -125.272 59.369 85.921  1.00 77.42  ? 496 ILE D O   1 
ATOM   3904 C CB  . ILE D 2 11  ? -123.297 59.522 88.153  1.00 73.58  ? 496 ILE D CB  1 
ATOM   3905 C CG1 . ILE D 2 11  ? -122.865 59.854 89.584  1.00 69.90  ? 496 ILE D CG1 1 
ATOM   3906 C CG2 . ILE D 2 11  ? -122.094 59.173 87.289  1.00 71.41  ? 496 ILE D CG2 1 
ATOM   3907 C CD1 . ILE D 2 11  ? -122.274 58.672 90.330  1.00 66.58  ? 496 ILE D CD1 1 
ATOM   3908 N N   . ASN D 2 12  ? -124.035 61.064 85.130  1.00 85.50  ? 497 ASN D N   1 
ATOM   3909 C CA  . ASN D 2 12  ? -124.320 60.728 83.740  1.00 91.49  ? 497 ASN D CA  1 
ATOM   3910 C C   . ASN D 2 12  ? -123.052 60.443 82.938  1.00 90.32  ? 497 ASN D C   1 
ATOM   3911 O O   . ASN D 2 12  ? -122.004 61.044 83.169  1.00 88.34  ? 497 ASN D O   1 
ATOM   3912 C CB  . ASN D 2 12  ? -125.138 61.843 83.068  1.00 101.34 ? 497 ASN D CB  1 
ATOM   3913 C CG  . ASN D 2 12  ? -124.497 63.216 83.204  1.00 111.72 ? 497 ASN D CG  1 
ATOM   3914 O OD1 . ASN D 2 12  ? -123.325 63.339 83.555  1.00 115.63 ? 497 ASN D OD1 1 
ATOM   3915 N ND2 . ASN D 2 12  ? -125.271 64.260 82.922  1.00 116.21 ? 497 ASN D ND2 1 
ATOM   3916 N N   . ARG D 2 13  ? -123.153 59.499 82.010  1.00 93.14  ? 498 ARG D N   1 
ATOM   3917 C CA  . ARG D 2 13  ? -122.081 59.249 81.059  1.00 97.15  ? 498 ARG D CA  1 
ATOM   3918 C C   . ARG D 2 13  ? -122.594 59.594 79.669  1.00 98.78  ? 498 ARG D C   1 
ATOM   3919 O O   . ARG D 2 13  ? -123.604 59.049 79.224  1.00 96.59  ? 498 ARG D O   1 
ATOM   3920 C CB  . ARG D 2 13  ? -121.608 57.792 81.122  1.00 100.24 ? 498 ARG D CB  1 
ATOM   3921 C CG  . ARG D 2 13  ? -120.354 57.506 80.306  1.00 107.25 ? 498 ARG D CG  1 
ATOM   3922 C CD  . ARG D 2 13  ? -119.930 56.044 80.401  1.00 108.28 ? 498 ARG D CD  1 
ATOM   3923 N NE  . ARG D 2 13  ? -119.791 55.590 81.783  1.00 105.97 ? 498 ARG D NE  1 
ATOM   3924 C CZ  . ARG D 2 13  ? -118.760 55.880 82.570  1.00 105.69 ? 498 ARG D CZ  1 
ATOM   3925 N NH1 . ARG D 2 13  ? -117.769 56.639 82.121  1.00 110.30 ? 498 ARG D NH1 1 
ATOM   3926 N NH2 . ARG D 2 13  ? -118.723 55.419 83.812  1.00 100.62 ? 498 ARG D NH2 1 
ATOM   3927 N N   . LYS D 2 14  ? -121.911 60.513 78.994  1.00 105.30 ? 499 LYS D N   1 
ATOM   3928 C CA  . LYS D 2 14  ? -122.335 60.958 77.671  1.00 112.52 ? 499 LYS D CA  1 
ATOM   3929 C C   . LYS D 2 14  ? -121.343 60.532 76.596  1.00 116.49 ? 499 LYS D C   1 
ATOM   3930 O O   . LYS D 2 14  ? -120.133 60.549 76.822  1.00 115.72 ? 499 LYS D O   1 
ATOM   3931 C CB  . LYS D 2 14  ? -122.500 62.483 77.642  1.00 117.05 ? 499 LYS D CB  1 
ATOM   3932 C CG  . LYS D 2 14  ? -123.204 63.075 78.855  1.00 116.05 ? 499 LYS D CG  1 
ATOM   3933 C CD  . LYS D 2 14  ? -123.360 64.591 78.728  1.00 120.21 ? 499 LYS D CD  1 
ATOM   3934 C CE  . LYS D 2 14  ? -123.998 65.195 79.972  1.00 118.51 ? 499 LYS D CE  1 
ATOM   3935 N NZ  . LYS D 2 14  ? -124.286 66.653 79.814  1.00 124.30 ? 499 LYS D NZ  1 
ATOM   3936 N N   . LYS D 2 15  ? -121.865 60.143 75.434  1.00 122.12 ? 500 LYS D N   1 
ATOM   3937 C CA  . LYS D 2 15  ? -121.047 59.917 74.242  1.00 127.55 ? 500 LYS D CA  1 
ATOM   3938 C C   . LYS D 2 15  ? -121.925 59.699 73.015  1.00 132.84 ? 500 LYS D C   1 
ATOM   3939 O O   . LYS D 2 15  ? -121.948 58.611 72.439  1.00 133.69 ? 500 LYS D O   1 
ATOM   3940 C CB  . LYS D 2 15  ? -120.101 58.725 74.423  1.00 123.32 ? 500 LYS D CB  1 
ATOM   3941 C CG  . LYS D 2 15  ? -118.795 58.880 73.652  1.00 125.63 ? 500 LYS D CG  1 
ATOM   3942 C CD  . LYS D 2 15  ? -118.230 60.285 73.835  1.00 127.84 ? 500 LYS D CD  1 
ATOM   3943 C CE  . LYS D 2 15  ? -117.070 60.562 72.891  1.00 134.26 ? 500 LYS D CE  1 
ATOM   3944 N NZ  . LYS D 2 15  ? -116.647 61.992 72.936  1.00 136.96 ? 500 LYS D NZ  1 
HETATM 3945 O O   . HOH E 3 .   ? -152.694 61.421 128.221 1.00 60.06  ? 301 HOH A O   1 
HETATM 3946 O O   . HOH E 3 .   ? -134.872 93.533 131.919 1.00 64.86  ? 302 HOH A O   1 
HETATM 3947 O O   . HOH E 3 .   ? -139.041 89.580 132.576 1.00 57.87  ? 303 HOH A O   1 
HETATM 3948 O O   . HOH E 3 .   ? -154.164 74.192 120.601 1.00 77.40  ? 304 HOH A O   1 
HETATM 3949 O O   . HOH E 3 .   ? -130.235 71.490 121.336 1.00 58.69  ? 305 HOH A O   1 
HETATM 3950 O O   . HOH E 3 .   ? -143.232 62.727 123.129 1.00 40.97  ? 306 HOH A O   1 
HETATM 3951 O O   . HOH E 3 .   ? -148.611 72.556 143.415 1.00 41.18  ? 307 HOH A O   1 
HETATM 3952 O O   . HOH E 3 .   ? -141.254 66.082 115.682 1.00 45.01  ? 308 HOH A O   1 
HETATM 3953 O O   . HOH E 3 .   ? -140.596 71.283 110.726 1.00 58.42  ? 309 HOH A O   1 
HETATM 3954 O O   . HOH E 3 .   ? -137.805 71.013 113.806 1.00 53.27  ? 310 HOH A O   1 
HETATM 3955 O O   . HOH E 3 .   ? -136.834 73.646 117.540 1.00 42.76  ? 311 HOH A O   1 
HETATM 3956 O O   . HOH E 3 .   ? -142.248 63.347 132.603 1.00 49.82  ? 312 HOH A O   1 
HETATM 3957 O O   . HOH E 3 .   ? -149.439 59.931 121.999 1.00 51.59  ? 313 HOH A O   1 
HETATM 3958 O O   . HOH E 3 .   ? -143.363 80.815 131.132 1.00 50.11  ? 314 HOH A O   1 
HETATM 3959 O O   . HOH E 3 .   ? -146.455 69.927 112.359 1.00 66.37  ? 315 HOH A O   1 
HETATM 3960 O O   . HOH E 3 .   ? -146.854 86.073 131.171 1.00 73.85  ? 316 HOH A O   1 
HETATM 3961 O O   . HOH E 3 .   ? -147.934 81.637 129.421 1.00 61.40  ? 317 HOH A O   1 
HETATM 3962 O O   . HOH E 3 .   ? -145.677 82.644 132.383 1.00 74.90  ? 318 HOH A O   1 
HETATM 3963 O O   . HOH E 3 .   ? -136.693 86.099 125.939 1.00 55.19  ? 319 HOH A O   1 
HETATM 3964 O O   . HOH E 3 .   ? -131.391 72.479 150.693 1.00 68.69  ? 320 HOH A O   1 
HETATM 3965 O O   . HOH E 3 .   ? -129.433 69.923 127.328 1.00 77.71  ? 321 HOH A O   1 
HETATM 3966 O O   . HOH E 3 .   ? -129.467 82.530 145.220 1.00 84.55  ? 322 HOH A O   1 
HETATM 3967 O O   . HOH E 3 .   ? -125.174 75.324 123.153 1.00 57.39  ? 323 HOH A O   1 
HETATM 3968 O O   . HOH E 3 .   ? -153.601 81.105 138.457 1.00 66.34  ? 324 HOH A O   1 
HETATM 3969 O O   . HOH E 3 .   ? -141.459 61.069 123.775 1.00 46.90  ? 325 HOH A O   1 
HETATM 3970 O O   . HOH E 3 .   ? -136.155 59.089 115.681 1.00 57.83  ? 326 HOH A O   1 
HETATM 3971 O O   . HOH E 3 .   ? -155.459 76.339 125.322 1.00 66.01  ? 327 HOH A O   1 
HETATM 3972 O O   . HOH E 3 .   ? -150.701 77.998 124.802 1.00 74.22  ? 328 HOH A O   1 
HETATM 3973 O O   . HOH E 3 .   ? -150.329 77.638 121.485 1.00 60.23  ? 329 HOH A O   1 
HETATM 3974 O O   . HOH E 3 .   ? -151.207 83.349 130.442 1.00 81.76  ? 330 HOH A O   1 
HETATM 3975 O O   . HOH E 3 .   ? -146.372 61.033 116.493 1.00 55.51  ? 331 HOH A O   1 
HETATM 3976 O O   . HOH E 3 .   ? -142.985 67.498 112.327 1.00 79.72  ? 332 HOH A O   1 
HETATM 3977 O O   . HOH E 3 .   ? -138.249 71.611 110.311 1.00 71.28  ? 333 HOH A O   1 
HETATM 3978 O O   . HOH F 3 .   ? -119.127 56.928 108.103 1.00 72.28  ? 301 HOH B O   1 
HETATM 3979 O O   . HOH F 3 .   ? -125.255 67.464 97.661  1.00 76.37  ? 302 HOH B O   1 
HETATM 3980 O O   . HOH F 3 .   ? -118.652 59.957 106.981 1.00 92.10  ? 303 HOH B O   1 
HETATM 3981 O O   . HOH F 3 .   ? -125.231 65.259 102.826 1.00 82.40  ? 304 HOH B O   1 
HETATM 3982 O O   . HOH F 3 .   ? -123.410 55.649 104.532 1.00 46.96  ? 305 HOH B O   1 
HETATM 3983 O O   . HOH F 3 .   ? -114.483 47.286 94.979  1.00 47.71  ? 306 HOH B O   1 
HETATM 3984 O O   . HOH F 3 .   ? -113.661 66.815 100.064 1.00 65.66  ? 307 HOH B O   1 
HETATM 3985 O O   . HOH F 3 .   ? -126.308 37.305 112.396 1.00 59.80  ? 308 HOH B O   1 
HETATM 3986 O O   . HOH F 3 .   ? -136.730 63.525 100.280 1.00 55.98  ? 309 HOH B O   1 
HETATM 3987 O O   . HOH F 3 .   ? -133.400 44.902 98.288  1.00 52.78  ? 310 HOH B O   1 
HETATM 3988 O O   . HOH F 3 .   ? -130.965 61.797 110.338 1.00 49.56  ? 311 HOH B O   1 
HETATM 3989 O O   . HOH F 3 .   ? -124.766 38.254 103.172 1.00 66.11  ? 312 HOH B O   1 
HETATM 3990 O O   . HOH F 3 .   ? -120.101 48.661 83.061  1.00 60.69  ? 313 HOH B O   1 
HETATM 3991 O O   . HOH F 3 .   ? -130.976 57.661 87.052  1.00 66.26  ? 314 HOH B O   1 
HETATM 3992 O O   . HOH F 3 .   ? -128.446 36.084 111.064 1.00 50.71  ? 315 HOH B O   1 
HETATM 3993 O O   . HOH F 3 .   ? -118.831 62.770 87.989  1.00 57.59  ? 316 HOH B O   1 
HETATM 3994 O O   . HOH F 3 .   ? -130.243 64.185 106.660 1.00 47.76  ? 317 HOH B O   1 
HETATM 3995 O O   . HOH F 3 .   ? -143.721 66.228 109.980 1.00 92.26  ? 318 HOH B O   1 
HETATM 3996 O O   . HOH G 3 .   ? -137.906 90.851 137.572 1.00 95.32  ? 601 HOH C O   1 
HETATM 3997 O O   . HOH H 3 .   ? -125.962 67.246 81.667  1.00 93.06  ? 601 HOH D O   1 
HETATM 3998 O O   . HOH H 3 .   ? -131.565 64.304 89.324  1.00 110.80 ? 602 HOH D O   1 
HETATM 3999 O O   . HOH H 3 .   ? -125.943 60.046 79.413  1.00 70.26  ? 603 HOH D O   1 
HETATM 4000 O O   . HOH H 3 .   ? -119.179 61.703 84.759  1.00 71.27  ? 604 HOH D O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . ASN A 6   ? 1.1873 1.4822 1.4892 -0.2545 -0.2753 -0.2527 6   ASN A N   
2    C CA  . ASN A 6   ? 1.2070 1.4303 1.4620 -0.2707 -0.2716 -0.2690 6   ASN A CA  
3    C C   . ASN A 6   ? 1.2157 1.4274 1.5049 -0.3042 -0.2623 -0.2670 6   ASN A C   
4    O O   . ASN A 6   ? 1.2952 1.4552 1.5548 -0.3288 -0.2711 -0.2800 6   ASN A O   
5    C CB  . ASN A 6   ? 1.1868 1.3675 1.4018 -0.2441 -0.2485 -0.2718 6   ASN A CB  
6    C CG  . ASN A 6   ? 1.1728 1.3699 1.3609 -0.2102 -0.2534 -0.2697 6   ASN A CG  
7    O OD1 . ASN A 6   ? 1.1994 1.4217 1.3796 -0.2071 -0.2765 -0.2703 6   ASN A OD1 
8    N ND2 . ASN A 6   ? 1.1339 1.3158 1.3066 -0.1855 -0.2322 -0.2661 6   ASN A ND2 
9    N N   . ASN A 7   ? 1.0949 1.3509 1.4428 -0.3049 -0.2433 -0.2503 7   ASN A N   
10   C CA  . ASN A 7   ? 1.0667 1.3208 1.4534 -0.3369 -0.2323 -0.2450 7   ASN A CA  
11   C C   . ASN A 7   ? 1.0213 1.3407 1.4666 -0.3575 -0.2512 -0.2375 7   ASN A C   
12   O O   . ASN A 7   ? 0.9690 1.3532 1.4654 -0.3450 -0.2433 -0.2225 7   ASN A O   
13   C CB  . ASN A 7   ? 1.0345 1.2924 1.4452 -0.3271 -0.1961 -0.2311 7   ASN A CB  
14   C CG  . ASN A 7   ? 1.0781 1.3248 1.5203 -0.3598 -0.1804 -0.2245 7   ASN A CG  
15   O OD1 . ASN A 7   ? 1.1357 1.3588 1.5758 -0.3904 -0.1960 -0.2320 7   ASN A OD1 
16   N ND2 . ASN A 7   ? 1.0493 1.3091 1.5173 -0.3542 -0.1492 -0.2101 7   ASN A ND2 
17   N N   . TYR A 8   ? 1.0409 1.3420 1.4784 -0.3889 -0.2766 -0.2480 8   TYR A N   
18   C CA  . TYR A 8   ? 1.0189 1.3830 1.5112 -0.4106 -0.3003 -0.2421 8   TYR A CA  
19   C C   . TYR A 8   ? 0.9979 1.3839 1.5524 -0.4415 -0.2852 -0.2308 8   TYR A C   
20   O O   . TYR A 8   ? 0.9902 1.4309 1.5991 -0.4638 -0.3026 -0.2245 8   TYR A O   
21   C CB  . TYR A 8   ? 1.0831 1.4200 1.5353 -0.4312 -0.3393 -0.2589 8   TYR A CB  
22   C CG  . TYR A 8   ? 1.0762 1.4089 1.4746 -0.4021 -0.3560 -0.2673 8   TYR A CG  
23   C CD1 . TYR A 8   ? 1.0348 1.4351 1.4623 -0.3760 -0.3632 -0.2556 8   TYR A CD1 
24   C CD2 . TYR A 8   ? 1.1118 1.3703 1.4285 -0.3994 -0.3631 -0.2864 8   TYR A CD2 
25   C CE1 . TYR A 8   ? 1.0345 1.4276 1.4113 -0.3493 -0.3776 -0.2616 8   TYR A CE1 
26   C CE2 . TYR A 8   ? 1.1136 1.3687 1.3799 -0.3730 -0.3749 -0.2935 8   TYR A CE2 
27   C CZ  . TYR A 8   ? 1.0799 1.4019 1.3767 -0.3486 -0.3827 -0.2805 8   TYR A CZ  
28   O OH  . TYR A 8   ? 1.0919 1.4069 1.3370 -0.3223 -0.3942 -0.2859 8   TYR A OH  
29   N N   . ASN A 9   ? 0.9906 1.3349 1.5370 -0.4429 -0.2522 -0.2271 9   ASN A N   
30   C CA  . ASN A 9   ? 0.9966 1.3589 1.5973 -0.4693 -0.2307 -0.2141 9   ASN A CA  
31   C C   . ASN A 9   ? 0.9450 1.3833 1.6042 -0.4505 -0.2066 -0.1948 9   ASN A C   
32   O O   . ASN A 9   ? 0.9436 1.4153 1.6566 -0.4701 -0.1885 -0.1817 9   ASN A O   
33   C CB  . ASN A 9   ? 0.9899 1.2717 1.5523 -0.4781 -0.2044 -0.2164 9   ASN A CB  
34   C CG  . ASN A 9   ? 1.0361 1.2454 1.5610 -0.5066 -0.2257 -0.2323 9   ASN A CG  
35   O OD1 . ASN A 9   ? 1.0676 1.2946 1.6175 -0.5341 -0.2546 -0.2372 9   ASN A OD1 
36   N ND2 . ASN A 9   ? 1.0552 1.1806 1.5206 -0.4991 -0.2126 -0.2404 9   ASN A ND2 
37   N N   . GLU A 10  ? 0.9230 1.3855 1.5698 -0.4119 -0.2054 -0.1929 10  GLU A N   
38   C CA  . GLU A 10  ? 0.9332 1.4588 1.6274 -0.3890 -0.1830 -0.1758 10  GLU A CA  
39   C C   . GLU A 10  ? 0.8939 1.4745 1.6008 -0.3594 -0.2045 -0.1730 10  GLU A C   
40   O O   . GLU A 10  ? 0.8567 1.4980 1.6119 -0.3429 -0.1928 -0.1585 10  GLU A O   
41   C CB  . GLU A 10  ? 0.9376 1.4251 1.6018 -0.3673 -0.1470 -0.1713 10  GLU A CB  
42   C CG  . GLU A 10  ? 1.0117 1.4730 1.6876 -0.3912 -0.1145 -0.1634 10  GLU A CG  
43   C CD  . GLU A 10  ? 1.1083 1.4849 1.7324 -0.4127 -0.1159 -0.1749 10  GLU A CD  
44   O OE1 . GLU A 10  ? 1.1309 1.4582 1.6983 -0.3962 -0.1265 -0.1874 10  GLU A OE1 
45   O OE2 . GLU A 10  ? 1.1436 1.5011 1.7830 -0.4451 -0.1057 -0.1708 10  GLU A OE2 
46   N N   . SER A 11  ? 0.8830 1.4395 1.5440 -0.3519 -0.2348 -0.1861 11  SER A N   
47   C CA  . SER A 11  ? 0.8466 1.4449 1.5089 -0.3224 -0.2554 -0.1828 11  SER A CA  
48   C C   . SER A 11  ? 0.9292 1.5074 1.5485 -0.3288 -0.2949 -0.1974 11  SER A C   
49   O O   . SER A 11  ? 0.9147 1.4271 1.4754 -0.3385 -0.3001 -0.2130 11  SER A O   
50   C CB  . SER A 11  ? 0.7528 1.3351 1.3842 -0.2821 -0.2347 -0.1785 11  SER A CB  
51   O OG  . SER A 11  ? 0.7219 1.3355 1.3484 -0.2534 -0.2543 -0.1744 11  SER A OG  
52   N N   . LEU A 12  ? 1.0026 1.6366 1.6486 -0.3222 -0.3219 -0.1919 12  LEU A N   
53   C CA  . LEU A 12  ? 1.0845 1.7046 1.6863 -0.3252 -0.3601 -0.2040 12  LEU A CA  
54   C C   . LEU A 12  ? 1.0695 1.6731 1.6203 -0.2844 -0.3619 -0.2043 12  LEU A C   
55   O O   . LEU A 12  ? 0.7136 1.2916 1.2104 -0.2817 -0.3871 -0.2154 12  LEU A O   
56   C CB  . LEU A 12  ? 0.7359 1.4252 1.3913 -0.3416 -0.3917 -0.1973 12  LEU A CB  
57   C CG  . LEU A 12  ? 0.7767 1.4854 1.4822 -0.3876 -0.3979 -0.1975 12  LEU A CG  
58   C CD1 . LEU A 12  ? 0.7877 1.5865 1.5678 -0.3937 -0.4197 -0.1836 12  LEU A CD1 
59   C CD2 . LEU A 12  ? 0.8473 1.4936 1.4960 -0.4214 -0.4220 -0.2179 12  LEU A CD2 
60   N N   . ASN A 13  ? 0.9916 1.6084 1.5574 -0.2537 -0.3345 -0.1917 13  ASN A N   
61   C CA  . ASN A 13  ? 0.9423 1.5413 1.4624 -0.2158 -0.3326 -0.1897 13  ASN A CA  
62   C C   . ASN A 13  ? 0.9534 1.4805 1.4082 -0.2110 -0.3168 -0.2025 13  ASN A C   
63   O O   . ASN A 13  ? 0.9274 1.4238 1.3831 -0.2287 -0.2971 -0.2079 13  ASN A O   
64   C CB  . ASN A 13  ? 0.8389 1.4770 1.3988 -0.1862 -0.3105 -0.1711 13  ASN A CB  
65   C CG  . ASN A 13  ? 0.8366 1.5482 1.4641 -0.1859 -0.3241 -0.1573 13  ASN A CG  
66   O OD1 . ASN A 13  ? 0.8582 1.6001 1.5240 -0.2157 -0.3402 -0.1592 13  ASN A OD1 
67   N ND2 . ASN A 13  ? 0.8186 1.5589 1.4618 -0.1523 -0.3181 -0.1428 13  ASN A ND2 
68   N N   . LYS A 14  ? 1.0055 1.5060 1.4038 -0.1870 -0.3251 -0.2066 14  LYS A N   
69   C CA  . LYS A 14  ? 1.0605 1.4990 1.3996 -0.1785 -0.3095 -0.2174 14  LYS A CA  
70   C C   . LYS A 14  ? 1.0699 1.5053 1.4256 -0.1620 -0.2753 -0.2075 14  LYS A C   
71   O O   . LYS A 14  ? 1.0217 1.4949 1.4100 -0.1430 -0.2665 -0.1920 14  LYS A O   
72   C CB  . LYS A 14  ? 1.0859 1.5026 1.3634 -0.1557 -0.3245 -0.2218 14  LYS A CB  
73   C CG  . LYS A 14  ? 1.1771 1.5841 1.4213 -0.1725 -0.3575 -0.2345 14  LYS A CG  
74   C CD  . LYS A 14  ? 1.2154 1.5988 1.3939 -0.1483 -0.3682 -0.2374 14  LYS A CD  
75   C CE  . LYS A 14  ? 1.2985 1.6695 1.4370 -0.1660 -0.4004 -0.2509 14  LYS A CE  
76   N NZ  . LYS A 14  ? 1.3289 1.6753 1.3988 -0.1426 -0.4089 -0.2529 14  LYS A NZ  
77   N N   . SER A 15  ? 1.1262 1.5140 1.4572 -0.1694 -0.2568 -0.2165 15  SER A N   
78   C CA  . SER A 15  ? 1.1045 1.4846 1.4456 -0.1566 -0.2261 -0.2082 15  SER A CA  
79   C C   . SER A 15  ? 1.0949 1.4709 1.4050 -0.1229 -0.2211 -0.2019 15  SER A C   
80   O O   . SER A 15  ? 1.1422 1.4950 1.4040 -0.1120 -0.2338 -0.2096 15  SER A O   
81   C CB  . SER A 15  ? 1.1259 1.4526 1.4449 -0.1727 -0.2106 -0.2193 15  SER A CB  
82   O OG  . SER A 15  ? 1.1609 1.4896 1.5130 -0.2044 -0.2087 -0.2208 15  SER A OG  
83   N N   . LYS A 16  ? 0.9851 1.3816 1.3207 -0.1075 -0.2017 -0.1875 16  LYS A N   
84   C CA  . LYS A 16  ? 0.9143 1.3040 1.2224 -0.0784 -0.1947 -0.1798 16  LYS A CA  
85   C C   . LYS A 16  ? 0.8177 1.1839 1.1221 -0.0747 -0.1685 -0.1771 16  LYS A C   
86   O O   . LYS A 16  ? 0.7956 1.1721 1.1353 -0.0846 -0.1515 -0.1713 16  LYS A O   
87   C CB  . LYS A 16  ? 0.9299 1.3610 1.2639 -0.0596 -0.1983 -0.1638 16  LYS A CB  
88   C CG  . LYS A 16  ? 0.9972 1.4407 1.3114 -0.0493 -0.2254 -0.1635 16  LYS A CG  
89   C CD  . LYS A 16  ? 0.9984 1.4730 1.3314 -0.0255 -0.2260 -0.1466 16  LYS A CD  
90   C CE  . LYS A 16  ? 1.0390 1.5180 1.3428 -0.0122 -0.2524 -0.1448 16  LYS A CE  
91   N NZ  . LYS A 16  ? 1.0357 1.5382 1.3538 0.0132  -0.2529 -0.1278 16  LYS A NZ  
92   N N   . ASP A 17  ? 0.7413 1.0773 1.0033 -0.0609 -0.1650 -0.1806 17  ASP A N   
93   C CA  . ASP A 17  ? 0.6809 0.9976 0.9397 -0.0562 -0.1435 -0.1769 17  ASP A CA  
94   C C   . ASP A 17  ? 0.6543 0.9959 0.9349 -0.0409 -0.1315 -0.1593 17  ASP A C   
95   O O   . ASP A 17  ? 0.6492 0.9886 0.9077 -0.0206 -0.1306 -0.1514 17  ASP A O   
96   C CB  . ASP A 17  ? 0.6555 0.9396 0.8665 -0.0433 -0.1431 -0.1828 17  ASP A CB  
97   C CG  . ASP A 17  ? 0.6148 0.8710 0.8156 -0.0359 -0.1184 -0.1694 17  ASP A CG  
98   O OD1 . ASP A 17  ? 0.6289 0.8800 0.8533 -0.0475 -0.1049 -0.1650 17  ASP A OD1 
99   O OD2 . ASP A 17  ? 0.5805 0.8208 0.7495 -0.0192 -0.1128 -0.1629 17  ASP A OD2 
100  N N   . ALA A 18  ? 0.6330 0.9959 0.9550 -0.0510 -0.1211 -0.1535 18  ALA A N   
101  C CA  . ALA A 18  ? 0.6142 0.9978 0.9570 -0.0368 -0.1074 -0.1388 18  ALA A CA  
102  C C   . ALA A 18  ? 0.6116 1.0056 0.9929 -0.0531 -0.0881 -0.1362 18  ALA A C   
103  O O   . ALA A 18  ? 0.6119 1.0092 1.0125 -0.0757 -0.0902 -0.1432 18  ALA A O   
104  C CB  . ALA A 18  ? 0.5983 1.0130 0.9507 -0.0212 -0.1216 -0.1312 18  ALA A CB  
105  N N   . ILE A 19  ? 0.6177 1.0143 1.0073 -0.0425 -0.0684 -0.1261 19  ILE A N   
106  C CA  . ILE A 19  ? 0.6811 1.0855 1.1025 -0.0565 -0.0455 -0.1227 19  ILE A CA  
107  C C   . ILE A 19  ? 0.8173 1.2662 1.2797 -0.0519 -0.0432 -0.1152 19  ILE A C   
108  O O   . ILE A 19  ? 0.8401 1.3060 1.3043 -0.0282 -0.0447 -0.1069 19  ILE A O   
109  C CB  . ILE A 19  ? 0.6279 0.9956 1.0197 -0.0466 -0.0220 -0.1113 19  ILE A CB  
110  C CG1 . ILE A 19  ? 0.6269 0.9400 0.9731 -0.0537 -0.0215 -0.1125 19  ILE A CG1 
111  C CG2 . ILE A 19  ? 0.5793 0.9566 0.9988 -0.0559 0.0046  -0.1052 19  ILE A CG2 
112  C CD1 . ILE A 19  ? 0.6173 0.8931 0.9228 -0.0389 -0.0105 -0.1009 19  ILE A CD1 
113  N N   . ASP A 20  ? 0.9259 1.3929 1.4219 -0.0748 -0.0399 -0.1175 20  ASP A N   
114  C CA  . ASP A 20  ? 0.9664 1.4817 1.5094 -0.0729 -0.0358 -0.1094 20  ASP A CA  
115  C C   . ASP A 20  ? 0.9636 1.4816 1.5271 -0.0788 -0.0013 -0.1022 20  ASP A C   
116  O O   . ASP A 20  ? 0.9939 1.5170 1.5807 -0.1044 0.0101  -0.1029 20  ASP A O   
117  C CB  . ASP A 20  ? 1.0261 1.5660 1.5965 -0.0954 -0.0556 -0.1152 20  ASP A CB  
118  C CG  . ASP A 20  ? 1.0822 1.6800 1.7007 -0.0869 -0.0626 -0.1063 20  ASP A CG  
119  O OD1 . ASP A 20  ? 1.0943 1.7066 1.7111 -0.0579 -0.0659 -0.0985 20  ASP A OD1 
120  O OD2 . ASP A 20  ? 1.1131 1.7413 1.7719 -0.1094 -0.0652 -0.1063 20  ASP A OD2 
121  N N   . ASP A 21  ? 0.8765 1.3867 1.4268 -0.0557 0.0162  -0.0951 21  ASP A N   
122  C CA  . ASP A 21  ? 0.8204 1.3261 1.3793 -0.0576 0.0518  -0.0884 21  ASP A CA  
123  C C   . ASP A 21  ? 0.7373 1.2540 1.2947 -0.0250 0.0642  -0.0800 21  ASP A C   
124  O O   . ASP A 21  ? 0.7172 1.2117 1.2418 -0.0045 0.0557  -0.0806 21  ASP A O   
125  C CB  . ASP A 21  ? 0.8376 1.2902 1.3595 -0.0716 0.0676  -0.0921 21  ASP A CB  
126  C CG  . ASP A 21  ? 0.8637 1.3018 1.3838 -0.0758 0.1063  -0.0842 21  ASP A CG  
127  O OD1 . ASP A 21  ? 0.8549 1.2691 1.3414 -0.0530 0.1197  -0.0767 21  ASP A OD1 
128  O OD2 . ASP A 21  ? 0.8969 1.3341 1.4324 -0.1009 0.1214  -0.0823 21  ASP A OD2 
129  N N   . LYS A 22  ? 0.6997 1.2496 1.2916 -0.0202 0.0851  -0.0720 22  LYS A N   
130  C CA  . LYS A 22  ? 0.6438 1.2053 1.2369 0.0127  0.0984  -0.0641 22  LYS A CA  
131  C C   . LYS A 22  ? 0.6258 1.1353 1.1708 0.0245  0.1226  -0.0646 22  LYS A C   
132  O O   . LYS A 22  ? 0.6281 1.1222 1.1496 0.0524  0.1208  -0.0630 22  LYS A O   
133  C CB  . LYS A 22  ? 0.6528 1.2638 1.2946 0.0140  0.1185  -0.0558 22  LYS A CB  
134  C CG  . LYS A 22  ? 0.6621 1.2981 1.3162 0.0514  0.1249  -0.0474 22  LYS A CG  
135  C CD  . LYS A 22  ? 0.6173 1.2631 1.2744 0.0697  0.0895  -0.0461 22  LYS A CD  
136  C CE  . LYS A 22  ? 0.5833 1.2612 1.2690 0.1040  0.0944  -0.0349 22  LYS A CE  
137  N NZ  . LYS A 22  ? 0.5775 1.3219 1.3268 0.0975  0.1035  -0.0274 22  LYS A NZ  
138  N N   . THR A 23  ? 0.6160 1.0934 1.1432 0.0023  0.1450  -0.0660 23  THR A N   
139  C CA  . THR A 23  ? 0.6224 1.0373 1.0891 0.0097  0.1662  -0.0624 23  THR A CA  
140  C C   . THR A 23  ? 0.6173 0.9818 1.0252 0.0160  0.1396  -0.0627 23  THR A C   
141  O O   . THR A 23  ? 0.6201 0.9459 0.9819 0.0353  0.1425  -0.0586 23  THR A O   
142  C CB  . THR A 23  ? 0.6450 1.0268 1.0920 -0.0170 0.1911  -0.0590 23  THR A CB  
143  O OG1 . THR A 23  ? 0.6768 1.1047 1.1756 -0.0267 0.2147  -0.0565 23  THR A OG1 
144  C CG2 . THR A 23  ? 0.6632 0.9760 1.0363 -0.0069 0.2095  -0.0523 23  THR A CG2 
145  N N   . TRP A 24  ? 0.6134 0.9780 1.0234 -0.0013 0.1146  -0.0680 24  TRP A N   
146  C CA  . TRP A 24  ? 0.5660 0.8907 0.9280 0.0032  0.0909  -0.0684 24  TRP A CA  
147  C C   . TRP A 24  ? 0.5106 0.8459 0.8675 0.0297  0.0753  -0.0672 24  TRP A C   
148  O O   . TRP A 24  ? 0.4740 0.7673 0.7825 0.0399  0.0697  -0.0630 24  TRP A O   
149  C CB  . TRP A 24  ? 0.5248 0.8547 0.8965 -0.0170 0.0692  -0.0760 24  TRP A CB  
150  C CG  . TRP A 24  ? 0.4881 0.7871 0.8187 -0.0107 0.0468  -0.0768 24  TRP A CG  
151  C CD1 . TRP A 24  ? 0.4994 0.8174 0.8333 0.0009  0.0234  -0.0804 24  TRP A CD1 
152  C CD2 . TRP A 24  ? 0.4878 0.7337 0.7691 -0.0154 0.0467  -0.0731 24  TRP A CD2 
153  N NE1 . TRP A 24  ? 0.5041 0.7853 0.7953 0.0027  0.0121  -0.0791 24  TRP A NE1 
154  C CE2 . TRP A 24  ? 0.4778 0.7176 0.7400 -0.0068 0.0251  -0.0748 24  TRP A CE2 
155  C CE3 . TRP A 24  ? 0.5193 0.7230 0.7703 -0.0253 0.0622  -0.0676 24  TRP A CE3 
156  C CZ2 . TRP A 24  ? 0.4679 0.6680 0.6904 -0.0078 0.0195  -0.0717 24  TRP A CZ2 
157  C CZ3 . TRP A 24  ? 0.5446 0.7068 0.7535 -0.0252 0.0529  -0.0644 24  TRP A CZ3 
158  C CH2 . TRP A 24  ? 0.5262 0.6902 0.7253 -0.0166 0.0321  -0.0666 24  TRP A CH2 
159  N N   . SER A 25  ? 0.5433 0.9344 0.9504 0.0403  0.0677  -0.0699 25  SER A N   
160  C CA  . SER A 25  ? 0.6306 1.0315 1.0329 0.0662  0.0503  -0.0677 25  SER A CA  
161  C C   . SER A 25  ? 0.6816 1.0533 1.0550 0.0909  0.0684  -0.0603 25  SER A C   
162  O O   . SER A 25  ? 0.7174 1.0770 1.0700 0.1120  0.0563  -0.0565 25  SER A O   
163  C CB  . SER A 25  ? 0.6519 1.1190 1.1141 0.0722  0.0351  -0.0708 25  SER A CB  
164  O OG  . SER A 25  ? 0.6701 1.1485 1.1417 0.0490  0.0136  -0.0767 25  SER A OG  
165  N N   . LYS A 26  ? 0.7027 1.0577 1.0695 0.0878  0.0982  -0.0582 26  LYS A N   
166  C CA  . LYS A 26  ? 0.7393 1.0608 1.0736 0.1106  0.1182  -0.0533 26  LYS A CA  
167  C C   . LYS A 26  ? 0.7062 0.9574 0.9678 0.1103  0.1109  -0.0500 26  LYS A C   
168  O O   . LYS A 26  ? 0.7317 0.9486 0.9587 0.1303  0.1164  -0.0468 26  LYS A O   
169  C CB  . LYS A 26  ? 0.8254 1.1476 1.1690 0.1063  0.1543  -0.0526 26  LYS A CB  
170  C CG  . LYS A 26  ? 0.9366 1.2302 1.2521 0.1336  0.1784  -0.0496 26  LYS A CG  
171  C CD  . LYS A 26  ? 1.0236 1.2985 1.3250 0.1260  0.2159  -0.0488 26  LYS A CD  
172  C CE  . LYS A 26  ? 1.1021 1.3368 1.3626 0.1543  0.2401  -0.0476 26  LYS A CE  
173  N NZ  . LYS A 26  ? 1.1550 1.3609 1.3869 0.1473  0.2778  -0.0469 26  LYS A NZ  
174  N N   . LEU A 27  ? 0.6650 0.8947 0.9049 0.0874  0.0981  -0.0511 27  LEU A N   
175  C CA  . LEU A 27  ? 0.6232 0.7945 0.8025 0.0836  0.0898  -0.0477 27  LEU A CA  
176  C C   . LEU A 27  ? 0.5540 0.7275 0.7283 0.0763  0.0621  -0.0481 27  LEU A C   
177  O O   . LEU A 27  ? 0.5422 0.6798 0.6770 0.0784  0.0523  -0.0442 27  LEU A O   
178  C CB  . LEU A 27  ? 0.6279 0.7619 0.7758 0.0657  0.1036  -0.0467 27  LEU A CB  
179  C CG  . LEU A 27  ? 0.6711 0.7773 0.7941 0.0732  0.1326  -0.0451 27  LEU A CG  
180  C CD1 . LEU A 27  ? 0.6760 0.7502 0.7702 0.0533  0.1437  -0.0432 27  LEU A CD1 
181  C CD2 . LEU A 27  ? 0.7440 0.8031 0.8169 0.0896  0.1314  -0.0431 27  LEU A CD2 
182  N N   . PHE A 28  ? 0.5283 0.7428 0.7415 0.0666  0.0504  -0.0530 28  PHE A N   
183  C CA  . PHE A 28  ? 0.4951 0.7092 0.7002 0.0582  0.0280  -0.0548 28  PHE A CA  
184  C C   . PHE A 28  ? 0.4762 0.7347 0.7143 0.0650  0.0101  -0.0590 28  PHE A C   
185  O O   . PHE A 28  ? 0.4973 0.7971 0.7779 0.0689  0.0127  -0.0624 28  PHE A O   
186  C CB  . PHE A 28  ? 0.4528 0.6573 0.6567 0.0364  0.0287  -0.0584 28  PHE A CB  
187  C CG  . PHE A 28  ? 0.4708 0.6292 0.6363 0.0294  0.0405  -0.0534 28  PHE A CG  
188  C CD1 . PHE A 28  ? 0.4974 0.6222 0.6250 0.0293  0.0306  -0.0488 28  PHE A CD1 
189  C CD2 . PHE A 28  ? 0.4753 0.6249 0.6424 0.0220  0.0608  -0.0526 28  PHE A CD2 
190  C CE1 . PHE A 28  ? 0.5094 0.5933 0.6014 0.0225  0.0370  -0.0443 28  PHE A CE1 
191  C CE2 . PHE A 28  ? 0.5300 0.6335 0.6548 0.0161  0.0694  -0.0476 28  PHE A CE2 
192  C CZ  . PHE A 28  ? 0.5486 0.6196 0.6358 0.0166  0.0554  -0.0437 28  PHE A CZ  
193  N N   . PRO A 29  ? 0.4679 0.7196 0.6867 0.0658  -0.0082 -0.0587 29  PRO A N   
194  C CA  . PRO A 29  ? 0.4638 0.7524 0.7048 0.0701  -0.0276 -0.0636 29  PRO A CA  
195  C C   . PRO A 29  ? 0.5023 0.8166 0.7737 0.0512  -0.0325 -0.0744 29  PRO A C   
196  O O   . PRO A 29  ? 0.4985 0.7903 0.7588 0.0351  -0.0258 -0.0769 29  PRO A O   
197  C CB  . PRO A 29  ? 0.4015 0.6659 0.6039 0.0728  -0.0401 -0.0599 29  PRO A CB  
198  C CG  . PRO A 29  ? 0.4328 0.6587 0.6073 0.0613  -0.0297 -0.0567 29  PRO A CG  
199  C CD  . PRO A 29  ? 0.4458 0.6574 0.6216 0.0625  -0.0116 -0.0535 29  PRO A CD  
200  N N   . SER A 30  ? 0.5233 0.8819 0.8316 0.0529  -0.0455 -0.0805 30  SER A N   
201  C CA  . SER A 30  ? 0.5289 0.9109 0.8673 0.0319  -0.0518 -0.0920 30  SER A CA  
202  C C   . SER A 30  ? 0.5270 0.8945 0.8392 0.0240  -0.0699 -0.0998 30  SER A C   
203  O O   . SER A 30  ? 0.5437 0.9081 0.8629 0.0047  -0.0724 -0.1097 30  SER A O   
204  C CB  . SER A 30  ? 0.5541 0.9837 0.9379 0.0335  -0.0597 -0.0931 30  SER A CB  
205  O OG  . SER A 30  ? 0.6129 1.0593 1.0266 0.0395  -0.0385 -0.0871 30  SER A OG  
206  N N   . ILE A 31  ? 0.5098 0.8652 0.7891 0.0393  -0.0807 -0.0953 31  ILE A N   
207  C CA  . ILE A 31  ? 0.4911 0.8290 0.7385 0.0353  -0.0930 -0.1014 31  ILE A CA  
208  C C   . ILE A 31  ? 0.4911 0.7901 0.6983 0.0410  -0.0822 -0.0921 31  ILE A C   
209  O O   . ILE A 31  ? 0.5515 0.8413 0.7452 0.0543  -0.0774 -0.0807 31  ILE A O   
210  C CB  . ILE A 31  ? 0.5133 0.8731 0.7544 0.0462  -0.1163 -0.1044 31  ILE A CB  
211  C CG1 . ILE A 31  ? 0.5252 0.9139 0.8009 0.0370  -0.1259 -0.1089 31  ILE A CG1 
212  C CG2 . ILE A 31  ? 0.5399 0.8779 0.7414 0.0432  -0.1253 -0.1114 31  ILE A CG2 
213  C CD1 . ILE A 31  ? 0.5633 0.9627 0.8250 0.0443  -0.1491 -0.1096 31  ILE A CD1 
214  N N   . VAL A 32  ? 0.4588 0.7350 0.6485 0.0310  -0.0788 -0.0969 32  VAL A N   
215  C CA  . VAL A 32  ? 0.4395 0.6861 0.6000 0.0342  -0.0691 -0.0883 32  VAL A CA  
216  C C   . VAL A 32  ? 0.4376 0.6746 0.5736 0.0347  -0.0743 -0.0938 32  VAL A C   
217  O O   . VAL A 32  ? 0.4357 0.6541 0.5559 0.0349  -0.0659 -0.0888 32  VAL A O   
218  C CB  . VAL A 32  ? 0.4449 0.6708 0.6102 0.0244  -0.0549 -0.0856 32  VAL A CB  
219  C CG1 . VAL A 32  ? 0.3954 0.6248 0.5761 0.0256  -0.0452 -0.0793 32  VAL A CG1 
220  C CG2 . VAL A 32  ? 0.4529 0.6744 0.6286 0.0110  -0.0555 -0.0972 32  VAL A CG2 
221  N N   . SER A 33  ? 0.4615 0.7124 0.5945 0.0353  -0.0881 -0.1044 33  SER A N   
222  C CA  . SER A 33  ? 0.5231 0.7618 0.6287 0.0362  -0.0911 -0.1126 33  SER A CA  
223  C C   . SER A 33  ? 0.5764 0.8108 0.6495 0.0489  -0.0905 -0.1035 33  SER A C   
224  O O   . SER A 33  ? 0.5718 0.7929 0.6224 0.0513  -0.0831 -0.1047 33  SER A O   
225  C CB  . SER A 33  ? 0.5442 0.7932 0.6528 0.0295  -0.1073 -0.1296 33  SER A CB  
226  O OG  . SER A 33  ? 0.5907 0.8670 0.7105 0.0341  -0.1231 -0.1286 33  SER A OG  
227  N N   . ASP A 34  ? 0.5764 0.8210 0.6470 0.0577  -0.0966 -0.0937 34  ASP A N   
228  C CA  . ASP A 34  ? 0.6340 0.8698 0.6702 0.0684  -0.0955 -0.0829 34  ASP A CA  
229  C C   . ASP A 34  ? 0.6021 0.8224 0.6357 0.0680  -0.0798 -0.0673 34  ASP A C   
230  O O   . ASP A 34  ? 0.5798 0.7979 0.6358 0.0634  -0.0743 -0.0640 34  ASP A O   
231  C CB  . ASP A 34  ? 0.7069 0.9556 0.7363 0.0797  -0.1122 -0.0791 34  ASP A CB  
232  C CG  . ASP A 34  ? 0.7554 1.0128 0.8126 0.0844  -0.1117 -0.0706 34  ASP A CG  
233  O OD1 . ASP A 34  ? 0.8023 1.0813 0.8955 0.0799  -0.1172 -0.0787 34  ASP A OD1 
234  O OD2 . ASP A 34  ? 0.7614 1.0024 0.8034 0.0921  -0.1046 -0.0560 34  ASP A OD2 
235  N N   . PRO A 35  ? 0.5635 0.7720 0.5680 0.0712  -0.0722 -0.0580 35  PRO A N   
236  C CA  . PRO A 35  ? 0.5328 0.7279 0.5358 0.0664  -0.0584 -0.0443 35  PRO A CA  
237  C C   . PRO A 35  ? 0.5745 0.7588 0.5844 0.0669  -0.0588 -0.0339 35  PRO A C   
238  O O   . PRO A 35  ? 0.5854 0.7606 0.6072 0.0587  -0.0513 -0.0299 35  PRO A O   
239  C CB  . PRO A 35  ? 0.5238 0.7113 0.4922 0.0702  -0.0526 -0.0354 35  PRO A CB  
240  C CG  . PRO A 35  ? 0.5241 0.7196 0.4764 0.0755  -0.0580 -0.0486 35  PRO A CG  
241  C CD  . PRO A 35  ? 0.5363 0.7432 0.5060 0.0777  -0.0757 -0.0605 35  PRO A CD  
242  N N   . ASP A 36  ? 0.5795 0.7625 0.5793 0.0780  -0.0678 -0.0298 36  ASP A N   
243  C CA  . ASP A 36  ? 0.5950 0.7628 0.5968 0.0824  -0.0664 -0.0205 36  ASP A CA  
244  C C   . ASP A 36  ? 0.5652 0.7423 0.5997 0.0798  -0.0651 -0.0283 36  ASP A C   
245  O O   . ASP A 36  ? 0.5134 0.6721 0.5492 0.0758  -0.0568 -0.0233 36  ASP A O   
246  C CB  . ASP A 36  ? 0.6984 0.8626 0.6817 0.0994  -0.0769 -0.0137 36  ASP A CB  
247  C CG  . ASP A 36  ? 0.8970 1.0348 0.8390 0.1010  -0.0729 0.0008  36  ASP A CG  
248  O OD1 . ASP A 36  ? 0.9527 1.0737 0.8867 0.0877  -0.0603 0.0075  36  ASP A OD1 
249  O OD2 . ASP A 36  ? 0.9748 1.1091 0.8925 0.1148  -0.0829 0.0062  36  ASP A OD2 
250  N N   . ARG A 37  ? 0.5378 0.7412 0.5962 0.0804  -0.0727 -0.0405 37  ARG A N   
251  C CA  . ARG A 37  ? 0.5461 0.7600 0.6364 0.0764  -0.0689 -0.0470 37  ARG A CA  
252  C C   . ARG A 37  ? 0.5318 0.7359 0.6289 0.0613  -0.0592 -0.0510 37  ARG A C   
253  O O   . ARG A 37  ? 0.5632 0.7623 0.6745 0.0565  -0.0514 -0.0517 37  ARG A O   
254  C CB  . ARG A 37  ? 0.5671 0.8146 0.6843 0.0792  -0.0810 -0.0578 37  ARG A CB  
255  C CG  . ARG A 37  ? 0.6198 0.8825 0.7481 0.0962  -0.0881 -0.0528 37  ARG A CG  
256  C CD  . ARG A 37  ? 0.6456 0.9496 0.8075 0.0973  -0.1035 -0.0634 37  ARG A CD  
257  N NE  . ARG A 37  ? 0.6975 1.0086 0.8389 0.0990  -0.1219 -0.0681 37  ARG A NE  
258  C CZ  . ARG A 37  ? 0.7483 1.0922 0.9092 0.1001  -0.1415 -0.0771 37  ARG A CZ  
259  N NH1 . ARG A 37  ? 0.7530 1.1216 0.9569 0.0961  -0.1405 -0.0790 37  ARG A NH1 
260  N NH2 . ARG A 37  ? 0.7875 1.1265 0.9176 0.1006  -0.1568 -0.0809 37  ARG A NH2 
261  N N   . SER A 38  ? 0.5090 0.7093 0.5940 0.0557  -0.0590 -0.0530 38  SER A N   
262  C CA  . SER A 38  ? 0.4767 0.6665 0.5661 0.0452  -0.0514 -0.0544 38  SER A CA  
263  C C   . SER A 38  ? 0.4740 0.6426 0.5529 0.0419  -0.0446 -0.0427 38  SER A C   
264  O O   . SER A 38  ? 0.4260 0.5833 0.5105 0.0347  -0.0402 -0.0422 38  SER A O   
265  C CB  . SER A 38  ? 0.4134 0.6064 0.4932 0.0444  -0.0514 -0.0584 38  SER A CB  
266  O OG  . SER A 38  ? 0.4305 0.6144 0.5144 0.0384  -0.0446 -0.0560 38  SER A OG  
267  N N   . SER A 39  ? 0.4801 0.6400 0.5399 0.0465  -0.0451 -0.0332 39  SER A N   
268  C CA  . SER A 39  ? 0.5069 0.6426 0.5517 0.0414  -0.0408 -0.0224 39  SER A CA  
269  C C   . SER A 39  ? 0.4903 0.6091 0.5325 0.0457  -0.0384 -0.0212 39  SER A C   
270  O O   . SER A 39  ? 0.4872 0.5833 0.5206 0.0386  -0.0347 -0.0179 39  SER A O   
271  C CB  . SER A 39  ? 0.6164 0.7444 0.6389 0.0431  -0.0408 -0.0124 39  SER A CB  
272  O OG  . SER A 39  ? 0.7217 0.8266 0.7316 0.0326  -0.0375 -0.0027 39  SER A OG  
273  N N   . ASN A 40  ? 0.4517 0.5822 0.5009 0.0584  -0.0408 -0.0242 40  ASN A N   
274  C CA  . ASN A 40  ? 0.3968 0.5175 0.4493 0.0663  -0.0353 -0.0243 40  ASN A CA  
275  C C   . ASN A 40  ? 0.4480 0.5710 0.5168 0.0577  -0.0280 -0.0309 40  ASN A C   
276  O O   . ASN A 40  ? 0.4825 0.5847 0.5428 0.0588  -0.0191 -0.0295 40  ASN A O   
277  C CB  . ASN A 40  ? 0.4417 0.5858 0.5089 0.0831  -0.0405 -0.0264 40  ASN A CB  
278  C CG  . ASN A 40  ? 0.5716 0.7004 0.6131 0.0958  -0.0462 -0.0167 40  ASN A CG  
279  O OD1 . ASN A 40  ? 0.6425 0.7357 0.6550 0.0928  -0.0420 -0.0080 40  ASN A OD1 
280  N ND2 . ASN A 40  ? 0.6015 0.7547 0.6514 0.1091  -0.0572 -0.0177 40  ASN A ND2 
281  N N   . PHE A 41  ? 0.3761 0.5192 0.4633 0.0495  -0.0309 -0.0381 41  PHE A N   
282  C CA  . PHE A 41  ? 0.3670 0.5067 0.4653 0.0404  -0.0236 -0.0427 41  PHE A CA  
283  C C   . PHE A 41  ? 0.3299 0.4383 0.4055 0.0315  -0.0208 -0.0369 41  PHE A C   
284  O O   . PHE A 41  ? 0.4676 0.5577 0.5356 0.0282  -0.0127 -0.0364 41  PHE A O   
285  C CB  . PHE A 41  ? 0.4267 0.5868 0.5453 0.0333  -0.0279 -0.0517 41  PHE A CB  
286  C CG  . PHE A 41  ? 0.3877 0.5357 0.5112 0.0228  -0.0203 -0.0541 41  PHE A CG  
287  C CD1 . PHE A 41  ? 0.4064 0.5612 0.5468 0.0203  -0.0107 -0.0572 41  PHE A CD1 
288  C CD2 . PHE A 41  ? 0.3815 0.5110 0.4922 0.0162  -0.0218 -0.0516 41  PHE A CD2 
289  C CE1 . PHE A 41  ? 0.4316 0.5695 0.5702 0.0097  -0.0017 -0.0576 41  PHE A CE1 
290  C CE2 . PHE A 41  ? 0.4330 0.5455 0.5420 0.0082  -0.0158 -0.0520 41  PHE A CE2 
291  C CZ  . PHE A 41  ? 0.4488 0.5625 0.5686 0.0041  -0.0052 -0.0546 41  PHE A CZ  
292  N N   . MET A 42  ? 0.3021 0.4060 0.3670 0.0273  -0.0276 -0.0323 42  MET A N   
293  C CA  . MET A 42  ? 0.2898 0.3706 0.3385 0.0177  -0.0293 -0.0267 42  MET A CA  
294  C C   . MET A 42  ? 0.4566 0.5051 0.4785 0.0175  -0.0261 -0.0217 42  MET A C   
295  O O   . MET A 42  ? 0.5204 0.5442 0.5252 0.0106  -0.0257 -0.0201 42  MET A O   
296  C CB  . MET A 42  ? 0.2759 0.3664 0.3260 0.0131  -0.0361 -0.0220 42  MET A CB  
297  C CG  . MET A 42  ? 0.3288 0.4434 0.3991 0.0144  -0.0377 -0.0276 42  MET A CG  
298  S SD  . MET A 42  ? 0.4679 0.5740 0.5459 0.0107  -0.0371 -0.0323 42  MET A SD  
299  C CE  . MET A 42  ? 0.7318 0.8559 0.8249 0.0132  -0.0408 -0.0338 42  MET A CE  
300  N N   . ILE A 43  ? 0.4784 0.5230 0.4923 0.0263  -0.0246 -0.0193 43  ILE A N   
301  C CA  . ILE A 43  ? 0.5365 0.5447 0.5214 0.0295  -0.0200 -0.0160 43  ILE A CA  
302  C C   . ILE A 43  ? 0.5481 0.5446 0.5295 0.0344  -0.0084 -0.0210 43  ILE A C   
303  O O   . ILE A 43  ? 0.5568 0.5169 0.5083 0.0298  -0.0050 -0.0201 43  ILE A O   
304  C CB  . ILE A 43  ? 0.5624 0.5682 0.5408 0.0429  -0.0197 -0.0123 43  ILE A CB  
305  C CG1 . ILE A 43  ? 0.5812 0.5944 0.5572 0.0364  -0.0280 -0.0057 43  ILE A CG1 
306  C CG2 . ILE A 43  ? 0.6098 0.5707 0.5546 0.0487  -0.0137 -0.0098 43  ILE A CG2 
307  C CD1 . ILE A 43  ? 0.6009 0.6028 0.5613 0.0483  -0.0286 0.0006  43  ILE A CD1 
308  N N   . ARG A 44  ? 0.5795 0.6070 0.5905 0.0425  -0.0019 -0.0264 44  ARG A N   
309  C CA  . ARG A 44  ? 0.6087 0.6325 0.6231 0.0459  0.0129  -0.0304 44  ARG A CA  
310  C C   . ARG A 44  ? 0.6021 0.6111 0.6062 0.0315  0.0143  -0.0309 44  ARG A C   
311  O O   . ARG A 44  ? 0.6690 0.6514 0.6511 0.0306  0.0261  -0.0310 44  ARG A O   
312  C CB  . ARG A 44  ? 0.6323 0.6999 0.6887 0.0542  0.0177  -0.0356 44  ARG A CB  
313  C CG  . ARG A 44  ? 0.6918 0.7788 0.7603 0.0706  0.0119  -0.0343 44  ARG A CG  
314  C CD  . ARG A 44  ? 0.7926 0.8479 0.8346 0.0860  0.0200  -0.0302 44  ARG A CD  
315  N NE  . ARG A 44  ? 0.8947 0.9527 0.9467 0.0963  0.0390  -0.0334 44  ARG A NE  
316  C CZ  . ARG A 44  ? 0.9742 0.9901 0.9917 0.0981  0.0536  -0.0331 44  ARG A CZ  
317  N NH1 . ARG A 44  ? 1.0065 0.9745 0.9782 0.0883  0.0473  -0.0301 44  ARG A NH1 
318  N NH2 . ARG A 44  ? 0.9986 1.0206 1.0269 0.1089  0.0746  -0.0360 44  ARG A NH2 
319  N N   . ALA A 45  ? 0.5312 0.5545 0.5477 0.0220  0.0028  -0.0307 45  ALA A N   
320  C CA  . ALA A 45  ? 0.5346 0.5429 0.5412 0.0110  0.0011  -0.0296 45  ALA A CA  
321  C C   . ALA A 45  ? 0.5399 0.5085 0.5065 0.0048  -0.0047 -0.0242 45  ALA A C   
322  O O   . ALA A 45  ? 0.5761 0.5179 0.5188 0.0001  -0.0004 -0.0231 45  ALA A O   
323  C CB  . ALA A 45  ? 0.4772 0.5086 0.5060 0.0065  -0.0101 -0.0306 45  ALA A CB  
324  N N   . ILE A 46  ? 0.5736 0.5365 0.5305 0.0033  -0.0153 -0.0208 46  ILE A N   
325  C CA  . ILE A 46  ? 0.6037 0.5291 0.5234 -0.0056 -0.0239 -0.0167 46  ILE A CA  
326  C C   . ILE A 46  ? 0.6117 0.4972 0.4940 -0.0009 -0.0109 -0.0193 46  ILE A C   
327  O O   . ILE A 46  ? 0.6296 0.4803 0.4763 -0.0078 -0.0132 -0.0185 46  ILE A O   
328  C CB  . ILE A 46  ? 0.6344 0.5599 0.5522 -0.0104 -0.0348 -0.0125 46  ILE A CB  
329  C CG1 . ILE A 46  ? 0.6128 0.5772 0.5647 -0.0150 -0.0449 -0.0094 46  ILE A CG1 
330  C CG2 . ILE A 46  ? 0.6432 0.5265 0.5211 -0.0227 -0.0449 -0.0097 46  ILE A CG2 
331  C CD1 . ILE A 46  ? 0.5469 0.5169 0.5012 -0.0206 -0.0510 -0.0040 46  ILE A CD1 
332  N N   . TYR A 47  ? 0.6365 0.5267 0.5254 0.0126  0.0029  -0.0223 47  TYR A N   
333  C CA  . TYR A 47  ? 0.6726 0.5274 0.5289 0.0218  0.0195  -0.0254 47  TYR A CA  
334  C C   . TYR A 47  ? 0.7170 0.5660 0.5667 0.0212  0.0348  -0.0275 47  TYR A C   
335  O O   . TYR A 47  ? 0.7336 0.5388 0.5377 0.0204  0.0432  -0.0286 47  TYR A O   
336  C CB  . TYR A 47  ? 0.6208 0.4924 0.4968 0.0405  0.0309  -0.0272 47  TYR A CB  
337  C CG  . TYR A 47  ? 0.6815 0.5296 0.5377 0.0559  0.0536  -0.0311 47  TYR A CG  
338  C CD1 . TYR A 47  ? 0.7383 0.5307 0.5431 0.0609  0.0576  -0.0324 47  TYR A CD1 
339  C CD2 . TYR A 47  ? 0.6718 0.5536 0.5615 0.0652  0.0721  -0.0340 47  TYR A CD2 
340  C CE1 . TYR A 47  ? 0.7091 0.4784 0.4938 0.0783  0.0816  -0.0368 47  TYR A CE1 
341  C CE2 . TYR A 47  ? 0.6859 0.5522 0.5628 0.0808  0.0964  -0.0371 47  TYR A CE2 
342  C CZ  . TYR A 47  ? 0.7363 0.5458 0.5595 0.0892  0.1021  -0.0387 47  TYR A CZ  
343  O OH  . TYR A 47  ? 0.7386 0.5312 0.5472 0.1079  0.1293  -0.0426 47  TYR A OH  
344  N N   . VAL A 48  ? 0.6773 0.5666 0.5683 0.0203  0.0390  -0.0282 48  VAL A N   
345  C CA  . VAL A 48  ? 0.6582 0.5438 0.5470 0.0180  0.0565  -0.0290 48  VAL A CA  
346  C C   . VAL A 48  ? 0.6493 0.5032 0.5039 0.0049  0.0471  -0.0248 48  VAL A C   
347  O O   . VAL A 48  ? 0.7229 0.5400 0.5372 0.0034  0.0596  -0.0238 48  VAL A O   
348  C CB  . VAL A 48  ? 0.6010 0.5366 0.5447 0.0180  0.0626  -0.0314 48  VAL A CB  
349  C CG1 . VAL A 48  ? 0.6422 0.5698 0.5822 0.0101  0.0797  -0.0304 48  VAL A CG1 
350  C CG2 . VAL A 48  ? 0.5370 0.5052 0.5138 0.0328  0.0724  -0.0351 48  VAL A CG2 
351  N N   . VAL A 49  ? 0.6350 0.5021 0.5034 -0.0030 0.0253  -0.0218 49  VAL A N   
352  C CA  . VAL A 49  ? 0.7110 0.5538 0.5534 -0.0125 0.0133  -0.0166 49  VAL A CA  
353  C C   . VAL A 49  ? 0.7228 0.5182 0.5094 -0.0170 0.0032  -0.0145 49  VAL A C   
354  O O   . VAL A 49  ? 0.7903 0.5485 0.5345 -0.0208 0.0058  -0.0117 49  VAL A O   
355  C CB  . VAL A 49  ? 0.7158 0.5883 0.5912 -0.0163 -0.0071 -0.0140 49  VAL A CB  
356  C CG1 . VAL A 49  ? 0.7686 0.6167 0.6187 -0.0224 -0.0215 -0.0075 49  VAL A CG1 
357  C CG2 . VAL A 49  ? 0.6477 0.5577 0.5687 -0.0132 0.0019  -0.0179 49  VAL A CG2 
358  N N   . PHE A 50  ? 0.7351 0.5275 0.5172 -0.0178 -0.0082 -0.0158 50  PHE A N   
359  C CA  . PHE A 50  ? 0.7828 0.5274 0.5105 -0.0254 -0.0206 -0.0153 50  PHE A CA  
360  C C   . PHE A 50  ? 0.8068 0.5045 0.4837 -0.0188 0.0007  -0.0201 50  PHE A C   
361  O O   . PHE A 50  ? 0.8949 0.5432 0.5140 -0.0253 -0.0065 -0.0204 50  PHE A O   
362  C CB  . PHE A 50  ? 0.7631 0.5137 0.4996 -0.0312 -0.0372 -0.0152 50  PHE A CB  
363  C CG  . PHE A 50  ? 0.7745 0.5568 0.5422 -0.0415 -0.0615 -0.0094 50  PHE A CG  
364  C CD1 . PHE A 50  ? 0.8292 0.5958 0.5753 -0.0518 -0.0821 -0.0051 50  PHE A CD1 
365  C CD2 . PHE A 50  ? 0.7444 0.5734 0.5626 -0.0394 -0.0633 -0.0079 50  PHE A CD2 
366  C CE1 . PHE A 50  ? 0.8170 0.6188 0.5983 -0.0585 -0.1035 0.0007  50  PHE A CE1 
367  C CE2 . PHE A 50  ? 0.7505 0.6112 0.5994 -0.0469 -0.0817 -0.0027 50  PHE A CE2 
368  C CZ  . PHE A 50  ? 0.7673 0.6171 0.6014 -0.0558 -0.1015 0.0017  50  PHE A CZ  
369  N N   . SER A 51  ? 0.7682 0.4820 0.4660 -0.0052 0.0267  -0.0241 51  SER A N   
370  C CA  . SER A 51  ? 0.8075 0.4841 0.4643 0.0043  0.0532  -0.0283 51  SER A CA  
371  C C   . SER A 51  ? 0.8234 0.4812 0.4536 -0.0008 0.0635  -0.0249 51  SER A C   
372  O O   . SER A 51  ? 0.8976 0.5019 0.4638 -0.0014 0.0713  -0.0262 51  SER A O   
373  C CB  . SER A 51  ? 0.8137 0.5242 0.5118 0.0214  0.0785  -0.0320 51  SER A CB  
374  O OG  . SER A 51  ? 0.8060 0.5158 0.5094 0.0298  0.0722  -0.0346 51  SER A OG  
375  N N   . ALA A 52  ? 0.8102 0.5073 0.4849 -0.0047 0.0641  -0.0205 52  ALA A N   
376  C CA  . ALA A 52  ? 0.7862 0.4648 0.4383 -0.0109 0.0732  -0.0151 52  ALA A CA  
377  C C   . ALA A 52  ? 0.8418 0.4735 0.4355 -0.0202 0.0486  -0.0102 52  ALA A C   
378  O O   . ALA A 52  ? 0.9598 0.5450 0.4956 -0.0220 0.0589  -0.0075 52  ALA A O   
379  C CB  . ALA A 52  ? 0.7160 0.4405 0.4261 -0.0149 0.0724  -0.0118 52  ALA A CB  
380  N N   . VAL A 53  ? 0.8108 0.4558 0.4192 -0.0262 0.0163  -0.0086 53  VAL A N   
381  C CA  . VAL A 53  ? 0.9014 0.5112 0.4635 -0.0355 -0.0123 -0.0036 53  VAL A CA  
382  C C   . VAL A 53  ? 1.0267 0.5764 0.5148 -0.0376 -0.0122 -0.0085 53  VAL A C   
383  O O   . VAL A 53  ? 1.0832 0.5853 0.5090 -0.0417 -0.0175 -0.0052 53  VAL A O   
384  C CB  . VAL A 53  ? 0.8956 0.5399 0.4971 -0.0418 -0.0454 -0.0012 53  VAL A CB  
385  C CG1 . VAL A 53  ? 0.9446 0.5572 0.5022 -0.0517 -0.0773 0.0039  53  VAL A CG1 
386  C CG2 . VAL A 53  ? 0.8410 0.5371 0.5066 -0.0382 -0.0459 0.0026  53  VAL A CG2 
387  N N   . LEU A 54  ? 1.0365 0.5833 0.5261 -0.0343 -0.0066 -0.0164 54  LEU A N   
388  C CA  . LEU A 54  ? 1.0867 0.5705 0.5033 -0.0353 -0.0049 -0.0234 54  LEU A CA  
389  C C   . LEU A 54  ? 1.0899 0.5297 0.4503 -0.0268 0.0269  -0.0252 54  LEU A C   
390  O O   . LEU A 54  ? 1.0770 0.4558 0.3595 -0.0317 0.0207  -0.0268 54  LEU A O   
391  C CB  . LEU A 54  ? 1.0953 0.5818 0.5267 -0.0291 0.0023  -0.0312 54  LEU A CB  
392  C CG  . LEU A 54  ? 1.0764 0.5851 0.5395 -0.0409 -0.0279 -0.0301 54  LEU A CG  
393  C CD1 . LEU A 54  ? 1.0982 0.6068 0.5749 -0.0311 -0.0142 -0.0358 54  LEU A CD1 
394  C CD2 . LEU A 54  ? 1.1163 0.5810 0.5260 -0.0597 -0.0606 -0.0306 54  LEU A CD2 
395  N N   . ARG A 55  ? 1.1014 0.5728 0.5005 -0.0151 0.0609  -0.0247 55  ARG A N   
396  C CA  . ARG A 55  ? 1.1773 0.6145 0.5314 -0.0072 0.0971  -0.0255 55  ARG A CA  
397  C C   . ARG A 55  ? 1.1974 0.6113 0.5155 -0.0165 0.0932  -0.0157 55  ARG A C   
398  O O   . ARG A 55  ? 1.2218 0.5736 0.4582 -0.0177 0.0992  -0.0157 55  ARG A O   
399  C CB  . ARG A 55  ? 1.1595 0.6462 0.5758 0.0059  0.1337  -0.0271 55  ARG A CB  
400  C CG  . ARG A 55  ? 1.2017 0.6675 0.5875 0.0119  0.1753  -0.0256 55  ARG A CG  
401  C CD  . ARG A 55  ? 1.3520 0.7554 0.6624 0.0227  0.1946  -0.0334 55  ARG A CD  
402  N NE  . ARG A 55  ? 1.5225 0.8909 0.7897 0.0190  0.2112  -0.0266 55  ARG A NE  
403  C CZ  . ARG A 55  ? 1.5921 0.9024 0.7923 0.0114  0.1909  -0.0245 55  ARG A CZ  
404  N NH1 . ARG A 55  ? 1.5629 0.8479 0.7370 0.0048  0.1529  -0.0282 55  ARG A NH1 
405  N NH2 . ARG A 55  ? 1.6867 0.9657 0.8485 0.0095  0.2083  -0.0188 55  ARG A NH2 
406  N N   . GLN A 56  ? 1.1925 0.6514 0.5666 -0.0221 0.0826  -0.0074 56  GLN A N   
407  C CA  . GLN A 56  ? 1.2618 0.7002 0.6086 -0.0288 0.0814  0.0037  56  GLN A CA  
408  C C   . GLN A 56  ? 1.2956 0.6815 0.5710 -0.0363 0.0466  0.0083  56  GLN A C   
409  O O   . GLN A 56  ? 1.3975 0.7379 0.6126 -0.0387 0.0511  0.0161  56  GLN A O   
410  C CB  . GLN A 56  ? 1.2784 0.7728 0.7011 -0.0320 0.0733  0.0100  56  GLN A CB  
411  C CG  . GLN A 56  ? 1.3825 0.8768 0.8114 -0.0346 0.1029  0.0175  56  GLN A CG  
412  C CD  . GLN A 56  ? 1.4248 0.9343 0.8718 -0.0293 0.1476  0.0119  56  GLN A CD  
413  O OE1 . GLN A 56  ? 1.4115 0.9652 0.9123 -0.0223 0.1541  0.0033  56  GLN A OE1 
414  N NE2 . GLN A 56  ? 1.4809 0.9548 0.8834 -0.0320 0.1789  0.0177  56  GLN A NE2 
415  N N   . ARG A 57  ? 1.2794 0.6716 0.5612 -0.0409 0.0113  0.0040  57  ARG A N   
416  C CA  . ARG A 57  ? 1.3209 0.6707 0.5435 -0.0496 -0.0262 0.0071  57  ARG A CA  
417  C C   . ARG A 57  ? 1.3860 0.6864 0.5579 -0.0493 -0.0194 -0.0020 57  ARG A C   
418  O O   . ARG A 57  ? 1.4317 0.7036 0.5726 -0.0571 -0.0487 -0.0015 57  ARG A O   
419  C CB  . ARG A 57  ? 1.2695 0.6603 0.5412 -0.0574 -0.0680 0.0078  57  ARG A CB  
420  C CG  . ARG A 57  ? 1.2156 0.6565 0.5504 -0.0557 -0.0822 0.0184  57  ARG A CG  
421  C CD  . ARG A 57  ? 1.2551 0.6585 0.5396 -0.0550 -0.0920 0.0304  57  ARG A CD  
422  N NE  . ARG A 57  ? 1.2654 0.6592 0.5347 -0.0611 -0.1339 0.0331  57  ARG A NE  
423  C CZ  . ARG A 57  ? 1.3319 0.6879 0.5570 -0.0605 -0.1432 0.0383  57  ARG A CZ  
424  N NH1 . ARG A 57  ? 1.3421 0.6603 0.5250 -0.0552 -0.1137 0.0418  57  ARG A NH1 
425  N NH2 . ARG A 57  ? 1.3868 0.7443 0.6112 -0.0659 -0.1812 0.0403  57  ARG A NH2 
426  N N   . ASN A 58  ? 1.3757 0.6674 0.5418 -0.0394 0.0195  -0.0096 58  ASN A N   
427  C CA  . ASN A 58  ? 1.4940 0.7359 0.6109 -0.0353 0.0325  -0.0169 58  ASN A CA  
428  C C   . ASN A 58  ? 1.4524 0.6800 0.5612 -0.0438 0.0004  -0.0228 58  ASN A C   
429  O O   . ASN A 58  ? 1.4116 0.5891 0.4686 -0.0471 -0.0073 -0.0255 58  ASN A O   
430  C CB  . ASN A 58  ? 1.6155 0.8083 0.6731 -0.0364 0.0366  -0.0118 58  ASN A CB  
431  C CG  . ASN A 58  ? 1.7804 0.9234 0.7873 -0.0279 0.0642  -0.0185 58  ASN A CG  
432  O OD1 . ASN A 58  ? 1.8396 0.9370 0.7988 -0.0328 0.0450  -0.0221 58  ASN A OD1 
433  N ND2 . ASN A 58  ? 1.8380 0.9917 0.8576 -0.0151 0.1098  -0.0197 58  ASN A ND2 
434  N N   . ILE A 59  ? 1.4048 0.6757 0.5647 -0.0485 -0.0175 -0.0244 59  ILE A N   
435  C CA  . ILE A 59  ? 1.3700 0.6341 0.5323 -0.0590 -0.0451 -0.0287 59  ILE A CA  
436  C C   . ILE A 59  ? 1.3779 0.6145 0.5221 -0.0482 -0.0184 -0.0376 59  ILE A C   
437  O O   . ILE A 59  ? 1.3491 0.5464 0.4591 -0.0544 -0.0306 -0.0409 59  ILE A O   
438  C CB  . ILE A 59  ? 1.2669 0.5888 0.4933 -0.0677 -0.0699 -0.0266 59  ILE A CB  
439  C CG1 . ILE A 59  ? 1.2805 0.6307 0.5273 -0.0752 -0.0973 -0.0163 59  ILE A CG1 
440  C CG2 . ILE A 59  ? 1.2664 0.5829 0.4993 -0.0807 -0.0940 -0.0299 59  ILE A CG2 
441  C CD1 . ILE A 59  ? 1.2181 0.6286 0.5314 -0.0830 -0.1227 -0.0128 59  ILE A CD1 
442  N N   . LEU A 60  ? 1.3878 0.6463 0.5564 -0.0310 0.0184  -0.0409 60  LEU A N   
443  C CA  . LEU A 60  ? 1.4113 0.6482 0.5675 -0.0145 0.0491  -0.0479 60  LEU A CA  
444  C C   . LEU A 60  ? 1.4586 0.6920 0.6051 0.0020  0.0915  -0.0472 60  LEU A C   
445  O O   . LEU A 60  ? 1.4566 0.7278 0.6354 0.0041  0.1057  -0.0430 60  LEU A O   
446  C CB  . LEU A 60  ? 1.3293 0.6053 0.5387 -0.0068 0.0538  -0.0527 60  LEU A CB  
447  C CG  . LEU A 60  ? 1.3085 0.5847 0.5286 -0.0223 0.0186  -0.0536 60  LEU A CG  
448  C CD1 . LEU A 60  ? 1.2722 0.5850 0.5437 -0.0120 0.0278  -0.0576 60  LEU A CD1 
449  C CD2 . LEU A 60  ? 1.3675 0.5837 0.5323 -0.0280 0.0093  -0.0556 60  LEU A CD2 
450  N N   . GLU A 61  ? 1.5110 0.6994 0.6138 0.0128  0.1124  -0.0507 61  GLU A N   
451  C CA  . GLU A 61  ? 1.5921 0.7772 0.6867 0.0281  0.1545  -0.0498 61  GLU A CA  
452  C C   . GLU A 61  ? 1.5202 0.7657 0.6835 0.0453  0.1866  -0.0511 61  GLU A C   
453  O O   . GLU A 61  ? 1.4587 0.7333 0.6627 0.0508  0.1795  -0.0551 61  GLU A O   
454  C CB  . GLU A 61  ? 1.7310 0.8552 0.7648 0.0376  0.1692  -0.0541 61  GLU A CB  
455  C CG  . GLU A 61  ? 1.8884 0.9492 0.8504 0.0214  0.1395  -0.0535 61  GLU A CG  
456  C CD  . GLU A 61  ? 1.9872 1.0298 0.9396 0.0088  0.1023  -0.0568 61  GLU A CD  
457  O OE1 . GLU A 61  ? 2.0679 1.0839 0.9878 -0.0103 0.0670  -0.0546 61  GLU A OE1 
458  O OE2 . GLU A 61  ? 1.9796 1.0359 0.9589 0.0178  0.1082  -0.0611 61  GLU A OE2 
459  N N   . LYS A 62  ? 1.5322 0.7968 0.7098 0.0531  0.2214  -0.0475 62  LYS A N   
460  C CA  . LYS A 62  ? 1.5017 0.8322 0.7532 0.0671  0.2520  -0.0476 62  LYS A CA  
461  C C   . LYS A 62  ? 1.4964 0.8400 0.7745 0.0895  0.2675  -0.0541 62  LYS A C   
462  O O   . LYS A 62  ? 1.4483 0.8527 0.7962 0.1018  0.2837  -0.0546 62  LYS A O   
463  C CB  . LYS A 62  ? 1.5464 0.8891 0.8035 0.0685  0.2875  -0.0417 62  LYS A CB  
464  C CG  . LYS A 62  ? 1.6564 0.9472 0.8563 0.0779  0.3096  -0.0430 62  LYS A CG  
465  C CD  . LYS A 62  ? 1.7126 1.0260 0.9309 0.0809  0.3498  -0.0374 62  LYS A CD  
466  C CE  . LYS A 62  ? 1.8345 1.0992 0.9982 0.0935  0.3753  -0.0399 62  LYS A CE  
467  N NZ  . LYS A 62  ? 1.8746 1.1661 1.0612 0.0969  0.4175  -0.0346 62  LYS A NZ  
468  N N   . GLU A 63  ? 1.5717 0.8581 0.7946 0.0950  0.2613  -0.0584 63  GLU A N   
469  C CA  . GLU A 63  ? 1.6023 0.8903 0.8404 0.1172  0.2735  -0.0637 63  GLU A CA  
470  C C   . GLU A 63  ? 1.5119 0.8310 0.7944 0.1182  0.2505  -0.0658 63  GLU A C   
471  O O   . GLU A 63  ? 1.4474 0.7973 0.7733 0.1391  0.2634  -0.0679 63  GLU A O   
472  C CB  . GLU A 63  ? 1.7363 0.9462 0.8957 0.1197  0.2695  -0.0675 63  GLU A CB  
473  C CG  . GLU A 63  ? 1.8676 1.0554 0.9993 0.1364  0.3074  -0.0684 63  GLU A CG  
474  C CD  . GLU A 63  ? 1.9308 1.1186 1.0469 0.1253  0.3219  -0.0630 63  GLU A CD  
475  O OE1 . GLU A 63  ? 1.9591 1.1850 1.1113 0.1374  0.3580  -0.0607 63  GLU A OE1 
476  O OE2 . GLU A 63  ? 1.9523 1.1025 1.0210 0.1042  0.2967  -0.0604 63  GLU A OE2 
477  N N   . TYR A 64  ? 1.4756 0.7874 0.7479 0.0962  0.2157  -0.0648 64  TYR A N   
478  C CA  . TYR A 64  ? 1.3965 0.7321 0.7044 0.0936  0.1919  -0.0666 64  TYR A CA  
479  C C   . TYR A 64  ? 1.2955 0.7055 0.6804 0.0991  0.2004  -0.0651 64  TYR A C   
480  O O   . TYR A 64  ? 1.2582 0.6931 0.6784 0.1002  0.1845  -0.0665 64  TYR A O   
481  C CB  . TYR A 64  ? 1.4047 0.7088 0.6767 0.0662  0.1508  -0.0657 64  TYR A CB  
482  C CG  . TYR A 64  ? 1.4957 0.7296 0.6975 0.0583  0.1369  -0.0672 64  TYR A CG  
483  C CD1 . TYR A 64  ? 1.5650 0.7677 0.7490 0.0720  0.1437  -0.0708 64  TYR A CD1 
484  C CD2 . TYR A 64  ? 1.5234 0.7210 0.6759 0.0379  0.1164  -0.0645 64  TYR A CD2 
485  C CE1 . TYR A 64  ? 1.6138 0.7494 0.7307 0.0636  0.1317  -0.0726 64  TYR A CE1 
486  C CE2 . TYR A 64  ? 1.5934 0.7274 0.6824 0.0299  0.1028  -0.0662 64  TYR A CE2 
487  C CZ  . TYR A 64  ? 1.6340 0.7363 0.7042 0.0420  0.1111  -0.0707 64  TYR A CZ  
488  O OH  . TYR A 64  ? 1.6956 0.7314 0.6994 0.0331  0.0980  -0.0729 64  TYR A OH  
489  N N   . PHE A 65  ? 1.2494 0.6932 0.6598 0.1016  0.2259  -0.0619 65  PHE A N   
490  C CA  . PHE A 65  ? 1.1248 0.6387 0.6071 0.1024  0.2338  -0.0599 65  PHE A CA  
491  C C   . PHE A 65  ? 1.1325 0.6999 0.6740 0.1221  0.2693  -0.0583 65  PHE A C   
492  O O   . PHE A 65  ? 1.1822 0.7313 0.7050 0.1348  0.2910  -0.0587 65  PHE A O   
493  C CB  . PHE A 65  ? 1.0344 0.5563 0.5135 0.0784  0.2227  -0.0529 65  PHE A CB  
494  C CG  . PHE A 65  ? 1.0183 0.5061 0.4589 0.0574  0.1815  -0.0510 65  PHE A CG  
495  C CD1 . PHE A 65  ? 0.9521 0.4840 0.4463 0.0459  0.1491  -0.0464 65  PHE A CD1 
496  C CD2 . PHE A 65  ? 1.0897 0.5038 0.4415 0.0492  0.1746  -0.0537 65  PHE A CD2 
497  C CE1 . PHE A 65  ? 0.9780 0.4862 0.4445 0.0270  0.1125  -0.0440 65  PHE A CE1 
498  C CE2 . PHE A 65  ? 1.1113 0.5001 0.4329 0.0292  0.1342  -0.0518 65  PHE A CE2 
499  C CZ  . PHE A 65  ? 1.0395 0.4787 0.4228 0.0183  0.1038  -0.0465 65  PHE A CZ  
500  N N   . SER A 66  ? 1.1266 0.7658 0.7460 0.1221  0.2710  -0.0555 66  SER A N   
501  C CA  . SER A 66  ? 1.1619 0.8625 0.8470 0.1363  0.3024  -0.0541 66  SER A CA  
502  C C   . SER A 66  ? 1.0758 0.8332 0.8180 0.1160  0.3016  -0.0480 66  SER A C   
503  O O   . SER A 66  ? 0.9969 0.7613 0.7479 0.0963  0.2690  -0.0445 66  SER A O   
504  C CB  . SER A 66  ? 1.1946 0.9365 0.9342 0.1605  0.2988  -0.0561 66  SER A CB  
505  O OG  . SER A 66  ? 1.2361 1.0405 1.0409 0.1728  0.3230  -0.0542 66  SER A OG  
506  N N   . LYS A 67  ? 1.0979 0.8967 0.8817 0.1191  0.3351  -0.0460 67  LYS A N   
507  C CA  . LYS A 67  ? 1.1013 0.9473 0.9358 0.0965  0.3360  -0.0402 67  LYS A CA  
508  C C   . LYS A 67  ? 1.0652 0.9889 0.9900 0.0968  0.3160  -0.0406 67  LYS A C   
509  O O   . LYS A 67  ? 1.0603 1.0296 1.0357 0.1178  0.3264  -0.0434 67  LYS A O   
510  C CB  . LYS A 67  ? 1.1224 0.9829 0.9682 0.0925  0.3735  -0.0361 67  LYS A CB  
511  C CG  . LYS A 67  ? 1.1236 1.0136 1.0040 0.0654  0.3797  -0.0298 67  LYS A CG  
512  C CD  . LYS A 67  ? 1.2113 1.1043 1.0917 0.0572  0.4111  -0.0237 67  LYS A CD  
513  C CE  . LYS A 67  ? 1.2309 1.1388 1.1343 0.0273  0.4152  -0.0164 67  LYS A CE  
514  N NZ  . LYS A 67  ? 1.3123 1.2191 1.2123 0.0178  0.4464  -0.0095 67  LYS A NZ  
515  N N   . ASN A 68  ? 1.0500 0.9860 0.9913 0.0749  0.2863  -0.0379 68  ASN A N   
516  C CA  . ASN A 68  ? 1.0280 1.0314 1.0460 0.0709  0.2657  -0.0390 68  ASN A CA  
517  C C   . ASN A 68  ? 0.9845 1.0102 1.0317 0.0437  0.2639  -0.0357 68  ASN A C   
518  O O   . ASN A 68  ? 0.9891 0.9722 0.9915 0.0285  0.2735  -0.0311 68  ASN A O   
519  C CB  . ASN A 68  ? 1.0240 1.0175 1.0319 0.0743  0.2271  -0.0406 68  ASN A CB  
520  C CG  . ASN A 68  ? 1.0847 1.0852 1.0996 0.1017  0.2255  -0.0436 68  ASN A CG  
521  O OD1 . ASN A 68  ? 1.0553 1.1133 1.1316 0.1132  0.2225  -0.0449 68  ASN A OD1 
522  N ND2 . ASN A 68  ? 1.1714 1.1100 1.1210 0.1121  0.2255  -0.0447 68  ASN A ND2 
523  N N   . TYR A 69  ? 0.9305 1.0185 1.0484 0.0379  0.2504  -0.0382 69  TYR A N   
524  C CA  . TYR A 69  ? 0.9249 1.0317 1.0718 0.0113  0.2451  -0.0369 69  TYR A CA  
525  C C   . TYR A 69  ? 0.8781 1.0051 1.0486 0.0058  0.2069  -0.0409 69  TYR A C   
526  O O   . TYR A 69  ? 0.8692 1.0300 1.0694 0.0208  0.1908  -0.0449 69  TYR A O   
527  C CB  . TYR A 69  ? 0.9174 1.0834 1.1319 0.0037  0.2710  -0.0373 69  TYR A CB  
528  C CG  . TYR A 69  ? 0.9790 1.1269 1.1732 0.0024  0.3147  -0.0321 69  TYR A CG  
529  C CD1 . TYR A 69  ? 1.0187 1.1619 1.1983 0.0283  0.3396  -0.0327 69  TYR A CD1 
530  C CD2 . TYR A 69  ? 1.0025 1.1346 1.1892 -0.0240 0.3330  -0.0263 69  TYR A CD2 
531  C CE1 . TYR A 69  ? 1.0774 1.2016 1.2320 0.0280  0.3767  -0.0279 69  TYR A CE1 
532  C CE2 . TYR A 69  ? 1.0679 1.1817 1.2319 -0.0260 0.3759  -0.0203 69  TYR A CE2 
533  C CZ  . TYR A 69  ? 1.1089 1.2192 1.2548 0.0006  0.3921  -0.0212 69  TYR A CZ  
534  O OH  . TYR A 69  ? 1.1913 1.2801 1.3072 0.0001  0.4226  -0.0153 69  TYR A OH  
535  N N   . ILE A 70  ? 0.8710 0.9741 1.0244 -0.0140 0.1935  -0.0392 70  ILE A N   
536  C CA  . ILE A 70  ? 0.8370 0.9576 1.0117 -0.0205 0.1618  -0.0438 70  ILE A CA  
537  C C   . ILE A 70  ? 0.8119 0.9763 1.0439 -0.0390 0.1638  -0.0481 70  ILE A C   
538  O O   . ILE A 70  ? 0.7837 0.9888 1.0563 -0.0390 0.1436  -0.0551 70  ILE A O   
539  C CB  . ILE A 70  ? 0.8629 0.9320 0.9871 -0.0281 0.1447  -0.0402 70  ILE A CB  
540  C CG1 . ILE A 70  ? 0.9002 0.9246 0.9671 -0.0147 0.1430  -0.0358 70  ILE A CG1 
541  C CG2 . ILE A 70  ? 0.8126 0.8997 0.9567 -0.0304 0.1150  -0.0456 70  ILE A CG2 
542  C CD1 . ILE A 70  ? 0.9600 0.9327 0.9754 -0.0230 0.1324  -0.0300 70  ILE A CD1 
543  N N   . THR A 71  ? 0.8334 0.9851 1.0641 -0.0566 0.1880  -0.0438 71  THR A N   
544  C CA  . THR A 71  ? 0.8434 1.0374 1.1317 -0.0777 0.1966  -0.0472 71  THR A CA  
545  C C   . THR A 71  ? 0.9347 1.1415 1.2374 -0.0810 0.2363  -0.0415 71  THR A C   
546  O O   . THR A 71  ? 0.9873 1.1634 1.2476 -0.0657 0.2554  -0.0360 71  THR A O   
547  C CB  . THR A 71  ? 0.8133 0.9743 1.0871 -0.1026 0.1877  -0.0471 71  THR A CB  
548  O OG1 . THR A 71  ? 0.8572 0.9650 1.0838 -0.1123 0.2116  -0.0367 71  THR A OG1 
549  C CG2 . THR A 71  ? 0.7875 0.9223 1.0312 -0.0947 0.1546  -0.0507 71  THR A CG2 
550  N N   . GLU A 72  ? 0.9551 1.2067 1.3166 -0.1017 0.2496  -0.0432 72  GLU A N   
551  C CA  . GLU A 72  ? 1.0049 1.2765 1.3884 -0.1068 0.2912  -0.0371 72  GLU A CA  
552  C C   . GLU A 72  ? 1.0435 1.2435 1.3577 -0.1176 0.3169  -0.0264 72  GLU A C   
553  O O   . GLU A 72  ? 1.0875 1.2781 1.3832 -0.1106 0.3509  -0.0197 72  GLU A O   
554  C CB  . GLU A 72  ? 1.0458 1.3742 1.4970 -0.1286 0.2883  -0.0385 72  GLU A CB  
555  C CG  . GLU A 72  ? 1.0677 1.4670 1.5799 -0.1153 0.2603  -0.0458 72  GLU A CG  
556  C CD  . GLU A 72  ? 1.1381 1.5876 1.7081 -0.1388 0.2533  -0.0453 72  GLU A CD  
557  O OE1 . GLU A 72  ? 1.1817 1.6063 1.7444 -0.1681 0.2660  -0.0415 72  GLU A OE1 
558  O OE2 . GLU A 72  ? 1.1501 1.6614 1.7702 -0.1282 0.2344  -0.0476 72  GLU A OE2 
559  N N   . ASN A 73  ? 1.0357 1.1824 1.3067 -0.1318 0.2979  -0.0244 73  ASN A N   
560  C CA  . ASN A 73  ? 1.0890 1.1636 1.2913 -0.1430 0.3160  -0.0130 73  ASN A CA  
561  C C   . ASN A 73  ? 1.0539 1.0690 1.1764 -0.1203 0.3073  -0.0088 73  ASN A C   
562  O O   . ASN A 73  ? 1.1157 1.0752 1.1762 -0.1225 0.3276  0.0011  73  ASN A O   
563  C CB  . ASN A 73  ? 1.1628 1.2064 1.3580 -0.1680 0.2989  -0.0122 73  ASN A CB  
564  C CG  . ASN A 73  ? 1.2655 1.2671 1.4338 -0.1931 0.3307  -0.0001 73  ASN A CG  
565  O OD1 . ASN A 73  ? 1.3503 1.2885 1.4460 -0.1881 0.3432  0.0109  73  ASN A OD1 
566  N ND2 . ASN A 73  ? 1.2652 1.2998 1.4883 -0.2204 0.3404  -0.0017 73  ASN A ND2 
567  N N   . LEU A 74  ? 0.9400 0.9658 1.0627 -0.1003 0.2763  -0.0160 74  LEU A N   
568  C CA  . LEU A 74  ? 0.9326 0.9037 0.9851 -0.0839 0.2597  -0.0130 74  LEU A CA  
569  C C   . LEU A 74  ? 0.9415 0.9250 0.9876 -0.0582 0.2596  -0.0175 74  LEU A C   
570  O O   . LEU A 74  ? 0.8677 0.9011 0.9628 -0.0472 0.2468  -0.0251 74  LEU A O   
571  C CB  . LEU A 74  ? 0.8881 0.8461 0.9343 -0.0857 0.2209  -0.0158 74  LEU A CB  
572  C CG  . LEU A 74  ? 0.8817 0.7950 0.8687 -0.0708 0.1985  -0.0131 74  LEU A CG  
573  C CD1 . LEU A 74  ? 0.8994 0.7459 0.8159 -0.0764 0.2080  -0.0018 74  LEU A CD1 
574  C CD2 . LEU A 74  ? 0.8368 0.7596 0.8389 -0.0690 0.1630  -0.0178 74  LEU A CD2 
575  N N   . SER A 75  ? 0.9836 0.9155 0.9631 -0.0486 0.2728  -0.0126 75  SER A N   
576  C CA  . SER A 75  ? 0.9294 0.8575 0.8896 -0.0249 0.2749  -0.0169 75  SER A CA  
577  C C   . SER A 75  ? 0.9485 0.8192 0.8398 -0.0183 0.2488  -0.0156 75  SER A C   
578  O O   . SER A 75  ? 0.9674 0.7978 0.8189 -0.0301 0.2352  -0.0096 75  SER A O   
579  C CB  . SER A 75  ? 0.9580 0.8767 0.9000 -0.0174 0.3183  -0.0147 75  SER A CB  
580  O OG  . SER A 75  ? 1.0078 0.8557 0.8679 -0.0234 0.3300  -0.0074 75  SER A OG  
581  N N   . CYS A 76  ? 0.9532 0.8201 0.8315 0.0004  0.2412  -0.0209 76  CYS A N   
582  C CA  . CYS A 76  ? 0.9819 0.7977 0.7988 0.0044  0.2162  -0.0205 76  CYS A CA  
583  C C   . CYS A 76  ? 0.9954 0.7919 0.7839 0.0241  0.2254  -0.0260 76  CYS A C   
584  O O   . CYS A 76  ? 0.9690 0.8002 0.7953 0.0383  0.2466  -0.0300 76  CYS A O   
585  C CB  . CYS A 76  ? 0.9770 0.8141 0.8215 0.0002  0.1779  -0.0218 76  CYS A CB  
586  S SG  . CYS A 76  ? 0.9105 0.8157 0.8302 0.0120  0.1689  -0.0290 76  CYS A SG  
587  N N   . MET A 77  ? 1.0429 0.7833 0.7651 0.0252  0.2086  -0.0262 77  MET A N   
588  C CA  . MET A 77  ? 1.0529 0.7618 0.7376 0.0421  0.2143  -0.0324 77  MET A CA  
589  C C   . MET A 77  ? 0.9691 0.6858 0.6671 0.0451  0.1811  -0.0352 77  MET A C   
590  O O   . MET A 77  ? 0.9236 0.6205 0.5994 0.0323  0.1511  -0.0326 77  MET A O   
591  C CB  . MET A 77  ? 1.1467 0.7787 0.7386 0.0394  0.2204  -0.0321 77  MET A CB  
592  C CG  . MET A 77  ? 1.1965 0.8112 0.7623 0.0362  0.2563  -0.0278 77  MET A CG  
593  S SD  . MET A 77  ? 1.2698 0.9254 0.8807 0.0558  0.3071  -0.0318 77  MET A SD  
594  C CE  . MET A 77  ? 1.0194 0.6175 0.5657 0.0781  0.3135  -0.0404 77  MET A CE  
595  N N   . THR A 78  ? 0.9532 0.7000 0.6887 0.0622  0.1870  -0.0394 78  THR A N   
596  C CA  . THR A 78  ? 0.8979 0.6478 0.6419 0.0661  0.1600  -0.0408 78  THR A CA  
597  C C   . THR A 78  ? 0.9498 0.6446 0.6386 0.0803  0.1655  -0.0458 78  THR A C   
598  O O   . THR A 78  ? 1.0258 0.7048 0.6980 0.0976  0.1954  -0.0497 78  THR A O   
599  C CB  . THR A 78  ? 0.8125 0.6298 0.6323 0.0759  0.1572  -0.0410 78  THR A CB  
600  O OG1 . THR A 78  ? 0.8207 0.6574 0.6627 0.0973  0.1863  -0.0439 78  THR A OG1 
601  C CG2 . THR A 78  ? 0.6704 0.5367 0.5410 0.0603  0.1490  -0.0380 78  THR A CG2 
602  N N   . LEU A 79  ? 0.9478 0.6123 0.6086 0.0727  0.1379  -0.0458 79  LEU A N   
603  C CA  . LEU A 79  ? 0.9897 0.5925 0.5923 0.0823  0.1392  -0.0511 79  LEU A CA  
604  C C   . LEU A 79  ? 1.0173 0.6334 0.6433 0.1113  0.1613  -0.0543 79  LEU A C   
605  O O   . LEU A 79  ? 1.0172 0.6911 0.7071 0.1200  0.1578  -0.0510 79  LEU A O   
606  C CB  . LEU A 79  ? 0.9407 0.5230 0.5274 0.0661  0.1045  -0.0491 79  LEU A CB  
607  C CG  . LEU A 79  ? 0.8798 0.4326 0.4272 0.0405  0.0808  -0.0473 79  LEU A CG  
608  C CD1 . LEU A 79  ? 0.8446 0.4093 0.4093 0.0233  0.0477  -0.0429 79  LEU A CD1 
609  C CD2 . LEU A 79  ? 0.9562 0.4295 0.4172 0.0392  0.0866  -0.0541 79  LEU A CD2 
610  N N   . SER A 80  ? 1.0443 0.6055 0.6163 0.1278  0.1838  -0.0608 80  SER A N   
611  C CA  . SER A 80  ? 1.1242 0.6948 0.7157 0.1604  0.2084  -0.0638 80  SER A CA  
612  C C   . SER A 80  ? 1.1884 0.7199 0.7562 0.1705  0.1924  -0.0648 80  SER A C   
613  O O   . SER A 80  ? 1.2285 0.6945 0.7331 0.1563  0.1763  -0.0671 80  SER A O   
614  C CB  . SER A 80  ? 1.2017 0.7466 0.7616 0.1708  0.2378  -0.0658 80  SER A CB  
615  O OG  . SER A 80  ? 1.2231 0.7934 0.8179 0.1993  0.2558  -0.0652 80  SER A OG  
616  N N   . PHE A 81  ? 1.1772 0.7520 0.7986 0.1925  0.1940  -0.0612 81  PHE A N   
617  C CA  . PHE A 81  ? 1.2737 0.8127 0.8755 0.2036  0.1795  -0.0597 81  PHE A CA  
618  C C   . PHE A 81  ? 1.3420 0.8377 0.9078 0.2222  0.1942  -0.0607 81  PHE A C   
619  O O   . PHE A 81  ? 1.3805 0.8350 0.9188 0.2287  0.1833  -0.0585 81  PHE A O   
620  C CB  . PHE A 81  ? 1.2367 0.8453 0.9117 0.2162  0.1685  -0.0516 81  PHE A CB  
621  C CG  . PHE A 81  ? 1.1961 0.8515 0.9087 0.1875  0.1405  -0.0453 81  PHE A CG  
622  C CD1 . PHE A 81  ? 1.2124 0.8404 0.9025 0.1698  0.1142  -0.0405 81  PHE A CD1 
623  C CD2 . PHE A 81  ? 1.1302 0.8550 0.8998 0.1779  0.1424  -0.0441 81  PHE A CD2 
624  C CE1 . PHE A 81  ? 1.1331 0.8050 0.8577 0.1461  0.0919  -0.0350 81  PHE A CE1 
625  C CE2 . PHE A 81  ? 1.0502 0.8126 0.8500 0.1543  0.1184  -0.0395 81  PHE A CE2 
626  C CZ  . PHE A 81  ? 1.0542 0.7916 0.8319 0.1400  0.0940  -0.0351 81  PHE A CZ  
627  N N   . LYS A 82  ? 1.3719 0.8756 0.9369 0.2302  0.2199  -0.0633 82  LYS A N   
628  C CA  . LYS A 82  ? 1.4170 0.8785 0.9452 0.2487  0.2370  -0.0652 82  LYS A CA  
629  C C   . LYS A 82  ? 1.4427 0.8194 0.8830 0.2287  0.2293  -0.0691 82  LYS A C   
630  O O   . LYS A 82  ? 1.5402 0.8604 0.9336 0.2377  0.2298  -0.0704 82  LYS A O   
631  C CB  . LYS A 82  ? 1.4465 0.9544 1.0131 0.2659  0.2690  -0.0662 82  LYS A CB  
632  C CG  . LYS A 82  ? 1.4570 1.0494 1.1126 0.2886  0.2754  -0.0625 82  LYS A CG  
633  C CD  . LYS A 82  ? 1.5402 1.1877 1.2413 0.2961  0.3050  -0.0637 82  LYS A CD  
634  C CE  . LYS A 82  ? 1.5267 1.2684 1.3243 0.3109  0.3053  -0.0604 82  LYS A CE  
635  N NZ  . LYS A 82  ? 1.5347 1.3380 1.3835 0.3079  0.3305  -0.0614 82  LYS A NZ  
636  N N   . ASN A 83  ? 1.3413 0.7092 0.7592 0.2014  0.2207  -0.0705 83  ASN A N   
637  C CA  . ASN A 83  ? 1.3489 0.6433 0.6887 0.1778  0.2046  -0.0731 83  ASN A CA  
638  C C   . ASN A 83  ? 1.3064 0.5745 0.6308 0.1594  0.1715  -0.0717 83  ASN A C   
639  O O   . ASN A 83  ? 1.2612 0.5674 0.6248 0.1480  0.1550  -0.0695 83  ASN A O   
640  C CB  . ASN A 83  ? 1.3424 0.6401 0.6664 0.1555  0.2032  -0.0735 83  ASN A CB  
641  C CG  . ASN A 83  ? 1.3779 0.6032 0.6224 0.1332  0.1859  -0.0752 83  ASN A CG  
642  O OD1 . ASN A 83  ? 1.3712 0.5703 0.5934 0.1115  0.1549  -0.0749 83  ASN A OD1 
643  N ND2 . ASN A 83  ? 1.4293 0.6243 0.6327 0.1375  0.2053  -0.0766 83  ASN A ND2 
644  N N   . LEU A 84  ? 1.2898 0.4921 0.5569 0.1555  0.1625  -0.0730 84  LEU A N   
645  C CA  . LEU A 84  ? 1.2948 0.4716 0.5498 0.1389  0.1347  -0.0706 84  LEU A CA  
646  C C   . LEU A 84  ? 1.2827 0.4602 0.5306 0.1012  0.1041  -0.0698 84  LEU A C   
647  O O   . LEU A 84  ? 1.2427 0.4414 0.5206 0.0888  0.0849  -0.0662 84  LEU A O   
648  C CB  . LEU A 84  ? 1.3525 0.4564 0.5448 0.1417  0.1340  -0.0724 84  LEU A CB  
649  C CG  . LEU A 84  ? 1.3745 0.4746 0.5796 0.1761  0.1517  -0.0707 84  LEU A CG  
650  C CD1 . LEU A 84  ? 1.4381 0.4585 0.5723 0.1787  0.1534  -0.0739 84  LEU A CD1 
651  C CD2 . LEU A 84  ? 1.3030 0.4346 0.5536 0.1777  0.1372  -0.0641 84  LEU A CD2 
652  N N   . ARG A 85  ? 1.3294 0.4850 0.5392 0.0835  0.0988  -0.0721 85  ARG A N   
653  C CA  . ARG A 85  ? 1.3853 0.5480 0.5935 0.0492  0.0676  -0.0703 85  ARG A CA  
654  C C   . ARG A 85  ? 1.2587 0.4876 0.5266 0.0473  0.0662  -0.0685 85  ARG A C   
655  O O   . ARG A 85  ? 1.2080 0.4581 0.4980 0.0247  0.0401  -0.0658 85  ARG A O   
656  C CB  . ARG A 85  ? 1.5093 0.6318 0.6610 0.0332  0.0602  -0.0717 85  ARG A CB  
657  C CG  . ARG A 85  ? 1.5547 0.6782 0.7018 -0.0027 0.0217  -0.0684 85  ARG A CG  
658  C CD  . ARG A 85  ? 1.6788 0.7820 0.7871 -0.0159 0.0125  -0.0679 85  ARG A CD  
659  N NE  . ARG A 85  ? 1.7413 0.8454 0.8473 -0.0485 -0.0268 -0.0640 85  ARG A NE  
660  C CZ  . ARG A 85  ? 1.7879 0.8782 0.8659 -0.0640 -0.0447 -0.0619 85  ARG A CZ  
661  N NH1 . ARG A 85  ? 1.8011 0.8695 0.8445 -0.0512 -0.0261 -0.0633 85  ARG A NH1 
662  N NH2 . ARG A 85  ? 1.8083 0.9083 0.8952 -0.0920 -0.0810 -0.0576 85  ARG A NH2 
663  N N   . ALA A 86  ? 1.2677 0.5309 0.5633 0.0703  0.0946  -0.0699 86  ALA A N   
664  C CA  . ALA A 86  ? 1.1481 0.4730 0.4991 0.0702  0.0966  -0.0690 86  ALA A CA  
665  C C   . ALA A 86  ? 1.0819 0.4465 0.4881 0.0776  0.0897  -0.0653 86  ALA A C   
666  O O   . ALA A 86  ? 1.0223 0.4455 0.4825 0.0625  0.0715  -0.0573 86  ALA A O   
667  C CB  . ALA A 86  ? 1.0902 0.4456 0.4616 0.0910  0.1305  -0.0698 86  ALA A CB  
668  N N   . HIS A 87  ? 1.1238 0.4665 0.5242 0.1002  0.1019  -0.0663 87  HIS A N   
669  C CA  . HIS A 87  ? 1.1042 0.4809 0.5523 0.1093  0.0942  -0.0593 87  HIS A CA  
670  C C   . HIS A 87  ? 1.1537 0.5196 0.5969 0.0784  0.0616  -0.0534 87  HIS A C   
671  O O   . HIS A 87  ? 1.1273 0.5488 0.6253 0.0728  0.0492  -0.0443 87  HIS A O   
672  C CB  . HIS A 87  ? 1.1290 0.4744 0.5615 0.1407  0.1125  -0.0603 87  HIS A CB  
673  C CG  . HIS A 87  ? 1.1357 0.5147 0.6145 0.1591  0.1092  -0.0530 87  HIS A CG  
674  N ND1 . HIS A 87  ? 1.1718 0.5453 0.6557 0.1910  0.1235  -0.0504 87  HIS A ND1 
675  C CD2 . HIS A 87  ? 1.0845 0.5209 0.6161 0.1457  0.0893  -0.0430 87  HIS A CD2 
676  C CE1 . HIS A 87  ? 1.1206 0.5251 0.6436 0.2026  0.1143  -0.0427 87  HIS A CE1 
677  N NE2 . HIS A 87  ? 1.1110 0.5606 0.6663 0.1722  0.0929  -0.0370 87  HIS A NE2 
678  N N   . GLN A 88  ? 1.2191 0.5144 0.5967 0.0576  0.0482  -0.0589 88  GLN A N   
679  C CA  . GLN A 88  ? 1.2131 0.4966 0.5861 0.0250  0.0180  -0.0536 88  GLN A CA  
680  C C   . GLN A 88  ? 1.1142 0.4652 0.5369 0.0012  -0.0013 -0.0470 88  GLN A C   
681  O O   . GLN A 88  ? 1.0980 0.4824 0.5569 -0.0164 -0.0191 -0.0384 88  GLN A O   
682  C CB  . GLN A 88  ? 1.3167 0.5394 0.6273 0.0061  0.0066  -0.0559 88  GLN A CB  
683  C CG  . GLN A 88  ? 1.3685 0.5784 0.6748 -0.0281 -0.0222 -0.0502 88  GLN A CG  
684  C CD  . GLN A 88  ? 1.5323 0.6834 0.7780 -0.0431 -0.0313 -0.0526 88  GLN A CD  
685  O OE1 . GLN A 88  ? 1.6036 0.7209 0.8066 -0.0297 -0.0180 -0.0584 88  GLN A OE1 
686  N NE2 . GLN A 88  ? 1.5556 0.6938 0.7976 -0.0716 -0.0531 -0.0478 88  GLN A NE2 
687  N N   . ILE A 89  ? 1.1264 0.4947 0.5486 0.0020  0.0040  -0.0507 89  ILE A N   
688  C CA  . ILE A 89  ? 1.0345 0.4650 0.5038 -0.0146 -0.0116 -0.0443 89  ILE A CA  
689  C C   . ILE A 89  ? 0.9326 0.4406 0.4778 -0.0011 -0.0036 -0.0371 89  ILE A C   
690  O O   . ILE A 89  ? 0.9451 0.5005 0.5342 -0.0155 -0.0202 -0.0300 89  ILE A O   
691  C CB  . ILE A 89  ? 1.1219 0.5436 0.5651 -0.0149 -0.0061 -0.0488 89  ILE A CB  
692  C CG1 . ILE A 89  ? 1.1665 0.5098 0.5285 -0.0309 -0.0192 -0.0564 89  ILE A CG1 
693  C CG2 . ILE A 89  ? 1.0779 0.5620 0.5714 -0.0278 -0.0213 -0.0412 89  ILE A CG2 
694  C CD1 . ILE A 89  ? 1.2568 0.5701 0.5737 -0.0196 -0.0005 -0.0610 89  ILE A CD1 
695  N N   . ALA A 90  ? 0.9046 0.4266 0.4657 0.0267  0.0216  -0.0393 90  ALA A N   
696  C CA  . ALA A 90  ? 0.8489 0.4422 0.4787 0.0392  0.0269  -0.0338 90  ALA A CA  
697  C C   . ALA A 90  ? 0.8804 0.4878 0.5316 0.0338  0.0125  -0.0264 90  ALA A C   
698  O O   . ALA A 90  ? 0.8546 0.5194 0.5562 0.0301  0.0050  -0.0209 90  ALA A O   
699  C CB  . ALA A 90  ? 0.8294 0.4340 0.4727 0.0698  0.0542  -0.0374 90  ALA A CB  
700  N N   . GLN A 91  ? 0.9266 0.4769 0.5352 0.0330  0.0096  -0.0263 91  GLN A N   
701  C CA  . GLN A 91  ? 0.9258 0.4796 0.5459 0.0259  -0.0020 -0.0176 91  GLN A CA  
702  C C   . GLN A 91  ? 0.8425 0.4181 0.4787 -0.0065 -0.0239 -0.0121 91  GLN A C   
703  O O   . GLN A 91  ? 0.8171 0.4332 0.4901 -0.0114 -0.0300 -0.0039 91  GLN A O   
704  C CB  . GLN A 91  ? 1.0511 0.5287 0.6158 0.0319  0.0015  -0.0185 91  GLN A CB  
705  C CG  . GLN A 91  ? 1.1112 0.5838 0.6783 0.0696  0.0213  -0.0191 91  GLN A CG  
706  C CD  . GLN A 91  ? 1.2622 0.6651 0.7828 0.0773  0.0220  -0.0160 91  GLN A CD  
707  O OE1 . GLN A 91  ? 1.3291 0.6934 0.8218 0.0508  0.0072  -0.0119 91  GLN A OE1 
708  N NE2 . GLN A 91  ? 1.3050 0.6915 0.8185 0.1138  0.0395  -0.0174 91  GLN A NE2 
709  N N   . LEU A 92  ? 0.8556 0.4058 0.4641 -0.0270 -0.0353 -0.0166 92  LEU A N   
710  C CA  . LEU A 92  ? 0.9408 0.5240 0.5743 -0.0544 -0.0563 -0.0117 92  LEU A CA  
711  C C   . LEU A 92  ? 0.8379 0.4976 0.5339 -0.0468 -0.0538 -0.0077 92  LEU A C   
712  O O   . LEU A 92  ? 0.8167 0.5166 0.5495 -0.0569 -0.0619 -0.0004 92  LEU A O   
713  C CB  . LEU A 92  ? 1.0781 0.6307 0.6757 -0.0705 -0.0691 -0.0178 92  LEU A CB  
714  C CG  . LEU A 92  ? 1.2800 0.7550 0.8120 -0.0870 -0.0794 -0.0231 92  LEU A CG  
715  C CD1 . LEU A 92  ? 1.3740 0.8247 0.8698 -0.0993 -0.0928 -0.0295 92  LEU A CD1 
716  C CD2 . LEU A 92  ? 1.3388 0.8149 0.8830 -0.1144 -0.0975 -0.0155 92  LEU A CD2 
717  N N   . LEU A 93  ? 0.7862 0.4628 0.4914 -0.0292 -0.0407 -0.0129 93  LEU A N   
718  C CA  . LEU A 93  ? 0.7628 0.5030 0.5206 -0.0233 -0.0386 -0.0111 93  LEU A CA  
719  C C   . LEU A 93  ? 0.7420 0.5201 0.5366 -0.0104 -0.0322 -0.0071 93  LEU A C   
720  O O   . LEU A 93  ? 0.6852 0.5119 0.5201 -0.0132 -0.0369 -0.0041 93  LEU A O   
721  C CB  . LEU A 93  ? 0.6745 0.4168 0.4295 -0.0102 -0.0241 -0.0172 93  LEU A CB  
722  C CG  . LEU A 93  ? 0.7575 0.4589 0.4683 -0.0215 -0.0299 -0.0204 93  LEU A CG  
723  C CD1 . LEU A 93  ? 0.7043 0.4050 0.4091 -0.0084 -0.0107 -0.0248 93  LEU A CD1 
724  C CD2 . LEU A 93  ? 0.7998 0.5217 0.5255 -0.0419 -0.0535 -0.0154 93  LEU A CD2 
725  N N   . ARG A 94  ? 0.7862 0.5386 0.5629 0.0053  -0.0221 -0.0073 94  ARG A N   
726  C CA  . ARG A 94  ? 0.7854 0.5682 0.5895 0.0198  -0.0183 -0.0027 94  ARG A CA  
727  C C   . ARG A 94  ? 0.7895 0.5756 0.5962 0.0034  -0.0298 0.0063  94  ARG A C   
728  O O   . ARG A 94  ? 0.7769 0.6048 0.6146 0.0064  -0.0312 0.0105  94  ARG A O   
729  C CB  . ARG A 94  ? 0.8769 0.6289 0.6596 0.0441  -0.0057 -0.0040 94  ARG A CB  
730  C CG  . ARG A 94  ? 0.8881 0.6663 0.6927 0.0609  -0.0055 0.0022  94  ARG A CG  
731  C CD  . ARG A 94  ? 0.8277 0.6711 0.6826 0.0712  -0.0037 -0.0011 94  ARG A CD  
732  N NE  . ARG A 94  ? 0.8439 0.7132 0.7160 0.0850  -0.0080 0.0046  94  ARG A NE  
733  C CZ  . ARG A 94  ? 0.9380 0.8041 0.8098 0.1109  -0.0034 0.0060  94  ARG A CZ  
734  N NH1 . ARG A 94  ? 0.9733 0.8127 0.8312 0.1268  0.0091  0.0017  94  ARG A NH1 
735  N NH2 . ARG A 94  ? 0.9447 0.8337 0.8282 0.1227  -0.0110 0.0120  94  ARG A NH2 
736  N N   . ALA A 95  ? 0.7761 0.5164 0.5483 -0.0153 -0.0375 0.0088  95  ALA A N   
737  C CA  . ALA A 95  ? 0.8048 0.5472 0.5804 -0.0357 -0.0466 0.0184  95  ALA A CA  
738  C C   . ALA A 95  ? 0.7817 0.5824 0.6015 -0.0495 -0.0543 0.0207  95  ALA A C   
739  O O   . ALA A 95  ? 0.7252 0.5571 0.5681 -0.0530 -0.0535 0.0280  95  ALA A O   
740  C CB  . ALA A 95  ? 0.8477 0.5300 0.5801 -0.0577 -0.0551 0.0192  95  ALA A CB  
741  N N   . ALA A 96  ? 0.7849 0.5970 0.6129 -0.0557 -0.0608 0.0150  96  ALA A N   
742  C CA  . ALA A 96  ? 0.7358 0.5997 0.6048 -0.0650 -0.0684 0.0169  96  ALA A CA  
743  C C   . ALA A 96  ? 0.6879 0.5987 0.5916 -0.0464 -0.0589 0.0152  96  ALA A C   
744  O O   . ALA A 96  ? 0.6539 0.6049 0.5884 -0.0499 -0.0598 0.0192  96  ALA A O   
745  C CB  . ALA A 96  ? 0.6609 0.5185 0.5236 -0.0722 -0.0785 0.0120  96  ALA A CB  
746  N N   . GLY A 97  ? 0.6706 0.5761 0.5690 -0.0270 -0.0493 0.0087  97  GLY A N   
747  C CA  . GLY A 97  ? 0.6365 0.5815 0.5641 -0.0107 -0.0423 0.0057  97  GLY A CA  
748  C C   . GLY A 97  ? 0.6503 0.6078 0.5822 -0.0052 -0.0401 0.0116  97  GLY A C   
749  O O   . GLY A 97  ? 0.6357 0.6312 0.5926 -0.0007 -0.0394 0.0108  97  GLY A O   
750  N N   . ASP A 98  ? 0.6696 0.5901 0.5718 -0.0049 -0.0387 0.0175  98  ASP A N   
751  C CA  . ASP A 98  ? 0.6647 0.5893 0.5627 0.0010  -0.0365 0.0253  98  ASP A CA  
752  C C   . ASP A 98  ? 0.6418 0.5916 0.5550 -0.0164 -0.0384 0.0322  98  ASP A C   
753  O O   . ASP A 98  ? 0.6447 0.6135 0.5620 -0.0108 -0.0348 0.0370  98  ASP A O   
754  C CB  . ASP A 98  ? 0.7509 0.6214 0.6087 0.0042  -0.0345 0.0317  98  ASP A CB  
755  C CG  . ASP A 98  ? 0.8483 0.7043 0.6965 0.0307  -0.0292 0.0268  98  ASP A CG  
756  O OD1 . ASP A 98  ? 0.8495 0.7452 0.7255 0.0466  -0.0279 0.0213  98  ASP A OD1 
757  O OD2 . ASP A 98  ? 0.9671 0.7719 0.7809 0.0358  -0.0262 0.0281  98  ASP A OD2 
758  N N   . ALA A 99  ? 0.6631 0.6147 0.5848 -0.0366 -0.0440 0.0329  99  ALA A N   
759  C CA  . ALA A 99  ? 0.6566 0.6390 0.6011 -0.0530 -0.0445 0.0397  99  ALA A CA  
760  C C   . ALA A 99  ? 0.6635 0.6974 0.6431 -0.0432 -0.0414 0.0346  99  ALA A C   
761  O O   . ALA A 99  ? 0.6380 0.7021 0.6377 -0.0507 -0.0374 0.0397  99  ALA A O   
762  C CB  . ALA A 99  ? 0.6114 0.5851 0.5595 -0.0767 -0.0548 0.0418  99  ALA A CB  
763  N N   . THR A 100 ? 0.6651 0.7079 0.6518 -0.0269 -0.0417 0.0243  100 THR A N   
764  C CA  . THR A 100 ? 0.6584 0.7413 0.6724 -0.0178 -0.0389 0.0182  100 THR A CA  
765  C C   . THR A 100 ? 0.7117 0.8054 0.7184 -0.0056 -0.0325 0.0188  100 THR A C   
766  O O   . THR A 100 ? 0.6877 0.8104 0.7091 -0.0007 -0.0286 0.0152  100 THR A O   
767  C CB  . THR A 100 ? 0.4822 0.5693 0.5066 -0.0083 -0.0414 0.0071  100 THR A CB  
768  O OG1 . THR A 100 ? 0.5190 0.5923 0.5305 0.0044  -0.0391 0.0027  100 THR A OG1 
769  C CG2 . THR A 100 ? 0.4426 0.5140 0.4658 -0.0188 -0.0483 0.0072  100 THR A CG2 
770  N N   . LYS A 101 ? 0.8015 0.8690 0.7819 0.0007  -0.0321 0.0231  101 LYS A N   
771  C CA  . LYS A 101 ? 0.8890 0.9622 0.8556 0.0127  -0.0291 0.0258  101 LYS A CA  
772  C C   . LYS A 101 ? 0.9053 0.9846 0.8654 0.0015  -0.0212 0.0365  101 LYS A C   
773  O O   . LYS A 101 ? 0.9362 1.0373 0.8963 0.0079  -0.0161 0.0353  101 LYS A O   
774  C CB  . LYS A 101 ? 0.9662 1.0075 0.9057 0.0247  -0.0318 0.0299  101 LYS A CB  
775  C CG  . LYS A 101 ? 1.0356 1.0786 0.9863 0.0380  -0.0361 0.0197  101 LYS A CG  
776  C CD  . LYS A 101 ? 1.1517 1.1711 1.0816 0.0554  -0.0381 0.0237  101 LYS A CD  
777  C CE  . LYS A 101 ? 1.1944 1.2307 1.1460 0.0699  -0.0401 0.0131  101 LYS A CE  
778  N NZ  . LYS A 101 ? 1.2754 1.2886 1.2120 0.0890  -0.0403 0.0169  101 LYS A NZ  
779  N N   . ASP A 102 ? 0.8971 0.9561 0.8505 -0.0164 -0.0196 0.0465  102 ASP A N   
780  C CA  . ASP A 102 ? 0.9356 1.0043 0.8899 -0.0319 -0.0099 0.0580  102 ASP A CA  
781  C C   . ASP A 102 ? 0.8225 0.9371 0.8161 -0.0371 -0.0058 0.0535  102 ASP A C   
782  O O   . ASP A 102 ? 0.8666 1.0043 0.8679 -0.0421 0.0065  0.0597  102 ASP A O   
783  C CB  . ASP A 102 ? 1.0762 1.1108 1.0166 -0.0537 -0.0112 0.0691  102 ASP A CB  
784  C CG  . ASP A 102 ? 1.1781 1.1593 1.0766 -0.0459 -0.0147 0.0732  102 ASP A CG  
785  O OD1 . ASP A 102 ? 1.1914 1.1659 1.0831 -0.0245 -0.0201 0.0646  102 ASP A OD1 
786  O OD2 . ASP A 102 ? 1.2336 1.1791 1.1073 -0.0612 -0.0115 0.0853  102 ASP A OD2 
787  N N   . GLY A 103 ? 0.6711 0.7971 0.6879 -0.0345 -0.0147 0.0433  103 GLY A N   
788  C CA  . GLY A 103 ? 0.5590 0.7239 0.6128 -0.0360 -0.0131 0.0392  103 GLY A CA  
789  C C   . GLY A 103 ? 0.5640 0.7399 0.6408 -0.0574 -0.0166 0.0478  103 GLY A C   
790  O O   . GLY A 103 ? 0.5551 0.7698 0.6647 -0.0606 -0.0105 0.0503  103 GLY A O   
791  N N   . PHE A 104 ? 0.5947 0.7369 0.6552 -0.0716 -0.0269 0.0516  104 PHE A N   
792  C CA  . PHE A 104 ? 0.6145 0.7621 0.6919 -0.0968 -0.0333 0.0603  104 PHE A CA  
793  C C   . PHE A 104 ? 0.5840 0.7289 0.6730 -0.1020 -0.0515 0.0547  104 PHE A C   
794  O O   . PHE A 104 ? 0.5959 0.7536 0.7053 -0.1222 -0.0615 0.0604  104 PHE A O   
795  C CB  . PHE A 104 ? 0.6882 0.7918 0.7313 -0.1141 -0.0325 0.0697  104 PHE A CB  
796  C CG  . PHE A 104 ? 0.7364 0.8407 0.7660 -0.1140 -0.0150 0.0795  104 PHE A CG  
797  C CD1 . PHE A 104 ? 0.7278 0.8777 0.7816 -0.1060 -0.0003 0.0809  104 PHE A CD1 
798  C CD2 . PHE A 104 ? 0.7970 0.8514 0.7844 -0.1209 -0.0124 0.0876  104 PHE A CD2 
799  C CE1 . PHE A 104 ? 0.7559 0.9022 0.7894 -0.1059 0.0170  0.0906  104 PHE A CE1 
800  C CE2 . PHE A 104 ? 0.8118 0.8613 0.7800 -0.1206 0.0035  0.0985  104 PHE A CE2 
801  C CZ  . PHE A 104 ? 0.7848 0.8807 0.7749 -0.1137 0.0184  0.1002  104 PHE A CZ  
802  N N   . LEU A 105 ? 0.5455 0.6742 0.6211 -0.0850 -0.0563 0.0443  105 LEU A N   
803  C CA  . LEU A 105 ? 0.5359 0.6529 0.6112 -0.0885 -0.0723 0.0397  105 LEU A CA  
804  C C   . LEU A 105 ? 0.4795 0.6359 0.5906 -0.0779 -0.0759 0.0362  105 LEU A C   
805  O O   . LEU A 105 ? 0.4710 0.6384 0.5871 -0.0589 -0.0674 0.0293  105 LEU A O   
806  C CB  . LEU A 105 ? 0.5545 0.6279 0.5926 -0.0772 -0.0729 0.0315  105 LEU A CB  
807  C CG  . LEU A 105 ? 0.5621 0.6141 0.5880 -0.0811 -0.0871 0.0274  105 LEU A CG  
808  C CD1 . LEU A 105 ? 0.6208 0.6469 0.6296 -0.1050 -0.1009 0.0326  105 LEU A CD1 
809  C CD2 . LEU A 105 ? 0.5663 0.5852 0.5626 -0.0662 -0.0811 0.0191  105 LEU A CD2 
810  N N   . LYS A 106 ? 0.4768 0.6522 0.6116 -0.0903 -0.0902 0.0410  106 LYS A N   
811  C CA  . LYS A 106 ? 0.4846 0.6948 0.6533 -0.0785 -0.0961 0.0395  106 LYS A CA  
812  C C   . LYS A 106 ? 0.5374 0.7171 0.6835 -0.0714 -0.1095 0.0337  106 LYS A C   
813  O O   . LYS A 106 ? 0.5393 0.7225 0.6897 -0.0531 -0.1055 0.0282  106 LYS A O   
814  C CB  . LYS A 106 ? 0.5189 0.7724 0.7308 -0.0931 -0.1062 0.0490  106 LYS A CB  
815  C CG  . LYS A 106 ? 0.5919 0.8794 0.8394 -0.0794 -0.1169 0.0492  106 LYS A CG  
816  C CD  . LYS A 106 ? 0.6075 0.9238 0.8775 -0.0544 -0.0978 0.0448  106 LYS A CD  
817  C CE  . LYS A 106 ? 0.6495 0.9974 0.9558 -0.0385 -0.1080 0.0462  106 LYS A CE  
818  N NZ  . LYS A 106 ? 0.6839 0.9952 0.9635 -0.0339 -0.1278 0.0436  106 LYS A NZ  
819  N N   . GLU A 107 ? 0.5754 0.7205 0.6928 -0.0870 -0.1245 0.0351  107 GLU A N   
820  C CA  . GLU A 107 ? 0.5859 0.6970 0.6739 -0.0827 -0.1365 0.0310  107 GLU A CA  
821  C C   . GLU A 107 ? 0.6284 0.6858 0.6667 -0.0965 -0.1421 0.0289  107 GLU A C   
822  O O   . GLU A 107 ? 0.6663 0.7166 0.6999 -0.1167 -0.1512 0.0330  107 GLU A O   
823  C CB  . GLU A 107 ? 0.6149 0.7496 0.7269 -0.0848 -0.1581 0.0364  107 GLU A CB  
824  C CG  . GLU A 107 ? 0.6828 0.7753 0.7546 -0.0839 -0.1737 0.0345  107 GLU A CG  
825  C CD  . GLU A 107 ? 0.7309 0.8450 0.8229 -0.0853 -0.1998 0.0413  107 GLU A CD  
826  O OE1 . GLU A 107 ? 0.7268 0.8952 0.8724 -0.0830 -0.2037 0.0471  107 GLU A OE1 
827  O OE2 . GLU A 107 ? 0.7662 0.8432 0.8196 -0.0873 -0.2163 0.0414  107 GLU A OE2 
828  N N   . ILE A 108 ? 0.6100 0.6280 0.6108 -0.0862 -0.1353 0.0222  108 ILE A N   
829  C CA  . ILE A 108 ? 0.6393 0.6023 0.5881 -0.0961 -0.1409 0.0193  108 ILE A CA  
830  C C   . ILE A 108 ? 0.7040 0.6415 0.6249 -0.0925 -0.1518 0.0176  108 ILE A C   
831  O O   . ILE A 108 ? 0.6883 0.6303 0.6133 -0.0767 -0.1424 0.0155  108 ILE A O   
832  C CB  . ILE A 108 ? 0.6440 0.5759 0.5650 -0.0867 -0.1200 0.0135  108 ILE A CB  
833  C CG1 . ILE A 108 ? 0.7607 0.6314 0.6240 -0.0930 -0.1233 0.0092  108 ILE A CG1 
834  C CG2 . ILE A 108 ? 0.5721 0.5192 0.5064 -0.0659 -0.1028 0.0088  108 ILE A CG2 
835  C CD1 . ILE A 108 ? 0.7955 0.6347 0.6325 -0.0824 -0.1038 0.0043  108 ILE A CD1 
836  N N   . SER A 109 ? 0.7426 0.6507 0.6324 -0.1086 -0.1726 0.0188  109 SER A N   
837  C CA  . SER A 109 ? 0.7745 0.6552 0.6309 -0.1064 -0.1863 0.0187  109 SER A CA  
838  C C   . SER A 109 ? 0.8234 0.6368 0.6098 -0.1149 -0.1890 0.0129  109 SER A C   
839  O O   . SER A 109 ? 0.8280 0.6179 0.5944 -0.1313 -0.1960 0.0107  109 SER A O   
840  C CB  . SER A 109 ? 0.8164 0.7299 0.7015 -0.1151 -0.2160 0.0265  109 SER A CB  
841  O OG  . SER A 109 ? 0.8032 0.7723 0.7461 -0.1009 -0.2109 0.0311  109 SER A OG  
842  N N   . LEU A 110 ? 0.8043 0.5835 0.5508 -0.1037 -0.1812 0.0103  110 LEU A N   
843  C CA  . LEU A 110 ? 0.8724 0.5853 0.5454 -0.1098 -0.1849 0.0051  110 LEU A CA  
844  C C   . LEU A 110 ? 0.9421 0.6451 0.5939 -0.1214 -0.2194 0.0100  110 LEU A C   
845  O O   . LEU A 110 ? 0.9499 0.6651 0.6082 -0.1116 -0.2257 0.0160  110 LEU A O   
846  C CB  . LEU A 110 ? 0.8733 0.5551 0.5126 -0.0925 -0.1565 0.0009  110 LEU A CB  
847  C CG  . LEU A 110 ? 1.0026 0.6131 0.5594 -0.0960 -0.1569 -0.0042 110 LEU A CG  
848  C CD1 . LEU A 110 ? 1.0713 0.6432 0.5931 -0.1088 -0.1625 -0.0115 110 LEU A CD1 
849  C CD2 . LEU A 110 ? 1.0142 0.6018 0.5462 -0.0788 -0.1224 -0.0076 110 LEU A CD2 
850  N N   . VAL A 111 ? 0.9719 0.6545 0.6039 -0.1402 -0.2385 0.0088  111 VAL A N   
851  C CA  . VAL A 111 ? 1.0381 0.7299 0.6759 -0.1480 -0.2648 0.0155  111 VAL A CA  
852  C C   . VAL A 111 ? 1.1521 0.7764 0.7159 -0.1529 -0.2695 0.0115  111 VAL A C   
853  O O   . VAL A 111 ? 1.1864 0.7688 0.7134 -0.1622 -0.2629 0.0049  111 VAL A O   
854  C CB  . VAL A 111 ? 1.0417 0.7801 0.7349 -0.1653 -0.2806 0.0198  111 VAL A CB  
855  C CG1 . VAL A 111 ? 1.0799 0.8240 0.7740 -0.1748 -0.3085 0.0248  111 VAL A CG1 
856  C CG2 . VAL A 111 ? 0.9856 0.7952 0.7546 -0.1583 -0.2756 0.0253  111 VAL A CG2 
857  N N   . VAL A 112 ? 1.1630 0.7738 0.7030 -0.1458 -0.2806 0.0158  112 VAL A N   
858  C CA  . VAL A 112 ? 1.2093 0.7558 0.6771 -0.1496 -0.2855 0.0126  112 VAL A CA  
859  C C   . VAL A 112 ? 1.2628 0.8225 0.7400 -0.1618 -0.3201 0.0181  112 VAL A C   
860  O O   . VAL A 112 ? 1.2328 0.8355 0.7492 -0.1557 -0.3371 0.0262  112 VAL A O   
861  C CB  . VAL A 112 ? 1.2199 0.7276 0.6378 -0.1327 -0.2688 0.0130  112 VAL A CB  
862  C CG1 . VAL A 112 ? 1.3163 0.7544 0.6563 -0.1364 -0.2703 0.0091  112 VAL A CG1 
863  C CG2 . VAL A 112 ? 1.1764 0.6785 0.5905 -0.1206 -0.2340 0.0075  112 VAL A CG2 
864  N N   . THR A 113 ? 1.3583 0.8804 0.7991 -0.1781 -0.3306 0.0134  113 THR A N   
865  C CA  . THR A 113 ? 1.4481 0.9779 0.8915 -0.1923 -0.3647 0.0169  113 THR A CA  
866  C C   . THR A 113 ? 1.5712 1.0234 0.9282 -0.1971 -0.3698 0.0114  113 THR A C   
867  O O   . THR A 113 ? 1.6385 1.0339 0.9408 -0.1935 -0.3456 0.0040  113 THR A O   
868  C CB  . THR A 113 ? 1.4313 0.9997 0.9243 -0.2135 -0.3784 0.0170  113 THR A CB  
869  O OG1 . THR A 113 ? 1.4562 0.9774 0.9115 -0.2232 -0.3619 0.0091  113 THR A OG1 
870  C CG2 . THR A 113 ? 1.3426 0.9909 0.9229 -0.2089 -0.3735 0.0230  113 THR A CG2 
871  N N   . GLU A 114 ? 1.6172 1.0673 0.9616 -0.2040 -0.4008 0.0149  114 GLU A N   
872  C CA  . GLU A 114 ? 1.7441 1.1200 1.0044 -0.2101 -0.4091 0.0096  114 GLU A CA  
873  C C   . GLU A 114 ? 1.7754 1.1193 1.0128 -0.2312 -0.4133 0.0021  114 GLU A C   
874  O O   . GLU A 114 ? 1.8153 1.0872 0.9800 -0.2310 -0.3985 -0.0055 114 GLU A O   
875  C CB  . GLU A 114 ? 1.8458 1.2303 1.0992 -0.2116 -0.4444 0.0156  114 GLU A CB  
876  C CG  . GLU A 114 ? 1.8654 1.3227 1.1934 -0.2253 -0.4773 0.0210  114 GLU A CG  
877  C CD  . GLU A 114 ? 1.9600 1.4215 1.2746 -0.2260 -0.5141 0.0260  114 GLU A CD  
878  O OE1 . GLU A 114 ? 2.0353 1.4359 1.2755 -0.2179 -0.5148 0.0251  114 GLU A OE1 
879  O OE2 . GLU A 114 ? 1.9542 1.4808 1.3325 -0.2341 -0.5416 0.0310  114 GLU A OE2 
880  N N   . HIS A 115 ? 1.7511 1.1479 1.0503 -0.2488 -0.4315 0.0043  115 HIS A N   
881  C CA  . HIS A 115 ? 1.7928 1.1617 1.0743 -0.2713 -0.4368 -0.0019 115 HIS A CA  
882  C C   . HIS A 115 ? 1.7445 1.1469 1.0773 -0.2749 -0.4161 -0.0019 115 HIS A C   
883  O O   . HIS A 115 ? 1.6555 1.1284 1.0626 -0.2695 -0.4129 0.0045  115 HIS A O   
884  C CB  . HIS A 115 ? 1.8188 1.2123 1.1202 -0.2944 -0.4777 0.0000  115 HIS A CB  
885  C CG  . HIS A 115 ? 1.8897 1.2524 1.1410 -0.2916 -0.5023 0.0004  115 HIS A CG  
886  N ND1 . HIS A 115 ? 1.9458 1.2304 1.1096 -0.2792 -0.4889 -0.0044 115 HIS A ND1 
887  C CD2 . HIS A 115 ? 1.9065 1.3065 1.1826 -0.2985 -0.5391 0.0052  115 HIS A CD2 
888  C CE1 . HIS A 115 ? 2.0031 1.2748 1.1362 -0.2796 -0.5170 -0.0023 115 HIS A CE1 
889  N NE2 . HIS A 115 ? 1.9826 1.3238 1.1827 -0.2907 -0.5489 0.0035  115 HIS A NE2 
890  N N   . ASP A 116 ? 1.7995 1.1485 1.0892 -0.2829 -0.4016 -0.0090 116 ASP A N   
891  C CA  . ASP A 116 ? 1.7428 1.1113 1.0686 -0.2860 -0.3814 -0.0094 116 ASP A CA  
892  C C   . ASP A 116 ? 1.6872 1.1236 1.0891 -0.3081 -0.4016 -0.0035 116 ASP A C   
893  O O   . ASP A 116 ? 1.7111 1.1403 1.1070 -0.3316 -0.4267 -0.0046 116 ASP A O   
894  C CB  . ASP A 116 ? 1.8220 1.1126 1.0789 -0.2899 -0.3654 -0.0180 116 ASP A CB  
895  C CG  . ASP A 116 ? 1.8144 1.1113 1.0923 -0.2824 -0.3364 -0.0190 116 ASP A CG  
896  O OD1 . ASP A 116 ? 1.7752 1.1390 1.1262 -0.2854 -0.3357 -0.0129 116 ASP A OD1 
897  O OD2 . ASP A 116 ? 1.8510 1.0856 1.0715 -0.2722 -0.3138 -0.0259 116 ASP A OD2 
898  N N   . GLY A 117 ? 1.6099 1.1126 1.0832 -0.3007 -0.3897 0.0024  117 GLY A N   
899  C CA  . GLY A 117 ? 1.5838 1.1546 1.1334 -0.3194 -0.4019 0.0085  117 GLY A CA  
900  C C   . GLY A 117 ? 1.5527 1.2026 1.1718 -0.3140 -0.4193 0.0163  117 GLY A C   
901  O O   . GLY A 117 ? 1.5253 1.2402 1.2147 -0.3267 -0.4268 0.0216  117 GLY A O   
902  N N   . ASP A 118 ? 1.5545 1.1985 1.1536 -0.2943 -0.4241 0.0172  118 ASP A N   
903  C CA  . ASP A 118 ? 1.5198 1.2327 1.1781 -0.2848 -0.4408 0.0247  118 ASP A CA  
904  C C   . ASP A 118 ? 1.4120 1.1941 1.1456 -0.2720 -0.4219 0.0305  118 ASP A C   
905  O O   . ASP A 118 ? 1.3626 1.1300 1.0870 -0.2595 -0.3947 0.0286  118 ASP A O   
906  C CB  . ASP A 118 ? 1.5656 1.2468 1.1768 -0.2647 -0.4468 0.0250  118 ASP A CB  
907  C CG  . ASP A 118 ? 1.6832 1.3185 1.2378 -0.2773 -0.4751 0.0219  118 ASP A CG  
908  O OD1 . ASP A 118 ? 1.7301 1.3821 1.3037 -0.3007 -0.4979 0.0211  118 ASP A OD1 
909  O OD2 . ASP A 118 ? 1.7263 1.3086 1.2167 -0.2644 -0.4744 0.0200  118 ASP A OD2 
910  N N   . VAL A 119 ? 1.3876 1.2457 1.1953 -0.2745 -0.4362 0.0369  119 VAL A N   
911  C CA  . VAL A 119 ? 1.3289 1.2558 1.2094 -0.2603 -0.4191 0.0425  119 VAL A CA  
912  C C   . VAL A 119 ? 1.3336 1.2791 1.2219 -0.2315 -0.4206 0.0466  119 VAL A C   
913  O O   . VAL A 119 ? 1.2769 1.2639 1.2090 -0.2135 -0.4034 0.0501  119 VAL A O   
914  C CB  . VAL A 119 ? 1.3099 1.3116 1.2692 -0.2759 -0.4294 0.0471  119 VAL A CB  
915  C CG1 . VAL A 119 ? 1.2266 1.2926 1.2549 -0.2616 -0.4060 0.0520  119 VAL A CG1 
916  C CG2 . VAL A 119 ? 1.3595 1.3352 1.3038 -0.3080 -0.4324 0.0436  119 VAL A CG2 
917  N N   . GLU A 120 ? 1.3836 1.2940 1.2251 -0.2273 -0.4413 0.0463  120 GLU A N   
918  C CA  . GLU A 120 ? 1.3736 1.2876 1.2089 -0.2008 -0.4437 0.0510  120 GLU A CA  
919  C C   . GLU A 120 ? 1.3755 1.2116 1.1302 -0.1913 -0.4284 0.0465  120 GLU A C   
920  O O   . GLU A 120 ? 1.4455 1.2184 1.1331 -0.2028 -0.4349 0.0411  120 GLU A O   
921  C CB  . GLU A 120 ? 1.4403 1.3733 1.2811 -0.2000 -0.4780 0.0555  120 GLU A CB  
922  C CG  . GLU A 120 ? 1.4716 1.4093 1.3077 -0.1716 -0.4820 0.0623  120 GLU A CG  
923  C CD  . GLU A 120 ? 1.5820 1.5387 1.4221 -0.1692 -0.5176 0.0676  120 GLU A CD  
924  O OE1 . GLU A 120 ? 1.6535 1.6198 1.4992 -0.1913 -0.5404 0.0649  120 GLU A OE1 
925  O OE2 . GLU A 120 ? 1.6081 1.5691 1.4447 -0.1454 -0.5237 0.0748  120 GLU A OE2 
926  N N   . ALA A 121 ? 1.2886 1.1285 1.0493 -0.1702 -0.4072 0.0484  121 ALA A N   
927  C CA  . ALA A 121 ? 1.2766 1.0486 0.9670 -0.1611 -0.3882 0.0438  121 ALA A CA  
928  C C   . ALA A 121 ? 1.2721 1.0176 0.9247 -0.1440 -0.3969 0.0488  121 ALA A C   
929  O O   . ALA A 121 ? 1.2537 1.0401 0.9429 -0.1334 -0.4149 0.0569  121 ALA A O   
930  C CB  . ALA A 121 ? 1.2222 1.0076 0.9351 -0.1512 -0.3584 0.0418  121 ALA A CB  
931  N N   . ILE A 122 ? 1.2918 0.9673 0.8692 -0.1402 -0.3824 0.0443  122 ILE A N   
932  C CA  . ILE A 122 ? 1.2773 0.9177 0.8092 -0.1245 -0.3843 0.0493  122 ILE A CA  
933  C C   . ILE A 122 ? 1.2252 0.8575 0.7532 -0.1077 -0.3547 0.0501  122 ILE A C   
934  O O   . ILE A 122 ? 1.2732 0.8862 0.7769 -0.0926 -0.3522 0.0564  122 ILE A O   
935  C CB  . ILE A 122 ? 1.3306 0.8943 0.7745 -0.1322 -0.3877 0.0442  122 ILE A CB  
936  C CG1 . ILE A 122 ? 1.3267 0.8375 0.7211 -0.1345 -0.3547 0.0344  122 ILE A CG1 
937  C CG2 . ILE A 122 ? 1.3297 0.8978 0.7743 -0.1516 -0.4181 0.0424  122 ILE A CG2 
938  C CD1 . ILE A 122 ? 1.3906 0.8218 0.6938 -0.1342 -0.3481 0.0302  122 ILE A CD1 
939  N N   . GLU A 123 ? 1.1649 0.8107 0.7155 -0.1111 -0.3327 0.0440  123 GLU A N   
940  C CA  . GLU A 123 ? 1.1308 0.7763 0.6847 -0.0973 -0.3057 0.0439  123 GLU A CA  
941  C C   . GLU A 123 ? 1.0624 0.7488 0.6676 -0.1019 -0.2923 0.0388  123 GLU A C   
942  O O   . GLU A 123 ? 1.0749 0.7518 0.6738 -0.1162 -0.2891 0.0317  123 GLU A O   
943  C CB  . GLU A 123 ? 1.2028 0.7774 0.6774 -0.0941 -0.2811 0.0387  123 GLU A CB  
944  C CG  . GLU A 123 ? 1.2280 0.8000 0.7012 -0.0812 -0.2517 0.0392  123 GLU A CG  
945  C CD  . GLU A 123 ? 1.3509 0.8579 0.7492 -0.0759 -0.2260 0.0376  123 GLU A CD  
946  O OE1 . GLU A 123 ? 1.3975 0.8798 0.7660 -0.0692 -0.2311 0.0455  123 GLU A OE1 
947  O OE2 . GLU A 123 ? 1.3689 0.8505 0.7396 -0.0775 -0.1986 0.0286  123 GLU A OE2 
948  N N   . VAL A 124 ? 0.9858 0.7142 0.6396 -0.0895 -0.2848 0.0429  124 VAL A N   
949  C CA  . VAL A 124 ? 0.9394 0.7086 0.6429 -0.0924 -0.2723 0.0387  124 VAL A CA  
950  C C   . VAL A 124 ? 0.9311 0.7081 0.6529 -0.0752 -0.2382 0.0369  124 VAL A C   
951  O O   . VAL A 124 ? 0.9984 0.7851 0.7345 -0.0605 -0.2368 0.0431  124 VAL A O   
952  C CB  . VAL A 124 ? 0.9095 0.7508 0.6937 -0.0939 -0.2871 0.0441  124 VAL A CB  
953  C CG1 . VAL A 124 ? 0.8259 0.7084 0.6605 -0.0940 -0.2693 0.0407  124 VAL A CG1 
954  C CG2 . VAL A 124 ? 0.9620 0.8078 0.7488 -0.1116 -0.3063 0.0441  124 VAL A CG2 
955  N N   . PHE A 125 ? 0.8976 0.6696 0.6202 -0.0765 -0.2103 0.0283  125 PHE A N   
956  C CA  . PHE A 125 ? 0.8489 0.6426 0.6050 -0.0628 -0.1795 0.0254  125 PHE A CA  
957  C C   . PHE A 125 ? 0.8351 0.6802 0.6505 -0.0646 -0.1742 0.0228  125 PHE A C   
958  O O   . PHE A 125 ? 0.8184 0.6565 0.6268 -0.0734 -0.1684 0.0179  125 PHE A O   
959  C CB  . PHE A 125 ? 0.8765 0.6280 0.5894 -0.0598 -0.1503 0.0186  125 PHE A CB  
960  C CG  . PHE A 125 ? 1.0229 0.7298 0.6848 -0.0549 -0.1448 0.0223  125 PHE A CG  
961  C CD1 . PHE A 125 ? 1.1183 0.7736 0.7129 -0.0622 -0.1599 0.0239  125 PHE A CD1 
962  C CD2 . PHE A 125 ? 1.0317 0.7445 0.7090 -0.0445 -0.1247 0.0245  125 PHE A CD2 
963  C CE1 . PHE A 125 ? 1.1861 0.7960 0.7269 -0.0576 -0.1532 0.0287  125 PHE A CE1 
964  C CE2 . PHE A 125 ? 1.0942 0.7625 0.7222 -0.0418 -0.1173 0.0297  125 PHE A CE2 
965  C CZ  . PHE A 125 ? 1.1724 0.7891 0.7308 -0.0476 -0.1306 0.0325  125 PHE A CZ  
966  N N   . SER A 126 ? 0.7759 0.6679 0.6449 -0.0551 -0.1754 0.0264  126 SER A N   
967  C CA  . SER A 126 ? 0.7363 0.6780 0.6588 -0.0567 -0.1719 0.0255  126 SER A CA  
968  C C   . SER A 126 ? 0.6269 0.5902 0.5783 -0.0435 -0.1464 0.0203  126 SER A C   
969  O O   . SER A 126 ? 0.6452 0.6039 0.5980 -0.0317 -0.1383 0.0198  126 SER A O   
970  C CB  . SER A 126 ? 0.7796 0.7650 0.7451 -0.0570 -0.1949 0.0333  126 SER A CB  
971  O OG  . SER A 126 ? 0.8803 0.8740 0.8594 -0.0397 -0.1968 0.0371  126 SER A OG  
972  N N   . MET A 127 ? 0.5318 0.5150 0.5025 -0.0467 -0.1349 0.0167  127 MET A N   
973  C CA  . MET A 127 ? 0.5142 0.5220 0.5129 -0.0354 -0.1152 0.0115  127 MET A CA  
974  C C   . MET A 127 ? 0.5431 0.5963 0.5837 -0.0365 -0.1163 0.0139  127 MET A C   
975  O O   . MET A 127 ? 0.5991 0.6556 0.6389 -0.0466 -0.1153 0.0151  127 MET A O   
976  C CB  . MET A 127 ? 0.5124 0.4980 0.4888 -0.0347 -0.0969 0.0050  127 MET A CB  
977  C CG  . MET A 127 ? 0.5315 0.5384 0.5317 -0.0233 -0.0797 -0.0013 127 MET A CG  
978  S SD  . MET A 127 ? 0.7530 0.7402 0.7340 -0.0196 -0.0605 -0.0080 127 MET A SD  
979  C CE  . MET A 127 ? 0.7626 0.7017 0.6981 -0.0236 -0.0592 -0.0067 127 MET A CE  
980  N N   . LYS A 128 ? 0.5232 0.6080 0.5975 -0.0255 -0.1166 0.0148  128 LYS A N   
981  C CA  . LYS A 128 ? 0.5192 0.6494 0.6338 -0.0243 -0.1145 0.0175  128 LYS A CA  
982  C C   . LYS A 128 ? 0.4887 0.6328 0.6143 -0.0132 -0.0948 0.0100  128 LYS A C   
983  O O   . LYS A 128 ? 0.4815 0.6122 0.5997 -0.0027 -0.0873 0.0033  128 LYS A O   
984  C CB  . LYS A 128 ? 0.5437 0.7029 0.6902 -0.0166 -0.1274 0.0233  128 LYS A CB  
985  C CG  . LYS A 128 ? 0.6233 0.7756 0.7627 -0.0281 -0.1523 0.0314  128 LYS A CG  
986  C CD  . LYS A 128 ? 0.6453 0.8266 0.8175 -0.0152 -0.1668 0.0377  128 LYS A CD  
987  C CE  . LYS A 128 ? 0.6932 0.8705 0.8585 -0.0272 -0.1964 0.0460  128 LYS A CE  
988  N NZ  . LYS A 128 ? 0.7289 0.9378 0.9292 -0.0116 -0.2136 0.0537  128 LYS A NZ  
989  N N   . PHE A 129 ? 0.4952 0.6640 0.6360 -0.0171 -0.0870 0.0116  129 PHE A N   
990  C CA  . PHE A 129 ? 0.4621 0.6380 0.6027 -0.0083 -0.0706 0.0046  129 PHE A CA  
991  C C   . PHE A 129 ? 0.4425 0.6563 0.6129 0.0016  -0.0617 0.0043  129 PHE A C   
992  O O   . PHE A 129 ? 0.4347 0.6775 0.6322 -0.0012 -0.0652 0.0117  129 PHE A O   
993  C CB  . PHE A 129 ? 0.4431 0.6056 0.5633 -0.0178 -0.0656 0.0064  129 PHE A CB  
994  C CG  . PHE A 129 ? 0.4650 0.5885 0.5535 -0.0215 -0.0684 0.0039  129 PHE A CG  
995  C CD1 . PHE A 129 ? 0.5338 0.6334 0.6042 -0.0342 -0.0795 0.0089  129 PHE A CD1 
996  C CD2 . PHE A 129 ? 0.4532 0.5648 0.5302 -0.0123 -0.0597 -0.0041 129 PHE A CD2 
997  C CE1 . PHE A 129 ? 0.5492 0.6100 0.5862 -0.0353 -0.0786 0.0058  129 PHE A CE1 
998  C CE2 . PHE A 129 ? 0.4751 0.5555 0.5272 -0.0137 -0.0586 -0.0061 129 PHE A CE2 
999  C CZ  . PHE A 129 ? 0.5213 0.5746 0.5513 -0.0240 -0.0664 -0.0013 129 PHE A CZ  
1000 N N   . ILE A 130 ? 0.3879 0.6016 0.5532 0.0134  -0.0501 -0.0051 130 ILE A N   
1001 C CA  . ILE A 130 ? 0.3376 0.5795 0.5196 0.0242  -0.0379 -0.0078 130 ILE A CA  
1002 C C   . ILE A 130 ? 0.3499 0.5859 0.5102 0.0252  -0.0279 -0.0134 130 ILE A C   
1003 O O   . ILE A 130 ? 0.3507 0.5645 0.4916 0.0262  -0.0302 -0.0207 130 ILE A O   
1004 C CB  . ILE A 130 ? 0.3224 0.5642 0.5141 0.0413  -0.0360 -0.0161 130 ILE A CB  
1005 C CG1 . ILE A 130 ? 0.3251 0.5695 0.5353 0.0434  -0.0487 -0.0092 130 ILE A CG1 
1006 C CG2 . ILE A 130 ? 0.3306 0.5978 0.5343 0.0546  -0.0207 -0.0205 130 ILE A CG2 
1007 C CD1 . ILE A 130 ? 0.3557 0.5886 0.5692 0.0613  -0.0483 -0.0160 130 ILE A CD1 
1008 N N   . TYR A 131 ? 0.3686 0.6259 0.5327 0.0249  -0.0169 -0.0090 131 TYR A N   
1009 C CA  . TYR A 131 ? 0.3723 0.6226 0.5108 0.0270  -0.0090 -0.0123 131 TYR A CA  
1010 C C   . TYR A 131 ? 0.3827 0.6449 0.5186 0.0422  0.0030  -0.0220 131 TYR A C   
1011 O O   . TYR A 131 ? 0.3865 0.6718 0.5441 0.0491  0.0120  -0.0207 131 TYR A O   
1012 C CB  . TYR A 131 ? 0.3816 0.6365 0.5137 0.0141  -0.0042 0.0009  131 TYR A CB  
1013 C CG  . TYR A 131 ? 0.3909 0.6242 0.5167 -0.0004 -0.0163 0.0080  131 TYR A CG  
1014 C CD1 . TYR A 131 ? 0.3980 0.6019 0.4965 -0.0001 -0.0214 0.0055  131 TYR A CD1 
1015 C CD2 . TYR A 131 ? 0.3839 0.6259 0.5307 -0.0133 -0.0235 0.0164  131 TYR A CD2 
1016 C CE1 . TYR A 131 ? 0.4180 0.5971 0.5057 -0.0108 -0.0300 0.0106  131 TYR A CE1 
1017 C CE2 . TYR A 131 ? 0.4084 0.6236 0.5414 -0.0268 -0.0352 0.0209  131 TYR A CE2 
1018 C CZ  . TYR A 131 ? 0.4570 0.6384 0.5583 -0.0247 -0.0368 0.0176  131 TYR A CZ  
1019 O OH  . TYR A 131 ? 0.5187 0.6684 0.6013 -0.0357 -0.0458 0.0209  131 TYR A OH  
1020 N N   . PHE A 132 ? 0.4267 0.6731 0.5365 0.0483  0.0023  -0.0326 132 PHE A N   
1021 C CA  . PHE A 132 ? 0.4542 0.7036 0.5518 0.0619  0.0119  -0.0444 132 PHE A CA  
1022 C C   . PHE A 132 ? 0.5419 0.7903 0.6079 0.0631  0.0190  -0.0432 132 PHE A C   
1023 O O   . PHE A 132 ? 0.5543 0.7932 0.6046 0.0557  0.0123  -0.0363 132 PHE A O   
1024 C CB  . PHE A 132 ? 0.4116 0.6406 0.5018 0.0674  0.0029  -0.0605 132 PHE A CB  
1025 C CG  . PHE A 132 ? 0.4104 0.6339 0.5239 0.0691  -0.0016 -0.0620 132 PHE A CG  
1026 C CD1 . PHE A 132 ? 0.3701 0.5839 0.4935 0.0588  -0.0126 -0.0557 132 PHE A CD1 
1027 C CD2 . PHE A 132 ? 0.3520 0.5758 0.4730 0.0829  0.0059  -0.0694 132 PHE A CD2 
1028 C CE1 . PHE A 132 ? 0.3793 0.5835 0.5173 0.0609  -0.0175 -0.0555 132 PHE A CE1 
1029 C CE2 . PHE A 132 ? 0.3194 0.5337 0.4582 0.0866  0.0004  -0.0690 132 PHE A CE2 
1030 C CZ  . PHE A 132 ? 0.3503 0.5544 0.4963 0.0749  -0.0120 -0.0615 132 PHE A CZ  
1031 N N   . GLU A 133 ? 0.6129 0.8678 0.6659 0.0745  0.0330  -0.0498 133 GLU A N   
1032 C CA  . GLU A 133 ? 0.6778 0.9281 0.6924 0.0778  0.0413  -0.0494 133 GLU A CA  
1033 C C   . GLU A 133 ? 0.6816 0.9176 0.6680 0.0912  0.0421  -0.0688 133 GLU A C   
1034 O O   . GLU A 133 ? 0.6462 0.8752 0.6460 0.0967  0.0379  -0.0815 133 GLU A O   
1035 C CB  . GLU A 133 ? 0.7555 1.0278 0.7760 0.0761  0.0632  -0.0354 133 GLU A CB  
1036 C CG  . GLU A 133 ? 0.8701 1.1634 0.9134 0.0886  0.0809  -0.0408 133 GLU A CG  
1037 C CD  . GLU A 133 ? 0.9737 1.3020 1.0511 0.0818  0.0984  -0.0238 133 GLU A CD  
1038 O OE1 . GLU A 133 ? 1.0174 1.3478 1.0933 0.0651  0.0977  -0.0083 133 GLU A OE1 
1039 O OE2 . GLU A 133 ? 1.0008 1.3544 1.1079 0.0932  0.1127  -0.0258 133 GLU A OE2 
1040 N N   . ASN A 134 ? 0.6711 0.8978 0.6139 0.0958  0.0469  -0.0711 134 ASN A N   
1041 C CA  . ASN A 134 ? 0.6486 0.8571 0.5549 0.1074  0.0468  -0.0908 134 ASN A CA  
1042 C C   . ASN A 134 ? 0.6516 0.8432 0.5618 0.1043  0.0235  -0.1070 134 ASN A C   
1043 O O   . ASN A 134 ? 0.6376 0.8204 0.5604 0.1090  0.0244  -0.1199 134 ASN A O   
1044 C CB  . ASN A 134 ? 0.6629 0.8781 0.5747 0.1211  0.0704  -0.0973 134 ASN A CB  
1045 C CG  . ASN A 134 ? 0.7040 0.8944 0.5648 0.1342  0.0755  -0.1169 134 ASN A CG  
1046 O OD1 . ASN A 134 ? 0.7297 0.9009 0.5476 0.1317  0.0610  -0.1239 134 ASN A OD1 
1047 N ND2 . ASN A 134 ? 0.7354 0.9252 0.5990 0.1495  0.0954  -0.1262 134 ASN A ND2 
1048 N N   . GLY A 135 ? 0.6538 0.8411 0.5554 0.0965  0.0035  -0.1053 135 GLY A N   
1049 C CA  . GLY A 135 ? 0.6373 0.8155 0.5485 0.0905  -0.0179 -0.1188 135 GLY A CA  
1050 C C   . GLY A 135 ? 0.5971 0.7802 0.5544 0.0828  -0.0205 -0.1155 135 GLY A C   
1051 O O   . GLY A 135 ? 0.5479 0.7214 0.5163 0.0772  -0.0321 -0.1274 135 GLY A O   
1052 N N   . GLY A 136 ? 0.5735 0.7697 0.5551 0.0809  -0.0099 -0.0990 136 GLY A N   
1053 C CA  . GLY A 136 ? 0.5039 0.7019 0.5222 0.0742  -0.0127 -0.0942 136 GLY A CA  
1054 C C   . GLY A 136 ? 0.5160 0.7054 0.5470 0.0803  -0.0064 -0.1034 136 GLY A C   
1055 O O   . GLY A 136 ? 0.4737 0.6543 0.5249 0.0752  -0.0126 -0.1045 136 GLY A O   
1056 N N   . VAL A 137 ? 0.5338 0.7232 0.5503 0.0928  0.0075  -0.1092 137 VAL A N   
1057 C CA  . VAL A 137 ? 0.5005 0.6773 0.5241 0.1037  0.0147  -0.1193 137 VAL A CA  
1058 C C   . VAL A 137 ? 0.5044 0.7035 0.5571 0.1131  0.0296  -0.1069 137 VAL A C   
1059 O O   . VAL A 137 ? 0.5070 0.7014 0.5831 0.1181  0.0283  -0.1062 137 VAL A O   
1060 C CB  . VAL A 137 ? 0.5580 0.7143 0.5426 0.1148  0.0206  -0.1384 137 VAL A CB  
1061 C CG1 . VAL A 137 ? 0.5350 0.6749 0.5243 0.1305  0.0319  -0.1480 137 VAL A CG1 
1062 C CG2 . VAL A 137 ? 0.5730 0.7084 0.5343 0.1037  0.0013  -0.1528 137 VAL A CG2 
1063 N N   . VAL A 138 ? 0.5365 0.7606 0.5885 0.1151  0.0432  -0.0963 138 VAL A N   
1064 C CA  . VAL A 138 ? 0.5433 0.7973 0.6277 0.1232  0.0590  -0.0849 138 VAL A CA  
1065 C C   . VAL A 138 ? 0.5606 0.8383 0.6776 0.1077  0.0520  -0.0652 138 VAL A C   
1066 O O   . VAL A 138 ? 0.5786 0.8599 0.6843 0.0945  0.0498  -0.0561 138 VAL A O   
1067 C CB  . VAL A 138 ? 0.5452 0.8148 0.6116 0.1335  0.0828  -0.0846 138 VAL A CB  
1068 C CG1 . VAL A 138 ? 0.5234 0.8320 0.6327 0.1422  0.1007  -0.0730 138 VAL A CG1 
1069 C CG2 . VAL A 138 ? 0.6194 0.8590 0.6435 0.1488  0.0893  -0.1060 138 VAL A CG2 
1070 N N   . ALA A 139 ? 0.5469 0.8369 0.7009 0.1101  0.0475  -0.0589 139 ALA A N   
1071 C CA  . ALA A 139 ? 0.5387 0.8477 0.7213 0.0946  0.0379  -0.0421 139 ALA A CA  
1072 C C   . ALA A 139 ? 0.5993 0.9469 0.8027 0.0894  0.0526  -0.0282 139 ALA A C   
1073 O O   . ALA A 139 ? 0.6072 0.9801 0.8262 0.1033  0.0711  -0.0288 139 ALA A O   
1074 C CB  . ALA A 139 ? 0.5027 0.8118 0.7142 0.0997  0.0261  -0.0398 139 ALA A CB  
1075 N N   . ARG A 140 ? 0.6556 1.0063 0.8591 0.0690  0.0460  -0.0157 140 ARG A N   
1076 C CA  . ARG A 140 ? 0.7162 1.1007 0.9410 0.0579  0.0586  -0.0008 140 ARG A CA  
1077 C C   . ARG A 140 ? 0.7687 1.1890 1.0466 0.0547  0.0525  0.0089  140 ARG A C   
1078 O O   . ARG A 140 ? 0.7808 1.1894 1.0686 0.0518  0.0317  0.0088  140 ARG A O   
1079 C CB  . ARG A 140 ? 0.7081 1.0749 0.9094 0.0363  0.0526  0.0091  140 ARG A CB  
1080 C CG  . ARG A 140 ? 0.7620 1.0983 0.9130 0.0400  0.0564  0.0026  140 ARG A CG  
1081 C CD  . ARG A 140 ? 0.7972 1.1286 0.9289 0.0238  0.0633  0.0169  140 ARG A CD  
1082 N NE  . ARG A 140 ? 0.7801 1.0955 0.9154 0.0052  0.0470  0.0260  140 ARG A NE  
1083 C CZ  . ARG A 140 ? 0.7987 1.0785 0.9016 0.0024  0.0349  0.0250  140 ARG A CZ  
1084 N NH1 . ARG A 140 ? 0.8369 1.0987 0.9061 0.0155  0.0346  0.0162  140 ARG A NH1 
1085 N NH2 . ARG A 140 ? 0.7673 1.0295 0.8712 -0.0128 0.0225  0.0323  140 ARG A NH2 
1086 N N   . LEU A 141 ? 0.7956 1.2608 1.1077 0.0552  0.0704  0.0177  141 LEU A N   
1087 C CA  . LEU A 141 ? 0.7798 1.2885 1.1492 0.0485  0.0627  0.0293  141 LEU A CA  
1088 C C   . LEU A 141 ? 0.7485 1.3068 1.1516 0.0377  0.0848  0.0424  141 LEU A C   
1089 O O   . LEU A 141 ? 0.7212 1.3050 1.1648 0.0215  0.0755  0.0525  141 LEU A O   
1090 C CB  . LEU A 141 ? 0.7854 1.3079 1.1839 0.0746  0.0579  0.0223  141 LEU A CB  
1091 C CG  . LEU A 141 ? 0.8398 1.3674 1.2370 0.1031  0.0820  0.0117  141 LEU A CG  
1092 C CD1 . LEU A 141 ? 0.8809 1.4491 1.3208 0.1037  0.0999  0.0190  141 LEU A CD1 
1093 C CD2 . LEU A 141 ? 0.8475 1.3495 1.2411 0.1269  0.0702  0.0004  141 LEU A CD2 
1094 N N   . GLU A 149 ? 1.0619 1.5964 1.5944 0.1163  -0.1092 0.0418  149 GLU A N   
1095 C CA  . GLU A 149 ? 1.0754 1.6085 1.5961 0.0891  -0.1338 0.0489  149 GLU A CA  
1096 C C   . GLU A 149 ? 1.1112 1.5938 1.5839 0.0899  -0.1552 0.0526  149 GLU A C   
1097 O O   . GLU A 149 ? 1.1484 1.6278 1.6180 0.0980  -0.1780 0.0585  149 GLU A O   
1098 C CB  . GLU A 149 ? 1.0341 1.5684 1.5469 0.0572  -0.1228 0.0502  149 GLU A CB  
1099 C CG  . GLU A 149 ? 1.0013 1.5532 1.5281 0.0610  -0.0894 0.0464  149 GLU A CG  
1100 C CD  . GLU A 149 ? 0.9652 1.4855 1.4517 0.0450  -0.0785 0.0457  149 GLU A CD  
1101 O OE1 . GLU A 149 ? 0.9335 1.4694 1.4251 0.0259  -0.0643 0.0492  149 GLU A OE1 
1102 O OE2 . GLU A 149 ? 0.9656 1.4465 1.4160 0.0518  -0.0841 0.0423  149 GLU A OE2 
1103 N N   . ASP A 150 ? 1.0830 1.5255 1.5185 0.0814  -0.1472 0.0502  150 ASP A N   
1104 C CA  . ASP A 150 ? 1.0589 1.4467 1.4491 0.0788  -0.1639 0.0531  150 ASP A CA  
1105 C C   . ASP A 150 ? 1.0322 1.3900 1.4127 0.1074  -0.1575 0.0497  150 ASP A C   
1106 O O   . ASP A 150 ? 1.0233 1.3848 1.4094 0.1202  -0.1326 0.0406  150 ASP A O   
1107 C CB  . ASP A 150 ? 1.0695 1.4279 1.4277 0.0532  -0.1604 0.0506  150 ASP A CB  
1108 C CG  . ASP A 150 ? 1.1113 1.4867 1.4729 0.0245  -0.1663 0.0534  150 ASP A CG  
1109 O OD1 . ASP A 150 ? 1.1753 1.5638 1.5463 0.0183  -0.1852 0.0579  150 ASP A OD1 
1110 O OD2 . ASP A 150 ? 1.0822 1.4557 1.4364 0.0083  -0.1528 0.0513  150 ASP A OD2 
1111 N N   . PRO A 151 ? 1.0165 1.3338 1.3692 0.1159  -0.1774 0.0542  151 PRO A N   
1112 C CA  . PRO A 151 ? 1.0067 1.2835 1.3384 0.1420  -0.1703 0.0500  151 PRO A CA  
1113 C C   . PRO A 151 ? 0.9490 1.1808 1.2411 0.1375  -0.1454 0.0356  151 PRO A C   
1114 O O   . PRO A 151 ? 0.9494 1.1615 1.2369 0.1581  -0.1316 0.0283  151 PRO A O   
1115 C CB  . PRO A 151 ? 1.0593 1.2944 1.3562 0.1417  -0.1977 0.0599  151 PRO A CB  
1116 C CG  . PRO A 151 ? 1.0592 1.2918 1.3364 0.1101  -0.2111 0.0628  151 PRO A CG  
1117 C CD  . PRO A 151 ? 1.0330 1.3290 1.3571 0.0978  -0.2041 0.0623  151 PRO A CD  
1118 N N   . HIS A 152 ? 0.8909 1.1066 1.1556 0.1114  -0.1408 0.0314  152 HIS A N   
1119 C CA  . HIS A 152 ? 0.8383 1.0156 1.0684 0.1050  -0.1214 0.0189  152 HIS A CA  
1120 C C   . HIS A 152 ? 0.7790 0.9831 1.0279 0.1097  -0.0988 0.0081  152 HIS A C   
1121 O O   . HIS A 152 ? 0.7664 0.9432 0.9950 0.1138  -0.0843 -0.0036 152 HIS A O   
1122 C CB  . HIS A 152 ? 0.8230 0.9768 1.0199 0.0790  -0.1244 0.0189  152 HIS A CB  
1123 C CG  . HIS A 152 ? 0.7751 0.9646 0.9890 0.0622  -0.1220 0.0197  152 HIS A CG  
1124 N ND1 . HIS A 152 ? 0.7833 1.0023 1.0179 0.0527  -0.1391 0.0299  152 HIS A ND1 
1125 C CD2 . HIS A 152 ? 0.7349 0.9323 0.9461 0.0528  -0.1055 0.0123  152 HIS A CD2 
1126 C CE1 . HIS A 152 ? 0.7512 0.9916 0.9942 0.0366  -0.1313 0.0288  152 HIS A CE1 
1127 N NE2 . HIS A 152 ? 0.7203 0.9471 0.9478 0.0380  -0.1109 0.0188  152 HIS A NE2 
1128 N N   . PHE A 153 ? 0.7506 1.0070 1.0362 0.1074  -0.0963 0.0123  153 PHE A N   
1129 C CA  . PHE A 153 ? 0.7380 1.0186 1.0334 0.1069  -0.0744 0.0042  153 PHE A CA  
1130 C C   . PHE A 153 ? 0.7359 1.0064 1.0290 0.1305  -0.0572 -0.0076 153 PHE A C   
1131 O O   . PHE A 153 ? 0.7374 0.9864 1.0045 0.1272  -0.0438 -0.0197 153 PHE A O   
1132 C CB  . PHE A 153 ? 0.7267 1.0665 1.0656 0.1017  -0.0731 0.0134  153 PHE A CB  
1133 C CG  . PHE A 153 ? 0.7563 1.1174 1.0980 0.0979  -0.0498 0.0078  153 PHE A CG  
1134 C CD1 . PHE A 153 ? 0.7957 1.1801 1.1558 0.1193  -0.0297 0.0021  153 PHE A CD1 
1135 C CD2 . PHE A 153 ? 0.7615 1.1153 1.0825 0.0746  -0.0475 0.0085  153 PHE A CD2 
1136 C CE1 . PHE A 153 ? 0.8015 1.2011 1.1561 0.1160  -0.0078 -0.0025 153 PHE A CE1 
1137 C CE2 . PHE A 153 ? 0.7690 1.1378 1.0865 0.0719  -0.0272 0.0051  153 PHE A CE2 
1138 C CZ  . PHE A 153 ? 0.7848 1.1764 1.1175 0.0918  -0.0075 -0.0002 153 PHE A CZ  
1139 N N   . ALA A 154 ? 0.7427 1.0270 1.0616 0.1550  -0.0588 -0.0044 154 ALA A N   
1140 C CA  . ALA A 154 ? 0.7830 1.0550 1.0988 0.1807  -0.0415 -0.0161 154 ALA A CA  
1141 C C   . ALA A 154 ? 0.8105 1.0201 1.0782 0.1774  -0.0376 -0.0298 154 ALA A C   
1142 O O   . ALA A 154 ? 0.8262 1.0239 1.0772 0.1822  -0.0210 -0.0441 154 ALA A O   
1143 C CB  . ALA A 154 ? 0.8188 1.1029 1.1644 0.2098  -0.0484 -0.0090 154 ALA A CB  
1144 N N   . GLU A 155 ? 0.8397 1.0096 1.0839 0.1675  -0.0529 -0.0254 155 GLU A N   
1145 C CA  . GLU A 155 ? 0.8792 0.9931 1.0830 0.1603  -0.0490 -0.0368 155 GLU A CA  
1146 C C   . GLU A 155 ? 0.7589 0.8741 0.9460 0.1361  -0.0427 -0.0447 155 GLU A C   
1147 O O   . GLU A 155 ? 0.7185 0.8182 0.8890 0.1354  -0.0317 -0.0593 155 GLU A O   
1148 C CB  . GLU A 155 ? 1.0326 1.1043 1.2155 0.1561  -0.0641 -0.0278 155 GLU A CB  
1149 C CG  . GLU A 155 ? 1.2142 1.2292 1.3596 0.1457  -0.0586 -0.0379 155 GLU A CG  
1150 C CD  . GLU A 155 ? 1.3599 1.3303 1.4808 0.1415  -0.0701 -0.0270 155 GLU A CD  
1151 O OE1 . GLU A 155 ? 1.4213 1.4045 1.5503 0.1459  -0.0852 -0.0120 155 GLU A OE1 
1152 O OE2 . GLU A 155 ? 1.3993 1.3210 1.4913 0.1326  -0.0645 -0.0330 155 GLU A OE2 
1153 N N   . LEU A 156 ? 0.6809 0.8129 0.8710 0.1173  -0.0511 -0.0352 156 LEU A N   
1154 C CA  . LEU A 156 ? 0.6564 0.7875 0.8309 0.0969  -0.0469 -0.0404 156 LEU A CA  
1155 C C   . LEU A 156 ? 0.6213 0.7797 0.8013 0.0988  -0.0339 -0.0487 156 LEU A C   
1156 O O   . LEU A 156 ? 0.6125 0.7618 0.7749 0.0890  -0.0295 -0.0578 156 LEU A O   
1157 C CB  . LEU A 156 ? 0.6278 0.7690 0.8029 0.0802  -0.0576 -0.0283 156 LEU A CB  
1158 C CG  . LEU A 156 ? 0.6457 0.7741 0.8002 0.0620  -0.0548 -0.0322 156 LEU A CG  
1159 C CD1 . LEU A 156 ? 0.6701 0.7591 0.8032 0.0583  -0.0523 -0.0395 156 LEU A CD1 
1160 C CD2 . LEU A 156 ? 0.6127 0.7441 0.7626 0.0480  -0.0643 -0.0213 156 LEU A CD2 
1161 N N   . ALA A 157 ? 0.5882 0.7815 0.7928 0.1118  -0.0278 -0.0449 157 ALA A N   
1162 C CA  . ALA A 157 ? 0.5872 0.8044 0.7923 0.1150  -0.0126 -0.0513 157 ALA A CA  
1163 C C   . ALA A 157 ? 0.6574 0.8470 0.8384 0.1263  -0.0028 -0.0691 157 ALA A C   
1164 O O   . ALA A 157 ? 0.6857 0.8754 0.8474 0.1218  0.0046  -0.0781 157 ALA A O   
1165 C CB  . ALA A 157 ? 0.5643 0.8269 0.8044 0.1264  -0.0048 -0.0424 157 ALA A CB  
1166 N N   . GLN A 158 ? 0.7204 0.8824 0.8989 0.1408  -0.0042 -0.0739 158 GLN A N   
1167 C CA  . GLN A 158 ? 0.7743 0.9007 0.9263 0.1506  0.0034  -0.0920 158 GLN A CA  
1168 C C   . GLN A 158 ? 0.7663 0.8567 0.8915 0.1307  -0.0047 -0.1012 158 GLN A C   
1169 O O   . GLN A 158 ? 0.8310 0.8951 0.9318 0.1307  -0.0010 -0.1178 158 GLN A O   
1170 C CB  . GLN A 158 ? 0.8341 0.9369 0.9908 0.1740  0.0048  -0.0932 158 GLN A CB  
1171 C CG  . GLN A 158 ? 0.8804 1.0210 1.0673 0.1996  0.0162  -0.0876 158 GLN A CG  
1172 C CD  . GLN A 158 ? 0.9985 1.1104 1.1869 0.2276  0.0179  -0.0903 158 GLN A CD  
1173 O OE1 . GLN A 158 ? 1.0487 1.1255 1.2297 0.2267  0.0044  -0.0852 158 GLN A OE1 
1174 N NE2 . GLN A 158 ? 1.0357 1.1591 1.2302 0.2540  0.0360  -0.0980 158 GLN A NE2 
1175 N N   . LEU A 159 ? 0.6781 0.7679 0.8082 0.1133  -0.0155 -0.0908 159 LEU A N   
1176 C CA  . LEU A 159 ? 0.6536 0.7151 0.7663 0.0945  -0.0212 -0.0973 159 LEU A CA  
1177 C C   . LEU A 159 ? 0.6535 0.7274 0.7555 0.0835  -0.0200 -0.1078 159 LEU A C   
1178 O O   . LEU A 159 ? 0.6035 0.7088 0.7116 0.0802  -0.0194 -0.1015 159 LEU A O   
1179 C CB  . LEU A 159 ? 0.6412 0.7018 0.7600 0.0808  -0.0295 -0.0831 159 LEU A CB  
1180 C CG  . LEU A 159 ? 0.6300 0.6654 0.7360 0.0620  -0.0315 -0.0884 159 LEU A CG  
1181 C CD1 . LEU A 159 ? 0.6453 0.6376 0.7368 0.0637  -0.0297 -0.0986 159 LEU A CD1 
1182 C CD2 . LEU A 159 ? 0.5892 0.6206 0.6958 0.0510  -0.0360 -0.0746 159 LEU A CD2 
1183 N N   . ARG A 160 ? 0.6762 0.7228 0.7608 0.0771  -0.0214 -0.1234 160 ARG A N   
1184 C CA  . ARG A 160 ? 0.6797 0.7360 0.7522 0.0679  -0.0242 -0.1353 160 ARG A CA  
1185 C C   . ARG A 160 ? 0.6423 0.7114 0.7246 0.0488  -0.0320 -0.1305 160 ARG A C   
1186 O O   . ARG A 160 ? 0.6107 0.6684 0.7026 0.0393  -0.0334 -0.1231 160 ARG A O   
1187 C CB  . ARG A 160 ? 0.7561 0.7772 0.8063 0.0667  -0.0255 -0.1554 160 ARG A CB  
1188 C CG  . ARG A 160 ? 0.8514 0.8732 0.8776 0.0795  -0.0206 -0.1692 160 ARG A CG  
1189 C CD  . ARG A 160 ? 0.9332 0.9138 0.9328 0.0728  -0.0259 -0.1911 160 ARG A CD  
1190 N NE  . ARG A 160 ? 1.0021 0.9626 0.9714 0.0919  -0.0167 -0.2054 160 ARG A NE  
1191 C CZ  . ARG A 160 ? 1.0904 1.0049 1.0291 0.0905  -0.0191 -0.2261 160 ARG A CZ  
1192 N NH1 . ARG A 160 ? 1.1190 1.0063 1.0578 0.0679  -0.0313 -0.2338 160 ARG A NH1 
1193 N NH2 . ARG A 160 ? 1.1218 1.0158 1.0286 0.1107  -0.0082 -0.2395 160 ARG A NH2 
1194 N N   . TYR A 161 ? 0.6164 0.7081 0.6944 0.0448  -0.0363 -0.1343 161 TYR A N   
1195 C CA  . TYR A 161 ? 0.5359 0.6403 0.6247 0.0296  -0.0440 -0.1330 161 TYR A CA  
1196 C C   . TYR A 161 ? 0.5315 0.6177 0.6181 0.0163  -0.0507 -0.1490 161 TYR A C   
1197 O O   . TYR A 161 ? 0.5781 0.6563 0.6467 0.0178  -0.0557 -0.1641 161 TYR A O   
1198 C CB  . TYR A 161 ? 0.4837 0.6174 0.5684 0.0326  -0.0482 -0.1299 161 TYR A CB  
1199 C CG  . TYR A 161 ? 0.4257 0.5741 0.5216 0.0210  -0.0583 -0.1331 161 TYR A CG  
1200 C CD1 . TYR A 161 ? 0.3360 0.4927 0.4524 0.0139  -0.0565 -0.1228 161 TYR A CD1 
1201 C CD2 . TYR A 161 ? 0.4390 0.5940 0.5253 0.0181  -0.0698 -0.1468 161 TYR A CD2 
1202 C CE1 . TYR A 161 ? 0.3522 0.5280 0.4852 0.0059  -0.0636 -0.1253 161 TYR A CE1 
1203 C CE2 . TYR A 161 ? 0.4172 0.5931 0.5212 0.0085  -0.0810 -0.1491 161 TYR A CE2 
1204 C CZ  . TYR A 161 ? 0.4209 0.6095 0.5514 0.0033  -0.0767 -0.1380 161 TYR A CZ  
1205 O OH  . TYR A 161 ? 0.4952 0.7102 0.6494 -0.0036 -0.0857 -0.1399 161 TYR A OH  
1206 N N   . GLU A 162 ? 0.5257 0.6036 0.6285 0.0019  -0.0503 -0.1458 162 GLU A N   
1207 C CA  . GLU A 162 ? 0.5601 0.6170 0.6643 -0.0148 -0.0546 -0.1593 162 GLU A CA  
1208 C C   . GLU A 162 ? 0.5706 0.6548 0.6997 -0.0327 -0.0612 -0.1612 162 GLU A C   
1209 O O   . GLU A 162 ? 0.6038 0.6756 0.7435 -0.0517 -0.0626 -0.1687 162 GLU A O   
1210 C CB  . GLU A 162 ? 0.5562 0.5734 0.6570 -0.0187 -0.0460 -0.1547 162 GLU A CB  
1211 C CG  . GLU A 162 ? 0.6498 0.6396 0.7304 0.0011  -0.0408 -0.1539 162 GLU A CG  
1212 C CD  . GLU A 162 ? 0.8043 0.7664 0.8618 0.0050  -0.0435 -0.1733 162 GLU A CD  
1213 O OE1 . GLU A 162 ? 0.8383 0.8044 0.8928 -0.0088 -0.0525 -0.1880 162 GLU A OE1 
1214 O OE2 . GLU A 162 ? 0.8884 0.8242 0.9303 0.0229  -0.0373 -0.1742 162 GLU A OE2 
1215 N N   . GLY A 163 ? 0.5158 0.6371 0.6559 -0.0266 -0.0647 -0.1538 163 GLY A N   
1216 C CA  . GLY A 163 ? 0.4958 0.6497 0.6634 -0.0384 -0.0719 -0.1556 163 GLY A CA  
1217 C C   . GLY A 163 ? 0.4811 0.6518 0.6698 -0.0381 -0.0615 -0.1401 163 GLY A C   
1218 O O   . GLY A 163 ? 0.4729 0.6233 0.6526 -0.0337 -0.0495 -0.1289 163 GLY A O   
1219 N N   . ALA A 164 ? 0.4851 0.6925 0.7007 -0.0416 -0.0668 -0.1399 164 ALA A N   
1220 C CA  . ALA A 164 ? 0.4686 0.6920 0.7028 -0.0386 -0.0553 -0.1268 164 ALA A CA  
1221 C C   . ALA A 164 ? 0.4796 0.6844 0.7244 -0.0537 -0.0389 -0.1228 164 ALA A C   
1222 O O   . ALA A 164 ? 0.4850 0.6767 0.7215 -0.0486 -0.0251 -0.1107 164 ALA A O   
1223 C CB  . ALA A 164 ? 0.4554 0.7247 0.7201 -0.0363 -0.0646 -0.1284 164 ALA A CB  
1224 N N   . GLU A 165 ? 0.5056 0.7050 0.7643 -0.0734 -0.0406 -0.1329 165 GLU A N   
1225 C CA  . GLU A 165 ? 0.5270 0.7061 0.7937 -0.0902 -0.0234 -0.1281 165 GLU A CA  
1226 C C   . GLU A 165 ? 0.5214 0.6502 0.7505 -0.0839 -0.0141 -0.1195 165 GLU A C   
1227 O O   . GLU A 165 ? 0.5449 0.6564 0.7682 -0.0872 0.0019  -0.1083 165 GLU A O   
1228 C CB  . GLU A 165 ? 0.6137 0.7920 0.9007 -0.1159 -0.0281 -0.1410 165 GLU A CB  
1229 C CG  . GLU A 165 ? 0.6537 0.8888 0.9899 -0.1271 -0.0353 -0.1469 165 GLU A CG  
1230 C CD  . GLU A 165 ? 0.6985 0.9585 1.0678 -0.1333 -0.0139 -0.1356 165 GLU A CD  
1231 O OE1 . GLU A 165 ? 0.7479 0.9731 1.0967 -0.1342 0.0068  -0.1246 165 GLU A OE1 
1232 O OE2 . GLU A 165 ? 0.6874 1.0022 1.1025 -0.1359 -0.0176 -0.1376 165 GLU A OE2 
1233 N N   . SER A 166 ? 0.5181 0.6248 0.7211 -0.0733 -0.0239 -0.1242 166 SER A N   
1234 C CA  . SER A 166 ? 0.5140 0.5801 0.6866 -0.0637 -0.0181 -0.1154 166 SER A CA  
1235 C C   . SER A 166 ? 0.4856 0.5596 0.6498 -0.0496 -0.0133 -0.1010 166 SER A C   
1236 O O   . SER A 166 ? 0.4999 0.5457 0.6462 -0.0481 -0.0057 -0.0902 166 SER A O   
1237 C CB  . SER A 166 ? 0.5297 0.5781 0.6821 -0.0523 -0.0280 -0.1240 166 SER A CB  
1238 O OG  . SER A 166 ? 0.6001 0.6771 0.7507 -0.0366 -0.0358 -0.1245 166 SER A OG  
1239 N N   . VAL A 167 ? 0.4492 0.5571 0.6224 -0.0398 -0.0190 -0.1007 167 VAL A N   
1240 C CA  . VAL A 167 ? 0.4299 0.5414 0.5932 -0.0287 -0.0150 -0.0883 167 VAL A CA  
1241 C C   . VAL A 167 ? 0.4500 0.5566 0.6175 -0.0361 -0.0004 -0.0808 167 VAL A C   
1242 O O   . VAL A 167 ? 0.5021 0.5851 0.6475 -0.0326 0.0058  -0.0705 167 VAL A O   
1243 C CB  . VAL A 167 ? 0.4290 0.5724 0.5985 -0.0174 -0.0231 -0.0891 167 VAL A CB  
1244 C CG1 . VAL A 167 ? 0.3982 0.5372 0.5541 -0.0085 -0.0187 -0.0769 167 VAL A CG1 
1245 C CG2 . VAL A 167 ? 0.4321 0.5783 0.5915 -0.0098 -0.0341 -0.0956 167 VAL A CG2 
1246 N N   . ARG A 168 ? 0.4432 0.5730 0.6389 -0.0464 0.0051  -0.0861 168 ARG A N   
1247 C CA  . ARG A 168 ? 0.5118 0.6402 0.7151 -0.0540 0.0237  -0.0796 168 ARG A CA  
1248 C C   . ARG A 168 ? 0.5794 0.6626 0.7577 -0.0645 0.0348  -0.0733 168 ARG A C   
1249 O O   . ARG A 168 ? 0.5909 0.6541 0.7495 -0.0635 0.0487  -0.0635 168 ARG A O   
1250 C CB  . ARG A 168 ? 0.5392 0.7077 0.7866 -0.0655 0.0274  -0.0870 168 ARG A CB  
1251 C CG  . ARG A 168 ? 0.5361 0.7092 0.7982 -0.0747 0.0514  -0.0807 168 ARG A CG  
1252 C CD  . ARG A 168 ? 0.5794 0.8010 0.8956 -0.0884 0.0532  -0.0885 168 ARG A CD  
1253 N NE  . ARG A 168 ? 0.6773 0.9078 1.0134 -0.0993 0.0801  -0.0824 168 ARG A NE  
1254 C CZ  . ARG A 168 ? 0.7678 0.9764 1.1044 -0.1225 0.0949  -0.0807 168 ARG A CZ  
1255 N NH1 . ARG A 168 ? 0.8071 0.9797 1.1240 -0.1358 0.0839  -0.0851 168 ARG A NH1 
1256 N NH2 . ARG A 168 ? 0.7725 0.9920 1.1271 -0.1319 0.1227  -0.0741 168 ARG A NH2 
1257 N N   . ASP A 169 ? 0.5680 0.6303 0.7421 -0.0733 0.0284  -0.0788 169 ASP A N   
1258 C CA  . ASP A 169 ? 0.6088 0.6217 0.7544 -0.0806 0.0363  -0.0717 169 ASP A CA  
1259 C C   . ASP A 169 ? 0.5829 0.5686 0.6923 -0.0647 0.0311  -0.0611 169 ASP A C   
1260 O O   . ASP A 169 ? 0.5726 0.5235 0.6537 -0.0669 0.0401  -0.0504 169 ASP A O   
1261 C CB  . ASP A 169 ? 0.6411 0.6319 0.7861 -0.0894 0.0285  -0.0808 169 ASP A CB  
1262 C CG  . ASP A 169 ? 0.7255 0.7330 0.9025 -0.1122 0.0334  -0.0906 169 ASP A CG  
1263 O OD1 . ASP A 169 ? 0.7635 0.7983 0.9652 -0.1222 0.0469  -0.0877 169 ASP A OD1 
1264 O OD2 . ASP A 169 ? 0.7780 0.7712 0.9560 -0.1203 0.0240  -0.1018 169 ASP A OD2 
1265 N N   . GLN A 170 ? 0.5467 0.5483 0.6562 -0.0499 0.0160  -0.0637 170 GLN A N   
1266 C CA  . GLN A 170 ? 0.5697 0.5543 0.6533 -0.0368 0.0082  -0.0543 170 GLN A CA  
1267 C C   . GLN A 170 ? 0.5550 0.5392 0.6241 -0.0347 0.0148  -0.0457 170 GLN A C   
1268 O O   . GLN A 170 ? 0.5697 0.5261 0.6090 -0.0313 0.0123  -0.0361 170 GLN A O   
1269 C CB  . GLN A 170 ? 0.5751 0.5825 0.6677 -0.0240 -0.0062 -0.0591 170 GLN A CB  
1270 C CG  . GLN A 170 ? 0.5252 0.5226 0.6206 -0.0208 -0.0126 -0.0669 170 GLN A CG  
1271 C CD  . GLN A 170 ? 0.5474 0.5736 0.6539 -0.0098 -0.0214 -0.0742 170 GLN A CD  
1272 O OE1 . GLN A 170 ? 0.5016 0.5559 0.6154 -0.0067 -0.0233 -0.0733 170 GLN A OE1 
1273 N NE2 . GLN A 170 ? 0.6030 0.6182 0.7069 -0.0029 -0.0254 -0.0811 170 GLN A NE2 
1274 N N   . MET A 171 ? 0.5215 0.5348 0.6099 -0.0358 0.0221  -0.0496 171 MET A N   
1275 C CA  . MET A 171 ? 0.5531 0.5630 0.6259 -0.0315 0.0306  -0.0434 171 MET A CA  
1276 C C   . MET A 171 ? 0.6093 0.5904 0.6622 -0.0404 0.0496  -0.0374 171 MET A C   
1277 O O   . MET A 171 ? 0.6462 0.5985 0.6629 -0.0373 0.0534  -0.0298 171 MET A O   
1278 C CB  . MET A 171 ? 0.4829 0.5317 0.5833 -0.0260 0.0332  -0.0490 171 MET A CB  
1279 C CG  . MET A 171 ? 0.5493 0.5914 0.6345 -0.0197 0.0460  -0.0442 171 MET A CG  
1280 S SD  . MET A 171 ? 0.7606 0.7668 0.7992 -0.0127 0.0356  -0.0363 171 MET A SD  
1281 C CE  . MET A 171 ? 0.3506 0.3843 0.4070 -0.0056 0.0150  -0.0392 171 MET A CE  
1282 N N   . VAL A 172 ? 0.5847 0.5718 0.6587 -0.0530 0.0616  -0.0408 172 VAL A N   
1283 C CA  . VAL A 172 ? 0.5824 0.5412 0.6381 -0.0643 0.0831  -0.0341 172 VAL A CA  
1284 C C   . VAL A 172 ? 0.5801 0.4854 0.5880 -0.0646 0.0777  -0.0243 172 VAL A C   
1285 O O   . VAL A 172 ? 0.5573 0.4288 0.5263 -0.0656 0.0897  -0.0154 172 VAL A O   
1286 C CB  . VAL A 172 ? 0.5949 0.5717 0.6874 -0.0820 0.0949  -0.0398 172 VAL A CB  
1287 C CG1 . VAL A 172 ? 0.6477 0.5832 0.7142 -0.0969 0.1156  -0.0307 172 VAL A CG1 
1288 C CG2 . VAL A 172 ? 0.5397 0.5704 0.6782 -0.0816 0.1041  -0.0464 172 VAL A CG2 
1289 N N   . THR A 173 ? 0.6314 0.5283 0.6402 -0.0617 0.0592  -0.0259 173 THR A N   
1290 C CA  . THR A 173 ? 0.6761 0.5269 0.6449 -0.0577 0.0495  -0.0162 173 THR A CA  
1291 C C   . THR A 173 ? 0.6707 0.5090 0.6064 -0.0465 0.0385  -0.0087 173 THR A C   
1292 O O   . THR A 173 ? 0.7317 0.5279 0.6233 -0.0467 0.0388  0.0018  173 THR A O   
1293 C CB  . THR A 173 ? 0.6416 0.4930 0.6243 -0.0516 0.0318  -0.0208 173 THR A CB  
1294 O OG1 . THR A 173 ? 0.7129 0.5553 0.7106 -0.0648 0.0412  -0.0265 173 THR A OG1 
1295 C CG2 . THR A 173 ? 0.6206 0.4345 0.5682 -0.0407 0.0172  -0.0100 173 THR A CG2 
1296 N N   . ILE A 174 ? 0.5949 0.4667 0.5488 -0.0381 0.0277  -0.0138 174 ILE A N   
1297 C CA  . ILE A 174 ? 0.6062 0.4676 0.5323 -0.0308 0.0146  -0.0081 174 ILE A CA  
1298 C C   . ILE A 174 ? 0.6215 0.4544 0.5087 -0.0344 0.0298  -0.0036 174 ILE A C   
1299 O O   . ILE A 174 ? 0.6846 0.4801 0.5265 -0.0337 0.0221  0.0045  174 ILE A O   
1300 C CB  . ILE A 174 ? 0.5868 0.4874 0.5402 -0.0240 0.0037  -0.0142 174 ILE A CB  
1301 C CG1 . ILE A 174 ? 0.6292 0.5480 0.6048 -0.0177 -0.0142 -0.0154 174 ILE A CG1 
1302 C CG2 . ILE A 174 ? 0.5833 0.4704 0.5070 -0.0220 -0.0028 -0.0101 174 ILE A CG2 
1303 C CD1 . ILE A 174 ? 0.6413 0.5968 0.6411 -0.0125 -0.0225 -0.0200 174 ILE A CD1 
1304 N N   . VAL A 175 ? 0.5592 0.4099 0.4632 -0.0373 0.0512  -0.0090 175 VAL A N   
1305 C CA  . VAL A 175 ? 0.6484 0.4753 0.5183 -0.0378 0.0709  -0.0064 175 VAL A CA  
1306 C C   . VAL A 175 ? 0.7373 0.5197 0.5672 -0.0463 0.0861  0.0022  175 VAL A C   
1307 O O   . VAL A 175 ? 0.7433 0.4852 0.5194 -0.0452 0.0917  0.0078  175 VAL A O   
1308 C CB  . VAL A 175 ? 0.6952 0.5594 0.6023 -0.0359 0.0915  -0.0139 175 VAL A CB  
1309 C CG1 . VAL A 175 ? 0.7523 0.5913 0.6236 -0.0330 0.1157  -0.0118 175 VAL A CG1 
1310 C CG2 . VAL A 175 ? 0.6437 0.5445 0.5814 -0.0262 0.0755  -0.0205 175 VAL A CG2 
1311 N N   . ARG A 176 ? 0.8166 0.6010 0.6673 -0.0553 0.0925  0.0035  176 ARG A N   
1312 C CA  . ARG A 176 ? 0.8872 0.6237 0.6972 -0.0644 0.1058  0.0138  176 ARG A CA  
1313 C C   . ARG A 176 ? 0.9064 0.5980 0.6646 -0.0580 0.0820  0.0235  176 ARG A C   
1314 O O   . ARG A 176 ? 1.0096 0.6535 0.7094 -0.0595 0.0890  0.0328  176 ARG A O   
1315 C CB  . ARG A 176 ? 0.9544 0.6981 0.7977 -0.0771 0.1143  0.0127  176 ARG A CB  
1316 C CG  . ARG A 176 ? 1.0172 0.7867 0.8935 -0.0903 0.1458  0.0088  176 ARG A CG  
1317 C CD  . ARG A 176 ? 1.1409 0.9000 1.0347 -0.1086 0.1552  0.0104  176 ARG A CD  
1318 N NE  . ARG A 176 ? 1.2676 1.0321 1.1722 -0.1252 0.1906  0.0132  176 ARG A NE  
1319 C CZ  . ARG A 176 ? 1.2800 1.0988 1.2468 -0.1356 0.2037  0.0042  176 ARG A CZ  
1320 N NH1 . ARG A 176 ? 1.2157 1.0828 1.2325 -0.1305 0.1828  -0.0084 176 ARG A NH1 
1321 N NH2 . ARG A 176 ? 1.3181 1.1446 1.2973 -0.1511 0.2377  0.0083  176 ARG A NH2 
1322 N N   . SER A 177 ? 0.8612 0.5697 0.6408 -0.0501 0.0538  0.0216  177 SER A N   
1323 C CA  . SER A 177 ? 0.8771 0.5538 0.6192 -0.0423 0.0277  0.0310  177 SER A CA  
1324 C C   . SER A 177 ? 0.8973 0.5579 0.5976 -0.0388 0.0176  0.0332  177 SER A C   
1325 O O   . SER A 177 ? 0.9631 0.5796 0.6091 -0.0374 0.0062  0.0431  177 SER A O   
1326 C CB  . SER A 177 ? 0.9010 0.6092 0.6843 -0.0330 0.0028  0.0275  177 SER A CB  
1327 O OG  . SER A 177 ? 1.0027 0.7063 0.8065 -0.0349 0.0083  0.0269  177 SER A OG  
1328 N N   . VAL A 178 ? 0.8230 0.5152 0.5448 -0.0375 0.0205  0.0239  178 VAL A N   
1329 C CA  . VAL A 178 ? 0.8261 0.4976 0.5057 -0.0361 0.0128  0.0237  178 VAL A CA  
1330 C C   . VAL A 178 ? 0.8778 0.4984 0.4950 -0.0401 0.0354  0.0283  178 VAL A C   
1331 O O   . VAL A 178 ? 0.9281 0.5035 0.4843 -0.0401 0.0221  0.0348  178 VAL A O   
1332 C CB  . VAL A 178 ? 0.7507 0.4589 0.4626 -0.0334 0.0162  0.0131  178 VAL A CB  
1333 C CG1 . VAL A 178 ? 0.7657 0.4394 0.4248 -0.0332 0.0178  0.0114  178 VAL A CG1 
1334 C CG2 . VAL A 178 ? 0.7051 0.4532 0.4610 -0.0301 -0.0093 0.0107  178 VAL A CG2 
1335 N N   . GLN A 179 ? 0.8654 0.4947 0.4978 -0.0436 0.0696  0.0251  179 GLN A N   
1336 C CA  . GLN A 179 ? 0.9373 0.5222 0.5143 -0.0472 0.0981  0.0297  179 GLN A CA  
1337 C C   . GLN A 179 ? 1.0369 0.5694 0.5607 -0.0519 0.0937  0.0433  179 GLN A C   
1338 O O   . GLN A 179 ? 1.1540 0.6336 0.6056 -0.0524 0.1005  0.0493  179 GLN A O   
1339 C CB  . GLN A 179 ? 0.9529 0.5681 0.5710 -0.0513 0.1362  0.0251  179 GLN A CB  
1340 C CG  . GLN A 179 ? 0.9860 0.6457 0.6463 -0.0431 0.1431  0.0132  179 GLN A CG  
1341 C CD  . GLN A 179 ? 1.0001 0.7009 0.7129 -0.0462 0.1760  0.0091  179 GLN A CD  
1342 O OE1 . GLN A 179 ? 0.9861 0.6887 0.7141 -0.0581 0.1914  0.0140  179 GLN A OE1 
1343 N NE2 . GLN A 179 ? 0.9769 0.7109 0.7190 -0.0357 0.1861  0.0004  179 GLN A NE2 
1344 N N   . PHE A 180 ? 1.0160 0.5584 0.5702 -0.0542 0.0819  0.0483  180 PHE A N   
1345 C CA  . PHE A 180 ? 1.0692 0.5584 0.5729 -0.0562 0.0759  0.0628  180 PHE A CA  
1346 C C   . PHE A 180 ? 1.1068 0.5678 0.5649 -0.0474 0.0371  0.0692  180 PHE A C   
1347 O O   . PHE A 180 ? 1.1986 0.6019 0.5832 -0.0475 0.0341  0.0801  180 PHE A O   
1348 C CB  . PHE A 180 ? 1.0116 0.5141 0.5595 -0.0596 0.0746  0.0654  180 PHE A CB  
1349 C CG  . PHE A 180 ? 1.0863 0.5330 0.5850 -0.0573 0.0615  0.0811  180 PHE A CG  
1350 C CD1 . PHE A 180 ? 1.1241 0.5142 0.5650 -0.0664 0.0863  0.0932  180 PHE A CD1 
1351 C CD2 . PHE A 180 ? 1.0636 0.5138 0.5732 -0.0447 0.0254  0.0847  180 PHE A CD2 
1352 C CE1 . PHE A 180 ? 1.1528 0.4857 0.5428 -0.0627 0.0730  0.1094  180 PHE A CE1 
1353 C CE2 . PHE A 180 ? 1.0976 0.4955 0.5620 -0.0388 0.0115  0.1001  180 PHE A CE2 
1354 C CZ  . PHE A 180 ? 1.1492 0.4856 0.5512 -0.0477 0.0343  0.1128  180 PHE A CZ  
1355 N N   . LEU A 181 ? 1.0266 0.5294 0.5283 -0.0405 0.0074  0.0629  181 LEU A N   
1356 C CA  . LEU A 181 ? 1.0730 0.5636 0.5472 -0.0339 -0.0321 0.0679  181 LEU A CA  
1357 C C   . LEU A 181 ? 1.1737 0.6241 0.5780 -0.0371 -0.0351 0.0672  181 LEU A C   
1358 O O   . LEU A 181 ? 1.2241 0.6289 0.5661 -0.0355 -0.0565 0.0770  181 LEU A O   
1359 C CB  . LEU A 181 ? 0.9618 0.5130 0.5032 -0.0291 -0.0555 0.0596  181 LEU A CB  
1360 C CG  . LEU A 181 ? 0.9428 0.4986 0.4737 -0.0255 -0.0959 0.0626  181 LEU A CG  
1361 C CD1 . LEU A 181 ? 0.9892 0.5196 0.4967 -0.0169 -0.1215 0.0769  181 LEU A CD1 
1362 C CD2 . LEU A 181 ? 0.8244 0.4438 0.4263 -0.0238 -0.1087 0.0540  181 LEU A CD2 
1363 N N   . CYS A 182 ? 1.1587 0.6230 0.5702 -0.0406 -0.0149 0.0555  182 CYS A N   
1364 C CA  . CYS A 182 ? 1.2468 0.6720 0.5932 -0.0428 -0.0183 0.0515  182 CYS A CA  
1365 C C   . CYS A 182 ? 1.3694 0.7293 0.6334 -0.0449 0.0070  0.0581  182 CYS A C   
1366 O O   . CYS A 182 ? 1.4862 0.8025 0.6856 -0.0455 -0.0051 0.0567  182 CYS A O   
1367 C CB  . CYS A 182 ? 1.1222 0.5780 0.5006 -0.0426 -0.0028 0.0370  182 CYS A CB  
1368 S SG  . CYS A 182 ? 1.1484 0.6708 0.6073 -0.0418 -0.0324 0.0302  182 CYS A SG  
1369 N N   . THR A 183 ? 1.3375 0.6975 0.6151 -0.0470 0.0423  0.0626  183 THR A N   
1370 C CA  . THR A 183 ? 1.4348 0.7417 0.6465 -0.0500 0.0741  0.0682  183 THR A CA  
1371 C C   . THR A 183 ? 1.4198 0.6922 0.6001 -0.0498 0.0597  0.0801  183 THR A C   
1372 O O   . THR A 183 ? 1.4379 0.6680 0.5603 -0.0484 0.0569  0.0800  183 THR A O   
1373 C CB  . THR A 183 ? 1.4856 0.8159 0.7349 -0.0549 0.1240  0.0664  183 THR A CB  
1374 O OG1 . THR A 183 ? 1.5002 0.8730 0.7927 -0.0504 0.1361  0.0512  183 THR A OG1 
1375 C CG2 . THR A 183 ? 1.5480 0.8399 0.7519 -0.0573 0.1569  0.0688  183 THR A CG2 
1376 N N   . LYS A 184 ? 1.3954 0.6826 0.6122 -0.0502 0.0505  0.0901  184 LYS A N   
1377 C CA  . LYS A 184 ? 1.4094 0.6634 0.6003 -0.0487 0.0433  0.1019  184 LYS A CA  
1378 C C   . LYS A 184 ? 1.3714 0.6249 0.5619 -0.0384 -0.0063 0.1085  184 LYS A C   
1379 O O   . LYS A 184 ? 1.4326 0.6544 0.5926 -0.0340 -0.0168 0.1181  184 LYS A O   
1380 C CB  . LYS A 184 ? 1.3792 0.6425 0.6097 -0.0562 0.0717  0.1083  184 LYS A CB  
1381 C CG  . LYS A 184 ? 1.3758 0.6516 0.6228 -0.0678 0.1216  0.1027  184 LYS A CG  
1382 C CD  . LYS A 184 ? 1.5034 0.7383 0.6933 -0.0707 0.1473  0.1044  184 LYS A CD  
1383 C CE  . LYS A 184 ? 1.5468 0.8032 0.7661 -0.0816 0.1980  0.1000  184 LYS A CE  
1384 N NZ  . LYS A 184 ? 1.6434 0.8598 0.8134 -0.0857 0.2256  0.1046  184 LYS A NZ  
1385 N N   . VAL A 185 ? 1.3153 0.6061 0.5420 -0.0339 -0.0362 0.1040  185 VAL A N   
1386 C CA  . VAL A 185 ? 1.3580 0.6619 0.6007 -0.0232 -0.0819 0.1101  185 VAL A CA  
1387 C C   . VAL A 185 ? 1.4073 0.7164 0.6315 -0.0226 -0.1163 0.1037  185 VAL A C   
1388 O O   . VAL A 185 ? 1.4091 0.6995 0.6060 -0.0173 -0.1430 0.1091  185 VAL A O   
1389 C CB  . VAL A 185 ? 1.2832 0.6350 0.5982 -0.0176 -0.0936 0.1111  185 VAL A CB  
1390 C CG1 . VAL A 185 ? 1.2796 0.6517 0.6166 -0.0040 -0.1392 0.1172  185 VAL A CG1 
1391 C CG2 . VAL A 185 ? 1.2553 0.6077 0.6023 -0.0198 -0.0625 0.1130  185 VAL A CG2 
1392 N N   . LEU A 186 ? 1.4314 0.7653 0.6720 -0.0289 -0.1157 0.0923  186 LEU A N   
1393 C CA  . LEU A 186 ? 1.4059 0.7461 0.6365 -0.0323 -0.1470 0.0846  186 LEU A CA  
1394 C C   . LEU A 186 ? 1.4656 0.7515 0.6237 -0.0369 -0.1400 0.0803  186 LEU A C   
1395 O O   . LEU A 186 ? 1.4776 0.7309 0.5992 -0.0394 -0.1021 0.0774  186 LEU A O   
1396 C CB  . LEU A 186 ? 1.3178 0.6944 0.5841 -0.0387 -0.1454 0.0732  186 LEU A CB  
1397 C CG  . LEU A 186 ? 1.2469 0.6832 0.5883 -0.0347 -0.1603 0.0753  186 LEU A CG  
1398 C CD1 . LEU A 186 ? 1.1359 0.6106 0.5175 -0.0421 -0.1552 0.0605  186 LEU A CD1 
1399 C CD2 . LEU A 186 ? 1.2548 0.7172 0.6260 -0.0280 -0.2023 0.0827  186 LEU A CD2 
1400 N N   . GLU A 187 ? 1.5023 0.7804 0.6425 -0.0379 -0.1761 0.0802  187 GLU A N   
1401 C CA  . GLU A 187 ? 1.6238 0.8505 0.6958 -0.0436 -0.1754 0.0743  187 GLU A CA  
1402 C C   . GLU A 187 ? 1.5515 0.7782 0.6214 -0.0520 -0.1614 0.0596  187 GLU A C   
1403 O O   . GLU A 187 ? 1.4778 0.7499 0.6019 -0.0548 -0.1661 0.0549  187 GLU A O   
1404 C CB  . GLU A 187 ? 1.7491 0.9720 0.8086 -0.0438 -0.2209 0.0785  187 GLU A CB  
1405 C CG  . GLU A 187 ? 1.9272 1.1057 0.9330 -0.0365 -0.2263 0.0895  187 GLU A CG  
1406 C CD  . GLU A 187 ? 2.0743 1.2415 1.0552 -0.0385 -0.2690 0.0913  187 GLU A CD  
1407 O OE1 . GLU A 187 ? 2.0887 1.2869 1.1005 -0.0469 -0.2939 0.0843  187 GLU A OE1 
1408 O OE2 . GLU A 187 ? 2.1536 1.2809 1.0837 -0.0326 -0.2774 0.1000  187 GLU A OE2 
1409 N N   . PRO A 188 ? 1.5861 0.7599 0.5921 -0.0550 -0.1431 0.0526  188 PRO A N   
1410 C CA  . PRO A 188 ? 1.5524 0.7187 0.5514 -0.0609 -0.1321 0.0389  188 PRO A CA  
1411 C C   . PRO A 188 ? 1.5756 0.7634 0.5981 -0.0703 -0.1737 0.0348  188 PRO A C   
1412 O O   . PRO A 188 ? 1.5921 0.7816 0.6112 -0.0727 -0.2099 0.0411  188 PRO A O   
1413 C CB  . PRO A 188 ? 1.6424 0.7413 0.5621 -0.0600 -0.1106 0.0349  188 PRO A CB  
1414 C CG  . PRO A 188 ? 1.6463 0.7257 0.5417 -0.0534 -0.0929 0.0460  188 PRO A CG  
1415 C CD  . PRO A 188 ? 1.6162 0.7326 0.5535 -0.0516 -0.1274 0.0574  188 PRO A CD  
1416 N N   . LEU A 189 ? 1.5481 0.7534 0.5961 -0.0755 -0.1679 0.0252  189 LEU A N   
1417 C CA  . LEU A 189 ? 1.5509 0.7731 0.6199 -0.0875 -0.2029 0.0212  189 LEU A CA  
1418 C C   . LEU A 189 ? 1.6631 0.8274 0.6642 -0.0946 -0.2176 0.0175  189 LEU A C   
1419 O O   . LEU A 189 ? 1.6895 0.7979 0.6272 -0.0896 -0.1916 0.0139  189 LEU A O   
1420 C CB  . LEU A 189 ? 1.4915 0.7365 0.5950 -0.0913 -0.1889 0.0121  189 LEU A CB  
1421 C CG  . LEU A 189 ? 1.4175 0.7297 0.5978 -0.0889 -0.1893 0.0152  189 LEU A CG  
1422 C CD1 . LEU A 189 ? 1.4018 0.7264 0.6040 -0.0913 -0.1723 0.0055  189 LEU A CD1 
1423 C CD2 . LEU A 189 ? 1.3855 0.7458 0.6171 -0.0954 -0.2308 0.0228  189 LEU A CD2 
1424 N N   . PRO A 190 ? 1.7141 0.8927 0.7289 -0.1065 -0.2588 0.0188  190 PRO A N   
1425 C CA  . PRO A 190 ? 1.7768 0.9013 0.7275 -0.1157 -0.2775 0.0150  190 PRO A CA  
1426 C C   . PRO A 190 ? 1.7844 0.8597 0.6900 -0.1191 -0.2531 0.0032  190 PRO A C   
1427 O O   . PRO A 190 ? 1.7024 0.7952 0.6375 -0.1157 -0.2273 -0.0018 190 PRO A O   
1428 C CB  . PRO A 190 ? 1.7798 0.9489 0.7778 -0.1296 -0.3231 0.0181  190 PRO A CB  
1429 C CG  . PRO A 190 ? 1.7005 0.9397 0.7742 -0.1218 -0.3309 0.0275  190 PRO A CG  
1430 C CD  . PRO A 190 ? 1.6411 0.8898 0.7333 -0.1113 -0.2903 0.0251  190 PRO A CD  
1431 N N   . ALA A 191 ? 1.8941 0.9072 0.7272 -0.1245 -0.2618 -0.0009 191 ALA A N   
1432 C CA  . ALA A 191 ? 1.9865 0.9434 0.7667 -0.1248 -0.2374 -0.0114 191 ALA A CA  
1433 C C   . ALA A 191 ? 1.9810 0.9573 0.7958 -0.1374 -0.2484 -0.0173 191 ALA A C   
1434 O O   . ALA A 191 ? 2.0126 0.9619 0.8089 -0.1332 -0.2210 -0.0250 191 ALA A O   
1435 C CB  . ALA A 191 ? 2.1055 0.9893 0.7967 -0.1282 -0.2480 -0.0140 191 ALA A CB  
1436 N N   . GLU A 192 ? 1.9699 0.9938 0.8358 -0.1521 -0.2874 -0.0131 192 GLU A N   
1437 C CA  . GLU A 192 ? 1.9984 1.0436 0.9000 -0.1669 -0.2995 -0.0172 192 GLU A CA  
1438 C C   . GLU A 192 ? 1.8978 1.0277 0.8944 -0.1698 -0.3101 -0.0111 192 GLU A C   
1439 O O   . GLU A 192 ? 1.8890 1.0640 0.9249 -0.1711 -0.3353 -0.0029 192 GLU A O   
1440 C CB  . GLU A 192 ? 2.1116 1.1289 0.9800 -0.1870 -0.3375 -0.0194 192 GLU A CB  
1441 C CG  . GLU A 192 ? 2.3000 1.2283 1.0697 -0.1859 -0.3285 -0.0268 192 GLU A CG  
1442 C CD  . GLU A 192 ? 2.4765 1.3771 1.2126 -0.2077 -0.3688 -0.0297 192 GLU A CD  
1443 O OE1 . GLU A 192 ? 2.4847 1.4394 1.2745 -0.2220 -0.4058 -0.0243 192 GLU A OE1 
1444 O OE2 . GLU A 192 ? 2.6024 1.4285 1.2595 -0.2103 -0.3632 -0.0376 192 GLU A OE2 
1445 N N   . PHE A 193 ? 1.7736 0.9242 0.8056 -0.1692 -0.2902 -0.0148 193 PHE A N   
1446 C CA  . PHE A 193 ? 1.6382 0.8659 0.7573 -0.1723 -0.2977 -0.0098 193 PHE A CA  
1447 C C   . PHE A 193 ? 1.5743 0.8090 0.7163 -0.1773 -0.2824 -0.0152 193 PHE A C   
1448 O O   . PHE A 193 ? 1.5885 0.7710 0.6821 -0.1718 -0.2583 -0.0227 193 PHE A O   
1449 C CB  . PHE A 193 ? 1.5497 0.8141 0.7018 -0.1542 -0.2803 -0.0043 193 PHE A CB  
1450 C CG  . PHE A 193 ? 1.5421 0.7750 0.6627 -0.1371 -0.2371 -0.0097 193 PHE A CG  
1451 C CD1 . PHE A 193 ? 1.5180 0.7701 0.6693 -0.1322 -0.2133 -0.0144 193 PHE A CD1 
1452 C CD2 . PHE A 193 ? 1.5784 0.7651 0.6408 -0.1254 -0.2194 -0.0097 193 PHE A CD2 
1453 C CE1 . PHE A 193 ? 1.5357 0.7653 0.6636 -0.1151 -0.1731 -0.0193 193 PHE A CE1 
1454 C CE2 . PHE A 193 ? 1.5928 0.7573 0.6330 -0.1097 -0.1769 -0.0141 193 PHE A CE2 
1455 C CZ  . PHE A 193 ? 1.5746 0.7630 0.6497 -0.1041 -0.1540 -0.0190 193 PHE A CZ  
1456 N N   . THR A 194 ? 1.4905 0.7899 0.7064 -0.1864 -0.2958 -0.0110 194 THR A N   
1457 C CA  . THR A 194 ? 1.4365 0.7506 0.6822 -0.1903 -0.2812 -0.0144 194 THR A CA  
1458 C C   . THR A 194 ? 1.3386 0.7124 0.6475 -0.1779 -0.2661 -0.0110 194 THR A C   
1459 O O   . THR A 194 ? 1.2377 0.6705 0.6034 -0.1798 -0.2833 -0.0035 194 THR A O   
1460 C CB  . THR A 194 ? 1.4234 0.7596 0.7004 -0.2151 -0.3083 -0.0126 194 THR A CB  
1461 O OG1 . THR A 194 ? 1.5159 0.7918 0.7297 -0.2280 -0.3228 -0.0171 194 THR A OG1 
1462 C CG2 . THR A 194 ? 1.3982 0.7481 0.7049 -0.2187 -0.2920 -0.0149 194 THR A CG2 
1463 N N   . ALA A 195 ? 1.3529 0.7119 0.6519 -0.1639 -0.2339 -0.0167 195 ALA A N   
1464 C CA  . ALA A 195 ? 1.3085 0.7203 0.6630 -0.1530 -0.2196 -0.0150 195 ALA A CA  
1465 C C   . ALA A 195 ? 1.2500 0.6887 0.6466 -0.1622 -0.2186 -0.0160 195 ALA A C   
1466 O O   . ALA A 195 ? 1.2590 0.6568 0.6240 -0.1660 -0.2097 -0.0214 195 ALA A O   
1467 C CB  . ALA A 195 ? 1.3050 0.6911 0.6283 -0.1310 -0.1844 -0.0204 195 ALA A CB  
1468 N N   . ASN A 196 ? 1.2176 0.7228 0.6834 -0.1647 -0.2266 -0.0103 196 ASN A N   
1469 C CA  . ASN A 196 ? 1.1901 0.7272 0.7016 -0.1764 -0.2285 -0.0088 196 ASN A CA  
1470 C C   . ASN A 196 ? 1.0976 0.6886 0.6647 -0.1661 -0.2167 -0.0072 196 ASN A C   
1471 O O   . ASN A 196 ? 1.0878 0.7117 0.6782 -0.1552 -0.2182 -0.0037 196 ASN A O   
1472 C CB  . ASN A 196 ? 1.2242 0.7951 0.7718 -0.1983 -0.2577 -0.0012 196 ASN A CB  
1473 C CG  . ASN A 196 ? 1.3150 0.8795 0.8709 -0.2170 -0.2591 -0.0013 196 ASN A CG  
1474 O OD1 . ASN A 196 ? 1.3408 0.9511 0.9467 -0.2342 -0.2751 0.0054  196 ASN A OD1 
1475 N ND2 . ASN A 196 ? 1.3929 0.9000 0.8997 -0.2127 -0.2405 -0.0086 196 ASN A ND2 
1476 N N   . PHE A 197 ? 1.0696 0.6649 0.6537 -0.1692 -0.2052 -0.0093 197 PHE A N   
1477 C CA  . PHE A 197 ? 0.9991 0.6568 0.6496 -0.1585 -0.1914 -0.0039 197 PHE A CA  
1478 C C   . PHE A 197 ? 0.9849 0.6880 0.6873 -0.1798 -0.2082 0.0039  197 PHE A C   
1479 O O   . PHE A 197 ? 1.0518 0.7281 0.7390 -0.1985 -0.2128 0.0032  197 PHE A O   
1480 C CB  . PHE A 197 ? 0.9760 0.6175 0.6196 -0.1392 -0.1592 -0.0079 197 PHE A CB  
1481 C CG  . PHE A 197 ? 1.0019 0.6339 0.6293 -0.1140 -0.1361 -0.0124 197 PHE A CG  
1482 C CD1 . PHE A 197 ? 0.9468 0.6313 0.6209 -0.1002 -0.1279 -0.0084 197 PHE A CD1 
1483 C CD2 . PHE A 197 ? 1.0891 0.6587 0.6547 -0.1048 -0.1210 -0.0210 197 PHE A CD2 
1484 C CE1 . PHE A 197 ? 0.9406 0.6175 0.6030 -0.0811 -0.1061 -0.0119 197 PHE A CE1 
1485 C CE2 . PHE A 197 ? 1.0786 0.6451 0.6348 -0.0833 -0.0968 -0.0241 197 PHE A CE2 
1486 C CZ  . PHE A 197 ? 1.0020 0.6232 0.6082 -0.0732 -0.0899 -0.0192 197 PHE A CZ  
1487 N N   . ARG A 198 ? 0.8968 0.6668 0.6599 -0.1769 -0.2159 0.0116  198 ARG A N   
1488 C CA  . ARG A 198 ? 0.8517 0.6743 0.6713 -0.1957 -0.2291 0.0200  198 ARG A CA  
1489 C C   . ARG A 198 ? 0.8291 0.7166 0.7118 -0.1778 -0.2101 0.0257  198 ARG A C   
1490 O O   . ARG A 198 ? 0.8168 0.7231 0.7119 -0.1560 -0.2022 0.0249  198 ARG A O   
1491 C CB  . ARG A 198 ? 0.8047 0.6515 0.6427 -0.2033 -0.2520 0.0254  198 ARG A CB  
1492 C CG  . ARG A 198 ? 0.8313 0.6163 0.6064 -0.2121 -0.2648 0.0206  198 ARG A CG  
1493 C CD  . ARG A 198 ? 0.8403 0.6520 0.6353 -0.2188 -0.2898 0.0259  198 ARG A CD  
1494 N NE  . ARG A 198 ? 0.9215 0.6714 0.6503 -0.2241 -0.3023 0.0210  198 ARG A NE  
1495 C CZ  . ARG A 198 ? 0.9895 0.7461 0.7187 -0.2322 -0.3271 0.0239  198 ARG A CZ  
1496 N NH1 . ARG A 198 ? 0.9539 0.7789 0.7494 -0.2347 -0.3413 0.0312  198 ARG A NH1 
1497 N NH2 . ARG A 198 ? 1.1031 0.7981 0.7658 -0.2368 -0.3371 0.0191  198 ARG A NH2 
1498 N N   . LEU A 199 ? 0.8185 0.7356 0.7367 -0.1879 -0.2021 0.0313  199 LEU A N   
1499 C CA  . LEU A 199 ? 0.7516 0.7225 0.7195 -0.1704 -0.1819 0.0354  199 LEU A CA  
1500 C C   . LEU A 199 ? 0.7354 0.7672 0.7631 -0.1853 -0.1868 0.0450  199 LEU A C   
1501 O O   . LEU A 199 ? 0.7410 0.7737 0.7749 -0.2130 -0.2040 0.0495  199 LEU A O   
1502 C CB  . LEU A 199 ? 0.7275 0.6722 0.6732 -0.1577 -0.1560 0.0324  199 LEU A CB  
1503 C CG  . LEU A 199 ? 0.7455 0.6520 0.6642 -0.1743 -0.1513 0.0347  199 LEU A CG  
1504 C CD1 . LEU A 199 ? 0.7125 0.6627 0.6745 -0.1873 -0.1453 0.0449  199 LEU A CD1 
1505 C CD2 . LEU A 199 ? 0.7467 0.6121 0.6279 -0.1535 -0.1310 0.0292  199 LEU A CD2 
1506 N N   . LYS A 200 ? 0.6907 0.7732 0.7623 -0.1673 -0.1709 0.0477  200 LYS A N   
1507 C CA  . LYS A 200 ? 0.6731 0.8182 0.8038 -0.1762 -0.1687 0.0567  200 LYS A CA  
1508 C C   . LYS A 200 ? 0.6396 0.7988 0.7796 -0.1652 -0.1399 0.0584  200 LYS A C   
1509 O O   . LYS A 200 ? 0.5900 0.7472 0.7222 -0.1401 -0.1252 0.0526  200 LYS A O   
1510 C CB  . LYS A 200 ? 0.6755 0.8728 0.8524 -0.1623 -0.1791 0.0586  200 LYS A CB  
1511 C CG  . LYS A 200 ? 0.6923 0.9586 0.9340 -0.1643 -0.1713 0.0666  200 LYS A CG  
1512 C CD  . LYS A 200 ? 0.7266 1.0303 1.0026 -0.1400 -0.1761 0.0650  200 LYS A CD  
1513 C CE  . LYS A 200 ? 0.7640 1.1315 1.1003 -0.1359 -0.1629 0.0698  200 LYS A CE  
1514 N NZ  . LYS A 200 ? 0.7801 1.1793 1.1468 -0.1089 -0.1666 0.0673  200 LYS A NZ  
1515 N N   . TYR A 201 ? 0.6793 0.8499 0.8326 -0.1857 -0.1327 0.0668  201 TYR A N   
1516 C CA  . TYR A 201 ? 0.6541 0.8357 0.8107 -0.1770 -0.1062 0.0704  201 TYR A CA  
1517 C C   . TYR A 201 ? 0.6052 0.8543 0.8159 -0.1625 -0.0941 0.0731  201 TYR A C   
1518 O O   . TYR A 201 ? 0.5895 0.8831 0.8448 -0.1661 -0.1062 0.0760  201 TYR A O   
1519 C CB  . TYR A 201 ? 0.6711 0.8354 0.8177 -0.2054 -0.1008 0.0801  201 TYR A CB  
1520 C CG  . TYR A 201 ? 0.7178 0.8066 0.8044 -0.2172 -0.1090 0.0771  201 TYR A CG  
1521 C CD1 . TYR A 201 ? 0.7611 0.8226 0.8338 -0.2413 -0.1330 0.0753  201 TYR A CD1 
1522 C CD2 . TYR A 201 ? 0.7509 0.7940 0.7929 -0.2033 -0.0933 0.0757  201 TYR A CD2 
1523 C CE1 . TYR A 201 ? 0.8184 0.8046 0.8308 -0.2506 -0.1386 0.0711  201 TYR A CE1 
1524 C CE2 . TYR A 201 ? 0.8136 0.7858 0.8007 -0.2103 -0.0988 0.0728  201 TYR A CE2 
1525 C CZ  . TYR A 201 ? 0.8645 0.8062 0.8352 -0.2338 -0.1201 0.0700  201 TYR A CZ  
1526 O OH  . TYR A 201 ? 0.9378 0.8028 0.8486 -0.2390 -0.1238 0.0656  201 TYR A OH  
1527 N N   . THR A 202 ? 0.6158 0.8711 0.8207 -0.1443 -0.0711 0.0718  202 THR A N   
1528 C CA  . THR A 202 ? 0.6235 0.9359 0.8715 -0.1299 -0.0551 0.0735  202 THR A CA  
1529 C C   . THR A 202 ? 0.7066 1.0551 0.9861 -0.1516 -0.0423 0.0866  202 THR A C   
1530 O O   . THR A 202 ? 0.7197 1.0420 0.9814 -0.1778 -0.0448 0.0942  202 THR A O   
1531 C CB  . THR A 202 ? 0.5619 0.8636 0.7856 -0.1035 -0.0363 0.0659  202 THR A CB  
1532 O OG1 . THR A 202 ? 0.5357 0.8032 0.7205 -0.1104 -0.0249 0.0702  202 THR A OG1 
1533 C CG2 . THR A 202 ? 0.5402 0.8130 0.7408 -0.0844 -0.0469 0.0534  202 THR A CG2 
1534 N N   . ASN A 203 ? 0.7832 1.1899 1.1087 -0.1408 -0.0270 0.0894  203 ASN A N   
1535 C CA  . ASN A 203 ? 0.8626 1.3119 1.2239 -0.1600 -0.0093 0.1025  203 ASN A CA  
1536 C C   . ASN A 203 ? 0.9342 1.3526 1.2529 -0.1643 0.0147  0.1079  203 ASN A C   
1537 O O   . ASN A 203 ? 0.9346 1.3611 1.2616 -0.1902 0.0264  0.1210  203 ASN A O   
1538 C CB  . ASN A 203 ? 0.8607 1.3802 1.2804 -0.1415 0.0051  0.1031  203 ASN A CB  
1539 C CG  . ASN A 203 ? 0.9002 1.4330 1.3485 -0.1276 -0.0185 0.0945  203 ASN A CG  
1540 O OD1 . ASN A 203 ? 0.9345 1.4434 1.3741 -0.1418 -0.0458 0.0933  203 ASN A OD1 
1541 N ND2 . ASN A 203 ? 0.9065 1.4712 1.3825 -0.0987 -0.0075 0.0879  203 ASN A ND2 
1542 N N   . ASP A 204 ? 0.9992 1.3815 1.2719 -0.1395 0.0211  0.0985  204 ASP A N   
1543 C CA  . ASP A 204 ? 1.0426 1.3928 1.2688 -0.1378 0.0405  0.1030  204 ASP A CA  
1544 C C   . ASP A 204 ? 1.0345 1.3269 1.2186 -0.1600 0.0309  0.1100  204 ASP A C   
1545 O O   . ASP A 204 ? 1.0686 1.3364 1.2209 -0.1682 0.0463  0.1200  204 ASP A O   
1546 C CB  . ASP A 204 ? 1.0886 1.4182 1.2798 -0.1055 0.0440  0.0898  204 ASP A CB  
1547 C CG  . ASP A 204 ? 1.0954 1.4583 1.3186 -0.0828 0.0397  0.0773  204 ASP A CG  
1548 O OD1 . ASP A 204 ? 1.0947 1.5043 1.3695 -0.0870 0.0392  0.0804  204 ASP A OD1 
1549 O OD2 . ASP A 204 ? 1.0941 1.4362 1.2919 -0.0608 0.0363  0.0647  204 ASP A OD2 
1550 N N   . ALA A 205 ? 0.9812 1.2475 1.1606 -0.1682 0.0060  0.1047  205 ALA A N   
1551 C CA  . ALA A 205 ? 0.9869 1.1906 1.1216 -0.1856 -0.0043 0.1083  205 ALA A CA  
1552 C C   . ALA A 205 ? 1.0124 1.2130 1.1526 -0.2208 0.0031  0.1242  205 ALA A C   
1553 O O   . ALA A 205 ? 1.0283 1.2727 1.2179 -0.2433 -0.0012 0.1296  205 ALA A O   
1554 C CB  . ALA A 205 ? 0.9882 1.1688 1.1186 -0.1888 -0.0309 0.0989  205 ALA A CB  
1555 N N   . PRO A 206 ? 1.0269 1.1754 1.1171 -0.2261 0.0139  0.1324  206 PRO A N   
1556 C CA  . PRO A 206 ? 1.0522 1.1829 1.1371 -0.2621 0.0218  0.1485  206 PRO A CA  
1557 C C   . PRO A 206 ? 1.0694 1.1696 1.1536 -0.2921 -0.0026 0.1470  206 PRO A C   
1558 O O   . PRO A 206 ? 1.0163 1.0893 1.0833 -0.2805 -0.0234 0.1340  206 PRO A O   
1559 C CB  . PRO A 206 ? 1.0825 1.1500 1.1009 -0.2515 0.0347  0.1553  206 PRO A CB  
1560 C CG  . PRO A 206 ? 1.0583 1.1351 1.0626 -0.2100 0.0381  0.1442  206 PRO A CG  
1561 C CD  . PRO A 206 ? 1.0194 1.1240 1.0562 -0.1975 0.0191  0.1279  206 PRO A CD  
1562 N N   . SER A 207 ? 1.1345 1.2370 1.2348 -0.3317 0.0003  0.1600  207 SER A N   
1563 C CA  . SER A 207 ? 1.1783 1.2511 1.2771 -0.3651 -0.0249 0.1581  207 SER A CA  
1564 C C   . SER A 207 ? 1.2144 1.1869 1.2352 -0.3661 -0.0326 0.1554  207 SER A C   
1565 O O   . SER A 207 ? 1.2033 1.1360 1.2041 -0.3773 -0.0567 0.1459  207 SER A O   
1566 C CB  . SER A 207 ? 1.2445 1.3488 1.3839 -0.3939 -0.0184 0.1656  207 SER A CB  
1567 O OG  . SER A 207 ? 1.2329 1.4263 1.4466 -0.3872 -0.0165 0.1632  207 SER A OG  
1568 N N   . ASN A 208 ? 1.2739 1.2038 1.2480 -0.3518 -0.0124 0.1634  208 ASN A N   
1569 C CA  . ASN A 208 ? 1.3410 1.1748 1.2412 -0.3477 -0.0172 0.1624  208 ASN A CA  
1570 C C   . ASN A 208 ? 1.2659 1.0754 1.1361 -0.3051 -0.0262 0.1464  208 ASN A C   
1571 O O   . ASN A 208 ? 1.3246 1.0596 1.1404 -0.2981 -0.0340 0.1415  208 ASN A O   
1572 C CB  . ASN A 208 ? 1.4333 1.2275 1.2931 -0.3493 0.0065  0.1799  208 ASN A CB  
1573 C CG  . ASN A 208 ? 1.4444 1.2688 1.3008 -0.3099 0.0244  0.1813  208 ASN A CG  
1574 O OD1 . ASN A 208 ? 1.4171 1.3157 1.3222 -0.2963 0.0289  0.1758  208 ASN A OD1 
1575 N ND2 . ASN A 208 ? 1.4888 1.2528 1.2849 -0.2905 0.0331  0.1883  208 ASN A ND2 
1576 N N   . PHE A 209 ? 1.1393 1.0106 1.0453 -0.2769 -0.0238 0.1383  209 PHE A N   
1577 C CA  . PHE A 209 ? 1.0558 0.9139 0.9430 -0.2403 -0.0316 0.1233  209 PHE A CA  
1578 C C   . PHE A 209 ? 1.0086 0.8606 0.9028 -0.2480 -0.0542 0.1101  209 PHE A C   
1579 O O   . PHE A 209 ? 0.9335 0.8389 0.8756 -0.2614 -0.0638 0.1079  209 PHE A O   
1580 C CB  . PHE A 209 ? 0.9823 0.9027 0.9015 -0.2103 -0.0215 0.1189  209 PHE A CB  
1581 C CG  . PHE A 209 ? 0.9470 0.8624 0.8566 -0.1776 -0.0297 0.1035  209 PHE A CG  
1582 C CD1 . PHE A 209 ? 0.9599 0.8366 0.8289 -0.1508 -0.0250 0.1017  209 PHE A CD1 
1583 C CD2 . PHE A 209 ? 0.8497 0.7998 0.7919 -0.1740 -0.0421 0.0920  209 PHE A CD2 
1584 C CE1 . PHE A 209 ? 0.8978 0.7756 0.7645 -0.1232 -0.0309 0.0881  209 PHE A CE1 
1585 C CE2 . PHE A 209 ? 0.7979 0.7419 0.7309 -0.1469 -0.0470 0.0792  209 PHE A CE2 
1586 C CZ  . PHE A 209 ? 0.8251 0.7355 0.7231 -0.1227 -0.0405 0.0770  209 PHE A CZ  
1587 N N   . ARG A 210 ? 1.0507 0.8368 0.8953 -0.2375 -0.0622 0.1018  210 ARG A N   
1588 C CA  . ARG A 210 ? 1.0407 0.8115 0.8793 -0.2420 -0.0819 0.0887  210 ARG A CA  
1589 C C   . ARG A 210 ? 0.9599 0.7007 0.7663 -0.2059 -0.0799 0.0767  210 ARG A C   
1590 O O   . ARG A 210 ? 0.9921 0.6890 0.7608 -0.1867 -0.0691 0.0783  210 ARG A O   
1591 C CB  . ARG A 210 ? 1.1894 0.8992 0.9941 -0.2773 -0.0955 0.0899  210 ARG A CB  
1592 C CG  . ARG A 210 ? 1.2614 0.9527 1.0536 -0.2852 -0.1183 0.0763  210 ARG A CG  
1593 C CD  . ARG A 210 ? 1.4068 1.0291 1.1568 -0.3204 -0.1329 0.0755  210 ARG A CD  
1594 N NE  . ARG A 210 ? 1.5098 1.0484 1.1949 -0.3074 -0.1208 0.0749  210 ARG A NE  
1595 C CZ  . ARG A 210 ? 1.5634 1.0416 1.1952 -0.2839 -0.1212 0.0624  210 ARG A CZ  
1596 N NH1 . ARG A 210 ? 1.5357 1.0239 1.1671 -0.2738 -0.1322 0.0498  210 ARG A NH1 
1597 N NH2 . ARG A 210 ? 1.6249 1.0346 1.2043 -0.2683 -0.1089 0.0626  210 ARG A NH2 
1598 N N   . ILE A 211 ? 0.8489 0.6148 0.6718 -0.1960 -0.0896 0.0656  211 ILE A N   
1599 C CA  . ILE A 211 ? 0.8559 0.5994 0.6540 -0.1645 -0.0855 0.0545  211 ILE A CA  
1600 C C   . ILE A 211 ? 0.9836 0.6467 0.7224 -0.1691 -0.0914 0.0478  211 ILE A C   
1601 O O   . ILE A 211 ? 1.0055 0.6444 0.7300 -0.1956 -0.1077 0.0448  211 ILE A O   
1602 C CB  . ILE A 211 ? 0.8033 0.5970 0.6358 -0.1533 -0.0913 0.0464  211 ILE A CB  
1603 C CG1 . ILE A 211 ? 0.7187 0.5834 0.6035 -0.1452 -0.0830 0.0517  211 ILE A CG1 
1604 C CG2 . ILE A 211 ? 0.7773 0.5473 0.5850 -0.1249 -0.0849 0.0356  211 ILE A CG2 
1605 C CD1 . ILE A 211 ? 0.6848 0.5984 0.6064 -0.1378 -0.0895 0.0458  211 ILE A CD1 
1606 N N   . ASP A 212 ? 1.0244 0.6455 0.7279 -0.1426 -0.0788 0.0452  212 ASP A N   
1607 C CA  . ASP A 212 ? 1.1286 0.6671 0.7709 -0.1413 -0.0797 0.0385  212 ASP A CA  
1608 C C   . ASP A 212 ? 1.1333 0.6583 0.7591 -0.1414 -0.0888 0.0251  212 ASP A C   
1609 O O   . ASP A 212 ? 1.0742 0.6353 0.7205 -0.1198 -0.0833 0.0190  212 ASP A O   
1610 C CB  . ASP A 212 ? 1.2378 0.7451 0.8546 -0.1056 -0.0629 0.0387  212 ASP A CB  
1611 C CG  . ASP A 212 ? 1.4691 0.8820 1.0192 -0.1051 -0.0610 0.0358  212 ASP A CG  
1612 O OD1 . ASP A 212 ? 1.5509 0.9201 1.0746 -0.1381 -0.0719 0.0381  212 ASP A OD1 
1613 O OD2 . ASP A 212 ? 1.5474 0.9294 1.0724 -0.0717 -0.0487 0.0309  212 ASP A OD2 
1614 N N   . GLY A 213 ? 1.1734 0.6435 0.7589 -0.1673 -0.1031 0.0206  213 GLY A N   
1615 C CA  . GLY A 213 ? 1.1952 0.6408 0.7517 -0.1692 -0.1133 0.0080  213 GLY A CA  
1616 C C   . GLY A 213 ? 1.1897 0.6761 0.7761 -0.1995 -0.1373 0.0091  213 GLY A C   
1617 O O   . GLY A 213 ? 1.2476 0.7068 0.8030 -0.2089 -0.1523 0.0002  213 GLY A O   
1618 N N   . PHE A 214 ? 1.1620 0.7140 0.8078 -0.2131 -0.1409 0.0204  214 PHE A N   
1619 C CA  . PHE A 214 ? 1.1296 0.7336 0.8168 -0.2379 -0.1629 0.0233  214 PHE A CA  
1620 C C   . PHE A 214 ? 1.1778 0.7854 0.8813 -0.2759 -0.1749 0.0325  214 PHE A C   
1621 O O   . PHE A 214 ? 1.1711 0.8136 0.9111 -0.2805 -0.1630 0.0438  214 PHE A O   
1622 C CB  . PHE A 214 ? 0.9966 0.6859 0.7488 -0.2195 -0.1555 0.0282  214 PHE A CB  
1623 C CG  . PHE A 214 ? 0.9052 0.5988 0.6493 -0.1876 -0.1460 0.0199  214 PHE A CG  
1624 C CD1 . PHE A 214 ? 0.8618 0.5450 0.5955 -0.1580 -0.1228 0.0176  214 PHE A CD1 
1625 C CD2 . PHE A 214 ? 0.8426 0.5524 0.5911 -0.1879 -0.1608 0.0156  214 PHE A CD2 
1626 C CE1 . PHE A 214 ? 0.8134 0.5049 0.5453 -0.1323 -0.1129 0.0106  214 PHE A CE1 
1627 C CE2 . PHE A 214 ? 0.7741 0.4854 0.5140 -0.1615 -0.1499 0.0094  214 PHE A CE2 
1628 C CZ  . PHE A 214 ? 0.7565 0.4602 0.4903 -0.1351 -0.1251 0.0067  214 PHE A CZ  
1629 N N   . ASP A 215 ? 1.2183 0.8050 0.9001 -0.2917 -0.1911 0.0291  215 ASP A N   
1630 C CA  . ASP A 215 ? 1.2494 0.8554 0.9564 -0.3220 -0.2005 0.0374  215 ASP A CA  
1631 C C   . ASP A 215 ? 1.1502 0.8483 0.9351 -0.3314 -0.2102 0.0453  215 ASP A C   
1632 O O   . ASP A 215 ? 1.0785 0.8101 0.8817 -0.3184 -0.2202 0.0416  215 ASP A O   
1633 C CB  . ASP A 215 ? 1.3789 0.9342 1.0388 -0.3362 -0.2172 0.0305  215 ASP A CB  
1634 C CG  . ASP A 215 ? 1.4754 0.9424 1.0559 -0.3190 -0.2069 0.0204  215 ASP A CG  
1635 O OD1 . ASP A 215 ? 1.4765 0.9128 1.0389 -0.3053 -0.1866 0.0218  215 ASP A OD1 
1636 O OD2 . ASP A 215 ? 1.5325 0.9610 1.0683 -0.3170 -0.2181 0.0117  215 ASP A OD2 
1637 N N   . ASP A 216 ? 1.1609 0.8989 0.9906 -0.3516 -0.2052 0.0563  216 ASP A N   
1638 C CA  . ASP A 216 ? 1.1575 0.9865 1.0653 -0.3570 -0.2097 0.0640  216 ASP A CA  
1639 C C   . ASP A 216 ? 1.1846 1.0356 1.1074 -0.3656 -0.2354 0.0600  216 ASP A C   
1640 O O   . ASP A 216 ? 1.2556 1.0563 1.1356 -0.3800 -0.2498 0.0546  216 ASP A O   
1641 C CB  . ASP A 216 ? 1.2073 1.0689 1.1549 -0.3777 -0.1953 0.0766  216 ASP A CB  
1642 C CG  . ASP A 216 ? 1.2091 1.0847 1.1678 -0.3647 -0.1696 0.0846  216 ASP A CG  
1643 O OD1 . ASP A 216 ? 1.2739 1.0851 1.1806 -0.3612 -0.1570 0.0852  216 ASP A OD1 
1644 O OD2 . ASP A 216 ? 1.1501 1.0996 1.1673 -0.3558 -0.1616 0.0904  216 ASP A OD2 
1645 N N   . SER A 217 ? 1.1462 1.0707 1.1282 -0.3552 -0.2409 0.0629  217 SER A N   
1646 C CA  . SER A 217 ? 1.1675 1.1160 1.1658 -0.3584 -0.2659 0.0599  217 SER A CA  
1647 C C   . SER A 217 ? 1.1234 1.1646 1.2056 -0.3557 -0.2666 0.0670  217 SER A C   
1648 O O   . SER A 217 ? 1.0835 1.1699 1.2045 -0.3390 -0.2482 0.0717  217 SER A O   
1649 C CB  . SER A 217 ? 1.1936 1.1094 1.1488 -0.3352 -0.2757 0.0513  217 SER A CB  
1650 O OG  . SER A 217 ? 1.2141 1.1544 1.1847 -0.3359 -0.2998 0.0501  217 SER A OG  
1651 N N   . SER A 218 ? 1.1460 1.2147 1.2553 -0.3712 -0.2877 0.0672  218 SER A N   
1652 C CA  . SER A 218 ? 1.1162 1.2716 1.3042 -0.3658 -0.2908 0.0722  218 SER A CA  
1653 C C   . SER A 218 ? 1.1127 1.2821 1.3009 -0.3417 -0.3092 0.0678  218 SER A C   
1654 O O   . SER A 218 ? 1.1174 1.3500 1.3619 -0.3355 -0.3191 0.0701  218 SER A O   
1655 C CB  . SER A 218 ? 1.1560 1.3404 1.3814 -0.3974 -0.3033 0.0751  218 SER A CB  
1656 O OG  . SER A 218 ? 1.2244 1.3553 1.4005 -0.4155 -0.3296 0.0687  218 SER A OG  
1657 N N   . THR A 219 ? 1.1096 1.2178 1.2332 -0.3276 -0.3126 0.0617  219 THR A N   
1658 C CA  . THR A 219 ? 1.0881 1.1967 1.1997 -0.3053 -0.3281 0.0583  219 THR A CA  
1659 C C   . THR A 219 ? 1.0394 1.1120 1.1109 -0.2799 -0.3128 0.0548  219 THR A C   
1660 O O   . THR A 219 ? 1.0337 1.0462 1.0511 -0.2834 -0.3024 0.0505  219 THR A O   
1661 C CB  . THR A 219 ? 1.1506 1.2133 1.2141 -0.3194 -0.3569 0.0533  219 THR A CB  
1662 O OG1 . THR A 219 ? 1.2022 1.1936 1.2051 -0.3389 -0.3537 0.0489  219 THR A OG1 
1663 C CG2 . THR A 219 ? 1.1580 1.2754 1.2746 -0.3366 -0.3790 0.0563  219 THR A CG2 
1664 N N   . PHE A 220 ? 0.9999 1.1093 1.0989 -0.2538 -0.3115 0.0562  220 PHE A N   
1665 C CA  . PHE A 220 ? 0.9634 1.0447 1.0304 -0.2297 -0.2989 0.0528  220 PHE A CA  
1666 C C   . PHE A 220 ? 0.9918 1.0301 1.0081 -0.2209 -0.3172 0.0489  220 PHE A C   
1667 O O   . PHE A 220 ? 1.0271 1.0057 0.9849 -0.2341 -0.3266 0.0442  220 PHE A O   
1668 C CB  . PHE A 220 ? 0.9020 1.0444 1.0261 -0.2062 -0.2841 0.0567  220 PHE A CB  
1669 C CG  . PHE A 220 ? 0.8582 0.9789 0.9600 -0.1876 -0.2649 0.0536  220 PHE A CG  
1670 C CD1 . PHE A 220 ? 0.8667 0.9264 0.9115 -0.1943 -0.2574 0.0480  220 PHE A CD1 
1671 C CD2 . PHE A 220 ? 0.8089 0.9696 0.9469 -0.1626 -0.2545 0.0553  220 PHE A CD2 
1672 C CE1 . PHE A 220 ? 0.8133 0.8578 0.8416 -0.1778 -0.2413 0.0444  220 PHE A CE1 
1673 C CE2 . PHE A 220 ? 0.7663 0.9091 0.8862 -0.1471 -0.2387 0.0520  220 PHE A CE2 
1674 C CZ  . PHE A 220 ? 0.7537 0.8413 0.8209 -0.1554 -0.2328 0.0466  220 PHE A CZ  
1675 N N   . TYR A 221 ? 0.9756 1.0407 1.0110 -0.1979 -0.3211 0.0513  221 TYR A N   
1676 C CA  . TYR A 221 ? 1.0111 1.0436 1.0052 -0.1899 -0.3408 0.0505  221 TYR A CA  
1677 C C   . TYR A 221 ? 1.0294 1.1186 1.0735 -0.1727 -0.3536 0.0567  221 TYR A C   
1678 O O   . TYR A 221 ? 1.0049 1.1488 1.1059 -0.1589 -0.3407 0.0600  221 TYR A O   
1679 C CB  . TYR A 221 ? 0.9823 0.9565 0.9158 -0.1753 -0.3286 0.0459  221 TYR A CB  
1680 C CG  . TYR A 221 ? 0.9039 0.9049 0.8652 -0.1518 -0.3104 0.0477  221 TYR A CG  
1681 C CD1 . TYR A 221 ? 0.8859 0.9082 0.8640 -0.1308 -0.3177 0.0526  221 TYR A CD1 
1682 C CD2 . TYR A 221 ? 0.8535 0.8549 0.8211 -0.1505 -0.2871 0.0445  221 TYR A CD2 
1683 C CE1 . TYR A 221 ? 0.8276 0.8694 0.8285 -0.1099 -0.3017 0.0539  221 TYR A CE1 
1684 C CE2 . TYR A 221 ? 0.8107 0.8357 0.8029 -0.1302 -0.2722 0.0454  221 TYR A CE2 
1685 C CZ  . TYR A 221 ? 0.7928 0.8366 0.8013 -0.1103 -0.2792 0.0498  221 TYR A CZ  
1686 O OH  . TYR A 221 ? 0.7666 0.8287 0.7973 -0.0905 -0.2648 0.0504  221 TYR A OH  
1687 N N   . THR A 222 ? 1.0927 1.1663 1.1124 -0.1723 -0.3788 0.0581  222 THR A N   
1688 C CA  . THR A 222 ? 1.0950 1.2151 1.1537 -0.1534 -0.3938 0.0644  222 THR A CA  
1689 C C   . THR A 222 ? 1.1060 1.1758 1.1069 -0.1364 -0.4023 0.0658  222 THR A C   
1690 O O   . THR A 222 ? 1.1206 1.1225 1.0513 -0.1448 -0.4028 0.0613  222 THR A O   
1691 C CB  . THR A 222 ? 1.1639 1.3241 1.2570 -0.1686 -0.4205 0.0665  222 THR A CB  
1692 O OG1 . THR A 222 ? 1.1342 1.3272 1.2688 -0.1903 -0.4113 0.0649  222 THR A OG1 
1693 C CG2 . THR A 222 ? 1.1746 1.3964 1.3217 -0.1458 -0.4327 0.0732  222 THR A CG2 
1694 N N   . LEU A 223 ? 1.1053 1.2053 1.1328 -0.1115 -0.4070 0.0724  223 LEU A N   
1695 C CA  . LEU A 223 ? 1.1615 1.2139 1.1357 -0.0944 -0.4140 0.0759  223 LEU A CA  
1696 C C   . LEU A 223 ? 1.2549 1.3204 1.2296 -0.0892 -0.4459 0.0822  223 LEU A C   
1697 O O   . LEU A 223 ? 1.2630 1.3903 1.2960 -0.0918 -0.4602 0.0847  223 LEU A O   
1698 C CB  . LEU A 223 ? 1.0998 1.1634 1.0933 -0.0678 -0.3947 0.0796  223 LEU A CB  
1699 C CG  . LEU A 223 ? 1.0090 1.0715 1.0126 -0.0694 -0.3646 0.0739  223 LEU A CG  
1700 C CD1 . LEU A 223 ? 0.9374 1.0160 0.9661 -0.0426 -0.3500 0.0777  223 LEU A CD1 
1701 C CD2 . LEU A 223 ? 1.0331 1.0246 0.9646 -0.0829 -0.3552 0.0671  223 LEU A CD2 
1702 N N   . PRO A 224 ? 1.3269 1.3339 1.2349 -0.0820 -0.4570 0.0849  224 PRO A N   
1703 C CA  . PRO A 224 ? 1.3921 1.4110 1.2992 -0.0700 -0.4864 0.0932  224 PRO A CA  
1704 C C   . PRO A 224 ? 1.4168 1.4886 1.3812 -0.0402 -0.4833 0.1022  224 PRO A C   
1705 O O   . PRO A 224 ? 1.3744 1.4589 1.3649 -0.0290 -0.4572 0.1013  224 PRO A O   
1706 C CB  . PRO A 224 ? 1.4265 1.3611 1.2419 -0.0672 -0.4895 0.0941  224 PRO A CB  
1707 C CG  . PRO A 224 ? 1.4118 1.2946 1.1805 -0.0868 -0.4686 0.0835  224 PRO A CG  
1708 C CD  . PRO A 224 ? 1.3457 1.2712 1.1721 -0.0872 -0.4435 0.0800  224 PRO A CD  
1709 N N   . ASP A 225 ? 1.4936 1.5942 1.4755 -0.0262 -0.5096 0.1107  225 ASP A N   
1710 C CA  . ASP A 225 ? 1.4898 1.6418 1.5273 0.0048  -0.5072 0.1196  225 ASP A CA  
1711 C C   . ASP A 225 ? 1.5029 1.6016 1.4942 0.0300  -0.4990 0.1276  225 ASP A C   
1712 O O   . ASP A 225 ? 1.4862 1.6091 1.5137 0.0556  -0.4858 0.1332  225 ASP A O   
1713 C CB  . ASP A 225 ? 1.5421 1.7538 1.6235 0.0118  -0.5388 0.1261  225 ASP A CB  
1714 C CG  . ASP A 225 ? 1.5457 1.8229 1.6895 -0.0105 -0.5433 0.1187  225 ASP A CG  
1715 O OD1 . ASP A 225 ? 1.5046 1.8392 1.7147 -0.0036 -0.5231 0.1166  225 ASP A OD1 
1716 O OD2 . ASP A 225 ? 1.5864 1.8548 1.7107 -0.0354 -0.5663 0.1148  225 ASP A OD2 
1717 N N   . GLY A 226 ? 1.5441 1.5667 1.4532 0.0223  -0.5051 0.1279  226 GLY A N   
1718 C CA  . GLY A 226 ? 1.5604 1.5250 1.4182 0.0429  -0.4972 0.1359  226 GLY A CA  
1719 C C   . GLY A 226 ? 1.5329 1.4317 1.3346 0.0327  -0.4690 0.1287  226 GLY A C   
1720 O O   . GLY A 226 ? 1.5660 1.4024 1.3078 0.0423  -0.4618 0.1338  226 GLY A O   
1721 N N   . ILE A 227 ? 1.4600 1.3727 1.2805 0.0134  -0.4519 0.1175  227 ILE A N   
1722 C CA  . ILE A 227 ? 1.4172 1.2736 1.1878 0.0035  -0.4255 0.1102  227 ILE A CA  
1723 C C   . ILE A 227 ? 1.3507 1.2039 1.1371 0.0234  -0.4021 0.1134  227 ILE A C   
1724 O O   . ILE A 227 ? 1.2996 1.2083 1.1532 0.0381  -0.3991 0.1158  227 ILE A O   
1725 C CB  . ILE A 227 ? 1.2387 1.1097 1.0236 -0.0219 -0.4153 0.0980  227 ILE A CB  
1726 C CG1 . ILE A 227 ? 1.2500 1.0562 0.9709 -0.0318 -0.3910 0.0906  227 ILE A CG1 
1727 C CG2 . ILE A 227 ? 1.1546 1.0984 1.0240 -0.0189 -0.4048 0.0959  227 ILE A CG2 
1728 C CD1 . ILE A 227 ? 1.2426 1.0436 0.9553 -0.0566 -0.3851 0.0795  227 ILE A CD1 
1729 N N   . GLN A 228 ? 1.3732 1.1595 1.0955 0.0240  -0.3844 0.1133  228 GLN A N   
1730 C CA  . GLN A 228 ? 1.3648 1.1363 1.0919 0.0410  -0.3629 0.1166  228 GLN A CA  
1731 C C   . GLN A 228 ? 1.2988 1.0900 1.0555 0.0327  -0.3401 0.1070  228 GLN A C   
1732 O O   . GLN A 228 ? 1.2955 1.0871 1.0423 0.0122  -0.3351 0.0979  228 GLN A O   
1733 C CB  . GLN A 228 ? 1.4572 1.1485 1.1028 0.0438  -0.3511 0.1219  228 GLN A CB  
1734 C CG  . GLN A 228 ? 1.5439 1.2134 1.1643 0.0595  -0.3703 0.1343  228 GLN A CG  
1735 C CD  . GLN A 228 ? 1.5335 1.2367 1.2080 0.0862  -0.3751 0.1430  228 GLN A CD  
1736 O OE1 . GLN A 228 ? 1.5010 1.2208 1.2132 0.0945  -0.3570 0.1400  228 GLN A OE1 
1737 N NE2 . GLN A 228 ? 1.5707 1.2828 1.2482 0.1011  -0.3993 0.1534  228 GLN A NE2 
1738 N N   . SER A 229 ? 1.2487 1.0529 1.0395 0.0498  -0.3265 0.1088  229 SER A N   
1739 C CA  . SER A 229 ? 1.1658 0.9971 0.9942 0.0450  -0.3048 0.0992  229 SER A CA  
1740 C C   . SER A 229 ? 1.1293 0.9271 0.9446 0.0529  -0.2697 0.0953  229 SER A C   
1741 O O   . SER A 229 ? 1.1953 0.9838 1.0195 0.0730  -0.2698 0.1017  229 SER A O   
1742 C CB  . SER A 229 ? 1.1190 1.0277 1.0323 0.0543  -0.3120 0.0978  229 SER A CB  
1743 O OG  . SER A 229 ? 1.0640 0.9980 1.0148 0.0533  -0.2797 0.0862  229 SER A OG  
1744 N N   . VAL A 230 ? 1.0317 0.8115 0.8276 0.0371  -0.2404 0.0848  230 VAL A N   
1745 C CA  . VAL A 230 ? 0.9703 0.7238 0.7588 0.0396  -0.2075 0.0801  230 VAL A CA  
1746 C C   . VAL A 230 ? 0.8952 0.6865 0.7264 0.0312  -0.1817 0.0653  230 VAL A C   
1747 O O   . VAL A 230 ? 0.9018 0.7134 0.7390 0.0181  -0.1807 0.0590  230 VAL A O   
1748 C CB  . VAL A 230 ? 1.2225 0.9075 0.9363 0.0300  -0.1941 0.0844  230 VAL A CB  
1749 C CG1 . VAL A 230 ? 1.2455 0.9244 0.9335 0.0112  -0.1833 0.0762  230 VAL A CG1 
1750 C CG2 . VAL A 230 ? 1.2281 0.8852 0.9375 0.0319  -0.1639 0.0827  230 VAL A CG2 
1751 N N   . THR A 231 ? 0.8835 0.6805 0.7412 0.0391  -0.1625 0.0600  231 THR A N   
1752 C CA  . THR A 231 ? 0.8117 0.6430 0.7076 0.0332  -0.1406 0.0463  231 THR A CA  
1753 C C   . THR A 231 ? 0.7978 0.5995 0.6671 0.0197  -0.1137 0.0402  231 THR A C   
1754 O O   . THR A 231 ? 0.8685 0.6298 0.7113 0.0196  -0.1025 0.0436  231 THR A O   
1755 C CB  . THR A 231 ? 0.8045 0.6596 0.7434 0.0489  -0.1357 0.0417  231 THR A CB  
1756 O OG1 . THR A 231 ? 0.8109 0.7034 0.7833 0.0630  -0.1572 0.0471  231 THR A OG1 
1757 C CG2 . THR A 231 ? 0.7351 0.6206 0.7052 0.0424  -0.1150 0.0274  231 THR A CG2 
1758 N N   . ILE A 232 ? 0.7748 0.5970 0.6524 0.0086  -0.1029 0.0320  232 ILE A N   
1759 C CA  . ILE A 232 ? 0.7797 0.5840 0.6405 -0.0024 -0.0772 0.0261  232 ILE A CA  
1760 C C   . ILE A 232 ? 0.7533 0.5822 0.6536 -0.0022 -0.0602 0.0157  232 ILE A C   
1761 O O   . ILE A 232 ? 0.7774 0.5870 0.6701 -0.0090 -0.0412 0.0133  232 ILE A O   
1762 C CB  . ILE A 232 ? 0.6987 0.5102 0.5480 -0.0113 -0.0736 0.0221  232 ILE A CB  
1763 C CG1 . ILE A 232 ? 0.8229 0.5948 0.6176 -0.0152 -0.0865 0.0303  232 ILE A CG1 
1764 C CG2 . ILE A 232 ? 0.6809 0.4919 0.5321 -0.0181 -0.0456 0.0143  232 ILE A CG2 
1765 C CD1 . ILE A 232 ? 0.9052 0.6929 0.7060 -0.0129 -0.1176 0.0353  232 ILE A CD1 
1766 N N   . GLY A 233 ? 0.7202 0.5913 0.6614 0.0044  -0.0671 0.0097  233 GLY A N   
1767 C CA  . GLY A 233 ? 0.6946 0.5886 0.6685 0.0051  -0.0547 -0.0014 233 GLY A CA  
1768 C C   . GLY A 233 ? 0.6596 0.6001 0.6674 0.0088  -0.0585 -0.0080 233 GLY A C   
1769 O O   . GLY A 233 ? 0.6076 0.5645 0.6181 0.0099  -0.0705 -0.0032 233 GLY A O   
1770 N N   . HIS A 234 ? 0.6297 0.5894 0.6608 0.0090  -0.0487 -0.0187 234 HIS A N   
1771 C CA  . HIS A 234 ? 0.5719 0.5713 0.6293 0.0131  -0.0502 -0.0248 234 HIS A CA  
1772 C C   . HIS A 234 ? 0.5237 0.5380 0.5913 0.0066  -0.0388 -0.0347 234 HIS A C   
1773 O O   . HIS A 234 ? 0.5262 0.5257 0.5888 -0.0011 -0.0291 -0.0382 234 HIS A O   
1774 C CB  . HIS A 234 ? 0.6468 0.6588 0.7230 0.0260  -0.0544 -0.0282 234 HIS A CB  
1775 C CG  . HIS A 234 ? 0.7612 0.7543 0.8369 0.0272  -0.0467 -0.0375 234 HIS A CG  
1776 N ND1 . HIS A 234 ? 0.8440 0.7991 0.9037 0.0297  -0.0473 -0.0338 234 HIS A ND1 
1777 C CD2 . HIS A 234 ? 0.7831 0.7862 0.8692 0.0248  -0.0395 -0.0505 234 HIS A CD2 
1778 C CE1 . HIS A 234 ? 0.8406 0.7814 0.9018 0.0273  -0.0397 -0.0446 234 HIS A CE1 
1779 N NE2 . HIS A 234 ? 0.8093 0.7801 0.8869 0.0239  -0.0359 -0.0556 234 HIS A NE2 
1780 N N   . LEU A 235 ? 0.4865 0.5315 0.5690 0.0097  -0.0402 -0.0382 235 LEU A N   
1781 C CA  . LEU A 235 ? 0.4458 0.5089 0.5383 0.0069  -0.0338 -0.0466 235 LEU A CA  
1782 C C   . LEU A 235 ? 0.4320 0.5197 0.5382 0.0146  -0.0364 -0.0532 235 LEU A C   
1783 O O   . LEU A 235 ? 0.4331 0.5332 0.5425 0.0205  -0.0405 -0.0482 235 LEU A O   
1784 C CB  . LEU A 235 ? 0.4277 0.4956 0.5129 0.0038  -0.0318 -0.0419 235 LEU A CB  
1785 C CG  . LEU A 235 ? 0.4370 0.4799 0.5041 -0.0025 -0.0249 -0.0376 235 LEU A CG  
1786 C CD1 . LEU A 235 ? 0.4583 0.4987 0.5119 -0.0023 -0.0240 -0.0330 235 LEU A CD1 
1787 C CD2 . LEU A 235 ? 0.3803 0.4240 0.4581 -0.0077 -0.0134 -0.0444 235 LEU A CD2 
1788 N N   . ARG A 236 ? 0.4358 0.5303 0.5490 0.0135  -0.0339 -0.0646 236 ARG A N   
1789 C CA  . ARG A 236 ? 0.4270 0.5393 0.5443 0.0210  -0.0357 -0.0723 236 ARG A CA  
1790 C C   . ARG A 236 ? 0.4632 0.5917 0.5841 0.0177  -0.0369 -0.0808 236 ARG A C   
1791 O O   . ARG A 236 ? 0.4988 0.6243 0.6227 0.0137  -0.0385 -0.0926 236 ARG A O   
1792 C CB  . ARG A 236 ? 0.4389 0.5354 0.5548 0.0265  -0.0350 -0.0802 236 ARG A CB  
1793 C CG  . ARG A 236 ? 0.4812 0.5903 0.5944 0.0367  -0.0342 -0.0895 236 ARG A CG  
1794 C CD  . ARG A 236 ? 0.5194 0.6527 0.6358 0.0447  -0.0323 -0.0803 236 ARG A CD  
1795 N NE  . ARG A 236 ? 0.5818 0.7236 0.6942 0.0571  -0.0268 -0.0872 236 ARG A NE  
1796 C CZ  . ARG A 236 ? 0.5659 0.7209 0.6668 0.0596  -0.0245 -0.0929 236 ARG A CZ  
1797 N NH1 . ARG A 236 ? 0.5979 0.7608 0.6931 0.0516  -0.0297 -0.0922 236 ARG A NH1 
1798 N NH2 . ARG A 236 ? 0.5032 0.6622 0.5958 0.0719  -0.0165 -0.0991 236 ARG A NH2 
1799 N N   . PRO A 237 ? 0.4383 0.5823 0.5581 0.0191  -0.0379 -0.0747 237 PRO A N   
1800 C CA  . PRO A 237 ? 0.4186 0.5811 0.5407 0.0205  -0.0423 -0.0812 237 PRO A CA  
1801 C C   . PRO A 237 ? 0.4405 0.6118 0.5513 0.0282  -0.0453 -0.0869 237 PRO A C   
1802 O O   . PRO A 237 ? 0.4188 0.5827 0.5249 0.0324  -0.0416 -0.0882 237 PRO A O   
1803 C CB  . PRO A 237 ? 0.4132 0.5812 0.5324 0.0229  -0.0414 -0.0707 237 PRO A CB  
1804 C CG  . PRO A 237 ? 0.4195 0.5739 0.5299 0.0223  -0.0381 -0.0599 237 PRO A CG  
1805 C CD  . PRO A 237 ? 0.4326 0.5723 0.5466 0.0186  -0.0364 -0.0619 237 PRO A CD  
1806 N N   . GLY A 238 ? 0.4395 0.6257 0.5443 0.0317  -0.0514 -0.0898 238 GLY A N   
1807 C CA  . GLY A 238 ? 0.4054 0.5962 0.4917 0.0387  -0.0540 -0.0962 238 GLY A CA  
1808 C C   . GLY A 238 ? 0.4039 0.5938 0.4777 0.0456  -0.0447 -0.0881 238 GLY A C   
1809 O O   . GLY A 238 ? 0.4490 0.6359 0.5116 0.0513  -0.0404 -0.0955 238 GLY A O   
1810 N N   . HIS A 239 ? 0.3790 0.5712 0.4548 0.0447  -0.0406 -0.0734 239 HIS A N   
1811 C CA  . HIS A 239 ? 0.3990 0.5967 0.4665 0.0483  -0.0319 -0.0645 239 HIS A CA  
1812 C C   . HIS A 239 ? 0.3678 0.5646 0.4501 0.0426  -0.0279 -0.0523 239 HIS A C   
1813 O O   . HIS A 239 ? 0.3855 0.5911 0.4675 0.0416  -0.0213 -0.0426 239 HIS A O   
1814 C CB  . HIS A 239 ? 0.3587 0.5599 0.4041 0.0514  -0.0327 -0.0578 239 HIS A CB  
1815 C CG  . HIS A 239 ? 0.3677 0.5705 0.3941 0.0577  -0.0402 -0.0693 239 HIS A CG  
1816 N ND1 . HIS A 239 ? 0.4413 0.6448 0.4430 0.0644  -0.0347 -0.0739 239 HIS A ND1 
1817 C CD2 . HIS A 239 ? 0.3973 0.6023 0.4259 0.0577  -0.0535 -0.0777 239 HIS A CD2 
1818 C CE1 . HIS A 239 ? 0.4611 0.6631 0.4454 0.0679  -0.0469 -0.0852 239 HIS A CE1 
1819 N NE2 . HIS A 239 ? 0.4082 0.6142 0.4121 0.0634  -0.0595 -0.0874 239 HIS A NE2 
1820 N N   . HIS A 240 ? 0.3811 0.5674 0.4757 0.0375  -0.0321 -0.0528 240 HIS A N   
1821 C CA  . HIS A 240 ? 0.4219 0.6037 0.5255 0.0313  -0.0325 -0.0422 240 HIS A CA  
1822 C C   . HIS A 240 ? 0.4215 0.5918 0.5353 0.0309  -0.0350 -0.0462 240 HIS A C   
1823 O O   . HIS A 240 ? 0.4330 0.5946 0.5463 0.0321  -0.0356 -0.0562 240 HIS A O   
1824 C CB  . HIS A 240 ? 0.3571 0.5266 0.4513 0.0245  -0.0357 -0.0343 240 HIS A CB  
1825 C CG  . HIS A 240 ? 0.4253 0.5977 0.5047 0.0257  -0.0340 -0.0286 240 HIS A CG  
1826 N ND1 . HIS A 240 ? 0.4867 0.6620 0.5560 0.0329  -0.0357 -0.0340 240 HIS A ND1 
1827 C CD2 . HIS A 240 ? 0.4702 0.6408 0.5417 0.0201  -0.0315 -0.0171 240 HIS A CD2 
1828 C CE1 . HIS A 240 ? 0.5100 0.6823 0.5621 0.0340  -0.0342 -0.0253 240 HIS A CE1 
1829 N NE2 . HIS A 240 ? 0.5116 0.6794 0.5644 0.0251  -0.0304 -0.0150 240 HIS A NE2 
1830 N N   . ALA A 241 ? 0.4326 0.6018 0.5545 0.0283  -0.0376 -0.0376 241 ALA A N   
1831 C CA  . ALA A 241 ? 0.4391 0.5914 0.5642 0.0283  -0.0419 -0.0379 241 ALA A CA  
1832 C C   . ALA A 241 ? 0.4313 0.5746 0.5527 0.0200  -0.0494 -0.0267 241 ALA A C   
1833 O O   . ALA A 241 ? 0.3975 0.5543 0.5236 0.0153  -0.0520 -0.0188 241 ALA A O   
1834 C CB  . ALA A 241 ? 0.4023 0.5612 0.5401 0.0395  -0.0402 -0.0414 241 ALA A CB  
1835 N N   . ALA A 242 ? 0.4077 0.5255 0.5177 0.0167  -0.0528 -0.0261 242 ALA A N   
1836 C CA  . ALA A 242 ? 0.4411 0.5432 0.5388 0.0090  -0.0617 -0.0169 242 ALA A CA  
1837 C C   . ALA A 242 ? 0.4787 0.5615 0.5713 0.0124  -0.0683 -0.0142 242 ALA A C   
1838 O O   . ALA A 242 ? 0.3847 0.4529 0.4741 0.0166  -0.0624 -0.0199 242 ALA A O   
1839 C CB  . ALA A 242 ? 0.4562 0.5372 0.5313 0.0015  -0.0579 -0.0171 242 ALA A CB  
1840 N N   . HIS A 243 ? 0.5181 0.5994 0.6088 0.0097  -0.0818 -0.0050 243 HIS A N   
1841 C CA  . HIS A 243 ? 0.5431 0.6021 0.6228 0.0141  -0.0914 0.0000  243 HIS A CA  
1842 C C   . HIS A 243 ? 0.5444 0.5748 0.5917 0.0032  -0.1020 0.0068  243 HIS A C   
1843 O O   . HIS A 243 ? 0.5836 0.6244 0.6322 -0.0050 -0.1137 0.0118  243 HIS A O   
1844 C CB  . HIS A 243 ? 0.5335 0.6192 0.6422 0.0255  -0.1017 0.0050  243 HIS A CB  
1845 C CG  . HIS A 243 ? 0.6424 0.7040 0.7400 0.0347  -0.1126 0.0109  243 HIS A CG  
1846 N ND1 . HIS A 243 ? 0.6937 0.7594 0.7926 0.0354  -0.1337 0.0217  243 HIS A ND1 
1847 C CD2 . HIS A 243 ? 0.6692 0.6996 0.7519 0.0430  -0.1068 0.0084  243 HIS A CD2 
1848 C CE1 . HIS A 243 ? 0.6853 0.7225 0.7685 0.0465  -0.1406 0.0263  243 HIS A CE1 
1849 N NE2 . HIS A 243 ? 0.6964 0.7095 0.7685 0.0507  -0.1232 0.0186  243 HIS A NE2 
1850 N N   . MET A 244 ? 0.4838 0.4758 0.4996 0.0019  -0.0970 0.0066  244 MET A N   
1851 C CA  . MET A 244 ? 0.5609 0.5173 0.5354 -0.0071 -0.1035 0.0116  244 MET A CA  
1852 C C   . MET A 244 ? 0.6756 0.6104 0.6317 -0.0027 -0.1212 0.0209  244 MET A C   
1853 O O   . MET A 244 ? 0.7075 0.6298 0.6637 0.0067  -0.1181 0.0225  244 MET A O   
1854 C CB  . MET A 244 ? 0.6275 0.5553 0.5759 -0.0111 -0.0831 0.0064  244 MET A CB  
1855 C CG  . MET A 244 ? 0.7748 0.6639 0.6755 -0.0193 -0.0835 0.0092  244 MET A CG  
1856 S SD  . MET A 244 ? 1.4366 1.3317 1.3311 -0.0277 -0.0893 0.0070  244 MET A SD  
1857 C CE  . MET A 244 ? 0.9317 0.7675 0.7584 -0.0345 -0.0885 0.0086  244 MET A CE  
1858 N N   . GLN A 245 ? 0.7110 0.6390 0.6493 -0.0097 -0.1414 0.0272  245 GLN A N   
1859 C CA  . GLN A 245 ? 0.7834 0.6955 0.7051 -0.0048 -0.1643 0.0373  245 GLN A CA  
1860 C C   . GLN A 245 ? 0.8490 0.7199 0.7155 -0.0168 -0.1772 0.0408  245 GLN A C   
1861 O O   . GLN A 245 ? 0.8355 0.6997 0.6868 -0.0292 -0.1730 0.0355  245 GLN A O   
1862 C CB  . GLN A 245 ? 0.8268 0.7878 0.7967 0.0012  -0.1847 0.0423  245 GLN A CB  
1863 C CG  . GLN A 245 ? 0.9290 0.9029 0.9258 0.0215  -0.1868 0.0462  245 GLN A CG  
1864 C CD  . GLN A 245 ? 0.9826 1.0159 1.0383 0.0298  -0.1980 0.0490  245 GLN A CD  
1865 O OE1 . GLN A 245 ? 0.9614 1.0295 1.0421 0.0179  -0.1995 0.0473  245 GLN A OE1 
1866 N NE2 . GLN A 245 ? 1.0359 1.0795 1.1136 0.0508  -0.2042 0.0539  245 GLN A NE2 
1867 N N   . CYS A 246 ? 0.9271 0.7653 0.7583 -0.0121 -0.1932 0.0496  246 CYS A N   
1868 C CA  . CYS A 246 ? 0.9839 0.7786 0.7546 -0.0228 -0.2088 0.0529  246 CYS A CA  
1869 C C   . CYS A 246 ? 1.0239 0.8194 0.7884 -0.0180 -0.2456 0.0643  246 CYS A C   
1870 O O   . CYS A 246 ? 1.0319 0.8178 0.7947 -0.0029 -0.2510 0.0727  246 CYS A O   
1871 C CB  . CYS A 246 ? 1.0230 0.7591 0.7333 -0.0234 -0.1862 0.0523  246 CYS A CB  
1872 S SG  . CYS A 246 ? 1.0975 0.7682 0.7178 -0.0339 -0.2021 0.0559  246 CYS A SG  
1873 N N   . TRP A 247 ? 1.0461 0.8536 0.8090 -0.0311 -0.2721 0.0647  247 TRP A N   
1874 C CA  . TRP A 247 ? 1.1134 0.9181 0.8639 -0.0303 -0.3059 0.0734  247 TRP A CA  
1875 C C   . TRP A 247 ? 1.1674 0.9093 0.8399 -0.0426 -0.3069 0.0704  247 TRP A C   
1876 O O   . TRP A 247 ? 1.1705 0.8905 0.8155 -0.0569 -0.2946 0.0613  247 TRP A O   
1877 C CB  . TRP A 247 ? 1.1174 0.9859 0.9326 -0.0381 -0.3216 0.0724  247 TRP A CB  
1878 C CG  . TRP A 247 ? 1.0901 1.0225 0.9821 -0.0225 -0.3199 0.0761  247 TRP A CG  
1879 C CD1 . TRP A 247 ? 1.1104 1.0665 1.0313 -0.0022 -0.3314 0.0847  247 TRP A CD1 
1880 C CD2 . TRP A 247 ? 1.0425 1.0215 0.9897 -0.0242 -0.3039 0.0710  247 TRP A CD2 
1881 N NE1 . TRP A 247 ? 1.0596 1.0733 1.0498 0.0097  -0.3215 0.0844  247 TRP A NE1 
1882 C CE2 . TRP A 247 ? 1.0245 1.0536 1.0317 -0.0041 -0.3043 0.0760  247 TRP A CE2 
1883 C CE3 . TRP A 247 ? 1.0208 1.0020 0.9700 -0.0393 -0.2878 0.0627  247 TRP A CE3 
1884 C CZ2 . TRP A 247 ? 0.9659 1.0460 1.0326 0.0004  -0.2876 0.0723  247 TRP A CZ2 
1885 C CZ3 . TRP A 247 ? 0.9486 0.9810 0.9578 -0.0351 -0.2691 0.0593  247 TRP A CZ3 
1886 C CH2 . TRP A 247 ? 0.9309 1.0119 0.9968 -0.0162 -0.2710 0.0644  247 TRP A CH2 
1887 N N   . SER A 248 ? 1.2037 0.9140 0.8382 -0.0359 -0.3200 0.0776  248 SER A N   
1888 C CA  . SER A 248 ? 1.2992 0.9459 0.8555 -0.0459 -0.3181 0.0742  248 SER A CA  
1889 C C   . SER A 248 ? 1.3443 0.9724 0.8728 -0.0416 -0.3433 0.0818  248 SER A C   
1890 O O   . SER A 248 ? 1.3353 0.9729 0.8778 -0.0248 -0.3524 0.0922  248 SER A O   
1891 C CB  . SER A 248 ? 1.3447 0.9368 0.8446 -0.0419 -0.2858 0.0731  248 SER A CB  
1892 O OG  . SER A 248 ? 1.4374 0.9717 0.8660 -0.0519 -0.2767 0.0670  248 SER A OG  
1893 N N   . LYS A 249 ? 1.4011 1.0001 0.8881 -0.0562 -0.3551 0.0765  249 LYS A N   
1894 C CA  . LYS A 249 ? 1.4384 1.0069 0.8820 -0.0540 -0.3781 0.0824  249 LYS A CA  
1895 C C   . LYS A 249 ? 1.4764 0.9758 0.8445 -0.0459 -0.3575 0.0854  249 LYS A C   
1896 O O   . LYS A 249 ? 1.5456 1.0190 0.8796 -0.0372 -0.3715 0.0940  249 LYS A O   
1897 C CB  . LYS A 249 ? 1.4683 1.0213 0.8860 -0.0735 -0.3962 0.0748  249 LYS A CB  
1898 C CG  . LYS A 249 ? 1.4275 1.0467 0.9143 -0.0826 -0.4237 0.0751  249 LYS A CG  
1899 C CD  . LYS A 249 ? 1.4603 1.1181 0.9807 -0.0683 -0.4523 0.0869  249 LYS A CD  
1900 C CE  . LYS A 249 ? 1.5001 1.2041 1.0605 -0.0818 -0.4843 0.0862  249 LYS A CE  
1901 N NZ  . LYS A 249 ? 1.5159 1.2685 1.1190 -0.0653 -0.5112 0.0978  249 LYS A NZ  
1902 N N   . SER A 250 ? 1.4501 0.9215 0.7934 -0.0488 -0.3226 0.0788  250 SER A N   
1903 C CA  . SER A 250 ? 1.5245 0.9310 0.7962 -0.0447 -0.2954 0.0800  250 SER A CA  
1904 C C   . SER A 250 ? 1.5145 0.9203 0.7958 -0.0291 -0.2804 0.0911  250 SER A C   
1905 O O   . SER A 250 ? 1.4998 0.8596 0.7336 -0.0272 -0.2502 0.0926  250 SER A O   
1906 C CB  . SER A 250 ? 1.5134 0.8936 0.7572 -0.0539 -0.2613 0.0680  250 SER A CB  
1907 O OG  . SER A 250 ? 1.5416 0.9182 0.7771 -0.0677 -0.2736 0.0578  250 SER A OG  
1908 N N   . MET A 251 ? 1.4786 0.9345 0.8227 -0.0181 -0.2997 0.0989  251 MET A N   
1909 C CA  . MET A 251 ? 1.4685 0.9224 0.8264 -0.0024 -0.2869 0.1093  251 MET A CA  
1910 C C   . MET A 251 ? 1.5097 0.9460 0.8486 0.0113  -0.3084 0.1220  251 MET A C   
1911 O O   . MET A 251 ? 1.4771 0.9560 0.8605 0.0204  -0.3393 0.1270  251 MET A O   
1912 C CB  . MET A 251 ? 1.4244 0.9407 0.8636 0.0047  -0.2897 0.1092  251 MET A CB  
1913 C CG  . MET A 251 ? 1.3947 0.8998 0.8442 0.0161  -0.2652 0.1155  251 MET A CG  
1914 S SD  . MET A 251 ? 1.7091 1.2847 1.2524 0.0270  -0.2711 0.1142  251 MET A SD  
1915 C CE  . MET A 251 ? 1.3054 0.9204 0.8737 0.0075  -0.2711 0.0997  251 MET A CE  
1916 N N   . LYS B 16  ? 1.6995 1.3622 1.2011 0.2639  -0.2439 0.2975  16  LYS B N   
1917 C CA  . LYS B 16  ? 1.6463 1.3749 1.2029 0.2278  -0.2276 0.2701  16  LYS B CA  
1918 C C   . LYS B 16  ? 1.5571 1.2990 1.1812 0.1907  -0.1845 0.2649  16  LYS B C   
1919 O O   . LYS B 16  ? 1.5279 1.2770 1.2138 0.1967  -0.1861 0.2610  16  LYS B O   
1920 C CB  . LYS B 16  ? 1.6485 1.4545 1.2781 0.2422  -0.2719 0.2359  16  LYS B CB  
1921 C CG  . LYS B 16  ? 1.7611 1.5652 1.3299 0.2767  -0.3196 0.2326  16  LYS B CG  
1922 C CD  . LYS B 16  ? 1.7154 1.6012 1.3710 0.2850  -0.3616 0.1938  16  LYS B CD  
1923 C CE  . LYS B 16  ? 1.8054 1.6969 1.4105 0.3112  -0.4045 0.1834  16  LYS B CE  
1924 N NZ  . LYS B 16  ? 1.7602 1.7328 1.4611 0.3123  -0.4399 0.1421  16  LYS B NZ  
1925 N N   . ASP B 17  ? 1.4706 1.2159 1.0817 0.1544  -0.1469 0.2632  17  ASP B N   
1926 C CA  . ASP B 17  ? 1.3543 1.1171 1.0273 0.1200  -0.1107 0.2540  17  ASP B CA  
1927 C C   . ASP B 17  ? 1.2559 1.0950 1.0170 0.1109  -0.1230 0.2212  17  ASP B C   
1928 O O   . ASP B 17  ? 1.2220 1.0937 1.0012 0.0847  -0.1055 0.2062  17  ASP B O   
1929 C CB  . ASP B 17  ? 1.3447 1.0858 0.9763 0.0864  -0.0678 0.2624  17  ASP B CB  
1930 C CG  . ASP B 17  ? 1.2382 0.9997 0.9330 0.0531  -0.0358 0.2498  17  ASP B CG  
1931 O OD1 . ASP B 17  ? 1.2301 0.9892 0.9731 0.0568  -0.0371 0.2470  17  ASP B OD1 
1932 O OD2 . ASP B 17  ? 1.1625 0.9432 0.8583 0.0253  -0.0107 0.2410  17  ASP B OD2 
1933 N N   . ALA B 18  ? 1.2228 1.0886 1.0392 0.1337  -0.1522 0.2103  18  ALA B N   
1934 C CA  . ALA B 18  ? 1.1432 1.0760 1.0453 0.1258  -0.1615 0.1808  18  ALA B CA  
1935 C C   . ALA B 18  ? 1.1283 1.0720 1.0981 0.1398  -0.1673 0.1756  18  ALA B C   
1936 O O   . ALA B 18  ? 1.1866 1.1006 1.1415 0.1683  -0.1845 0.1892  18  ALA B O   
1937 C CB  . ALA B 18  ? 1.1503 1.1227 1.0540 0.1398  -0.1984 0.1634  18  ALA B CB  
1938 N N   . ILE B 19  ? 1.0660 1.0495 1.1071 0.1214  -0.1515 0.1563  19  ILE B N   
1939 C CA  . ILE B 19  ? 1.0674 1.0665 1.1768 0.1334  -0.1521 0.1483  19  ILE B CA  
1940 C C   . ILE B 19  ? 1.1270 1.1727 1.2891 0.1586  -0.1904 0.1315  19  ILE B C   
1941 O O   . ILE B 19  ? 1.1388 1.2306 1.3316 0.1499  -0.2031 0.1115  19  ILE B O   
1942 C CB  . ILE B 19  ? 0.9462 0.9691 1.1079 0.1068  -0.1207 0.1334  19  ILE B CB  
1943 C CG1 . ILE B 19  ? 0.9302 0.9097 1.0489 0.0846  -0.0870 0.1464  19  ILE B CG1 
1944 C CG2 . ILE B 19  ? 0.9156 0.9588 1.1488 0.1204  -0.1195 0.1228  19  ILE B CG2 
1945 C CD1 . ILE B 19  ? 0.8851 0.8851 1.0371 0.0589  -0.0603 0.1314  19  ILE B CD1 
1946 N N   . ASP B 20  ? 1.1807 1.2142 1.3561 0.1903  -0.2096 0.1379  20  ASP B N   
1947 C CA  . ASP B 20  ? 1.2226 1.3056 1.4607 0.2169  -0.2479 0.1190  20  ASP B CA  
1948 C C   . ASP B 20  ? 1.1863 1.3044 1.5195 0.2176  -0.2325 0.1028  20  ASP B C   
1949 O O   . ASP B 20  ? 1.2328 1.3493 1.5966 0.2476  -0.2465 0.1039  20  ASP B O   
1950 C CB  . ASP B 20  ? 1.3533 1.4035 1.5430 0.2583  -0.2862 0.1346  20  ASP B CB  
1951 C CG  . ASP B 20  ? 1.4526 1.4804 1.5548 0.2624  -0.3082 0.1444  20  ASP B CG  
1952 O OD1 . ASP B 20  ? 1.4341 1.4914 1.5367 0.2375  -0.3037 0.1304  20  ASP B OD1 
1953 O OD2 . ASP B 20  ? 1.5519 1.5291 1.5810 0.2918  -0.3291 0.1663  20  ASP B OD2 
1954 N N   . ASP B 21  ? 1.1199 1.2666 1.4959 0.1860  -0.2020 0.0882  21  ASP B N   
1955 C CA  . ASP B 21  ? 1.0914 1.2721 1.5541 0.1825  -0.1809 0.0717  21  ASP B CA  
1956 C C   . ASP B 21  ? 1.0200 1.2574 1.5436 0.1598  -0.1772 0.0468  21  ASP B C   
1957 O O   . ASP B 21  ? 0.9992 1.2298 1.4927 0.1317  -0.1591 0.0468  21  ASP B O   
1958 C CB  . ASP B 21  ? 1.1018 1.2410 1.5424 0.1664  -0.1372 0.0831  21  ASP B CB  
1959 C CG  . ASP B 21  ? 1.0727 1.2368 1.5904 0.1688  -0.1133 0.0686  21  ASP B CG  
1960 O OD1 . ASP B 21  ? 1.0786 1.2811 1.6639 0.1921  -0.1317 0.0555  21  ASP B OD1 
1961 O OD2 . ASP B 21  ? 1.0428 1.1882 1.5528 0.1487  -0.0759 0.0692  21  ASP B OD2 
1962 N N   . LYS B 22  ? 0.9922 1.2846 1.6038 0.1723  -0.1943 0.0247  22  LYS B N   
1963 C CA  . LYS B 22  ? 0.9344 1.2798 1.6112 0.1505  -0.1923 -0.0007 22  LYS B CA  
1964 C C   . LYS B 22  ? 0.8561 1.1958 1.5500 0.1191  -0.1414 -0.0028 22  LYS B C   
1965 O O   . LYS B 22  ? 0.8284 1.1805 1.5272 0.0934  -0.1311 -0.0126 22  LYS B O   
1966 C CB  . LYS B 22  ? 0.9510 1.3513 1.7131 0.1659  -0.2127 -0.0251 22  LYS B CB  
1967 C CG  . LYS B 22  ? 0.9684 1.3723 1.7776 0.1785  -0.1883 -0.0264 22  LYS B CG  
1968 C CD  . LYS B 22  ? 0.9962 1.4504 1.8769 0.1779  -0.1911 -0.0529 22  LYS B CD  
1969 C CE  . LYS B 22  ? 1.0149 1.4734 1.9423 0.1872  -0.1605 -0.0555 22  LYS B CE  
1970 N NZ  . LYS B 22  ? 1.0332 1.5419 2.0374 0.1838  -0.1583 -0.0811 22  LYS B NZ  
1971 N N   . THR B 23  ? 0.8273 1.1435 1.5244 0.1235  -0.1105 0.0064  23  THR B N   
1972 C CA  . THR B 23  ? 0.7663 1.0708 1.4704 0.0991  -0.0628 0.0052  23  THR B CA  
1973 C C   . THR B 23  ? 0.7537 1.0147 1.3729 0.0774  -0.0488 0.0195  23  THR B C   
1974 O O   . THR B 23  ? 0.7217 0.9827 1.3414 0.0539  -0.0237 0.0140  23  THR B O   
1975 C CB  . THR B 23  ? 0.7520 1.0381 1.4723 0.1130  -0.0357 0.0100  23  THR B CB  
1976 O OG1 . THR B 23  ? 0.7660 1.0999 1.5771 0.1329  -0.0450 -0.0067 23  THR B OG1 
1977 C CG2 . THR B 23  ? 0.7070 0.9742 1.4198 0.0902  0.0125  0.0092  23  THR B CG2 
1978 N N   . TRP B 24  ? 0.7701 0.9932 1.3174 0.0861  -0.0643 0.0376  24  TRP B N   
1979 C CA  . TRP B 24  ? 0.7334 0.9212 1.2071 0.0666  -0.0528 0.0491  24  TRP B CA  
1980 C C   . TRP B 24  ? 0.7108 0.9213 1.1801 0.0497  -0.0636 0.0391  24  TRP B C   
1981 O O   . TRP B 24  ? 0.6968 0.8962 1.1421 0.0290  -0.0434 0.0383  24  TRP B O   
1982 C CB  . TRP B 24  ? 0.7478 0.8937 1.1528 0.0784  -0.0669 0.0694  24  TRP B CB  
1983 C CG  . TRP B 24  ? 0.7161 0.8356 1.0537 0.0585  -0.0590 0.0785  24  TRP B CG  
1984 C CD1 . TRP B 24  ? 0.6895 0.8136 0.9900 0.0544  -0.0780 0.0802  24  TRP B CD1 
1985 C CD2 . TRP B 24  ? 0.6980 0.7857 1.0012 0.0414  -0.0306 0.0844  24  TRP B CD2 
1986 N NE1 . TRP B 24  ? 0.6770 0.7770 0.9273 0.0353  -0.0602 0.0871  24  TRP B NE1 
1987 C CE2 . TRP B 24  ? 0.6824 0.7615 0.9359 0.0269  -0.0330 0.0890  24  TRP B CE2 
1988 C CE3 . TRP B 24  ? 0.6646 0.7313 0.9743 0.0379  -0.0043 0.0839  24  TRP B CE3 
1989 C CZ2 . TRP B 24  ? 0.6609 0.7163 0.8797 0.0090  -0.0117 0.0922  24  TRP B CZ2 
1990 C CZ3 . TRP B 24  ? 0.6305 0.6701 0.8994 0.0205  0.0141  0.0868  24  TRP B CZ3 
1991 C CH2 . TRP B 24  ? 0.6257 0.6624 0.8539 0.0061  0.0095  0.0904  24  TRP B CH2 
1992 N N   . SER B 25  ? 0.7303 0.9716 1.2222 0.0607  -0.0977 0.0299  25  SER B N   
1993 C CA  . SER B 25  ? 0.7225 0.9826 1.2063 0.0474  -0.1125 0.0184  25  SER B CA  
1994 C C   . SER B 25  ? 0.7097 0.9991 1.2556 0.0278  -0.0948 -0.0012 25  SER B C   
1995 O O   . SER B 25  ? 0.7189 1.0194 1.2616 0.0141  -0.1022 -0.0125 25  SER B O   
1996 C CB  . SER B 25  ? 0.7558 1.0369 1.2400 0.0674  -0.1578 0.0121  25  SER B CB  
1997 O OG  . SER B 25  ? 0.8031 1.0473 1.2022 0.0768  -0.1708 0.0310  25  SER B OG  
1998 N N   . LYS B 26  ? 0.6878 0.9858 1.2876 0.0266  -0.0689 -0.0050 26  LYS B N   
1999 C CA  . LYS B 26  ? 0.6599 0.9754 1.3123 0.0063  -0.0425 -0.0197 26  LYS B CA  
2000 C C   . LYS B 26  ? 0.6247 0.9040 1.2203 -0.0133 -0.0161 -0.0117 26  LYS B C   
2001 O O   . LYS B 26  ? 0.6178 0.9023 1.2264 -0.0307 -0.0078 -0.0222 26  LYS B O   
2002 C CB  . LYS B 26  ? 0.7043 1.0321 1.4191 0.0111  -0.0152 -0.0235 26  LYS B CB  
2003 C CG  . LYS B 26  ? 0.7648 1.1310 1.5405 0.0313  -0.0401 -0.0356 26  LYS B CG  
2004 C CD  . LYS B 26  ? 0.8139 1.1803 1.6274 0.0353  -0.0076 -0.0391 26  LYS B CD  
2005 C CE  . LYS B 26  ? 0.8532 1.2553 1.7192 0.0558  -0.0324 -0.0522 26  LYS B CE  
2006 N NZ  . LYS B 26  ? 0.8740 1.2782 1.7786 0.0599  0.0005  -0.0567 26  LYS B NZ  
2007 N N   . LEU B 27  ? 0.6191 0.8608 1.1532 -0.0095 -0.0044 0.0056  27  LEU B N   
2008 C CA  . LEU B 27  ? 0.5935 0.8028 1.0749 -0.0239 0.0174  0.0117  27  LEU B CA  
2009 C C   . LEU B 27  ? 0.5977 0.7899 1.0129 -0.0247 0.0005  0.0203  27  LEU B C   
2010 O O   . LEU B 27  ? 0.6122 0.7906 0.9936 -0.0363 0.0089  0.0195  27  LEU B O   
2011 C CB  . LEU B 27  ? 0.5822 0.7625 1.0489 -0.0217 0.0481  0.0202  27  LEU B CB  
2012 C CG  . LEU B 27  ? 0.5730 0.7595 1.0900 -0.0248 0.0786  0.0128  27  LEU B CG  
2013 C CD1 . LEU B 27  ? 0.5774 0.7292 1.0637 -0.0194 0.1060  0.0209  27  LEU B CD1 
2014 C CD2 . LEU B 27  ? 0.5639 0.7508 1.0904 -0.0426 0.0935  0.0046  27  LEU B CD2 
2015 N N   . PHE B 28  ? 0.6225 0.8141 1.0187 -0.0112 -0.0217 0.0287  28  PHE B N   
2016 C CA  . PHE B 28  ? 0.6284 0.7987 0.9600 -0.0124 -0.0298 0.0396  28  PHE B CA  
2017 C C   . PHE B 28  ? 0.6459 0.8279 0.9601 -0.0021 -0.0617 0.0402  28  PHE B C   
2018 O O   . PHE B 28  ? 0.6730 0.8756 1.0220 0.0120  -0.0828 0.0352  28  PHE B O   
2019 C CB  . PHE B 28  ? 0.5973 0.7351 0.8989 -0.0073 -0.0172 0.0547  28  PHE B CB  
2020 C CG  . PHE B 28  ? 0.5438 0.6630 0.8428 -0.0165 0.0114  0.0535  28  PHE B CG  
2021 C CD1 . PHE B 28  ? 0.5289 0.6363 0.7928 -0.0299 0.0217  0.0519  28  PHE B CD1 
2022 C CD2 . PHE B 28  ? 0.5279 0.6412 0.8572 -0.0093 0.0270  0.0528  28  PHE B CD2 
2023 C CE1 . PHE B 28  ? 0.5352 0.6236 0.7906 -0.0349 0.0434  0.0495  28  PHE B CE1 
2024 C CE2 . PHE B 28  ? 0.5421 0.6339 0.8590 -0.0155 0.0524  0.0510  28  PHE B CE2 
2025 C CZ  . PHE B 28  ? 0.5469 0.6252 0.8246 -0.0277 0.0587  0.0494  28  PHE B CZ  
2026 N N   . PRO B 29  ? 0.6331 0.8024 0.8923 -0.0077 -0.0653 0.0451  29  PRO B N   
2027 C CA  . PRO B 29  ? 0.6905 0.8607 0.9149 0.0041  -0.0922 0.0489  29  PRO B CA  
2028 C C   . PRO B 29  ? 0.7914 0.9340 0.9857 0.0201  -0.0976 0.0687  29  PRO B C   
2029 O O   . PRO B 29  ? 0.8063 0.9207 0.9821 0.0147  -0.0757 0.0813  29  PRO B O   
2030 C CB  . PRO B 29  ? 0.6498 0.8117 0.8248 -0.0087 -0.0844 0.0484  29  PRO B CB  
2031 C CG  . PRO B 29  ? 0.6417 0.7898 0.8163 -0.0234 -0.0547 0.0513  29  PRO B CG  
2032 C CD  . PRO B 29  ? 0.6020 0.7589 0.8310 -0.0240 -0.0452 0.0446  29  PRO B CD  
2033 N N   . SER B 30  ? 0.8456 0.9936 1.0342 0.0407  -0.1279 0.0702  30  SER B N   
2034 C CA  . SER B 30  ? 0.8839 0.9996 1.0398 0.0605  -0.1361 0.0902  30  SER B CA  
2035 C C   . SER B 30  ? 0.9063 0.9805 0.9814 0.0556  -0.1249 0.1097  30  SER B C   
2036 O O   . SER B 30  ? 0.9808 1.0147 1.0243 0.0618  -0.1153 0.1295  30  SER B O   
2037 C CB  . SER B 30  ? 0.9497 1.0830 1.1196 0.0882  -0.1764 0.0850  30  SER B CB  
2038 O OG  . SER B 30  ? 0.9681 1.1397 1.2227 0.0936  -0.1829 0.0680  30  SER B OG  
2039 N N   . ILE B 31  ? 0.8701 0.9527 0.9133 0.0439  -0.1240 0.1032  31  ILE B N   
2040 C CA  . ILE B 31  ? 0.9050 0.9538 0.8759 0.0367  -0.1085 0.1192  31  ILE B CA  
2041 C C   . ILE B 31  ? 0.8552 0.9105 0.8326 0.0094  -0.0771 0.1127  31  ILE B C   
2042 O O   . ILE B 31  ? 0.8137 0.9013 0.8284 -0.0003 -0.0766 0.0935  31  ILE B O   
2043 C CB  . ILE B 31  ? 0.9564 1.0066 0.8750 0.0486  -0.1314 0.1171  31  ILE B CB  
2044 C CG1 . ILE B 31  ? 0.9963 1.0477 0.9157 0.0792  -0.1708 0.1180  31  ILE B CG1 
2045 C CG2 . ILE B 31  ? 1.0110 1.0203 0.8502 0.0427  -0.1102 0.1369  31  ILE B CG2 
2046 C CD1 . ILE B 31  ? 1.0140 1.0883 0.9146 0.0912  -0.2039 0.1010  31  ILE B CD1 
2047 N N   . VAL B 32  ? 0.8634 0.8867 0.8067 -0.0022 -0.0514 0.1278  32  VAL B N   
2048 C CA  . VAL B 32  ? 0.7889 0.8204 0.7422 -0.0263 -0.0241 0.1200  32  VAL B CA  
2049 C C   . VAL B 32  ? 0.8733 0.8809 0.7740 -0.0383 -0.0022 0.1321  32  VAL B C   
2050 O O   . VAL B 32  ? 0.8791 0.8890 0.7905 -0.0581 0.0220  0.1277  32  VAL B O   
2051 C CB  . VAL B 32  ? 0.7081 0.7321 0.7012 -0.0344 -0.0090 0.1192  32  VAL B CB  
2052 C CG1 . VAL B 32  ? 0.6469 0.6971 0.6941 -0.0267 -0.0214 0.1053  32  VAL B CG1 
2053 C CG2 . VAL B 32  ? 0.7060 0.6856 0.6775 -0.0281 -0.0030 0.1397  32  VAL B CG2 
2054 N N   . SER B 33  ? 0.9179 0.9029 0.7618 -0.0259 -0.0103 0.1460  33  SER B N   
2055 C CA  . SER B 33  ? 0.9805 0.9345 0.7681 -0.0370 0.0159  0.1613  33  SER B CA  
2056 C C   . SER B 33  ? 0.9910 0.9722 0.7647 -0.0494 0.0292  0.1474  33  SER B C   
2057 O O   . SER B 33  ? 1.0226 0.9991 0.7892 -0.0695 0.0607  0.1492  33  SER B O   
2058 C CB  . SER B 33  ? 1.0434 0.9517 0.7630 -0.0159 0.0043  0.1852  33  SER B CB  
2059 O OG  . SER B 33  ? 1.0832 1.0102 0.7902 0.0075  -0.0315 0.1767  33  SER B OG  
2060 N N   . ASP B 34  ? 0.9628 0.9730 0.7365 -0.0375 0.0058  0.1315  34  ASP B N   
2061 C CA  . ASP B 34  ? 0.9842 1.0185 0.7423 -0.0449 0.0160  0.1162  34  ASP B CA  
2062 C C   . ASP B 34  ? 0.9160 0.9918 0.7378 -0.0574 0.0193  0.0921  34  ASP B C   
2063 O O   . ASP B 34  ? 0.8781 0.9657 0.7485 -0.0551 0.0052  0.0854  34  ASP B O   
2064 C CB  . ASP B 34  ? 1.0350 1.0723 0.7516 -0.0242 -0.0122 0.1100  34  ASP B CB  
2065 C CG  . ASP B 34  ? 1.0368 1.1011 0.8022 -0.0121 -0.0479 0.0931  34  ASP B CG  
2066 O OD1 . ASP B 34  ? 1.0055 1.1029 0.8108 -0.0191 -0.0509 0.0705  34  ASP B OD1 
2067 O OD2 . ASP B 34  ? 1.0594 1.1109 0.8255 0.0045  -0.0720 0.1021  34  ASP B OD2 
2068 N N   . PRO B 35  ? 0.9014 0.9976 0.7209 -0.0686 0.0386  0.0790  35  PRO B N   
2069 C CA  . PRO B 35  ? 0.8609 0.9902 0.7342 -0.0792 0.0450  0.0585  35  PRO B CA  
2070 C C   . PRO B 35  ? 0.8396 0.9883 0.7518 -0.0703 0.0195  0.0421  35  PRO B C   
2071 O O   . PRO B 35  ? 0.7814 0.9426 0.7360 -0.0765 0.0230  0.0329  35  PRO B O   
2072 C CB  . PRO B 35  ? 0.8513 0.9987 0.7038 -0.0841 0.0630  0.0463  35  PRO B CB  
2073 C CG  . PRO B 35  ? 0.8943 1.0130 0.6896 -0.0866 0.0823  0.0659  35  PRO B CG  
2074 C CD  . PRO B 35  ? 0.9428 1.0297 0.7051 -0.0702 0.0577  0.0835  35  PRO B CD  
2075 N N   . ASP B 36  ? 0.8864 1.0357 0.7835 -0.0563 -0.0050 0.0378  36  ASP B N   
2076 C CA  . ASP B 36  ? 0.8644 1.0312 0.8018 -0.0516 -0.0250 0.0205  36  ASP B CA  
2077 C C   . ASP B 36  ? 0.7767 0.9378 0.7529 -0.0490 -0.0358 0.0276  36  ASP B C   
2078 O O   . ASP B 36  ? 0.7439 0.9150 0.7624 -0.0523 -0.0370 0.0174  36  ASP B O   
2079 C CB  . ASP B 36  ? 0.9790 1.1521 0.8928 -0.0399 -0.0479 0.0075  36  ASP B CB  
2080 C CG  . ASP B 36  ? 1.0773 1.2640 0.9761 -0.0419 -0.0391 -0.0108 36  ASP B CG  
2081 O OD1 . ASP B 36  ? 1.0702 1.2692 1.0027 -0.0489 -0.0286 -0.0219 36  ASP B OD1 
2082 O OD2 . ASP B 36  ? 1.1528 1.3356 1.0028 -0.0343 -0.0430 -0.0144 36  ASP B OD2 
2083 N N   . ARG B 37  ? 0.7832 0.9255 0.7423 -0.0417 -0.0419 0.0452  37  ARG B N   
2084 C CA  . ARG B 37  ? 0.7914 0.9285 0.7880 -0.0375 -0.0490 0.0521  37  ARG B CA  
2085 C C   . ARG B 37  ? 0.7288 0.8553 0.7432 -0.0495 -0.0250 0.0590  37  ARG B C   
2086 O O   . ARG B 37  ? 0.7072 0.8352 0.7605 -0.0499 -0.0239 0.0568  37  ARG B O   
2087 C CB  . ARG B 37  ? 0.8839 1.0015 0.8544 -0.0218 -0.0651 0.0684  37  ARG B CB  
2088 C CG  . ARG B 37  ? 1.0029 1.1189 0.9256 -0.0088 -0.0855 0.0665  37  ARG B CG  
2089 C CD  . ARG B 37  ? 1.0444 1.1879 0.9987 0.0004  -0.1159 0.0455  37  ARG B CD  
2090 N NE  . ARG B 37  ? 1.1239 1.2634 1.0257 0.0154  -0.1395 0.0416  37  ARG B NE  
2091 C CZ  . ARG B 37  ? 1.1566 1.2880 1.0395 0.0367  -0.1691 0.0472  37  ARG B CZ  
2092 N NH1 . ARG B 37  ? 1.1449 1.2738 1.0634 0.0455  -0.1776 0.0568  37  ARG B NH1 
2093 N NH2 . ARG B 37  ? 1.2093 1.3346 1.0360 0.0518  -0.1917 0.0418  37  ARG B NH2 
2094 N N   . SER B 38  ? 0.7065 0.8223 0.6920 -0.0595 -0.0050 0.0659  38  SER B N   
2095 C CA  . SER B 38  ? 0.6435 0.7502 0.6443 -0.0724 0.0158  0.0690  38  SER B CA  
2096 C C   . SER B 38  ? 0.6210 0.7481 0.6574 -0.0779 0.0191  0.0512  38  SER B C   
2097 O O   . SER B 38  ? 0.5748 0.6947 0.6345 -0.0806 0.0247  0.0506  38  SER B O   
2098 C CB  . SER B 38  ? 0.6241 0.7212 0.5934 -0.0847 0.0374  0.0759  38  SER B CB  
2099 O OG  . SER B 38  ? 0.6109 0.7038 0.6022 -0.0989 0.0550  0.0738  38  SER B OG  
2100 N N   . SER B 39  ? 0.6200 0.7683 0.6554 -0.0774 0.0153  0.0366  39  SER B N   
2101 C CA  . SER B 39  ? 0.5769 0.7383 0.6380 -0.0789 0.0167  0.0209  39  SER B CA  
2102 C C   . SER B 39  ? 0.5372 0.6961 0.6233 -0.0717 0.0048  0.0179  39  SER B C   
2103 O O   . SER B 39  ? 0.5280 0.6827 0.6333 -0.0721 0.0096  0.0128  39  SER B O   
2104 C CB  . SER B 39  ? 0.6172 0.7982 0.6682 -0.0789 0.0175  0.0059  39  SER B CB  
2105 O OG  . SER B 39  ? 0.7086 0.8928 0.7379 -0.0725 0.0060  0.0049  39  SER B OG  
2106 N N   . ASN B 40  ? 0.5170 0.6779 0.6024 -0.0649 -0.0103 0.0206  40  ASN B N   
2107 C CA  . ASN B 40  ? 0.5157 0.6787 0.6351 -0.0602 -0.0200 0.0169  40  ASN B CA  
2108 C C   . ASN B 40  ? 0.4909 0.6405 0.6312 -0.0597 -0.0106 0.0266  40  ASN B C   
2109 O O   . ASN B 40  ? 0.5118 0.6594 0.6797 -0.0603 -0.0046 0.0217  40  ASN B O   
2110 C CB  . ASN B 40  ? 0.5826 0.7544 0.7011 -0.0518 -0.0418 0.0159  40  ASN B CB  
2111 C CG  . ASN B 40  ? 0.6453 0.8313 0.7662 -0.0517 -0.0543 -0.0023 40  ASN B CG  
2112 O OD1 . ASN B 40  ? 0.6590 0.8456 0.7782 -0.0570 -0.0452 -0.0123 40  ASN B OD1 
2113 N ND2 . ASN B 40  ? 0.6800 0.8760 0.8043 -0.0440 -0.0775 -0.0082 40  ASN B ND2 
2114 N N   . PHE B 41  ? 0.4633 0.5994 0.5873 -0.0584 -0.0072 0.0405  41  PHE B N   
2115 C CA  . PHE B 41  ? 0.4552 0.5749 0.5952 -0.0566 0.0020  0.0485  41  PHE B CA  
2116 C C   . PHE B 41  ? 0.4199 0.5318 0.5631 -0.0637 0.0182  0.0423  41  PHE B C   
2117 O O   . PHE B 41  ? 0.5220 0.6247 0.6840 -0.0609 0.0259  0.0413  41  PHE B O   
2118 C CB  . PHE B 41  ? 0.5430 0.6421 0.6592 -0.0544 0.0036  0.0644  41  PHE B CB  
2119 C CG  . PHE B 41  ? 0.5232 0.6007 0.6511 -0.0535 0.0153  0.0702  41  PHE B CG  
2120 C CD1 . PHE B 41  ? 0.5085 0.5831 0.6636 -0.0414 0.0106  0.0732  41  PHE B CD1 
2121 C CD2 . PHE B 41  ? 0.5496 0.6118 0.6651 -0.0644 0.0306  0.0696  41  PHE B CD2 
2122 C CE1 . PHE B 41  ? 0.4992 0.5520 0.6630 -0.0389 0.0228  0.0767  41  PHE B CE1 
2123 C CE2 . PHE B 41  ? 0.5395 0.5789 0.6630 -0.0631 0.0401  0.0720  41  PHE B CE2 
2124 C CZ  . PHE B 41  ? 0.5081 0.5408 0.6528 -0.0498 0.0372  0.0761  41  PHE B CZ  
2125 N N   . MET B 42  ? 0.3801 0.4958 0.5036 -0.0713 0.0232  0.0369  42  MET B N   
2126 C CA  . MET B 42  ? 0.4210 0.5317 0.5446 -0.0751 0.0328  0.0282  42  MET B CA  
2127 C C   . MET B 42  ? 0.4687 0.5797 0.6035 -0.0699 0.0327  0.0195  42  MET B C   
2128 O O   . MET B 42  ? 0.4906 0.5861 0.6254 -0.0672 0.0407  0.0170  42  MET B O   
2129 C CB  . MET B 42  ? 0.4248 0.5484 0.5343 -0.0827 0.0354  0.0208  42  MET B CB  
2130 C CG  . MET B 42  ? 0.4798 0.5958 0.5793 -0.0922 0.0436  0.0289  42  MET B CG  
2131 S SD  . MET B 42  ? 0.6012 0.6889 0.7077 -0.0941 0.0512  0.0330  42  MET B SD  
2132 C CE  . MET B 42  ? 0.4954 0.5822 0.5972 -0.1117 0.0630  0.0309  42  MET B CE  
2133 N N   . ILE B 43  ? 0.4630 0.5873 0.6035 -0.0683 0.0244  0.0146  43  ILE B N   
2134 C CA  . ILE B 43  ? 0.4641 0.5831 0.6160 -0.0655 0.0266  0.0074  43  ILE B CA  
2135 C C   . ILE B 43  ? 0.4941 0.6014 0.6698 -0.0635 0.0352  0.0131  43  ILE B C   
2136 O O   . ILE B 43  ? 0.4871 0.5758 0.6616 -0.0616 0.0480  0.0118  43  ILE B O   
2137 C CB  . ILE B 43  ? 0.4127 0.5464 0.5697 -0.0659 0.0150  -0.0008 43  ILE B CB  
2138 C CG1 . ILE B 43  ? 0.4878 0.6326 0.6210 -0.0660 0.0109  -0.0085 43  ILE B CG1 
2139 C CG2 . ILE B 43  ? 0.3775 0.4998 0.5506 -0.0658 0.0199  -0.0073 43  ILE B CG2 
2140 C CD1 . ILE B 43  ? 0.5236 0.6803 0.6546 -0.0648 -0.0003 -0.0190 43  ILE B CD1 
2141 N N   . ARG B 44  ? 0.4996 0.6166 0.6945 -0.0622 0.0289  0.0194  44  ARG B N   
2142 C CA  . ARG B 44  ? 0.4912 0.6036 0.7168 -0.0588 0.0376  0.0231  44  ARG B CA  
2143 C C   . ARG B 44  ? 0.4986 0.5884 0.7110 -0.0559 0.0527  0.0289  44  ARG B C   
2144 O O   . ARG B 44  ? 0.5092 0.5874 0.7366 -0.0531 0.0683  0.0291  44  ARG B O   
2145 C CB  . ARG B 44  ? 0.5180 0.6483 0.7672 -0.0536 0.0222  0.0269  44  ARG B CB  
2146 C CG  . ARG B 44  ? 0.5830 0.7358 0.8447 -0.0548 0.0033  0.0179  44  ARG B CG  
2147 C CD  . ARG B 44  ? 0.6144 0.7713 0.9094 -0.0611 0.0115  0.0066  44  ARG B CD  
2148 N NE  . ARG B 44  ? 0.6465 0.8028 0.9818 -0.0598 0.0269  0.0081  44  ARG B NE  
2149 C CZ  . ARG B 44  ? 0.6368 0.7908 1.0044 -0.0669 0.0437  0.0012  44  ARG B CZ  
2150 N NH1 . ARG B 44  ? 0.6016 0.7494 0.9636 -0.0754 0.0450  -0.0072 44  ARG B NH1 
2151 N NH2 . ARG B 44  ? 0.6699 0.8253 1.0749 -0.0655 0.0617  0.0025  44  ARG B NH2 
2152 N N   . ALA B 45  ? 0.5249 0.6078 0.7098 -0.0575 0.0496  0.0320  45  ALA B N   
2153 C CA  . ALA B 45  ? 0.5231 0.5834 0.6946 -0.0558 0.0606  0.0342  45  ALA B CA  
2154 C C   . ALA B 45  ? 0.4710 0.5149 0.6234 -0.0544 0.0708  0.0264  45  ALA B C   
2155 O O   . ALA B 45  ? 0.4631 0.4859 0.6112 -0.0491 0.0843  0.0264  45  ALA B O   
2156 C CB  . ALA B 45  ? 0.4789 0.5362 0.6312 -0.0613 0.0552  0.0376  45  ALA B CB  
2157 N N   . ILE B 46  ? 0.4938 0.5452 0.6310 -0.0568 0.0641  0.0194  46  ILE B N   
2158 C CA  . ILE B 46  ? 0.5183 0.5516 0.6315 -0.0513 0.0693  0.0123  46  ILE B CA  
2159 C C   . ILE B 46  ? 0.4957 0.5097 0.6142 -0.0468 0.0858  0.0158  46  ILE B C   
2160 O O   . ILE B 46  ? 0.5659 0.5515 0.6601 -0.0397 0.0982  0.0152  46  ILE B O   
2161 C CB  . ILE B 46  ? 0.5308 0.5774 0.6337 -0.0513 0.0580  0.0042  46  ILE B CB  
2162 C CG1 . ILE B 46  ? 0.4942 0.5598 0.5925 -0.0562 0.0475  -0.0019 46  ILE B CG1 
2163 C CG2 . ILE B 46  ? 0.6118 0.6336 0.6874 -0.0412 0.0620  -0.0010 46  ILE B CG2 
2164 C CD1 . ILE B 46  ? 0.4641 0.5513 0.5609 -0.0562 0.0377  -0.0106 46  ILE B CD1 
2165 N N   . TYR B 47  ? 0.4986 0.5277 0.6492 -0.0512 0.0866  0.0183  47  TYR B N   
2166 C CA  . TYR B 47  ? 0.5333 0.5490 0.7008 -0.0513 0.1055  0.0202  47  TYR B CA  
2167 C C   . TYR B 47  ? 0.5358 0.5411 0.7164 -0.0475 0.1236  0.0250  47  TYR B C   
2168 O O   . TYR B 47  ? 0.5566 0.5339 0.7221 -0.0437 0.1462  0.0265  47  TYR B O   
2169 C CB  . TYR B 47  ? 0.4450 0.4861 0.6538 -0.0590 0.0983  0.0173  47  TYR B CB  
2170 C CG  . TYR B 47  ? 0.4861 0.5233 0.7324 -0.0635 0.1190  0.0173  47  TYR B CG  
2171 C CD1 . TYR B 47  ? 0.4879 0.4962 0.7216 -0.0664 0.1384  0.0169  47  TYR B CD1 
2172 C CD2 . TYR B 47  ? 0.5379 0.5999 0.8345 -0.0645 0.1198  0.0172  47  TYR B CD2 
2173 C CE1 . TYR B 47  ? 0.4929 0.4973 0.7655 -0.0740 0.1627  0.0166  47  TYR B CE1 
2174 C CE2 . TYR B 47  ? 0.5231 0.5885 0.8652 -0.0702 0.1407  0.0142  47  TYR B CE2 
2175 C CZ  . TYR B 47  ? 0.5045 0.5414 0.8359 -0.0769 0.1642  0.0140  47  TYR B CZ  
2176 O OH  . TYR B 47  ? 0.5284 0.5673 0.9057 -0.0848 0.1884  0.0105  47  TYR B OH  
2177 N N   . VAL B 48  ? 0.5368 0.5608 0.7413 -0.0469 0.1149  0.0276  48  VAL B N   
2178 C CA  . VAL B 48  ? 0.5129 0.5296 0.7355 -0.0408 0.1304  0.0307  48  VAL B CA  
2179 C C   . VAL B 48  ? 0.5091 0.4929 0.6887 -0.0340 0.1405  0.0300  48  VAL B C   
2180 O O   . VAL B 48  ? 0.5414 0.5046 0.7175 -0.0278 0.1634  0.0300  48  VAL B O   
2181 C CB  . VAL B 48  ? 0.4535 0.4939 0.7082 -0.0381 0.1148  0.0342  48  VAL B CB  
2182 C CG1 . VAL B 48  ? 0.4510 0.4799 0.7200 -0.0284 0.1295  0.0362  48  VAL B CG1 
2183 C CG2 . VAL B 48  ? 0.4139 0.4874 0.7143 -0.0416 0.1033  0.0316  48  VAL B CG2 
2184 N N   . VAL B 49  ? 0.5115 0.4910 0.6596 -0.0353 0.1243  0.0274  49  VAL B N   
2185 C CA  . VAL B 49  ? 0.5804 0.5314 0.6915 -0.0295 0.1287  0.0226  49  VAL B CA  
2186 C C   . VAL B 49  ? 0.6282 0.5498 0.6986 -0.0223 0.1414  0.0185  49  VAL B C   
2187 O O   . VAL B 49  ? 0.6613 0.5544 0.7099 -0.0137 0.1588  0.0170  49  VAL B O   
2188 C CB  . VAL B 49  ? 0.6094 0.5670 0.7056 -0.0354 0.1084  0.0177  49  VAL B CB  
2189 C CG1 . VAL B 49  ? 0.6413 0.5709 0.7013 -0.0303 0.1094  0.0076  49  VAL B CG1 
2190 C CG2 . VAL B 49  ? 0.5901 0.5615 0.7131 -0.0404 0.1010  0.0248  49  VAL B CG2 
2191 N N   . PHE B 50  ? 0.6653 0.5899 0.7211 -0.0237 0.1336  0.0170  50  PHE B N   
2192 C CA  . PHE B 50  ? 0.6787 0.5680 0.6856 -0.0134 0.1426  0.0147  50  PHE B CA  
2193 C C   . PHE B 50  ? 0.6840 0.5496 0.6915 -0.0110 0.1740  0.0226  50  PHE B C   
2194 O O   . PHE B 50  ? 0.7496 0.5744 0.7085 0.0000  0.1903  0.0232  50  PHE B O   
2195 C CB  . PHE B 50  ? 0.6405 0.5369 0.6318 -0.0127 0.1244  0.0107  50  PHE B CB  
2196 C CG  . PHE B 50  ? 0.6437 0.5511 0.6180 -0.0100 0.0998  -0.0011 50  PHE B CG  
2197 C CD1 . PHE B 50  ? 0.6775 0.5569 0.6046 0.0033  0.0946  -0.0102 50  PHE B CD1 
2198 C CD2 . PHE B 50  ? 0.6195 0.5652 0.6255 -0.0209 0.0826  -0.0047 50  PHE B CD2 
2199 C CE1 . PHE B 50  ? 0.6768 0.5720 0.5987 0.0044  0.0706  -0.0251 50  PHE B CE1 
2200 C CE2 . PHE B 50  ? 0.6425 0.6018 0.6418 -0.0214 0.0641  -0.0172 50  PHE B CE2 
2201 C CZ  . PHE B 50  ? 0.6623 0.5993 0.6248 -0.0095 0.0571  -0.0288 50  PHE B CZ  
2202 N N   . SER B 51  ? 0.6355 0.5264 0.6981 -0.0211 0.1831  0.0276  51  SER B N   
2203 C CA  . SER B 51  ? 0.6273 0.5047 0.7086 -0.0223 0.2168  0.0327  51  SER B CA  
2204 C C   . SER B 51  ? 0.5928 0.4500 0.6596 -0.0126 0.2362  0.0320  51  SER B C   
2205 O O   . SER B 51  ? 0.6476 0.4665 0.6782 -0.0055 0.2651  0.0346  51  SER B O   
2206 C CB  . SER B 51  ? 0.6436 0.5626 0.7998 -0.0344 0.2167  0.0331  51  SER B CB  
2207 O OG  . SER B 51  ? 0.6442 0.5692 0.8114 -0.0437 0.2115  0.0327  51  SER B OG  
2208 N N   . ALA B 52  ? 0.6284 0.5070 0.7193 -0.0115 0.2218  0.0287  52  ALA B N   
2209 C CA  . ALA B 52  ? 0.6045 0.4641 0.6849 -0.0014 0.2376  0.0258  52  ALA B CA  
2210 C C   . ALA B 52  ? 0.6474 0.4606 0.6511 0.0102  0.2417  0.0207  52  ALA B C   
2211 O O   . ALA B 52  ? 0.7344 0.5153 0.7102 0.0200  0.2701  0.0201  52  ALA B O   
2212 C CB  . ALA B 52  ? 0.6031 0.4849 0.7126 -0.0017 0.2163  0.0235  52  ALA B CB  
2213 N N   . VAL B 53  ? 0.6490 0.4598 0.6189 0.0103  0.2132  0.0155  53  VAL B N   
2214 C CA  . VAL B 53  ? 0.7306 0.5015 0.6284 0.0235  0.2087  0.0073  53  VAL B CA  
2215 C C   . VAL B 53  ? 0.8288 0.5588 0.6769 0.0332  0.2339  0.0139  53  VAL B C   
2216 O O   . VAL B 53  ? 0.9413 0.6279 0.7308 0.0479  0.2492  0.0106  53  VAL B O   
2217 C CB  . VAL B 53  ? 0.7174 0.5029 0.6010 0.0215  0.1719  -0.0017 53  VAL B CB  
2218 C CG1 . VAL B 53  ? 0.8040 0.5517 0.6164 0.0379  0.1621  -0.0136 53  VAL B CG1 
2219 C CG2 . VAL B 53  ? 0.6714 0.4895 0.5978 0.0100  0.1525  -0.0067 53  VAL B CG2 
2220 N N   . LEU B 54  ? 0.7606 0.4996 0.6278 0.0254  0.2397  0.0233  54  LEU B N   
2221 C CA  . LEU B 54  ? 0.8190 0.5130 0.6404 0.0321  0.2679  0.0326  54  LEU B CA  
2222 C C   . LEU B 54  ? 0.8256 0.4966 0.6485 0.0337  0.3134  0.0382  54  LEU B C   
2223 O O   . LEU B 54  ? 0.8424 0.4592 0.5959 0.0472  0.3382  0.0421  54  LEU B O   
2224 C CB  . LEU B 54  ? 0.8374 0.5467 0.6920 0.0196  0.2676  0.0403  54  LEU B CB  
2225 C CG  . LEU B 54  ? 0.8583 0.5714 0.6890 0.0238  0.2326  0.0364  54  LEU B CG  
2226 C CD1 . LEU B 54  ? 0.8470 0.5824 0.7245 0.0091  0.2318  0.0411  54  LEU B CD1 
2227 C CD2 . LEU B 54  ? 0.8751 0.5293 0.6147 0.0453  0.2331  0.0379  54  LEU B CD2 
2228 N N   . ARG B 55  ? 0.8203 0.5315 0.7204 0.0219  0.3247  0.0380  55  ARG B N   
2229 C CA  . ARG B 55  ? 0.9202 0.6198 0.8380 0.0226  0.3699  0.0410  55  ARG B CA  
2230 C C   . ARG B 55  ? 0.9525 0.6269 0.8290 0.0391  0.3772  0.0328  55  ARG B C   
2231 O O   . ARG B 55  ? 0.9845 0.6213 0.8258 0.0477  0.4081  0.0346  55  ARG B O   
2232 C CB  . ARG B 55  ? 0.9063 0.6627 0.9275 0.0076  0.3737  0.0402  55  ARG B CB  
2233 C CG  . ARG B 55  ? 0.9526 0.7070 1.0068 0.0089  0.4017  0.0378  55  ARG B CG  
2234 C CD  . ARG B 55  ? 1.0546 0.7694 1.0786 0.0065  0.4266  0.0435  55  ARG B CD  
2235 N NE  . ARG B 55  ? 1.2336 0.9171 1.2365 0.0152  0.4589  0.0428  55  ARG B NE  
2236 C CZ  . ARG B 55  ? 1.3641 0.9881 1.2772 0.0298  0.4733  0.0468  55  ARG B CZ  
2237 N NH1 . ARG B 55  ? 1.4174 1.0073 1.2539 0.0388  0.4562  0.0507  55  ARG B NH1 
2238 N NH2 . ARG B 55  ? 1.4447 1.0429 1.3427 0.0368  0.5031  0.0462  55  ARG B NH2 
2239 N N   . GLN B 56  ? 0.9621 0.6552 0.8436 0.0420  0.3412  0.0229  56  GLN B N   
2240 C CA  . GLN B 56  ? 0.9772 0.6500 0.8318 0.0554  0.3446  0.0121  56  GLN B CA  
2241 C C   . GLN B 56  ? 1.0045 0.6206 0.7576 0.0728  0.3422  0.0054  56  GLN B C   
2242 O O   . GLN B 56  ? 1.1131 0.6952 0.8252 0.0868  0.3613  -0.0023 56  GLN B O   
2243 C CB  . GLN B 56  ? 0.9262 0.6334 0.8226 0.0502  0.3086  0.0042  56  GLN B CB  
2244 C CG  . GLN B 56  ? 1.0064 0.7245 0.9476 0.0546  0.3233  0.0000  56  GLN B CG  
2245 C CD  . GLN B 56  ? 1.0333 0.7856 1.0493 0.0487  0.3495  0.0082  56  GLN B CD  
2246 O OE1 . GLN B 56  ? 1.0701 0.8559 1.1296 0.0355  0.3406  0.0157  56  GLN B OE1 
2247 N NE2 . GLN B 56  ? 1.0737 0.8195 1.1082 0.0590  0.3813  0.0040  56  GLN B NE2 
2248 N N   . ARG B 57  ? 0.9843 0.5895 0.6954 0.0743  0.3172  0.0067  57  ARG B N   
2249 C CA  . ARG B 57  ? 1.0456 0.5957 0.6564 0.0945  0.3116  0.0004  57  ARG B CA  
2250 C C   . ARG B 57  ? 1.1649 0.6665 0.7219 0.1026  0.3525  0.0156  57  ARG B C   
2251 O O   . ARG B 57  ? 1.2607 0.7128 0.7331 0.1202  0.3450  0.0161  57  ARG B O   
2252 C CB  . ARG B 57  ? 1.0181 0.5794 0.6090 0.0964  0.2633  -0.0077 57  ARG B CB  
2253 C CG  . ARG B 57  ? 0.9573 0.5533 0.5842 0.0896  0.2270  -0.0250 57  ARG B CG  
2254 C CD  . ARG B 57  ? 0.9791 0.5450 0.5711 0.1013  0.2342  -0.0398 57  ARG B CD  
2255 N NE  . ARG B 57  ? 1.0089 0.5329 0.5136 0.1219  0.2137  -0.0556 57  ARG B NE  
2256 C CZ  . ARG B 57  ? 1.1136 0.5868 0.5482 0.1410  0.2303  -0.0644 57  ARG B CZ  
2257 N NH1 . ARG B 57  ? 1.0752 0.5345 0.5206 0.1415  0.2717  -0.0585 57  ARG B NH1 
2258 N NH2 . ARG B 57  ? 1.2315 0.6702 0.5870 0.1610  0.2039  -0.0803 57  ARG B NH2 
2259 N N   . ASN B 58  ? 1.1346 0.6582 0.7575 0.0861  0.3826  0.0292  58  ASN B N   
2260 C CA  . ASN B 58  ? 1.2484 0.7367 0.8537 0.0848  0.4108  0.0442  58  ASN B CA  
2261 C C   . ASN B 58  ? 1.2387 0.6899 0.7794 0.0931  0.3966  0.0520  58  ASN B C   
2262 O O   . ASN B 58  ? 1.3114 0.7062 0.7866 0.1058  0.4097  0.0600  58  ASN B O   
2263 C CB  . ASN B 58  ? 1.3679 0.8132 0.9261 0.0981  0.4342  0.0438  58  ASN B CB  
2264 C CG  . ASN B 58  ? 1.4615 0.8822 1.0312 0.0918  0.4733  0.0561  58  ASN B CG  
2265 O OD1 . ASN B 58  ? 1.4601 0.9163 1.1112 0.0766  0.4956  0.0560  58  ASN B OD1 
2266 N ND2 . ASN B 58  ? 1.5673 0.9266 1.0562 0.1048  0.4806  0.0650  58  ASN B ND2 
2267 N N   . ILE B 59  ? 1.1890 0.6703 0.7468 0.0877  0.3696  0.0493  59  ILE B N   
2268 C CA  . ILE B 59  ? 1.2066 0.6581 0.7111 0.0963  0.3530  0.0560  59  ILE B CA  
2269 C C   . ILE B 59  ? 1.2139 0.6607 0.7595 0.0805  0.3783  0.0703  59  ILE B C   
2270 O O   . ILE B 59  ? 1.2042 0.6016 0.6955 0.0906  0.3824  0.0788  59  ILE B O   
2271 C CB  . ILE B 59  ? 1.0858 0.5856 0.6224 0.0934  0.2994  0.0439  59  ILE B CB  
2272 C CG1 . ILE B 59  ? 1.0726 0.5739 0.5724 0.1091  0.2650  0.0247  59  ILE B CG1 
2273 C CG2 . ILE B 59  ? 1.1588 0.6376 0.6616 0.1007  0.2822  0.0505  59  ILE B CG2 
2274 C CD1 . ILE B 59  ? 1.0060 0.5641 0.5554 0.1014  0.2164  0.0103  59  ILE B CD1 
2275 N N   . LEU B 60  ? 1.1861 0.6845 0.8296 0.0572  0.3927  0.0695  60  LEU B N   
2276 C CA  . LEU B 60  ? 1.1898 0.6927 0.8858 0.0410  0.4153  0.0751  60  LEU B CA  
2277 C C   . LEU B 60  ? 1.1937 0.7142 0.9473 0.0320  0.4454  0.0715  60  LEU B C   
2278 O O   . LEU B 60  ? 1.1892 0.7421 0.9766 0.0315  0.4424  0.0646  60  LEU B O   
2279 C CB  . LEU B 60  ? 1.1128 0.6679 0.8808 0.0218  0.3956  0.0737  60  LEU B CB  
2280 C CG  . LEU B 60  ? 1.0867 0.6179 0.8120 0.0259  0.3761  0.0797  60  LEU B CG  
2281 C CD1 . LEU B 60  ? 0.9689 0.5579 0.7698 0.0067  0.3534  0.0760  60  LEU B CD1 
2282 C CD2 . LEU B 60  ? 1.1289 0.6098 0.8237 0.0279  0.3992  0.0867  60  LEU B CD2 
2283 N N   . GLU B 61  ? 1.2565 0.7549 1.0216 0.0252  0.4748  0.0755  61  GLU B N   
2284 C CA  . GLU B 61  ? 1.2608 0.7726 1.0797 0.0167  0.5065  0.0718  61  GLU B CA  
2285 C C   . GLU B 61  ? 1.1341 0.7227 1.0659 -0.0019 0.4959  0.0621  61  GLU B C   
2286 O O   . GLU B 61  ? 1.0781 0.7057 1.0508 -0.0120 0.4688  0.0595  61  GLU B O   
2287 C CB  . GLU B 61  ? 1.3492 0.8173 1.1528 0.0124  0.5421  0.0777  61  GLU B CB  
2288 C CG  . GLU B 61  ? 1.5046 0.8911 1.1987 0.0334  0.5619  0.0872  61  GLU B CG  
2289 C CD  . GLU B 61  ? 1.6699 1.0118 1.2824 0.0475  0.5405  0.0946  61  GLU B CD  
2290 O OE1 . GLU B 61  ? 1.7845 1.1151 1.4048 0.0389  0.5460  0.0986  61  GLU B OE1 
2291 O OE2 . GLU B 61  ? 1.6801 0.9978 1.2204 0.0680  0.5172  0.0955  61  GLU B OE2 
2292 N N   . LYS B 62  ? 1.1430 0.7506 1.1220 -0.0047 0.5168  0.0567  62  LYS B N   
2293 C CA  . LYS B 62  ? 1.1152 0.7921 1.1988 -0.0178 0.5073  0.0465  62  LYS B CA  
2294 C C   . LYS B 62  ? 1.0843 0.7916 1.2347 -0.0369 0.5045  0.0422  62  LYS B C   
2295 O O   . LYS B 62  ? 1.0034 0.7697 1.2296 -0.0464 0.4805  0.0337  62  LYS B O   
2296 C CB  . LYS B 62  ? 1.2254 0.9055 1.3354 -0.0141 0.5360  0.0420  62  LYS B CB  
2297 C CG  . LYS B 62  ? 1.2365 0.9778 1.4547 -0.0269 0.5377  0.0310  62  LYS B CG  
2298 C CD  . LYS B 62  ? 1.2780 1.0226 1.5133 -0.0185 0.5620  0.0264  62  LYS B CD  
2299 C CE  . LYS B 62  ? 1.2850 1.0704 1.6136 -0.0312 0.5808  0.0162  62  LYS B CE  
2300 N NZ  . LYS B 62  ? 1.3591 1.1067 1.6740 -0.0416 0.6191  0.0194  62  LYS B NZ  
2301 N N   . GLU B 63  ? 1.1789 0.8430 1.2974 -0.0415 0.5280  0.0476  63  GLU B N   
2302 C CA  . GLU B 63  ? 1.1954 0.8814 1.3730 -0.0605 0.5291  0.0423  63  GLU B CA  
2303 C C   . GLU B 63  ? 1.0812 0.7924 1.2679 -0.0661 0.4900  0.0413  63  GLU B C   
2304 O O   . GLU B 63  ? 1.0106 0.7576 1.2620 -0.0820 0.4795  0.0330  63  GLU B O   
2305 C CB  . GLU B 63  ? 1.3591 0.9842 1.4932 -0.0634 0.5680  0.0494  63  GLU B CB  
2306 C CG  . GLU B 63  ? 1.4777 1.0869 1.6285 -0.0654 0.6122  0.0476  63  GLU B CG  
2307 C CD  . GLU B 63  ? 1.5664 1.1370 1.6471 -0.0454 0.6261  0.0546  63  GLU B CD  
2308 O OE1 . GLU B 63  ? 1.6060 1.1252 1.5924 -0.0292 0.6192  0.0649  63  GLU B OE1 
2309 O OE2 . GLU B 63  ? 1.5987 1.1904 1.7183 -0.0449 0.6427  0.0487  63  GLU B OE2 
2310 N N   . TYR B 64  ? 1.0480 0.7402 1.1698 -0.0532 0.4686  0.0487  64  TYR B N   
2311 C CA  . TYR B 64  ? 0.9655 0.6778 1.0893 -0.0575 0.4334  0.0485  64  TYR B CA  
2312 C C   . TYR B 64  ? 0.8726 0.6519 1.0616 -0.0623 0.3997  0.0399  64  TYR B C   
2313 O O   . TYR B 64  ? 0.8439 0.6475 1.0492 -0.0687 0.3710  0.0376  64  TYR B O   
2314 C CB  . TYR B 64  ? 0.9565 0.6206 0.9846 -0.0412 0.4243  0.0592  64  TYR B CB  
2315 C CG  . TYR B 64  ? 1.0340 0.6276 0.9887 -0.0335 0.4499  0.0686  64  TYR B CG  
2316 C CD1 . TYR B 64  ? 1.0274 0.6022 0.9756 -0.0409 0.4481  0.0714  64  TYR B CD1 
2317 C CD2 . TYR B 64  ? 1.0866 0.6284 0.9752 -0.0178 0.4759  0.0747  64  TYR B CD2 
2318 C CE1 . TYR B 64  ? 1.0943 0.6003 0.9718 -0.0321 0.4717  0.0810  64  TYR B CE1 
2319 C CE2 . TYR B 64  ? 1.1861 0.6587 1.0015 -0.0084 0.4986  0.0840  64  TYR B CE2 
2320 C CZ  . TYR B 64  ? 1.1910 0.6459 1.0011 -0.0153 0.4967  0.0875  64  TYR B CZ  
2321 O OH  . TYR B 64  ? 1.2677 0.6500 1.0018 -0.0044 0.5194  0.0975  64  TYR B OH  
2322 N N   . PHE B 65  ? 0.8755 0.6815 1.0992 -0.0580 0.4035  0.0353  65  PHE B N   
2323 C CA  . PHE B 65  ? 0.8160 0.6780 1.0906 -0.0584 0.3718  0.0290  65  PHE B CA  
2324 C C   . PHE B 65  ? 0.8418 0.7533 1.2056 -0.0662 0.3705  0.0175  65  PHE B C   
2325 O O   . PHE B 65  ? 0.9042 0.8082 1.2934 -0.0713 0.3985  0.0137  65  PHE B O   
2326 C CB  . PHE B 65  ? 0.7582 0.6110 0.9952 -0.0433 0.3701  0.0330  65  PHE B CB  
2327 C CG  . PHE B 65  ? 0.7032 0.5106 0.8524 -0.0339 0.3677  0.0417  65  PHE B CG  
2328 C CD1 . PHE B 65  ? 0.7181 0.4651 0.7955 -0.0247 0.3945  0.0483  65  PHE B CD1 
2329 C CD2 . PHE B 65  ? 0.6431 0.4665 0.7793 -0.0330 0.3383  0.0430  65  PHE B CD2 
2330 C CE1 . PHE B 65  ? 0.7181 0.4217 0.7096 -0.0126 0.3883  0.0550  65  PHE B CE1 
2331 C CE2 . PHE B 65  ? 0.6763 0.4590 0.7326 -0.0236 0.3353  0.0493  65  PHE B CE2 
2332 C CZ  . PHE B 65  ? 0.6346 0.3573 0.6167 -0.0120 0.3585  0.0549  65  PHE B CZ  
2333 N N   . SER B 66  ? 0.8088 0.7697 1.2186 -0.0665 0.3375  0.0119  66  SER B N   
2334 C CA  . SER B 66  ? 0.8471 0.8581 1.3392 -0.0696 0.3288  0.0002  66  SER B CA  
2335 C C   . SER B 66  ? 0.8405 0.8784 1.3486 -0.0562 0.3114  0.0005  66  SER B C   
2336 O O   . SER B 66  ? 0.8036 0.8405 1.2797 -0.0508 0.2907  0.0068  66  SER B O   
2337 C CB  . SER B 66  ? 0.8442 0.8901 1.3822 -0.0821 0.3016  -0.0093 66  SER B CB  
2338 O OG  . SER B 66  ? 0.8634 0.9569 1.4800 -0.0839 0.2921  -0.0227 66  SER B OG  
2339 N N   . LYS B 67  ? 0.8715 0.9325 1.4306 -0.0506 0.3213  -0.0065 67  LYS B N   
2340 C CA  . LYS B 67  ? 0.8547 0.9364 1.4305 -0.0352 0.3086  -0.0061 67  LYS B CA  
2341 C C   . LYS B 67  ? 0.8246 0.9558 1.4490 -0.0330 0.2667  -0.0112 67  LYS B C   
2342 O O   . LYS B 67  ? 0.8032 0.9690 1.4823 -0.0400 0.2526  -0.0223 67  LYS B O   
2343 C CB  . LYS B 67  ? 0.8858 0.9735 1.4983 -0.0275 0.3346  -0.0124 67  LYS B CB  
2344 C CG  . LYS B 67  ? 0.8933 1.0006 1.5272 -0.0086 0.3228  -0.0132 67  LYS B CG  
2345 C CD  . LYS B 67  ? 0.9527 1.0521 1.6023 0.0002  0.3556  -0.0181 67  LYS B CD  
2346 C CE  . LYS B 67  ? 0.9375 1.0624 1.6228 0.0211  0.3413  -0.0220 67  LYS B CE  
2347 N NZ  . LYS B 67  ? 0.9776 1.0930 1.6735 0.0305  0.3746  -0.0277 67  LYS B NZ  
2348 N N   . ASN B 68  ? 0.8356 0.9676 1.4377 -0.0226 0.2471  -0.0036 68  ASN B N   
2349 C CA  . ASN B 68  ? 0.8267 0.9989 1.4647 -0.0167 0.2072  -0.0055 68  ASN B CA  
2350 C C   . ASN B 68  ? 0.7947 0.9701 1.4364 0.0037  0.1990  0.0007  68  ASN B C   
2351 O O   . ASN B 68  ? 0.8141 0.9566 1.4203 0.0109  0.2231  0.0065  68  ASN B O   
2352 C CB  . ASN B 68  ? 0.8398 1.0087 1.4436 -0.0278 0.1852  -0.0007 68  ASN B CB  
2353 C CG  . ASN B 68  ? 0.8736 1.0555 1.4972 -0.0432 0.1777  -0.0109 68  ASN B CG  
2354 O OD1 . ASN B 68  ? 0.8902 1.1086 1.5527 -0.0433 0.1471  -0.0196 68  ASN B OD1 
2355 N ND2 . ASN B 68  ? 0.8854 1.0346 1.4804 -0.0546 0.2052  -0.0103 68  ASN B ND2 
2356 N N   . TYR B 69  ? 0.7712 0.9820 1.4522 0.0151  0.1636  -0.0009 69  TYR B N   
2357 C CA  . TYR B 69  ? 0.7717 0.9691 1.4327 0.0368  0.1459  0.0069  69  TYR B CA  
2358 C C   . TYR B 69  ? 0.7608 0.9412 1.3621 0.0362  0.1099  0.0183  69  TYR B C   
2359 O O   . TYR B 69  ? 0.7600 0.9666 1.3744 0.0324  0.0813  0.0157  69  TYR B O   
2360 C CB  . TYR B 69  ? 0.7667 1.0064 1.5069 0.0574  0.1321  -0.0025 69  TYR B CB  
2361 C CG  . TYR B 69  ? 0.7919 1.0329 1.5632 0.0604  0.1650  -0.0128 69  TYR B CG  
2362 C CD1 . TYR B 69  ? 0.8113 1.0717 1.6150 0.0439  0.1789  -0.0258 69  TYR B CD1 
2363 C CD2 . TYR B 69  ? 0.8071 1.0251 1.5701 0.0799  0.1818  -0.0098 69  TYR B CD2 
2364 C CE1 . TYR B 69  ? 0.8382 1.0985 1.6678 0.0457  0.2101  -0.0343 69  TYR B CE1 
2365 C CE2 . TYR B 69  ? 0.8232 1.0415 1.6086 0.0825  0.2114  -0.0197 69  TYR B CE2 
2366 C CZ  . TYR B 69  ? 0.8371 1.0784 1.6572 0.0650  0.2261  -0.0312 69  TYR B CZ  
2367 O OH  . TYR B 69  ? 0.8618 1.1039 1.7063 0.0673  0.2580  -0.0402 69  TYR B OH  
2368 N N   . ILE B 70  ? 0.7536 0.8895 1.2894 0.0391  0.1132  0.0294  70  ILE B N   
2369 C CA  . ILE B 70  ? 0.7346 0.8516 1.2181 0.0401  0.0847  0.0410  70  ILE B CA  
2370 C C   . ILE B 70  ? 0.7565 0.8778 1.2589 0.0634  0.0611  0.0461  70  ILE B C   
2371 O O   . ILE B 70  ? 0.7627 0.8939 1.2561 0.0687  0.0299  0.0515  70  ILE B O   
2372 C CB  . ILE B 70  ? 0.7272 0.7965 1.1429 0.0328  0.0979  0.0482  70  ILE B CB  
2373 C CG1 . ILE B 70  ? 0.7349 0.7962 1.1301 0.0162  0.1209  0.0424  70  ILE B CG1 
2374 C CG2 . ILE B 70  ? 0.6950 0.7482 1.0628 0.0287  0.0739  0.0592  70  ILE B CG2 
2375 C CD1 . ILE B 70  ? 0.7823 0.8007 1.1228 0.0138  0.1359  0.0435  70  ILE B CD1 
2376 N N   . THR B 71  ? 0.7741 0.8840 1.2978 0.0796  0.0764  0.0442  71  THR B N   
2377 C CA  . THR B 71  ? 0.8125 0.9283 1.3654 0.1069  0.0560  0.0466  71  THR B CA  
2378 C C   . THR B 71  ? 0.8639 1.0128 1.4944 0.1201  0.0749  0.0315  71  THR B C   
2379 O O   . THR B 71  ? 0.8590 1.0239 1.5162 0.1054  0.1051  0.0210  71  THR B O   
2380 C CB  . THR B 71  ? 0.8034 0.8629 1.3012 0.1182  0.0549  0.0603  71  THR B CB  
2381 O OG1 . THR B 71  ? 0.7714 0.8057 1.2671 0.1192  0.0881  0.0542  71  THR B OG1 
2382 C CG2 . THR B 71  ? 0.7950 0.8215 1.2199 0.0994  0.0469  0.0732  71  THR B CG2 
2383 N N   . GLU B 72  ? 0.8997 1.0571 1.5661 0.1489  0.0587  0.0305  72  GLU B N   
2384 C CA  . GLU B 72  ? 0.9291 1.1228 1.6775 0.1645  0.0769  0.0141  72  GLU B CA  
2385 C C   . GLU B 72  ? 0.9411 1.0992 1.6709 0.1632  0.1210  0.0117  72  GLU B C   
2386 O O   . GLU B 72  ? 0.9178 1.0999 1.6934 0.1584  0.1534  -0.0021 72  GLU B O   
2387 C CB  . GLU B 72  ? 1.0003 1.2104 1.7894 0.2006  0.0441  0.0130  72  GLU B CB  
2388 C CG  . GLU B 72  ? 1.0364 1.2881 1.8512 0.2067  -0.0018 0.0105  72  GLU B CG  
2389 C CD  . GLU B 72  ? 1.1205 1.3808 1.9537 0.2436  -0.0375 0.0092  72  GLU B CD  
2390 O OE1 . GLU B 72  ? 1.1778 1.4038 1.9989 0.2658  -0.0281 0.0146  72  GLU B OE1 
2391 O OE2 . GLU B 72  ? 1.1329 1.4307 1.9848 0.2507  -0.0752 0.0019  72  GLU B OE2 
2392 N N   . ASN B 73  ? 0.9894 1.0869 1.6449 0.1653  0.1224  0.0242  73  ASN B N   
2393 C CA  . ASN B 73  ? 1.0091 1.0671 1.6378 0.1661  0.1595  0.0198  73  ASN B CA  
2394 C C   . ASN B 73  ? 0.9867 1.0295 1.5722 0.1378  0.1874  0.0179  73  ASN B C   
2395 O O   . ASN B 73  ? 1.0516 1.0739 1.6251 0.1378  0.2228  0.0100  73  ASN B O   
2396 C CB  . ASN B 73  ? 1.0333 1.0295 1.6019 0.1782  0.1490  0.0307  73  ASN B CB  
2397 C CG  . ASN B 73  ? 1.0553 1.0528 1.6564 0.2114  0.1239  0.0343  73  ASN B CG  
2398 O OD1 . ASN B 73  ? 1.0639 1.0208 1.6191 0.2188  0.0999  0.0494  73  ASN B OD1 
2399 N ND2 . ASN B 73  ? 1.0438 1.0871 1.7251 0.2325  0.1303  0.0203  73  ASN B ND2 
2400 N N   . LEU B 74  ? 0.8608 0.9114 1.4193 0.1162  0.1707  0.0248  74  LEU B N   
2401 C CA  . LEU B 74  ? 0.7671 0.7928 1.2692 0.0930  0.1881  0.0257  74  LEU B CA  
2402 C C   . LEU B 74  ? 0.7798 0.8412 1.3087 0.0746  0.1970  0.0212  74  LEU B C   
2403 O O   . LEU B 74  ? 0.7779 0.8714 1.3298 0.0680  0.1714  0.0232  74  LEU B O   
2404 C CB  . LEU B 74  ? 0.6915 0.6846 1.1277 0.0828  0.1637  0.0372  74  LEU B CB  
2405 C CG  . LEU B 74  ? 0.6370 0.6006 1.0106 0.0633  0.1742  0.0367  74  LEU B CG  
2406 C CD1 . LEU B 74  ? 0.6027 0.5299 0.9491 0.0693  0.2036  0.0279  74  LEU B CD1 
2407 C CD2 . LEU B 74  ? 0.6318 0.5728 0.9590 0.0543  0.1496  0.0461  74  LEU B CD2 
2408 N N   . SER B 75  ? 0.7870 0.8374 1.3079 0.0671  0.2341  0.0150  75  SER B N   
2409 C CA  . SER B 75  ? 0.7610 0.8331 1.3007 0.0486  0.2489  0.0120  75  SER B CA  
2410 C C   . SER B 75  ? 0.7978 0.8297 1.2593 0.0339  0.2576  0.0170  75  SER B C   
2411 O O   . SER B 75  ? 0.8352 0.8252 1.2360 0.0389  0.2610  0.0187  75  SER B O   
2412 C CB  . SER B 75  ? 0.7612 0.8489 1.3500 0.0500  0.2847  0.0019  75  SER B CB  
2413 O OG  . SER B 75  ? 0.7942 0.8359 1.3277 0.0511  0.3197  0.0017  75  SER B OG  
2414 N N   . CYS B 76  ? 0.7754 0.8193 1.2399 0.0171  0.2592  0.0176  76  CYS B N   
2415 C CA  . CYS B 76  ? 0.7696 0.7772 1.1627 0.0064  0.2643  0.0220  76  CYS B CA  
2416 C C   . CYS B 76  ? 0.7639 0.7785 1.1733 -0.0086 0.2839  0.0211  76  CYS B C   
2417 O O   . CYS B 76  ? 0.7428 0.7904 1.2100 -0.0142 0.2776  0.0153  76  CYS B O   
2418 C CB  . CYS B 76  ? 0.7465 0.7510 1.1011 0.0020  0.2258  0.0271  76  CYS B CB  
2419 S SG  . CYS B 76  ? 0.8823 0.9332 1.2815 -0.0083 0.1930  0.0277  76  CYS B SG  
2420 N N   . MET B 77  ? 0.7723 0.7465 1.1159 -0.0134 0.2973  0.0252  77  MET B N   
2421 C CA  . MET B 77  ? 0.7944 0.7559 1.1295 -0.0246 0.3088  0.0251  77  MET B CA  
2422 C C   . MET B 77  ? 0.7409 0.7008 1.0494 -0.0345 0.2872  0.0288  77  MET B C   
2423 O O   . MET B 77  ? 0.7420 0.6723 0.9861 -0.0302 0.2797  0.0329  77  MET B O   
2424 C CB  . MET B 77  ? 0.8485 0.7576 1.1258 -0.0187 0.3440  0.0276  77  MET B CB  
2425 C CG  . MET B 77  ? 0.8715 0.7791 1.1734 -0.0099 0.3691  0.0229  77  MET B CG  
2426 S SD  . MET B 77  ? 0.9190 0.8626 1.3058 -0.0205 0.3790  0.0147  77  MET B SD  
2427 C CE  . MET B 77  ? 0.7747 0.6659 1.1106 -0.0284 0.4124  0.0195  77  MET B CE  
2428 N N   . THR B 78  ? 0.6944 0.6847 1.0475 -0.0452 0.2704  0.0242  78  THR B N   
2429 C CA  . THR B 78  ? 0.6616 0.6518 0.9954 -0.0544 0.2507  0.0256  78  THR B CA  
2430 C C   . THR B 78  ? 0.6624 0.6242 0.9791 -0.0620 0.2684  0.0252  78  THR B C   
2431 O O   . THR B 78  ? 0.6483 0.6107 0.9964 -0.0655 0.2872  0.0205  78  THR B O   
2432 C CB  . THR B 78  ? 0.6104 0.6502 0.9983 -0.0601 0.2172  0.0196  78  THR B CB  
2433 O OG1 . THR B 78  ? 0.6240 0.6929 1.0748 -0.0613 0.2185  0.0106  78  THR B OG1 
2434 C CG2 . THR B 78  ? 0.5434 0.5963 0.9196 -0.0500 0.1914  0.0227  78  THR B CG2 
2435 N N   . LEU B 79  ? 0.6677 0.6028 0.9359 -0.0644 0.2640  0.0300  79  LEU B N   
2436 C CA  . LEU B 79  ? 0.7282 0.6284 0.9735 -0.0699 0.2807  0.0316  79  LEU B CA  
2437 C C   . LEU B 79  ? 0.7473 0.6786 1.0578 -0.0835 0.2739  0.0212  79  LEU B C   
2438 O O   . LEU B 79  ? 0.7324 0.7072 1.0859 -0.0887 0.2450  0.0136  79  LEU B O   
2439 C CB  . LEU B 79  ? 0.7394 0.6092 0.9273 -0.0685 0.2713  0.0378  79  LEU B CB  
2440 C CG  . LEU B 79  ? 0.7401 0.5751 0.8492 -0.0498 0.2669  0.0432  79  LEU B CG  
2441 C CD1 . LEU B 79  ? 0.7295 0.5646 0.8005 -0.0425 0.2315  0.0397  79  LEU B CD1 
2442 C CD2 . LEU B 79  ? 0.7929 0.5659 0.8446 -0.0426 0.3047  0.0529  79  LEU B CD2 
2443 N N   . SER B 80  ? 0.7797 0.6870 1.0954 -0.0889 0.3007  0.0201  80  SER B N   
2444 C CA  . SER B 80  ? 0.8412 0.7757 1.2213 -0.1031 0.2977  0.0080  80  SER B CA  
2445 C C   . SER B 80  ? 0.8747 0.7861 1.2380 -0.1128 0.2941  0.0071  80  SER B C   
2446 O O   . SER B 80  ? 0.9131 0.7713 1.2139 -0.1086 0.3114  0.0176  80  SER B O   
2447 C CB  . SER B 80  ? 0.9164 0.8421 1.3241 -0.1062 0.3316  0.0050  80  SER B CB  
2448 O OG  . SER B 80  ? 1.0125 0.8807 1.3707 -0.1075 0.3634  0.0131  80  SER B OG  
2449 N N   . PHE B 81  ? 0.8296 0.7778 1.2460 -0.1241 0.2707  -0.0061 81  PHE B N   
2450 C CA  . PHE B 81  ? 0.8375 0.7664 1.2452 -0.1342 0.2644  -0.0101 81  PHE B CA  
2451 C C   . PHE B 81  ? 0.8668 0.7765 1.3011 -0.1469 0.2908  -0.0158 81  PHE B C   
2452 O O   . PHE B 81  ? 0.9477 0.8432 1.3872 -0.1576 0.2870  -0.0222 81  PHE B O   
2453 C CB  . PHE B 81  ? 0.7873 0.7629 1.2330 -0.1392 0.2240  -0.0238 81  PHE B CB  
2454 C CG  . PHE B 81  ? 0.7271 0.7161 1.1427 -0.1291 0.2002  -0.0180 81  PHE B CG  
2455 C CD1 . PHE B 81  ? 0.7091 0.7252 1.1309 -0.1188 0.1934  -0.0134 81  PHE B CD1 
2456 C CD2 . PHE B 81  ? 0.7245 0.6975 1.1080 -0.1302 0.1861  -0.0182 81  PHE B CD2 
2457 C CE1 . PHE B 81  ? 0.6336 0.6611 1.0295 -0.1111 0.1740  -0.0082 81  PHE B CE1 
2458 C CE2 . PHE B 81  ? 0.6888 0.6765 1.0384 -0.1175 0.1618  -0.0146 81  PHE B CE2 
2459 C CZ  . PHE B 81  ? 0.6427 0.6572 0.9982 -0.1090 0.1563  -0.0092 81  PHE B CZ  
2460 N N   . LYS B 82  ? 0.8860 0.7940 1.3385 -0.1463 0.3188  -0.0145 82  LYS B N   
2461 C CA  . LYS B 82  ? 0.9365 0.8215 1.4113 -0.1587 0.3516  -0.0183 82  LYS B CA  
2462 C C   . LYS B 82  ? 0.9765 0.7888 1.3724 -0.1526 0.3851  -0.0012 82  LYS B C   
2463 O O   . LYS B 82  ? 1.0184 0.7946 1.4093 -0.1629 0.4083  -0.0008 82  LYS B O   
2464 C CB  . LYS B 82  ? 0.9713 0.8862 1.5034 -0.1608 0.3691  -0.0259 82  LYS B CB  
2465 C CG  . LYS B 82  ? 0.9917 0.9754 1.6053 -0.1658 0.3373  -0.0444 82  LYS B CG  
2466 C CD  . LYS B 82  ? 1.0668 1.0761 1.7330 -0.1650 0.3564  -0.0508 82  LYS B CD  
2467 C CE  . LYS B 82  ? 1.0678 1.1443 1.8144 -0.1673 0.3230  -0.0700 82  LYS B CE  
2468 N NZ  . LYS B 82  ? 1.0924 1.1952 1.8935 -0.1652 0.3411  -0.0771 82  LYS B NZ  
2469 N N   . ASN B 83  ? 0.9459 0.7346 1.2775 -0.1350 0.3867  0.0127  83  ASN B N   
2470 C CA  . ASN B 83  ? 0.9449 0.6626 1.1893 -0.1236 0.4129  0.0291  83  ASN B CA  
2471 C C   . ASN B 83  ? 0.9178 0.6062 1.1051 -0.1166 0.3910  0.0362  83  ASN B C   
2472 O O   . ASN B 83  ? 0.8443 0.5574 1.0246 -0.1097 0.3611  0.0359  83  ASN B O   
2473 C CB  . ASN B 83  ? 0.9233 0.6277 1.1259 -0.1065 0.4264  0.0378  83  ASN B CB  
2474 C CG  . ASN B 83  ? 0.9886 0.6168 1.0989 -0.0925 0.4555  0.0529  83  ASN B CG  
2475 O OD1 . ASN B 83  ? 0.9824 0.5753 1.0199 -0.0778 0.4424  0.0626  83  ASN B OD1 
2476 N ND2 . ASN B 83  ? 1.0520 0.6526 1.1626 -0.0956 0.4947  0.0544  83  ASN B ND2 
2477 N N   . LEU B 84  ? 0.9468 0.5804 1.0937 -0.1182 0.4067  0.0426  84  LEU B N   
2478 C CA  . LEU B 84  ? 0.9757 0.5765 1.0723 -0.1110 0.3859  0.0479  84  LEU B CA  
2479 C C   . LEU B 84  ? 0.9959 0.5699 1.0137 -0.0870 0.3740  0.0602  84  LEU B C   
2480 O O   . LEU B 84  ? 0.9843 0.5668 0.9899 -0.0813 0.3439  0.0589  84  LEU B O   
2481 C CB  . LEU B 84  ? 0.8796 0.4167 0.9389 -0.1136 0.4085  0.0543  84  LEU B CB  
2482 C CG  . LEU B 84  ? 0.8765 0.4296 1.0005 -0.1366 0.4046  0.0405  84  LEU B CG  
2483 C CD1 . LEU B 84  ? 0.9679 0.4491 1.0464 -0.1377 0.4309  0.0495  84  LEU B CD1 
2484 C CD2 . LEU B 84  ? 0.8145 0.3994 0.9623 -0.1392 0.3629  0.0293  84  LEU B CD2 
2485 N N   . ARG B 85  ? 1.0374 0.5773 1.0019 -0.0726 0.3977  0.0704  85  ARG B N   
2486 C CA  . ARG B 85  ? 1.0897 0.6017 0.9758 -0.0482 0.3870  0.0801  85  ARG B CA  
2487 C C   . ARG B 85  ? 1.0003 0.5710 0.9235 -0.0492 0.3602  0.0736  85  ARG B C   
2488 O O   . ARG B 85  ? 0.9879 0.5516 0.8717 -0.0366 0.3351  0.0768  85  ARG B O   
2489 C CB  . ARG B 85  ? 1.2525 0.7204 1.0830 -0.0345 0.4193  0.0883  85  ARG B CB  
2490 C CG  . ARG B 85  ? 1.3768 0.8132 1.1222 -0.0075 0.4080  0.0956  85  ARG B CG  
2491 C CD  . ARG B 85  ? 1.5181 0.9078 1.1861 0.0130  0.3837  0.1028  85  ARG B CD  
2492 N NE  . ARG B 85  ? 1.6708 1.0211 1.2477 0.0427  0.3739  0.1081  85  ARG B NE  
2493 C CZ  . ARG B 85  ? 1.7443 1.0687 1.2565 0.0670  0.3406  0.1105  85  ARG B CZ  
2494 N NH1 . ARG B 85  ? 1.7207 1.0512 1.2495 0.0654  0.3163  0.1091  85  ARG B NH1 
2495 N NH2 . ARG B 85  ? 1.8127 1.1053 1.2450 0.0950  0.3287  0.1116  85  ARG B NH2 
2496 N N   . ALA B 86  ? 0.9231 0.5496 0.9217 -0.0629 0.3648  0.0642  86  ALA B N   
2497 C CA  . ALA B 86  ? 0.7885 0.4713 0.8257 -0.0641 0.3404  0.0581  86  ALA B CA  
2498 C C   . ALA B 86  ? 0.7671 0.4905 0.8512 -0.0762 0.3090  0.0496  86  ALA B C   
2499 O O   . ALA B 86  ? 0.7196 0.4717 0.8022 -0.0707 0.2816  0.0469  86  ALA B O   
2500 C CB  . ALA B 86  ? 0.6557 0.3806 0.7551 -0.0707 0.3524  0.0506  86  ALA B CB  
2501 N N   . HIS B 87  ? 0.7996 0.5283 0.9236 -0.0906 0.3096  0.0421  87  HIS B N   
2502 C CA  . HIS B 87  ? 0.7294 0.4916 0.8952 -0.1018 0.2804  0.0310  87  HIS B CA  
2503 C C   . HIS B 87  ? 0.7211 0.4584 0.8225 -0.0847 0.2554  0.0337  87  HIS B C   
2504 O O   . HIS B 87  ? 0.6592 0.4418 0.7728 -0.0796 0.2190  0.0236  87  HIS B O   
2505 C CB  . HIS B 87  ? 0.7724 0.5330 0.9798 -0.1178 0.2868  0.0211  87  HIS B CB  
2506 C CG  . HIS B 87  ? 0.7998 0.6004 1.0577 -0.1299 0.2556  0.0047  87  HIS B CG  
2507 N ND1 . HIS B 87  ? 0.8351 0.6506 1.1455 -0.1457 0.2538  -0.0097 87  HIS B ND1 
2508 C CD2 . HIS B 87  ? 0.7652 0.5961 1.0231 -0.1252 0.2218  -0.0021 87  HIS B CD2 
2509 C CE1 . HIS B 87  ? 0.7821 0.6313 1.1227 -0.1515 0.2214  -0.0247 87  HIS B CE1 
2510 N NE2 . HIS B 87  ? 0.7439 0.6036 1.0526 -0.1390 0.2023  -0.0202 87  HIS B NE2 
2511 N N   . GLN B 88  ? 0.7791 0.4481 0.8072 -0.0708 0.2711  0.0457  88  GLN B N   
2512 C CA  . GLN B 88  ? 0.8029 0.4509 0.7667 -0.0470 0.2424  0.0452  88  GLN B CA  
2513 C C   . GLN B 88  ? 0.7536 0.4386 0.6982 -0.0306 0.2149  0.0415  88  GLN B C   
2514 O O   . GLN B 88  ? 0.7714 0.4852 0.7121 -0.0209 0.1811  0.0315  88  GLN B O   
2515 C CB  . GLN B 88  ? 0.9055 0.4672 0.7884 -0.0313 0.2657  0.0606  88  GLN B CB  
2516 C CG  . GLN B 88  ? 0.9550 0.4910 0.7730 -0.0029 0.2348  0.0587  88  GLN B CG  
2517 C CD  . GLN B 88  ? 1.1279 0.5724 0.8751 0.0104  0.2562  0.0732  88  GLN B CD  
2518 O OE1 . GLN B 88  ? 1.2257 0.6168 0.9394 0.0076  0.2950  0.0892  88  GLN B OE1 
2519 N NE2 . GLN B 88  ? 1.1255 0.5506 0.8481 0.0260  0.2322  0.0674  88  GLN B NE2 
2520 N N   . ILE B 89  ? 0.8267 0.5100 0.7612 -0.0283 0.2315  0.0484  89  ILE B N   
2521 C CA  . ILE B 89  ? 0.7878 0.5001 0.7051 -0.0150 0.2081  0.0439  89  ILE B CA  
2522 C C   . ILE B 89  ? 0.7302 0.5139 0.7122 -0.0272 0.1831  0.0325  89  ILE B C   
2523 O O   . ILE B 89  ? 0.7552 0.5668 0.7287 -0.0187 0.1546  0.0249  89  ILE B O   
2524 C CB  . ILE B 89  ? 0.8234 0.5124 0.7142 -0.0099 0.2340  0.0523  89  ILE B CB  
2525 C CG1 . ILE B 89  ? 0.9230 0.5339 0.7300 0.0075  0.2553  0.0645  89  ILE B CG1 
2526 C CG2 . ILE B 89  ? 0.7317 0.4532 0.6157 -0.0002 0.2096  0.0447  89  ILE B CG2 
2527 C CD1 . ILE B 89  ? 1.0132 0.5907 0.7837 0.0135  0.2870  0.0732  89  ILE B CD1 
2528 N N   . ALA B 90  ? 0.6790 0.4911 0.7254 -0.0466 0.1940  0.0307  90  ALA B N   
2529 C CA  . ALA B 90  ? 0.5781 0.4512 0.6792 -0.0559 0.1697  0.0212  90  ALA B CA  
2530 C C   . ALA B 90  ? 0.5917 0.4817 0.6894 -0.0539 0.1410  0.0115  90  ALA B C   
2531 O O   . ALA B 90  ? 0.5392 0.4700 0.6506 -0.0535 0.1172  0.0052  90  ALA B O   
2532 C CB  . ALA B 90  ? 0.5709 0.4687 0.7410 -0.0739 0.1838  0.0188  90  ALA B CB  
2533 N N   . GLN B 91  ? 0.6270 0.4816 0.7040 -0.0520 0.1459  0.0106  91  GLN B N   
2534 C CA  . GLN B 91  ? 0.5889 0.4541 0.6604 -0.0477 0.1216  -0.0003 91  GLN B CA  
2535 C C   . GLN B 91  ? 0.5548 0.4266 0.5847 -0.0287 0.1007  -0.0033 91  GLN B C   
2536 O O   . GLN B 91  ? 0.6184 0.5247 0.6581 -0.0268 0.0784  -0.0140 91  GLN B O   
2537 C CB  . GLN B 91  ? 0.7006 0.5165 0.7560 -0.0482 0.1342  -0.0002 91  GLN B CB  
2538 C CG  . GLN B 91  ? 0.7908 0.6040 0.8985 -0.0710 0.1537  -0.0023 91  GLN B CG  
2539 C CD  . GLN B 91  ? 0.8382 0.6825 0.9863 -0.0814 0.1325  -0.0196 91  GLN B CD  
2540 O OE1 . GLN B 91  ? 0.8416 0.7385 1.0338 -0.0901 0.1166  -0.0282 91  GLN B OE1 
2541 N NE2 . GLN B 91  ? 0.8170 0.6244 0.9454 -0.0786 0.1314  -0.0253 91  GLN B NE2 
2542 N N   . LEU B 92  ? 0.5647 0.4032 0.5484 -0.0144 0.1085  0.0045  92  LEU B N   
2543 C CA  . LEU B 92  ? 0.6487 0.4983 0.6008 0.0030  0.0872  -0.0015 92  LEU B CA  
2544 C C   . LEU B 92  ? 0.6086 0.5128 0.5950 -0.0063 0.0746  -0.0067 92  LEU B C   
2545 O O   . LEU B 92  ? 0.5759 0.5116 0.5651 -0.0017 0.0543  -0.0169 92  LEU B O   
2546 C CB  . LEU B 92  ? 0.7372 0.5401 0.6328 0.0200  0.0967  0.0064  92  LEU B CB  
2547 C CG  . LEU B 92  ? 0.8737 0.6117 0.7145 0.0366  0.1059  0.0133  92  LEU B CG  
2548 C CD1 . LEU B 92  ? 0.9179 0.6054 0.6989 0.0512  0.1213  0.0239  92  LEU B CD1 
2549 C CD2 . LEU B 92  ? 0.8979 0.6406 0.7189 0.0564  0.0772  0.0014  92  LEU B CD2 
2550 N N   . LEU B 93  ? 0.5957 0.5095 0.6094 -0.0192 0.0886  0.0004  93  LEU B N   
2551 C CA  . LEU B 93  ? 0.5907 0.5455 0.6316 -0.0269 0.0793  -0.0014 93  LEU B CA  
2552 C C   . LEU B 93  ? 0.5655 0.5601 0.6418 -0.0372 0.0654  -0.0073 93  LEU B C   
2553 O O   . LEU B 93  ? 0.5476 0.5729 0.6307 -0.0394 0.0523  -0.0112 93  LEU B O   
2554 C CB  . LEU B 93  ? 0.5227 0.4722 0.5811 -0.0335 0.0979  0.0076  93  LEU B CB  
2555 C CG  . LEU B 93  ? 0.6059 0.5140 0.6243 -0.0229 0.1150  0.0131  93  LEU B CG  
2556 C CD1 . LEU B 93  ? 0.6064 0.5138 0.6501 -0.0295 0.1362  0.0201  93  LEU B CD1 
2557 C CD2 . LEU B 93  ? 0.6439 0.5513 0.6274 -0.0111 0.0983  0.0061  93  LEU B CD2 
2558 N N   . ARG B 94  ? 0.5741 0.5650 0.6706 -0.0440 0.0694  -0.0086 94  ARG B N   
2559 C CA  . ARG B 94  ? 0.5766 0.6003 0.6999 -0.0516 0.0545  -0.0165 94  ARG B CA  
2560 C C   . ARG B 94  ? 0.5814 0.6165 0.6834 -0.0434 0.0389  -0.0268 94  ARG B C   
2561 O O   . ARG B 94  ? 0.6161 0.6839 0.7256 -0.0463 0.0270  -0.0314 94  ARG B O   
2562 C CB  . ARG B 94  ? 0.6010 0.6149 0.7513 -0.0607 0.0609  -0.0201 94  ARG B CB  
2563 C CG  . ARG B 94  ? 0.5887 0.6318 0.7598 -0.0663 0.0422  -0.0321 94  ARG B CG  
2564 C CD  . ARG B 94  ? 0.6446 0.7252 0.8345 -0.0698 0.0300  -0.0300 94  ARG B CD  
2565 N NE  . ARG B 94  ? 0.6721 0.7767 0.8640 -0.0707 0.0105  -0.0411 94  ARG B NE  
2566 C CZ  . ARG B 94  ? 0.7158 0.8315 0.9368 -0.0773 0.0005  -0.0510 94  ARG B CZ  
2567 N NH1 . ARG B 94  ? 0.7172 0.8266 0.9772 -0.0858 0.0099  -0.0514 94  ARG B NH1 
2568 N NH2 . ARG B 94  ? 0.7381 0.8721 0.9503 -0.0755 -0.0185 -0.0623 94  ARG B NH2 
2569 N N   . ALA B 95  ? 0.5921 0.5984 0.6657 -0.0315 0.0402  -0.0300 95  ALA B N   
2570 C CA  . ALA B 95  ? 0.5907 0.6089 0.6490 -0.0204 0.0257  -0.0422 95  ALA B CA  
2571 C C   . ALA B 95  ? 0.5554 0.6033 0.6102 -0.0169 0.0176  -0.0454 95  ALA B C   
2572 O O   . ALA B 95  ? 0.4804 0.5610 0.5432 -0.0170 0.0085  -0.0552 95  ALA B O   
2573 C CB  . ALA B 95  ? 0.6134 0.5889 0.6398 -0.0043 0.0273  -0.0441 95  ALA B CB  
2574 N N   . ALA B 96  ? 0.5753 0.6109 0.6190 -0.0146 0.0228  -0.0384 96  ALA B N   
2575 C CA  . ALA B 96  ? 0.5489 0.6105 0.5952 -0.0150 0.0161  -0.0430 96  ALA B CA  
2576 C C   . ALA B 96  ? 0.5145 0.6091 0.5869 -0.0313 0.0174  -0.0397 96  ALA B C   
2577 O O   . ALA B 96  ? 0.5052 0.6295 0.5858 -0.0348 0.0125  -0.0469 96  ALA B O   
2578 C CB  . ALA B 96  ? 0.5709 0.6077 0.5984 -0.0103 0.0213  -0.0374 96  ALA B CB  
2579 N N   . GLY B 97  ? 0.5135 0.6016 0.5989 -0.0403 0.0246  -0.0290 97  GLY B N   
2580 C CA  . GLY B 97  ? 0.5169 0.6289 0.6196 -0.0514 0.0231  -0.0241 97  GLY B CA  
2581 C C   . GLY B 97  ? 0.5422 0.6777 0.6456 -0.0526 0.0151  -0.0326 97  GLY B C   
2582 O O   . GLY B 97  ? 0.5332 0.6896 0.6367 -0.0585 0.0143  -0.0316 97  GLY B O   
2583 N N   . ASP B 98  ? 0.5373 0.6648 0.6377 -0.0467 0.0112  -0.0410 98  ASP B N   
2584 C CA  . ASP B 98  ? 0.4786 0.6247 0.5762 -0.0456 0.0038  -0.0520 98  ASP B CA  
2585 C C   . ASP B 98  ? 0.4808 0.6502 0.5715 -0.0415 0.0037  -0.0613 98  ASP B C   
2586 O O   . ASP B 98  ? 0.5224 0.7146 0.6103 -0.0442 0.0034  -0.0667 98  ASP B O   
2587 C CB  . ASP B 98  ? 0.5338 0.6598 0.6294 -0.0393 0.0004  -0.0611 98  ASP B CB  
2588 C CG  . ASP B 98  ? 0.6345 0.7481 0.7481 -0.0477 0.0004  -0.0572 98  ASP B CG  
2589 O OD1 . ASP B 98  ? 0.6101 0.7363 0.7376 -0.0554 -0.0005 -0.0488 98  ASP B OD1 
2590 O OD2 . ASP B 98  ? 0.7750 0.8663 0.8916 -0.0465 0.0010  -0.0638 98  ASP B OD2 
2591 N N   . ALA B 99  ? 0.4874 0.6520 0.5759 -0.0344 0.0042  -0.0645 99  ALA B N   
2592 C CA  . ALA B 99  ? 0.5143 0.7074 0.6081 -0.0310 0.0032  -0.0769 99  ALA B CA  
2593 C C   . ALA B 99  ? 0.5583 0.7741 0.6622 -0.0464 0.0119  -0.0712 99  ALA B C   
2594 O O   . ALA B 99  ? 0.5821 0.8276 0.6948 -0.0498 0.0168  -0.0808 99  ALA B O   
2595 C CB  . ALA B 99  ? 0.4568 0.6389 0.5462 -0.0177 -0.0033 -0.0836 99  ALA B CB  
2596 N N   . THR B 100 ? 0.5698 0.7697 0.6730 -0.0557 0.0161  -0.0557 100 THR B N   
2597 C CA  . THR B 100 ? 0.6212 0.8322 0.7292 -0.0699 0.0254  -0.0479 100 THR B CA  
2598 C C   . THR B 100 ? 0.6500 0.8723 0.7473 -0.0750 0.0296  -0.0437 100 THR B C   
2599 O O   . THR B 100 ? 0.7032 0.9397 0.7988 -0.0847 0.0408  -0.0422 100 THR B O   
2600 C CB  . THR B 100 ? 0.5850 0.7717 0.6925 -0.0755 0.0282  -0.0323 100 THR B CB  
2601 O OG1 . THR B 100 ? 0.6216 0.7968 0.7238 -0.0750 0.0257  -0.0204 100 THR B OG1 
2602 C CG2 . THR B 100 ? 0.5155 0.6824 0.6226 -0.0672 0.0245  -0.0354 100 THR B CG2 
2603 N N   . LYS B 101 ? 0.6425 0.8559 0.7307 -0.0686 0.0211  -0.0426 101 LYS B N   
2604 C CA  . LYS B 101 ? 0.6671 0.8884 0.7380 -0.0696 0.0204  -0.0418 101 LYS B CA  
2605 C C   . LYS B 101 ? 0.7034 0.9489 0.7697 -0.0671 0.0270  -0.0574 101 LYS B C   
2606 O O   . LYS B 101 ? 0.7514 1.0069 0.7992 -0.0712 0.0358  -0.0558 101 LYS B O   
2607 C CB  . LYS B 101 ? 0.6783 0.8874 0.7475 -0.0633 0.0064  -0.0434 101 LYS B CB  
2608 C CG  . LYS B 101 ? 0.7217 0.9330 0.7700 -0.0631 -0.0006 -0.0400 101 LYS B CG  
2609 C CD  . LYS B 101 ? 0.7480 0.9489 0.8089 -0.0597 -0.0168 -0.0415 101 LYS B CD  
2610 C CE  . LYS B 101 ? 0.8052 1.0035 0.8558 -0.0591 -0.0269 -0.0298 101 LYS B CE  
2611 N NZ  . LYS B 101 ? 0.8249 1.0184 0.9069 -0.0580 -0.0399 -0.0301 101 LYS B NZ  
2612 N N   . ASP B 102 ? 0.6910 0.9439 0.7717 -0.0583 0.0236  -0.0725 102 ASP B N   
2613 C CA  . ASP B 102 ? 0.6872 0.9674 0.7724 -0.0527 0.0295  -0.0906 102 ASP B CA  
2614 C C   . ASP B 102 ? 0.5989 0.9046 0.7050 -0.0622 0.0433  -0.0939 102 ASP B C   
2615 O O   . ASP B 102 ? 0.5710 0.9066 0.6866 -0.0625 0.0548  -0.1074 102 ASP B O   
2616 C CB  . ASP B 102 ? 0.7372 1.0123 0.8295 -0.0355 0.0175  -0.1060 102 ASP B CB  
2617 C CG  . ASP B 102 ? 0.7927 1.0424 0.8693 -0.0290 0.0069  -0.1065 102 ASP B CG  
2618 O OD1 . ASP B 102 ? 0.8257 1.0804 0.8867 -0.0302 0.0075  -0.1103 102 ASP B OD1 
2619 O OD2 . ASP B 102 ? 0.8042 1.0268 0.8827 -0.0231 -0.0012 -0.1039 102 ASP B OD2 
2620 N N   . GLY B 103 ? 0.5232 0.8178 0.6398 -0.0706 0.0432  -0.0838 103 GLY B N   
2621 C CA  . GLY B 103 ? 0.4728 0.7884 0.6141 -0.0826 0.0548  -0.0887 103 GLY B CA  
2622 C C   . GLY B 103 ? 0.4681 0.8033 0.6380 -0.0724 0.0441  -0.1092 103 GLY B C   
2623 O O   . GLY B 103 ? 0.4374 0.8045 0.6385 -0.0804 0.0521  -0.1229 103 GLY B O   
2624 N N   . PHE B 104 ? 0.4836 0.7985 0.6433 -0.0545 0.0259  -0.1119 104 PHE B N   
2625 C CA  . PHE B 104 ? 0.5048 0.8332 0.6811 -0.0377 0.0114  -0.1315 104 PHE B CA  
2626 C C   . PHE B 104 ? 0.5027 0.8051 0.6720 -0.0325 -0.0014 -0.1281 104 PHE B C   
2627 O O   . PHE B 104 ? 0.5533 0.8620 0.7292 -0.0160 -0.0172 -0.1439 104 PHE B O   
2628 C CB  . PHE B 104 ? 0.5040 0.8248 0.6662 -0.0157 0.0009  -0.1401 104 PHE B CB  
2629 C CG  . PHE B 104 ? 0.5167 0.8664 0.6860 -0.0159 0.0116  -0.1506 104 PHE B CG  
2630 C CD1 . PHE B 104 ? 0.5013 0.8945 0.6998 -0.0284 0.0275  -0.1609 104 PHE B CD1 
2631 C CD2 . PHE B 104 ? 0.5391 0.8709 0.6860 -0.0047 0.0081  -0.1512 104 PHE B CD2 
2632 C CE1 . PHE B 104 ? 0.5146 0.9329 0.7150 -0.0277 0.0415  -0.1707 104 PHE B CE1 
2633 C CE2 . PHE B 104 ? 0.5397 0.8956 0.6876 -0.0032 0.0182  -0.1626 104 PHE B CE2 
2634 C CZ  . PHE B 104 ? 0.5373 0.9366 0.7098 -0.0139 0.0359  -0.1719 104 PHE B CZ  
2635 N N   . LEU B 105 ? 0.4714 0.7437 0.6251 -0.0440 0.0045  -0.1086 105 LEU B N   
2636 C CA  . LEU B 105 ? 0.4852 0.7294 0.6270 -0.0386 -0.0043 -0.1054 105 LEU B CA  
2637 C C   . LEU B 105 ? 0.5011 0.7579 0.6641 -0.0548 -0.0001 -0.1099 105 LEU B C   
2638 O O   . LEU B 105 ? 0.5052 0.7579 0.6722 -0.0736 0.0145  -0.0968 105 LEU B O   
2639 C CB  . LEU B 105 ? 0.4576 0.6599 0.5729 -0.0389 0.0006  -0.0841 105 LEU B CB  
2640 C CG  . LEU B 105 ? 0.4742 0.6410 0.5684 -0.0297 -0.0045 -0.0802 105 LEU B CG  
2641 C CD1 . LEU B 105 ? 0.5143 0.6642 0.5860 -0.0059 -0.0178 -0.0893 105 LEU B CD1 
2642 C CD2 . LEU B 105 ? 0.4204 0.5561 0.5026 -0.0358 0.0069  -0.0600 105 LEU B CD2 
2643 N N   . LYS B 106 ? 0.5276 0.7976 0.7036 -0.0463 -0.0147 -0.1297 106 LYS B N   
2644 C CA  . LYS B 106 ? 0.5380 0.8186 0.7377 -0.0619 -0.0138 -0.1390 106 LYS B CA  
2645 C C   . LYS B 106 ? 0.5536 0.7892 0.7242 -0.0605 -0.0161 -0.1276 106 LYS B C   
2646 O O   . LYS B 106 ? 0.5652 0.7904 0.7433 -0.0788 -0.0049 -0.1206 106 LYS B O   
2647 C CB  . LYS B 106 ? 0.5867 0.9050 0.8179 -0.0525 -0.0325 -0.1699 106 LYS B CB  
2648 C CG  . LYS B 106 ? 0.6687 1.0021 0.9331 -0.0708 -0.0336 -0.1854 106 LYS B CG  
2649 C CD  . LYS B 106 ? 0.7196 1.0758 1.0195 -0.1025 -0.0061 -0.1806 106 LYS B CD  
2650 C CE  . LYS B 106 ? 0.7754 1.1331 1.1048 -0.1246 -0.0035 -0.1925 106 LYS B CE  
2651 N NZ  . LYS B 106 ? 0.8085 1.1117 1.0987 -0.1239 -0.0057 -0.1766 106 LYS B NZ  
2652 N N   . GLU B 107 ? 0.5730 0.7779 0.7076 -0.0379 -0.0285 -0.1254 107 GLU B N   
2653 C CA  . GLU B 107 ? 0.6066 0.7683 0.7096 -0.0333 -0.0288 -0.1172 107 GLU B CA  
2654 C C   . GLU B 107 ? 0.5767 0.6988 0.6352 -0.0119 -0.0303 -0.1054 107 GLU B C   
2655 O O   . GLU B 107 ? 0.5549 0.6778 0.5998 0.0072  -0.0431 -0.1132 107 GLU B O   
2656 C CB  . GLU B 107 ? 0.6758 0.8423 0.7835 -0.0293 -0.0464 -0.1403 107 GLU B CB  
2657 C CG  . GLU B 107 ? 0.7568 0.8749 0.8212 -0.0185 -0.0489 -0.1358 107 GLU B CG  
2658 C CD  . GLU B 107 ? 0.8270 0.9485 0.8889 -0.0098 -0.0724 -0.1630 107 GLU B CD  
2659 O OE1 . GLU B 107 ? 0.8533 1.0195 0.9547 -0.0125 -0.0883 -0.1866 107 GLU B OE1 
2660 O OE2 . GLU B 107 ? 0.8876 0.9685 0.9094 0.0002  -0.0754 -0.1628 107 GLU B OE2 
2661 N N   . ILE B 108 ? 0.5562 0.6424 0.5938 -0.0150 -0.0155 -0.0867 108 ILE B N   
2662 C CA  . ILE B 108 ? 0.5793 0.6223 0.5743 0.0028  -0.0119 -0.0765 108 ILE B CA  
2663 C C   . ILE B 108 ? 0.6371 0.6437 0.6024 0.0076  -0.0075 -0.0749 108 ILE B C   
2664 O O   . ILE B 108 ? 0.6263 0.6323 0.6070 -0.0068 0.0029  -0.0703 108 ILE B O   
2665 C CB  . ILE B 108 ? 0.5529 0.5863 0.5527 -0.0036 0.0055  -0.0571 108 ILE B CB  
2666 C CG1 . ILE B 108 ? 0.6504 0.6364 0.6096 0.0117  0.0144  -0.0471 108 ILE B CG1 
2667 C CG2 . ILE B 108 ? 0.4946 0.5344 0.5193 -0.0225 0.0200  -0.0449 108 ILE B CG2 
2668 C CD1 . ILE B 108 ? 0.6893 0.6663 0.6608 0.0033  0.0318  -0.0317 108 ILE B CD1 
2669 N N   . SER B 109 ? 0.7072 0.6796 0.6247 0.0301  -0.0155 -0.0792 109 SER B N   
2670 C CA  . SER B 109 ? 0.6908 0.6255 0.5695 0.0389  -0.0128 -0.0811 109 SER B CA  
2671 C C   . SER B 109 ? 0.7624 0.6426 0.5855 0.0560  0.0031  -0.0658 109 SER B C   
2672 O O   . SER B 109 ? 0.8001 0.6650 0.5993 0.0703  -0.0003 -0.0617 109 SER B O   
2673 C CB  . SER B 109 ? 0.7185 0.6615 0.5841 0.0516  -0.0419 -0.1071 109 SER B CB  
2674 O OG  . SER B 109 ? 0.7843 0.7745 0.7056 0.0314  -0.0508 -0.1221 109 SER B OG  
2675 N N   . LEU B 110 ? 0.7232 0.5717 0.5262 0.0544  0.0234  -0.0574 110 LEU B N   
2676 C CA  . LEU B 110 ? 0.7574 0.5489 0.5004 0.0712  0.0425  -0.0452 110 LEU B CA  
2677 C C   . LEU B 110 ? 0.8540 0.6136 0.5349 0.0942  0.0245  -0.0607 110 LEU B C   
2678 O O   . LEU B 110 ? 0.8413 0.6018 0.5224 0.0910  0.0203  -0.0726 110 LEU B O   
2679 C CB  . LEU B 110 ? 0.7593 0.5359 0.5160 0.0588  0.0769  -0.0296 110 LEU B CB  
2680 C CG  . LEU B 110 ? 0.8926 0.6090 0.5878 0.0738  0.1041  -0.0186 110 LEU B CG  
2681 C CD1 . LEU B 110 ? 0.9629 0.6486 0.6254 0.0839  0.1126  -0.0063 110 LEU B CD1 
2682 C CD2 . LEU B 110 ? 0.8845 0.5998 0.6110 0.0602  0.1379  -0.0073 110 LEU B CD2 
2683 N N   . VAL B 111 ? 0.9164 0.6451 0.5421 0.1189  0.0117  -0.0616 111 VAL B N   
2684 C CA  . VAL B 111 ? 0.9780 0.6795 0.5413 0.1456  -0.0147 -0.0795 111 VAL B CA  
2685 C C   . VAL B 111 ? 1.0542 0.6788 0.5252 0.1688  0.0062  -0.0652 111 VAL B C   
2686 O O   . VAL B 111 ? 1.0782 0.6668 0.5166 0.1778  0.0228  -0.0464 111 VAL B O   
2687 C CB  . VAL B 111 ? 0.9880 0.7145 0.5536 0.1628  -0.0540 -0.0962 111 VAL B CB  
2688 C CG1 . VAL B 111 ? 1.0557 0.7503 0.5505 0.1957  -0.0854 -0.1154 111 VAL B CG1 
2689 C CG2 . VAL B 111 ? 0.8890 0.6915 0.5435 0.1396  -0.0714 -0.1132 111 VAL B CG2 
2690 N N   . VAL B 112 ? 1.1433 0.7390 0.5699 0.1779  0.0076  -0.0745 112 VAL B N   
2691 C CA  . VAL B 112 ? 1.1711 0.6895 0.4998 0.2018  0.0296  -0.0623 112 VAL B CA  
2692 C C   . VAL B 112 ? 1.2644 0.7501 0.5109 0.2383  -0.0100 -0.0816 112 VAL B C   
2693 O O   . VAL B 112 ? 1.2327 0.7503 0.4969 0.2405  -0.0458 -0.1099 112 VAL B O   
2694 C CB  . VAL B 112 ? 1.1269 0.6261 0.4504 0.1911  0.0636  -0.0588 112 VAL B CB  
2695 C CG1 . VAL B 112 ? 1.2097 0.6268 0.4307 0.2143  0.0953  -0.0435 112 VAL B CG1 
2696 C CG2 . VAL B 112 ? 1.0087 0.5480 0.4211 0.1578  0.0952  -0.0437 112 VAL B CG2 
2697 N N   . THR B 113 ? 1.3666 0.7962 0.5433 0.2630  -0.0049 -0.0634 113 THR B N   
2698 C CA  . THR B 113 ? 1.4796 0.8846 0.6032 0.2960  -0.0422 -0.0723 113 THR B CA  
2699 C C   . THR B 113 ? 1.6199 0.9432 0.6589 0.3146  -0.0122 -0.0491 113 THR B C   
2700 O O   . THR B 113 ? 1.6442 0.9318 0.6713 0.3023  0.0368  -0.0237 113 THR B O   
2701 C CB  . THR B 113 ? 1.4481 0.8655 0.5756 0.3156  -0.0765 -0.0762 113 THR B CB  
2702 O OG1 . THR B 113 ? 1.4349 0.8085 0.5353 0.3163  -0.0436 -0.0477 113 THR B OG1 
2703 C CG2 . THR B 113 ? 1.3577 0.8593 0.5729 0.2982  -0.1071 -0.1017 113 THR B CG2 
2704 N N   . GLU B 114 ? 1.7301 1.0249 0.7148 0.3438  -0.0403 -0.0593 114 GLU B N   
2705 C CA  . GLU B 114 ? 1.9072 1.1184 0.8040 0.3657  -0.0142 -0.0391 114 GLU B CA  
2706 C C   . GLU B 114 ? 1.9812 1.1417 0.8351 0.3862  -0.0084 -0.0200 114 GLU B C   
2707 O O   . GLU B 114 ? 2.0632 1.1587 0.8706 0.3872  0.0362  0.0048  114 GLU B O   
2708 C CB  . GLU B 114 ? 2.0429 1.2367 0.8905 0.3924  -0.0473 -0.0582 114 GLU B CB  
2709 C CG  . GLU B 114 ? 2.1071 1.3321 0.9640 0.4176  -0.1086 -0.0834 114 GLU B CG  
2710 C CD  . GLU B 114 ? 2.2490 1.4506 1.0527 0.4459  -0.1395 -0.1020 114 GLU B CD  
2711 O OE1 . GLU B 114 ? 2.3239 1.4753 1.0705 0.4492  -0.1120 -0.0925 114 GLU B OE1 
2712 O OE2 . GLU B 114 ? 2.2783 1.5133 1.1001 0.4652  -0.1909 -0.1277 114 GLU B OE2 
2713 N N   . HIS B 115 ? 1.9515 1.1426 0.8263 0.4014  -0.0517 -0.0339 115 HIS B N   
2714 C CA  . HIS B 115 ? 2.0270 1.1705 0.8624 0.4233  -0.0503 -0.0201 115 HIS B CA  
2715 C C   . HIS B 115 ? 1.9739 1.1661 0.8752 0.4060  -0.0550 -0.0198 115 HIS B C   
2716 O O   . HIS B 115 ? 1.8955 1.1668 0.8690 0.3927  -0.0855 -0.0410 115 HIS B O   
2717 C CB  . HIS B 115 ? 2.1040 1.2247 0.8896 0.4673  -0.0977 -0.0371 115 HIS B CB  
2718 C CG  . HIS B 115 ? 2.1831 1.2394 0.8856 0.4902  -0.0912 -0.0345 115 HIS B CG  
2719 N ND1 . HIS B 115 ? 2.2370 1.2128 0.8721 0.4902  -0.0393 -0.0080 115 HIS B ND1 
2720 C CD2 . HIS B 115 ? 2.2302 1.2911 0.9074 0.5136  -0.1294 -0.0565 115 HIS B CD2 
2721 C CE1 . HIS B 115 ? 2.3363 1.2677 0.9028 0.5141  -0.0458 -0.0126 115 HIS B CE1 
2722 N NE2 . HIS B 115 ? 2.3307 1.3115 0.9193 0.5292  -0.1014 -0.0418 115 HIS B NE2 
2723 N N   . ASP B 116 ? 2.0137 1.1574 0.8908 0.4046  -0.0221 0.0031  116 ASP B N   
2724 C CA  . ASP B 116 ? 1.9462 1.1227 0.8719 0.3934  -0.0264 0.0051  116 ASP B CA  
2725 C C   . ASP B 116 ? 2.0024 1.1710 0.9066 0.4299  -0.0698 -0.0084 116 ASP B C   
2726 O O   . ASP B 116 ? 2.1408 1.2356 0.9721 0.4558  -0.0612 0.0008  116 ASP B O   
2727 C CB  . ASP B 116 ? 1.9862 1.1167 0.9040 0.3710  0.0311  0.0337  116 ASP B CB  
2728 C CG  . ASP B 116 ? 2.0213 1.1674 0.9722 0.3659  0.0257  0.0378  116 ASP B CG  
2729 O OD1 . ASP B 116 ? 1.9605 1.1766 0.9699 0.3612  -0.0086 0.0222  116 ASP B OD1 
2730 O OD2 . ASP B 116 ? 2.0903 1.1805 1.0109 0.3654  0.0565  0.0551  116 ASP B OD2 
2731 N N   . GLY B 117 ? 1.9214 1.1671 0.8912 0.4318  -0.1141 -0.0324 117 GLY B N   
2732 C CA  . GLY B 117 ? 1.7718 1.1030 0.8257 0.3990  -0.1207 -0.0457 117 GLY B CA  
2733 C C   . GLY B 117 ? 1.7051 1.1080 0.8098 0.4090  -0.1731 -0.0812 117 GLY B C   
2734 O O   . GLY B 117 ? 1.6499 1.0948 0.7945 0.4234  -0.2079 -0.0997 117 GLY B O   
2735 N N   . ASP B 118 ? 1.6955 1.1135 0.8040 0.4000  -0.1761 -0.0920 118 ASP B N   
2736 C CA  . ASP B 118 ? 1.6431 1.1219 0.7977 0.4074  -0.2218 -0.1263 118 ASP B CA  
2737 C C   . ASP B 118 ? 1.4721 1.0459 0.7319 0.3749  -0.2337 -0.1477 118 ASP B C   
2738 O O   . ASP B 118 ? 1.3826 0.9715 0.6713 0.3443  -0.2041 -0.1365 118 ASP B O   
2739 C CB  . ASP B 118 ? 1.7286 1.1824 0.8444 0.4087  -0.2190 -0.1305 118 ASP B CB  
2740 C CG  . ASP B 118 ? 1.7798 1.2691 0.9149 0.4290  -0.2681 -0.1638 118 ASP B CG  
2741 O OD1 . ASP B 118 ? 1.7689 1.3188 0.9684 0.4339  -0.3014 -0.1866 118 ASP B OD1 
2742 O OD2 . ASP B 118 ? 1.8322 1.2896 0.9203 0.4398  -0.2718 -0.1683 118 ASP B OD2 
2743 N N   . VAL B 119 ? 1.4466 1.0829 0.7648 0.3814  -0.2746 -0.1798 119 VAL B N   
2744 C CA  . VAL B 119 ? 1.3595 1.0862 0.7821 0.3497  -0.2842 -0.2027 119 VAL B CA  
2745 C C   . VAL B 119 ? 1.3683 1.1169 0.8163 0.3219  -0.2784 -0.2154 119 VAL B C   
2746 O O   . VAL B 119 ? 1.3012 1.1036 0.8201 0.2872  -0.2697 -0.2254 119 VAL B O   
2747 C CB  . VAL B 119 ? 1.3454 1.1325 0.8302 0.3666  -0.3245 -0.2323 119 VAL B CB  
2748 C CG1 . VAL B 119 ? 1.2278 1.1048 0.8222 0.3317  -0.3246 -0.2509 119 VAL B CG1 
2749 C CG2 . VAL B 119 ? 1.3969 1.1467 0.8404 0.4025  -0.3326 -0.2218 119 VAL B CG2 
2750 N N   . GLU B 120 ? 1.4496 1.1510 0.8357 0.3378  -0.2819 -0.2150 120 GLU B N   
2751 C CA  . GLU B 120 ? 1.4452 1.1558 0.8443 0.3148  -0.2753 -0.2269 120 GLU B CA  
2752 C C   . GLU B 120 ? 1.4370 1.0913 0.7829 0.3008  -0.2289 -0.1993 120 GLU B C   
2753 O O   . GLU B 120 ? 1.4740 1.0623 0.7450 0.3195  -0.2066 -0.1720 120 GLU B O   
2754 C CB  . GLU B 120 ? 1.5412 1.2365 0.9077 0.3393  -0.3059 -0.2463 120 GLU B CB  
2755 C CG  . GLU B 120 ? 1.5557 1.2857 0.9673 0.3134  -0.3126 -0.2716 120 GLU B CG  
2756 C CD  . GLU B 120 ? 1.6781 1.3770 1.0384 0.3377  -0.3362 -0.2868 120 GLU B CD  
2757 O OE1 . GLU B 120 ? 1.7415 1.4555 1.1063 0.3650  -0.3739 -0.3055 120 GLU B OE1 
2758 O OE2 . GLU B 120 ? 1.7039 1.3628 1.0195 0.3309  -0.3168 -0.2815 120 GLU B OE2 
2759 N N   . ALA B 121 ? 1.3873 1.0661 0.7752 0.2680  -0.2119 -0.2072 121 ALA B N   
2760 C CA  . ALA B 121 ? 1.3834 1.0187 0.7385 0.2529  -0.1647 -0.1839 121 ALA B CA  
2761 C C   . ALA B 121 ? 1.4032 1.0147 0.7356 0.2469  -0.1545 -0.1919 121 ALA B C   
2762 O O   . ALA B 121 ? 1.3785 1.0229 0.7465 0.2397  -0.1814 -0.2202 121 ALA B O   
2763 C CB  . ALA B 121 ? 1.2805 0.9576 0.7068 0.2204  -0.1440 -0.1798 121 ALA B CB  
2764 N N   . ILE B 122 ? 1.4313 0.9858 0.7082 0.2488  -0.1127 -0.1669 122 ILE B N   
2765 C CA  . ILE B 122 ? 1.4286 0.9571 0.6840 0.2428  -0.0944 -0.1713 122 ILE B CA  
2766 C C   . ILE B 122 ? 1.3878 0.9366 0.6992 0.2113  -0.0650 -0.1721 122 ILE B C   
2767 O O   . ILE B 122 ? 1.4307 0.9753 0.7508 0.2014  -0.0589 -0.1853 122 ILE B O   
2768 C CB  . ILE B 122 ? 1.4651 0.9216 0.6352 0.2626  -0.0612 -0.1442 122 ILE B CB  
2769 C CG1 . ILE B 122 ? 1.4268 0.8630 0.5996 0.2497  -0.0104 -0.1128 122 ILE B CG1 
2770 C CG2 . ILE B 122 ? 1.5168 0.9409 0.6240 0.2973  -0.0882 -0.1403 122 ILE B CG2 
2771 C CD1 . ILE B 122 ? 1.4930 0.8610 0.5942 0.2639  0.0286  -0.0851 122 ILE B CD1 
2772 N N   . GLU B 123 ? 1.2912 0.8667 0.6532 0.1940  -0.0465 -0.1538 123 GLU B N   
2773 C CA  . GLU B 123 ? 1.2129 0.8225 0.6563 0.1600  -0.0173 -0.1414 123 GLU B CA  
2774 C C   . GLU B 123 ? 1.1697 0.8366 0.6926 0.1393  -0.0211 -0.1313 123 GLU B C   
2775 O O   . GLU B 123 ? 1.1467 0.8077 0.6550 0.1484  -0.0177 -0.1159 123 GLU B O   
2776 C CB  . GLU B 123 ? 1.2268 0.7926 0.6406 0.1600  0.0330  -0.1152 123 GLU B CB  
2777 C CG  . GLU B 123 ? 1.1945 0.7869 0.6806 0.1323  0.0599  -0.1072 123 GLU B CG  
2778 C CD  . GLU B 123 ? 1.2816 0.8299 0.7348 0.1375  0.1057  -0.0914 123 GLU B CD  
2779 O OE1 . GLU B 123 ? 1.2791 0.7872 0.6766 0.1524  0.1100  -0.1045 123 GLU B OE1 
2780 O OE2 . GLU B 123 ? 1.3132 0.8689 0.7991 0.1267  0.1377  -0.0678 123 GLU B OE2 
2781 N N   . VAL B 124 ? 1.1088 0.8259 0.7110 0.1120  -0.0268 -0.1399 124 VAL B N   
2782 C CA  . VAL B 124 ? 0.9768 0.7485 0.6510 0.0923  -0.0306 -0.1329 124 VAL B CA  
2783 C C   . VAL B 124 ? 0.8940 0.6904 0.6328 0.0631  -0.0066 -0.1198 124 VAL B C   
2784 O O   . VAL B 124 ? 0.9123 0.7145 0.6754 0.0499  -0.0084 -0.1316 124 VAL B O   
2785 C CB  . VAL B 124 ? 0.9783 0.7960 0.6874 0.0904  -0.0702 -0.1612 124 VAL B CB  
2786 C CG1 . VAL B 124 ? 0.9066 0.7810 0.6929 0.0664  -0.0675 -0.1547 124 VAL B CG1 
2787 C CG2 . VAL B 124 ? 1.0529 0.8540 0.7055 0.1230  -0.0992 -0.1730 124 VAL B CG2 
2788 N N   . PHE B 125 ? 0.8000 0.6073 0.5640 0.0545  0.0145  -0.0961 125 PHE B N   
2789 C CA  . PHE B 125 ? 0.7466 0.5829 0.5725 0.0300  0.0303  -0.0838 125 PHE B CA  
2790 C C   . PHE B 125 ? 0.7667 0.6512 0.6398 0.0172  0.0175  -0.0835 125 PHE B C   
2791 O O   . PHE B 125 ? 0.7667 0.6564 0.6379 0.0220  0.0208  -0.0726 125 PHE B O   
2792 C CB  . PHE B 125 ? 0.7464 0.5623 0.5711 0.0297  0.0632  -0.0603 125 PHE B CB  
2793 C CG  . PHE B 125 ? 0.8559 0.6317 0.6491 0.0380  0.0825  -0.0604 125 PHE B CG  
2794 C CD1 . PHE B 125 ? 0.8822 0.6626 0.7091 0.0264  0.0922  -0.0600 125 PHE B CD1 
2795 C CD2 . PHE B 125 ? 0.9230 0.6523 0.6483 0.0594  0.0917  -0.0611 125 PHE B CD2 
2796 C CE1 . PHE B 125 ? 0.9335 0.6767 0.7325 0.0361  0.1111  -0.0623 125 PHE B CE1 
2797 C CE2 . PHE B 125 ? 0.9748 0.6660 0.6676 0.0682  0.1127  -0.0626 125 PHE B CE2 
2798 C CZ  . PHE B 125 ? 0.9593 0.6597 0.6919 0.0565  0.1222  -0.0643 125 PHE B CZ  
2799 N N   . SER B 126 ? 0.7262 0.6430 0.6409 0.0003  0.0054  -0.0962 126 SER B N   
2800 C CA  . SER B 126 ? 0.7249 0.6881 0.6804 -0.0107 -0.0065 -0.1007 126 SER B CA  
2801 C C   . SER B 126 ? 0.6885 0.6750 0.6904 -0.0341 0.0082  -0.0869 126 SER B C   
2802 O O   . SER B 126 ? 0.6623 0.6397 0.6781 -0.0467 0.0163  -0.0857 126 SER B O   
2803 C CB  . SER B 126 ? 0.8211 0.8076 0.7892 -0.0111 -0.0327 -0.1298 126 SER B CB  
2804 O OG  . SER B 126 ? 0.8631 0.8987 0.8813 -0.0264 -0.0378 -0.1354 126 SER B OG  
2805 N N   . MET B 127 ? 0.6146 0.6266 0.6353 -0.0379 0.0109  -0.0768 127 MET B N   
2806 C CA  . MET B 127 ? 0.5738 0.6080 0.6300 -0.0571 0.0213  -0.0649 127 MET B CA  
2807 C C   . MET B 127 ? 0.5973 0.6738 0.6813 -0.0660 0.0122  -0.0762 127 MET B C   
2808 O O   . MET B 127 ? 0.6180 0.7105 0.6990 -0.0562 0.0054  -0.0787 127 MET B O   
2809 C CB  . MET B 127 ? 0.5813 0.6085 0.6362 -0.0545 0.0345  -0.0434 127 MET B CB  
2810 C CG  . MET B 127 ? 0.5926 0.6337 0.6736 -0.0698 0.0429  -0.0298 127 MET B CG  
2811 S SD  . MET B 127 ? 0.8316 0.8681 0.9174 -0.0651 0.0524  -0.0097 127 MET B SD  
2812 C CE  . MET B 127 ? 0.6203 0.6194 0.6905 -0.0535 0.0644  -0.0061 127 MET B CE  
2813 N N   . LYS B 128 ? 0.5704 0.6631 0.6824 -0.0847 0.0144  -0.0838 128 LYS B N   
2814 C CA  . LYS B 128 ? 0.5563 0.6920 0.7006 -0.0956 0.0110  -0.0966 128 LYS B CA  
2815 C C   . LYS B 128 ? 0.5131 0.6597 0.6728 -0.1131 0.0291  -0.0794 128 LYS B C   
2816 O O   . LYS B 128 ? 0.4943 0.6158 0.6486 -0.1221 0.0414  -0.0630 128 LYS B O   
2817 C CB  . LYS B 128 ? 0.5780 0.7283 0.7477 -0.1059 0.0016  -0.1222 128 LYS B CB  
2818 C CG  . LYS B 128 ? 0.6259 0.7694 0.7760 -0.0848 -0.0223 -0.1433 128 LYS B CG  
2819 C CD  . LYS B 128 ? 0.6924 0.8459 0.8683 -0.0959 -0.0343 -0.1708 128 LYS B CD  
2820 C CE  . LYS B 128 ? 0.7671 0.9132 0.9163 -0.0706 -0.0633 -0.1939 128 LYS B CE  
2821 N NZ  . LYS B 128 ? 0.8155 0.9672 0.9876 -0.0807 -0.0785 -0.2237 128 LYS B NZ  
2822 N N   . PHE B 129 ? 0.4759 0.6574 0.6508 -0.1151 0.0301  -0.0838 129 PHE B N   
2823 C CA  . PHE B 129 ? 0.4866 0.6749 0.6626 -0.1263 0.0462  -0.0668 129 PHE B CA  
2824 C C   . PHE B 129 ? 0.4938 0.7133 0.6994 -0.1462 0.0594  -0.0761 129 PHE B C   
2825 O O   . PHE B 129 ? 0.5244 0.7776 0.7597 -0.1479 0.0531  -0.0999 129 PHE B O   
2826 C CB  . PHE B 129 ? 0.4707 0.6668 0.6310 -0.1110 0.0412  -0.0608 129 PHE B CB  
2827 C CG  . PHE B 129 ? 0.5049 0.6695 0.6409 -0.0967 0.0358  -0.0482 129 PHE B CG  
2828 C CD1 . PHE B 129 ? 0.4953 0.6403 0.6212 -0.0993 0.0433  -0.0279 129 PHE B CD1 
2829 C CD2 . PHE B 129 ? 0.4823 0.6356 0.6056 -0.0799 0.0241  -0.0569 129 PHE B CD2 
2830 C CE1 . PHE B 129 ? 0.4576 0.5796 0.5719 -0.0879 0.0409  -0.0188 129 PHE B CE1 
2831 C CE2 . PHE B 129 ? 0.4760 0.5992 0.5794 -0.0695 0.0254  -0.0449 129 PHE B CE2 
2832 C CZ  . PHE B 129 ? 0.4564 0.5673 0.5605 -0.0748 0.0347  -0.0270 129 PHE B CZ  
2833 N N   . ILE B 130 ? 0.4860 0.6931 0.6828 -0.1602 0.0783  -0.0571 130 ILE B N   
2834 C CA  . ILE B 130 ? 0.5117 0.7413 0.7284 -0.1806 0.0990  -0.0603 130 ILE B CA  
2835 C C   . ILE B 130 ? 0.5397 0.7657 0.7263 -0.1775 0.1102  -0.0408 130 ILE B C   
2836 O O   . ILE B 130 ? 0.5232 0.7166 0.6771 -0.1695 0.1071  -0.0194 130 ILE B O   
2837 C CB  . ILE B 130 ? 0.5368 0.7418 0.7648 -0.2041 0.1155  -0.0557 130 ILE B CB  
2838 C CG1 . ILE B 130 ? 0.5736 0.7838 0.8317 -0.2069 0.1012  -0.0801 130 ILE B CG1 
2839 C CG2 . ILE B 130 ? 0.5535 0.7687 0.7916 -0.2210 0.1396  -0.0527 130 ILE B CG2 
2840 C CD1 . ILE B 130 ? 0.6459 0.8280 0.9167 -0.2282 0.1142  -0.0792 130 ILE B CD1 
2841 N N   . TYR B 131 ? 0.5879 0.8486 0.7859 -0.1821 0.1219  -0.0504 131 TYR B N   
2842 C CA  . TYR B 131 ? 0.6475 0.9056 0.8111 -0.1764 0.1305  -0.0360 131 TYR B CA  
2843 C C   . TYR B 131 ? 0.7291 0.9823 0.8835 -0.1972 0.1624  -0.0253 131 TYR B C   
2844 O O   . TYR B 131 ? 0.7532 1.0195 0.9394 -0.2102 0.1756  -0.0367 131 TYR B O   
2845 C CB  . TYR B 131 ? 0.6094 0.9044 0.7813 -0.1606 0.1202  -0.0543 131 TYR B CB  
2846 C CG  . TYR B 131 ? 0.5719 0.8617 0.7432 -0.1396 0.0923  -0.0610 131 TYR B CG  
2847 C CD1 . TYR B 131 ? 0.5637 0.8295 0.7036 -0.1256 0.0801  -0.0474 131 TYR B CD1 
2848 C CD2 . TYR B 131 ? 0.5493 0.8560 0.7503 -0.1339 0.0785  -0.0814 131 TYR B CD2 
2849 C CE1 . TYR B 131 ? 0.5465 0.8030 0.6857 -0.1093 0.0606  -0.0521 131 TYR B CE1 
2850 C CE2 . TYR B 131 ? 0.5252 0.8184 0.7157 -0.1140 0.0566  -0.0846 131 TYR B CE2 
2851 C CZ  . TYR B 131 ? 0.5262 0.7929 0.6861 -0.1032 0.0506  -0.0690 131 TYR B CZ  
2852 O OH  . TYR B 131 ? 0.5333 0.7823 0.6827 -0.0862 0.0346  -0.0709 131 TYR B OH  
2853 N N   . PHE B 132 ? 0.8028 1.0267 0.9074 -0.1925 0.1690  -0.0020 132 PHE B N   
2854 C CA  . PHE B 132 ? 0.9139 1.1196 0.9923 -0.2093 0.2012  0.0138  132 PHE B CA  
2855 C C   . PHE B 132 ? 1.0326 1.2461 1.0697 -0.1987 0.2086  0.0179  132 PHE B C   
2856 O O   . PHE B 132 ? 1.0243 1.2254 1.0267 -0.1781 0.1864  0.0254  132 PHE B O   
2857 C CB  . PHE B 132 ? 0.9138 1.0613 0.9558 -0.2122 0.2039  0.0423  132 PHE B CB  
2858 C CG  . PHE B 132 ? 0.8625 0.9942 0.9383 -0.2228 0.1995  0.0387  132 PHE B CG  
2859 C CD1 . PHE B 132 ? 0.7860 0.9165 0.8752 -0.2069 0.1701  0.0326  132 PHE B CD1 
2860 C CD2 . PHE B 132 ? 0.8728 0.9845 0.9635 -0.2391 0.2180  0.0417  132 PHE B CD2 
2861 C CE1 . PHE B 132 ? 0.7588 0.8719 0.8724 -0.2147 0.1663  0.0278  132 PHE B CE1 
2862 C CE2 . PHE B 132 ? 0.8474 0.9418 0.9655 -0.2454 0.2097  0.0360  132 PHE B CE2 
2863 C CZ  . PHE B 132 ? 0.8145 0.9099 0.9428 -0.2356 0.1864  0.0283  132 PHE B CZ  
2864 N N   . GLU B 133 ? 1.1602 1.3922 1.2023 -0.2110 0.2385  0.0117  133 GLU B N   
2865 C CA  . GLU B 133 ? 1.2973 1.5329 1.2915 -0.2037 0.2527  0.0156  133 GLU B CA  
2866 C C   . GLU B 133 ? 1.3552 1.5705 1.3325 -0.2142 0.2873  0.0276  133 GLU B C   
2867 O O   . GLU B 133 ? 1.3404 1.5702 1.3685 -0.2271 0.3000  0.0178  133 GLU B O   
2868 C CB  . GLU B 133 ? 1.3846 1.6725 1.4080 -0.1900 0.2412  -0.0135 133 GLU B CB  
2869 C CG  . GLU B 133 ? 1.4855 1.8127 1.5744 -0.1956 0.2500  -0.0381 133 GLU B CG  
2870 C CD  . GLU B 133 ? 1.5144 1.8878 1.6238 -0.1790 0.2403  -0.0652 133 GLU B CD  
2871 O OE1 . GLU B 133 ? 1.5116 1.8853 1.5834 -0.1643 0.2286  -0.0653 133 GLU B OE1 
2872 O OE2 . GLU B 133 ? 1.5144 1.9217 1.6767 -0.1789 0.2418  -0.0870 133 GLU B OE2 
2873 N N   . ASN B 134 ? 1.4561 1.6367 1.3588 -0.2083 0.3011  0.0490  134 ASN B N   
2874 C CA  . ASN B 134 ? 1.4423 1.6040 1.2836 -0.1897 0.2770  0.0590  134 ASN B CA  
2875 C C   . ASN B 134 ? 1.4390 1.5364 1.2233 -0.1849 0.2704  0.0922  134 ASN B C   
2876 O O   . ASN B 134 ? 1.4329 1.5128 1.1884 -0.1623 0.2349  0.0996  134 ASN B O   
2877 C CB  . ASN B 134 ? 1.5185 1.6907 1.3111 -0.1763 0.2858  0.0525  134 ASN B CB  
2878 C CG  . ASN B 134 ? 1.4957 1.7299 1.3430 -0.1746 0.2875  0.0183  134 ASN B CG  
2879 O OD1 . ASN B 134 ? 1.4593 1.7134 1.3187 -0.1553 0.2543  0.0020  134 ASN B OD1 
2880 N ND2 . ASN B 134 ? 1.5090 1.7636 1.3982 -0.1850 0.3150  0.0086  134 ASN B ND2 
2881 N N   . GLY B 135 ? 1.4345 1.4971 1.2104 -0.2019 0.3004  0.1106  135 GLY B N   
2882 C CA  . GLY B 135 ? 1.4505 1.4472 1.1725 -0.1975 0.2971  0.1428  135 GLY B CA  
2883 C C   . GLY B 135 ? 1.3764 1.3649 1.1318 -0.1929 0.2654  0.1436  135 GLY B C   
2884 O O   . GLY B 135 ? 1.4133 1.3588 1.1271 -0.1748 0.2438  0.1643  135 GLY B O   
2885 N N   . GLY B 136 ? 1.2273 1.2587 1.0603 -0.2045 0.2591  0.1193  136 GLY B N   
2886 C CA  . GLY B 136 ? 1.0674 1.0941 0.9363 -0.1977 0.2298  0.1166  136 GLY B CA  
2887 C C   . GLY B 136 ? 0.9604 0.9652 0.8631 -0.2210 0.2479  0.1193  136 GLY B C   
2888 O O   . GLY B 136 ? 0.8506 0.8559 0.7891 -0.2180 0.2277  0.1118  136 GLY B O   
2889 N N   . VAL B 137 ? 0.9619 0.9502 0.8608 -0.2336 0.2754  0.1268  137 VAL B N   
2890 C CA  . VAL B 137 ? 0.9933 0.9609 0.9278 -0.2490 0.2836  0.1269  137 VAL B CA  
2891 C C   . VAL B 137 ? 0.9321 0.9522 0.9416 -0.2645 0.2876  0.0951  137 VAL B C   
2892 O O   . VAL B 137 ? 0.8761 0.8975 0.9290 -0.2729 0.2778  0.0821  137 VAL B O   
2893 C CB  . VAL B 137 ? 1.1492 1.0637 1.0370 -0.2553 0.3092  0.1536  137 VAL B CB  
2894 C CG1 . VAL B 137 ? 1.1712 1.0605 1.0941 -0.2731 0.3167  0.1522  137 VAL B CG1 
2895 C CG2 . VAL B 137 ? 1.2063 1.0652 1.0127 -0.2344 0.3005  0.1852  137 VAL B CG2 
2896 N N   . VAL B 138 ? 0.9592 1.0211 0.9810 -0.2664 0.3005  0.0816  138 VAL B N   
2897 C CA  . VAL B 138 ? 0.9601 1.0720 1.0507 -0.2786 0.3043  0.0516  138 VAL B CA  
2898 C C   . VAL B 138 ? 0.9380 1.0993 1.0694 -0.2667 0.2755  0.0239  138 VAL B C   
2899 O O   . VAL B 138 ? 0.9280 1.1091 1.0397 -0.2516 0.2661  0.0211  138 VAL B O   
2900 C CB  . VAL B 138 ? 0.9826 1.1169 1.0714 -0.2850 0.3334  0.0487  138 VAL B CB  
2901 C CG1 . VAL B 138 ? 0.9604 1.1473 1.1246 -0.2967 0.3358  0.0164  138 VAL B CG1 
2902 C CG2 . VAL B 138 ? 1.0407 1.1225 1.0829 -0.2962 0.3636  0.0773  138 VAL B CG2 
2903 N N   . ALA B 139 ? 0.9455 1.1240 1.1296 -0.2730 0.2610  0.0027  139 ALA B N   
2904 C CA  . ALA B 139 ? 0.9122 1.1302 1.1297 -0.2599 0.2317  -0.0226 139 ALA B CA  
2905 C C   . ALA B 139 ? 0.9390 1.2126 1.1886 -0.2542 0.2322  -0.0470 139 ALA B C   
2906 O O   . ALA B 139 ? 0.9543 1.2473 1.2336 -0.2666 0.2507  -0.0572 139 ALA B O   
2907 C CB  . ALA B 139 ? 0.8903 1.1047 1.1454 -0.2667 0.2158  -0.0380 139 ALA B CB  
2908 N N   . ARG B 140 ? 0.9565 1.2550 1.2014 -0.2351 0.2123  -0.0569 140 ARG B N   
2909 C CA  . ARG B 140 ? 0.9888 1.3373 1.2618 -0.2249 0.2089  -0.0811 140 ARG B CA  
2910 C C   . ARG B 140 ? 1.0529 1.4331 1.3818 -0.2230 0.1890  -0.1104 140 ARG B C   
2911 O O   . ARG B 140 ? 1.0495 1.4146 1.3859 -0.2233 0.1706  -0.1131 140 ARG B O   
2912 C CB  . ARG B 140 ? 0.9218 1.2810 1.1669 -0.2044 0.1935  -0.0814 140 ARG B CB  
2913 C CG  . ARG B 140 ? 0.9135 1.3154 1.1729 -0.1922 0.1960  -0.1013 140 ARG B CG  
2914 C CD  . ARG B 140 ? 0.8866 1.2980 1.1241 -0.1711 0.1754  -0.1054 140 ARG B CD  
2915 N NE  . ARG B 140 ? 0.8969 1.2768 1.0800 -0.1721 0.1800  -0.0808 140 ARG B NE  
2916 C CZ  . ARG B 140 ? 0.8798 1.2463 1.0352 -0.1523 0.1556  -0.0769 140 ARG B CZ  
2917 N NH1 . ARG B 140 ? 0.8439 1.2297 1.0210 -0.1342 0.1322  -0.0958 140 ARG B NH1 
2918 N NH2 . ARG B 140 ? 0.8973 1.2251 1.0017 -0.1482 0.1522  -0.0538 140 ARG B NH2 
2919 N N   . LEU B 141 ? 1.1202 1.5436 1.4863 -0.2199 0.1924  -0.1332 141 LEU B N   
2920 C CA  . LEU B 141 ? 1.1184 1.5752 1.5367 -0.2152 0.1715  -0.1635 141 LEU B CA  
2921 C C   . LEU B 141 ? 1.1348 1.6411 1.5856 -0.2030 0.1712  -0.1878 141 LEU B C   
2922 O O   . LEU B 141 ? 1.1196 1.6544 1.5983 -0.1855 0.1444  -0.2126 141 LEU B O   
2923 C CB  . LEU B 141 ? 1.1394 1.5878 1.5895 -0.2385 0.1822  -0.1674 141 LEU B CB  
2924 C CG  . LEU B 141 ? 1.1385 1.6185 1.6410 -0.2347 0.1580  -0.2001 141 LEU B CG  
2925 C CD1 . LEU B 141 ? 1.1014 1.5772 1.5888 -0.2117 0.1214  -0.2077 141 LEU B CD1 
2926 C CD2 . LEU B 141 ? 1.1749 1.6391 1.7034 -0.2597 0.1682  -0.2026 141 LEU B CD2 
2927 N N   . PRO B 151 ? 1.1654 1.4207 1.6045 -0.2278 -0.0130 -0.2736 151 PRO B N   
2928 C CA  . PRO B 151 ? 1.2261 1.4335 1.6472 -0.2348 -0.0185 -0.2798 151 PRO B CA  
2929 C C   . PRO B 151 ? 1.2882 1.4437 1.6843 -0.2515 0.0121  -0.2476 151 PRO B C   
2930 O O   . PRO B 151 ? 1.3274 1.4570 1.7365 -0.2732 0.0299  -0.2421 151 PRO B O   
2931 C CB  . PRO B 151 ? 1.1948 1.3918 1.5750 -0.2048 -0.0512 -0.2945 151 PRO B CB  
2932 C CG  . PRO B 151 ? 1.1338 1.3595 1.5018 -0.1864 -0.0535 -0.2829 151 PRO B CG  
2933 C CD  . PRO B 151 ? 1.1253 1.3990 1.5401 -0.1966 -0.0398 -0.2818 151 PRO B CD  
2934 N N   . HIS B 152 ? 1.2947 1.4335 1.6545 -0.2399 0.0173  -0.2264 152 HIS B N   
2935 C CA  . HIS B 152 ? 1.3309 1.4234 1.6649 -0.2501 0.0451  -0.1925 152 HIS B CA  
2936 C C   . HIS B 152 ? 1.2859 1.4007 1.6215 -0.2538 0.0665  -0.1656 152 HIS B C   
2937 O O   . HIS B 152 ? 1.2874 1.3697 1.5971 -0.2574 0.0874  -0.1343 152 HIS B O   
2938 C CB  . HIS B 152 ? 1.3679 1.4206 1.6435 -0.2206 0.0365  -0.1750 152 HIS B CB  
2939 C CG  . HIS B 152 ? 1.4307 1.4634 1.6868 -0.2050 0.0122  -0.2002 152 HIS B CG  
2940 N ND1 . HIS B 152 ? 1.4855 1.4674 1.7268 -0.2096 0.0161  -0.2034 152 HIS B ND1 
2941 C CD2 . HIS B 152 ? 1.4466 1.4989 1.6893 -0.1823 -0.0165 -0.2234 152 HIS B CD2 
2942 C CE1 . HIS B 152 ? 1.5154 1.4881 1.7340 -0.1912 -0.0086 -0.2287 152 HIS B CE1 
2943 N NE2 . HIS B 152 ? 1.4975 1.5110 1.7140 -0.1739 -0.0292 -0.2404 152 HIS B NE2 
2944 N N   . PHE B 153 ? 1.2277 1.3961 1.5905 -0.2496 0.0594  -0.1792 153 PHE B N   
2945 C CA  . PHE B 153 ? 1.1847 1.3770 1.5478 -0.2506 0.0778  -0.1599 153 PHE B CA  
2946 C C   . PHE B 153 ? 1.2102 1.3776 1.5737 -0.2721 0.1079  -0.1388 153 PHE B C   
2947 O O   . PHE B 153 ? 1.1933 1.3452 1.5291 -0.2722 0.1266  -0.1102 153 PHE B O   
2948 C CB  . PHE B 153 ? 1.1765 1.4277 1.5735 -0.2414 0.0645  -0.1841 153 PHE B CB  
2949 C CG  . PHE B 153 ? 1.1896 1.4655 1.5873 -0.2415 0.0834  -0.1693 153 PHE B CG  
2950 C CD1 . PHE B 153 ? 1.2392 1.5244 1.6606 -0.2600 0.1071  -0.1668 153 PHE B CD1 
2951 C CD2 . PHE B 153 ? 1.1553 1.4437 1.5293 -0.2231 0.0781  -0.1598 153 PHE B CD2 
2952 C CE1 . PHE B 153 ? 1.2394 1.5448 1.6572 -0.2594 0.1254  -0.1552 153 PHE B CE1 
2953 C CE2 . PHE B 153 ? 1.1538 1.4627 1.5254 -0.2222 0.0945  -0.1490 153 PHE B CE2 
2954 C CZ  . PHE B 153 ? 1.1902 1.5072 1.5821 -0.2398 0.1183  -0.1470 153 PHE B CZ  
2955 N N   . ALA B 154 ? 1.2354 1.3973 1.6281 -0.2894 0.1115  -0.1538 154 ALA B N   
2956 C CA  . ALA B 154 ? 1.2804 1.4176 1.6759 -0.3112 0.1407  -0.1367 154 ALA B CA  
2957 C C   . ALA B 154 ? 1.2704 1.3455 1.6184 -0.3119 0.1557  -0.1026 154 ALA B C   
2958 O O   . ALA B 154 ? 1.2840 1.3434 1.6081 -0.3155 0.1775  -0.0754 154 ALA B O   
2959 C CB  . ALA B 154 ? 1.3381 1.4767 1.7751 -0.3300 0.1393  -0.1616 154 ALA B CB  
2960 N N   . GLU B 155 ? 1.2476 1.2862 1.5797 -0.3062 0.1430  -0.1050 155 GLU B N   
2961 C CA  . GLU B 155 ? 1.2700 1.2468 1.5601 -0.3037 0.1547  -0.0754 155 GLU B CA  
2962 C C   . GLU B 155 ? 1.1930 1.1670 1.4453 -0.2865 0.1580  -0.0476 155 GLU B C   
2963 O O   . GLU B 155 ? 1.2356 1.1695 1.4541 -0.2851 0.1730  -0.0176 155 GLU B O   
2964 C CB  . GLU B 155 ? 1.3463 1.2873 1.6304 -0.2985 0.1398  -0.0889 155 GLU B CB  
2965 C CG  . GLU B 155 ? 1.4668 1.3386 1.7156 -0.2966 0.1524  -0.0629 155 GLU B CG  
2966 C CD  . GLU B 155 ? 1.5498 1.3846 1.7960 -0.2924 0.1399  -0.0811 155 GLU B CD  
2967 O OE1 . GLU B 155 ? 1.5631 1.4153 1.8389 -0.3016 0.1268  -0.1139 155 GLU B OE1 
2968 O OE2 . GLU B 155 ? 1.5939 1.3821 1.8079 -0.2777 0.1423  -0.0639 155 GLU B OE2 
2969 N N   . LEU B 156 ? 1.0997 1.1149 1.3567 -0.2725 0.1427  -0.0584 156 LEU B N   
2970 C CA  . LEU B 156 ? 1.0644 1.0803 1.2896 -0.2568 0.1438  -0.0357 156 LEU B CA  
2971 C C   . LEU B 156 ? 1.0957 1.1290 1.3114 -0.2606 0.1602  -0.0192 156 LEU B C   
2972 O O   . LEU B 156 ? 1.1063 1.1177 1.2856 -0.2532 0.1684  0.0076  156 LEU B O   
2973 C CB  . LEU B 156 ? 0.9909 1.0423 1.2201 -0.2378 0.1211  -0.0520 156 LEU B CB  
2974 C CG  . LEU B 156 ? 0.9631 1.0081 1.1547 -0.2122 0.1138  -0.0289 156 LEU B CG  
2975 C CD1 . LEU B 156 ? 1.0129 1.0059 1.1767 -0.2015 0.1144  -0.0090 156 LEU B CD1 
2976 C CD2 . LEU B 156 ? 0.8905 0.9667 1.0822 -0.1908 0.0917  -0.0438 156 LEU B CD2 
2977 N N   . ALA B 157 ? 1.0889 1.1607 1.3367 -0.2711 0.1649  -0.0366 157 ALA B N   
2978 C CA  . ALA B 157 ? 1.0897 1.1788 1.3305 -0.2755 0.1838  -0.0249 157 ALA B CA  
2979 C C   . ALA B 157 ? 1.1673 1.2077 1.3804 -0.2881 0.2086  0.0017  157 ALA B C   
2980 O O   . ALA B 157 ? 1.1883 1.2226 1.3712 -0.2868 0.2250  0.0220  157 ALA B O   
2981 C CB  . ALA B 157 ? 1.0667 1.2079 1.3542 -0.2831 0.1842  -0.0525 157 ALA B CB  
2982 N N   . GLN B 158 ? 1.1882 1.1908 1.4077 -0.2992 0.2111  0.0010  158 GLN B N   
2983 C CA  . GLN B 158 ? 1.2882 1.2365 1.4785 -0.3096 0.2331  0.0266  158 GLN B CA  
2984 C C   . GLN B 158 ? 1.2538 1.1519 1.3914 -0.2926 0.2292  0.0562  158 GLN B C   
2985 O O   . GLN B 158 ? 1.3277 1.1839 1.4247 -0.2926 0.2454  0.0838  158 GLN B O   
2986 C CB  . GLN B 158 ? 1.3921 1.3165 1.6106 -0.3282 0.2373  0.0129  158 GLN B CB  
2987 C CG  . GLN B 158 ? 1.4400 1.4139 1.7171 -0.3450 0.2376  -0.0202 158 GLN B CG  
2988 C CD  . GLN B 158 ? 1.4877 1.4962 1.7755 -0.3536 0.2588  -0.0184 158 GLN B CD  
2989 O OE1 . GLN B 158 ? 1.5338 1.5132 1.7854 -0.3572 0.2824  0.0087  158 GLN B OE1 
2990 N NE2 . GLN B 158 ? 1.4639 1.5334 1.7994 -0.3553 0.2503  -0.0479 158 GLN B NE2 
2991 N N   . LEU B 159 ? 1.1491 1.0500 1.2866 -0.2770 0.2078  0.0500  159 LEU B N   
2992 C CA  . LEU B 159 ? 1.1161 0.9737 1.2117 -0.2587 0.2021  0.0747  159 LEU B CA  
2993 C C   . LEU B 159 ? 1.1189 0.9792 1.1746 -0.2482 0.2081  0.0981  159 LEU B C   
2994 O O   . LEU B 159 ? 1.1120 1.0206 1.1768 -0.2468 0.2058  0.0883  159 LEU B O   
2995 C CB  . LEU B 159 ? 1.0446 0.9130 1.1537 -0.2447 0.1814  0.0605  159 LEU B CB  
2996 C CG  . LEU B 159 ? 1.0730 0.9006 1.1499 -0.2213 0.1724  0.0818  159 LEU B CG  
2997 C CD1 . LEU B 159 ? 1.1435 0.9090 1.2126 -0.2245 0.1796  0.0891  159 LEU B CD1 
2998 C CD2 . LEU B 159 ? 1.0632 0.9243 1.1523 -0.1982 0.1472  0.0676  159 LEU B CD2 
2999 N N   . ARG B 160 ? 1.1436 0.9495 1.1517 -0.2389 0.2144  0.1281  160 ARG B N   
3000 C CA  . ARG B 160 ? 1.1492 0.9489 1.1086 -0.2277 0.2194  0.1512  160 ARG B CA  
3001 C C   . ARG B 160 ? 1.1124 0.8969 1.0438 -0.1976 0.1953  0.1653  160 ARG B C   
3002 O O   . ARG B 160 ? 1.1023 0.8705 1.0483 -0.1850 0.1800  0.1625  160 ARG B O   
3003 C CB  . ARG B 160 ? 1.2725 1.0266 1.1919 -0.2334 0.2398  0.1746  160 ARG B CB  
3004 C CG  . ARG B 160 ? 1.3498 1.1293 1.3005 -0.2588 0.2616  0.1599  160 ARG B CG  
3005 C CD  . ARG B 160 ? 1.4955 1.2248 1.4036 -0.2653 0.2853  0.1845  160 ARG B CD  
3006 N NE  . ARG B 160 ? 1.5544 1.3086 1.4958 -0.2908 0.3096  0.1705  160 ARG B NE  
3007 C CZ  . ARG B 160 ? 1.6823 1.3980 1.5988 -0.3033 0.3360  0.1866  160 ARG B CZ  
3008 N NH1 . ARG B 160 ? 1.7717 1.4201 1.6255 -0.2906 0.3392  0.2179  160 ARG B NH1 
3009 N NH2 . ARG B 160 ? 1.7117 1.4549 1.6660 -0.3274 0.3592  0.1712  160 ARG B NH2 
3010 N N   . TYR B 161 ? 1.1083 0.9075 1.0051 -0.1812 0.1863  0.1761  161 TYR B N   
3011 C CA  . TYR B 161 ? 1.0655 0.8639 0.9435 -0.1482 0.1557  0.1852  161 TYR B CA  
3012 C C   . TYR B 161 ? 1.1199 0.8502 0.9533 -0.1328 0.1548  0.2136  161 TYR B C   
3013 O O   . TYR B 161 ? 1.2135 0.8994 0.9964 -0.1387 0.1746  0.2356  161 TYR B O   
3014 C CB  . TYR B 161 ? 1.0129 0.8469 0.8675 -0.1371 0.1452  0.1843  161 TYR B CB  
3015 C CG  . TYR B 161 ? 0.9641 0.7984 0.7988 -0.1048 0.1129  0.1925  161 TYR B CG  
3016 C CD1 . TYR B 161 ? 0.8406 0.7043 0.7188 -0.0906 0.0886  0.1779  161 TYR B CD1 
3017 C CD2 . TYR B 161 ? 1.0121 0.8181 0.7846 -0.0883 0.1070  0.2133  161 TYR B CD2 
3018 C CE1 . TYR B 161 ? 0.8586 0.7290 0.7303 -0.0633 0.0597  0.1819  161 TYR B CE1 
3019 C CE2 . TYR B 161 ? 0.9988 0.8103 0.7592 -0.0579 0.0729  0.2167  161 TYR B CE2 
3020 C CZ  . TYR B 161 ? 0.9418 0.7886 0.7577 -0.0468 0.0495  0.1998  161 TYR B CZ  
3021 O OH  . TYR B 161 ? 0.9715 0.8297 0.7865 -0.0188 0.0163  0.1999  161 TYR B OH  
3022 N N   . GLU B 162 ? 1.1013 0.8208 0.9520 -0.1121 0.1338  0.2134  162 GLU B N   
3023 C CA  . GLU B 162 ? 1.1990 0.8534 1.0146 -0.0937 0.1304  0.2377  162 GLU B CA  
3024 C C   . GLU B 162 ? 1.1369 0.7997 0.9416 -0.0556 0.0958  0.2450  162 GLU B C   
3025 O O   . GLU B 162 ? 1.1196 0.7433 0.9162 -0.0334 0.0844  0.2572  162 GLU B O   
3026 C CB  . GLU B 162 ? 1.2824 0.9078 1.1308 -0.1016 0.1386  0.2301  162 GLU B CB  
3027 C CG  . GLU B 162 ? 1.3693 0.9840 1.2352 -0.1397 0.1696  0.2195  162 GLU B CG  
3028 C CD  . GLU B 162 ? 1.4390 1.0327 1.3410 -0.1460 0.1720  0.2046  162 GLU B CD  
3029 O OE1 . GLU B 162 ? 1.4658 1.0586 1.3808 -0.1206 0.1521  0.2015  162 GLU B OE1 
3030 O OE2 . GLU B 162 ? 1.4538 1.0402 1.3750 -0.1745 0.1903  0.1918  162 GLU B OE2 
3031 N N   . GLY B 163 ? 1.0593 0.7741 0.8679 -0.0477 0.0783  0.2351  163 GLY B N   
3032 C CA  . GLY B 163 ? 1.0501 0.7800 0.8546 -0.0143 0.0438  0.2378  163 GLY B CA  
3033 C C   . GLY B 163 ? 0.9971 0.7842 0.8685 -0.0078 0.0258  0.2131  163 GLY B C   
3034 O O   . GLY B 163 ? 0.9705 0.7736 0.8842 -0.0243 0.0391  0.1974  163 GLY B O   
3035 N N   . ALA B 164 ? 0.9986 0.8146 0.8784 0.0163  -0.0043 0.2090  164 ALA B N   
3036 C CA  . ALA B 164 ? 0.8812 0.7509 0.8255 0.0208  -0.0183 0.1861  164 ALA B CA  
3037 C C   . ALA B 164 ? 0.9213 0.7800 0.9074 0.0292  -0.0151 0.1830  164 ALA B C   
3038 O O   . ALA B 164 ? 0.8962 0.7875 0.9323 0.0228  -0.0102 0.1647  164 ALA B O   
3039 C CB  . ALA B 164 ? 0.8260 0.7272 0.7745 0.0434  -0.0516 0.1810  164 ALA B CB  
3040 N N   . GLU B 165 ? 0.9790 0.7872 0.9398 0.0450  -0.0162 0.2012  165 GLU B N   
3041 C CA  . GLU B 165 ? 0.9765 0.7688 0.9727 0.0564  -0.0126 0.1981  165 GLU B CA  
3042 C C   . GLU B 165 ? 0.9100 0.6879 0.9178 0.0299  0.0168  0.1892  165 GLU B C   
3043 O O   . GLU B 165 ? 0.8647 0.6548 0.9141 0.0319  0.0224  0.1748  165 GLU B O   
3044 C CB  . GLU B 165 ? 1.1026 0.8382 1.0638 0.0830  -0.0228 0.2204  165 GLU B CB  
3045 C CG  . GLU B 165 ? 1.1781 0.9331 1.1428 0.1183  -0.0595 0.2235  165 GLU B CG  
3046 C CD  . GLU B 165 ? 1.1732 0.9805 1.2162 0.1342  -0.0732 0.2020  165 GLU B CD  
3047 O OE1 . GLU B 165 ? 1.1792 0.9899 1.2616 0.1245  -0.0525 0.1905  165 GLU B OE1 
3048 O OE2 . GLU B 165 ? 1.1642 1.0092 1.2297 0.1561  -0.1038 0.1953  165 GLU B OE2 
3049 N N   . SER B 166 ? 0.8952 0.6483 0.8668 0.0053  0.0357  0.1962  166 SER B N   
3050 C CA  . SER B 166 ? 0.8520 0.5975 0.8377 -0.0213 0.0596  0.1835  166 SER B CA  
3051 C C   . SER B 166 ? 0.8099 0.6123 0.8352 -0.0318 0.0592  0.1593  166 SER B C   
3052 O O   . SER B 166 ? 0.7791 0.5826 0.8283 -0.0393 0.0690  0.1441  166 SER B O   
3053 C CB  . SER B 166 ? 0.8562 0.5733 0.8044 -0.0473 0.0799  0.1932  166 SER B CB  
3054 O OG  . SER B 166 ? 0.8646 0.6200 0.8014 -0.0567 0.0780  0.1908  166 SER B OG  
3055 N N   . VAL B 167 ? 0.8068 0.6516 0.8338 -0.0308 0.0475  0.1556  167 VAL B N   
3056 C CA  . VAL B 167 ? 0.7178 0.6101 0.7761 -0.0393 0.0471  0.1350  167 VAL B CA  
3057 C C   . VAL B 167 ? 0.6870 0.5959 0.7855 -0.0231 0.0408  0.1251  167 VAL B C   
3058 O O   . VAL B 167 ? 0.6301 0.5527 0.7497 -0.0300 0.0500  0.1098  167 VAL B O   
3059 C CB  . VAL B 167 ? 0.6845 0.6126 0.7337 -0.0409 0.0359  0.1330  167 VAL B CB  
3060 C CG1 . VAL B 167 ? 0.6224 0.5896 0.6982 -0.0513 0.0386  0.1128  167 VAL B CG1 
3061 C CG2 . VAL B 167 ? 0.7182 0.6282 0.7240 -0.0539 0.0453  0.1447  167 VAL B CG2 
3062 N N   . ARG B 168 ? 0.7067 0.6136 0.8149 -0.0002 0.0257  0.1335  168 ARG B N   
3063 C CA  . ARG B 168 ? 0.6768 0.6020 0.8306 0.0157  0.0229  0.1238  168 ARG B CA  
3064 C C   . ARG B 168 ? 0.7104 0.6045 0.8709 0.0161  0.0410  0.1196  168 ARG B C   
3065 O O   . ARG B 168 ? 0.6632 0.5726 0.8517 0.0160  0.0518  0.1055  168 ARG B O   
3066 C CB  . ARG B 168 ? 0.6876 0.6191 0.8550 0.0423  0.0001  0.1319  168 ARG B CB  
3067 C CG  . ARG B 168 ? 0.6687 0.6196 0.8915 0.0602  -0.0002 0.1214  168 ARG B CG  
3068 C CD  . ARG B 168 ? 0.7411 0.7093 0.9849 0.0872  -0.0286 0.1253  168 ARG B CD  
3069 N NE  . ARG B 168 ? 0.7819 0.7741 1.0885 0.1052  -0.0277 0.1134  168 ARG B NE  
3070 C CZ  . ARG B 168 ? 0.8982 0.8629 1.2138 0.1255  -0.0240 0.1178  168 ARG B CZ  
3071 N NH1 . ARG B 168 ? 0.9820 0.8889 1.2452 0.1289  -0.0215 0.1348  168 ARG B NH1 
3072 N NH2 . ARG B 168 ? 0.9071 0.9006 1.2861 0.1419  -0.0208 0.1046  168 ARG B NH2 
3073 N N   . ASP B 169 ? 0.7006 0.5467 0.8317 0.0165  0.0458  0.1316  169 ASP B N   
3074 C CA  . ASP B 169 ? 0.7574 0.5679 0.8902 0.0158  0.0620  0.1255  169 ASP B CA  
3075 C C   . ASP B 169 ? 0.7400 0.5582 0.8700 -0.0072 0.0766  0.1086  169 ASP B C   
3076 O O   . ASP B 169 ? 0.7248 0.5367 0.8668 -0.0044 0.0874  0.0950  169 ASP B O   
3077 C CB  . ASP B 169 ? 0.8541 0.6056 0.9531 0.0169  0.0652  0.1416  169 ASP B CB  
3078 C CG  . ASP B 169 ? 0.9686 0.7034 1.0638 0.0460  0.0483  0.1589  169 ASP B CG  
3079 O OD1 . ASP B 169 ? 0.9619 0.7348 1.0925 0.0665  0.0341  0.1539  169 ASP B OD1 
3080 O OD2 . ASP B 169 ? 1.1084 0.7907 1.1659 0.0488  0.0490  0.1770  169 ASP B OD2 
3081 N N   . GLN B 170 ? 0.7307 0.5625 0.8430 -0.0276 0.0763  0.1085  170 GLN B N   
3082 C CA  . GLN B 170 ? 0.7275 0.5726 0.8393 -0.0462 0.0847  0.0909  170 GLN B CA  
3083 C C   . GLN B 170 ? 0.6637 0.5424 0.7966 -0.0389 0.0844  0.0779  170 GLN B C   
3084 O O   . GLN B 170 ? 0.6832 0.5573 0.8140 -0.0424 0.0926  0.0631  170 GLN B O   
3085 C CB  . GLN B 170 ? 0.7295 0.5906 0.8259 -0.0663 0.0838  0.0923  170 GLN B CB  
3086 C CG  . GLN B 170 ? 0.6826 0.5069 0.7577 -0.0817 0.0930  0.1014  170 GLN B CG  
3087 C CD  . GLN B 170 ? 0.7512 0.5950 0.8124 -0.0981 0.0951  0.1063  170 GLN B CD  
3088 O OE1 . GLN B 170 ? 0.7140 0.5974 0.7792 -0.0951 0.0866  0.1031  170 GLN B OE1 
3089 N NE2 . GLN B 170 ? 0.7760 0.5900 0.8213 -0.1160 0.1089  0.1132  170 GLN B NE2 
3090 N N   . MET B 171 ? 0.6228 0.5319 0.7736 -0.0285 0.0752  0.0829  171 MET B N   
3091 C CA  . MET B 171 ? 0.6229 0.5606 0.7958 -0.0243 0.0786  0.0721  171 MET B CA  
3092 C C   . MET B 171 ? 0.6592 0.5845 0.8518 -0.0095 0.0911  0.0670  171 MET B C   
3093 O O   . MET B 171 ? 0.6336 0.5595 0.8259 -0.0101 0.1043  0.0560  171 MET B O   
3094 C CB  . MET B 171 ? 0.5976 0.5713 0.7901 -0.0200 0.0652  0.0760  171 MET B CB  
3095 C CG  . MET B 171 ? 0.6059 0.6045 0.8272 -0.0173 0.0720  0.0658  171 MET B CG  
3096 S SD  . MET B 171 ? 0.7499 0.7438 0.9469 -0.0300 0.0848  0.0535  171 MET B SD  
3097 C CE  . MET B 171 ? 0.4489 0.4614 0.6259 -0.0433 0.0694  0.0545  171 MET B CE  
3098 N N   . VAL B 172 ? 0.6910 0.6030 0.8977 0.0057  0.0878  0.0753  172 VAL B N   
3099 C CA  . VAL B 172 ? 0.6771 0.5755 0.9041 0.0219  0.1014  0.0697  172 VAL B CA  
3100 C C   . VAL B 172 ? 0.6845 0.5464 0.8823 0.0159  0.1167  0.0593  172 VAL B C   
3101 O O   . VAL B 172 ? 0.6663 0.5242 0.8679 0.0222  0.1336  0.0483  172 VAL B O   
3102 C CB  . VAL B 172 ? 0.7016 0.5857 0.9439 0.0419  0.0917  0.0804  172 VAL B CB  
3103 C CG1 . VAL B 172 ? 0.7414 0.6016 0.9975 0.0583  0.1083  0.0729  172 VAL B CG1 
3104 C CG2 . VAL B 172 ? 0.6925 0.6179 0.9718 0.0537  0.0743  0.0850  172 VAL B CG2 
3105 N N   . THR B 173 ? 0.7296 0.5639 0.8975 0.0034  0.1116  0.0617  173 THR B N   
3106 C CA  . THR B 173 ? 0.7214 0.5220 0.8637 -0.0043 0.1211  0.0483  173 THR B CA  
3107 C C   . THR B 173 ? 0.6815 0.4978 0.8101 -0.0117 0.1260  0.0334  173 THR B C   
3108 O O   . THR B 173 ? 0.6941 0.4907 0.8081 -0.0053 0.1375  0.0201  173 THR B O   
3109 C CB  . THR B 173 ? 0.7060 0.4817 0.8274 -0.0222 0.1148  0.0517  173 THR B CB  
3110 O OG1 . THR B 173 ? 0.7649 0.5145 0.8883 -0.0136 0.1115  0.0685  173 THR B OG1 
3111 C CG2 . THR B 173 ? 0.6923 0.4360 0.7942 -0.0311 0.1215  0.0329  173 THR B CG2 
3112 N N   . ILE B 174 ? 0.6333 0.4816 0.7620 -0.0229 0.1170  0.0357  174 ILE B N   
3113 C CA  . ILE B 174 ? 0.5856 0.4455 0.6968 -0.0282 0.1182  0.0233  174 ILE B CA  
3114 C C   . ILE B 174 ? 0.5810 0.4421 0.6943 -0.0144 0.1336  0.0196  174 ILE B C   
3115 O O   . ILE B 174 ? 0.6304 0.4739 0.7146 -0.0110 0.1411  0.0076  174 ILE B O   
3116 C CB  . ILE B 174 ? 0.5280 0.4220 0.6426 -0.0398 0.1059  0.0273  174 ILE B CB  
3117 C CG1 . ILE B 174 ? 0.5197 0.4110 0.6255 -0.0564 0.0968  0.0254  174 ILE B CG1 
3118 C CG2 . ILE B 174 ? 0.5395 0.4447 0.6392 -0.0386 0.1074  0.0174  174 ILE B CG2 
3119 C CD1 . ILE B 174 ? 0.5595 0.4838 0.6666 -0.0671 0.0874  0.0255  174 ILE B CD1 
3120 N N   . VAL B 175 ? 0.5766 0.4574 0.7239 -0.0060 0.1390  0.0290  175 VAL B N   
3121 C CA  . VAL B 175 ? 0.6344 0.5194 0.7918 0.0035  0.1590  0.0259  175 VAL B CA  
3122 C C   . VAL B 175 ? 0.6967 0.5504 0.8462 0.0173  0.1783  0.0189  175 VAL B C   
3123 O O   . VAL B 175 ? 0.7478 0.5852 0.8741 0.0230  0.1979  0.0114  175 VAL B O   
3124 C CB  . VAL B 175 ? 0.6119 0.5334 0.8194 0.0062  0.1583  0.0340  175 VAL B CB  
3125 C CG1 . VAL B 175 ? 0.6022 0.5273 0.8303 0.0138  0.1853  0.0299  175 VAL B CG1 
3126 C CG2 . VAL B 175 ? 0.5582 0.5064 0.7662 -0.0066 0.1417  0.0376  175 VAL B CG2 
3127 N N   . ARG B 176 ? 0.7542 0.5946 0.9172 0.0240  0.1738  0.0214  176 ARG B N   
3128 C CA  . ARG B 176 ? 0.7918 0.5977 0.9447 0.0381  0.1903  0.0127  176 ARG B CA  
3129 C C   . ARG B 176 ? 0.8135 0.5836 0.9117 0.0340  0.1927  -0.0022 176 ARG B C   
3130 O O   . ARG B 176 ? 0.8639 0.6094 0.9391 0.0457  0.2125  -0.0128 176 ARG B O   
3131 C CB  . ARG B 176 ? 0.8856 0.6758 1.0563 0.0456  0.1807  0.0186  176 ARG B CB  
3132 C CG  . ARG B 176 ? 0.9371 0.7531 1.1611 0.0619  0.1824  0.0272  176 ARG B CG  
3133 C CD  . ARG B 176 ? 1.0505 0.8358 1.2841 0.0823  0.1915  0.0234  176 ARG B CD  
3134 N NE  . ARG B 176 ? 1.1156 0.9325 1.4073 0.1019  0.1967  0.0260  176 ARG B NE  
3135 C CZ  . ARG B 176 ? 1.1533 0.9846 1.4770 0.1131  0.1760  0.0373  176 ARG B CZ  
3136 N NH1 . ARG B 176 ? 1.1637 0.9744 1.4598 0.1057  0.1530  0.0498  176 ARG B NH1 
3137 N NH2 . ARG B 176 ? 1.1614 1.0273 1.5445 0.1325  0.1786  0.0353  176 ARG B NH2 
3138 N N   . SER B 177 ? 0.8158 0.5841 0.8938 0.0183  0.1723  -0.0045 177 SER B N   
3139 C CA  . SER B 177 ? 0.8518 0.5922 0.8847 0.0139  0.1674  -0.0222 177 SER B CA  
3140 C C   . SER B 177 ? 0.8267 0.5698 0.8265 0.0186  0.1742  -0.0286 177 SER B C   
3141 O O   . SER B 177 ? 0.8732 0.5847 0.8303 0.0283  0.1818  -0.0432 177 SER B O   
3142 C CB  . SER B 177 ? 0.8873 0.6338 0.9200 -0.0058 0.1449  -0.0244 177 SER B CB  
3143 O OG  . SER B 177 ? 1.0033 0.7392 1.0592 -0.0102 0.1417  -0.0149 177 SER B OG  
3144 N N   . VAL B 178 ? 0.6798 0.4557 0.6943 0.0129  0.1712  -0.0178 178 VAL B N   
3145 C CA  . VAL B 178 ? 0.6872 0.4606 0.6704 0.0184  0.1803  -0.0196 178 VAL B CA  
3146 C C   . VAL B 178 ? 0.7237 0.4744 0.6953 0.0340  0.2121  -0.0197 178 VAL B C   
3147 O O   . VAL B 178 ? 0.7456 0.4636 0.6631 0.0443  0.2226  -0.0288 178 VAL B O   
3148 C CB  . VAL B 178 ? 0.6134 0.4234 0.6227 0.0097  0.1750  -0.0071 178 VAL B CB  
3149 C CG1 . VAL B 178 ? 0.6849 0.4835 0.6666 0.0170  0.1931  -0.0051 178 VAL B CG1 
3150 C CG2 . VAL B 178 ? 0.5670 0.3960 0.5743 -0.0033 0.1474  -0.0103 178 VAL B CG2 
3151 N N   . GLN B 179 ? 0.7393 0.5077 0.7610 0.0370  0.2277  -0.0104 179 GLN B N   
3152 C CA  . GLN B 179 ? 0.7832 0.5364 0.8065 0.0511  0.2622  -0.0118 179 GLN B CA  
3153 C C   . GLN B 179 ? 0.8100 0.5185 0.7891 0.0642  0.2704  -0.0267 179 GLN B C   
3154 O O   . GLN B 179 ? 0.9078 0.5869 0.8452 0.0760  0.2961  -0.0327 179 GLN B O   
3155 C CB  . GLN B 179 ? 0.8033 0.5902 0.9001 0.0536  0.2717  -0.0034 179 GLN B CB  
3156 C CG  . GLN B 179 ? 0.7889 0.6182 0.9303 0.0425  0.2688  0.0074  179 GLN B CG  
3157 C CD  . GLN B 179 ? 0.7783 0.6451 0.9960 0.0471  0.2724  0.0117  179 GLN B CD  
3158 O OE1 . GLN B 179 ? 0.7854 0.6474 1.0236 0.0597  0.2732  0.0088  179 GLN B OE1 
3159 N NE2 . GLN B 179 ? 0.7182 0.6221 0.9796 0.0381  0.2727  0.0168  179 GLN B NE2 
3160 N N   . PHE B 180 ? 0.7265 0.4257 0.7103 0.0618  0.2498  -0.0331 180 PHE B N   
3161 C CA  . PHE B 180 ? 0.8180 0.4723 0.7626 0.0732  0.2552  -0.0503 180 PHE B CA  
3162 C C   . PHE B 180 ? 0.8507 0.4753 0.7244 0.0736  0.2437  -0.0660 180 PHE B C   
3163 O O   . PHE B 180 ? 0.8977 0.4837 0.7205 0.0888  0.2599  -0.0793 180 PHE B O   
3164 C CB  . PHE B 180 ? 0.7890 0.4357 0.7597 0.0686  0.2370  -0.0528 180 PHE B CB  
3165 C CG  . PHE B 180 ? 0.8704 0.4677 0.8006 0.0769  0.2378  -0.0738 180 PHE B CG  
3166 C CD1 . PHE B 180 ? 0.8849 0.4554 0.8093 0.0972  0.2644  -0.0814 180 PHE B CD1 
3167 C CD2 . PHE B 180 ? 0.8979 0.4773 0.7993 0.0643  0.2122  -0.0886 180 PHE B CD2 
3168 C CE1 . PHE B 180 ? 0.9614 0.4830 0.8452 0.1056  0.2644  -0.1033 180 PHE B CE1 
3169 C CE2 . PHE B 180 ? 0.9534 0.4868 0.8197 0.0706  0.2105  -0.1114 180 PHE B CE2 
3170 C CZ  . PHE B 180 ? 1.0013 0.5032 0.8552 0.0918  0.2361  -0.1188 180 PHE B CZ  
3171 N N   . LEU B 181 ? 0.8034 0.4463 0.6730 0.0590  0.2152  -0.0659 181 LEU B N   
3172 C CA  . LEU B 181 ? 0.9032 0.5254 0.7126 0.0611  0.1974  -0.0827 181 LEU B CA  
3173 C C   . LEU B 181 ? 1.0487 0.6502 0.8030 0.0770  0.2175  -0.0804 181 LEU B C   
3174 O O   . LEU B 181 ? 1.1223 0.6842 0.8095 0.0914  0.2168  -0.0965 181 LEU B O   
3175 C CB  . LEU B 181 ? 0.8605 0.5162 0.6888 0.0434  0.1657  -0.0820 181 LEU B CB  
3176 C CG  . LEU B 181 ? 0.8566 0.5032 0.6353 0.0463  0.1406  -0.1005 181 LEU B CG  
3177 C CD1 . LEU B 181 ? 0.8914 0.5085 0.6455 0.0476  0.1247  -0.1278 181 LEU B CD1 
3178 C CD2 . LEU B 181 ? 0.7873 0.4769 0.5978 0.0304  0.1166  -0.0962 181 LEU B CD2 
3179 N N   . CYS B 182 ? 1.0452 0.6696 0.8247 0.0745  0.2358  -0.0606 182 CYS B N   
3180 C CA  . CYS B 182 ? 1.1074 0.7080 0.8344 0.0863  0.2575  -0.0548 182 CYS B CA  
3181 C C   . CYS B 182 ? 1.1790 0.7438 0.8777 0.1027  0.2992  -0.0560 182 CYS B C   
3182 O O   . CYS B 182 ? 1.2544 0.7799 0.8832 0.1167  0.3180  -0.0562 182 CYS B O   
3183 C CB  . CYS B 182 ? 1.0226 0.6569 0.7896 0.0752  0.2644  -0.0349 182 CYS B CB  
3184 S SG  . CYS B 182 ? 1.0374 0.7100 0.8262 0.0594  0.2207  -0.0339 182 CYS B SG  
3185 N N   . THR B 183 ? 1.1352 0.7107 0.8842 0.1030  0.3149  -0.0568 183 THR B N   
3186 C CA  . THR B 183 ? 1.1460 0.6982 0.8849 0.1177  0.3601  -0.0570 183 THR B CA  
3187 C C   . THR B 183 ? 1.2427 0.7593 0.9415 0.1311  0.3583  -0.0749 183 THR B C   
3188 O O   . THR B 183 ? 1.2687 0.7666 0.9387 0.1407  0.3823  -0.0732 183 THR B O   
3189 C CB  . THR B 183 ? 1.5152 1.1119 1.3483 0.1114  0.3810  -0.0449 183 THR B CB  
3190 O OG1 . THR B 183 ? 1.5790 1.1729 1.4139 0.1151  0.4167  -0.0368 183 THR B OG1 
3191 C CG2 . THR B 183 ? 1.5081 1.1141 1.3862 0.1142  0.3672  -0.0530 183 THR B CG2 
3192 N N   . LYS B 184 ? 1.2707 0.7776 0.9688 0.1294  0.3286  -0.0918 184 LYS B N   
3193 C CA  . LYS B 184 ? 1.2871 0.7633 0.9598 0.1396  0.3246  -0.1104 184 LYS B CA  
3194 C C   . LYS B 184 ? 1.2428 0.6918 0.8692 0.1377  0.2866  -0.1341 184 LYS B C   
3195 O O   . LYS B 184 ? 1.2822 0.7060 0.8910 0.1435  0.2784  -0.1526 184 LYS B O   
3196 C CB  . LYS B 184 ? 1.3376 0.8299 1.0831 0.1391  0.3330  -0.1084 184 LYS B CB  
3197 C CG  . LYS B 184 ? 1.4348 0.9486 1.2197 0.1467  0.3693  -0.0951 184 LYS B CG  
3198 C CD  . LYS B 184 ? 1.4426 0.9902 1.3161 0.1450  0.3705  -0.0869 184 LYS B CD  
3199 C CE  . LYS B 184 ? 1.4626 1.0431 1.3864 0.1501  0.4029  -0.0753 184 LYS B CE  
3200 N NZ  . LYS B 184 ? 1.4296 1.0496 1.4424 0.1512  0.3981  -0.0677 184 LYS B NZ  
3201 N N   . VAL B 185 ? 1.1853 0.6498 0.8020 0.1268  0.2584  -0.1331 185 VAL B N   
3202 C CA  . VAL B 185 ? 1.2265 0.6777 0.8099 0.1225  0.2180  -0.1570 185 VAL B CA  
3203 C C   . VAL B 185 ? 1.2883 0.7236 0.7973 0.1342  0.2044  -0.1628 185 VAL B C   
3204 O O   . VAL B 185 ? 1.3691 0.7776 0.8205 0.1456  0.1848  -0.1842 185 VAL B O   
3205 C CB  . VAL B 185 ? 1.1881 0.6820 0.8401 0.0964  0.1866  -0.1536 185 VAL B CB  
3206 C CG1 . VAL B 185 ? 1.2417 0.7304 0.8680 0.0898  0.1462  -0.1803 185 VAL B CG1 
3207 C CG2 . VAL B 185 ? 1.1274 0.6237 0.8383 0.0881  0.1953  -0.1495 185 VAL B CG2 
3208 N N   . LEU B 186 ? 1.2501 0.7114 0.7694 0.1302  0.2095  -0.1406 186 LEU B N   
3209 C CA  . LEU B 186 ? 1.2868 0.7317 0.7373 0.1429  0.1952  -0.1423 186 LEU B CA  
3210 C C   . LEU B 186 ? 1.3521 0.7630 0.7377 0.1620  0.2205  -0.1315 186 LEU B C   
3211 O O   . LEU B 186 ? 1.3163 0.7250 0.7203 0.1622  0.2609  -0.1141 186 LEU B O   
3212 C CB  . LEU B 186 ? 1.2354 0.7224 0.7276 0.1298  0.1901  -0.1196 186 LEU B CB  
3213 C CG  . LEU B 186 ? 1.1293 0.6679 0.6883 0.1076  0.1532  -0.1234 186 LEU B CG  
3214 C CD1 . LEU B 186 ? 1.0391 0.6142 0.6352 0.0974  0.1556  -0.1003 186 LEU B CD1 
3215 C CD2 . LEU B 186 ? 1.1680 0.7008 0.6905 0.1129  0.1102  -0.1513 186 LEU B CD2 
3216 N N   . GLU B 187 ? 1.4156 0.8034 0.7310 0.1771  0.1945  -0.1416 187 GLU B N   
3217 C CA  . GLU B 187 ? 1.5146 0.8653 0.7605 0.1951  0.2145  -0.1267 187 GLU B CA  
3218 C C   . GLU B 187 ? 1.4474 0.8006 0.6954 0.1924  0.2363  -0.0972 187 GLU B C   
3219 O O   . GLU B 187 ? 1.3698 0.7497 0.6468 0.1836  0.2180  -0.0952 187 GLU B O   
3220 C CB  . GLU B 187 ? 1.6340 0.9598 0.8067 0.2137  0.1752  -0.1451 187 GLU B CB  
3221 C CG  . GLU B 187 ? 1.7153 1.0277 0.8724 0.2191  0.1604  -0.1736 187 GLU B CG  
3222 C CD  . GLU B 187 ? 1.8813 1.1523 0.9867 0.2341  0.1955  -0.1654 187 GLU B CD  
3223 O OE1 . GLU B 187 ? 1.8939 1.1682 1.0372 0.2269  0.2288  -0.1624 187 GLU B OE1 
3224 O OE2 . GLU B 187 ? 1.9963 1.2304 1.0233 0.2544  0.1896  -0.1621 187 GLU B OE2 
3225 N N   . PRO B 188 ? 1.4577 0.7815 0.6775 0.1987  0.2767  -0.0756 188 PRO B N   
3226 C CA  . PRO B 188 ? 1.4311 0.7492 0.6522 0.1946  0.2997  -0.0484 188 PRO B CA  
3227 C C   . PRO B 188 ? 1.4636 0.7675 0.6338 0.2064  0.2645  -0.0473 188 PRO B C   
3228 O O   . PRO B 188 ? 1.4842 0.7666 0.5948 0.2246  0.2306  -0.0627 188 PRO B O   
3229 C CB  . PRO B 188 ? 1.5093 0.7837 0.6898 0.2034  0.3425  -0.0324 188 PRO B CB  
3230 C CG  . PRO B 188 ? 1.4806 0.7597 0.6772 0.2043  0.3536  -0.0479 188 PRO B CG  
3231 C CD  . PRO B 188 ? 1.4576 0.7513 0.6488 0.2080  0.3053  -0.0766 188 PRO B CD  
3232 N N   . LEU B 189 ? 1.4688 0.7862 0.6657 0.1971  0.2706  -0.0308 189 LEU B N   
3233 C CA  . LEU B 189 ? 1.5036 0.8043 0.6532 0.2107  0.2404  -0.0274 189 LEU B CA  
3234 C C   . LEU B 189 ? 1.6069 0.8414 0.6676 0.2341  0.2511  -0.0143 189 LEU B C   
3235 O O   . LEU B 189 ? 1.6060 0.8097 0.6555 0.2324  0.2953  0.0008  189 LEU B O   
3236 C CB  . LEU B 189 ? 1.4261 0.7505 0.6233 0.1955  0.2510  -0.0116 189 LEU B CB  
3237 C CG  . LEU B 189 ? 1.3527 0.7357 0.6167 0.1801  0.2245  -0.0271 189 LEU B CG  
3238 C CD1 . LEU B 189 ? 1.3221 0.7236 0.6256 0.1668  0.2380  -0.0105 189 LEU B CD1 
3239 C CD2 . LEU B 189 ? 1.3676 0.7608 0.6041 0.1938  0.1681  -0.0521 189 LEU B CD2 
3240 N N   . PRO B 190 ? 1.6838 0.8962 0.6838 0.2570  0.2102  -0.0211 190 PRO B N   
3241 C CA  . PRO B 190 ? 1.7770 0.9197 0.6854 0.2839  0.2159  -0.0088 190 PRO B CA  
3242 C C   . PRO B 190 ? 1.7587 0.8604 0.6579 0.2791  0.2648  0.0209  190 PRO B C   
3243 O O   . PRO B 190 ? 1.6558 0.7881 0.6215 0.2560  0.2858  0.0313  190 PRO B O   
3244 C CB  . PRO B 190 ? 1.8170 0.9609 0.6917 0.3057  0.1598  -0.0209 190 PRO B CB  
3245 C CG  . PRO B 190 ? 1.7424 0.9543 0.6794 0.2926  0.1207  -0.0492 190 PRO B CG  
3246 C CD  . PRO B 190 ? 1.6445 0.8980 0.6633 0.2603  0.1545  -0.0437 190 PRO B CD  
3247 N N   . ALA B 191 ? 1.8539 0.8854 0.6722 0.3007  0.2824  0.0325  191 ALA B N   
3248 C CA  . ALA B 191 ? 1.9400 0.9237 0.7446 0.2969  0.3308  0.0574  191 ALA B CA  
3249 C C   . ALA B 191 ? 1.9488 0.9257 0.7541 0.3000  0.3161  0.0664  191 ALA B C   
3250 O O   . ALA B 191 ? 1.9543 0.9176 0.7862 0.2852  0.3536  0.0825  191 ALA B O   
3251 C CB  . ALA B 191 ? 2.0417 0.9464 0.7506 0.3221  0.3517  0.0651  191 ALA B CB  
3252 N N   . GLU B 192 ? 1.9692 0.9584 0.7498 0.3193  0.2605  0.0531  192 GLU B N   
3253 C CA  . GLU B 192 ? 1.9843 0.9714 0.7658 0.3257  0.2399  0.0581  192 GLU B CA  
3254 C C   . GLU B 192 ? 1.8812 0.9441 0.7237 0.3170  0.1926  0.0396  192 GLU B C   
3255 O O   . GLU B 192 ? 1.8660 0.9591 0.7060 0.3268  0.1511  0.0174  192 GLU B O   
3256 C CB  . GLU B 192 ? 2.1560 1.0742 0.8396 0.3653  0.2173  0.0597  192 GLU B CB  
3257 C CG  . GLU B 192 ? 2.3636 1.1977 0.9793 0.3753  0.2665  0.0791  192 GLU B CG  
3258 C CD  . GLU B 192 ? 2.5666 1.3286 1.0798 0.4174  0.2427  0.0798  192 GLU B CD  
3259 O OE1 . GLU B 192 ? 2.5949 1.3761 1.0903 0.4411  0.1846  0.0621  192 GLU B OE1 
3260 O OE2 . GLU B 192 ? 2.7070 1.3942 1.1599 0.4271  0.2821  0.0963  192 GLU B OE2 
3261 N N   . PHE B 193 ? 1.7680 0.8624 0.6677 0.2978  0.1996  0.0465  193 PHE B N   
3262 C CA  . PHE B 193 ? 1.6719 0.8343 0.6258 0.2907  0.1569  0.0294  193 PHE B CA  
3263 C C   . PHE B 193 ? 1.6410 0.8135 0.6271 0.2807  0.1624  0.0406  193 PHE B C   
3264 O O   . PHE B 193 ? 1.6525 0.7844 0.6305 0.2740  0.2024  0.0607  193 PHE B O   
3265 C CB  . PHE B 193 ? 1.5526 0.7792 0.5780 0.2637  0.1608  0.0153  193 PHE B CB  
3266 C CG  . PHE B 193 ? 1.4969 0.7384 0.5828 0.2327  0.2129  0.0311  193 PHE B CG  
3267 C CD1 . PHE B 193 ? 1.4045 0.6856 0.5530 0.2120  0.2185  0.0356  193 PHE B CD1 
3268 C CD2 . PHE B 193 ? 1.5514 0.7714 0.6371 0.2248  0.2546  0.0392  193 PHE B CD2 
3269 C CE1 . PHE B 193 ? 1.3709 0.6721 0.5853 0.1837  0.2628  0.0480  193 PHE B CE1 
3270 C CE2 . PHE B 193 ? 1.5128 0.7552 0.6680 0.1972  0.2986  0.0503  193 PHE B CE2 
3271 C CZ  . PHE B 193 ? 1.4137 0.6984 0.6362 0.1764  0.3014  0.0544  193 PHE B CZ  
3272 N N   . THR B 194 ? 1.5918 0.8206 0.6184 0.2788  0.1218  0.0244  194 THR B N   
3273 C CA  . THR B 194 ? 1.5479 0.7992 0.6155 0.2657  0.1250  0.0317  194 THR B CA  
3274 C C   . THR B 194 ? 1.4202 0.7532 0.5684 0.2424  0.1078  0.0129  194 THR B C   
3275 O O   . THR B 194 ? 1.3904 0.7657 0.5566 0.2493  0.0647  -0.0127 194 THR B O   
3276 C CB  . THR B 194 ? 1.5630 0.7893 0.5889 0.2954  0.0892  0.0301  194 THR B CB  
3277 O OG1 . THR B 194 ? 1.6952 0.8434 0.6636 0.3071  0.1215  0.0513  194 THR B OG1 
3278 C CG2 . THR B 194 ? 1.5045 0.7779 0.5831 0.2841  0.0734  0.0264  194 THR B CG2 
3279 N N   . ALA B 195 ? 1.3220 0.6901 0.5532 0.2091  0.1377  0.0249  195 ALA B N   
3280 C CA  . ALA B 195 ? 1.1982 0.6527 0.5379 0.1813  0.1206  0.0112  195 ALA B CA  
3281 C C   . ALA B 195 ? 1.1497 0.6398 0.5399 0.1744  0.1012  0.0111  195 ALA B C   
3282 O O   . ALA B 195 ? 1.1562 0.6156 0.5386 0.1717  0.1234  0.0286  195 ALA B O   
3283 C CB  . ALA B 195 ? 1.1332 0.6082 0.5332 0.1519  0.1612  0.0210  195 ALA B CB  
3284 N N   . ASN B 196 ? 1.1208 0.6743 0.5634 0.1707  0.0622  -0.0096 196 ASN B N   
3285 C CA  . ASN B 196 ? 1.0908 0.6840 0.5827 0.1656  0.0426  -0.0137 196 ASN B CA  
3286 C C   . ASN B 196 ? 1.0048 0.6768 0.5930 0.1360  0.0352  -0.0240 196 ASN B C   
3287 O O   . ASN B 196 ? 0.9751 0.6752 0.5873 0.1261  0.0298  -0.0348 196 ASN B O   
3288 C CB  . ASN B 196 ? 1.1450 0.7352 0.5978 0.1972  -0.0006 -0.0306 196 ASN B CB  
3289 C CG  . ASN B 196 ? 1.2841 0.8504 0.7203 0.2112  -0.0046 -0.0220 196 ASN B CG  
3290 O OD1 . ASN B 196 ? 1.3943 0.9446 0.7879 0.2429  -0.0364 -0.0320 196 ASN B OD1 
3291 N ND2 . ASN B 196 ? 1.3272 0.8896 0.7976 0.1892  0.0261  -0.0050 196 ASN B ND2 
3292 N N   . PHE B 197 ? 0.9155 0.6172 0.5533 0.1226  0.0360  -0.0204 197 PHE B N   
3293 C CA  . PHE B 197 ? 0.8326 0.6056 0.5482 0.1009  0.0230  -0.0317 197 PHE B CA  
3294 C C   . PHE B 197 ? 0.8473 0.6520 0.5725 0.1150  -0.0115 -0.0501 197 PHE B C   
3295 O O   . PHE B 197 ? 0.8833 0.6656 0.5834 0.1323  -0.0185 -0.0482 197 PHE B O   
3296 C CB  . PHE B 197 ? 0.8050 0.5955 0.5711 0.0772  0.0449  -0.0190 197 PHE B CB  
3297 C CG  . PHE B 197 ? 0.8160 0.6022 0.6026 0.0590  0.0737  -0.0071 197 PHE B CG  
3298 C CD1 . PHE B 197 ? 0.8093 0.6359 0.6390 0.0433  0.0707  -0.0124 197 PHE B CD1 
3299 C CD2 . PHE B 197 ? 0.8292 0.5701 0.5944 0.0578  0.1053  0.0091  197 PHE B CD2 
3300 C CE1 . PHE B 197 ? 0.7965 0.6197 0.6472 0.0304  0.0953  -0.0025 197 PHE B CE1 
3301 C CE2 . PHE B 197 ? 0.8377 0.5809 0.6304 0.0424  0.1322  0.0175  197 PHE B CE2 
3302 C CZ  . PHE B 197 ? 0.8179 0.6031 0.6532 0.0305  0.1254  0.0113  197 PHE B CZ  
3303 N N   . ARG B 198 ? 0.8109 0.6666 0.5748 0.1077  -0.0317 -0.0689 198 ARG B N   
3304 C CA  . ARG B 198 ? 0.7781 0.6736 0.5624 0.1197  -0.0634 -0.0906 198 ARG B CA  
3305 C C   . ARG B 198 ? 0.7134 0.6760 0.5722 0.0930  -0.0647 -0.1009 198 ARG B C   
3306 O O   . ARG B 198 ? 0.6191 0.5937 0.5008 0.0723  -0.0534 -0.0985 198 ARG B O   
3307 C CB  . ARG B 198 ? 0.8182 0.7007 0.5618 0.1450  -0.0917 -0.1092 198 ARG B CB  
3308 C CG  . ARG B 198 ? 0.8400 0.6462 0.4946 0.1740  -0.0885 -0.0967 198 ARG B CG  
3309 C CD  . ARG B 198 ? 0.9127 0.7031 0.5189 0.2015  -0.1198 -0.1164 198 ARG B CD  
3310 N NE  . ARG B 198 ? 1.0118 0.7205 0.5234 0.2244  -0.1071 -0.0998 198 ARG B NE  
3311 C CZ  . ARG B 198 ? 1.0597 0.7325 0.5013 0.2564  -0.1325 -0.1119 198 ARG B CZ  
3312 N NH1 . ARG B 198 ? 1.0523 0.7695 0.5168 0.2687  -0.1756 -0.1437 198 ARG B NH1 
3313 N NH2 . ARG B 198 ? 1.1414 0.7335 0.4897 0.2764  -0.1144 -0.0933 198 ARG B NH2 
3314 N N   . LEU B 199 ? 0.7383 0.7408 0.6320 0.0941  -0.0762 -0.1117 199 LEU B N   
3315 C CA  . LEU B 199 ? 0.6729 0.7336 0.6305 0.0684  -0.0717 -0.1187 199 LEU B CA  
3316 C C   . LEU B 199 ? 0.6983 0.8120 0.6938 0.0751  -0.0941 -0.1452 199 LEU B C   
3317 O O   . LEU B 199 ? 0.7427 0.8521 0.7193 0.1028  -0.1164 -0.1584 199 LEU B O   
3318 C CB  . LEU B 199 ? 0.5975 0.6603 0.5720 0.0530  -0.0507 -0.1017 199 LEU B CB  
3319 C CG  . LEU B 199 ? 0.6433 0.6832 0.5971 0.0688  -0.0508 -0.0967 199 LEU B CG  
3320 C CD1 . LEU B 199 ? 0.5962 0.6779 0.5774 0.0784  -0.0669 -0.1159 199 LEU B CD1 
3321 C CD2 . LEU B 199 ? 0.6349 0.6616 0.5969 0.0510  -0.0282 -0.0781 199 LEU B CD2 
3322 N N   . LYS B 200 ? 0.6620 0.8247 0.7116 0.0500  -0.0868 -0.1527 200 LYS B N   
3323 C CA  . LYS B 200 ? 0.6385 0.8599 0.7377 0.0499  -0.1003 -0.1785 200 LYS B CA  
3324 C C   . LYS B 200 ? 0.6169 0.8722 0.7521 0.0313  -0.0806 -0.1733 200 LYS B C   
3325 O O   . LYS B 200 ? 0.5906 0.8407 0.7311 0.0075  -0.0588 -0.1559 200 LYS B O   
3326 C CB  . LYS B 200 ? 0.6234 0.8720 0.7554 0.0351  -0.1077 -0.1968 200 LYS B CB  
3327 C CG  . LYS B 200 ? 0.6339 0.9498 0.8304 0.0294  -0.1173 -0.2259 200 LYS B CG  
3328 C CD  . LYS B 200 ? 0.6957 1.0331 0.9261 0.0134  -0.1256 -0.2464 200 LYS B CD  
3329 C CE  . LYS B 200 ? 0.7251 1.1336 1.0291 0.0064  -0.1338 -0.2786 200 LYS B CE  
3330 N NZ  . LYS B 200 ? 0.7725 1.1859 1.1018 -0.0072 -0.1389 -0.2946 200 LYS B NZ  
3331 N N   . TYR B 201 ? 0.6269 0.9145 0.7830 0.0450  -0.0892 -0.1889 201 TYR B N   
3332 C CA  . TYR B 201 ? 0.5857 0.9058 0.7710 0.0307  -0.0707 -0.1875 201 TYR B CA  
3333 C C   . TYR B 201 ? 0.5579 0.9337 0.7999 0.0073  -0.0606 -0.2031 201 TYR B C   
3334 O O   . TYR B 201 ? 0.5556 0.9598 0.8285 0.0096  -0.0755 -0.2254 201 TYR B O   
3335 C CB  . TYR B 201 ? 0.5850 0.9140 0.7682 0.0566  -0.0813 -0.1992 201 TYR B CB  
3336 C CG  . TYR B 201 ? 0.6067 0.8763 0.7357 0.0755  -0.0849 -0.1822 201 TYR B CG  
3337 C CD1 . TYR B 201 ? 0.5710 0.8225 0.6873 0.0664  -0.0678 -0.1668 201 TYR B CD1 
3338 C CD2 . TYR B 201 ? 0.6443 0.8736 0.7336 0.1025  -0.1048 -0.1826 201 TYR B CD2 
3339 C CE1 . TYR B 201 ? 0.5834 0.7808 0.6577 0.0799  -0.0687 -0.1533 201 TYR B CE1 
3340 C CE2 . TYR B 201 ? 0.6650 0.8346 0.7042 0.1173  -0.1028 -0.1658 201 TYR B CE2 
3341 C CZ  . TYR B 201 ? 0.6461 0.8013 0.6826 0.1042  -0.0837 -0.1518 201 TYR B CZ  
3342 O OH  . TYR B 201 ? 0.6856 0.7815 0.6794 0.1152  -0.0794 -0.1369 201 TYR B OH  
3343 N N   . THR B 202 ? 0.5587 0.9481 0.8133 -0.0153 -0.0349 -0.1921 202 THR B N   
3344 C CA  . THR B 202 ? 0.5801 1.0184 0.8855 -0.0389 -0.0180 -0.2047 202 THR B CA  
3345 C C   . THR B 202 ? 0.5978 1.0905 0.9456 -0.0251 -0.0239 -0.2333 202 THR B C   
3346 O O   . THR B 202 ? 0.5937 1.0811 0.9248 0.0023  -0.0384 -0.2389 202 THR B O   
3347 C CB  . THR B 202 ? 0.5472 0.9784 0.8425 -0.0631 0.0124  -0.1831 202 THR B CB  
3348 O OG1 . THR B 202 ? 0.5501 0.9778 0.8233 -0.0505 0.0161  -0.1782 202 THR B OG1 
3349 C CG2 . THR B 202 ? 0.5155 0.8976 0.7761 -0.0750 0.0172  -0.1566 202 THR B CG2 
3350 N N   . ASN B 203 ? 0.6493 1.1663 1.0322 -0.0416 -0.0098 -0.2437 203 ASN B N   
3351 C CA  . ASN B 203 ? 0.7376 1.2914 1.1525 -0.0303 -0.0098 -0.2662 203 ASN B CA  
3352 C C   . ASN B 203 ? 0.7458 1.3090 1.1495 -0.0253 0.0069  -0.2618 203 ASN B C   
3353 O O   . ASN B 203 ? 0.7534 1.3399 1.1718 -0.0050 -0.0001 -0.2804 203 ASN B O   
3354 C CB  . ASN B 203 ? 0.8047 1.3813 1.2617 -0.0547 0.0076  -0.2756 203 ASN B CB  
3355 C CG  . ASN B 203 ? 0.8698 1.4744 1.3653 -0.0394 -0.0156 -0.3058 203 ASN B CG  
3356 O OD1 . ASN B 203 ? 0.8902 1.5067 1.3857 -0.0089 -0.0380 -0.3220 203 ASN B OD1 
3357 N ND2 . ASN B 203 ? 0.9012 1.5146 1.4291 -0.0593 -0.0113 -0.3141 203 ASN B ND2 
3358 N N   . ASP B 204 ? 0.7565 1.2998 1.1322 -0.0427 0.0280  -0.2383 204 ASP B N   
3359 C CA  . ASP B 204 ? 0.7587 1.3068 1.1161 -0.0401 0.0453  -0.2332 204 ASP B CA  
3360 C C   . ASP B 204 ? 0.6928 1.2346 1.0310 -0.0092 0.0251  -0.2396 204 ASP B C   
3361 O O   . ASP B 204 ? 0.7021 1.2565 1.0363 0.0022  0.0328  -0.2481 204 ASP B O   
3362 C CB  . ASP B 204 ? 0.8183 1.3413 1.1436 -0.0635 0.0678  -0.2060 204 ASP B CB  
3363 C CG  . ASP B 204 ? 0.8919 1.4205 1.2250 -0.0891 0.0987  -0.1990 204 ASP B CG  
3364 O OD1 . ASP B 204 ? 0.9312 1.4892 1.2931 -0.0881 0.1089  -0.2158 204 ASP B OD1 
3365 O OD2 . ASP B 204 ? 0.9291 1.4305 1.2388 -0.1091 0.1134  -0.1761 204 ASP B OD2 
3366 N N   . ALA B 205 ? 0.6372 1.1371 0.9466 0.0045  0.0003  -0.2303 205 ALA B N   
3367 C CA  . ALA B 205 ? 0.6067 1.0651 0.8742 0.0298  -0.0160 -0.2244 205 ALA B CA  
3368 C C   . ALA B 205 ? 0.5676 1.0512 0.8527 0.0592  -0.0278 -0.2497 205 ALA B C   
3369 O O   . ALA B 205 ? 0.5714 1.0929 0.8959 0.0728  -0.0419 -0.2728 205 ALA B O   
3370 C CB  . ALA B 205 ? 0.6121 1.0231 0.8488 0.0396  -0.0365 -0.2120 205 ALA B CB  
3371 N N   . PRO B 206 ? 0.5393 1.0024 0.7972 0.0702  -0.0236 -0.2474 206 PRO B N   
3372 C CA  . PRO B 206 ? 0.5614 1.0347 0.8268 0.1023  -0.0363 -0.2695 206 PRO B CA  
3373 C C   . PRO B 206 ? 0.6320 1.0707 0.8788 0.1322  -0.0672 -0.2716 206 PRO B C   
3374 O O   . PRO B 206 ? 0.5951 0.9817 0.8029 0.1285  -0.0741 -0.2500 206 PRO B O   
3375 C CB  . PRO B 206 ? 0.4955 0.9353 0.7230 0.1027  -0.0259 -0.2611 206 PRO B CB  
3376 C CG  . PRO B 206 ? 0.4873 0.9275 0.7040 0.0691  -0.0030 -0.2423 206 PRO B CG  
3377 C CD  . PRO B 206 ? 0.5084 0.9415 0.7306 0.0526  -0.0069 -0.2270 206 PRO B CD  
3378 N N   . SER B 207 ? 0.7124 1.1787 0.9851 0.1631  -0.0848 -0.2973 207 SER B N   
3379 C CA  . SER B 207 ? 0.7341 1.1659 0.9831 0.1974  -0.1169 -0.3006 207 SER B CA  
3380 C C   . SER B 207 ? 0.7471 1.0956 0.9291 0.2093  -0.1209 -0.2784 207 SER B C   
3381 O O   . SER B 207 ? 0.7441 1.0416 0.8857 0.2223  -0.1369 -0.2651 207 SER B O   
3382 C CB  . SER B 207 ? 0.7966 1.2653 1.0785 0.2298  -0.1344 -0.3311 207 SER B CB  
3383 O OG  . SER B 207 ? 0.8242 1.3528 1.1573 0.2059  -0.1179 -0.3466 207 SER B OG  
3384 N N   . ASN B 208 ? 0.7573 1.0907 0.9271 0.2042  -0.1048 -0.2756 208 ASN B N   
3385 C CA  . ASN B 208 ? 0.7696 1.0273 0.8860 0.2143  -0.1069 -0.2599 208 ASN B CA  
3386 C C   . ASN B 208 ? 0.7118 0.9330 0.8022 0.1810  -0.0895 -0.2328 208 ASN B C   
3387 O O   . ASN B 208 ? 0.7475 0.9084 0.8012 0.1824  -0.0873 -0.2198 208 ASN B O   
3388 C CB  . ASN B 208 ? 0.8170 1.0747 0.9356 0.2312  -0.1035 -0.2770 208 ASN B CB  
3389 C CG  . ASN B 208 ? 0.9005 1.2039 1.0548 0.2653  -0.1190 -0.3069 208 ASN B CG  
3390 O OD1 . ASN B 208 ? 0.9737 1.2436 1.1080 0.3017  -0.1420 -0.3124 208 ASN B OD1 
3391 N ND2 . ASN B 208 ? 0.9002 1.2799 1.1078 0.2546  -0.1054 -0.3267 208 ASN B ND2 
3392 N N   . PHE B 209 ? 0.6322 0.8897 0.7448 0.1514  -0.0767 -0.2256 209 PHE B N   
3393 C CA  . PHE B 209 ? 0.6025 0.8293 0.6948 0.1235  -0.0639 -0.2006 209 PHE B CA  
3394 C C   . PHE B 209 ? 0.6556 0.8429 0.7232 0.1264  -0.0723 -0.1844 209 PHE B C   
3395 O O   . PHE B 209 ? 0.6180 0.8286 0.6987 0.1310  -0.0819 -0.1900 209 PHE B O   
3396 C CB  . PHE B 209 ? 0.5110 0.7839 0.6299 0.0934  -0.0468 -0.1974 209 PHE B CB  
3397 C CG  . PHE B 209 ? 0.4839 0.7296 0.5867 0.0690  -0.0380 -0.1728 209 PHE B CG  
3398 C CD1 . PHE B 209 ? 0.4940 0.7101 0.5781 0.0585  -0.0314 -0.1621 209 PHE B CD1 
3399 C CD2 . PHE B 209 ? 0.4986 0.7483 0.6076 0.0581  -0.0380 -0.1630 209 PHE B CD2 
3400 C CE1 . PHE B 209 ? 0.5110 0.7070 0.5875 0.0387  -0.0249 -0.1419 209 PHE B CE1 
3401 C CE2 . PHE B 209 ? 0.4897 0.7144 0.5860 0.0387  -0.0296 -0.1416 209 PHE B CE2 
3402 C CZ  . PHE B 209 ? 0.4862 0.6862 0.5684 0.0297  -0.0231 -0.1310 209 PHE B CZ  
3403 N N   . ARG B 210 ? 0.6968 0.8247 0.7296 0.1229  -0.0673 -0.1658 210 ARG B N   
3404 C CA  . ARG B 210 ? 0.6902 0.7731 0.6918 0.1267  -0.0700 -0.1492 210 ARG B CA  
3405 C C   . ARG B 210 ? 0.6387 0.6922 0.6314 0.1004  -0.0518 -0.1274 210 ARG B C   
3406 O O   . ARG B 210 ? 0.6464 0.6789 0.6370 0.0916  -0.0431 -0.1236 210 ARG B O   
3407 C CB  . ARG B 210 ? 0.7733 0.7999 0.7339 0.1589  -0.0822 -0.1494 210 ARG B CB  
3408 C CG  . ARG B 210 ? 0.8869 0.8715 0.8075 0.1719  -0.0887 -0.1370 210 ARG B CG  
3409 C CD  . ARG B 210 ? 1.0323 0.9416 0.8980 0.2006  -0.0939 -0.1294 210 ARG B CD  
3410 N NE  . ARG B 210 ? 1.1235 0.9682 0.9502 0.1881  -0.0735 -0.1040 210 ARG B NE  
3411 C CZ  . ARG B 210 ? 1.1466 0.9400 0.9583 0.1793  -0.0554 -0.0921 210 ARG B CZ  
3412 N NH1 . ARG B 210 ? 1.1081 0.9022 0.9344 0.1832  -0.0578 -0.1036 210 ARG B NH1 
3413 N NH2 . ARG B 210 ? 1.1638 0.9047 0.9476 0.1661  -0.0335 -0.0704 210 ARG B NH2 
3414 N N   . ILE B 211 ? 0.6206 0.6742 0.6115 0.0886  -0.0473 -0.1157 211 ILE B N   
3415 C CA  . ILE B 211 ? 0.6181 0.6469 0.6052 0.0669  -0.0303 -0.0963 211 ILE B CA  
3416 C C   . ILE B 211 ? 0.6795 0.6404 0.6288 0.0763  -0.0229 -0.0835 211 ILE B C   
3417 O O   . ILE B 211 ? 0.7243 0.6503 0.6369 0.0981  -0.0296 -0.0815 211 ILE B O   
3418 C CB  . ILE B 211 ? 0.5967 0.6422 0.5916 0.0544  -0.0267 -0.0890 211 ILE B CB  
3419 C CG1 . ILE B 211 ? 0.5241 0.6302 0.5556 0.0423  -0.0297 -0.1001 211 ILE B CG1 
3420 C CG2 . ILE B 211 ? 0.5694 0.5915 0.5646 0.0352  -0.0091 -0.0705 211 ILE B CG2 
3421 C CD1 . ILE B 211 ? 0.5355 0.6565 0.5757 0.0323  -0.0287 -0.0972 211 ILE B CD1 
3422 N N   . ASP B 212 ? 0.6709 0.6118 0.6286 0.0600  -0.0088 -0.0757 212 ASP B N   
3423 C CA  . ASP B 212 ? 0.7312 0.6065 0.6603 0.0637  0.0040  -0.0644 212 ASP B CA  
3424 C C   . ASP B 212 ? 0.7600 0.5978 0.6595 0.0649  0.0173  -0.0472 212 ASP B C   
3425 O O   . ASP B 212 ? 0.7367 0.5948 0.6552 0.0481  0.0267  -0.0399 212 ASP B O   
3426 C CB  . ASP B 212 ? 0.7997 0.6719 0.7580 0.0406  0.0163  -0.0633 212 ASP B CB  
3427 C CG  . ASP B 212 ? 0.9686 0.7730 0.9046 0.0425  0.0307  -0.0564 212 ASP B CG  
3428 O OD1 . ASP B 212 ? 1.0273 0.7892 0.9228 0.0666  0.0256  -0.0568 212 ASP B OD1 
3429 O OD2 . ASP B 212 ? 1.0294 0.8219 0.9898 0.0203  0.0471  -0.0511 212 ASP B OD2 
3430 N N   . GLY B 213 ? 0.7933 0.5721 0.6415 0.0871  0.0186  -0.0407 213 GLY B N   
3431 C CA  . GLY B 213 ? 0.8420 0.5744 0.6488 0.0917  0.0340  -0.0241 213 GLY B CA  
3432 C C   . GLY B 213 ? 0.8318 0.5722 0.6063 0.1154  0.0135  -0.0297 213 GLY B C   
3433 O O   . GLY B 213 ? 0.8576 0.5553 0.5843 0.1262  0.0214  -0.0186 213 GLY B O   
3434 N N   . PHE B 214 ? 0.7737 0.5697 0.5754 0.1233  -0.0122 -0.0488 214 PHE B N   
3435 C CA  . PHE B 214 ? 0.7660 0.5823 0.5525 0.1434  -0.0356 -0.0603 214 PHE B CA  
3436 C C   . PHE B 214 ? 0.8652 0.6799 0.6353 0.1759  -0.0622 -0.0757 214 PHE B C   
3437 O O   . PHE B 214 ? 0.8632 0.7183 0.6723 0.1749  -0.0708 -0.0901 214 PHE B O   
3438 C CB  . PHE B 214 ? 0.6265 0.5161 0.4684 0.1227  -0.0415 -0.0719 214 PHE B CB  
3439 C CG  . PHE B 214 ? 0.6140 0.5038 0.4674 0.0976  -0.0205 -0.0582 214 PHE B CG  
3440 C CD1 . PHE B 214 ? 0.5937 0.4944 0.4813 0.0719  -0.0014 -0.0492 214 PHE B CD1 
3441 C CD2 . PHE B 214 ? 0.6532 0.5323 0.4833 0.1018  -0.0221 -0.0567 214 PHE B CD2 
3442 C CE1 . PHE B 214 ? 0.5956 0.4985 0.4973 0.0525  0.0158  -0.0380 214 PHE B CE1 
3443 C CE2 . PHE B 214 ? 0.6163 0.4944 0.4579 0.0813  -0.0023 -0.0454 214 PHE B CE2 
3444 C CZ  . PHE B 214 ? 0.5669 0.4579 0.4461 0.0573  0.0167  -0.0356 214 PHE B CZ  
3445 N N   . ASP B 215 ? 0.9652 0.7317 0.6746 0.2073  -0.0755 -0.0733 215 ASP B N   
3446 C CA  . ASP B 215 ? 1.0346 0.7989 0.7256 0.2447  -0.1060 -0.0892 215 ASP B CA  
3447 C C   . ASP B 215 ? 0.9848 0.8205 0.7132 0.2524  -0.1354 -0.1148 215 ASP B C   
3448 O O   . ASP B 215 ? 0.9446 0.7941 0.6723 0.2430  -0.1368 -0.1156 215 ASP B O   
3449 C CB  . ASP B 215 ? 1.1965 0.8708 0.7978 0.2789  -0.1098 -0.0748 215 ASP B CB  
3450 C CG  . ASP B 215 ? 1.2860 0.8843 0.8521 0.2681  -0.0754 -0.0491 215 ASP B CG  
3451 O OD1 . ASP B 215 ? 1.2924 0.8755 0.8677 0.2721  -0.0736 -0.0509 215 ASP B OD1 
3452 O OD2 . ASP B 215 ? 1.3539 0.9074 0.8853 0.2550  -0.0490 -0.0288 215 ASP B OD2 
3453 N N   . ASP B 216 ? 1.0104 0.8922 0.7755 0.2688  -0.1575 -0.1376 216 ASP B N   
3454 C CA  . ASP B 216 ? 1.0263 0.9815 0.8383 0.2752  -0.1844 -0.1656 216 ASP B CA  
3455 C C   . ASP B 216 ? 1.0728 1.0005 0.8341 0.3087  -0.2142 -0.1726 216 ASP B C   
3456 O O   . ASP B 216 ? 1.1126 0.9690 0.8016 0.3418  -0.2233 -0.1616 216 ASP B O   
3457 C CB  . ASP B 216 ? 1.0647 1.0728 0.9269 0.2892  -0.1991 -0.1897 216 ASP B CB  
3458 C CG  . ASP B 216 ? 1.0891 1.1394 1.0063 0.2547  -0.1727 -0.1890 216 ASP B CG  
3459 O OD1 . ASP B 216 ? 1.0546 1.1766 1.0327 0.2329  -0.1699 -0.2039 216 ASP B OD1 
3460 O OD2 . ASP B 216 ? 1.1587 1.1677 1.0559 0.2494  -0.1547 -0.1740 216 ASP B OD2 
3461 N N   . SER B 217 ? 1.0814 1.0617 0.8772 0.3001  -0.2294 -0.1912 217 SER B N   
3462 C CA  . SER B 217 ? 1.1528 1.1128 0.9031 0.3299  -0.2612 -0.2023 217 SER B CA  
3463 C C   . SER B 217 ? 1.1347 1.1815 0.9566 0.3292  -0.2910 -0.2396 217 SER B C   
3464 O O   . SER B 217 ? 1.0573 1.1707 0.9565 0.2935  -0.2757 -0.2492 217 SER B O   
3465 C CB  . SER B 217 ? 1.1962 1.1017 0.8910 0.3152  -0.2414 -0.1803 217 SER B CB  
3466 O OG  . SER B 217 ? 1.2819 1.1697 0.9304 0.3429  -0.2730 -0.1940 217 SER B OG  
3467 N N   . SER B 218 ? 1.2253 1.2625 1.0289 0.3607  -0.3186 -0.2562 218 SER B N   
3468 C CA  . SER B 218 ? 1.2539 1.3609 1.1312 0.3531  -0.3333 -0.2884 218 SER B CA  
3469 C C   . SER B 218 ? 1.2697 1.3817 1.1501 0.3288  -0.3298 -0.2890 218 SER B C   
3470 O O   . SER B 218 ? 1.2651 1.4387 1.2166 0.3081  -0.3327 -0.3118 218 SER B O   
3471 C CB  . SER B 218 ? 1.3594 1.4515 1.2158 0.3956  -0.3638 -0.3082 218 SER B CB  
3472 O OG  . SER B 218 ? 1.4288 1.5174 1.2848 0.4175  -0.3675 -0.3114 218 SER B OG  
3473 N N   . THR B 219 ? 1.2675 1.3099 1.0679 0.3309  -0.3207 -0.2639 219 THR B N   
3474 C CA  . THR B 219 ? 1.1995 1.2345 0.9894 0.3125  -0.3176 -0.2645 219 THR B CA  
3475 C C   . THR B 219 ? 1.1317 1.1521 0.9100 0.2776  -0.2863 -0.2441 219 THR B C   
3476 O O   . THR B 219 ? 1.1067 1.0855 0.8508 0.2747  -0.2605 -0.2167 219 THR B O   
3477 C CB  . THR B 219 ? 1.2603 1.2217 0.9602 0.3471  -0.3325 -0.2574 219 THR B CB  
3478 O OG1 . THR B 219 ? 1.3066 1.1873 0.9184 0.3670  -0.3180 -0.2270 219 THR B OG1 
3479 C CG2 . THR B 219 ? 1.2973 1.2783 1.0139 0.3803  -0.3668 -0.2845 219 THR B CG2 
3480 N N   . PHE B 220 ? 1.1025 1.1535 0.9195 0.2472  -0.2800 -0.2542 220 PHE B N   
3481 C CA  . PHE B 220 ? 1.0322 1.0702 0.8554 0.2100  -0.2411 -0.2320 220 PHE B CA  
3482 C C   . PHE B 220 ? 1.1014 1.0723 0.8481 0.2169  -0.2340 -0.2196 220 PHE B C   
3483 O O   . PHE B 220 ? 1.1188 1.0210 0.7882 0.2369  -0.2220 -0.1962 220 PHE B O   
3484 C CB  . PHE B 220 ? 0.9038 1.0124 0.8180 0.1716  -0.2341 -0.2491 220 PHE B CB  
3485 C CG  . PHE B 220 ? 0.7993 0.9033 0.7349 0.1340  -0.1919 -0.2227 220 PHE B CG  
3486 C CD1 . PHE B 220 ? 0.7513 0.8102 0.6488 0.1338  -0.1645 -0.1905 220 PHE B CD1 
3487 C CD2 . PHE B 220 ? 0.7714 0.9144 0.7662 0.0995  -0.1805 -0.2312 220 PHE B CD2 
3488 C CE1 . PHE B 220 ? 0.7246 0.7835 0.6450 0.1024  -0.1308 -0.1692 220 PHE B CE1 
3489 C CE2 . PHE B 220 ? 0.7262 0.8618 0.7359 0.0695  -0.1452 -0.2067 220 PHE B CE2 
3490 C CZ  . PHE B 220 ? 0.7240 0.8203 0.6975 0.0723  -0.1225 -0.1767 220 PHE B CZ  
3491 N N   . TYR B 221 ? 1.1356 1.1242 0.9041 0.1996  -0.2388 -0.2360 221 TYR B N   
3492 C CA  . TYR B 221 ? 1.2262 1.1562 0.9225 0.2106  -0.2385 -0.2331 221 TYR B CA  
3493 C C   . TYR B 221 ? 1.2649 1.2291 0.9976 0.2050  -0.2643 -0.2643 221 TYR B C   
3494 O O   . TYR B 221 ? 1.2226 1.2518 1.0414 0.1785  -0.2684 -0.2835 221 TYR B O   
3495 C CB  . TYR B 221 ? 1.2170 1.1125 0.9025 0.1839  -0.1919 -0.2026 221 TYR B CB  
3496 C CG  . TYR B 221 ? 1.1684 1.1102 0.9323 0.1428  -0.1746 -0.2064 221 TYR B CG  
3497 C CD1 . TYR B 221 ? 1.1804 1.1215 0.9500 0.1316  -0.1804 -0.2238 221 TYR B CD1 
3498 C CD2 . TYR B 221 ? 1.1061 1.0851 0.9314 0.1164  -0.1520 -0.1920 221 TYR B CD2 
3499 C CE1 . TYR B 221 ? 1.1396 1.1135 0.9751 0.0951  -0.1632 -0.2251 221 TYR B CE1 
3500 C CE2 . TYR B 221 ? 1.0711 1.0834 0.9572 0.0816  -0.1356 -0.1925 221 TYR B CE2 
3501 C CZ  . TYR B 221 ? 1.0948 1.1027 0.9860 0.0709  -0.1404 -0.2080 221 TYR B CZ  
3502 O OH  . TYR B 221 ? 1.0738 1.1064 1.0208 0.0373  -0.1228 -0.2067 221 TYR B OH  
3503 N N   . THR B 222 ? 1.3429 1.2616 1.0140 0.2279  -0.2764 -0.2656 222 THR B N   
3504 C CA  . THR B 222 ? 1.3677 1.3122 1.0696 0.2247  -0.3000 -0.2934 222 THR B CA  
3505 C C   . THR B 222 ? 1.3734 1.2800 1.0418 0.2089  -0.2830 -0.2916 222 THR B C   
3506 O O   . THR B 222 ? 1.3975 1.2419 0.9927 0.2165  -0.2580 -0.2678 222 THR B O   
3507 C CB  . THR B 222 ? 1.4900 1.4156 1.1508 0.2664  -0.3332 -0.3031 222 THR B CB  
3508 O OG1 . THR B 222 ? 1.5264 1.4626 1.1923 0.2892  -0.3429 -0.2978 222 THR B OG1 
3509 C CG2 . THR B 222 ? 1.5156 1.4897 1.2352 0.2616  -0.3624 -0.3386 222 THR B CG2 
3510 N N   . LEU B 223 ? 1.3532 1.2953 1.0771 0.1867  -0.2932 -0.3170 223 LEU B N   
3511 C CA  . LEU B 223 ? 1.3814 1.2874 1.0769 0.1736  -0.2803 -0.3202 223 LEU B CA  
3512 C C   . LEU B 223 ? 1.4479 1.3454 1.1233 0.1906  -0.3097 -0.3430 223 LEU B C   
3513 O O   . LEU B 223 ? 1.4436 1.3918 1.1781 0.1898  -0.3379 -0.3685 223 LEU B O   
3514 C CB  . LEU B 223 ? 1.3193 1.2609 1.0912 0.1299  -0.2629 -0.3299 223 LEU B CB  
3515 C CG  . LEU B 223 ? 1.2603 1.1965 1.0418 0.1114  -0.2288 -0.3068 223 LEU B CG  
3516 C CD1 . LEU B 223 ? 1.2014 1.1674 1.0608 0.0684  -0.2069 -0.3079 223 LEU B CD1 
3517 C CD2 . LEU B 223 ? 1.3044 1.1696 1.0019 0.1273  -0.1986 -0.2746 223 LEU B CD2 
3518 N N   . PRO B 224 ? 1.5176 1.3508 1.1095 0.2070  -0.3017 -0.3345 224 PRO B N   
3519 C CA  . PRO B 224 ? 1.5725 1.3928 1.1405 0.2207  -0.3277 -0.3577 224 PRO B CA  
3520 C C   . PRO B 224 ? 1.5495 1.4112 1.1953 0.1855  -0.3337 -0.3869 224 PRO B C   
3521 O O   . PRO B 224 ? 1.4857 1.3597 1.1760 0.1520  -0.3078 -0.3822 224 PRO B O   
3522 C CB  . PRO B 224 ? 1.6156 1.3582 1.0848 0.2362  -0.3033 -0.3376 224 PRO B CB  
3523 C CG  . PRO B 224 ? 1.6101 1.3225 1.0400 0.2444  -0.2732 -0.3019 224 PRO B CG  
3524 C CD  . PRO B 224 ? 1.5303 1.2989 1.0444 0.2158  -0.2659 -0.3020 224 PRO B CD  
3525 N N   . ASP B 225 ? 1.6138 1.4934 1.2758 0.1932  -0.3667 -0.4166 225 ASP B N   
3526 C CA  . ASP B 225 ? 1.6128 1.5296 1.3514 0.1586  -0.3721 -0.4452 225 ASP B CA  
3527 C C   . ASP B 225 ? 1.6123 1.4798 1.3153 0.1426  -0.3507 -0.4459 225 ASP B C   
3528 O O   . ASP B 225 ? 1.5966 1.4818 1.3593 0.1081  -0.3434 -0.4620 225 ASP B O   
3529 C CB  . ASP B 225 ? 1.7055 1.6573 1.4753 0.1727  -0.4146 -0.4794 225 ASP B CB  
3530 C CG  . ASP B 225 ? 1.7184 1.7307 1.5497 0.1820  -0.4330 -0.4857 225 ASP B CG  
3531 O OD1 . ASP B 225 ? 1.6663 1.7019 1.5319 0.1683  -0.4112 -0.4667 225 ASP B OD1 
3532 O OD2 . ASP B 225 ? 1.7820 1.8185 1.6281 0.2041  -0.4693 -0.5114 225 ASP B OD2 
3533 N N   . GLY B 226 ? 1.6578 1.4608 1.2639 0.1679  -0.3377 -0.4275 226 GLY B N   
3534 C CA  . GLY B 226 ? 1.7055 1.4585 1.2721 0.1583  -0.3150 -0.4282 226 GLY B CA  
3535 C C   . GLY B 226 ? 1.6700 1.3937 1.2241 0.1443  -0.2697 -0.4000 226 GLY B C   
3536 O O   . GLY B 226 ? 1.6841 1.3620 1.2017 0.1410  -0.2454 -0.3969 226 GLY B O   
3537 N N   . ILE B 227 ? 1.6171 1.3675 1.2034 0.1375  -0.2582 -0.3809 227 ILE B N   
3538 C CA  . ILE B 227 ? 1.5894 1.3130 1.1643 0.1278  -0.2172 -0.3543 227 ILE B CA  
3539 C C   . ILE B 227 ? 1.5654 1.3045 1.2120 0.0896  -0.2019 -0.3647 227 ILE B C   
3540 O O   . ILE B 227 ? 1.5337 1.3221 1.2580 0.0648  -0.2192 -0.3845 227 ILE B O   
3541 C CB  . ILE B 227 ? 1.5031 1.2445 1.0799 0.1365  -0.2107 -0.3299 227 ILE B CB  
3542 C CG1 . ILE B 227 ? 1.5065 1.1957 1.0256 0.1456  -0.1687 -0.2972 227 ILE B CG1 
3543 C CG2 . ILE B 227 ? 1.4081 1.2131 1.0810 0.1069  -0.2160 -0.3378 227 ILE B CG2 
3544 C CD1 . ILE B 227 ? 1.4898 1.1837 0.9941 0.1584  -0.1616 -0.2723 227 ILE B CD1 
3545 N N   . GLN B 228 ? 1.5833 1.2770 1.2045 0.0858  -0.1670 -0.3499 228 GLN B N   
3546 C CA  . GLN B 228 ? 1.5408 1.2402 1.2271 0.0522  -0.1469 -0.3504 228 GLN B CA  
3547 C C   . GLN B 228 ? 1.4386 1.1540 1.1594 0.0390  -0.1086 -0.3059 228 GLN B C   
3548 O O   . GLN B 228 ? 1.4094 1.1106 1.0875 0.0584  -0.0921 -0.2795 228 GLN B O   
3549 C CB  . GLN B 228 ? 1.6319 1.2741 1.2791 0.0557  -0.1332 -0.3613 228 GLN B CB  
3550 C CG  . GLN B 228 ? 1.7327 1.3711 1.3588 0.0622  -0.1620 -0.3912 228 GLN B CG  
3551 C CD  . GLN B 228 ? 1.7374 1.4245 1.4450 0.0324  -0.1887 -0.4180 228 GLN B CD  
3552 O OE1 . GLN B 228 ? 1.7325 1.4137 1.4885 0.0039  -0.1784 -0.4277 228 GLN B OE1 
3553 N NE2 . GLN B 228 ? 1.7361 1.4700 1.4610 0.0396  -0.2206 -0.4281 228 GLN B NE2 
3554 N N   . SER B 229 ? 1.3296 1.0715 1.1256 0.0061  -0.0947 -0.2984 229 SER B N   
3555 C CA  . SER B 229 ? 1.1833 0.9451 1.0150 -0.0064 -0.0647 -0.2598 229 SER B CA  
3556 C C   . SER B 229 ? 1.1086 0.8527 0.9741 -0.0272 -0.0365 -0.2445 229 SER B C   
3557 O O   . SER B 229 ? 1.1277 0.8536 1.0088 -0.0408 -0.0411 -0.2651 229 SER B O   
3558 C CB  . SER B 229 ? 1.1159 0.9383 1.0056 -0.0225 -0.0782 -0.2601 229 SER B CB  
3559 O OG  . SER B 229 ? 1.1135 0.9617 1.0595 -0.0479 -0.0944 -0.2881 229 SER B OG  
3560 N N   . VAL B 230 ? 1.0257 0.7730 0.9019 -0.0282 -0.0089 -0.2091 230 VAL B N   
3561 C CA  . VAL B 230 ? 0.9746 0.7092 0.8846 -0.0443 0.0151  -0.1908 230 VAL B CA  
3562 C C   . VAL B 230 ? 0.8797 0.6523 0.8320 -0.0577 0.0261  -0.1624 230 VAL B C   
3563 O O   . VAL B 230 ? 0.8249 0.6218 0.7693 -0.0481 0.0249  -0.1503 230 VAL B O   
3564 C CB  . VAL B 230 ? 1.0554 0.7446 0.9281 -0.0250 0.0394  -0.1784 230 VAL B CB  
3565 C CG1 . VAL B 230 ? 1.0105 0.7088 0.8664 -0.0088 0.0567  -0.1518 230 VAL B CG1 
3566 C CG2 . VAL B 230 ? 1.0946 0.7637 1.0002 -0.0382 0.0571  -0.1675 230 VAL B CG2 
3567 N N   . THR B 231 ? 0.8701 0.6437 0.8629 -0.0793 0.0365  -0.1525 231 THR B N   
3568 C CA  . THR B 231 ? 0.8526 0.6565 0.8778 -0.0907 0.0468  -0.1260 231 THR B CA  
3569 C C   . THR B 231 ? 0.8641 0.6514 0.8814 -0.0772 0.0672  -0.0976 231 THR B C   
3570 O O   . THR B 231 ? 0.8910 0.6434 0.9067 -0.0746 0.0792  -0.0926 231 THR B O   
3571 C CB  . THR B 231 ? 0.8607 0.6705 0.9273 -0.1198 0.0499  -0.1266 231 THR B CB  
3572 O OG1 . THR B 231 ? 0.8595 0.7038 0.9491 -0.1341 0.0322  -0.1515 231 THR B OG1 
3573 C CG2 . THR B 231 ? 0.7951 0.6214 0.8807 -0.1268 0.0643  -0.0952 231 THR B CG2 
3574 N N   . ILE B 232 ? 0.8336 0.6468 0.8492 -0.0680 0.0701  -0.0814 232 ILE B N   
3575 C CA  . ILE B 232 ? 0.8236 0.6307 0.8409 -0.0556 0.0871  -0.0581 232 ILE B CA  
3576 C C   . ILE B 232 ? 0.8133 0.6293 0.8624 -0.0673 0.0925  -0.0377 232 ILE B C   
3577 O O   . ILE B 232 ? 0.8216 0.6178 0.8773 -0.0594 0.1035  -0.0246 232 ILE B O   
3578 C CB  . ILE B 232 ? 0.7875 0.6162 0.7931 -0.0435 0.0884  -0.0506 232 ILE B CB  
3579 C CG1 . ILE B 232 ? 0.8411 0.6459 0.8017 -0.0265 0.0882  -0.0658 232 ILE B CG1 
3580 C CG2 . ILE B 232 ? 0.7484 0.5827 0.7723 -0.0363 0.1041  -0.0286 232 ILE B CG2 
3581 C CD1 . ILE B 232 ? 0.8518 0.6682 0.7928 -0.0154 0.0895  -0.0597 232 ILE B CD1 
3582 N N   . GLY B 233 ? 0.7850 0.6290 0.8513 -0.0842 0.0846  -0.0356 233 GLY B N   
3583 C CA  . GLY B 233 ? 0.7905 0.6361 0.8753 -0.0952 0.0900  -0.0165 233 GLY B CA  
3584 C C   . GLY B 233 ? 0.7871 0.6717 0.8842 -0.1076 0.0848  -0.0117 233 GLY B C   
3585 O O   . GLY B 233 ? 0.7400 0.6525 0.8370 -0.1085 0.0757  -0.0254 233 GLY B O   
3586 N N   . HIS B 234 ? 0.7891 0.6730 0.8929 -0.1146 0.0904  0.0075  234 HIS B N   
3587 C CA  . HIS B 234 ? 0.7852 0.7028 0.8959 -0.1255 0.0887  0.0127  234 HIS B CA  
3588 C C   . HIS B 234 ? 0.7268 0.6500 0.8325 -0.1155 0.0888  0.0357  234 HIS B C   
3589 O O   . HIS B 234 ? 0.6839 0.5822 0.7855 -0.1037 0.0908  0.0495  234 HIS B O   
3590 C CB  . HIS B 234 ? 0.8804 0.7919 1.0003 -0.1499 0.0970  0.0091  234 HIS B CB  
3591 C CG  . HIS B 234 ? 0.9890 0.8532 1.1007 -0.1549 0.1085  0.0244  234 HIS B CG  
3592 N ND1 . HIS B 234 ? 1.0338 0.8822 1.1302 -0.1487 0.1135  0.0508  234 HIS B ND1 
3593 C CD2 . HIS B 234 ? 1.0620 0.8870 1.1756 -0.1633 0.1144  0.0165  234 HIS B CD2 
3594 C CE1 . HIS B 234 ? 1.1105 0.9096 1.1978 -0.1520 0.1228  0.0607  234 HIS B CE1 
3595 N NE2 . HIS B 234 ? 1.1230 0.9065 1.2222 -0.1621 0.1247  0.0400  234 HIS B NE2 
3596 N N   . LEU B 235 ? 0.7278 0.6849 0.8347 -0.1184 0.0848  0.0372  235 LEU B N   
3597 C CA  . LEU B 235 ? 0.6897 0.6554 0.7897 -0.1098 0.0812  0.0549  235 LEU B CA  
3598 C C   . LEU B 235 ? 0.6884 0.6624 0.7781 -0.1242 0.0872  0.0619  235 LEU B C   
3599 O O   . LEU B 235 ? 0.6683 0.6632 0.7663 -0.1385 0.0918  0.0485  235 LEU B O   
3600 C CB  . LEU B 235 ? 0.6198 0.6151 0.7268 -0.0977 0.0715  0.0495  235 LEU B CB  
3601 C CG  . LEU B 235 ? 0.5584 0.5441 0.6741 -0.0826 0.0709  0.0471  235 LEU B CG  
3602 C CD1 . LEU B 235 ? 0.4892 0.4995 0.6109 -0.0761 0.0662  0.0397  235 LEU B CD1 
3603 C CD2 . LEU B 235 ? 0.5079 0.4778 0.6296 -0.0705 0.0701  0.0623  235 LEU B CD2 
3604 N N   . ARG B 236 ? 0.7210 0.6780 0.7913 -0.1188 0.0877  0.0822  236 ARG B N   
3605 C CA  . ARG B 236 ? 0.7261 0.6820 0.7757 -0.1312 0.0979  0.0919  236 ARG B CA  
3606 C C   . ARG B 236 ? 0.7666 0.7203 0.7887 -0.1161 0.0884  0.1096  236 ARG B C   
3607 O O   . ARG B 236 ? 0.8170 0.7336 0.8118 -0.1101 0.0905  0.1295  236 ARG B O   
3608 C CB  . ARG B 236 ? 0.7843 0.6995 0.8253 -0.1477 0.1162  0.0999  236 ARG B CB  
3609 C CG  . ARG B 236 ? 0.8249 0.7353 0.8446 -0.1650 0.1351  0.1097  236 ARG B CG  
3610 C CD  . ARG B 236 ? 0.7943 0.7541 0.8365 -0.1793 0.1406  0.0891  236 ARG B CD  
3611 N NE  . ARG B 236 ? 0.8499 0.8041 0.8809 -0.2008 0.1666  0.0950  236 ARG B NE  
3612 C CZ  . ARG B 236 ? 0.8381 0.7972 0.8362 -0.1983 0.1745  0.1072  236 ARG B CZ  
3613 N NH1 . ARG B 236 ? 0.8611 0.8324 0.8369 -0.1753 0.1543  0.1127  236 ARG B NH1 
3614 N NH2 . ARG B 236 ? 0.8147 0.7659 0.8026 -0.2197 0.2042  0.1123  236 ARG B NH2 
3615 N N   . PRO B 237 ? 0.7225 0.7132 0.7493 -0.1083 0.0760  0.1011  237 PRO B N   
3616 C CA  . PRO B 237 ? 0.7145 0.7075 0.7127 -0.0961 0.0652  0.1128  237 PRO B CA  
3617 C C   . PRO B 237 ? 0.7225 0.7103 0.6862 -0.1086 0.0812  0.1198  237 PRO B C   
3618 O O   . PRO B 237 ? 0.6740 0.6541 0.6422 -0.1283 0.1028  0.1177  237 PRO B O   
3619 C CB  . PRO B 237 ? 0.6446 0.6776 0.6643 -0.0881 0.0495  0.0965  237 PRO B CB  
3620 C CG  . PRO B 237 ? 0.6268 0.6791 0.6714 -0.1010 0.0591  0.0784  237 PRO B CG  
3621 C CD  . PRO B 237 ? 0.6575 0.6837 0.7124 -0.1078 0.0692  0.0805  237 PRO B CD  
3622 N N   . GLY B 238 ? 0.7884 0.7813 0.7193 -0.0976 0.0717  0.1262  238 GLY B N   
3623 C CA  . GLY B 238 ? 0.8065 0.7885 0.6934 -0.1061 0.0893  0.1355  238 GLY B CA  
3624 C C   . GLY B 238 ? 0.7940 0.8039 0.6986 -0.1280 0.1127  0.1199  238 GLY B C   
3625 O O   . GLY B 238 ? 0.8572 0.8488 0.7458 -0.1451 0.1398  0.1280  238 GLY B O   
3626 N N   . HIS B 239 ? 0.7838 0.8370 0.7233 -0.1273 0.1032  0.0971  239 HIS B N   
3627 C CA  . HIS B 239 ? 0.7749 0.8607 0.7314 -0.1424 0.1211  0.0800  239 HIS B CA  
3628 C C   . HIS B 239 ? 0.6903 0.8060 0.6994 -0.1473 0.1157  0.0574  239 HIS B C   
3629 O O   . HIS B 239 ? 0.6312 0.7821 0.6607 -0.1519 0.1206  0.0385  239 HIS B O   
3630 C CB  . HIS B 239 ? 0.7882 0.8958 0.7191 -0.1325 0.1161  0.0734  239 HIS B CB  
3631 C CG  . HIS B 239 ? 0.8974 0.9737 0.7662 -0.1251 0.1201  0.0940  239 HIS B CG  
3632 N ND1 . HIS B 239 ? 0.9623 1.0252 0.7964 -0.1375 0.1507  0.1033  239 HIS B ND1 
3633 C CD2 . HIS B 239 ? 0.9266 0.9803 0.7599 -0.1053 0.0971  0.1071  239 HIS B CD2 
3634 C CE1 . HIS B 239 ? 1.0463 1.0739 0.8161 -0.1240 0.1463  0.1232  239 HIS B CE1 
3635 N NE2 . HIS B 239 ? 1.0127 1.0362 0.7826 -0.1033 0.1112  0.1248  239 HIS B NE2 
3636 N N   . HIS B 240 ? 0.7035 0.8031 0.7312 -0.1438 0.1052  0.0591  240 HIS B N   
3637 C CA  . HIS B 240 ? 0.6947 0.8137 0.7608 -0.1451 0.0983  0.0393  240 HIS B CA  
3638 C C   . HIS B 240 ? 0.7124 0.8039 0.7914 -0.1514 0.1012  0.0424  240 HIS B C   
3639 O O   . HIS B 240 ? 0.7710 0.8268 0.8318 -0.1497 0.1039  0.0609  240 HIS B O   
3640 C CB  . HIS B 240 ? 0.6405 0.7725 0.7126 -0.1270 0.0773  0.0319  240 HIS B CB  
3641 C CG  . HIS B 240 ? 0.6536 0.8099 0.7151 -0.1202 0.0723  0.0250  240 HIS B CG  
3642 N ND1 . HIS B 240 ? 0.7036 0.8525 0.7373 -0.1114 0.0651  0.0359  240 HIS B ND1 
3643 C CD2 . HIS B 240 ? 0.6178 0.8044 0.6918 -0.1192 0.0720  0.0064  240 HIS B CD2 
3644 C CE1 . HIS B 240 ? 0.6598 0.8319 0.6880 -0.1069 0.0617  0.0237  240 HIS B CE1 
3645 N NE2 . HIS B 240 ? 0.6367 0.8312 0.6897 -0.1111 0.0668  0.0064  240 HIS B NE2 
3646 N N   . ALA B 241 ? 0.6719 0.7782 0.7798 -0.1564 0.0988  0.0229  241 ALA B N   
3647 C CA  . ALA B 241 ? 0.6790 0.7601 0.7984 -0.1614 0.0995  0.0203  241 ALA B CA  
3648 C C   . ALA B 241 ? 0.6141 0.7077 0.7485 -0.1506 0.0840  0.0012  241 ALA B C   
3649 O O   . ALA B 241 ? 0.5832 0.7092 0.7300 -0.1477 0.0772  -0.0157 241 ALA B O   
3650 C CB  . ALA B 241 ? 0.6907 0.7685 0.8260 -0.1855 0.1175  0.0143  241 ALA B CB  
3651 N N   . ALA B 242 ? 0.5934 0.6585 0.7230 -0.1424 0.0792  0.0042  242 ALA B N   
3652 C CA  . ALA B 242 ? 0.6041 0.6716 0.7361 -0.1303 0.0672  -0.0115 242 ALA B CA  
3653 C C   . ALA B 242 ? 0.6094 0.6482 0.7424 -0.1331 0.0680  -0.0192 242 ALA B C   
3654 O O   . ALA B 242 ? 0.5961 0.6036 0.7237 -0.1361 0.0762  -0.0065 242 ALA B O   
3655 C CB  . ALA B 242 ? 0.6201 0.6827 0.7394 -0.1117 0.0612  -0.0021 242 ALA B CB  
3656 N N   . HIS B 243 ? 0.6564 0.7039 0.7934 -0.1298 0.0574  -0.0414 243 HIS B N   
3657 C CA  . HIS B 243 ? 0.6754 0.6957 0.8088 -0.1303 0.0547  -0.0538 243 HIS B CA  
3658 C C   . HIS B 243 ? 0.6330 0.6406 0.7410 -0.1081 0.0445  -0.0614 243 HIS B C   
3659 O O   . HIS B 243 ? 0.5694 0.5972 0.6712 -0.0976 0.0330  -0.0713 243 HIS B O   
3660 C CB  . HIS B 243 ? 0.7023 0.7408 0.8622 -0.1480 0.0502  -0.0779 243 HIS B CB  
3661 C CG  . HIS B 243 ? 0.8068 0.8169 0.9638 -0.1499 0.0445  -0.0951 243 HIS B CG  
3662 N ND1 . HIS B 243 ? 0.9076 0.8739 1.0538 -0.1529 0.0558  -0.0840 243 HIS B ND1 
3663 C CD2 . HIS B 243 ? 0.8486 0.8665 1.0100 -0.1471 0.0267  -0.1245 243 HIS B CD2 
3664 C CE1 . HIS B 243 ? 0.9461 0.8928 1.0896 -0.1535 0.0470  -0.1064 243 HIS B CE1 
3665 N NE2 . HIS B 243 ? 0.9359 0.9138 1.0876 -0.1501 0.0282  -0.1317 243 HIS B NE2 
3666 N N   . MET B 244 ? 0.6383 0.6090 0.7286 -0.0998 0.0504  -0.0563 244 MET B N   
3667 C CA  . MET B 244 ? 0.6421 0.5937 0.7017 -0.0786 0.0478  -0.0598 244 MET B CA  
3668 C C   . MET B 244 ? 0.6620 0.5855 0.7022 -0.0741 0.0416  -0.0800 244 MET B C   
3669 O O   . MET B 244 ? 0.6482 0.5471 0.6934 -0.0816 0.0486  -0.0810 244 MET B O   
3670 C CB  . MET B 244 ? 0.6762 0.6109 0.7307 -0.0690 0.0631  -0.0380 244 MET B CB  
3671 C CG  . MET B 244 ? 0.7604 0.6740 0.7849 -0.0493 0.0689  -0.0383 244 MET B CG  
3672 S SD  . MET B 244 ? 1.5208 1.4525 1.5336 -0.0396 0.0651  -0.0346 244 MET B SD  
3673 C CE  . MET B 244 ? 0.9025 0.7931 0.8743 -0.0197 0.0812  -0.0326 244 MET B CE  
3674 N N   . GLN B 245 ? 0.7123 0.6360 0.7265 -0.0601 0.0270  -0.0970 245 GLN B N   
3675 C CA  . GLN B 245 ? 0.8019 0.6989 0.7897 -0.0524 0.0162  -0.1199 245 GLN B CA  
3676 C C   . GLN B 245 ? 0.8275 0.6957 0.7600 -0.0257 0.0156  -0.1208 245 GLN B C   
3677 O O   . GLN B 245 ? 0.8054 0.6788 0.7239 -0.0148 0.0203  -0.1070 245 GLN B O   
3678 C CB  . GLN B 245 ? 0.8519 0.7774 0.8610 -0.0616 -0.0078 -0.1481 245 GLN B CB  
3679 C CG  . GLN B 245 ? 0.9082 0.8533 0.9687 -0.0908 -0.0029 -0.1515 245 GLN B CG  
3680 C CD  . GLN B 245 ? 0.9743 0.9569 1.0677 -0.1016 -0.0244 -0.1818 245 GLN B CD  
3681 O OE1 . GLN B 245 ? 0.9513 0.9768 1.0784 -0.1109 -0.0256 -0.1813 245 GLN B OE1 
3682 N NE2 . GLN B 245 ? 1.0460 1.0146 1.1320 -0.0996 -0.0421 -0.2109 245 GLN B NE2 
3683 N N   . CYS B 246 ? 0.8289 0.6625 0.7265 -0.0155 0.0108  -0.1378 246 CYS B N   
3684 C CA  . CYS B 246 ? 0.8167 0.6151 0.6498 0.0112  0.0114  -0.1403 246 CYS B CA  
3685 C C   . CYS B 246 ? 0.8769 0.6573 0.6727 0.0232  -0.0148 -0.1722 246 CYS B C   
3686 O O   . CYS B 246 ? 0.9830 0.7429 0.7778 0.0179  -0.0160 -0.1879 246 CYS B O   
3687 C CB  . CYS B 246 ? 0.8069 0.5679 0.6190 0.0189  0.0426  -0.1230 246 CYS B CB  
3688 S SG  . CYS B 246 ? 1.0248 0.7323 0.7482 0.0506  0.0512  -0.1266 246 CYS B SG  
3689 N N   . TRP B 247 ? 0.9103 0.6966 0.6743 0.0410  -0.0379 -0.1830 247 TRP B N   
3690 C CA  . TRP B 247 ? 0.9934 0.7562 0.7054 0.0614  -0.0659 -0.2125 247 TRP B CA  
3691 C C   . TRP B 247 ? 1.0845 0.7910 0.7092 0.0913  -0.0512 -0.2004 247 TRP B C   
3692 O O   . TRP B 247 ? 1.1126 0.8124 0.7190 0.1002  -0.0345 -0.1757 247 TRP B O   
3693 C CB  . TRP B 247 ? 1.0404 0.8425 0.7671 0.0678  -0.1039 -0.2338 247 TRP B CB  
3694 C CG  . TRP B 247 ? 1.0391 0.8981 0.8516 0.0383  -0.1161 -0.2491 247 TRP B CG  
3695 C CD1 . TRP B 247 ? 1.0629 0.9409 0.9080 0.0265  -0.1412 -0.2841 247 TRP B CD1 
3696 C CD2 . TRP B 247 ? 0.9890 0.8921 0.8651 0.0160  -0.1016 -0.2309 247 TRP B CD2 
3697 N NE1 . TRP B 247 ? 1.0106 0.9413 0.9379 -0.0036 -0.1391 -0.2872 247 TRP B NE1 
3698 C CE2 . TRP B 247 ? 0.9686 0.9141 0.9115 -0.0091 -0.1149 -0.2542 247 TRP B CE2 
3699 C CE3 . TRP B 247 ? 0.9604 0.8698 0.8424 0.0145  -0.0782 -0.1987 247 TRP B CE3 
3700 C CZ2 . TRP B 247 ? 0.9486 0.9391 0.9564 -0.0340 -0.1026 -0.2440 247 TRP B CZ2 
3701 C CZ3 . TRP B 247 ? 0.9442 0.8992 0.8893 -0.0086 -0.0708 -0.1907 247 TRP B CZ3 
3702 C CH2 . TRP B 247 ? 0.9348 0.9284 0.9386 -0.0319 -0.0815 -0.2120 247 TRP B CH2 
3703 N N   . SER B 248 ? 1.1772 0.8399 0.7457 0.1065  -0.0554 -0.2183 248 SER B N   
3704 C CA  . SER B 248 ? 1.2543 0.8575 0.7319 0.1351  -0.0361 -0.2065 248 SER B CA  
3705 C C   . SER B 248 ? 1.3551 0.9144 0.7571 0.1588  -0.0580 -0.2365 248 SER B C   
3706 O O   . SER B 248 ? 1.3474 0.9103 0.7729 0.1474  -0.0702 -0.2610 248 SER B O   
3707 C CB  . SER B 248 ? 1.2195 0.8028 0.7076 0.1262  0.0130  -0.1792 248 SER B CB  
3708 O OG  . SER B 248 ? 1.2872 0.8202 0.6987 0.1497  0.0399  -0.1622 248 SER B OG  
3709 N N   . LYS B 249 ? 1.4490 0.9815 0.7837 0.1851  -0.0608 -0.2243 249 LYS B N   
3710 C CA  . LYS B 249 ? 1.5197 1.0223 0.7978 0.2044  -0.0749 -0.2366 249 LYS B CA  
3711 C C   . LYS B 249 ? 1.5543 1.0116 0.7970 0.2063  -0.0320 -0.2238 249 LYS B C   
3712 O O   . LYS B 249 ? 1.6245 1.0530 0.8215 0.2196  -0.0367 -0.2350 249 LYS B O   
3713 C CB  . LYS B 249 ? 1.5742 1.0562 0.7890 0.2347  -0.0930 -0.2255 249 LYS B CB  
3714 C CG  . LYS B 249 ? 1.5727 1.1004 0.8242 0.2378  -0.1337 -0.2360 249 LYS B CG  
3715 C CD  . LYS B 249 ? 1.5849 1.1561 0.8841 0.2303  -0.1785 -0.2743 249 LYS B CD  
3716 C CE  . LYS B 249 ? 1.6889 1.2280 0.9271 0.2551  -0.2001 -0.2888 249 LYS B CE  
3717 N NZ  . LYS B 249 ? 1.6734 1.2576 0.9647 0.2467  -0.2436 -0.3274 249 LYS B NZ  
3718 N N   . SER B 250 ? 1.5147 0.9684 0.7826 0.1936  0.0101  -0.2009 250 SER B N   
3719 C CA  . SER B 250 ? 1.5433 0.9640 0.7948 0.1940  0.0553  -0.1867 250 SER B CA  
3720 C C   . SER B 250 ? 1.5068 0.9374 0.8102 0.1758  0.0599  -0.2054 250 SER B C   
3721 O O   . SER B 250 ? 1.5147 0.9268 0.8233 0.1742  0.0970  -0.1953 250 SER B O   
3722 C CB  . SER B 250 ? 1.5030 0.9189 0.7657 0.1895  0.1000  -0.1522 250 SER B CB  
3723 O OG  . SER B 250 ? 1.5156 0.9240 0.7429 0.2017  0.0931  -0.1356 250 SER B OG  
3724 N N   . MET B 251 ? 1.4737 0.9333 0.8199 0.1618  0.0227  -0.2324 251 MET B N   
3725 C CA  . MET B 251 ? 1.4779 0.9408 0.8764 0.1418  0.0254  -0.2493 251 MET B CA  
3726 C C   . MET B 251 ? 1.5646 1.0138 0.9447 0.1452  0.0016  -0.2806 251 MET B C   
3727 O O   . MET B 251 ? 1.6023 1.0689 0.9749 0.1481  -0.0387 -0.3029 251 MET B O   
3728 C CB  . MET B 251 ? 1.4276 0.9479 0.9157 0.1127  0.0054  -0.2492 251 MET B CB  
3729 C CG  . MET B 251 ? 1.3938 0.9299 0.9577 0.0866  0.0264  -0.2384 251 MET B CG  
3730 S SD  . MET B 251 ? 1.6405 1.2439 1.3024 0.0523  0.0073  -0.2330 251 MET B SD  
3731 C CE  . MET B 251 ? 1.2646 0.8979 0.9188 0.0616  0.0099  -0.2064 251 MET B CE  
3732 N N   . ALA C 2   ? 0.8402 1.2785 1.2619 -0.2261 -0.1656 0.0895  487 ALA C N   
3733 C CA  . ALA C 2   ? 0.8886 1.3271 1.3181 -0.2591 -0.1597 0.0962  487 ALA C CA  
3734 C C   . ALA C 2   ? 0.9508 1.3146 1.3151 -0.2819 -0.1705 0.0952  487 ALA C C   
3735 O O   . ALA C 2   ? 0.9943 1.3368 1.3471 -0.3063 -0.1892 0.0944  487 ALA C O   
3736 C CB  . ALA C 2   ? 0.8618 1.3334 1.3182 -0.2578 -0.1254 0.1037  487 ALA C CB  
3737 N N   . ARG C 3   ? 0.9425 1.2657 1.2636 -0.2732 -0.1589 0.0944  488 ARG C N   
3738 C CA  . ARG C 3   ? 0.9594 1.2070 1.2155 -0.2911 -0.1656 0.0926  488 ARG C CA  
3739 C C   . ARG C 3   ? 0.9315 1.1311 1.1383 -0.2738 -0.1797 0.0828  488 ARG C C   
3740 O O   . ARG C 3   ? 0.8896 1.1038 1.1014 -0.2483 -0.1724 0.0800  488 ARG C O   
3741 C CB  . ARG C 3   ? 0.9312 1.1617 1.1706 -0.2992 -0.1400 0.1004  488 ARG C CB  
3742 C CG  . ARG C 3   ? 0.9320 1.0788 1.1028 -0.3167 -0.1444 0.0988  488 ARG C CG  
3743 C CD  . ARG C 3   ? 0.9000 1.0302 1.0569 -0.3283 -0.1191 0.1098  488 ARG C CD  
3744 N NE  . ARG C 3   ? 0.8943 0.9358 0.9792 -0.3364 -0.1208 0.1074  488 ARG C NE  
3745 C CZ  . ARG C 3   ? 0.8914 0.8952 0.9353 -0.3131 -0.0998 0.1076  488 ARG C CZ  
3746 N NH1 . ARG C 3   ? 0.8752 0.9216 0.9414 -0.2876 -0.0783 0.1105  488 ARG C NH1 
3747 N NH2 . ARG C 3   ? 0.9388 0.8610 0.9180 -0.3140 -0.1012 0.1044  488 ARG C NH2 
3748 N N   . TYR C 4   ? 0.9514 1.0917 1.1085 -0.2878 -0.1984 0.0772  489 TYR C N   
3749 C CA  . TYR C 4   ? 0.9414 1.0308 1.0462 -0.2730 -0.2102 0.0675  489 TYR C CA  
3750 C C   . TYR C 4   ? 0.9790 0.9853 1.0131 -0.2850 -0.2091 0.0626  489 TYR C C   
3751 O O   . TYR C 4   ? 1.0513 1.0342 1.0737 -0.3073 -0.2049 0.0667  489 TYR C O   
3752 C CB  . TYR C 4   ? 0.9549 1.0494 1.0609 -0.2709 -0.2349 0.0634  489 TYR C CB  
3753 C CG  . TYR C 4   ? 0.9250 1.0942 1.0962 -0.2555 -0.2372 0.0671  489 TYR C CG  
3754 C CD1 . TYR C 4   ? 0.9023 1.1062 1.1003 -0.2289 -0.2221 0.0676  489 TYR C CD1 
3755 C CD2 . TYR C 4   ? 0.9431 1.1468 1.1487 -0.2667 -0.2545 0.0692  489 TYR C CD2 
3756 C CE1 . TYR C 4   ? 0.8734 1.1388 1.1263 -0.2117 -0.2226 0.0699  489 TYR C CE1 
3757 C CE2 . TYR C 4   ? 0.9250 1.1951 1.1894 -0.2499 -0.2561 0.0717  489 TYR C CE2 
3758 C CZ  . TYR C 4   ? 0.8912 1.1894 1.1771 -0.2215 -0.2393 0.0719  489 TYR C CZ  
3759 O OH  . TYR C 4   ? 0.8707 1.2289 1.2108 -0.2022 -0.2397 0.0734  489 TYR C OH  
3760 N N   . GLY C 5   ? 0.9566 0.9160 0.9423 -0.2685 -0.2111 0.0535  490 GLY C N   
3761 C CA  . GLY C 5   ? 0.9942 0.8702 0.9087 -0.2730 -0.2082 0.0465  490 GLY C CA  
3762 C C   . GLY C 5   ? 1.0412 0.8703 0.9042 -0.2609 -0.2200 0.0358  490 GLY C C   
3763 O O   . GLY C 5   ? 1.0641 0.9103 0.9329 -0.2407 -0.2206 0.0323  490 GLY C O   
3764 N N   . VAL C 6   ? 1.0811 0.8494 0.8914 -0.2731 -0.2278 0.0312  491 VAL C N   
3765 C CA  . VAL C 6   ? 1.0941 0.8115 0.8475 -0.2628 -0.2362 0.0218  491 VAL C CA  
3766 C C   . VAL C 6   ? 1.1500 0.7860 0.8330 -0.2553 -0.2212 0.0132  491 VAL C C   
3767 O O   . VAL C 6   ? 1.2182 0.8196 0.8812 -0.2687 -0.2167 0.0145  491 VAL C O   
3768 C CB  . VAL C 6   ? 1.1222 0.8364 0.8692 -0.2807 -0.2602 0.0229  491 VAL C CB  
3769 C CG1 . VAL C 6   ? 1.1668 0.8194 0.8455 -0.2712 -0.2665 0.0142  491 VAL C CG1 
3770 C CG2 . VAL C 6   ? 1.0742 0.8680 0.8908 -0.2824 -0.2744 0.0305  491 VAL C CG2 
3771 N N   . SER C 7   ? 1.1368 0.7420 0.7825 -0.2320 -0.2114 0.0046  492 SER C N   
3772 C CA  . SER C 7   ? 1.2377 0.7696 0.8198 -0.2179 -0.1929 -0.0043 492 SER C CA  
3773 C C   . SER C 7   ? 1.4112 0.8843 0.9398 -0.2310 -0.2010 -0.0070 492 SER C C   
3774 O O   . SER C 7   ? 1.4603 0.9366 0.9828 -0.2441 -0.2212 -0.0059 492 SER C O   
3775 C CB  . SER C 7   ? 1.2062 0.7218 0.7610 -0.1912 -0.1801 -0.0129 492 SER C CB  
3776 O OG  . SER C 7   ? 1.2225 0.7334 0.7571 -0.1928 -0.1944 -0.0137 492 SER C OG  
3777 N N   . ASN C 8   ? 1.5172 0.9355 1.0064 -0.2265 -0.1859 -0.0102 493 ASN C N   
3778 C CA  . ASN C 8   ? 1.6389 0.9966 1.0735 -0.2384 -0.1923 -0.0134 493 ASN C CA  
3779 C C   . ASN C 8   ? 1.6918 0.9959 1.0626 -0.2206 -0.1863 -0.0230 493 ASN C C   
3780 O O   . ASN C 8   ? 1.7766 1.0428 1.1063 -0.2336 -0.2000 -0.0255 493 ASN C O   
3781 C CB  . ASN C 8   ? 1.6725 0.9900 1.0878 -0.2381 -0.1776 -0.0123 493 ASN C CB  
3782 C CG  . ASN C 8   ? 1.6503 0.9649 1.0706 -0.2084 -0.1516 -0.0136 493 ASN C CG  
3783 O OD1 . ASN C 8   ? 1.6190 0.9506 1.0464 -0.1865 -0.1421 -0.0182 493 ASN C OD1 
3784 N ND2 . ASN C 8   ? 1.6622 0.9543 1.0787 -0.2069 -0.1400 -0.0088 493 ASN C ND2 
3785 N N   . THR C 9   ? 1.6054 0.9061 0.9678 -0.1914 -0.1647 -0.0282 494 THR C N   
3786 C CA  . THR C 9   ? 1.6138 0.8710 0.9210 -0.1736 -0.1545 -0.0358 494 THR C CA  
3787 C C   . THR C 9   ? 1.5536 0.8507 0.8818 -0.1718 -0.1638 -0.0343 494 THR C C   
3788 O O   . THR C 9   ? 1.4930 0.8472 0.8752 -0.1690 -0.1645 -0.0307 494 THR C O   
3789 C CB  . THR C 9   ? 1.5147 0.7392 0.7959 -0.1401 -0.1206 -0.0424 494 THR C CB  
3790 O OG1 . THR C 9   ? 1.6011 0.7755 0.8223 -0.1260 -0.1090 -0.0489 494 THR C OG1 
3791 C CG2 . THR C 9   ? 1.3994 0.6733 0.7279 -0.1208 -0.1055 -0.0425 494 THR C CG2 
3792 N N   . SER C 10  ? 1.5743 0.8385 0.8574 -0.1740 -0.1720 -0.0365 495 SER C N   
3793 C CA  . SER C 10  ? 1.4995 0.7930 0.7948 -0.1727 -0.1828 -0.0337 495 SER C CA  
3794 C C   . SER C 10  ? 1.5461 0.7876 0.7780 -0.1553 -0.1664 -0.0393 495 SER C C   
3795 O O   . SER C 10  ? 1.5962 0.7806 0.7758 -0.1464 -0.1501 -0.0452 495 SER C O   
3796 C CB  . SER C 10  ? 1.4861 0.8045 0.8023 -0.1994 -0.2183 -0.0270 495 SER C CB  
3797 O OG  . SER C 10  ? 1.5827 0.8432 0.8398 -0.2108 -0.2301 -0.0302 495 SER C OG  
3798 N N   . ILE C 11  ? 1.5442 0.8050 0.7805 -0.1496 -0.1696 -0.0368 496 ILE C N   
3799 C CA  . ILE C 11  ? 1.5847 0.8008 0.7648 -0.1330 -0.1505 -0.0407 496 ILE C CA  
3800 C C   . ILE C 11  ? 1.6415 0.8362 0.7882 -0.1461 -0.1760 -0.0375 496 ILE C C   
3801 O O   . ILE C 11  ? 1.6080 0.8452 0.7906 -0.1548 -0.1987 -0.0309 496 ILE C O   
3802 C CB  . ILE C 11  ? 1.5203 0.7686 0.7252 -0.1122 -0.1260 -0.0408 496 ILE C CB  
3803 C CG1 . ILE C 11  ? 1.4592 0.7259 0.6946 -0.0971 -0.1005 -0.0454 496 ILE C CG1 
3804 C CG2 . ILE C 11  ? 1.5314 0.7373 0.6815 -0.0974 -0.1047 -0.0431 496 ILE C CG2 
3805 C CD1 . ILE C 11  ? 1.3948 0.7030 0.6654 -0.0800 -0.0794 -0.0459 496 ILE C CD1 
3806 N N   . ASN C 12  ? 1.7481 0.8761 0.8257 -0.1463 -0.1726 -0.0421 497 ASN C N   
3807 C CA  . ASN C 12  ? 1.8167 0.9159 0.8535 -0.1575 -0.1964 -0.0403 497 ASN C CA  
3808 C C   . ASN C 12  ? 1.8220 0.8710 0.7963 -0.1399 -0.1729 -0.0434 497 ASN C C   
3809 O O   . ASN C 12  ? 1.8388 0.8529 0.7812 -0.1225 -0.1393 -0.0491 497 ASN C O   
3810 C CB  . ASN C 12  ? 1.9254 0.9855 0.9289 -0.1790 -0.2206 -0.0429 497 ASN C CB  
3811 C CG  . ASN C 12  ? 1.9327 1.0472 0.9991 -0.2025 -0.2516 -0.0375 497 ASN C CG  
3812 O OD1 . ASN C 12  ? 1.9382 1.0611 1.0273 -0.2094 -0.2478 -0.0386 497 ASN C OD1 
3813 N ND2 . ASN C 12  ? 1.9211 1.0736 1.0166 -0.2142 -0.2813 -0.0313 497 ASN C ND2 
3814 N N   . ARG C 13  ? 1.8142 0.8616 0.7731 -0.1436 -0.1898 -0.0390 498 ARG C N   
3815 C CA  . ARG C 13  ? 1.8885 0.8791 0.7778 -0.1320 -0.1730 -0.0414 498 ARG C CA  
3816 C C   . ARG C 13  ? 1.9463 0.8925 0.7828 -0.1491 -0.2061 -0.0418 498 ARG C C   
3817 O O   . ARG C 13  ? 1.8934 0.8725 0.7589 -0.1647 -0.2429 -0.0363 498 ARG C O   
3818 C CB  . ARG C 13  ? 1.8686 0.8866 0.7746 -0.1189 -0.1596 -0.0358 498 ARG C CB  
3819 C CG  . ARG C 13  ? 1.9797 0.9392 0.8141 -0.1068 -0.1371 -0.0376 498 ARG C CG  
3820 C CD  . ARG C 13  ? 2.0079 0.9932 0.8592 -0.0942 -0.1184 -0.0317 498 ARG C CD  
3821 N NE  . ARG C 13  ? 1.9839 1.0186 0.8931 -0.0824 -0.0904 -0.0318 498 ARG C NE  
3822 C CZ  . ARG C 13  ? 1.9922 1.0159 0.8952 -0.0662 -0.0494 -0.0372 498 ARG C CZ  
3823 N NH1 . ARG C 13  ? 2.0706 1.0345 0.9117 -0.0590 -0.0299 -0.0427 498 ARG C NH1 
3824 N NH2 . ARG C 13  ? 1.8759 0.9500 0.8359 -0.0564 -0.0280 -0.0371 498 ARG C NH2 
3825 N N   . LYS C 14  ? 2.0506 0.9237 0.8106 -0.1452 -0.1931 -0.0486 499 LYS C N   
3826 C CA  . LYS C 14  ? 2.1378 0.9597 0.8375 -0.1613 -0.2234 -0.0509 499 LYS C CA  
3827 C C   . LYS C 14  ? 2.2048 0.9742 0.8342 -0.1502 -0.2118 -0.0515 499 LYS C C   
3828 O O   . LYS C 14  ? 2.2192 0.9648 0.8227 -0.1297 -0.1709 -0.0539 499 LYS C O   
3829 C CB  . LYS C 14  ? 2.2009 0.9711 0.8591 -0.1695 -0.2232 -0.0590 499 LYS C CB  
3830 C CG  . LYS C 14  ? 2.1798 0.9834 0.8833 -0.1943 -0.2570 -0.0578 499 LYS C CG  
3831 C CD  . LYS C 14  ? 2.2732 1.0150 0.9243 -0.2035 -0.2570 -0.0660 499 LYS C CD  
3832 C CE  . LYS C 14  ? 2.2492 0.9981 0.9243 -0.1902 -0.2251 -0.0686 499 LYS C CE  
3833 N NZ  . LYS C 14  ? 2.1676 0.9915 0.9299 -0.2019 -0.2384 -0.0628 499 LYS C NZ  
3834 N N   . ALA D 2   ? 1.0052 1.4642 1.3203 0.1344  -0.2244 -0.3509 487 ALA D N   
3835 C CA  . ALA D 2   ? 0.9954 1.4735 1.3253 0.1343  -0.2068 -0.3453 487 ALA D CA  
3836 C C   . ALA D 2   ? 1.0292 1.4598 1.2947 0.1622  -0.2168 -0.3264 487 ALA D C   
3837 O O   . ALA D 2   ? 1.0897 1.4939 1.3189 0.2008  -0.2430 -0.3327 487 ALA D O   
3838 C CB  . ALA D 2   ? 0.9284 1.4300 1.2930 0.0913  -0.1685 -0.3323 487 ALA D CB  
3839 N N   . ARG D 3   ? 0.9424 1.3587 1.1919 0.1429  -0.1957 -0.3032 488 ARG D N   
3840 C CA  . ARG D 3   ? 0.8885 1.2511 1.0756 0.1638  -0.1983 -0.2818 488 ARG D CA  
3841 C C   . ARG D 3   ? 0.8392 1.1363 0.9678 0.1494  -0.1832 -0.2512 488 ARG D C   
3842 O O   . ARG D 3   ? 0.7794 1.0838 0.9262 0.1152  -0.1600 -0.2403 488 ARG D O   
3843 C CB  . ARG D 3   ? 0.8272 1.2044 1.0325 0.1540  -0.1729 -0.2735 488 ARG D CB  
3844 C CG  . ARG D 3   ? 0.7981 1.1070 0.9389 0.1699  -0.1669 -0.2487 488 ARG D CG  
3845 C CD  . ARG D 3   ? 0.7523 1.0789 0.9100 0.1811  -0.1611 -0.2561 488 ARG D CD  
3846 N NE  . ARG D 3   ? 0.7359 0.9946 0.8367 0.1896  -0.1522 -0.2327 488 ARG D NE  
3847 C CZ  . ARG D 3   ? 0.6718 0.9220 0.7722 0.1683  -0.1270 -0.2187 488 ARG D CZ  
3848 N NH1 . ARG D 3   ? 0.6022 0.9034 0.7468 0.1403  -0.1080 -0.2232 488 ARG D NH1 
3849 N NH2 . ARG D 3   ? 0.6925 0.8810 0.7468 0.1753  -0.1210 -0.2009 488 ARG D NH2 
3850 N N   . TYR D 4   ? 0.8491 1.0800 0.9062 0.1770  -0.1948 -0.2374 489 TYR D N   
3851 C CA  . TYR D 4   ? 0.8104 0.9783 0.8114 0.1672  -0.1788 -0.2103 489 TYR D CA  
3852 C C   . TYR D 4   ? 0.8185 0.9205 0.7614 0.1802  -0.1652 -0.1843 489 TYR D C   
3853 O O   . TYR D 4   ? 0.8403 0.9321 0.7707 0.2054  -0.1762 -0.1886 489 TYR D O   
3854 C CB  . TYR D 4   ? 0.8467 0.9908 0.8106 0.1848  -0.2032 -0.2203 489 TYR D CB  
3855 C CG  . TYR D 4   ? 0.8369 1.0442 0.8606 0.1736  -0.2215 -0.2513 489 TYR D CG  
3856 C CD1 . TYR D 4   ? 0.8176 1.0544 0.8875 0.1339  -0.1996 -0.2500 489 TYR D CD1 
3857 C CD2 . TYR D 4   ? 0.8999 1.1337 0.9354 0.2027  -0.2594 -0.2816 489 TYR D CD2 
3858 C CE1 . TYR D 4   ? 0.8454 1.1360 0.9734 0.1201  -0.2132 -0.2790 489 TYR D CE1 
3859 C CE2 . TYR D 4   ? 0.9268 1.2090 1.0241 0.1867  -0.2633 -0.3043 489 TYR D CE2 
3860 C CZ  . TYR D 4   ? 0.9014 1.2126 1.0444 0.1449  -0.2416 -0.3041 489 TYR D CZ  
3861 O OH  . TYR D 4   ? 0.9190 1.2710 1.1202 0.1276  -0.2431 -0.3256 489 TYR D OH  
3862 N N   . GLY D 5   ? 0.7955 0.8525 0.7068 0.1626  -0.1403 -0.1587 490 GLY D N   
3863 C CA  . GLY D 5   ? 0.8147 0.8088 0.6779 0.1691  -0.1228 -0.1346 490 GLY D CA  
3864 C C   . GLY D 5   ? 0.8796 0.8111 0.6845 0.1704  -0.1098 -0.1151 490 GLY D C   
3865 O O   . GLY D 5   ? 0.8852 0.8260 0.7019 0.1500  -0.0990 -0.1117 490 GLY D O   
3866 N N   . VAL D 6   ? 0.9385 0.8024 0.6781 0.1952  -0.1085 -0.1022 491 VAL D N   
3867 C CA  . VAL D 6   ? 0.9379 0.7347 0.6135 0.1990  -0.0909 -0.0825 491 VAL D CA  
3868 C C   . VAL D 6   ? 0.9252 0.6691 0.5796 0.1900  -0.0584 -0.0575 491 VAL D C   
3869 O O   . VAL D 6   ? 1.0021 0.7234 0.6442 0.2039  -0.0616 -0.0556 491 VAL D O   
3870 C CB  . VAL D 6   ? 1.0095 0.7608 0.6108 0.2394  -0.1170 -0.0888 491 VAL D CB  
3871 C CG1 . VAL D 6   ? 1.0677 0.7369 0.5897 0.2459  -0.0919 -0.0649 491 VAL D CG1 
3872 C CG2 . VAL D 6   ? 0.9855 0.7895 0.6123 0.2446  -0.1490 -0.1165 491 VAL D CG2 
3873 N N   . SER D 7   ? 0.8465 0.5722 0.5019 0.1664  -0.0270 -0.0405 492 SER D N   
3874 C CA  . SER D 7   ? 0.9269 0.6100 0.5763 0.1526  0.0061  -0.0198 492 SER D CA  
3875 C C   . SER D 7   ? 1.1502 0.7491 0.7197 0.1800  0.0127  -0.0062 492 SER D C   
3876 O O   . SER D 7   ? 1.2318 0.7905 0.7347 0.2062  0.0027  -0.0051 492 SER D O   
3877 C CB  . SER D 7   ? 0.8921 0.5733 0.5584 0.1265  0.0374  -0.0067 492 SER D CB  
3878 O OG  . SER D 7   ? 1.0337 0.6658 0.6365 0.1413  0.0465  0.0009  492 SER D OG  
3879 N N   . ASN D 8   ? 1.2136 0.7819 0.7865 0.1742  0.0291  0.0036  493 ASN D N   
3880 C CA  . ASN D 8   ? 1.3563 0.8362 0.8534 0.1979  0.0395  0.0190  493 ASN D CA  
3881 C C   . ASN D 8   ? 1.4442 0.8566 0.8845 0.1944  0.0765  0.0415  493 ASN D C   
3882 O O   . ASN D 8   ? 1.5449 0.8910 0.8978 0.2246  0.0744  0.0506  493 ASN D O   
3883 C CB  . ASN D 8   ? 1.3332 0.7973 0.8566 0.1873  0.0508  0.0220  493 ASN D CB  
3884 C CG  . ASN D 8   ? 1.2889 0.7934 0.8885 0.1449  0.0759  0.0234  493 ASN D CG  
3885 O OD1 . ASN D 8   ? 1.2747 0.8233 0.9109 0.1248  0.0833  0.0224  493 ASN D OD1 
3886 N ND2 . ASN D 8   ? 1.2711 0.7598 0.8948 0.1328  0.0866  0.0240  493 ASN D ND2 
3887 N N   . THR D 9   ? 1.3752 0.8044 0.8638 0.1594  0.1103  0.0496  494 THR D N   
3888 C CA  . THR D 9   ? 1.4438 0.8165 0.8902 0.1529  0.1514  0.0693  494 THR D CA  
3889 C C   . THR D 9   ? 1.4484 0.8529 0.8931 0.1529  0.1469  0.0631  494 THR D C   
3890 O O   . THR D 9   ? 1.3844 0.8646 0.8959 0.1377  0.1289  0.0479  494 THR D O   
3891 C CB  . THR D 9   ? 1.3552 0.7275 0.8599 0.1159  0.1929  0.0796  494 THR D CB  
3892 O OG1 . THR D 9   ? 1.4493 0.7698 0.9179 0.1093  0.2374  0.0976  494 THR D OG1 
3893 C CG2 . THR D 9   ? 1.2154 0.6803 0.8209 0.0869  0.1828  0.0646  494 THR D CG2 
3894 N N   . SER D 10  ? 1.5145 0.8555 0.8768 0.1714  0.1636  0.0748  495 SER D N   
3895 C CA  . SER D 10  ? 1.4560 0.8165 0.8060 0.1746  0.1597  0.0673  495 SER D CA  
3896 C C   . SER D 10  ? 1.4905 0.7961 0.8004 0.1676  0.2104  0.0859  495 SER D C   
3897 O O   . SER D 10  ? 1.5850 0.8247 0.8556 0.1671  0.2462  0.1053  495 SER D O   
3898 C CB  . SER D 10  ? 1.4825 0.8296 0.7640 0.2128  0.1166  0.0538  495 SER D CB  
3899 O OG  . SER D 10  ? 1.5970 0.8504 0.7686 0.2441  0.1263  0.0695  495 SER D OG  
3900 N N   . ILE D 11  ? 1.4535 0.7863 0.7761 0.1615  0.2153  0.0785  496 ILE D N   
3901 C CA  . ILE D 11  ? 1.4827 0.7740 0.7768 0.1545  0.2649  0.0925  496 ILE D CA  
3902 C C   . ILE D 11  ? 1.5407 0.7819 0.7426 0.1861  0.2563  0.0880  496 ILE D C   
3903 O O   . ILE D 11  ? 1.4988 0.7623 0.6804 0.2001  0.2237  0.0723  496 ILE D O   
3904 C CB  . ILE D 11  ? 1.3502 0.7098 0.7356 0.1260  0.2774  0.0840  496 ILE D CB  
3905 C CG1 . ILE D 11  ? 1.2481 0.6686 0.7393 0.0956  0.2765  0.0821  496 ILE D CG1 
3906 C CG2 . ILE D 11  ? 1.3360 0.6657 0.7116 0.1202  0.3244  0.0917  496 ILE D CG2 
3907 C CD1 . ILE D 11  ? 1.1530 0.6446 0.7321 0.0732  0.2766  0.0721  496 ILE D CD1 
3908 N N   . ASN D 12  ? 1.6389 0.8170 0.7926 0.1964  0.2829  0.0973  497 ASN D N   
3909 C CA  . ASN D 12  ? 1.7595 0.8864 0.8305 0.2257  0.2763  0.0940  497 ASN D CA  
3910 C C   . ASN D 12  ? 1.7543 0.8529 0.8247 0.2152  0.3256  0.1015  497 ASN D C   
3911 O O   . ASN D 12  ? 1.7160 0.8115 0.8290 0.1929  0.3672  0.1106  497 ASN D O   
3912 C CB  . ASN D 12  ? 1.9318 0.9970 0.9216 0.2585  0.2567  0.0966  497 ASN D CB  
3913 C CG  . ASN D 12  ? 2.0746 1.1032 1.0672 0.2474  0.2926  0.1106  497 ASN D CG  
3914 O OD1 . ASN D 12  ? 2.0998 1.1428 1.1508 0.2166  0.3357  0.1179  497 ASN D OD1 
3915 N ND2 . ASN D 12  ? 2.1658 1.1503 1.0995 0.2729  0.2731  0.1120  497 ASN D ND2 
3916 N N   . ARG D 13  ? 1.8097 0.8923 0.8368 0.2310  0.3188  0.0955  498 ARG D N   
3917 C CA  . ARG D 13  ? 1.8791 0.9241 0.8879 0.2284  0.3625  0.1024  498 ARG D CA  
3918 C C   . ARG D 13  ? 1.9626 0.9295 0.8612 0.2646  0.3539  0.1051  498 ARG D C   
3919 O O   . ARG D 13  ? 1.9515 0.9161 0.8024 0.2896  0.3102  0.0941  498 ARG D O   
3920 C CB  . ARG D 13  ? 1.8888 0.9789 0.9410 0.2154  0.3671  0.0936  498 ARG D CB  
3921 C CG  . ARG D 13  ? 1.9877 1.0491 1.0382 0.2088  0.4161  0.1002  498 ARG D CG  
3922 C CD  . ARG D 13  ? 1.9712 1.0780 1.0650 0.1982  0.4181  0.0898  498 ARG D CD  
3923 N NE  . ARG D 13  ? 1.8834 1.0676 1.0753 0.1725  0.4098  0.0829  498 ARG D NE  
3924 C CZ  . ARG D 13  ? 1.8387 1.0590 1.1180 0.1455  0.4400  0.0875  498 ARG D CZ  
3925 N NH1 . ARG D 13  ? 1.9057 1.0944 1.1906 0.1388  0.4815  0.0972  498 ARG D NH1 
3926 N NH2 . ARG D 13  ? 1.7238 1.0129 1.0865 0.1257  0.4275  0.0806  498 ARG D NH2 
3927 N N   . LYS D 14  ? 2.0786 0.9834 0.9389 0.2676  0.3945  0.1182  499 LYS D N   
3928 C CA  . LYS D 14  ? 2.2345 1.0567 0.9841 0.3033  0.3909  0.1226  499 LYS D CA  
3929 C C   . LYS D 14  ? 2.3108 1.0892 1.0261 0.3040  0.4351  0.1294  499 LYS D C   
3930 O O   . LYS D 14  ? 2.2771 1.0694 1.0503 0.2761  0.4832  0.1357  499 LYS D O   
3931 C CB  . LYS D 14  ? 2.3215 1.0927 1.0332 0.3121  0.4012  0.1324  499 LYS D CB  
3932 C CG  . LYS D 14  ? 2.2776 1.0943 1.0375 0.3041  0.3701  0.1279  499 LYS D CG  
3933 C CD  . LYS D 14  ? 2.3641 1.1246 1.0786 0.3146  0.3811  0.1375  499 LYS D CD  
3934 C CE  . LYS D 14  ? 2.3101 1.1170 1.0757 0.3052  0.3524  0.1336  499 LYS D CE  
3935 N NZ  . LYS D 14  ? 2.4193 1.1696 1.1338 0.3190  0.3571  0.1420  499 LYS D NZ  
3936 N N   . LYS D 15  ? 2.4290 1.1579 1.0531 0.3367  0.4170  0.1267  500 LYS D N   
3937 C CA  . LYS D 15  ? 2.5364 1.2062 1.1036 0.3447  0.4586  0.1348  500 LYS D CA  
3938 C C   . LYS D 15  ? 2.6609 1.2715 1.1149 0.3876  0.4260  0.1303  500 LYS D C   
3939 O O   . LYS D 15  ? 2.6763 1.2935 1.1096 0.3959  0.4156  0.1218  500 LYS D O   
3940 C CB  . LYS D 15  ? 2.4437 1.1634 1.0786 0.3192  0.4839  0.1304  500 LYS D CB  
3941 C CG  . LYS D 15  ? 2.4930 1.1668 1.1134 0.3108  0.5483  0.1423  500 LYS D CG  
3942 C CD  . LYS D 15  ? 2.5295 1.1692 1.1589 0.2987  0.5878  0.1557  500 LYS D CD  
3943 C CE  . LYS D 15  ? 2.6411 1.2219 1.2383 0.2954  0.6513  0.1675  500 LYS D CE  
3944 N NZ  . LYS D 15  ? 2.6919 1.2294 1.2828 0.2869  0.6878  0.1798  500 LYS D NZ  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   ALA 2   2   ?   ?   ?   A . n 
A 1 3   PRO 3   3   ?   ?   ?   A . n 
A 1 4   LEU 4   4   ?   ?   ?   A . n 
A 1 5   GLU 5   5   ?   ?   ?   A . n 
A 1 6   ASN 6   6   6   ASN ASN A . n 
A 1 7   ASN 7   7   7   ASN ASN A . n 
A 1 8   TYR 8   8   8   TYR TYR A . n 
A 1 9   ASN 9   9   9   ASN ASN A . n 
A 1 10  GLU 10  10  10  GLU GLU A . n 
A 1 11  SER 11  11  11  SER SER A . n 
A 1 12  LEU 12  12  12  LEU LEU A . n 
A 1 13  ASN 13  13  13  ASN ASN A . n 
A 1 14  LYS 14  14  14  LYS LYS A . n 
A 1 15  SER 15  15  15  SER SER A . n 
A 1 16  LYS 16  16  16  LYS LYS A . n 
A 1 17  ASP 17  17  17  ASP ASP A . n 
A 1 18  ALA 18  18  18  ALA ALA A . n 
A 1 19  ILE 19  19  19  ILE ILE A . n 
A 1 20  ASP 20  20  20  ASP ASP A . n 
A 1 21  ASP 21  21  21  ASP ASP A . n 
A 1 22  LYS 22  22  22  LYS LYS A . n 
A 1 23  THR 23  23  23  THR THR A . n 
A 1 24  TRP 24  24  24  TRP TRP A . n 
A 1 25  SER 25  25  25  SER SER A . n 
A 1 26  LYS 26  26  26  LYS LYS A . n 
A 1 27  LEU 27  27  27  LEU LEU A . n 
A 1 28  PHE 28  28  28  PHE PHE A . n 
A 1 29  PRO 29  29  29  PRO PRO A . n 
A 1 30  SER 30  30  30  SER SER A . n 
A 1 31  ILE 31  31  31  ILE ILE A . n 
A 1 32  VAL 32  32  32  VAL VAL A . n 
A 1 33  SER 33  33  33  SER SER A . n 
A 1 34  ASP 34  34  34  ASP ASP A . n 
A 1 35  PRO 35  35  35  PRO PRO A . n 
A 1 36  ASP 36  36  36  ASP ASP A . n 
A 1 37  ARG 37  37  37  ARG ARG A . n 
A 1 38  SER 38  38  38  SER SER A . n 
A 1 39  SER 39  39  39  SER SER A . n 
A 1 40  ASN 40  40  40  ASN ASN A . n 
A 1 41  PHE 41  41  41  PHE PHE A . n 
A 1 42  MET 42  42  42  MET MET A . n 
A 1 43  ILE 43  43  43  ILE ILE A . n 
A 1 44  ARG 44  44  44  ARG ARG A . n 
A 1 45  ALA 45  45  45  ALA ALA A . n 
A 1 46  ILE 46  46  46  ILE ILE A . n 
A 1 47  TYR 47  47  47  TYR TYR A . n 
A 1 48  VAL 48  48  48  VAL VAL A . n 
A 1 49  VAL 49  49  49  VAL VAL A . n 
A 1 50  PHE 50  50  50  PHE PHE A . n 
A 1 51  SER 51  51  51  SER SER A . n 
A 1 52  ALA 52  52  52  ALA ALA A . n 
A 1 53  VAL 53  53  53  VAL VAL A . n 
A 1 54  LEU 54  54  54  LEU LEU A . n 
A 1 55  ARG 55  55  55  ARG ARG A . n 
A 1 56  GLN 56  56  56  GLN GLN A . n 
A 1 57  ARG 57  57  57  ARG ARG A . n 
A 1 58  ASN 58  58  58  ASN ASN A . n 
A 1 59  ILE 59  59  59  ILE ILE A . n 
A 1 60  LEU 60  60  60  LEU LEU A . n 
A 1 61  GLU 61  61  61  GLU GLU A . n 
A 1 62  LYS 62  62  62  LYS LYS A . n 
A 1 63  GLU 63  63  63  GLU GLU A . n 
A 1 64  TYR 64  64  64  TYR TYR A . n 
A 1 65  PHE 65  65  65  PHE PHE A . n 
A 1 66  SER 66  66  66  SER SER A . n 
A 1 67  LYS 67  67  67  LYS LYS A . n 
A 1 68  ASN 68  68  68  ASN ASN A . n 
A 1 69  TYR 69  69  69  TYR TYR A . n 
A 1 70  ILE 70  70  70  ILE ILE A . n 
A 1 71  THR 71  71  71  THR THR A . n 
A 1 72  GLU 72  72  72  GLU GLU A . n 
A 1 73  ASN 73  73  73  ASN ASN A . n 
A 1 74  LEU 74  74  74  LEU LEU A . n 
A 1 75  SER 75  75  75  SER SER A . n 
A 1 76  CYS 76  76  76  CYS CYS A . n 
A 1 77  MET 77  77  77  MET MET A . n 
A 1 78  THR 78  78  78  THR THR A . n 
A 1 79  LEU 79  79  79  LEU LEU A . n 
A 1 80  SER 80  80  80  SER SER A . n 
A 1 81  PHE 81  81  81  PHE PHE A . n 
A 1 82  LYS 82  82  82  LYS LYS A . n 
A 1 83  ASN 83  83  83  ASN ASN A . n 
A 1 84  LEU 84  84  84  LEU LEU A . n 
A 1 85  ARG 85  85  85  ARG ARG A . n 
A 1 86  ALA 86  86  86  ALA ALA A . n 
A 1 87  HIS 87  87  87  HIS HIS A . n 
A 1 88  GLN 88  88  88  GLN GLN A . n 
A 1 89  ILE 89  89  89  ILE ILE A . n 
A 1 90  ALA 90  90  90  ALA ALA A . n 
A 1 91  GLN 91  91  91  GLN GLN A . n 
A 1 92  LEU 92  92  92  LEU LEU A . n 
A 1 93  LEU 93  93  93  LEU LEU A . n 
A 1 94  ARG 94  94  94  ARG ARG A . n 
A 1 95  ALA 95  95  95  ALA ALA A . n 
A 1 96  ALA 96  96  96  ALA ALA A . n 
A 1 97  GLY 97  97  97  GLY GLY A . n 
A 1 98  ASP 98  98  98  ASP ASP A . n 
A 1 99  ALA 99  99  99  ALA ALA A . n 
A 1 100 THR 100 100 100 THR THR A . n 
A 1 101 LYS 101 101 101 LYS LYS A . n 
A 1 102 ASP 102 102 102 ASP ASP A . n 
A 1 103 GLY 103 103 103 GLY GLY A . n 
A 1 104 PHE 104 104 104 PHE PHE A . n 
A 1 105 LEU 105 105 105 LEU LEU A . n 
A 1 106 LYS 106 106 106 LYS LYS A . n 
A 1 107 GLU 107 107 107 GLU GLU A . n 
A 1 108 ILE 108 108 108 ILE ILE A . n 
A 1 109 SER 109 109 109 SER SER A . n 
A 1 110 LEU 110 110 110 LEU LEU A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 VAL 112 112 112 VAL VAL A . n 
A 1 113 THR 113 113 113 THR THR A . n 
A 1 114 GLU 114 114 114 GLU GLU A . n 
A 1 115 HIS 115 115 115 HIS HIS A . n 
A 1 116 ASP 116 116 116 ASP ASP A . n 
A 1 117 GLY 117 117 117 GLY GLY A . n 
A 1 118 ASP 118 118 118 ASP ASP A . n 
A 1 119 VAL 119 119 119 VAL VAL A . n 
A 1 120 GLU 120 120 120 GLU GLU A . n 
A 1 121 ALA 121 121 121 ALA ALA A . n 
A 1 122 ILE 122 122 122 ILE ILE A . n 
A 1 123 GLU 123 123 123 GLU GLU A . n 
A 1 124 VAL 124 124 124 VAL VAL A . n 
A 1 125 PHE 125 125 125 PHE PHE A . n 
A 1 126 SER 126 126 126 SER SER A . n 
A 1 127 MET 127 127 127 MET MET A . n 
A 1 128 LYS 128 128 128 LYS LYS A . n 
A 1 129 PHE 129 129 129 PHE PHE A . n 
A 1 130 ILE 130 130 130 ILE ILE A . n 
A 1 131 TYR 131 131 131 TYR TYR A . n 
A 1 132 PHE 132 132 132 PHE PHE A . n 
A 1 133 GLU 133 133 133 GLU GLU A . n 
A 1 134 ASN 134 134 134 ASN ASN A . n 
A 1 135 GLY 135 135 135 GLY GLY A . n 
A 1 136 GLY 136 136 136 GLY GLY A . n 
A 1 137 VAL 137 137 137 VAL VAL A . n 
A 1 138 VAL 138 138 138 VAL VAL A . n 
A 1 139 ALA 139 139 139 ALA ALA A . n 
A 1 140 ARG 140 140 140 ARG ARG A . n 
A 1 141 LEU 141 141 141 LEU LEU A . n 
A 1 142 SER 142 142 ?   ?   ?   A . n 
A 1 143 THR 143 143 ?   ?   ?   A . n 
A 1 144 ASP 144 144 ?   ?   ?   A . n 
A 1 145 ASN 145 145 ?   ?   ?   A . n 
A 1 146 ASN 146 146 ?   ?   ?   A . n 
A 1 147 ASP 147 147 ?   ?   ?   A . n 
A 1 148 GLN 148 148 ?   ?   ?   A . n 
A 1 149 GLU 149 149 149 GLU GLU A . n 
A 1 150 ASP 150 150 150 ASP ASP A . n 
A 1 151 PRO 151 151 151 PRO PRO A . n 
A 1 152 HIS 152 152 152 HIS HIS A . n 
A 1 153 PHE 153 153 153 PHE PHE A . n 
A 1 154 ALA 154 154 154 ALA ALA A . n 
A 1 155 GLU 155 155 155 GLU GLU A . n 
A 1 156 LEU 156 156 156 LEU LEU A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 GLN 158 158 158 GLN GLN A . n 
A 1 159 LEU 159 159 159 LEU LEU A . n 
A 1 160 ARG 160 160 160 ARG ARG A . n 
A 1 161 TYR 161 161 161 TYR TYR A . n 
A 1 162 GLU 162 162 162 GLU GLU A . n 
A 1 163 GLY 163 163 163 GLY GLY A . n 
A 1 164 ALA 164 164 164 ALA ALA A . n 
A 1 165 GLU 165 165 165 GLU GLU A . n 
A 1 166 SER 166 166 166 SER SER A . n 
A 1 167 VAL 167 167 167 VAL VAL A . n 
A 1 168 ARG 168 168 168 ARG ARG A . n 
A 1 169 ASP 169 169 169 ASP ASP A . n 
A 1 170 GLN 170 170 170 GLN GLN A . n 
A 1 171 MET 171 171 171 MET MET A . n 
A 1 172 VAL 172 172 172 VAL VAL A . n 
A 1 173 THR 173 173 173 THR THR A . n 
A 1 174 ILE 174 174 174 ILE ILE A . n 
A 1 175 VAL 175 175 175 VAL VAL A . n 
A 1 176 ARG 176 176 176 ARG ARG A . n 
A 1 177 SER 177 177 177 SER SER A . n 
A 1 178 VAL 178 178 178 VAL VAL A . n 
A 1 179 GLN 179 179 179 GLN GLN A . n 
A 1 180 PHE 180 180 180 PHE PHE A . n 
A 1 181 LEU 181 181 181 LEU LEU A . n 
A 1 182 CYS 182 182 182 CYS CYS A . n 
A 1 183 THR 183 183 183 THR THR A . n 
A 1 184 LYS 184 184 184 LYS LYS A . n 
A 1 185 VAL 185 185 185 VAL VAL A . n 
A 1 186 LEU 186 186 186 LEU LEU A . n 
A 1 187 GLU 187 187 187 GLU GLU A . n 
A 1 188 PRO 188 188 188 PRO PRO A . n 
A 1 189 LEU 189 189 189 LEU LEU A . n 
A 1 190 PRO 190 190 190 PRO PRO A . n 
A 1 191 ALA 191 191 191 ALA ALA A . n 
A 1 192 GLU 192 192 192 GLU GLU A . n 
A 1 193 PHE 193 193 193 PHE PHE A . n 
A 1 194 THR 194 194 194 THR THR A . n 
A 1 195 ALA 195 195 195 ALA ALA A . n 
A 1 196 ASN 196 196 196 ASN ASN A . n 
A 1 197 PHE 197 197 197 PHE PHE A . n 
A 1 198 ARG 198 198 198 ARG ARG A . n 
A 1 199 LEU 199 199 199 LEU LEU A . n 
A 1 200 LYS 200 200 200 LYS LYS A . n 
A 1 201 TYR 201 201 201 TYR TYR A . n 
A 1 202 THR 202 202 202 THR THR A . n 
A 1 203 ASN 203 203 203 ASN ASN A . n 
A 1 204 ASP 204 204 204 ASP ASP A . n 
A 1 205 ALA 205 205 205 ALA ALA A . n 
A 1 206 PRO 206 206 206 PRO PRO A . n 
A 1 207 SER 207 207 207 SER SER A . n 
A 1 208 ASN 208 208 208 ASN ASN A . n 
A 1 209 PHE 209 209 209 PHE PHE A . n 
A 1 210 ARG 210 210 210 ARG ARG A . n 
A 1 211 ILE 211 211 211 ILE ILE A . n 
A 1 212 ASP 212 212 212 ASP ASP A . n 
A 1 213 GLY 213 213 213 GLY GLY A . n 
A 1 214 PHE 214 214 214 PHE PHE A . n 
A 1 215 ASP 215 215 215 ASP ASP A . n 
A 1 216 ASP 216 216 216 ASP ASP A . n 
A 1 217 SER 217 217 217 SER SER A . n 
A 1 218 SER 218 218 218 SER SER A . n 
A 1 219 THR 219 219 219 THR THR A . n 
A 1 220 PHE 220 220 220 PHE PHE A . n 
A 1 221 TYR 221 221 221 TYR TYR A . n 
A 1 222 THR 222 222 222 THR THR A . n 
A 1 223 LEU 223 223 223 LEU LEU A . n 
A 1 224 PRO 224 224 224 PRO PRO A . n 
A 1 225 ASP 225 225 225 ASP ASP A . n 
A 1 226 GLY 226 226 226 GLY GLY A . n 
A 1 227 ILE 227 227 227 ILE ILE A . n 
A 1 228 GLN 228 228 228 GLN GLN A . n 
A 1 229 SER 229 229 229 SER SER A . n 
A 1 230 VAL 230 230 230 VAL VAL A . n 
A 1 231 THR 231 231 231 THR THR A . n 
A 1 232 ILE 232 232 232 ILE ILE A . n 
A 1 233 GLY 233 233 233 GLY GLY A . n 
A 1 234 HIS 234 234 234 HIS HIS A . n 
A 1 235 LEU 235 235 235 LEU LEU A . n 
A 1 236 ARG 236 236 236 ARG ARG A . n 
A 1 237 PRO 237 237 237 PRO PRO A . n 
A 1 238 GLY 238 238 238 GLY GLY A . n 
A 1 239 HIS 239 239 239 HIS HIS A . n 
A 1 240 HIS 240 240 240 HIS HIS A . n 
A 1 241 ALA 241 241 241 ALA ALA A . n 
A 1 242 ALA 242 242 242 ALA ALA A . n 
A 1 243 HIS 243 243 243 HIS HIS A . n 
A 1 244 MET 244 244 244 MET MET A . n 
A 1 245 GLN 245 245 245 GLN GLN A . n 
A 1 246 CYS 246 246 246 CYS CYS A . n 
A 1 247 TRP 247 247 247 TRP TRP A . n 
A 1 248 SER 248 248 248 SER SER A . n 
A 1 249 LYS 249 249 249 LYS LYS A . n 
A 1 250 SER 250 250 250 SER SER A . n 
A 1 251 MET 251 251 251 MET MET A . n 
A 1 252 SER 252 252 ?   ?   ?   A . n 
A 1 253 ASP 253 253 ?   ?   ?   A . n 
B 1 1   MET 1   1   ?   ?   ?   B . n 
B 1 2   ALA 2   2   ?   ?   ?   B . n 
B 1 3   PRO 3   3   ?   ?   ?   B . n 
B 1 4   LEU 4   4   ?   ?   ?   B . n 
B 1 5   GLU 5   5   ?   ?   ?   B . n 
B 1 6   ASN 6   6   ?   ?   ?   B . n 
B 1 7   ASN 7   7   ?   ?   ?   B . n 
B 1 8   TYR 8   8   ?   ?   ?   B . n 
B 1 9   ASN 9   9   ?   ?   ?   B . n 
B 1 10  GLU 10  10  ?   ?   ?   B . n 
B 1 11  SER 11  11  ?   ?   ?   B . n 
B 1 12  LEU 12  12  ?   ?   ?   B . n 
B 1 13  ASN 13  13  ?   ?   ?   B . n 
B 1 14  LYS 14  14  ?   ?   ?   B . n 
B 1 15  SER 15  15  ?   ?   ?   B . n 
B 1 16  LYS 16  16  16  LYS LYS B . n 
B 1 17  ASP 17  17  17  ASP ASP B . n 
B 1 18  ALA 18  18  18  ALA ALA B . n 
B 1 19  ILE 19  19  19  ILE ILE B . n 
B 1 20  ASP 20  20  20  ASP ASP B . n 
B 1 21  ASP 21  21  21  ASP ASP B . n 
B 1 22  LYS 22  22  22  LYS LYS B . n 
B 1 23  THR 23  23  23  THR THR B . n 
B 1 24  TRP 24  24  24  TRP TRP B . n 
B 1 25  SER 25  25  25  SER SER B . n 
B 1 26  LYS 26  26  26  LYS LYS B . n 
B 1 27  LEU 27  27  27  LEU LEU B . n 
B 1 28  PHE 28  28  28  PHE PHE B . n 
B 1 29  PRO 29  29  29  PRO PRO B . n 
B 1 30  SER 30  30  30  SER SER B . n 
B 1 31  ILE 31  31  31  ILE ILE B . n 
B 1 32  VAL 32  32  32  VAL VAL B . n 
B 1 33  SER 33  33  33  SER SER B . n 
B 1 34  ASP 34  34  34  ASP ASP B . n 
B 1 35  PRO 35  35  35  PRO PRO B . n 
B 1 36  ASP 36  36  36  ASP ASP B . n 
B 1 37  ARG 37  37  37  ARG ARG B . n 
B 1 38  SER 38  38  38  SER SER B . n 
B 1 39  SER 39  39  39  SER SER B . n 
B 1 40  ASN 40  40  40  ASN ASN B . n 
B 1 41  PHE 41  41  41  PHE PHE B . n 
B 1 42  MET 42  42  42  MET MET B . n 
B 1 43  ILE 43  43  43  ILE ILE B . n 
B 1 44  ARG 44  44  44  ARG ARG B . n 
B 1 45  ALA 45  45  45  ALA ALA B . n 
B 1 46  ILE 46  46  46  ILE ILE B . n 
B 1 47  TYR 47  47  47  TYR TYR B . n 
B 1 48  VAL 48  48  48  VAL VAL B . n 
B 1 49  VAL 49  49  49  VAL VAL B . n 
B 1 50  PHE 50  50  50  PHE PHE B . n 
B 1 51  SER 51  51  51  SER SER B . n 
B 1 52  ALA 52  52  52  ALA ALA B . n 
B 1 53  VAL 53  53  53  VAL VAL B . n 
B 1 54  LEU 54  54  54  LEU LEU B . n 
B 1 55  ARG 55  55  55  ARG ARG B . n 
B 1 56  GLN 56  56  56  GLN GLN B . n 
B 1 57  ARG 57  57  57  ARG ARG B . n 
B 1 58  ASN 58  58  58  ASN ASN B . n 
B 1 59  ILE 59  59  59  ILE ILE B . n 
B 1 60  LEU 60  60  60  LEU LEU B . n 
B 1 61  GLU 61  61  61  GLU GLU B . n 
B 1 62  LYS 62  62  62  LYS LYS B . n 
B 1 63  GLU 63  63  63  GLU GLU B . n 
B 1 64  TYR 64  64  64  TYR TYR B . n 
B 1 65  PHE 65  65  65  PHE PHE B . n 
B 1 66  SER 66  66  66  SER SER B . n 
B 1 67  LYS 67  67  67  LYS LYS B . n 
B 1 68  ASN 68  68  68  ASN ASN B . n 
B 1 69  TYR 69  69  69  TYR TYR B . n 
B 1 70  ILE 70  70  70  ILE ILE B . n 
B 1 71  THR 71  71  71  THR THR B . n 
B 1 72  GLU 72  72  72  GLU GLU B . n 
B 1 73  ASN 73  73  73  ASN ASN B . n 
B 1 74  LEU 74  74  74  LEU LEU B . n 
B 1 75  SER 75  75  75  SER SER B . n 
B 1 76  CYS 76  76  76  CYS CYS B . n 
B 1 77  MET 77  77  77  MET MET B . n 
B 1 78  THR 78  78  78  THR THR B . n 
B 1 79  LEU 79  79  79  LEU LEU B . n 
B 1 80  SER 80  80  80  SER SER B . n 
B 1 81  PHE 81  81  81  PHE PHE B . n 
B 1 82  LYS 82  82  82  LYS LYS B . n 
B 1 83  ASN 83  83  83  ASN ASN B . n 
B 1 84  LEU 84  84  84  LEU LEU B . n 
B 1 85  ARG 85  85  85  ARG ARG B . n 
B 1 86  ALA 86  86  86  ALA ALA B . n 
B 1 87  HIS 87  87  87  HIS HIS B . n 
B 1 88  GLN 88  88  88  GLN GLN B . n 
B 1 89  ILE 89  89  89  ILE ILE B . n 
B 1 90  ALA 90  90  90  ALA ALA B . n 
B 1 91  GLN 91  91  91  GLN GLN B . n 
B 1 92  LEU 92  92  92  LEU LEU B . n 
B 1 93  LEU 93  93  93  LEU LEU B . n 
B 1 94  ARG 94  94  94  ARG ARG B . n 
B 1 95  ALA 95  95  95  ALA ALA B . n 
B 1 96  ALA 96  96  96  ALA ALA B . n 
B 1 97  GLY 97  97  97  GLY GLY B . n 
B 1 98  ASP 98  98  98  ASP ASP B . n 
B 1 99  ALA 99  99  99  ALA ALA B . n 
B 1 100 THR 100 100 100 THR THR B . n 
B 1 101 LYS 101 101 101 LYS LYS B . n 
B 1 102 ASP 102 102 102 ASP ASP B . n 
B 1 103 GLY 103 103 103 GLY GLY B . n 
B 1 104 PHE 104 104 104 PHE PHE B . n 
B 1 105 LEU 105 105 105 LEU LEU B . n 
B 1 106 LYS 106 106 106 LYS LYS B . n 
B 1 107 GLU 107 107 107 GLU GLU B . n 
B 1 108 ILE 108 108 108 ILE ILE B . n 
B 1 109 SER 109 109 109 SER SER B . n 
B 1 110 LEU 110 110 110 LEU LEU B . n 
B 1 111 VAL 111 111 111 VAL VAL B . n 
B 1 112 VAL 112 112 112 VAL VAL B . n 
B 1 113 THR 113 113 113 THR THR B . n 
B 1 114 GLU 114 114 114 GLU GLU B . n 
B 1 115 HIS 115 115 115 HIS HIS B . n 
B 1 116 ASP 116 116 116 ASP ASP B . n 
B 1 117 GLY 117 117 117 GLY GLY B . n 
B 1 118 ASP 118 118 118 ASP ASP B . n 
B 1 119 VAL 119 119 119 VAL VAL B . n 
B 1 120 GLU 120 120 120 GLU GLU B . n 
B 1 121 ALA 121 121 121 ALA ALA B . n 
B 1 122 ILE 122 122 122 ILE ILE B . n 
B 1 123 GLU 123 123 123 GLU GLU B . n 
B 1 124 VAL 124 124 124 VAL VAL B . n 
B 1 125 PHE 125 125 125 PHE PHE B . n 
B 1 126 SER 126 126 126 SER SER B . n 
B 1 127 MET 127 127 127 MET MET B . n 
B 1 128 LYS 128 128 128 LYS LYS B . n 
B 1 129 PHE 129 129 129 PHE PHE B . n 
B 1 130 ILE 130 130 130 ILE ILE B . n 
B 1 131 TYR 131 131 131 TYR TYR B . n 
B 1 132 PHE 132 132 132 PHE PHE B . n 
B 1 133 GLU 133 133 133 GLU GLU B . n 
B 1 134 ASN 134 134 134 ASN ASN B . n 
B 1 135 GLY 135 135 135 GLY GLY B . n 
B 1 136 GLY 136 136 136 GLY GLY B . n 
B 1 137 VAL 137 137 137 VAL VAL B . n 
B 1 138 VAL 138 138 138 VAL VAL B . n 
B 1 139 ALA 139 139 139 ALA ALA B . n 
B 1 140 ARG 140 140 140 ARG ARG B . n 
B 1 141 LEU 141 141 141 LEU LEU B . n 
B 1 142 SER 142 142 ?   ?   ?   B . n 
B 1 143 THR 143 143 ?   ?   ?   B . n 
B 1 144 ASP 144 144 ?   ?   ?   B . n 
B 1 145 ASN 145 145 ?   ?   ?   B . n 
B 1 146 ASN 146 146 ?   ?   ?   B . n 
B 1 147 ASP 147 147 ?   ?   ?   B . n 
B 1 148 GLN 148 148 ?   ?   ?   B . n 
B 1 149 GLU 149 149 ?   ?   ?   B . n 
B 1 150 ASP 150 150 ?   ?   ?   B . n 
B 1 151 PRO 151 151 151 PRO PRO B . n 
B 1 152 HIS 152 152 152 HIS HIS B . n 
B 1 153 PHE 153 153 153 PHE PHE B . n 
B 1 154 ALA 154 154 154 ALA ALA B . n 
B 1 155 GLU 155 155 155 GLU GLU B . n 
B 1 156 LEU 156 156 156 LEU LEU B . n 
B 1 157 ALA 157 157 157 ALA ALA B . n 
B 1 158 GLN 158 158 158 GLN GLN B . n 
B 1 159 LEU 159 159 159 LEU LEU B . n 
B 1 160 ARG 160 160 160 ARG ARG B . n 
B 1 161 TYR 161 161 161 TYR TYR B . n 
B 1 162 GLU 162 162 162 GLU GLU B . n 
B 1 163 GLY 163 163 163 GLY GLY B . n 
B 1 164 ALA 164 164 164 ALA ALA B . n 
B 1 165 GLU 165 165 165 GLU GLU B . n 
B 1 166 SER 166 166 166 SER SER B . n 
B 1 167 VAL 167 167 167 VAL VAL B . n 
B 1 168 ARG 168 168 168 ARG ARG B . n 
B 1 169 ASP 169 169 169 ASP ASP B . n 
B 1 170 GLN 170 170 170 GLN GLN B . n 
B 1 171 MET 171 171 171 MET MET B . n 
B 1 172 VAL 172 172 172 VAL VAL B . n 
B 1 173 THR 173 173 173 THR THR B . n 
B 1 174 ILE 174 174 174 ILE ILE B . n 
B 1 175 VAL 175 175 175 VAL VAL B . n 
B 1 176 ARG 176 176 176 ARG ARG B . n 
B 1 177 SER 177 177 177 SER SER B . n 
B 1 178 VAL 178 178 178 VAL VAL B . n 
B 1 179 GLN 179 179 179 GLN GLN B . n 
B 1 180 PHE 180 180 180 PHE PHE B . n 
B 1 181 LEU 181 181 181 LEU LEU B . n 
B 1 182 CYS 182 182 182 CYS CYS B . n 
B 1 183 THR 183 183 183 THR THR B . n 
B 1 184 LYS 184 184 184 LYS LYS B . n 
B 1 185 VAL 185 185 185 VAL VAL B . n 
B 1 186 LEU 186 186 186 LEU LEU B . n 
B 1 187 GLU 187 187 187 GLU GLU B . n 
B 1 188 PRO 188 188 188 PRO PRO B . n 
B 1 189 LEU 189 189 189 LEU LEU B . n 
B 1 190 PRO 190 190 190 PRO PRO B . n 
B 1 191 ALA 191 191 191 ALA ALA B . n 
B 1 192 GLU 192 192 192 GLU GLU B . n 
B 1 193 PHE 193 193 193 PHE PHE B . n 
B 1 194 THR 194 194 194 THR THR B . n 
B 1 195 ALA 195 195 195 ALA ALA B . n 
B 1 196 ASN 196 196 196 ASN ASN B . n 
B 1 197 PHE 197 197 197 PHE PHE B . n 
B 1 198 ARG 198 198 198 ARG ARG B . n 
B 1 199 LEU 199 199 199 LEU LEU B . n 
B 1 200 LYS 200 200 200 LYS LYS B . n 
B 1 201 TYR 201 201 201 TYR TYR B . n 
B 1 202 THR 202 202 202 THR THR B . n 
B 1 203 ASN 203 203 203 ASN ASN B . n 
B 1 204 ASP 204 204 204 ASP ASP B . n 
B 1 205 ALA 205 205 205 ALA ALA B . n 
B 1 206 PRO 206 206 206 PRO PRO B . n 
B 1 207 SER 207 207 207 SER SER B . n 
B 1 208 ASN 208 208 208 ASN ASN B . n 
B 1 209 PHE 209 209 209 PHE PHE B . n 
B 1 210 ARG 210 210 210 ARG ARG B . n 
B 1 211 ILE 211 211 211 ILE ILE B . n 
B 1 212 ASP 212 212 212 ASP ASP B . n 
B 1 213 GLY 213 213 213 GLY GLY B . n 
B 1 214 PHE 214 214 214 PHE PHE B . n 
B 1 215 ASP 215 215 215 ASP ASP B . n 
B 1 216 ASP 216 216 216 ASP ASP B . n 
B 1 217 SER 217 217 217 SER SER B . n 
B 1 218 SER 218 218 218 SER SER B . n 
B 1 219 THR 219 219 219 THR THR B . n 
B 1 220 PHE 220 220 220 PHE PHE B . n 
B 1 221 TYR 221 221 221 TYR TYR B . n 
B 1 222 THR 222 222 222 THR THR B . n 
B 1 223 LEU 223 223 223 LEU LEU B . n 
B 1 224 PRO 224 224 224 PRO PRO B . n 
B 1 225 ASP 225 225 225 ASP ASP B . n 
B 1 226 GLY 226 226 226 GLY GLY B . n 
B 1 227 ILE 227 227 227 ILE ILE B . n 
B 1 228 GLN 228 228 228 GLN GLN B . n 
B 1 229 SER 229 229 229 SER SER B . n 
B 1 230 VAL 230 230 230 VAL VAL B . n 
B 1 231 THR 231 231 231 THR THR B . n 
B 1 232 ILE 232 232 232 ILE ILE B . n 
B 1 233 GLY 233 233 233 GLY GLY B . n 
B 1 234 HIS 234 234 234 HIS HIS B . n 
B 1 235 LEU 235 235 235 LEU LEU B . n 
B 1 236 ARG 236 236 236 ARG ARG B . n 
B 1 237 PRO 237 237 237 PRO PRO B . n 
B 1 238 GLY 238 238 238 GLY GLY B . n 
B 1 239 HIS 239 239 239 HIS HIS B . n 
B 1 240 HIS 240 240 240 HIS HIS B . n 
B 1 241 ALA 241 241 241 ALA ALA B . n 
B 1 242 ALA 242 242 242 ALA ALA B . n 
B 1 243 HIS 243 243 243 HIS HIS B . n 
B 1 244 MET 244 244 244 MET MET B . n 
B 1 245 GLN 245 245 245 GLN GLN B . n 
B 1 246 CYS 246 246 246 CYS CYS B . n 
B 1 247 TRP 247 247 247 TRP TRP B . n 
B 1 248 SER 248 248 248 SER SER B . n 
B 1 249 LYS 249 249 249 LYS LYS B . n 
B 1 250 SER 250 250 250 SER SER B . n 
B 1 251 MET 251 251 251 MET MET B . n 
B 1 252 SER 252 252 ?   ?   ?   B . n 
B 1 253 ASP 253 253 ?   ?   ?   B . n 
C 2 1   THR 1   486 ?   ?   ?   C . n 
C 2 2   ALA 2   487 487 ALA ALA C . n 
C 2 3   ARG 3   488 488 ARG ARG C . n 
C 2 4   TYR 4   489 489 TYR TYR C . n 
C 2 5   GLY 5   490 490 GLY GLY C . n 
C 2 6   VAL 6   491 491 VAL VAL C . n 
C 2 7   SER 7   492 492 SER SER C . n 
C 2 8   ASN 8   493 493 ASN ASN C . n 
C 2 9   THR 9   494 494 THR THR C . n 
C 2 10  SER 10  495 495 SER SER C . n 
C 2 11  ILE 11  496 496 ILE ILE C . n 
C 2 12  ASN 12  497 497 ASN ASN C . n 
C 2 13  ARG 13  498 498 ARG ARG C . n 
C 2 14  LYS 14  499 499 LYS LYS C . n 
C 2 15  LYS 15  500 ?   ?   ?   C . n 
C 2 16  PRO 16  501 ?   ?   ?   C . n 
D 2 1   THR 1   486 ?   ?   ?   D . n 
D 2 2   ALA 2   487 487 ALA ALA D . n 
D 2 3   ARG 3   488 488 ARG ARG D . n 
D 2 4   TYR 4   489 489 TYR TYR D . n 
D 2 5   GLY 5   490 490 GLY GLY D . n 
D 2 6   VAL 6   491 491 VAL VAL D . n 
D 2 7   SER 7   492 492 SER SER D . n 
D 2 8   ASN 8   493 493 ASN ASN D . n 
D 2 9   THR 9   494 494 THR THR D . n 
D 2 10  SER 10  495 495 SER SER D . n 
D 2 11  ILE 11  496 496 ILE ILE D . n 
D 2 12  ASN 12  497 497 ASN ASN D . n 
D 2 13  ARG 13  498 498 ARG ARG D . n 
D 2 14  LYS 14  499 499 LYS LYS D . n 
D 2 15  LYS 15  500 500 LYS LYS D . n 
D 2 16  PRO 16  501 ?   ?   ?   D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 HOH 1  301 32 HOH HOH A . 
E 3 HOH 2  302 16 HOH HOH A . 
E 3 HOH 3  303 17 HOH HOH A . 
E 3 HOH 4  304 1  HOH HOH A . 
E 3 HOH 5  305 2  HOH HOH A . 
E 3 HOH 6  306 3  HOH HOH A . 
E 3 HOH 7  307 6  HOH HOH A . 
E 3 HOH 8  308 7  HOH HOH A . 
E 3 HOH 9  309 8  HOH HOH A . 
E 3 HOH 10 310 9  HOH HOH A . 
E 3 HOH 11 311 12 HOH HOH A . 
E 3 HOH 12 312 13 HOH HOH A . 
E 3 HOH 13 313 22 HOH HOH A . 
E 3 HOH 14 314 24 HOH HOH A . 
E 3 HOH 15 315 25 HOH HOH A . 
E 3 HOH 16 316 26 HOH HOH A . 
E 3 HOH 17 317 27 HOH HOH A . 
E 3 HOH 18 318 28 HOH HOH A . 
E 3 HOH 19 319 29 HOH HOH A . 
E 3 HOH 20 320 30 HOH HOH A . 
E 3 HOH 21 321 31 HOH HOH A . 
E 3 HOH 22 322 35 HOH HOH A . 
E 3 HOH 23 323 36 HOH HOH A . 
E 3 HOH 24 324 37 HOH HOH A . 
E 3 HOH 25 325 38 HOH HOH A . 
E 3 HOH 26 326 40 HOH HOH A . 
E 3 HOH 27 327 44 HOH HOH A . 
E 3 HOH 28 328 45 HOH HOH A . 
E 3 HOH 29 329 46 HOH HOH A . 
E 3 HOH 30 330 47 HOH HOH A . 
E 3 HOH 31 331 48 HOH HOH A . 
E 3 HOH 32 332 49 HOH HOH A . 
E 3 HOH 33 333 50 HOH HOH A . 
F 3 HOH 1  301 21 HOH HOH B . 
F 3 HOH 2  302 15 HOH HOH B . 
F 3 HOH 3  303 39 HOH HOH B . 
F 3 HOH 4  304 23 HOH HOH B . 
F 3 HOH 5  305 4  HOH HOH B . 
F 3 HOH 6  306 5  HOH HOH B . 
F 3 HOH 7  307 10 HOH HOH B . 
F 3 HOH 8  308 11 HOH HOH B . 
F 3 HOH 9  309 14 HOH HOH B . 
F 3 HOH 10 310 20 HOH HOH B . 
F 3 HOH 11 311 33 HOH HOH B . 
F 3 HOH 12 312 34 HOH HOH B . 
F 3 HOH 13 313 42 HOH HOH B . 
F 3 HOH 14 314 43 HOH HOH B . 
F 3 HOH 15 315 51 HOH HOH B . 
F 3 HOH 16 316 54 HOH HOH B . 
F 3 HOH 17 317 55 HOH HOH B . 
F 3 HOH 18 318 56 HOH HOH B . 
G 3 HOH 1  601 53 HOH HOH C . 
H 3 HOH 1  601 41 HOH HOH D . 
H 3 HOH 2  602 52 HOH HOH D . 
H 3 HOH 3  603 18 HOH HOH D . 
H 3 HOH 4  604 19 HOH HOH D . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric 2 
2 author_and_software_defined_assembly PISA dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,E,G 
2 1 B,D,F,H 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2100  ? 
1 MORE         -2    ? 
1 'SSA (A^2)'  12810 ? 
2 'ABSA (A^2)' 2140  ? 
2 MORE         -3    ? 
2 'SSA (A^2)'  11670 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2014-11-19 
2 'Structure model' 1 1 2014-12-17 
3 'Structure model' 1 2 2017-09-20 
4 'Structure model' 1 3 2019-12-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'        
2 3 'Structure model' 'Author supporting evidence' 
3 3 'Structure model' 'Derived calculations'       
4 3 'Structure model' 'Source and taxonomy'        
5 3 'Structure model' 'Structure summary'          
6 4 'Structure model' 'Author supporting evidence' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' entity_src_gen        
2 3 'Structure model' pdbx_audit_support    
3 3 'Structure model' pdbx_struct_oper_list 
4 3 'Structure model' struct_keywords       
5 4 'Structure model' pdbx_audit_support    
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_entity_src_gen.pdbx_alt_source_flag'      
2 3 'Structure model' '_pdbx_audit_support.funding_organization'  
3 3 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 
4 3 'Structure model' '_struct_keywords.pdbx_keywords'            
5 4 'Structure model' '_pdbx_audit_support.funding_organization'  
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[1][1]_esd 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][2]_esd 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[1][3]_esd 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[2][2]_esd 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.T[2][3]_esd 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[3][3]_esd 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[1][1]_esd 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][2]_esd 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[1][3]_esd 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[2][2]_esd 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.L[2][3]_esd 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[3][3]_esd 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][1]_esd 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][2]_esd 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[1][3]_esd 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][1]_esd 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][2]_esd 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][3]_esd 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][1]_esd 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][2]_esd 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[3][3]_esd 
1 'X-RAY DIFFRACTION' ? refined -139.7754 74.1011 133.7168 0.3356 ? -0.0220 ? -0.0503 ? 0.2661 ? -0.0095 ? 0.2611 ? 1.9180 ? 
-0.1875 ? -0.1303 ? 4.3245 ? -0.2867 ? 4.2708 ? 0.0518 ? 0.0059 ? -0.0723 ? 0.7894  ? -0.1360 ? -0.0669 ? -0.3152 ? 0.1167  ? 
0.0607 ? 
2 'X-RAY DIFFRACTION' ? refined -126.4008 50.0598 99.9496  0.3241 ? -0.0345 ? 0.0683  ? 0.3026 ? -0.0094 ? 0.3592 ? 2.8455 ? 
-1.2863 ? -0.4687 ? 5.4617 ? 1.6841  ? 3.6691 ? 0.1493 ? 0.0273 ? -0.2011 ? -0.6832 ? -0.3360 ? -0.2223 ? 0.0104  ? -0.2493 ? 
0.1285 ? 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? ? ? ? ? 
;chain 'A' or chain 'C'
;
2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? ? ? ? ? 
;chain 'B' or chain 'D'
;
# 
_software.citation_id            ? 
_software.classification         refinement 
_software.compiler_name          ? 
_software.compiler_version       ? 
_software.contact_author         ? 
_software.contact_author_email   ? 
_software.date                   ? 
_software.description            ? 
_software.dependencies           ? 
_software.hardware               ? 
_software.language               ? 
_software.location               ? 
_software.mods                   ? 
_software.name                   PHENIX 
_software.os                     ? 
_software.os_version             ? 
_software.type                   ? 
_software.version                '(phenix.refine: 1.9_1692)' 
_software.pdbx_ordinal           1 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 17  ? ? -67.28  81.36   
2 1 ASN A 134 ? ? 53.56   71.41   
3 1 PHE A 220 ? ? -98.61  -111.46 
4 1 PRO A 237 ? ? -74.85  -166.57 
5 1 ASP B 20  ? ? -103.48 64.25   
6 1 PHE B 220 ? ? -100.29 -101.82 
7 1 PRO B 237 ? ? -74.97  -168.68 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A ALA 2   ? A ALA 2   
3  1 Y 1 A PRO 3   ? A PRO 3   
4  1 Y 1 A LEU 4   ? A LEU 4   
5  1 Y 1 A GLU 5   ? A GLU 5   
6  1 Y 1 A SER 142 ? A SER 142 
7  1 Y 1 A THR 143 ? A THR 143 
8  1 Y 1 A ASP 144 ? A ASP 144 
9  1 Y 1 A ASN 145 ? A ASN 145 
10 1 Y 1 A ASN 146 ? A ASN 146 
11 1 Y 1 A ASP 147 ? A ASP 147 
12 1 Y 1 A GLN 148 ? A GLN 148 
13 1 Y 1 A SER 252 ? A SER 252 
14 1 Y 1 A ASP 253 ? A ASP 253 
15 1 Y 1 B MET 1   ? B MET 1   
16 1 Y 1 B ALA 2   ? B ALA 2   
17 1 Y 1 B PRO 3   ? B PRO 3   
18 1 Y 1 B LEU 4   ? B LEU 4   
19 1 Y 1 B GLU 5   ? B GLU 5   
20 1 Y 1 B ASN 6   ? B ASN 6   
21 1 Y 1 B ASN 7   ? B ASN 7   
22 1 Y 1 B TYR 8   ? B TYR 8   
23 1 Y 1 B ASN 9   ? B ASN 9   
24 1 Y 1 B GLU 10  ? B GLU 10  
25 1 Y 1 B SER 11  ? B SER 11  
26 1 Y 1 B LEU 12  ? B LEU 12  
27 1 Y 1 B ASN 13  ? B ASN 13  
28 1 Y 1 B LYS 14  ? B LYS 14  
29 1 Y 1 B SER 15  ? B SER 15  
30 1 Y 1 B SER 142 ? B SER 142 
31 1 Y 1 B THR 143 ? B THR 143 
32 1 Y 1 B ASP 144 ? B ASP 144 
33 1 Y 1 B ASN 145 ? B ASN 145 
34 1 Y 1 B ASN 146 ? B ASN 146 
35 1 Y 1 B ASP 147 ? B ASP 147 
36 1 Y 1 B GLN 148 ? B GLN 148 
37 1 Y 1 B GLU 149 ? B GLU 149 
38 1 Y 1 B ASP 150 ? B ASP 150 
39 1 Y 1 B SER 252 ? B SER 252 
40 1 Y 1 B ASP 253 ? B ASP 253 
41 1 Y 1 C THR 486 ? C THR 1   
42 1 Y 1 C LYS 500 ? C LYS 15  
43 1 Y 1 C PRO 501 ? C PRO 16  
44 1 Y 1 D THR 486 ? D THR 1   
45 1 Y 1 D PRO 501 ? D PRO 16  
# 
_pdbx_audit_support.funding_organization   
'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 
_pdbx_audit_support.country                'United States' 
_pdbx_audit_support.grant_number           R01GM104141 
_pdbx_audit_support.ordinal                1 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#