data_4TZQ
# 
_entry.id   4TZQ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4TZQ         
WWPDB D_1000202564 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB 'C. elegans HIM-3 wild type'                      4TRK unspecified 
PDB 'C. elegans HIM-3 bound to HTP-3 closure motif-4' 4TZJ unspecified 
PDB 'C. elegans HTP-2 bound to HIM-3 closure motif'   4TZL unspecified 
PDB 'C. elegans HTP-2 bound to HTP-3 closure motif-1' 4TZM unspecified 
PDB 'C. elegans HTP-2 bound to HTP-3 closure motif-6' 4TZN unspecified 
PDB 'C. elegans HTP-1 bound to HIM-3 closure motif'   4TZO unspecified 
PDB .                                                 4TZS unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4TZQ 
_pdbx_database_status.recvd_initial_deposition_date   2014-07-10 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Rosenberg, S.C.' 1 
'Corbett, K.D.'   2 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Dev.Cell 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1534-5807 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            31 
_citation.language                  ? 
_citation.page_first                487 
_citation.page_last                 502 
_citation.title                     
'The Chromosome Axis Controls Meiotic Events through a Hierarchical Assembly of HORMA Domain Proteins.' 
_citation.year                      2014 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.devcel.2014.09.013 
_citation.pdbx_database_id_PubMed   25446517 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Kim, Y.'         1 ? 
primary 'Rosenberg, S.C.' 2 ? 
primary 'Kugel, C.L.'     3 ? 
primary 'Kostow, N.'      4 ? 
primary 'Rog, O.'         5 ? 
primary 'Davydov, V.'     6 ? 
primary 'Su, T.Y.'        7 ? 
primary 'Dernburg, A.F.'  8 ? 
primary 'Corbett, K.D.'   9 ? 
# 
_cell.entry_id           4TZQ 
_cell.length_a           53.073 
_cell.length_b           66.400 
_cell.length_c           84.130 
_cell.angle_alpha        90.00 
_cell.angle_beta         105.58 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4TZQ 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Protein HTP-1' 28742.455 2   ? P84L 'UNP residues 1-253'   ? 
2 polymer man 'Protein HTP-3' 1883.116  2   ? ?    'UNP residues 485-501' ? 
3 water   nat water           18.015    196 ? ?    ?                      ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MAPLETIYDESLNKSADSIDDKKWSKLFPRIVSDPDRSSNFMTRAIYVAFSAVLRNRNILGQEYFTKNYITEKLKCMTLC
FRNLRSNQIAQLLRNAGDATKDGFLKEVSLVITNNEGDLEAIEVFSMKFIYFENGGVVARLSTDKNGQEDPHFAKLAQLV
YEGGDSVRDQMVTIVRSVQFLCTKVLEPLPEEFTANFRLEYTNDAPSNFRIDGFEDSSTFYTLPDDIQSATIGHLRPGCH
AANMECWSMLMSD
;
;MAPLETIYDESLNKSADSIDDKKWSKLFPRIVSDPDRSSNFMTRAIYVAFSAVLRNRNILGQEYFTKNYITEKLKCMTLC
FRNLRSNQIAQLLRNAGDATKDGFLKEVSLVITNNEGDLEAIEVFSMKFIYFENGGVVARLSTDKNGQEDPHFAKLAQLV
YEGGDSVRDQMVTIVRSVQFLCTKVLEPLPEEFTANFRLEYTNDAPSNFRIDGFEDSSTFYTLPDDIQSATIGHLRPGCH
AANMECWSMLMSD
;
A,C ? 
2 'polypeptide(L)' no no STARYGVSNTSINRKKP STARYGVSNTSINRKKP B,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   PRO n 
1 4   LEU n 
1 5   GLU n 
1 6   THR n 
1 7   ILE n 
1 8   TYR n 
1 9   ASP n 
1 10  GLU n 
1 11  SER n 
1 12  LEU n 
1 13  ASN n 
1 14  LYS n 
1 15  SER n 
1 16  ALA n 
1 17  ASP n 
1 18  SER n 
1 19  ILE n 
1 20  ASP n 
1 21  ASP n 
1 22  LYS n 
1 23  LYS n 
1 24  TRP n 
1 25  SER n 
1 26  LYS n 
1 27  LEU n 
1 28  PHE n 
1 29  PRO n 
1 30  ARG n 
1 31  ILE n 
1 32  VAL n 
1 33  SER n 
1 34  ASP n 
1 35  PRO n 
1 36  ASP n 
1 37  ARG n 
1 38  SER n 
1 39  SER n 
1 40  ASN n 
1 41  PHE n 
1 42  MET n 
1 43  THR n 
1 44  ARG n 
1 45  ALA n 
1 46  ILE n 
1 47  TYR n 
1 48  VAL n 
1 49  ALA n 
1 50  PHE n 
1 51  SER n 
1 52  ALA n 
1 53  VAL n 
1 54  LEU n 
1 55  ARG n 
1 56  ASN n 
1 57  ARG n 
1 58  ASN n 
1 59  ILE n 
1 60  LEU n 
1 61  GLY n 
1 62  GLN n 
1 63  GLU n 
1 64  TYR n 
1 65  PHE n 
1 66  THR n 
1 67  LYS n 
1 68  ASN n 
1 69  TYR n 
1 70  ILE n 
1 71  THR n 
1 72  GLU n 
1 73  LYS n 
1 74  LEU n 
1 75  LYS n 
1 76  CYS n 
1 77  MET n 
1 78  THR n 
1 79  LEU n 
1 80  CYS n 
1 81  PHE n 
1 82  ARG n 
1 83  ASN n 
1 84  LEU n 
1 85  ARG n 
1 86  SER n 
1 87  ASN n 
1 88  GLN n 
1 89  ILE n 
1 90  ALA n 
1 91  GLN n 
1 92  LEU n 
1 93  LEU n 
1 94  ARG n 
1 95  ASN n 
1 96  ALA n 
1 97  GLY n 
1 98  ASP n 
1 99  ALA n 
1 100 THR n 
1 101 LYS n 
1 102 ASP n 
1 103 GLY n 
1 104 PHE n 
1 105 LEU n 
1 106 LYS n 
1 107 GLU n 
1 108 VAL n 
1 109 SER n 
1 110 LEU n 
1 111 VAL n 
1 112 ILE n 
1 113 THR n 
1 114 ASN n 
1 115 ASN n 
1 116 GLU n 
1 117 GLY n 
1 118 ASP n 
1 119 LEU n 
1 120 GLU n 
1 121 ALA n 
1 122 ILE n 
1 123 GLU n 
1 124 VAL n 
1 125 PHE n 
1 126 SER n 
1 127 MET n 
1 128 LYS n 
1 129 PHE n 
1 130 ILE n 
1 131 TYR n 
1 132 PHE n 
1 133 GLU n 
1 134 ASN n 
1 135 GLY n 
1 136 GLY n 
1 137 VAL n 
1 138 VAL n 
1 139 ALA n 
1 140 ARG n 
1 141 LEU n 
1 142 SER n 
1 143 THR n 
1 144 ASP n 
1 145 LYS n 
1 146 ASN n 
1 147 GLY n 
1 148 GLN n 
1 149 GLU n 
1 150 ASP n 
1 151 PRO n 
1 152 HIS n 
1 153 PHE n 
1 154 ALA n 
1 155 LYS n 
1 156 LEU n 
1 157 ALA n 
1 158 GLN n 
1 159 LEU n 
1 160 VAL n 
1 161 TYR n 
1 162 GLU n 
1 163 GLY n 
1 164 GLY n 
1 165 ASP n 
1 166 SER n 
1 167 VAL n 
1 168 ARG n 
1 169 ASP n 
1 170 GLN n 
1 171 MET n 
1 172 VAL n 
1 173 THR n 
1 174 ILE n 
1 175 VAL n 
1 176 ARG n 
1 177 SER n 
1 178 VAL n 
1 179 GLN n 
1 180 PHE n 
1 181 LEU n 
1 182 CYS n 
1 183 THR n 
1 184 LYS n 
1 185 VAL n 
1 186 LEU n 
1 187 GLU n 
1 188 PRO n 
1 189 LEU n 
1 190 PRO n 
1 191 GLU n 
1 192 GLU n 
1 193 PHE n 
1 194 THR n 
1 195 ALA n 
1 196 ASN n 
1 197 PHE n 
1 198 ARG n 
1 199 LEU n 
1 200 GLU n 
1 201 TYR n 
1 202 THR n 
1 203 ASN n 
1 204 ASP n 
1 205 ALA n 
1 206 PRO n 
1 207 SER n 
1 208 ASN n 
1 209 PHE n 
1 210 ARG n 
1 211 ILE n 
1 212 ASP n 
1 213 GLY n 
1 214 PHE n 
1 215 GLU n 
1 216 ASP n 
1 217 SER n 
1 218 SER n 
1 219 THR n 
1 220 PHE n 
1 221 TYR n 
1 222 THR n 
1 223 LEU n 
1 224 PRO n 
1 225 ASP n 
1 226 ASP n 
1 227 ILE n 
1 228 GLN n 
1 229 SER n 
1 230 ALA n 
1 231 THR n 
1 232 ILE n 
1 233 GLY n 
1 234 HIS n 
1 235 LEU n 
1 236 ARG n 
1 237 PRO n 
1 238 GLY n 
1 239 CYS n 
1 240 HIS n 
1 241 ALA n 
1 242 ALA n 
1 243 ASN n 
1 244 MET n 
1 245 GLU n 
1 246 CYS n 
1 247 TRP n 
1 248 SER n 
1 249 MET n 
1 250 LEU n 
1 251 MET n 
1 252 SER n 
1 253 ASP n 
2 1   SER n 
2 2   THR n 
2 3   ALA n 
2 4   ARG n 
2 5   TYR n 
2 6   GLY n 
2 7   VAL n 
2 8   SER n 
2 9   ASN n 
2 10  THR n 
2 11  SER n 
2 12  ILE n 
2 13  ASN n 
2 14  ARG n 
2 15  LYS n 
2 16  LYS n 
2 17  PRO n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 253 ? ? 'htp-1, CELE_F41H10.10, F41H10.10' ? ? ? ? ? ? 'Caenorhabditis elegans' 6239 ? ? ? ? ? 
? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 'Rosetta 2 pLysS' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 17  ? ? 'htp-3, CELE_F57C9.5, F57C9.5'     ? ? ? ? ? ? 'Caenorhabditis elegans' 6239 ? ? ? ? ? 
? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 'Rosetta 2 pLysS' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP Q20305_CAEEL Q20305 1 
;MAPLETIYDESLNKSADSIDDKKWSKLFPRIVSDPDRSSNFMTRAIYVAFSAVLRNRNILGQEYFTKNYITEKLKCMTLC
FRNPRSNQIAQLLRNAGDATKDGFLKEVSLVITNNEGDLEAIEVFSMKFIYFENGGVVARLSTDKNGQEDPHFAKLAQLV
YEGGDSVRDQMVTIVRSVQFLCTKVLEPLPEEFTANFRLEYTNDAPSNFRIDGFEDSSTFYTLPDDIQSATIGHLRPGCH
AANMECWSMLMSD
;
1   ? 
2 UNP O01820_CAEEL O01820 2 STARYGVSNTSINRKKP 485 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4TZQ A 1 ? 253 ? Q20305 1   ? 253 ? 1   253 
2 2 4TZQ B 1 ? 17  ? O01820 485 ? 501 ? 485 501 
3 1 4TZQ C 1 ? 253 ? Q20305 1   ? 253 ? 1   253 
4 2 4TZQ D 1 ? 17  ? O01820 485 ? 501 ? 485 501 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4TZQ LEU A 84 ? UNP Q20305 PRO 84 'engineered mutation' 84 1 
3 4TZQ LEU C 84 ? UNP Q20305 PRO 84 'engineered mutation' 84 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4TZQ 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.33 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         47.24 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            298.15 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '15-22% PEG 3350' 
_exptl_crystal_grow.pdbx_pH_range   '7.5 - 8.0' 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315r' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2013-12-05 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   .979 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SSRL BEAMLINE BL7-1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        .979 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL7-1 
_diffrn_source.pdbx_synchrotron_site       SSRL 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         4TZQ 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.3 
_reflns.d_resolution_low                 50 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       24480 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             97.3 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.6 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  0.073 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            14.2 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 4TZQ 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.300 
_refine.ls_d_res_low                             38.792 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     24368 
_refine.ls_number_reflns_R_free                  1163 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    96.74 
_refine.ls_percent_reflns_R_free                 4.77 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2430 
_refine.ls_R_factor_R_free                       0.2793 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2411 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.57 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4TZO 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 28.53 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.28 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3956 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             196 
_refine_hist.number_atoms_total               4152 
_refine_hist.d_res_high                       2.300 
_refine_hist.d_res_low                        38.792 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.003  ? 4030 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.768  ? 5439 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 15.358 ? 1496 ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.032  ? 601  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.003  ? 711  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
'X-RAY DIFFRACTION' 2.30   2.4050  . . 140 2850 96.00  . . . 0.2885 . 0.2422 . . . . . . . . 
'X-RAY DIFFRACTION' 2.4050 2.5318  . . 135 2855 95.00  . . . 0.3524 . 0.2774 . . . . . . . . 
'X-RAY DIFFRACTION' 2.5318 2.6904  . . 156 2812 95.00  . . . 0.3311 . 0.3095 . . . . . . . . 
'X-RAY DIFFRACTION' 2.6904 2.8981  . . 127 2965 99.00  . . . 0.3195 . 0.2708 . . . . . . . . 
'X-RAY DIFFRACTION' 2.8981 3.1896  . . 153 2976 100.00 . . . 0.2859 . 0.2590 . . . . . . . . 
'X-RAY DIFFRACTION' 3.1896 3.6508  . . 132 2840 95.00  . . . 0.2904 . 0.2527 . . . . . . . . 
'X-RAY DIFFRACTION' 3.6508 4.5985  . . 136 2865 95.00  . . . 0.2504 . 0.2091 . . . . . . . . 
'X-RAY DIFFRACTION' 4.5985 38.7978 . . 184 3042 100.00 . . . 0.2320 . 0.1943 . . . . . . . . 
# 
_struct.entry_id                     4TZQ 
_struct.title                        'Structure of C. elegans HTP-1 bound to HTP-3 motif-1' 
_struct.pdbx_descriptor              'Protein HTP-1, Protein HTP-3' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4TZQ 
_struct_keywords.text            'HORMA domain, Meiosis, Chromosome axis, Peptide BINDING PROTEIN' 
_struct_keywords.pdbx_keywords   'PEPTIDE BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 LYS A 23  ? PHE A 28  ? LYS A 23  PHE A 28  1 ? 6  
HELX_P HELX_P2  AA2 ASP A 34  ? ARG A 57  ? ASP A 34  ARG A 57  1 ? 24 
HELX_P HELX_P3  AA3 GLY A 61  ? GLU A 63  ? GLY A 61  GLU A 63  5 ? 3  
HELX_P HELX_P4  AA4 ASN A 83  ? ALA A 99  ? ASN A 83  ALA A 99  1 ? 17 
HELX_P HELX_P5  AA5 HIS A 152 ? LEU A 159 ? HIS A 152 LEU A 159 1 ? 8  
HELX_P HELX_P6  AA6 GLY A 163 ? VAL A 185 ? GLY A 163 VAL A 185 1 ? 23 
HELX_P HELX_P7  AA7 LYS C 23  ? PHE C 28  ? LYS C 23  PHE C 28  1 ? 6  
HELX_P HELX_P8  AA8 ASP C 34  ? ARG C 57  ? ASP C 34  ARG C 57  1 ? 24 
HELX_P HELX_P9  AA9 GLY C 61  ? GLU C 63  ? GLY C 61  GLU C 63  5 ? 3  
HELX_P HELX_P10 AB1 ASN C 83  ? ALA C 99  ? ASN C 83  ALA C 99  1 ? 17 
HELX_P HELX_P11 AB2 HIS C 152 ? LEU C 159 ? HIS C 152 LEU C 159 1 ? 8  
HELX_P HELX_P12 AB3 GLY C 163 ? LYS C 184 ? GLY C 163 LYS C 184 1 ? 22 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          ASP 
_struct_mon_prot_cis.label_seq_id           144 
_struct_mon_prot_cis.label_asym_id          C 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           ASP 
_struct_mon_prot_cis.auth_seq_id            144 
_struct_mon_prot_cis.auth_asym_id           C 
_struct_mon_prot_cis.pdbx_label_comp_id_2   LYS 
_struct_mon_prot_cis.pdbx_label_seq_id_2    145 
_struct_mon_prot_cis.pdbx_label_asym_id_2   C 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    LYS 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     145 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    C 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       27.37 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 7 ? 
AA3 ? 2 ? 
AA4 ? 7 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA2 5 6 ? anti-parallel 
AA2 6 7 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA4 4 5 ? anti-parallel 
AA4 5 6 ? anti-parallel 
AA4 6 7 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 PHE A 65  ? TYR A 69  ? PHE A 65  TYR A 69  
AA1 2 LYS A 75  ? LEU A 79  ? LYS A 75  LEU A 79  
AA2 1 PHE A 214 ? SER A 217 ? PHE A 214 SER A 217 
AA2 2 TYR B 5   ? ARG B 14  ? TYR B 489 ARG B 498 
AA2 3 PHE A 193 ? TYR A 201 ? PHE A 193 TYR A 201 
AA2 4 LEU A 105 ? THR A 113 ? LEU A 105 THR A 113 
AA2 5 GLU A 123 ? TYR A 131 ? GLU A 123 TYR A 131 
AA2 6 HIS A 240 ? SER A 248 ? HIS A 240 SER A 248 
AA2 7 GLN A 228 ? LEU A 235 ? GLN A 228 LEU A 235 
AA3 1 PHE C 65  ? TYR C 69  ? PHE C 65  TYR C 69  
AA3 2 LYS C 75  ? LEU C 79  ? LYS C 75  LEU C 79  
AA4 1 PHE C 214 ? SER C 217 ? PHE C 214 SER C 217 
AA4 2 TYR D 5   ? ARG D 14  ? TYR D 489 ARG D 498 
AA4 3 PHE C 193 ? TYR C 201 ? PHE C 193 TYR C 201 
AA4 4 LEU C 105 ? THR C 113 ? LEU C 105 THR C 113 
AA4 5 GLU C 123 ? TYR C 131 ? GLU C 123 TYR C 131 
AA4 6 HIS C 240 ? SER C 248 ? HIS C 240 SER C 248 
AA4 7 GLN C 228 ? LEU C 235 ? GLN C 228 LEU C 235 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N THR A 66  ? N THR A 66  O THR A 78  ? O THR A 78  
AA2 1 2 N GLU A 215 ? N GLU A 215 O VAL B 7   ? O VAL B 491 
AA2 2 3 O ILE B 12  ? O ILE B 496 N ALA A 195 ? N ALA A 195 
AA2 3 4 O ASN A 196 ? O ASN A 196 N VAL A 111 ? N VAL A 111 
AA2 4 5 N LYS A 106 ? N LYS A 106 O PHE A 129 ? O PHE A 129 
AA2 5 6 N VAL A 124 ? N VAL A 124 O TRP A 247 ? O TRP A 247 
AA2 6 7 O MET A 244 ? O MET A 244 N GLY A 233 ? N GLY A 233 
AA3 1 2 N ASN C 68  ? N ASN C 68  O CYS C 76  ? O CYS C 76  
AA4 1 2 N GLU C 215 ? N GLU C 215 O VAL D 7   ? O VAL D 491 
AA4 2 3 O ILE D 12  ? O ILE D 496 N ALA C 195 ? N ALA C 195 
AA4 3 4 O ASN C 196 ? O ASN C 196 N VAL C 111 ? N VAL C 111 
AA4 4 5 N LYS C 106 ? N LYS C 106 O PHE C 129 ? O PHE C 129 
AA4 5 6 N VAL C 124 ? N VAL C 124 O TRP C 247 ? O TRP C 247 
AA4 6 7 O MET C 244 ? O MET C 244 N GLY C 233 ? N GLY C 233 
# 
_atom_sites.entry_id                    4TZQ 
_atom_sites.fract_transf_matrix[1][1]   0.018842 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.005253 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015060 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012340 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASP A 1 17  ? -73.804 63.806  -120.059 1.00 41.03 ? 17  ASP A N   1 
ATOM   2    C CA  . ASP A 1 17  ? -72.504 63.813  -120.720 1.00 42.40 ? 17  ASP A CA  1 
ATOM   3    C C   . ASP A 1 17  ? -71.872 65.201  -120.662 1.00 47.99 ? 17  ASP A C   1 
ATOM   4    O O   . ASP A 1 17  ? -71.877 65.942  -121.647 1.00 47.87 ? 17  ASP A O   1 
ATOM   5    C CB  . ASP A 1 17  ? -72.635 63.347  -122.174 1.00 40.09 ? 17  ASP A CB  1 
ATOM   6    C CG  . ASP A 1 17  ? -71.296 63.285  -122.896 1.00 39.56 ? 17  ASP A CG  1 
ATOM   7    O OD1 . ASP A 1 17  ? -70.257 63.104  -122.225 1.00 38.70 ? 17  ASP A OD1 1 
ATOM   8    O OD2 . ASP A 1 17  ? -71.285 63.416  -124.138 1.00 35.51 ? 17  ASP A OD2 1 
ATOM   9    N N   . SER A 1 18  ? -71.337 65.547  -119.496 1.00 48.70 ? 18  SER A N   1 
ATOM   10   C CA  . SER A 1 18  ? -70.630 66.808  -119.316 1.00 43.64 ? 18  SER A CA  1 
ATOM   11   C C   . SER A 1 18  ? -69.491 66.624  -118.323 1.00 44.08 ? 18  SER A C   1 
ATOM   12   O O   . SER A 1 18  ? -69.520 65.714  -117.495 1.00 49.85 ? 18  SER A O   1 
ATOM   13   C CB  . SER A 1 18  ? -71.582 67.904  -118.836 1.00 40.35 ? 18  SER A CB  1 
ATOM   14   O OG  . SER A 1 18  ? -72.097 67.604  -117.552 1.00 44.76 ? 18  SER A OG  1 
ATOM   15   N N   . ILE A 1 19  ? -68.485 67.487  -118.411 1.00 38.92 ? 19  ILE A N   1 
ATOM   16   C CA  . ILE A 1 19  ? -67.347 67.416  -117.505 1.00 35.23 ? 19  ILE A CA  1 
ATOM   17   C C   . ILE A 1 19  ? -67.563 68.360  -116.327 1.00 38.75 ? 19  ILE A C   1 
ATOM   18   O O   . ILE A 1 19  ? -67.516 69.582  -116.475 1.00 42.08 ? 19  ILE A O   1 
ATOM   19   C CB  . ILE A 1 19  ? -66.038 67.750  -118.230 1.00 31.42 ? 19  ILE A CB  1 
ATOM   20   C CG1 . ILE A 1 19  ? -65.856 66.804  -119.421 1.00 32.96 ? 19  ILE A CG1 1 
ATOM   21   C CG2 . ILE A 1 19  ? -64.863 67.633  -117.275 1.00 28.14 ? 19  ILE A CG2 1 
ATOM   22   C CD1 . ILE A 1 19  ? -65.134 67.415  -120.600 1.00 30.98 ? 19  ILE A CD1 1 
ATOM   23   N N   . ASP A 1 20  ? -67.804 67.775  -115.158 1.00 37.76 ? 20  ASP A N   1 
ATOM   24   C CA  . ASP A 1 20  ? -68.231 68.528  -113.984 1.00 35.11 ? 20  ASP A CA  1 
ATOM   25   C C   . ASP A 1 20  ? -67.077 68.954  -113.079 1.00 32.24 ? 20  ASP A C   1 
ATOM   26   O O   . ASP A 1 20  ? -67.302 69.526  -112.013 1.00 36.63 ? 20  ASP A O   1 
ATOM   27   C CB  . ASP A 1 20  ? -69.236 67.701  -113.179 1.00 38.53 ? 20  ASP A CB  1 
ATOM   28   C CG  . ASP A 1 20  ? -70.447 67.297  -113.999 1.00 46.92 ? 20  ASP A CG  1 
ATOM   29   O OD1 . ASP A 1 20  ? -70.990 68.156  -114.726 1.00 49.35 ? 20  ASP A OD1 1 
ATOM   30   O OD2 . ASP A 1 20  ? -70.853 66.117  -113.920 1.00 51.49 ? 20  ASP A OD2 1 
ATOM   31   N N   . ASP A 1 21  ? -65.848 68.672  -113.499 1.00 29.83 ? 21  ASP A N   1 
ATOM   32   C CA  . ASP A 1 21  ? -64.675 69.086  -112.734 1.00 33.48 ? 21  ASP A CA  1 
ATOM   33   C C   . ASP A 1 21  ? -64.630 70.609  -112.620 1.00 37.55 ? 21  ASP A C   1 
ATOM   34   O O   . ASP A 1 21  ? -64.665 71.316  -113.629 1.00 35.26 ? 21  ASP A O   1 
ATOM   35   C CB  . ASP A 1 21  ? -63.392 68.560  -113.381 1.00 22.00 ? 21  ASP A CB  1 
ATOM   36   C CG  . ASP A 1 21  ? -62.157 68.847  -112.548 1.00 25.05 ? 21  ASP A CG  1 
ATOM   37   O OD1 . ASP A 1 21  ? -61.678 69.999  -112.571 1.00 26.89 ? 21  ASP A OD1 1 
ATOM   38   O OD2 . ASP A 1 21  ? -61.660 67.918  -111.877 1.00 24.40 ? 21  ASP A OD2 1 
ATOM   39   N N   . LYS A 1 22  ? -64.557 71.100  -111.385 1.00 41.22 ? 22  LYS A N   1 
ATOM   40   C CA  . LYS A 1 22  ? -64.602 72.535  -111.105 1.00 42.11 ? 22  LYS A CA  1 
ATOM   41   C C   . LYS A 1 22  ? -63.452 73.310  -111.740 1.00 39.87 ? 22  LYS A C   1 
ATOM   42   O O   . LYS A 1 22  ? -63.601 74.479  -112.091 1.00 44.28 ? 22  LYS A O   1 
ATOM   43   C CB  . LYS A 1 22  ? -64.606 72.778  -109.593 1.00 46.45 ? 22  LYS A CB  1 
ATOM   44   C CG  . LYS A 1 22  ? -65.983 73.043  -109.004 1.00 50.08 ? 22  LYS A CG  1 
ATOM   45   C CD  . LYS A 1 22  ? -66.925 71.869  -109.216 1.00 45.37 ? 22  LYS A CD  1 
ATOM   46   C CE  . LYS A 1 22  ? -68.328 72.197  -108.729 1.00 44.52 ? 22  LYS A CE  1 
ATOM   47   N NZ  . LYS A 1 22  ? -68.338 72.616  -107.299 1.00 43.93 ? 22  LYS A NZ  1 
ATOM   48   N N   . LYS A 1 23  ? -62.305 72.656  -111.880 1.00 34.94 ? 23  LYS A N   1 
ATOM   49   C CA  . LYS A 1 23  ? -61.128 73.297  -112.450 1.00 30.82 ? 23  LYS A CA  1 
ATOM   50   C C   . LYS A 1 23  ? -61.156 73.276  -113.974 1.00 26.18 ? 23  LYS A C   1 
ATOM   51   O O   . LYS A 1 23  ? -60.654 74.191  -114.629 1.00 20.92 ? 23  LYS A O   1 
ATOM   52   C CB  . LYS A 1 23  ? -59.859 72.612  -111.945 1.00 31.78 ? 23  LYS A CB  1 
ATOM   53   C CG  . LYS A 1 23  ? -59.696 72.637  -110.433 1.00 33.39 ? 23  LYS A CG  1 
ATOM   54   C CD  . LYS A 1 23  ? -59.589 74.058  -109.908 1.00 35.86 ? 23  LYS A CD  1 
ATOM   55   C CE  . LYS A 1 23  ? -59.373 74.069  -108.403 1.00 38.82 ? 23  LYS A CE  1 
ATOM   56   N NZ  . LYS A 1 23  ? -59.291 75.453  -107.861 1.00 41.89 ? 23  LYS A NZ  1 
ATOM   57   N N   . TRP A 1 24  ? -61.751 72.224  -114.525 1.00 25.89 ? 24  TRP A N   1 
ATOM   58   C CA  . TRP A 1 24  ? -61.784 71.996  -115.966 1.00 25.27 ? 24  TRP A CA  1 
ATOM   59   C C   . TRP A 1 24  ? -62.462 73.130  -116.734 1.00 28.81 ? 24  TRP A C   1 
ATOM   60   O O   . TRP A 1 24  ? -62.102 73.417  -117.877 1.00 30.82 ? 24  TRP A O   1 
ATOM   61   C CB  . TRP A 1 24  ? -62.493 70.669  -116.257 1.00 21.21 ? 24  TRP A CB  1 
ATOM   62   C CG  . TRP A 1 24  ? -62.598 70.314  -117.709 1.00 20.19 ? 24  TRP A CG  1 
ATOM   63   C CD1 . TRP A 1 24  ? -63.650 70.568  -118.543 1.00 23.71 ? 24  TRP A CD1 1 
ATOM   64   C CD2 . TRP A 1 24  ? -61.621 69.620  -118.498 1.00 17.61 ? 24  TRP A CD2 1 
ATOM   65   N NE1 . TRP A 1 24  ? -63.385 70.079  -119.800 1.00 21.51 ? 24  TRP A NE1 1 
ATOM   66   C CE2 . TRP A 1 24  ? -62.150 69.493  -119.796 1.00 17.49 ? 24  TRP A CE2 1 
ATOM   67   C CE3 . TRP A 1 24  ? -60.353 69.099  -118.227 1.00 16.74 ? 24  TRP A CE3 1 
ATOM   68   C CZ2 . TRP A 1 24  ? -61.447 68.869  -120.828 1.00 16.23 ? 24  TRP A CZ2 1 
ATOM   69   C CZ3 . TRP A 1 24  ? -59.660 68.478  -119.254 1.00 15.72 ? 24  TRP A CZ3 1 
ATOM   70   C CH2 . TRP A 1 24  ? -60.208 68.368  -120.535 1.00 15.48 ? 24  TRP A CH2 1 
ATOM   71   N N   . SER A 1 25  ? -63.429 73.781  -116.095 1.00 27.65 ? 25  SER A N   1 
ATOM   72   C CA  . SER A 1 25  ? -64.260 74.779  -116.766 1.00 31.99 ? 25  SER A CA  1 
ATOM   73   C C   . SER A 1 25  ? -63.515 76.065  -117.110 1.00 35.09 ? 25  SER A C   1 
ATOM   74   O O   . SER A 1 25  ? -63.945 76.816  -117.986 1.00 34.40 ? 25  SER A O   1 
ATOM   75   C CB  . SER A 1 25  ? -65.477 75.119  -115.902 1.00 35.41 ? 25  SER A CB  1 
ATOM   76   O OG  . SER A 1 25  ? -65.093 75.833  -114.741 1.00 36.65 ? 25  SER A OG  1 
ATOM   77   N N   . LYS A 1 26  ? -62.409 76.326  -116.420 1.00 37.27 ? 26  LYS A N   1 
ATOM   78   C CA  . LYS A 1 26  ? -61.657 77.557  -116.648 1.00 37.38 ? 26  LYS A CA  1 
ATOM   79   C C   . LYS A 1 26  ? -60.987 77.558  -118.015 1.00 31.73 ? 26  LYS A C   1 
ATOM   80   O O   . LYS A 1 26  ? -61.092 78.527  -118.767 1.00 34.31 ? 26  LYS A O   1 
ATOM   81   C CB  . LYS A 1 26  ? -60.602 77.766  -115.560 1.00 40.48 ? 26  LYS A CB  1 
ATOM   82   C CG  . LYS A 1 26  ? -59.768 79.023  -115.770 1.00 43.86 ? 26  LYS A CG  1 
ATOM   83   C CD  . LYS A 1 26  ? -58.780 79.248  -114.638 1.00 46.34 ? 26  LYS A CD  1 
ATOM   84   C CE  . LYS A 1 26  ? -57.975 80.522  -114.859 1.00 47.37 ? 26  LYS A CE  1 
ATOM   85   N NZ  . LYS A 1 26  ? -58.844 81.732  -114.912 1.00 49.80 ? 26  LYS A NZ  1 
ATOM   86   N N   . LEU A 1 27  ? -60.299 76.467  -118.330 1.00 27.77 ? 27  LEU A N   1 
ATOM   87   C CA  . LEU A 1 27  ? -59.559 76.372  -119.581 1.00 29.15 ? 27  LEU A CA  1 
ATOM   88   C C   . LEU A 1 27  ? -60.363 75.685  -120.680 1.00 28.30 ? 27  LEU A C   1 
ATOM   89   O O   . LEU A 1 27  ? -60.200 75.998  -121.856 1.00 34.47 ? 27  LEU A O   1 
ATOM   90   C CB  . LEU A 1 27  ? -58.240 75.626  -119.361 1.00 27.13 ? 27  LEU A CB  1 
ATOM   91   C CG  . LEU A 1 27  ? -57.166 76.345  -118.541 1.00 26.14 ? 27  LEU A CG  1 
ATOM   92   C CD1 . LEU A 1 27  ? -55.960 75.444  -118.327 1.00 26.14 ? 27  LEU A CD1 1 
ATOM   93   C CD2 . LEU A 1 27  ? -56.756 77.644  -119.217 1.00 23.22 ? 27  LEU A CD2 1 
ATOM   94   N N   . PHE A 1 28  ? -61.236 74.759  -120.298 1.00 21.18 ? 28  PHE A N   1 
ATOM   95   C CA  . PHE A 1 28  ? -61.905 73.909  -121.277 1.00 22.96 ? 28  PHE A CA  1 
ATOM   96   C C   . PHE A 1 28  ? -63.429 74.007  -121.249 1.00 23.67 ? 28  PHE A C   1 
ATOM   97   O O   . PHE A 1 28  ? -64.012 74.410  -120.244 1.00 24.27 ? 28  PHE A O   1 
ATOM   98   C CB  . PHE A 1 28  ? -61.489 72.453  -121.061 1.00 26.02 ? 28  PHE A CB  1 
ATOM   99   C CG  . PHE A 1 28  ? -60.014 72.226  -121.168 1.00 24.23 ? 28  PHE A CG  1 
ATOM   100  C CD1 . PHE A 1 28  ? -59.406 72.139  -122.406 1.00 23.39 ? 28  PHE A CD1 1 
ATOM   101  C CD2 . PHE A 1 28  ? -59.234 72.101  -120.030 1.00 22.66 ? 28  PHE A CD2 1 
ATOM   102  C CE1 . PHE A 1 28  ? -58.047 71.933  -122.510 1.00 22.96 ? 28  PHE A CE1 1 
ATOM   103  C CE2 . PHE A 1 28  ? -57.873 71.893  -120.127 1.00 23.07 ? 28  PHE A CE2 1 
ATOM   104  C CZ  . PHE A 1 28  ? -57.279 71.808  -121.369 1.00 24.44 ? 28  PHE A CZ  1 
ATOM   105  N N   . PRO A 1 29  ? -64.077 73.644  -122.369 1.00 24.67 ? 29  PRO A N   1 
ATOM   106  C CA  . PRO A 1 29  ? -65.537 73.518  -122.409 1.00 27.59 ? 29  PRO A CA  1 
ATOM   107  C C   . PRO A 1 29  ? -66.006 72.320  -121.590 1.00 26.65 ? 29  PRO A C   1 
ATOM   108  O O   . PRO A 1 29  ? -65.283 71.327  -121.500 1.00 27.84 ? 29  PRO A O   1 
ATOM   109  C CB  . PRO A 1 29  ? -65.840 73.313  -123.900 1.00 32.33 ? 29  PRO A CB  1 
ATOM   110  C CG  . PRO A 1 29  ? -64.605 73.760  -124.622 1.00 30.17 ? 29  PRO A CG  1 
ATOM   111  C CD  . PRO A 1 29  ? -63.473 73.455  -123.700 1.00 25.31 ? 29  PRO A CD  1 
ATOM   112  N N   . ARG A 1 30  ? -67.195 72.411  -121.003 1.00 24.59 ? 30  ARG A N   1 
ATOM   113  C CA  . ARG A 1 30  ? -67.717 71.324  -120.183 1.00 29.56 ? 30  ARG A CA  1 
ATOM   114  C C   . ARG A 1 30  ? -68.322 70.212  -121.036 1.00 33.09 ? 30  ARG A C   1 
ATOM   115  O O   . ARG A 1 30  ? -68.391 69.060  -120.609 1.00 38.06 ? 30  ARG A O   1 
ATOM   116  C CB  . ARG A 1 30  ? -68.762 71.848  -119.196 1.00 32.16 ? 30  ARG A CB  1 
ATOM   117  C CG  . ARG A 1 30  ? -68.234 72.880  -118.216 1.00 37.01 ? 30  ARG A CG  1 
ATOM   118  C CD  . ARG A 1 30  ? -69.268 73.194  -117.148 1.00 42.84 ? 30  ARG A CD  1 
ATOM   119  N NE  . ARG A 1 30  ? -69.114 74.547  -116.626 1.00 48.73 ? 30  ARG A NE  1 
ATOM   120  C CZ  . ARG A 1 30  ? -69.651 75.623  -117.190 1.00 52.38 ? 30  ARG A CZ  1 
ATOM   121  N NH1 . ARG A 1 30  ? -70.375 75.501  -118.294 1.00 53.69 ? 30  ARG A NH1 1 
ATOM   122  N NH2 . ARG A 1 30  ? -69.465 76.822  -116.653 1.00 53.43 ? 30  ARG A NH2 1 
ATOM   123  N N   . ILE A 1 31  ? -68.766 70.562  -122.238 1.00 31.70 ? 31  ILE A N   1 
ATOM   124  C CA  . ILE A 1 31  ? -69.337 69.584  -123.160 1.00 32.28 ? 31  ILE A CA  1 
ATOM   125  C C   . ILE A 1 31  ? -68.592 69.619  -124.491 1.00 21.76 ? 31  ILE A C   1 
ATOM   126  O O   . ILE A 1 31  ? -68.384 70.687  -125.062 1.00 21.67 ? 31  ILE A O   1 
ATOM   127  C CB  . ILE A 1 31  ? -70.840 69.837  -123.393 1.00 36.23 ? 31  ILE A CB  1 
ATOM   128  C CG1 . ILE A 1 31  ? -71.627 69.553  -122.113 1.00 25.86 ? 31  ILE A CG1 1 
ATOM   129  C CG2 . ILE A 1 31  ? -71.363 68.977  -124.534 1.00 35.96 ? 31  ILE A CG2 1 
ATOM   130  C CD1 . ILE A 1 31  ? -73.124 69.673  -122.277 1.00 30.03 ? 31  ILE A CD1 1 
ATOM   131  N N   . VAL A 1 32  ? -68.187 68.448  -124.976 1.00 21.11 ? 32  VAL A N   1 
ATOM   132  C CA  . VAL A 1 32  ? -67.347 68.364  -126.166 1.00 20.11 ? 32  VAL A CA  1 
ATOM   133  C C   . VAL A 1 32  ? -67.946 67.483  -127.264 1.00 26.81 ? 32  VAL A C   1 
ATOM   134  O O   . VAL A 1 32  ? -67.257 67.113  -128.215 1.00 26.77 ? 32  VAL A O   1 
ATOM   135  C CB  . VAL A 1 32  ? -65.948 67.825  -125.811 1.00 20.39 ? 32  VAL A CB  1 
ATOM   136  C CG1 . VAL A 1 32  ? -65.247 68.767  -124.846 1.00 20.92 ? 32  VAL A CG1 1 
ATOM   137  C CG2 . VAL A 1 32  ? -66.052 66.429  -125.212 1.00 18.87 ? 32  VAL A CG2 1 
ATOM   138  N N   . SER A 1 33  ? -69.229 67.159  -127.140 1.00 32.48 ? 33  SER A N   1 
ATOM   139  C CA  . SER A 1 33  ? -69.886 66.264  -128.089 1.00 35.57 ? 33  SER A CA  1 
ATOM   140  C C   . SER A 1 33  ? -70.187 66.938  -129.431 1.00 38.69 ? 33  SER A C   1 
ATOM   141  O O   . SER A 1 33  ? -69.808 66.429  -130.487 1.00 41.23 ? 33  SER A O   1 
ATOM   142  C CB  . SER A 1 33  ? -71.176 65.713  -127.479 1.00 34.48 ? 33  SER A CB  1 
ATOM   143  O OG  . SER A 1 33  ? -71.963 66.753  -126.928 1.00 37.46 ? 33  SER A OG  1 
ATOM   144  N N   . ASP A 1 34  ? -70.870 68.077  -129.381 1.00 39.14 ? 34  ASP A N   1 
ATOM   145  C CA  . ASP A 1 34  ? -71.215 68.841  -130.580 1.00 35.19 ? 34  ASP A CA  1 
ATOM   146  C C   . ASP A 1 34  ? -69.964 69.338  -131.312 1.00 28.72 ? 34  ASP A C   1 
ATOM   147  O O   . ASP A 1 34  ? -68.933 69.566  -130.682 1.00 30.88 ? 34  ASP A O   1 
ATOM   148  C CB  . ASP A 1 34  ? -72.113 70.019  -130.199 1.00 37.56 ? 34  ASP A CB  1 
ATOM   149  C CG  . ASP A 1 34  ? -71.450 70.956  -129.214 1.00 37.58 ? 34  ASP A CG  1 
ATOM   150  O OD1 . ASP A 1 34  ? -71.411 70.625  -128.010 1.00 37.22 ? 34  ASP A OD1 1 
ATOM   151  O OD2 . ASP A 1 34  ? -70.966 72.023  -129.645 1.00 39.49 ? 34  ASP A OD2 1 
ATOM   152  N N   . PRO A 1 35  ? -70.054 69.509  -132.645 1.00 25.18 ? 35  PRO A N   1 
ATOM   153  C CA  . PRO A 1 35  ? -68.906 69.874  -133.490 1.00 25.65 ? 35  PRO A CA  1 
ATOM   154  C C   . PRO A 1 35  ? -68.210 71.186  -133.121 1.00 28.71 ? 35  PRO A C   1 
ATOM   155  O O   . PRO A 1 35  ? -66.976 71.225  -133.100 1.00 27.34 ? 35  PRO A O   1 
ATOM   156  C CB  . PRO A 1 35  ? -69.526 69.987  -134.887 1.00 26.84 ? 35  PRO A CB  1 
ATOM   157  C CG  . PRO A 1 35  ? -70.709 69.101  -134.842 1.00 28.76 ? 35  PRO A CG  1 
ATOM   158  C CD  . PRO A 1 35  ? -71.258 69.249  -133.453 1.00 28.77 ? 35  PRO A CD  1 
ATOM   159  N N   . ASP A 1 36  ? -68.978 72.241  -132.864 1.00 29.92 ? 36  ASP A N   1 
ATOM   160  C CA  . ASP A 1 36  ? -68.405 73.535  -132.497 1.00 28.78 ? 36  ASP A CA  1 
ATOM   161  C C   . ASP A 1 36  ? -67.518 73.425  -131.256 1.00 26.15 ? 36  ASP A C   1 
ATOM   162  O O   . ASP A 1 36  ? -66.377 73.888  -131.254 1.00 27.25 ? 36  ASP A O   1 
ATOM   163  C CB  . ASP A 1 36  ? -69.511 74.570  -132.260 1.00 31.34 ? 36  ASP A CB  1 
ATOM   164  C CG  . ASP A 1 36  ? -70.195 74.999  -133.543 1.00 33.57 ? 36  ASP A CG  1 
ATOM   165  O OD1 . ASP A 1 36  ? -69.784 74.531  -134.624 1.00 35.24 ? 36  ASP A OD1 1 
ATOM   166  O OD2 . ASP A 1 36  ? -71.135 75.817  -133.465 1.00 34.56 ? 36  ASP A OD2 1 
ATOM   167  N N   . ARG A 1 37  ? -68.048 72.807  -130.206 1.00 25.41 ? 37  ARG A N   1 
ATOM   168  C CA  . ARG A 1 37  ? -67.317 72.667  -128.953 1.00 28.53 ? 37  ARG A CA  1 
ATOM   169  C C   . ARG A 1 37  ? -66.238 71.591  -129.048 1.00 27.38 ? 37  ARG A C   1 
ATOM   170  O O   . ARG A 1 37  ? -65.183 71.703  -128.420 1.00 21.64 ? 37  ARG A O   1 
ATOM   171  C CB  . ARG A 1 37  ? -68.285 72.358  -127.807 1.00 32.29 ? 37  ARG A CB  1 
ATOM   172  C CG  . ARG A 1 37  ? -69.160 73.537  -127.398 1.00 34.28 ? 37  ARG A CG  1 
ATOM   173  C CD  . ARG A 1 37  ? -69.936 73.247  -126.121 1.00 34.48 ? 37  ARG A CD  1 
ATOM   174  N NE  . ARG A 1 37  ? -71.093 72.388  -126.353 1.00 38.19 ? 37  ARG A NE  1 
ATOM   175  C CZ  . ARG A 1 37  ? -72.322 72.664  -125.924 1.00 40.68 ? 37  ARG A CZ  1 
ATOM   176  N NH1 . ARG A 1 37  ? -72.550 73.773  -125.232 1.00 44.00 ? 37  ARG A NH1 1 
ATOM   177  N NH2 . ARG A 1 37  ? -73.322 71.831  -126.181 1.00 36.16 ? 37  ARG A NH2 1 
ATOM   178  N N   . SER A 1 38  ? -66.507 70.553  -129.834 1.00 27.88 ? 38  SER A N   1 
ATOM   179  C CA  . SER A 1 38  ? -65.496 69.541  -130.131 1.00 26.20 ? 38  SER A CA  1 
ATOM   180  C C   . SER A 1 38  ? -64.259 70.186  -130.745 1.00 23.20 ? 38  SER A C   1 
ATOM   181  O O   . SER A 1 38  ? -63.128 69.858  -130.386 1.00 21.38 ? 38  SER A O   1 
ATOM   182  C CB  . SER A 1 38  ? -66.044 68.470  -131.080 1.00 28.64 ? 38  SER A CB  1 
ATOM   183  O OG  . SER A 1 38  ? -64.986 67.725  -131.657 1.00 31.66 ? 38  SER A OG  1 
ATOM   184  N N   . SER A 1 39  ? -64.485 71.111  -131.672 1.00 19.58 ? 39  SER A N   1 
ATOM   185  C CA  . SER A 1 39  ? -63.391 71.806  -132.338 1.00 19.49 ? 39  SER A CA  1 
ATOM   186  C C   . SER A 1 39  ? -62.700 72.787  -131.407 1.00 24.86 ? 39  SER A C   1 
ATOM   187  O O   . SER A 1 39  ? -61.474 72.891  -131.398 1.00 23.86 ? 39  SER A O   1 
ATOM   188  C CB  . SER A 1 39  ? -63.889 72.548  -133.575 1.00 19.36 ? 39  SER A CB  1 
ATOM   189  O OG  . SER A 1 39  ? -62.895 73.445  -134.035 1.00 23.20 ? 39  SER A OG  1 
ATOM   190  N N   . ASN A 1 40  ? -63.493 73.516  -130.632 1.00 30.91 ? 40  ASN A N   1 
ATOM   191  C CA  . ASN A 1 40  ? -62.935 74.499  -129.719 1.00 29.55 ? 40  ASN A CA  1 
ATOM   192  C C   . ASN A 1 40  ? -62.103 73.831  -128.634 1.00 25.07 ? 40  ASN A C   1 
ATOM   193  O O   . ASN A 1 40  ? -61.073 74.361  -128.222 1.00 26.03 ? 40  ASN A O   1 
ATOM   194  C CB  . ASN A 1 40  ? -64.039 75.351  -129.089 1.00 38.18 ? 40  ASN A CB  1 
ATOM   195  C CG  . ASN A 1 40  ? -63.487 76.545  -128.338 1.00 44.43 ? 40  ASN A CG  1 
ATOM   196  O OD1 . ASN A 1 40  ? -62.698 77.322  -128.881 1.00 47.20 ? 40  ASN A OD1 1 
ATOM   197  N ND2 . ASN A 1 40  ? -63.879 76.687  -127.077 1.00 44.06 ? 40  ASN A ND2 1 
ATOM   198  N N   . PHE A 1 41  ? -62.555 72.668  -128.173 1.00 23.10 ? 41  PHE A N   1 
ATOM   199  C CA  . PHE A 1 41  ? -61.781 71.884  -127.216 1.00 20.96 ? 41  PHE A CA  1 
ATOM   200  C C   . PHE A 1 41  ? -60.421 71.528  -127.795 1.00 20.42 ? 41  PHE A C   1 
ATOM   201  O O   . PHE A 1 41  ? -59.406 71.580  -127.098 1.00 14.02 ? 41  PHE A O   1 
ATOM   202  C CB  . PHE A 1 41  ? -62.507 70.598  -126.817 1.00 24.16 ? 41  PHE A CB  1 
ATOM   203  C CG  . PHE A 1 41  ? -61.587 69.552  -126.254 1.00 25.18 ? 41  PHE A CG  1 
ATOM   204  C CD1 . PHE A 1 41  ? -61.205 69.594  -124.924 1.00 26.61 ? 41  PHE A CD1 1 
ATOM   205  C CD2 . PHE A 1 41  ? -61.078 68.544  -127.064 1.00 22.70 ? 41  PHE A CD2 1 
ATOM   206  C CE1 . PHE A 1 41  ? -60.349 68.645  -124.410 1.00 20.69 ? 41  PHE A CE1 1 
ATOM   207  C CE2 . PHE A 1 41  ? -60.218 67.597  -126.555 1.00 18.73 ? 41  PHE A CE2 1 
ATOM   208  C CZ  . PHE A 1 41  ? -59.853 67.648  -125.231 1.00 16.72 ? 41  PHE A CZ  1 
ATOM   209  N N   . MET A 1 42  ? -60.416 71.137  -129.067 1.00 17.01 ? 42  MET A N   1 
ATOM   210  C CA  . MET A 1 42  ? -59.176 70.794  -129.745 1.00 18.29 ? 42  MET A CA  1 
ATOM   211  C C   . MET A 1 42  ? -58.235 71.990  -129.735 1.00 22.61 ? 42  MET A C   1 
ATOM   212  O O   . MET A 1 42  ? -57.039 71.841  -129.487 1.00 22.00 ? 42  MET A O   1 
ATOM   213  C CB  . MET A 1 42  ? -59.433 70.335  -131.182 1.00 16.83 ? 42  MET A CB  1 
ATOM   214  C CG  . MET A 1 42  ? -60.060 68.948  -131.311 1.00 21.15 ? 42  MET A CG  1 
ATOM   215  S SD  . MET A 1 42  ? -59.294 67.661  -130.290 1.00 23.59 ? 42  MET A SD  1 
ATOM   216  C CE  . MET A 1 42  ? -57.570 67.810  -130.739 1.00 12.85 ? 42  MET A CE  1 
ATOM   217  N N   . THR A 1 43  ? -58.788 73.174  -129.992 1.00 23.24 ? 43  THR A N   1 
ATOM   218  C CA  . THR A 1 43  ? -58.024 74.416  -129.958 1.00 24.79 ? 43  THR A CA  1 
ATOM   219  C C   . THR A 1 43  ? -57.371 74.629  -128.596 1.00 24.33 ? 43  THR A C   1 
ATOM   220  O O   . THR A 1 43  ? -56.186 74.959  -128.511 1.00 13.38 ? 43  THR A O   1 
ATOM   221  C CB  . THR A 1 43  ? -58.917 75.631  -130.285 1.00 30.65 ? 43  THR A CB  1 
ATOM   222  O OG1 . THR A 1 43  ? -59.457 75.492  -131.606 1.00 30.25 ? 43  THR A OG1 1 
ATOM   223  C CG2 . THR A 1 43  ? -58.116 76.921  -130.199 1.00 33.55 ? 43  THR A CG2 1 
ATOM   224  N N   . ARG A 1 44  ? -58.150 74.433  -127.537 1.00 19.78 ? 44  ARG A N   1 
ATOM   225  C CA  . ARG A 1 44  ? -57.662 74.605  -126.174 1.00 22.68 ? 44  ARG A CA  1 
ATOM   226  C C   . ARG A 1 44  ? -56.634 73.538  -125.833 1.00 24.88 ? 44  ARG A C   1 
ATOM   227  O O   . ARG A 1 44  ? -55.642 73.800  -125.157 1.00 25.73 ? 44  ARG A O   1 
ATOM   228  C CB  . ARG A 1 44  ? -58.825 74.551  -125.181 1.00 28.02 ? 44  ARG A CB  1 
ATOM   229  C CG  . ARG A 1 44  ? -59.925 75.577  -125.431 1.00 35.16 ? 44  ARG A CG  1 
ATOM   230  C CD  . ARG A 1 44  ? -59.609 76.924  -124.794 1.00 40.55 ? 44  ARG A CD  1 
ATOM   231  N NE  . ARG A 1 44  ? -58.512 77.622  -125.457 1.00 44.69 ? 44  ARG A NE  1 
ATOM   232  C CZ  . ARG A 1 44  ? -57.751 78.542  -124.872 1.00 47.01 ? 44  ARG A CZ  1 
ATOM   233  N NH1 . ARG A 1 44  ? -57.960 78.872  -123.605 1.00 49.38 ? 44  ARG A NH1 1 
ATOM   234  N NH2 . ARG A 1 44  ? -56.774 79.124  -125.551 1.00 45.09 ? 44  ARG A NH2 1 
ATOM   235  N N   . ALA A 1 45  ? -56.897 72.328  -126.311 1.00 25.87 ? 45  ALA A N   1 
ATOM   236  C CA  . ALA A 1 45  ? -55.996 71.196  -126.138 1.00 21.51 ? 45  ALA A CA  1 
ATOM   237  C C   . ALA A 1 45  ? -54.605 71.526  -126.660 1.00 20.09 ? 45  ALA A C   1 
ATOM   238  O O   . ALA A 1 45  ? -53.607 71.322  -125.970 1.00 23.40 ? 45  ALA A O   1 
ATOM   239  C CB  . ALA A 1 45  ? -56.549 69.971  -126.847 1.00 23.32 ? 45  ALA A CB  1 
ATOM   240  N N   . ILE A 1 46  ? -54.556 72.035  -127.887 1.00 17.42 ? 46  ILE A N   1 
ATOM   241  C CA  . ILE A 1 46  ? -53.313 72.468  -128.515 1.00 16.66 ? 46  ILE A CA  1 
ATOM   242  C C   . ILE A 1 46  ? -52.571 73.511  -127.669 1.00 16.30 ? 46  ILE A C   1 
ATOM   243  O O   . ILE A 1 46  ? -51.353 73.432  -127.485 1.00 13.45 ? 46  ILE A O   1 
ATOM   244  C CB  . ILE A 1 46  ? -53.602 73.041  -129.926 1.00 16.63 ? 46  ILE A CB  1 
ATOM   245  C CG1 . ILE A 1 46  ? -54.153 71.938  -130.830 1.00 18.51 ? 46  ILE A CG1 1 
ATOM   246  C CG2 . ILE A 1 46  ? -52.362 73.677  -130.534 1.00 14.09 ? 46  ILE A CG2 1 
ATOM   247  C CD1 . ILE A 1 46  ? -54.498 72.402  -132.224 1.00 17.40 ? 46  ILE A CD1 1 
ATOM   248  N N   . TYR A 1 47  ? -53.325 74.474  -127.148 1.00 16.44 ? 47  TYR A N   1 
ATOM   249  C CA  . TYR A 1 47  ? -52.782 75.528  -126.301 1.00 17.56 ? 47  TYR A CA  1 
ATOM   250  C C   . TYR A 1 47  ? -52.108 74.963  -125.052 1.00 15.20 ? 47  TYR A C   1 
ATOM   251  O O   . TYR A 1 47  ? -50.954 75.283  -124.767 1.00 13.26 ? 47  TYR A O   1 
ATOM   252  C CB  . TYR A 1 47  ? -53.894 76.505  -125.912 1.00 17.61 ? 47  TYR A CB  1 
ATOM   253  C CG  . TYR A 1 47  ? -53.558 77.416  -124.756 1.00 17.69 ? 47  TYR A CG  1 
ATOM   254  C CD1 . TYR A 1 47  ? -52.574 78.390  -124.872 1.00 20.54 ? 47  TYR A CD1 1 
ATOM   255  C CD2 . TYR A 1 47  ? -54.238 77.313  -123.551 1.00 14.61 ? 47  TYR A CD2 1 
ATOM   256  C CE1 . TYR A 1 47  ? -52.269 79.227  -123.817 1.00 17.30 ? 47  TYR A CE1 1 
ATOM   257  C CE2 . TYR A 1 47  ? -53.943 78.142  -122.492 1.00 15.40 ? 47  TYR A CE2 1 
ATOM   258  C CZ  . TYR A 1 47  ? -52.958 79.099  -122.629 1.00 17.93 ? 47  TYR A CZ  1 
ATOM   259  O OH  . TYR A 1 47  ? -52.661 79.933  -121.575 1.00 17.07 ? 47  TYR A OH  1 
ATOM   260  N N   . VAL A 1 48  ? -52.821 74.107  -124.324 1.00 13.09 ? 48  VAL A N   1 
ATOM   261  C CA  . VAL A 1 48  ? -52.308 73.559  -123.071 1.00 13.05 ? 48  VAL A CA  1 
ATOM   262  C C   . VAL A 1 48  ? -51.187 72.543  -123.286 1.00 12.54 ? 48  VAL A C   1 
ATOM   263  O O   . VAL A 1 48  ? -50.214 72.520  -122.530 1.00 14.89 ? 48  VAL A O   1 
ATOM   264  C CB  . VAL A 1 48  ? -53.435 72.900  -122.254 1.00 17.28 ? 48  VAL A CB  1 
ATOM   265  C CG1 . VAL A 1 48  ? -52.887 72.265  -120.980 1.00 12.94 ? 48  VAL A CG1 1 
ATOM   266  C CG2 . VAL A 1 48  ? -54.503 73.920  -121.911 1.00 13.58 ? 48  VAL A CG2 1 
ATOM   267  N N   . ALA A 1 49  ? -51.322 71.710  -124.314 1.00 13.01 ? 49  ALA A N   1 
ATOM   268  C CA  . ALA A 1 49  ? -50.323 70.680  -124.606 1.00 13.62 ? 49  ALA A CA  1 
ATOM   269  C C   . ALA A 1 49  ? -48.964 71.272  -124.982 1.00 17.45 ? 49  ALA A C   1 
ATOM   270  O O   . ALA A 1 49  ? -47.932 70.865  -124.448 1.00 14.37 ? 49  ALA A O   1 
ATOM   271  C CB  . ALA A 1 49  ? -50.813 69.763  -125.717 1.00 10.73 ? 49  ALA A CB  1 
ATOM   272  N N   . PHE A 1 50  ? -48.964 72.223  -125.910 1.00 10.98 ? 50  PHE A N   1 
ATOM   273  C CA  . PHE A 1 50  ? -47.715 72.848  -126.340 1.00 13.98 ? 50  PHE A CA  1 
ATOM   274  C C   . PHE A 1 50  ? -47.175 73.781  -125.266 1.00 13.36 ? 50  PHE A C   1 
ATOM   275  O O   . PHE A 1 50  ? -45.982 74.072  -125.230 1.00 14.78 ? 50  PHE A O   1 
ATOM   276  C CB  . PHE A 1 50  ? -47.904 73.595  -127.666 1.00 11.15 ? 50  PHE A CB  1 
ATOM   277  C CG  . PHE A 1 50  ? -47.935 72.690  -128.862 1.00 14.82 ? 50  PHE A CG  1 
ATOM   278  C CD1 . PHE A 1 50  ? -46.777 72.064  -129.303 1.00 15.51 ? 50  PHE A CD1 1 
ATOM   279  C CD2 . PHE A 1 50  ? -49.119 72.460  -129.547 1.00 12.49 ? 50  PHE A CD2 1 
ATOM   280  C CE1 . PHE A 1 50  ? -46.800 71.224  -130.406 1.00 16.26 ? 50  PHE A CE1 1 
ATOM   281  C CE2 . PHE A 1 50  ? -49.147 71.625  -130.649 1.00 13.89 ? 50  PHE A CE2 1 
ATOM   282  C CZ  . PHE A 1 50  ? -47.987 71.005  -131.078 1.00 17.15 ? 50  PHE A CZ  1 
ATOM   283  N N   . SER A 1 51  ? -48.060 74.249  -124.394 1.00 16.74 ? 51  SER A N   1 
ATOM   284  C CA  . SER A 1 51  ? -47.649 75.006  -123.221 1.00 15.02 ? 51  SER A CA  1 
ATOM   285  C C   . SER A 1 51  ? -46.809 74.123  -122.313 1.00 16.42 ? 51  SER A C   1 
ATOM   286  O O   . SER A 1 51  ? -45.739 74.523  -121.854 1.00 17.58 ? 51  SER A O   1 
ATOM   287  C CB  . SER A 1 51  ? -48.864 75.544  -122.464 1.00 15.25 ? 51  SER A CB  1 
ATOM   288  O OG  . SER A 1 51  ? -49.494 76.584  -123.190 1.00 19.34 ? 51  SER A OG  1 
ATOM   289  N N   . ALA A 1 52  ? -47.298 72.912  -122.068 1.00 12.27 ? 52  ALA A N   1 
ATOM   290  C CA  . ALA A 1 52  ? -46.578 71.948  -121.245 1.00 12.41 ? 52  ALA A CA  1 
ATOM   291  C C   . ALA A 1 52  ? -45.223 71.599  -121.860 1.00 12.29 ? 52  ALA A C   1 
ATOM   292  O O   . ALA A 1 52  ? -44.229 71.479  -121.148 1.00 12.79 ? 52  ALA A O   1 
ATOM   293  C CB  . ALA A 1 52  ? -47.408 70.695  -121.054 1.00 12.14 ? 52  ALA A CB  1 
ATOM   294  N N   . VAL A 1 53  ? -45.191 71.443  -123.182 1.00 13.29 ? 53  VAL A N   1 
ATOM   295  C CA  . VAL A 1 53  ? -43.962 71.091  -123.891 1.00 11.80 ? 53  VAL A CA  1 
ATOM   296  C C   . VAL A 1 53  ? -42.940 72.217  -123.829 1.00 12.33 ? 53  VAL A C   1 
ATOM   297  O O   . VAL A 1 53  ? -41.773 71.988  -123.522 1.00 19.65 ? 53  VAL A O   1 
ATOM   298  C CB  . VAL A 1 53  ? -44.238 70.747  -125.369 1.00 13.92 ? 53  VAL A CB  1 
ATOM   299  C CG1 . VAL A 1 53  ? -42.933 70.586  -126.135 1.00 21.66 ? 53  VAL A CG1 1 
ATOM   300  C CG2 . VAL A 1 53  ? -45.075 69.486  -125.474 1.00 10.99 ? 53  VAL A CG2 1 
ATOM   301  N N   . LEU A 1 54  ? -43.384 73.434  -124.121 1.00 12.65 ? 54  LEU A N   1 
ATOM   302  C CA  . LEU A 1 54  ? -42.499 74.592  -124.118 1.00 13.79 ? 54  LEU A CA  1 
ATOM   303  C C   . LEU A 1 54  ? -41.906 74.864  -122.739 1.00 17.04 ? 54  LEU A C   1 
ATOM   304  O O   . LEU A 1 54  ? -40.743 75.252  -122.621 1.00 19.84 ? 54  LEU A O   1 
ATOM   305  C CB  . LEU A 1 54  ? -43.245 75.832  -124.618 1.00 15.67 ? 54  LEU A CB  1 
ATOM   306  C CG  . LEU A 1 54  ? -43.394 75.925  -126.134 1.00 20.54 ? 54  LEU A CG  1 
ATOM   307  C CD1 . LEU A 1 54  ? -44.447 76.949  -126.531 1.00 22.56 ? 54  LEU A CD1 1 
ATOM   308  C CD2 . LEU A 1 54  ? -42.052 76.262  -126.768 1.00 24.30 ? 54  LEU A CD2 1 
ATOM   309  N N   . ARG A 1 55  ? -42.702 74.656  -121.696 1.00 13.96 ? 55  ARG A N   1 
ATOM   310  C CA  . ARG A 1 55  ? -42.240 74.910  -120.335 1.00 14.88 ? 55  ARG A CA  1 
ATOM   311  C C   . ARG A 1 55  ? -41.382 73.771  -119.787 1.00 15.83 ? 55  ARG A C   1 
ATOM   312  O O   . ARG A 1 55  ? -40.289 74.004  -119.281 1.00 15.91 ? 55  ARG A O   1 
ATOM   313  C CB  . ARG A 1 55  ? -43.429 75.166  -119.396 1.00 15.11 ? 55  ARG A CB  1 
ATOM   314  C CG  . ARG A 1 55  ? -43.014 75.384  -117.949 1.00 16.23 ? 55  ARG A CG  1 
ATOM   315  C CD  . ARG A 1 55  ? -41.999 76.516  -117.827 1.00 22.34 ? 55  ARG A CD  1 
ATOM   316  N NE  . ARG A 1 55  ? -40.994 76.244  -116.802 1.00 30.06 ? 55  ARG A NE  1 
ATOM   317  C CZ  . ARG A 1 55  ? -39.682 76.335  -116.999 1.00 34.63 ? 55  ARG A CZ  1 
ATOM   318  N NH1 . ARG A 1 55  ? -39.207 76.703  -118.181 1.00 35.49 ? 55  ARG A NH1 1 
ATOM   319  N NH2 . ARG A 1 55  ? -38.841 76.063  -116.009 1.00 39.86 ? 55  ARG A NH2 1 
ATOM   320  N N   . ASN A 1 56  ? -41.876 72.542  -119.890 1.00 17.77 ? 56  ASN A N   1 
ATOM   321  C CA  . ASN A 1 56  ? -41.181 71.397  -119.302 1.00 24.68 ? 56  ASN A CA  1 
ATOM   322  C C   . ASN A 1 56  ? -39.886 71.028  -120.025 1.00 31.06 ? 56  ASN A C   1 
ATOM   323  O O   . ASN A 1 56  ? -39.014 70.378  -119.449 1.00 31.36 ? 56  ASN A O   1 
ATOM   324  C CB  . ASN A 1 56  ? -42.101 70.176  -119.254 1.00 24.35 ? 56  ASN A CB  1 
ATOM   325  C CG  . ASN A 1 56  ? -43.002 70.177  -118.034 1.00 31.02 ? 56  ASN A CG  1 
ATOM   326  O OD1 . ASN A 1 56  ? -42.609 69.720  -116.961 1.00 42.61 ? 56  ASN A OD1 1 
ATOM   327  N ND2 . ASN A 1 56  ? -44.219 70.684  -118.194 1.00 26.38 ? 56  ASN A ND2 1 
ATOM   328  N N   . ARG A 1 57  ? -39.756 71.436  -121.282 1.00 31.42 ? 57  ARG A N   1 
ATOM   329  C CA  . ARG A 1 57  ? -38.524 71.190  -122.029 1.00 32.99 ? 57  ARG A CA  1 
ATOM   330  C C   . ARG A 1 57  ? -37.567 72.354  -121.805 1.00 30.44 ? 57  ARG A C   1 
ATOM   331  O O   . ARG A 1 57  ? -36.396 72.308  -122.205 1.00 26.93 ? 57  ARG A O   1 
ATOM   332  C CB  . ARG A 1 57  ? -38.814 71.008  -123.525 1.00 33.17 ? 57  ARG A CB  1 
ATOM   333  C CG  . ARG A 1 57  ? -37.730 70.276  -124.306 1.00 32.45 ? 57  ARG A CG  1 
ATOM   334  C CD  . ARG A 1 57  ? -37.614 68.824  -123.860 1.00 28.03 ? 57  ARG A CD  1 
ATOM   335  N NE  . ARG A 1 57  ? -36.774 68.025  -124.749 1.00 25.03 ? 57  ARG A NE  1 
ATOM   336  C CZ  . ARG A 1 57  ? -35.496 67.744  -124.516 1.00 27.59 ? 57  ARG A CZ  1 
ATOM   337  N NH1 . ARG A 1 57  ? -34.903 68.200  -123.420 1.00 30.18 ? 57  ARG A NH1 1 
ATOM   338  N NH2 . ARG A 1 57  ? -34.810 67.006  -125.379 1.00 24.51 ? 57  ARG A NH2 1 
ATOM   339  N N   . ASN A 1 58  ? -38.093 73.390  -121.155 1.00 31.67 ? 58  ASN A N   1 
ATOM   340  C CA  . ASN A 1 58  ? -37.379 74.641  -120.898 1.00 31.91 ? 58  ASN A CA  1 
ATOM   341  C C   . ASN A 1 58  ? -36.957 75.348  -122.184 1.00 27.69 ? 58  ASN A C   1 
ATOM   342  O O   . ASN A 1 58  ? -35.821 75.803  -122.318 1.00 24.08 ? 58  ASN A O   1 
ATOM   343  C CB  . ASN A 1 58  ? -36.157 74.400  -120.002 1.00 35.26 ? 58  ASN A CB  1 
ATOM   344  C CG  . ASN A 1 58  ? -35.561 75.691  -119.478 1.00 41.66 ? 58  ASN A CG  1 
ATOM   345  O OD1 . ASN A 1 58  ? -36.274 76.671  -119.257 1.00 43.39 ? 58  ASN A OD1 1 
ATOM   346  N ND2 . ASN A 1 58  ? -34.245 75.708  -119.304 1.00 43.84 ? 58  ASN A ND2 1 
ATOM   347  N N   . ILE A 1 59  ? -37.881 75.440  -123.132 1.00 25.12 ? 59  ILE A N   1 
ATOM   348  C CA  . ILE A 1 59  ? -37.636 76.227  -124.332 1.00 23.82 ? 59  ILE A CA  1 
ATOM   349  C C   . ILE A 1 59  ? -37.939 77.683  -123.997 1.00 24.61 ? 59  ILE A C   1 
ATOM   350  O O   . ILE A 1 59  ? -37.301 78.603  -124.509 1.00 26.29 ? 59  ILE A O   1 
ATOM   351  C CB  . ILE A 1 59  ? -38.485 75.738  -125.517 1.00 19.63 ? 59  ILE A CB  1 
ATOM   352  C CG1 . ILE A 1 59  ? -38.009 74.353  -125.953 1.00 17.16 ? 59  ILE A CG1 1 
ATOM   353  C CG2 . ILE A 1 59  ? -38.391 76.698  -126.692 1.00 15.16 ? 59  ILE A CG2 1 
ATOM   354  C CD1 . ILE A 1 59  ? -39.016 73.559  -126.754 1.00 13.65 ? 59  ILE A CD1 1 
ATOM   355  N N   . LEU A 1 60  ? -38.901 77.878  -123.102 1.00 23.70 ? 60  LEU A N   1 
ATOM   356  C CA  . LEU A 1 60  ? -39.217 79.204  -122.585 1.00 24.51 ? 60  LEU A CA  1 
ATOM   357  C C   . LEU A 1 60  ? -39.233 79.196  -121.063 1.00 22.67 ? 60  LEU A C   1 
ATOM   358  O O   . LEU A 1 60  ? -39.679 78.227  -120.444 1.00 17.61 ? 60  LEU A O   1 
ATOM   359  C CB  . LEU A 1 60  ? -40.565 79.688  -123.119 1.00 23.34 ? 60  LEU A CB  1 
ATOM   360  C CG  . LEU A 1 60  ? -40.680 79.898  -124.627 1.00 24.58 ? 60  LEU A CG  1 
ATOM   361  C CD1 . LEU A 1 60  ? -42.108 80.276  -124.988 1.00 23.49 ? 60  LEU A CD1 1 
ATOM   362  C CD2 . LEU A 1 60  ? -39.700 80.957  -125.113 1.00 25.55 ? 60  LEU A CD2 1 
ATOM   363  N N   . GLY A 1 61  ? -38.748 80.283  -120.468 1.00 23.85 ? 61  GLY A N   1 
ATOM   364  C CA  . GLY A 1 61  ? -38.710 80.412  -119.024 1.00 28.31 ? 61  GLY A CA  1 
ATOM   365  C C   . GLY A 1 61  ? -40.091 80.465  -118.402 1.00 33.19 ? 61  GLY A C   1 
ATOM   366  O O   . GLY A 1 61  ? -41.090 80.627  -119.102 1.00 35.68 ? 61  GLY A O   1 
ATOM   367  N N   . GLN A 1 62  ? -40.145 80.331  -117.081 1.00 33.70 ? 62  GLN A N   1 
ATOM   368  C CA  . GLN A 1 62  ? -41.411 80.287  -116.362 1.00 32.02 ? 62  GLN A CA  1 
ATOM   369  C C   . GLN A 1 62  ? -42.192 81.593  -116.488 1.00 29.54 ? 62  GLN A C   1 
ATOM   370  O O   . GLN A 1 62  ? -43.423 81.595  -116.433 1.00 29.01 ? 62  GLN A O   1 
ATOM   371  C CB  . GLN A 1 62  ? -41.165 79.968  -114.884 1.00 38.75 ? 62  GLN A CB  1 
ATOM   372  C CG  . GLN A 1 62  ? -40.208 78.809  -114.646 1.00 45.27 ? 62  GLN A CG  1 
ATOM   373  C CD  . GLN A 1 62  ? -39.976 78.531  -113.172 1.00 48.90 ? 62  GLN A CD  1 
ATOM   374  O OE1 . GLN A 1 62  ? -38.902 78.808  -112.637 1.00 49.29 ? 62  GLN A OE1 1 
ATOM   375  N NE2 . GLN A 1 62  ? -40.983 77.972  -112.510 1.00 49.44 ? 62  GLN A NE2 1 
ATOM   376  N N   . GLU A 1 63  ? -41.473 82.699  -116.665 1.00 29.60 ? 63  GLU A N   1 
ATOM   377  C CA  . GLU A 1 63  ? -42.090 84.023  -116.710 1.00 30.96 ? 63  GLU A CA  1 
ATOM   378  C C   . GLU A 1 63  ? -43.043 84.188  -117.896 1.00 27.95 ? 63  GLU A C   1 
ATOM   379  O O   . GLU A 1 63  ? -43.862 85.106  -117.918 1.00 32.41 ? 63  GLU A O   1 
ATOM   380  C CB  . GLU A 1 63  ? -41.015 85.114  -116.755 1.00 35.35 ? 63  GLU A CB  1 
ATOM   381  C CG  . GLU A 1 63  ? -40.380 85.326  -118.122 1.00 37.48 ? 63  GLU A CG  1 
ATOM   382  C CD  . GLU A 1 63  ? -39.009 84.693  -118.238 1.00 38.60 ? 63  GLU A CD  1 
ATOM   383  O OE1 . GLU A 1 63  ? -38.788 83.632  -117.617 1.00 39.70 ? 63  GLU A OE1 1 
ATOM   384  O OE2 . GLU A 1 63  ? -38.152 85.265  -118.942 1.00 37.63 ? 63  GLU A OE2 1 
ATOM   385  N N   . TYR A 1 64  ? -42.933 83.301  -118.878 1.00 26.14 ? 64  TYR A N   1 
ATOM   386  C CA  . TYR A 1 64  ? -43.826 83.332  -120.029 1.00 27.94 ? 64  TYR A CA  1 
ATOM   387  C C   . TYR A 1 64  ? -45.085 82.502  -119.784 1.00 29.07 ? 64  TYR A C   1 
ATOM   388  O O   . TYR A 1 64  ? -45.911 82.330  -120.681 1.00 24.81 ? 64  TYR A O   1 
ATOM   389  C CB  . TYR A 1 64  ? -43.104 82.828  -121.282 1.00 27.94 ? 64  TYR A CB  1 
ATOM   390  C CG  . TYR A 1 64  ? -41.957 83.709  -121.722 1.00 29.90 ? 64  TYR A CG  1 
ATOM   391  C CD1 . TYR A 1 64  ? -42.193 84.898  -122.397 1.00 34.57 ? 64  TYR A CD1 1 
ATOM   392  C CD2 . TYR A 1 64  ? -40.640 83.349  -121.469 1.00 30.77 ? 64  TYR A CD2 1 
ATOM   393  C CE1 . TYR A 1 64  ? -41.150 85.707  -122.803 1.00 36.57 ? 64  TYR A CE1 1 
ATOM   394  C CE2 . TYR A 1 64  ? -39.592 84.151  -121.871 1.00 32.88 ? 64  TYR A CE2 1 
ATOM   395  C CZ  . TYR A 1 64  ? -39.853 85.329  -122.538 1.00 35.62 ? 64  TYR A CZ  1 
ATOM   396  O OH  . TYR A 1 64  ? -38.811 86.131  -122.941 1.00 37.19 ? 64  TYR A OH  1 
ATOM   397  N N   . PHE A 1 65  ? -45.235 81.994  -118.566 1.00 31.38 ? 65  PHE A N   1 
ATOM   398  C CA  . PHE A 1 65  ? -46.335 81.086  -118.276 1.00 31.66 ? 65  PHE A CA  1 
ATOM   399  C C   . PHE A 1 65  ? -47.194 81.525  -117.095 1.00 31.79 ? 65  PHE A C   1 
ATOM   400  O O   . PHE A 1 65  ? -46.751 82.290  -116.236 1.00 34.01 ? 65  PHE A O   1 
ATOM   401  C CB  . PHE A 1 65  ? -45.789 79.678  -118.024 1.00 30.63 ? 65  PHE A CB  1 
ATOM   402  C CG  . PHE A 1 65  ? -45.288 78.995  -119.261 1.00 28.59 ? 65  PHE A CG  1 
ATOM   403  C CD1 . PHE A 1 65  ? -43.960 79.098  -119.643 1.00 27.54 ? 65  PHE A CD1 1 
ATOM   404  C CD2 . PHE A 1 65  ? -46.152 78.251  -120.047 1.00 26.79 ? 65  PHE A CD2 1 
ATOM   405  C CE1 . PHE A 1 65  ? -43.504 78.467  -120.787 1.00 28.54 ? 65  PHE A CE1 1 
ATOM   406  C CE2 . PHE A 1 65  ? -45.706 77.621  -121.188 1.00 29.44 ? 65  PHE A CE2 1 
ATOM   407  C CZ  . PHE A 1 65  ? -44.380 77.729  -121.560 1.00 30.89 ? 65  PHE A CZ  1 
ATOM   408  N N   . THR A 1 66  ? -48.429 81.035  -117.074 1.00 30.27 ? 66  THR A N   1 
ATOM   409  C CA  . THR A 1 66  ? -49.328 81.232  -115.946 1.00 33.08 ? 66  THR A CA  1 
ATOM   410  C C   . THR A 1 66  ? -49.705 79.865  -115.384 1.00 31.97 ? 66  THR A C   1 
ATOM   411  O O   . THR A 1 66  ? -50.042 78.957  -116.145 1.00 23.87 ? 66  THR A O   1 
ATOM   412  C CB  . THR A 1 66  ? -50.598 81.998  -116.355 1.00 34.72 ? 66  THR A CB  1 
ATOM   413  O OG1 . THR A 1 66  ? -50.244 83.092  -117.210 1.00 38.69 ? 66  THR A OG1 1 
ATOM   414  C CG2 . THR A 1 66  ? -51.325 82.526  -115.128 1.00 33.02 ? 66  THR A CG2 1 
ATOM   415  N N   . LYS A 1 67  ? -49.635 79.706  -114.065 1.00 36.61 ? 67  LYS A N   1 
ATOM   416  C CA  . LYS A 1 67  ? -50.013 78.433  -113.462 1.00 37.77 ? 67  LYS A CA  1 
ATOM   417  C C   . LYS A 1 67  ? -51.526 78.254  -113.512 1.00 34.49 ? 67  LYS A C   1 
ATOM   418  O O   . LYS A 1 67  ? -52.281 79.161  -113.160 1.00 33.63 ? 67  LYS A O   1 
ATOM   419  C CB  . LYS A 1 67  ? -49.508 78.325  -112.020 1.00 39.00 ? 67  LYS A CB  1 
ATOM   420  C CG  . LYS A 1 67  ? -48.296 77.413  -111.881 1.00 39.16 ? 67  LYS A CG  1 
ATOM   421  C CD  . LYS A 1 67  ? -48.240 76.710  -110.536 1.00 44.36 ? 67  LYS A CD  1 
ATOM   422  C CE  . LYS A 1 67  ? -47.055 75.749  -110.460 1.00 46.22 ? 67  LYS A CE  1 
ATOM   423  N NZ  . LYS A 1 67  ? -47.405 74.343  -110.825 1.00 45.61 ? 67  LYS A NZ  1 
ATOM   424  N N   . ASN A 1 68  ? -51.955 77.081  -113.967 1.00 32.04 ? 68  ASN A N   1 
ATOM   425  C CA  . ASN A 1 68  ? -53.372 76.784  -114.132 1.00 31.15 ? 68  ASN A CA  1 
ATOM   426  C C   . ASN A 1 68  ? -53.741 75.421  -113.574 1.00 31.77 ? 68  ASN A C   1 
ATOM   427  O O   . ASN A 1 68  ? -52.866 74.612  -113.260 1.00 29.53 ? 68  ASN A O   1 
ATOM   428  C CB  . ASN A 1 68  ? -53.763 76.842  -115.607 1.00 32.45 ? 68  ASN A CB  1 
ATOM   429  C CG  . ASN A 1 68  ? -54.496 78.110  -115.965 1.00 43.23 ? 68  ASN A CG  1 
ATOM   430  O OD1 . ASN A 1 68  ? -55.682 78.258  -115.669 1.00 46.66 ? 68  ASN A OD1 1 
ATOM   431  N ND2 . ASN A 1 68  ? -53.799 79.033  -116.617 1.00 48.98 ? 68  ASN A ND2 1 
ATOM   432  N N   . TYR A 1 69  ? -55.042 75.176  -113.456 1.00 35.85 ? 69  TYR A N   1 
ATOM   433  C CA  . TYR A 1 69  ? -55.549 73.841  -113.177 1.00 33.81 ? 69  TYR A CA  1 
ATOM   434  C C   . TYR A 1 69  ? -56.140 73.274  -114.453 1.00 31.12 ? 69  TYR A C   1 
ATOM   435  O O   . TYR A 1 69  ? -56.930 73.941  -115.123 1.00 33.68 ? 69  TYR A O   1 
ATOM   436  C CB  . TYR A 1 69  ? -56.620 73.857  -112.086 1.00 34.89 ? 69  TYR A CB  1 
ATOM   437  C CG  . TYR A 1 69  ? -56.120 74.110  -110.685 1.00 36.02 ? 69  TYR A CG  1 
ATOM   438  C CD1 . TYR A 1 69  ? -56.003 75.403  -110.196 1.00 38.87 ? 69  TYR A CD1 1 
ATOM   439  C CD2 . TYR A 1 69  ? -55.797 73.056  -109.840 1.00 31.85 ? 69  TYR A CD2 1 
ATOM   440  C CE1 . TYR A 1 69  ? -55.558 75.643  -108.914 1.00 39.40 ? 69  TYR A CE1 1 
ATOM   441  C CE2 . TYR A 1 69  ? -55.350 73.285  -108.555 1.00 33.66 ? 69  TYR A CE2 1 
ATOM   442  C CZ  . TYR A 1 69  ? -55.233 74.582  -108.097 1.00 37.50 ? 69  TYR A CZ  1 
ATOM   443  O OH  . TYR A 1 69  ? -54.790 74.825  -106.818 1.00 39.84 ? 69  TYR A OH  1 
ATOM   444  N N   . ILE A 1 70  ? -55.764 72.049  -114.794 1.00 26.34 ? 70  ILE A N   1 
ATOM   445  C CA  . ILE A 1 70  ? -56.484 71.318  -115.823 1.00 27.60 ? 70  ILE A CA  1 
ATOM   446  C C   . ILE A 1 70  ? -57.656 70.609  -115.156 1.00 29.19 ? 70  ILE A C   1 
ATOM   447  O O   . ILE A 1 70  ? -58.790 70.660  -115.639 1.00 28.57 ? 70  ILE A O   1 
ATOM   448  C CB  . ILE A 1 70  ? -55.577 70.324  -116.548 1.00 29.90 ? 70  ILE A CB  1 
ATOM   449  C CG1 . ILE A 1 70  ? -54.702 71.083  -117.541 1.00 37.30 ? 70  ILE A CG1 1 
ATOM   450  C CG2 . ILE A 1 70  ? -56.401 69.269  -117.269 1.00 25.01 ? 70  ILE A CG2 1 
ATOM   451  C CD1 . ILE A 1 70  ? -53.467 70.372  -117.911 1.00 43.26 ? 70  ILE A CD1 1 
ATOM   452  N N   . THR A 1 71  ? -57.373 69.960  -114.030 1.00 27.49 ? 71  THR A N   1 
ATOM   453  C CA  . THR A 1 71  ? -58.418 69.383  -113.190 1.00 27.51 ? 71  THR A CA  1 
ATOM   454  C C   . THR A 1 71  ? -58.121 69.645  -111.719 1.00 24.90 ? 71  THR A C   1 
ATOM   455  O O   . THR A 1 71  ? -57.157 70.336  -111.376 1.00 20.63 ? 71  THR A O   1 
ATOM   456  C CB  . THR A 1 71  ? -58.578 67.859  -113.399 1.00 27.39 ? 71  THR A CB  1 
ATOM   457  O OG1 . THR A 1 71  ? -57.423 67.176  -112.900 1.00 26.20 ? 71  THR A OG1 1 
ATOM   458  C CG2 . THR A 1 71  ? -58.776 67.523  -114.869 1.00 23.84 ? 71  THR A CG2 1 
ATOM   459  N N   . GLU A 1 72  ? -58.958 69.074  -110.860 1.00 25.45 ? 72  GLU A N   1 
ATOM   460  C CA  . GLU A 1 72  ? -58.789 69.174  -109.418 1.00 30.40 ? 72  GLU A CA  1 
ATOM   461  C C   . GLU A 1 72  ? -57.531 68.454  -108.941 1.00 30.41 ? 72  GLU A C   1 
ATOM   462  O O   . GLU A 1 72  ? -57.039 68.715  -107.845 1.00 32.96 ? 72  GLU A O   1 
ATOM   463  C CB  . GLU A 1 72  ? -60.020 68.607  -108.703 1.00 31.73 ? 72  GLU A CB  1 
ATOM   464  C CG  . GLU A 1 72  ? -61.188 69.578  -108.602 1.00 36.80 ? 72  GLU A CG  1 
ATOM   465  C CD  . GLU A 1 72  ? -62.529 68.881  -108.476 1.00 42.24 ? 72  GLU A CD  1 
ATOM   466  O OE1 . GLU A 1 72  ? -62.558 67.633  -108.440 1.00 44.40 ? 72  GLU A OE1 1 
ATOM   467  O OE2 . GLU A 1 72  ? -63.557 69.587  -108.421 1.00 45.11 ? 72  GLU A OE2 1 
ATOM   468  N N   . LYS A 1 73  ? -57.017 67.549  -109.769 1.00 26.43 ? 73  LYS A N   1 
ATOM   469  C CA  . LYS A 1 73  ? -55.875 66.722  -109.391 1.00 26.68 ? 73  LYS A CA  1 
ATOM   470  C C   . LYS A 1 73  ? -54.598 67.061  -110.160 1.00 27.09 ? 73  LYS A C   1 
ATOM   471  O O   . LYS A 1 73  ? -53.517 66.592  -109.809 1.00 28.40 ? 73  LYS A O   1 
ATOM   472  C CB  . LYS A 1 73  ? -56.217 65.241  -109.587 1.00 25.06 ? 73  LYS A CB  1 
ATOM   473  C CG  . LYS A 1 73  ? -57.043 64.634  -108.456 1.00 27.44 ? 73  LYS A CG  1 
ATOM   474  C CD  . LYS A 1 73  ? -57.892 63.471  -108.951 1.00 28.27 ? 73  LYS A CD  1 
ATOM   475  C CE  . LYS A 1 73  ? -58.617 62.770  -107.810 1.00 31.54 ? 73  LYS A CE  1 
ATOM   476  N NZ  . LYS A 1 73  ? -59.485 63.696  -107.031 1.00 36.17 ? 73  LYS A NZ  1 
ATOM   477  N N   . LEU A 1 74  ? -54.715 67.879  -111.200 1.00 25.12 ? 74  LEU A N   1 
ATOM   478  C CA  . LEU A 1 74  ? -53.558 68.180  -112.040 1.00 24.72 ? 74  LEU A CA  1 
ATOM   479  C C   . LEU A 1 74  ? -53.407 69.666  -112.352 1.00 23.33 ? 74  LEU A C   1 
ATOM   480  O O   . LEU A 1 74  ? -54.345 70.310  -112.828 1.00 27.45 ? 74  LEU A O   1 
ATOM   481  C CB  . LEU A 1 74  ? -53.638 67.391  -113.351 1.00 26.97 ? 74  LEU A CB  1 
ATOM   482  C CG  . LEU A 1 74  ? -52.436 67.573  -114.277 1.00 31.07 ? 74  LEU A CG  1 
ATOM   483  C CD1 . LEU A 1 74  ? -51.165 67.125  -113.572 1.00 34.77 ? 74  LEU A CD1 1 
ATOM   484  C CD2 . LEU A 1 74  ? -52.631 66.819  -115.585 1.00 28.71 ? 74  LEU A CD2 1 
ATOM   485  N N   . LYS A 1 75  ? -52.220 70.201  -112.079 1.00 21.92 ? 75  LYS A N   1 
ATOM   486  C CA  . LYS A 1 75  ? -51.889 71.567  -112.461 1.00 27.63 ? 75  LYS A CA  1 
ATOM   487  C C   . LYS A 1 75  ? -50.924 71.578  -113.641 1.00 30.18 ? 75  LYS A C   1 
ATOM   488  O O   . LYS A 1 75  ? -50.158 70.633  -113.843 1.00 33.71 ? 75  LYS A O   1 
ATOM   489  C CB  . LYS A 1 75  ? -51.285 72.332  -111.283 1.00 26.94 ? 75  LYS A CB  1 
ATOM   490  C CG  . LYS A 1 75  ? -52.313 73.045  -110.417 1.00 29.87 ? 75  LYS A CG  1 
ATOM   491  C CD  . LYS A 1 75  ? -51.721 73.483  -109.083 1.00 31.99 ? 75  LYS A CD  1 
ATOM   492  C CE  . LYS A 1 75  ? -51.127 74.884  -109.148 1.00 36.33 ? 75  LYS A CE  1 
ATOM   493  N NZ  . LYS A 1 75  ? -52.168 75.946  -109.265 1.00 36.96 ? 75  LYS A NZ  1 
ATOM   494  N N   . CYS A 1 76  ? -50.970 72.652  -114.419 1.00 25.38 ? 76  CYS A N   1 
ATOM   495  C CA  . CYS A 1 76  ? -50.086 72.803  -115.563 1.00 26.49 ? 76  CYS A CA  1 
ATOM   496  C C   . CYS A 1 76  ? -49.857 74.270  -115.889 1.00 31.94 ? 76  CYS A C   1 
ATOM   497  O O   . CYS A 1 76  ? -50.771 75.091  -115.796 1.00 32.11 ? 76  CYS A O   1 
ATOM   498  C CB  . CYS A 1 76  ? -50.657 72.082  -116.783 1.00 24.76 ? 76  CYS A CB  1 
ATOM   499  S SG  . CYS A 1 76  ? -49.656 72.234  -118.280 1.00 53.77 ? 76  CYS A SG  1 
ATOM   500  N N   . MET A 1 77  ? -48.624 74.587  -116.268 1.00 34.83 ? 77  MET A N   1 
ATOM   501  C CA  . MET A 1 77  ? -48.271 75.922  -116.727 1.00 35.24 ? 77  MET A CA  1 
ATOM   502  C C   . MET A 1 77  ? -48.769 76.121  -118.151 1.00 28.58 ? 77  MET A C   1 
ATOM   503  O O   . MET A 1 77  ? -48.610 75.237  -118.996 1.00 24.20 ? 77  MET A O   1 
ATOM   504  C CB  . MET A 1 77  ? -46.759 76.130  -116.658 1.00 36.31 ? 77  MET A CB  1 
ATOM   505  C CG  . MET A 1 77  ? -46.188 76.084  -115.252 1.00 36.49 ? 77  MET A CG  1 
ATOM   506  S SD  . MET A 1 77  ? -46.078 77.717  -114.500 1.00 41.13 ? 77  MET A SD  1 
ATOM   507  C CE  . MET A 1 77  ? -44.326 77.797  -114.147 1.00 52.69 ? 77  MET A CE  1 
ATOM   508  N N   . THR A 1 78  ? -49.381 77.271  -118.413 1.00 25.72 ? 78  THR A N   1 
ATOM   509  C CA  . THR A 1 78  ? -49.867 77.577  -119.753 1.00 29.22 ? 78  THR A CA  1 
ATOM   510  C C   . THR A 1 78  ? -49.360 78.939  -120.211 1.00 29.40 ? 78  THR A C   1 
ATOM   511  O O   . THR A 1 78  ? -49.070 79.806  -119.386 1.00 27.71 ? 78  THR A O   1 
ATOM   512  C CB  . THR A 1 78  ? -51.407 77.547  -119.827 1.00 32.95 ? 78  THR A CB  1 
ATOM   513  O OG1 . THR A 1 78  ? -51.959 78.419  -118.835 1.00 33.55 ? 78  THR A OG1 1 
ATOM   514  C CG2 . THR A 1 78  ? -51.924 76.139  -119.604 1.00 32.41 ? 78  THR A CG2 1 
ATOM   515  N N   . LEU A 1 79  ? -49.247 79.112  -121.526 1.00 27.67 ? 79  LEU A N   1 
ATOM   516  C CA  . LEU A 1 79  ? -48.710 80.340  -122.105 1.00 21.39 ? 79  LEU A CA  1 
ATOM   517  C C   . LEU A 1 79  ? -49.465 81.574  -121.619 1.00 20.35 ? 79  LEU A C   1 
ATOM   518  O O   . LEU A 1 79  ? -50.693 81.640  -121.698 1.00 17.63 ? 79  LEU A O   1 
ATOM   519  C CB  . LEU A 1 79  ? -48.744 80.269  -123.632 1.00 21.55 ? 79  LEU A CB  1 
ATOM   520  C CG  . LEU A 1 79  ? -47.736 79.317  -124.280 1.00 21.71 ? 79  LEU A CG  1 
ATOM   521  C CD1 . LEU A 1 79  ? -48.017 79.154  -125.767 1.00 24.73 ? 79  LEU A CD1 1 
ATOM   522  C CD2 . LEU A 1 79  ? -46.311 79.804  -124.057 1.00 16.26 ? 79  LEU A CD2 1 
ATOM   523  N N   . CYS A 1 80  ? -48.716 82.548  -121.112 1.00 18.55 ? 80  CYS A N   1 
ATOM   524  C CA  . CYS A 1 80  ? -49.310 83.727  -120.495 1.00 22.89 ? 80  CYS A CA  1 
ATOM   525  C C   . CYS A 1 80  ? -49.885 84.691  -121.529 1.00 26.95 ? 80  CYS A C   1 
ATOM   526  O O   . CYS A 1 80  ? -49.196 85.120  -122.459 1.00 20.48 ? 80  CYS A O   1 
ATOM   527  C CB  . CYS A 1 80  ? -48.278 84.448  -119.628 1.00 25.07 ? 80  CYS A CB  1 
ATOM   528  S SG  . CYS A 1 80  ? -48.946 85.843  -118.693 1.00 34.79 ? 80  CYS A SG  1 
ATOM   529  N N   . PHE A 1 81  ? -51.154 85.037  -121.351 1.00 25.42 ? 81  PHE A N   1 
ATOM   530  C CA  . PHE A 1 81  ? -51.822 85.948  -122.267 1.00 25.10 ? 81  PHE A CA  1 
ATOM   531  C C   . PHE A 1 81  ? -51.458 87.399  -121.970 1.00 27.49 ? 81  PHE A C   1 
ATOM   532  O O   . PHE A 1 81  ? -51.751 88.291  -122.763 1.00 24.45 ? 81  PHE A O   1 
ATOM   533  C CB  . PHE A 1 81  ? -53.340 85.761  -122.200 1.00 24.25 ? 81  PHE A CB  1 
ATOM   534  C CG  . PHE A 1 81  ? -53.797 84.380  -122.567 1.00 26.17 ? 81  PHE A CG  1 
ATOM   535  C CD1 . PHE A 1 81  ? -53.643 83.905  -123.861 1.00 25.45 ? 81  PHE A CD1 1 
ATOM   536  C CD2 . PHE A 1 81  ? -54.397 83.562  -121.623 1.00 29.88 ? 81  PHE A CD2 1 
ATOM   537  C CE1 . PHE A 1 81  ? -54.071 82.633  -124.203 1.00 25.67 ? 81  PHE A CE1 1 
ATOM   538  C CE2 . PHE A 1 81  ? -54.825 82.292  -121.959 1.00 29.88 ? 81  PHE A CE2 1 
ATOM   539  C CZ  . PHE A 1 81  ? -54.663 81.829  -123.251 1.00 26.34 ? 81  PHE A CZ  1 
ATOM   540  N N   . ARG A 1 82  ? -50.813 87.627  -120.828 1.00 24.40 ? 82  ARG A N   1 
ATOM   541  C CA  . ARG A 1 82  ? -50.461 88.979  -120.400 1.00 26.32 ? 82  ARG A CA  1 
ATOM   542  C C   . ARG A 1 82  ? -49.000 89.333  -120.683 1.00 26.46 ? 82  ARG A C   1 
ATOM   543  O O   . ARG A 1 82  ? -48.519 90.399  -120.293 1.00 41.24 ? 82  ARG A O   1 
ATOM   544  C CB  . ARG A 1 82  ? -50.764 89.146  -118.910 1.00 27.54 ? 82  ARG A CB  1 
ATOM   545  C CG  . ARG A 1 82  ? -52.248 89.052  -118.580 1.00 33.05 ? 82  ARG A CG  1 
ATOM   546  C CD  . ARG A 1 82  ? -52.486 88.897  -117.086 1.00 33.52 ? 82  ARG A CD  1 
ATOM   547  N NE  . ARG A 1 82  ? -53.907 88.756  -116.777 1.00 37.28 ? 82  ARG A NE  1 
ATOM   548  C CZ  . ARG A 1 82  ? -54.392 88.561  -115.554 1.00 38.05 ? 82  ARG A CZ  1 
ATOM   549  N NH1 . ARG A 1 82  ? -53.571 88.483  -114.517 1.00 35.35 ? 82  ARG A NH1 1 
ATOM   550  N NH2 . ARG A 1 82  ? -55.700 88.444  -115.366 1.00 30.79 ? 82  ARG A NH2 1 
ATOM   551  N N   . ASN A 1 83  ? -48.301 88.430  -121.359 1.00 24.85 ? 83  ASN A N   1 
ATOM   552  C CA  . ASN A 1 83  ? -46.950 88.704  -121.837 1.00 37.43 ? 83  ASN A CA  1 
ATOM   553  C C   . ASN A 1 83  ? -46.925 88.705  -123.361 1.00 24.22 ? 83  ASN A C   1 
ATOM   554  O O   . ASN A 1 83  ? -47.449 87.784  -123.985 1.00 34.54 ? 83  ASN A O   1 
ATOM   555  C CB  . ASN A 1 83  ? -45.957 87.674  -121.289 1.00 34.80 ? 83  ASN A CB  1 
ATOM   556  C CG  . ASN A 1 83  ? -44.547 87.889  -121.808 1.00 34.93 ? 83  ASN A CG  1 
ATOM   557  O OD1 . ASN A 1 83  ? -44.204 87.460  -122.913 1.00 35.92 ? 83  ASN A OD1 1 
ATOM   558  N ND2 . ASN A 1 83  ? -43.717 88.549  -121.008 1.00 32.84 ? 83  ASN A ND2 1 
ATOM   559  N N   . LEU A 1 84  ? -46.314 89.732  -123.949 1.00 25.34 ? 84  LEU A N   1 
ATOM   560  C CA  . LEU A 1 84  ? -46.306 89.913  -125.402 1.00 29.67 ? 84  LEU A CA  1 
ATOM   561  C C   . LEU A 1 84  ? -45.772 88.707  -126.175 1.00 23.29 ? 84  LEU A C   1 
ATOM   562  O O   . LEU A 1 84  ? -46.416 88.226  -127.109 1.00 22.43 ? 84  LEU A O   1 
ATOM   563  C CB  . LEU A 1 84  ? -45.484 91.149  -125.773 1.00 32.48 ? 84  LEU A CB  1 
ATOM   564  C CG  . LEU A 1 84  ? -45.168 91.336  -127.263 1.00 32.88 ? 84  LEU A CG  1 
ATOM   565  C CD1 . LEU A 1 84  ? -46.385 91.838  -128.038 1.00 30.63 ? 84  LEU A CD1 1 
ATOM   566  C CD2 . LEU A 1 84  ? -43.974 92.263  -127.465 1.00 34.05 ? 84  LEU A CD2 1 
ATOM   567  N N   . ARG A 1 85  ? -44.596 88.226  -125.788 1.00 27.65 ? 85  ARG A N   1 
ATOM   568  C CA  . ARG A 1 85  ? -43.948 87.138  -126.513 1.00 28.47 ? 85  ARG A CA  1 
ATOM   569  C C   . ARG A 1 85  ? -44.761 85.852  -126.427 1.00 29.98 ? 85  ARG A C   1 
ATOM   570  O O   . ARG A 1 85  ? -44.934 85.148  -127.422 1.00 33.21 ? 85  ARG A O   1 
ATOM   571  C CB  . ARG A 1 85  ? -42.532 86.902  -125.980 1.00 36.84 ? 85  ARG A CB  1 
ATOM   572  C CG  . ARG A 1 85  ? -41.568 86.346  -127.019 1.00 44.23 ? 85  ARG A CG  1 
ATOM   573  C CD  . ARG A 1 85  ? -40.840 85.103  -126.521 1.00 45.27 ? 85  ARG A CD  1 
ATOM   574  N NE  . ARG A 1 85  ? -39.407 85.150  -126.808 1.00 46.58 ? 85  ARG A NE  1 
ATOM   575  C CZ  . ARG A 1 85  ? -38.867 84.883  -127.995 1.00 48.04 ? 85  ARG A CZ  1 
ATOM   576  N NH1 . ARG A 1 85  ? -39.638 84.555  -129.024 1.00 47.04 ? 85  ARG A NH1 1 
ATOM   577  N NH2 . ARG A 1 85  ? -37.552 84.949  -128.154 1.00 51.45 ? 85  ARG A NH2 1 
ATOM   578  N N   . SER A 1 86  ? -45.266 85.552  -125.236 1.00 27.03 ? 86  SER A N   1 
ATOM   579  C CA  . SER A 1 86  ? -46.041 84.334  -125.029 1.00 21.95 ? 86  SER A CA  1 
ATOM   580  C C   . SER A 1 86  ? -47.438 84.444  -125.631 1.00 20.03 ? 86  SER A C   1 
ATOM   581  O O   . SER A 1 86  ? -48.010 83.449  -126.070 1.00 17.51 ? 86  SER A O   1 
ATOM   582  C CB  . SER A 1 86  ? -46.136 84.005  -123.535 1.00 24.62 ? 86  SER A CB  1 
ATOM   583  O OG  . SER A 1 86  ? -46.849 85.006  -122.832 1.00 28.75 ? 86  SER A OG  1 
ATOM   584  N N   . ASN A 1 87  ? -47.988 85.653  -125.647 1.00 21.57 ? 87  ASN A N   1 
ATOM   585  C CA  . ASN A 1 87  ? -49.308 85.872  -126.226 1.00 26.81 ? 87  ASN A CA  1 
ATOM   586  C C   . ASN A 1 87  ? -49.290 85.653  -127.733 1.00 28.08 ? 87  ASN A C   1 
ATOM   587  O O   . ASN A 1 87  ? -50.251 85.145  -128.310 1.00 29.74 ? 87  ASN A O   1 
ATOM   588  C CB  . ASN A 1 87  ? -49.819 87.281  -125.900 1.00 28.78 ? 87  ASN A CB  1 
ATOM   589  C CG  . ASN A 1 87  ? -51.217 87.525  -126.420 1.00 33.43 ? 87  ASN A CG  1 
ATOM   590  O OD1 . ASN A 1 87  ? -51.410 88.222  -127.416 1.00 36.90 ? 87  ASN A OD1 1 
ATOM   591  N ND2 . ASN A 1 87  ? -52.203 86.943  -125.749 1.00 35.80 ? 87  ASN A ND2 1 
ATOM   592  N N   . GLN A 1 88  ? -48.185 86.037  -128.363 1.00 24.41 ? 88  GLN A N   1 
ATOM   593  C CA  . GLN A 1 88  ? -48.004 85.831  -129.796 1.00 25.38 ? 88  GLN A CA  1 
ATOM   594  C C   . GLN A 1 88  ? -48.075 84.350  -130.153 1.00 20.05 ? 88  GLN A C   1 
ATOM   595  O O   . GLN A 1 88  ? -48.750 83.965  -131.107 1.00 18.12 ? 88  GLN A O   1 
ATOM   596  C CB  . GLN A 1 88  ? -46.666 86.414  -130.268 1.00 30.61 ? 88  GLN A CB  1 
ATOM   597  C CG  . GLN A 1 88  ? -46.615 87.931  -130.311 1.00 36.23 ? 88  GLN A CG  1 
ATOM   598  C CD  . GLN A 1 88  ? -45.252 88.452  -130.733 1.00 37.17 ? 88  GLN A CD  1 
ATOM   599  O OE1 . GLN A 1 88  ? -44.243 87.753  -130.624 1.00 36.76 ? 88  GLN A OE1 1 
ATOM   600  N NE2 . GLN A 1 88  ? -45.216 89.688  -131.217 1.00 37.03 ? 88  GLN A NE2 1 
ATOM   601  N N   . ILE A 1 89  ? -47.363 83.527  -129.389 1.00 17.10 ? 89  ILE A N   1 
ATOM   602  C CA  . ILE A 1 89  ? -47.338 82.090  -129.630 1.00 19.26 ? 89  ILE A CA  1 
ATOM   603  C C   . ILE A 1 89  ? -48.724 81.480  -129.427 1.00 20.23 ? 89  ILE A C   1 
ATOM   604  O O   . ILE A 1 89  ? -49.193 80.691  -130.250 1.00 22.21 ? 89  ILE A O   1 
ATOM   605  C CB  . ILE A 1 89  ? -46.323 81.387  -128.709 1.00 15.38 ? 89  ILE A CB  1 
ATOM   606  C CG1 . ILE A 1 89  ? -44.917 81.942  -128.944 1.00 22.79 ? 89  ILE A CG1 1 
ATOM   607  C CG2 . ILE A 1 89  ? -46.343 79.887  -128.937 1.00 14.27 ? 89  ILE A CG2 1 
ATOM   608  C CD1 . ILE A 1 89  ? -43.856 81.323  -128.051 1.00 18.39 ? 89  ILE A CD1 1 
ATOM   609  N N   . ALA A 1 90  ? -49.376 81.864  -128.334 1.00 21.32 ? 90  ALA A N   1 
ATOM   610  C CA  . ALA A 1 90  ? -50.715 81.378  -128.022 1.00 26.45 ? 90  ALA A CA  1 
ATOM   611  C C   . ALA A 1 90  ? -51.721 81.740  -129.117 1.00 16.05 ? 90  ALA A C   1 
ATOM   612  O O   . ALA A 1 90  ? -52.572 80.928  -129.476 1.00 15.62 ? 90  ALA A O   1 
ATOM   613  C CB  . ALA A 1 90  ? -51.173 81.929  -126.676 1.00 16.36 ? 90  ALA A CB  1 
ATOM   614  N N   . GLN A 1 91  ? -51.625 82.961  -129.634 1.00 17.06 ? 91  GLN A N   1 
ATOM   615  C CA  . GLN A 1 91  ? -52.516 83.416  -130.698 1.00 31.77 ? 91  GLN A CA  1 
ATOM   616  C C   . GLN A 1 91  ? -52.318 82.585  -131.958 1.00 29.60 ? 91  GLN A C   1 
ATOM   617  O O   . GLN A 1 91  ? -53.273 82.174  -132.621 1.00 31.58 ? 91  GLN A O   1 
ATOM   618  C CB  . GLN A 1 91  ? -52.268 84.894  -131.004 1.00 29.53 ? 91  GLN A CB  1 
ATOM   619  C CG  . GLN A 1 91  ? -53.172 85.460  -132.085 1.00 34.06 ? 91  GLN A CG  1 
ATOM   620  C CD  . GLN A 1 91  ? -54.618 85.535  -131.645 1.00 39.59 ? 91  GLN A CD  1 
ATOM   621  O OE1 . GLN A 1 91  ? -54.952 86.242  -130.693 1.00 44.26 ? 91  GLN A OE1 1 
ATOM   622  N NE2 . GLN A 1 91  ? -55.486 84.799  -132.330 1.00 38.07 ? 91  GLN A NE2 1 
ATOM   623  N N   . LEU A 1 92  ? -51.051 82.356  -132.271 1.00 25.59 ? 92  LEU A N   1 
ATOM   624  C CA  . LEU A 1 92  ? -50.639 81.569  -133.420 1.00 28.70 ? 92  LEU A CA  1 
ATOM   625  C C   . LEU A 1 92  ? -51.147 80.131  -133.330 1.00 29.01 ? 92  LEU A C   1 
ATOM   626  O O   . LEU A 1 92  ? -51.608 79.557  -134.318 1.00 35.72 ? 92  LEU A O   1 
ATOM   627  C CB  . LEU A 1 92  ? -49.115 81.618  -133.525 1.00 32.59 ? 92  LEU A CB  1 
ATOM   628  C CG  . LEU A 1 92  ? -48.395 81.040  -134.729 1.00 40.29 ? 92  LEU A CG  1 
ATOM   629  C CD1 . LEU A 1 92  ? -47.170 81.879  -134.972 1.00 43.53 ? 92  LEU A CD1 1 
ATOM   630  C CD2 . LEU A 1 92  ? -48.007 79.596  -134.461 1.00 42.43 ? 92  LEU A CD2 1 
ATOM   631  N N   . LEU A 1 93  ? -51.066 79.562  -132.133 1.00 23.03 ? 93  LEU A N   1 
ATOM   632  C CA  . LEU A 1 93  ? -51.592 78.229  -131.874 1.00 20.35 ? 93  LEU A CA  1 
ATOM   633  C C   . LEU A 1 93  ? -53.113 78.214  -131.964 1.00 18.90 ? 93  LEU A C   1 
ATOM   634  O O   . LEU A 1 93  ? -53.708 77.229  -132.398 1.00 15.50 ? 93  LEU A O   1 
ATOM   635  C CB  . LEU A 1 93  ? -51.142 77.734  -130.497 1.00 19.24 ? 93  LEU A CB  1 
ATOM   636  C CG  . LEU A 1 93  ? -49.680 77.309  -130.391 1.00 19.37 ? 93  LEU A CG  1 
ATOM   637  C CD1 . LEU A 1 93  ? -49.203 77.366  -128.952 1.00 17.92 ? 93  LEU A CD1 1 
ATOM   638  C CD2 . LEU A 1 93  ? -49.504 75.909  -130.956 1.00 21.86 ? 93  LEU A CD2 1 
ATOM   639  N N   . ARG A 1 94  ? -53.738 79.312  -131.551 1.00 20.30 ? 94  ARG A N   1 
ATOM   640  C CA  . ARG A 1 94  ? -55.193 79.419  -131.584 1.00 24.55 ? 94  ARG A CA  1 
ATOM   641  C C   . ARG A 1 94  ? -55.699 79.521  -133.018 1.00 24.62 ? 94  ARG A C   1 
ATOM   642  O O   . ARG A 1 94  ? -56.750 78.973  -133.357 1.00 25.67 ? 94  ARG A O   1 
ATOM   643  C CB  . ARG A 1 94  ? -55.668 80.628  -130.778 1.00 26.85 ? 94  ARG A CB  1 
ATOM   644  C CG  . ARG A 1 94  ? -57.157 80.616  -130.470 1.00 30.42 ? 94  ARG A CG  1 
ATOM   645  C CD  . ARG A 1 94  ? -57.618 81.947  -129.891 1.00 36.43 ? 94  ARG A CD  1 
ATOM   646  N NE  . ARG A 1 94  ? -56.532 82.655  -129.221 1.00 42.89 ? 94  ARG A NE  1 
ATOM   647  C CZ  . ARG A 1 94  ? -56.156 82.437  -127.965 1.00 48.21 ? 94  ARG A CZ  1 
ATOM   648  N NH1 . ARG A 1 94  ? -55.155 83.131  -127.441 1.00 46.38 ? 94  ARG A NH1 1 
ATOM   649  N NH2 . ARG A 1 94  ? -56.776 81.522  -127.234 1.00 52.67 ? 94  ARG A NH2 1 
ATOM   650  N N   . ASN A 1 95  ? -54.950 80.233  -133.855 1.00 23.34 ? 95  ASN A N   1 
ATOM   651  C CA  . ASN A 1 95  ? -55.270 80.326  -135.275 1.00 25.63 ? 95  ASN A CA  1 
ATOM   652  C C   . ASN A 1 95  ? -55.280 78.944  -135.916 1.00 25.60 ? 95  ASN A C   1 
ATOM   653  O O   . ASN A 1 95  ? -56.120 78.648  -136.765 1.00 28.79 ? 95  ASN A O   1 
ATOM   654  C CB  . ASN A 1 95  ? -54.272 81.236  -135.999 1.00 25.74 ? 95  ASN A CB  1 
ATOM   655  C CG  . ASN A 1 95  ? -54.391 82.687  -135.576 1.00 27.47 ? 95  ASN A CG  1 
ATOM   656  O OD1 . ASN A 1 95  ? -55.418 83.107  -135.040 1.00 29.13 ? 95  ASN A OD1 1 
ATOM   657  N ND2 . ASN A 1 95  ? -53.344 83.464  -135.827 1.00 28.70 ? 95  ASN A ND2 1 
ATOM   658  N N   . ALA A 1 96  ? -54.334 78.105  -135.504 1.00 17.77 ? 96  ALA A N   1 
ATOM   659  C CA  . ALA A 1 96  ? -54.248 76.736  -135.996 1.00 19.74 ? 96  ALA A CA  1 
ATOM   660  C C   . ALA A 1 96  ? -55.459 75.925  -135.545 1.00 21.62 ? 96  ALA A C   1 
ATOM   661  O O   . ALA A 1 96  ? -56.011 75.131  -136.312 1.00 22.54 ? 96  ALA A O   1 
ATOM   662  C CB  . ALA A 1 96  ? -52.964 76.081  -135.520 1.00 18.73 ? 96  ALA A CB  1 
ATOM   663  N N   . GLY A 1 97  ? -55.866 76.135  -134.296 1.00 18.98 ? 97  GLY A N   1 
ATOM   664  C CA  . GLY A 1 97  ? -57.002 75.437  -133.722 1.00 20.43 ? 97  GLY A CA  1 
ATOM   665  C C   . GLY A 1 97  ? -58.302 75.730  -134.443 1.00 20.94 ? 97  GLY A C   1 
ATOM   666  O O   . GLY A 1 97  ? -59.113 74.827  -134.668 1.00 24.00 ? 97  GLY A O   1 
ATOM   667  N N   . ASP A 1 98  ? -58.499 76.991  -134.816 1.00 18.43 ? 98  ASP A N   1 
ATOM   668  C CA  . ASP A 1 98  ? -59.697 77.392  -135.545 1.00 17.85 ? 98  ASP A CA  1 
ATOM   669  C C   . ASP A 1 98  ? -59.830 76.654  -136.878 1.00 18.14 ? 98  ASP A C   1 
ATOM   670  O O   . ASP A 1 98  ? -60.925 76.536  -137.425 1.00 21.32 ? 98  ASP A O   1 
ATOM   671  C CB  . ASP A 1 98  ? -59.696 78.901  -135.789 1.00 23.22 ? 98  ASP A CB  1 
ATOM   672  C CG  . ASP A 1 98  ? -59.865 79.702  -134.511 1.00 29.53 ? 98  ASP A CG  1 
ATOM   673  O OD1 . ASP A 1 98  ? -60.284 79.123  -133.485 1.00 29.18 ? 98  ASP A OD1 1 
ATOM   674  O OD2 . ASP A 1 98  ? -59.590 80.919  -134.539 1.00 33.54 ? 98  ASP A OD2 1 
ATOM   675  N N   . ALA A 1 99  ? -58.715 76.153  -137.400 1.00 17.43 ? 99  ALA A N   1 
ATOM   676  C CA  . ALA A 1 99  ? -58.743 75.426  -138.665 1.00 21.83 ? 99  ALA A CA  1 
ATOM   677  C C   . ALA A 1 99  ? -59.425 74.063  -138.519 1.00 23.86 ? 99  ALA A C   1 
ATOM   678  O O   . ALA A 1 99  ? -59.834 73.465  -139.510 1.00 29.69 ? 99  ALA A O   1 
ATOM   679  C CB  . ALA A 1 99  ? -57.333 75.259  -139.214 1.00 17.26 ? 99  ALA A CB  1 
ATOM   680  N N   . THR A 1 100 ? -59.558 73.583  -137.284 1.00 19.25 ? 100 THR A N   1 
ATOM   681  C CA  . THR A 1 100 ? -60.175 72.279  -137.030 1.00 19.04 ? 100 THR A CA  1 
ATOM   682  C C   . THR A 1 100 ? -61.689 72.305  -137.221 1.00 24.78 ? 100 THR A C   1 
ATOM   683  O O   . THR A 1 100 ? -62.325 71.258  -137.344 1.00 31.76 ? 100 THR A O   1 
ATOM   684  C CB  . THR A 1 100 ? -59.870 71.770  -135.607 1.00 18.87 ? 100 THR A CB  1 
ATOM   685  O OG1 . THR A 1 100 ? -60.334 72.721  -134.643 1.00 16.11 ? 100 THR A OG1 1 
ATOM   686  C CG2 . THR A 1 100 ? -58.377 71.551  -135.428 1.00 20.96 ? 100 THR A CG2 1 
ATOM   687  N N   . LYS A 1 101 ? -62.259 73.505  -137.232 1.00 24.67 ? 101 LYS A N   1 
ATOM   688  C CA  . LYS A 1 101 ? -63.698 73.678  -137.400 1.00 31.45 ? 101 LYS A CA  1 
ATOM   689  C C   . LYS A 1 101 ? -64.182 73.144  -138.743 1.00 36.33 ? 101 LYS A C   1 
ATOM   690  O O   . LYS A 1 101 ? -65.165 72.403  -138.811 1.00 41.57 ? 101 LYS A O   1 
ATOM   691  C CB  . LYS A 1 101 ? -64.078 75.155  -137.260 1.00 36.24 ? 101 LYS A CB  1 
ATOM   692  C CG  . LYS A 1 101 ? -64.197 75.630  -135.819 1.00 41.00 ? 101 LYS A CG  1 
ATOM   693  C CD  . LYS A 1 101 ? -63.430 76.924  -135.581 1.00 43.54 ? 101 LYS A CD  1 
ATOM   694  C CE  . LYS A 1 101 ? -64.362 78.098  -135.330 1.00 46.65 ? 101 LYS A CE  1 
ATOM   695  N NZ  . LYS A 1 101 ? -63.622 79.391  -135.298 1.00 50.00 ? 101 LYS A NZ  1 
ATOM   696  N N   . ASP A 1 102 ? -63.484 73.526  -139.808 1.00 34.77 ? 102 ASP A N   1 
ATOM   697  C CA  . ASP A 1 102 ? -63.842 73.105  -141.158 1.00 35.07 ? 102 ASP A CA  1 
ATOM   698  C C   . ASP A 1 102 ? -63.061 71.862  -141.572 1.00 33.92 ? 102 ASP A C   1 
ATOM   699  O O   . ASP A 1 102 ? -63.347 71.251  -142.600 1.00 40.70 ? 102 ASP A O   1 
ATOM   700  C CB  . ASP A 1 102 ? -63.595 74.242  -142.153 1.00 37.52 ? 102 ASP A CB  1 
ATOM   701  C CG  . ASP A 1 102 ? -64.449 75.463  -141.866 1.00 39.44 ? 102 ASP A CG  1 
ATOM   702  O OD1 . ASP A 1 102 ? -65.553 75.296  -141.305 1.00 37.90 ? 102 ASP A OD1 1 
ATOM   703  O OD2 . ASP A 1 102 ? -64.026 76.587  -142.211 1.00 42.22 ? 102 ASP A OD2 1 
ATOM   704  N N   . GLY A 1 103 ? -62.063 71.504  -140.771 1.00 26.55 ? 103 GLY A N   1 
ATOM   705  C CA  . GLY A 1 103 ? -61.275 70.310  -141.021 1.00 24.63 ? 103 GLY A CA  1 
ATOM   706  C C   . GLY A 1 103 ? -60.118 70.540  -141.976 1.00 22.61 ? 103 GLY A C   1 
ATOM   707  O O   . GLY A 1 103 ? -59.797 69.678  -142.796 1.00 20.49 ? 103 GLY A O   1 
ATOM   708  N N   . PHE A 1 104 ? -59.479 71.699  -141.856 1.00 22.78 ? 104 PHE A N   1 
ATOM   709  C CA  . PHE A 1 104 ? -58.422 72.099  -142.779 1.00 21.67 ? 104 PHE A CA  1 
ATOM   710  C C   . PHE A 1 104 ? -57.011 71.878  -142.222 1.00 19.47 ? 104 PHE A C   1 
ATOM   711  O O   . PHE A 1 104 ? -56.020 72.180  -142.888 1.00 20.95 ? 104 PHE A O   1 
ATOM   712  C CB  . PHE A 1 104 ? -58.595 73.574  -143.157 1.00 26.68 ? 104 PHE A CB  1 
ATOM   713  C CG  . PHE A 1 104 ? -59.846 73.867  -143.947 1.00 31.99 ? 104 PHE A CG  1 
ATOM   714  C CD1 . PHE A 1 104 ? -60.543 72.857  -144.597 1.00 34.81 ? 104 PHE A CD1 1 
ATOM   715  C CD2 . PHE A 1 104 ? -60.315 75.167  -144.048 1.00 34.38 ? 104 PHE A CD2 1 
ATOM   716  C CE1 . PHE A 1 104 ? -61.690 73.144  -145.327 1.00 37.10 ? 104 PHE A CE1 1 
ATOM   717  C CE2 . PHE A 1 104 ? -61.456 75.460  -144.773 1.00 35.05 ? 104 PHE A CE2 1 
ATOM   718  C CZ  . PHE A 1 104 ? -62.145 74.447  -145.413 1.00 36.38 ? 104 PHE A CZ  1 
ATOM   719  N N   . LEU A 1 105 ? -56.921 71.361  -141.001 1.00 20.20 ? 105 LEU A N   1 
ATOM   720  C CA  . LEU A 1 105 ? -55.631 71.200  -140.336 1.00 24.08 ? 105 LEU A CA  1 
ATOM   721  C C   . LEU A 1 105 ? -55.252 69.735  -140.179 1.00 27.06 ? 105 LEU A C   1 
ATOM   722  O O   . LEU A 1 105 ? -55.847 69.011  -139.377 1.00 31.94 ? 105 LEU A O   1 
ATOM   723  C CB  . LEU A 1 105 ? -55.647 71.879  -138.962 1.00 24.06 ? 105 LEU A CB  1 
ATOM   724  C CG  . LEU A 1 105 ? -54.427 71.624  -138.074 1.00 28.04 ? 105 LEU A CG  1 
ATOM   725  C CD1 . LEU A 1 105 ? -53.160 72.156  -138.730 1.00 29.04 ? 105 LEU A CD1 1 
ATOM   726  C CD2 . LEU A 1 105 ? -54.621 72.230  -136.688 1.00 31.43 ? 105 LEU A CD2 1 
ATOM   727  N N   . LYS A 1 106 ? -54.344 69.256  -141.020 1.00 22.09 ? 106 LYS A N   1 
ATOM   728  C CA  . LYS A 1 106 ? -53.788 67.918  -140.847 1.00 21.49 ? 106 LYS A CA  1 
ATOM   729  C C   . LYS A 1 106 ? -52.847 67.717  -139.668 1.00 18.89 ? 106 LYS A C   1 
ATOM   730  O O   . LYS A 1 106 ? -52.953 66.739  -138.947 1.00 18.24 ? 106 LYS A O   1 
ATOM   731  C CB  . LYS A 1 106 ? -53.115 67.413  -142.123 1.00 21.58 ? 106 LYS A CB  1 
ATOM   732  C CG  . LYS A 1 106 ? -52.556 66.006  -141.980 1.00 19.34 ? 106 LYS A CG  1 
ATOM   733  C CD  . LYS A 1 106 ? -52.106 65.425  -143.302 1.00 20.86 ? 106 LYS A CD  1 
ATOM   734  C CE  . LYS A 1 106 ? -53.284 65.113  -144.185 1.00 25.77 ? 106 LYS A CE  1 
ATOM   735  N NZ  . LYS A 1 106 ? -52.929 65.242  -145.614 1.00 33.03 ? 106 LYS A NZ  1 
ATOM   736  N N   . GLU A 1 107 ? -51.925 68.649  -139.482 1.00 17.07 ? 107 GLU A N   1 
ATOM   737  C CA  . GLU A 1 107 ? -50.900 68.504  -138.455 1.00 17.68 ? 107 GLU A CA  1 
ATOM   738  C C   . GLU A 1 107 ? -50.350 69.856  -138.016 1.00 13.16 ? 107 GLU A C   1 
ATOM   739  O O   . GLU A 1 107 ? -50.115 70.731  -138.847 1.00 18.75 ? 107 GLU A O   1 
ATOM   740  C CB  . GLU A 1 107 ? -49.759 67.619  -138.971 1.00 13.80 ? 107 GLU A CB  1 
ATOM   741  C CG  . GLU A 1 107 ? -48.554 67.549  -138.049 1.00 18.29 ? 107 GLU A CG  1 
ATOM   742  C CD  . GLU A 1 107 ? -47.443 66.679  -138.604 1.00 23.63 ? 107 GLU A CD  1 
ATOM   743  O OE1 . GLU A 1 107 ? -47.663 66.024  -139.646 1.00 26.34 ? 107 GLU A OE1 1 
ATOM   744  O OE2 . GLU A 1 107 ? -46.352 66.656  -137.994 1.00 22.01 ? 107 GLU A OE2 1 
ATOM   745  N N   . VAL A 1 108 ? -50.161 70.030  -136.712 1.00 12.93 ? 108 VAL A N   1 
ATOM   746  C CA  . VAL A 1 108 ? -49.437 71.188  -136.201 1.00 13.12 ? 108 VAL A CA  1 
ATOM   747  C C   . VAL A 1 108 ? -48.337 70.666  -135.285 1.00 16.85 ? 108 VAL A C   1 
ATOM   748  O O   . VAL A 1 108 ? -48.570 69.764  -134.478 1.00 20.60 ? 108 VAL A O   1 
ATOM   749  C CB  . VAL A 1 108 ? -50.364 72.185  -135.464 1.00 15.43 ? 108 VAL A CB  1 
ATOM   750  C CG1 . VAL A 1 108 ? -51.006 71.539  -134.245 1.00 11.74 ? 108 VAL A CG1 1 
ATOM   751  C CG2 . VAL A 1 108 ? -49.598 73.445  -135.071 1.00 18.24 ? 108 VAL A CG2 1 
ATOM   752  N N   . SER A 1 109 ? -47.129 71.203  -135.437 1.00 20.03 ? 109 SER A N   1 
ATOM   753  C CA  . SER A 1 109 ? -45.973 70.664  -134.730 1.00 19.67 ? 109 SER A CA  1 
ATOM   754  C C   . SER A 1 109 ? -44.933 71.720  -134.362 1.00 21.60 ? 109 SER A C   1 
ATOM   755  O O   . SER A 1 109 ? -44.694 72.667  -135.116 1.00 18.49 ? 109 SER A O   1 
ATOM   756  C CB  . SER A 1 109 ? -45.304 69.570  -135.572 1.00 16.08 ? 109 SER A CB  1 
ATOM   757  O OG  . SER A 1 109 ? -46.210 68.533  -135.884 1.00 13.41 ? 109 SER A OG  1 
ATOM   758  N N   . LEU A 1 110 ? -44.321 71.539  -133.194 1.00 22.88 ? 110 LEU A N   1 
ATOM   759  C CA  . LEU A 1 110 ? -43.179 72.346  -132.787 1.00 19.13 ? 110 LEU A CA  1 
ATOM   760  C C   . LEU A 1 110 ? -41.902 71.679  -133.278 1.00 16.65 ? 110 LEU A C   1 
ATOM   761  O O   . LEU A 1 110 ? -41.608 70.544  -132.897 1.00 14.20 ? 110 LEU A O   1 
ATOM   762  C CB  . LEU A 1 110 ? -43.133 72.517  -131.272 1.00 16.83 ? 110 LEU A CB  1 
ATOM   763  C CG  . LEU A 1 110 ? -41.917 73.308  -130.788 1.00 16.58 ? 110 LEU A CG  1 
ATOM   764  C CD1 . LEU A 1 110 ? -42.046 74.773  -131.174 1.00 15.37 ? 110 LEU A CD1 1 
ATOM   765  C CD2 . LEU A 1 110 ? -41.725 73.152  -129.291 1.00 18.80 ? 110 LEU A CD2 1 
ATOM   766  N N   . VAL A 1 111 ? -41.147 72.376  -134.119 1.00 17.43 ? 111 VAL A N   1 
ATOM   767  C CA  . VAL A 1 111 ? -39.982 71.776  -134.760 1.00 16.21 ? 111 VAL A CA  1 
ATOM   768  C C   . VAL A 1 111 ? -38.671 72.399  -134.284 1.00 14.05 ? 111 VAL A C   1 
ATOM   769  O O   . VAL A 1 111 ? -38.444 73.598  -134.453 1.00 14.67 ? 111 VAL A O   1 
ATOM   770  C CB  . VAL A 1 111 ? -40.074 71.898  -136.289 1.00 14.00 ? 111 VAL A CB  1 
ATOM   771  C CG1 . VAL A 1 111 ? -38.851 71.276  -136.943 1.00 14.80 ? 111 VAL A CG1 1 
ATOM   772  C CG2 . VAL A 1 111 ? -41.349 71.235  -136.792 1.00 13.98 ? 111 VAL A CG2 1 
ATOM   773  N N   . ILE A 1 112 ? -37.812 71.570  -133.697 1.00 15.15 ? 112 ILE A N   1 
ATOM   774  C CA  . ILE A 1 112 ? -36.527 72.024  -133.176 1.00 15.51 ? 112 ILE A CA  1 
ATOM   775  C C   . ILE A 1 112 ? -35.385 71.565  -134.078 1.00 22.69 ? 112 ILE A C   1 
ATOM   776  O O   . ILE A 1 112 ? -35.264 70.375  -134.380 1.00 16.02 ? 112 ILE A O   1 
ATOM   777  C CB  . ILE A 1 112 ? -36.282 71.506  -131.748 1.00 14.82 ? 112 ILE A CB  1 
ATOM   778  C CG1 . ILE A 1 112 ? -37.498 71.783  -130.864 1.00 14.60 ? 112 ILE A CG1 1 
ATOM   779  C CG2 . ILE A 1 112 ? -35.025 72.127  -131.160 1.00 16.25 ? 112 ILE A CG2 1 
ATOM   780  C CD1 . ILE A 1 112 ? -37.362 71.252  -129.454 1.00 15.03 ? 112 ILE A CD1 1 
ATOM   781  N N   . THR A 1 113 ? -34.551 72.513  -134.499 1.00 19.49 ? 113 THR A N   1 
ATOM   782  C CA  . THR A 1 113 ? -33.430 72.218  -135.387 1.00 20.45 ? 113 THR A CA  1 
ATOM   783  C C   . THR A 1 113 ? -32.131 72.800  -134.838 1.00 23.59 ? 113 THR A C   1 
ATOM   784  O O   . THR A 1 113 ? -32.153 73.611  -133.913 1.00 26.97 ? 113 THR A O   1 
ATOM   785  C CB  . THR A 1 113 ? -33.673 72.770  -136.807 1.00 22.06 ? 113 THR A CB  1 
ATOM   786  O OG1 . THR A 1 113 ? -33.928 74.178  -136.739 1.00 22.94 ? 113 THR A OG1 1 
ATOM   787  C CG2 . THR A 1 113 ? -34.858 72.077  -137.457 1.00 17.53 ? 113 THR A CG2 1 
ATOM   788  N N   . ASN A 1 114 ? -31.002 72.381  -135.405 1.00 25.75 ? 114 ASN A N   1 
ATOM   789  C CA  . ASN A 1 114 ? -29.716 72.973  -135.056 1.00 30.39 ? 114 ASN A CA  1 
ATOM   790  C C   . ASN A 1 114 ? -29.649 74.413  -135.534 1.00 30.06 ? 114 ASN A C   1 
ATOM   791  O O   . ASN A 1 114 ? -29.203 75.305  -134.811 1.00 29.57 ? 114 ASN A O   1 
ATOM   792  C CB  . ASN A 1 114 ? -28.555 72.181  -135.661 1.00 35.50 ? 114 ASN A CB  1 
ATOM   793  C CG  . ASN A 1 114 ? -28.361 70.829  -135.008 1.00 40.16 ? 114 ASN A CG  1 
ATOM   794  O OD1 . ASN A 1 114 ? -28.197 69.817  -135.692 1.00 43.51 ? 114 ASN A OD1 1 
ATOM   795  N ND2 . ASN A 1 114 ? -28.366 70.804  -133.678 1.00 37.71 ? 114 ASN A ND2 1 
ATOM   796  N N   . ASN A 1 115 ? -30.086 74.629  -136.768 1.00 27.66 ? 115 ASN A N   1 
ATOM   797  C CA  . ASN A 1 115 ? -30.090 75.962  -137.348 1.00 26.95 ? 115 ASN A CA  1 
ATOM   798  C C   . ASN A 1 115 ? -31.458 76.355  -137.871 1.00 23.26 ? 115 ASN A C   1 
ATOM   799  O O   . ASN A 1 115 ? -32.244 75.500  -138.283 1.00 23.91 ? 115 ASN A O   1 
ATOM   800  C CB  . ASN A 1 115 ? -29.063 76.059  -138.474 1.00 36.35 ? 115 ASN A CB  1 
ATOM   801  C CG  . ASN A 1 115 ? -27.677 76.379  -137.966 1.00 45.16 ? 115 ASN A CG  1 
ATOM   802  O OD1 . ASN A 1 115 ? -27.387 77.519  -137.598 1.00 51.41 ? 115 ASN A OD1 1 
ATOM   803  N ND2 . ASN A 1 115 ? -26.807 75.377  -137.947 1.00 45.81 ? 115 ASN A ND2 1 
ATOM   804  N N   . GLU A 1 116 ? -31.729 77.656  -137.857 1.00 24.33 ? 116 GLU A N   1 
ATOM   805  C CA  . GLU A 1 116 ? -32.975 78.186  -138.388 1.00 25.47 ? 116 GLU A CA  1 
ATOM   806  C C   . GLU A 1 116 ? -33.161 77.841  -139.857 1.00 24.16 ? 116 GLU A C   1 
ATOM   807  O O   . GLU A 1 116 ? -32.274 78.084  -140.679 1.00 25.12 ? 116 GLU A O   1 
ATOM   808  C CB  . GLU A 1 116 ? -33.027 79.700  -138.217 1.00 36.24 ? 116 GLU A CB  1 
ATOM   809  C CG  . GLU A 1 116 ? -34.043 80.373  -139.128 1.00 51.43 ? 116 GLU A CG  1 
ATOM   810  C CD  . GLU A 1 116 ? -34.478 81.723  -138.612 1.00 62.71 ? 116 GLU A CD  1 
ATOM   811  O OE1 . GLU A 1 116 ? -33.892 82.196  -137.616 1.00 66.74 ? 116 GLU A OE1 1 
ATOM   812  O OE2 . GLU A 1 116 ? -35.412 82.310  -139.199 1.00 64.98 ? 116 GLU A OE2 1 
ATOM   813  N N   . GLY A 1 117 ? -34.318 77.273  -140.182 1.00 22.99 ? 117 GLY A N   1 
ATOM   814  C CA  . GLY A 1 117 ? -34.659 76.997  -141.562 1.00 27.89 ? 117 GLY A CA  1 
ATOM   815  C C   . GLY A 1 117 ? -34.285 75.606  -142.037 1.00 27.95 ? 117 GLY A C   1 
ATOM   816  O O   . GLY A 1 117 ? -34.605 75.231  -143.168 1.00 29.60 ? 117 GLY A O   1 
ATOM   817  N N   . ASP A 1 118 ? -33.605 74.844  -141.183 1.00 26.70 ? 118 ASP A N   1 
ATOM   818  C CA  . ASP A 1 118 ? -33.231 73.471  -141.511 1.00 27.39 ? 118 ASP A CA  1 
ATOM   819  C C   . ASP A 1 118 ? -34.458 72.614  -141.814 1.00 30.11 ? 118 ASP A C   1 
ATOM   820  O O   . ASP A 1 118 ? -35.499 72.749  -141.163 1.00 19.20 ? 118 ASP A O   1 
ATOM   821  C CB  . ASP A 1 118 ? -32.428 72.840  -140.368 1.00 27.36 ? 118 ASP A CB  1 
ATOM   822  C CG  . ASP A 1 118 ? -31.007 73.362  -140.291 1.00 30.99 ? 118 ASP A CG  1 
ATOM   823  O OD1 . ASP A 1 118 ? -30.569 74.042  -141.242 1.00 33.07 ? 118 ASP A OD1 1 
ATOM   824  O OD2 . ASP A 1 118 ? -30.326 73.079  -139.283 1.00 31.61 ? 118 ASP A OD2 1 
ATOM   825  N N   . LEU A 1 119 ? -34.334 71.739  -142.808 1.00 28.79 ? 119 LEU A N   1 
ATOM   826  C CA  . LEU A 1 119 ? -35.415 70.826  -143.161 1.00 25.36 ? 119 LEU A CA  1 
ATOM   827  C C   . LEU A 1 119 ? -35.516 69.699  -142.140 1.00 19.85 ? 119 LEU A C   1 
ATOM   828  O O   . LEU A 1 119 ? -36.610 69.280  -141.763 1.00 18.91 ? 119 LEU A O   1 
ATOM   829  C CB  . LEU A 1 119 ? -35.198 70.241  -144.558 1.00 23.12 ? 119 LEU A CB  1 
ATOM   830  C CG  . LEU A 1 119 ? -35.157 71.173  -145.767 1.00 31.66 ? 119 LEU A CG  1 
ATOM   831  C CD1 . LEU A 1 119 ? -34.711 70.407  -147.001 1.00 24.57 ? 119 LEU A CD1 1 
ATOM   832  C CD2 . LEU A 1 119 ? -36.516 71.815  -146.005 1.00 39.20 ? 119 LEU A CD2 1 
ATOM   833  N N   . GLU A 1 120 ? -34.359 69.217  -141.698 1.00 20.40 ? 120 GLU A N   1 
ATOM   834  C CA  . GLU A 1 120 ? -34.286 68.041  -140.840 1.00 21.94 ? 120 GLU A CA  1 
ATOM   835  C C   . GLU A 1 120 ? -34.234 68.410  -139.362 1.00 20.55 ? 120 GLU A C   1 
ATOM   836  O O   . GLU A 1 120 ? -33.361 69.166  -138.926 1.00 20.30 ? 120 GLU A O   1 
ATOM   837  C CB  . GLU A 1 120 ? -33.071 67.192  -141.203 1.00 21.44 ? 120 GLU A CB  1 
ATOM   838  C CG  . GLU A 1 120 ? -33.024 65.868  -140.470 1.00 28.36 ? 120 GLU A CG  1 
ATOM   839  C CD  . GLU A 1 120 ? -31.804 65.048  -140.833 1.00 31.78 ? 120 GLU A CD  1 
ATOM   840  O OE1 . GLU A 1 120 ? -30.697 65.390  -140.366 1.00 32.06 ? 120 GLU A OE1 1 
ATOM   841  O OE2 . GLU A 1 120 ? -31.957 64.059  -141.580 1.00 31.42 ? 120 GLU A OE2 1 
ATOM   842  N N   . ALA A 1 121 ? -35.160 67.852  -138.589 1.00 18.88 ? 121 ALA A N   1 
ATOM   843  C CA  . ALA A 1 121 ? -35.333 68.263  -137.203 1.00 18.25 ? 121 ALA A CA  1 
ATOM   844  C C   . ALA A 1 121 ? -34.485 67.440  -136.236 1.00 23.71 ? 121 ALA A C   1 
ATOM   845  O O   . ALA A 1 121 ? -34.154 66.285  -136.508 1.00 23.65 ? 121 ALA A O   1 
ATOM   846  C CB  . ALA A 1 121 ? -36.799 68.176  -136.823 1.00 16.03 ? 121 ALA A CB  1 
ATOM   847  N N   . ILE A 1 122 ? -34.134 68.050  -135.108 1.00 27.78 ? 122 ILE A N   1 
ATOM   848  C CA  . ILE A 1 122 ? -33.480 67.343  -134.018 1.00 34.10 ? 122 ILE A CA  1 
ATOM   849  C C   . ILE A 1 122 ? -34.554 66.703  -133.152 1.00 32.44 ? 122 ILE A C   1 
ATOM   850  O O   . ILE A 1 122 ? -34.405 65.583  -132.655 1.00 35.54 ? 122 ILE A O   1 
ATOM   851  C CB  . ILE A 1 122 ? -32.614 68.288  -133.156 1.00 40.34 ? 122 ILE A CB  1 
ATOM   852  C CG1 . ILE A 1 122 ? -31.440 68.823  -133.969 1.00 44.38 ? 122 ILE A CG1 1 
ATOM   853  C CG2 . ILE A 1 122 ? -32.125 67.581  -131.899 1.00 43.91 ? 122 ILE A CG2 1 
ATOM   854  C CD1 . ILE A 1 122 ? -30.695 69.954  -133.287 1.00 49.42 ? 122 ILE A CD1 1 
ATOM   855  N N   . GLU A 1 123 ? -35.652 67.435  -132.997 1.00 27.26 ? 123 GLU A N   1 
ATOM   856  C CA  . GLU A 1 123 ? -36.738 67.030  -132.123 1.00 25.75 ? 123 GLU A CA  1 
ATOM   857  C C   . GLU A 1 123 ? -38.059 67.621  -132.599 1.00 23.22 ? 123 GLU A C   1 
ATOM   858  O O   . GLU A 1 123 ? -38.110 68.777  -133.030 1.00 25.79 ? 123 GLU A O   1 
ATOM   859  C CB  . GLU A 1 123 ? -36.450 67.464  -130.685 1.00 28.39 ? 123 GLU A CB  1 
ATOM   860  C CG  . GLU A 1 123 ? -37.514 67.057  -129.683 1.00 29.98 ? 123 GLU A CG  1 
ATOM   861  C CD  . GLU A 1 123 ? -37.050 67.240  -128.254 1.00 33.50 ? 123 GLU A CD  1 
ATOM   862  O OE1 . GLU A 1 123 ? -36.373 66.329  -127.731 1.00 30.72 ? 123 GLU A OE1 1 
ATOM   863  O OE2 . GLU A 1 123 ? -37.355 68.295  -127.659 1.00 37.39 ? 123 GLU A OE2 1 
ATOM   864  N N   . VAL A 1 124 ? -39.123 66.823  -132.525 1.00 19.35 ? 124 VAL A N   1 
ATOM   865  C CA  . VAL A 1 124 ? -40.456 67.264  -132.932 1.00 18.67 ? 124 VAL A CA  1 
ATOM   866  C C   . VAL A 1 124 ? -41.531 66.838  -131.929 1.00 18.81 ? 124 VAL A C   1 
ATOM   867  O O   . VAL A 1 124 ? -41.540 65.698  -131.453 1.00 15.71 ? 124 VAL A O   1 
ATOM   868  C CB  . VAL A 1 124 ? -40.839 66.709  -134.324 1.00 18.32 ? 124 VAL A CB  1 
ATOM   869  C CG1 . VAL A 1 124 ? -42.288 67.051  -134.668 1.00 22.50 ? 124 VAL A CG1 1 
ATOM   870  C CG2 . VAL A 1 124 ? -39.906 67.239  -135.395 1.00 15.78 ? 124 VAL A CG2 1 
ATOM   871  N N   . PHE A 1 125 ? -42.424 67.768  -131.603 1.00 19.23 ? 125 PHE A N   1 
ATOM   872  C CA  . PHE A 1 125 ? -43.640 67.451  -130.869 1.00 16.02 ? 125 PHE A CA  1 
ATOM   873  C C   . PHE A 1 125 ? -44.829 67.667  -131.795 1.00 15.79 ? 125 PHE A C   1 
ATOM   874  O O   . PHE A 1 125 ? -45.194 68.804  -132.099 1.00 14.10 ? 125 PHE A O   1 
ATOM   875  C CB  . PHE A 1 125 ? -43.757 68.304  -129.609 1.00 14.28 ? 125 PHE A CB  1 
ATOM   876  C CG  . PHE A 1 125 ? -42.763 67.941  -128.548 1.00 13.74 ? 125 PHE A CG  1 
ATOM   877  C CD1 . PHE A 1 125 ? -41.475 68.445  -128.586 1.00 14.13 ? 125 PHE A CD1 1 
ATOM   878  C CD2 . PHE A 1 125 ? -43.113 67.085  -127.518 1.00 16.02 ? 125 PHE A CD2 1 
ATOM   879  C CE1 . PHE A 1 125 ? -40.554 68.106  -127.611 1.00 17.28 ? 125 PHE A CE1 1 
ATOM   880  C CE2 . PHE A 1 125 ? -42.196 66.742  -126.540 1.00 17.51 ? 125 PHE A CE2 1 
ATOM   881  C CZ  . PHE A 1 125 ? -40.917 67.254  -126.586 1.00 12.22 ? 125 PHE A CZ  1 
ATOM   882  N N   . SER A 1 126 ? -45.419 66.567  -132.254 1.00 16.95 ? 126 SER A N   1 
ATOM   883  C CA  . SER A 1 126 ? -46.408 66.625  -133.322 1.00 23.40 ? 126 SER A CA  1 
ATOM   884  C C   . SER A 1 126 ? -47.816 66.289  -132.856 1.00 20.67 ? 126 SER A C   1 
ATOM   885  O O   . SER A 1 126 ? -48.017 65.364  -132.076 1.00 21.01 ? 126 SER A O   1 
ATOM   886  C CB  . SER A 1 126 ? -46.008 65.678  -134.458 1.00 27.32 ? 126 SER A CB  1 
ATOM   887  O OG  . SER A 1 126 ? -45.897 64.341  -133.997 1.00 27.84 ? 126 SER A OG  1 
ATOM   888  N N   . MET A 1 127 ? -48.791 67.066  -133.293 1.00 16.48 ? 127 MET A N   1 
ATOM   889  C CA  . MET A 1 127 ? -50.188 66.713  -133.116 1.00 13.79 ? 127 MET A CA  1 
ATOM   890  C C   . MET A 1 127 ? -50.820 66.564  -134.494 1.00 15.85 ? 127 MET A C   1 
ATOM   891  O O   . MET A 1 127 ? -50.805 67.492  -135.285 1.00 16.37 ? 127 MET A O   1 
ATOM   892  C CB  . MET A 1 127 ? -50.940 67.770  -132.298 1.00 15.38 ? 127 MET A CB  1 
ATOM   893  C CG  . MET A 1 127 ? -50.356 68.091  -130.927 1.00 22.38 ? 127 MET A CG  1 
ATOM   894  S SD  . MET A 1 127 ? -51.414 69.048  -129.809 1.00 35.25 ? 127 MET A SD  1 
ATOM   895  C CE  . MET A 1 127 ? -52.953 68.186  -130.047 1.00 16.28 ? 127 MET A CE  1 
ATOM   896  N N   . LYS A 1 128 ? -51.389 65.396  -134.761 1.00 17.75 ? 128 LYS A N   1 
ATOM   897  C CA  . LYS A 1 128 ? -51.981 65.096  -136.063 1.00 14.99 ? 128 LYS A CA  1 
ATOM   898  C C   . LYS A 1 128 ? -53.475 64.817  -135.945 1.00 17.43 ? 128 LYS A C   1 
ATOM   899  O O   . LYS A 1 128 ? -53.909 64.117  -135.034 1.00 19.69 ? 128 LYS A O   1 
ATOM   900  C CB  . LYS A 1 128 ? -51.268 63.908  -136.703 1.00 16.22 ? 128 LYS A CB  1 
ATOM   901  C CG  . LYS A 1 128 ? -49.758 64.079  -136.776 1.00 18.99 ? 128 LYS A CG  1 
ATOM   902  C CD  . LYS A 1 128 ? -49.100 62.897  -137.465 1.00 16.78 ? 128 LYS A CD  1 
ATOM   903  C CE  . LYS A 1 128 ? -47.588 63.051  -137.491 1.00 19.08 ? 128 LYS A CE  1 
ATOM   904  N NZ  . LYS A 1 128 ? -46.933 61.957  -138.260 1.00 24.20 ? 128 LYS A NZ  1 
ATOM   905  N N   . PHE A 1 129 ? -54.253 65.347  -136.882 1.00 20.01 ? 129 PHE A N   1 
ATOM   906  C CA  . PHE A 1 129 ? -55.703 65.362  -136.739 1.00 24.15 ? 129 PHE A CA  1 
ATOM   907  C C   . PHE A 1 129 ? -56.438 64.543  -137.793 1.00 19.82 ? 129 PHE A C   1 
ATOM   908  O O   . PHE A 1 129 ? -55.956 64.355  -138.910 1.00 17.86 ? 129 PHE A O   1 
ATOM   909  C CB  . PHE A 1 129 ? -56.208 66.805  -136.773 1.00 27.88 ? 129 PHE A CB  1 
ATOM   910  C CG  . PHE A 1 129 ? -55.583 67.684  -135.733 1.00 26.61 ? 129 PHE A CG  1 
ATOM   911  C CD1 . PHE A 1 129 ? -54.361 68.296  -135.966 1.00 24.96 ? 129 PHE A CD1 1 
ATOM   912  C CD2 . PHE A 1 129 ? -56.213 67.897  -134.521 1.00 25.36 ? 129 PHE A CD2 1 
ATOM   913  C CE1 . PHE A 1 129 ? -53.783 69.100  -135.008 1.00 26.95 ? 129 PHE A CE1 1 
ATOM   914  C CE2 . PHE A 1 129 ? -55.638 68.702  -133.560 1.00 22.07 ? 129 PHE A CE2 1 
ATOM   915  C CZ  . PHE A 1 129 ? -54.422 69.302  -133.804 1.00 24.19 ? 129 PHE A CZ  1 
ATOM   916  N N   . ILE A 1 130 ? -57.618 64.064  -137.412 1.00 18.94 ? 130 ILE A N   1 
ATOM   917  C CA  . ILE A 1 130 ? -58.523 63.383  -138.325 1.00 22.35 ? 130 ILE A CA  1 
ATOM   918  C C   . ILE A 1 130 ? -59.912 63.962  -138.090 1.00 19.21 ? 130 ILE A C   1 
ATOM   919  O O   . ILE A 1 130 ? -60.193 64.478  -137.007 1.00 17.22 ? 130 ILE A O   1 
ATOM   920  C CB  . ILE A 1 130 ? -58.513 61.851  -138.113 1.00 33.84 ? 130 ILE A CB  1 
ATOM   921  C CG1 . ILE A 1 130 ? -58.358 61.130  -139.450 1.00 39.17 ? 130 ILE A CG1 1 
ATOM   922  C CG2 . ILE A 1 130 ? -59.760 61.375  -137.372 1.00 41.16 ? 130 ILE A CG2 1 
ATOM   923  C CD1 . ILE A 1 130 ? -57.034 61.389  -140.118 1.00 41.08 ? 130 ILE A CD1 1 
ATOM   924  N N   . TYR A 1 131 ? -60.778 63.897  -139.095 1.00 19.11 ? 131 TYR A N   1 
ATOM   925  C CA  . TYR A 1 131 ? -62.088 64.522  -138.971 1.00 21.80 ? 131 TYR A CA  1 
ATOM   926  C C   . TYR A 1 131 ? -63.226 63.562  -139.282 1.00 26.71 ? 131 TYR A C   1 
ATOM   927  O O   . TYR A 1 131 ? -63.063 62.596  -140.027 1.00 30.43 ? 131 TYR A O   1 
ATOM   928  C CB  . TYR A 1 131 ? -62.163 65.753  -139.873 1.00 22.97 ? 131 TYR A CB  1 
ATOM   929  C CG  . TYR A 1 131 ? -61.107 66.776  -139.530 1.00 21.63 ? 131 TYR A CG  1 
ATOM   930  C CD1 . TYR A 1 131 ? -61.268 67.627  -138.443 1.00 19.68 ? 131 TYR A CD1 1 
ATOM   931  C CD2 . TYR A 1 131 ? -59.939 66.878  -140.274 1.00 20.23 ? 131 TYR A CD2 1 
ATOM   932  C CE1 . TYR A 1 131 ? -60.300 68.558  -138.114 1.00 19.76 ? 131 TYR A CE1 1 
ATOM   933  C CE2 . TYR A 1 131 ? -58.966 67.808  -139.953 1.00 17.70 ? 131 TYR A CE2 1 
ATOM   934  C CZ  . TYR A 1 131 ? -59.152 68.644  -138.872 1.00 17.10 ? 131 TYR A CZ  1 
ATOM   935  O OH  . TYR A 1 131 ? -58.189 69.571  -138.545 1.00 18.39 ? 131 TYR A OH  1 
ATOM   936  N N   . PHE A 1 132 ? -64.381 63.833  -138.689 1.00 27.73 ? 132 PHE A N   1 
ATOM   937  C CA  . PHE A 1 132 ? -65.532 62.967  -138.854 1.00 31.62 ? 132 PHE A CA  1 
ATOM   938  C C   . PHE A 1 132 ? -66.671 63.691  -139.546 1.00 35.84 ? 132 PHE A C   1 
ATOM   939  O O   . PHE A 1 132 ? -66.918 64.873  -139.302 1.00 36.70 ? 132 PHE A O   1 
ATOM   940  C CB  . PHE A 1 132 ? -65.996 62.428  -137.500 1.00 31.25 ? 132 PHE A CB  1 
ATOM   941  C CG  . PHE A 1 132 ? -65.019 61.488  -136.863 1.00 33.05 ? 132 PHE A CG  1 
ATOM   942  C CD1 . PHE A 1 132 ? -63.969 61.971  -136.100 1.00 29.35 ? 132 PHE A CD1 1 
ATOM   943  C CD2 . PHE A 1 132 ? -65.143 60.120  -137.034 1.00 35.06 ? 132 PHE A CD2 1 
ATOM   944  C CE1 . PHE A 1 132 ? -63.063 61.107  -135.517 1.00 25.88 ? 132 PHE A CE1 1 
ATOM   945  C CE2 . PHE A 1 132 ? -64.241 59.250  -136.453 1.00 34.15 ? 132 PHE A CE2 1 
ATOM   946  C CZ  . PHE A 1 132 ? -63.199 59.745  -135.694 1.00 29.32 ? 132 PHE A CZ  1 
ATOM   947  N N   . GLU A 1 133 ? -67.360 62.967  -140.417 1.00 38.34 ? 133 GLU A N   1 
ATOM   948  C CA  . GLU A 1 133 ? -68.552 63.486  -141.061 1.00 43.62 ? 133 GLU A CA  1 
ATOM   949  C C   . GLU A 1 133 ? -69.663 63.644  -140.025 1.00 44.36 ? 133 GLU A C   1 
ATOM   950  O O   . GLU A 1 133 ? -69.506 63.241  -138.870 1.00 42.31 ? 133 GLU A O   1 
ATOM   951  C CB  . GLU A 1 133 ? -68.980 62.563  -142.200 1.00 47.36 ? 133 GLU A CB  1 
ATOM   952  C CG  . GLU A 1 133 ? -67.920 62.425  -143.286 1.00 50.24 ? 133 GLU A CG  1 
ATOM   953  C CD  . GLU A 1 133 ? -67.988 61.097  -144.013 1.00 58.81 ? 133 GLU A CD  1 
ATOM   954  O OE1 . GLU A 1 133 ? -68.740 60.209  -143.562 1.00 65.35 ? 133 GLU A OE1 1 
ATOM   955  O OE2 . GLU A 1 133 ? -67.287 60.941  -145.035 1.00 59.61 ? 133 GLU A OE2 1 
ATOM   956  N N   . ASN A 1 134 ? -70.776 64.237  -140.442 1.00 47.28 ? 134 ASN A N   1 
ATOM   957  C CA  . ASN A 1 134 ? -71.876 64.551  -139.533 1.00 47.77 ? 134 ASN A CA  1 
ATOM   958  C C   . ASN A 1 134 ? -72.380 63.339  -138.749 1.00 44.47 ? 134 ASN A C   1 
ATOM   959  O O   . ASN A 1 134 ? -72.767 62.322  -139.332 1.00 48.02 ? 134 ASN A O   1 
ATOM   960  C CB  . ASN A 1 134 ? -73.033 65.181  -140.310 1.00 51.87 ? 134 ASN A CB  1 
ATOM   961  C CG  . ASN A 1 134 ? -72.625 66.447  -141.044 1.00 54.44 ? 134 ASN A CG  1 
ATOM   962  O OD1 . ASN A 1 134 ? -72.682 66.511  -142.272 1.00 56.23 ? 134 ASN A OD1 1 
ATOM   963  N ND2 . ASN A 1 134 ? -72.210 67.462  -140.292 1.00 54.66 ? 134 ASN A ND2 1 
ATOM   964  N N   . GLY A 1 135 ? -72.364 63.455  -137.424 1.00 37.99 ? 135 GLY A N   1 
ATOM   965  C CA  . GLY A 1 135 ? -72.733 62.354  -136.554 1.00 39.65 ? 135 GLY A CA  1 
ATOM   966  C C   . GLY A 1 135 ? -71.559 61.958  -135.677 1.00 40.84 ? 135 GLY A C   1 
ATOM   967  O O   . GLY A 1 135 ? -71.734 61.466  -134.559 1.00 42.55 ? 135 GLY A O   1 
ATOM   968  N N   . GLY A 1 136 ? -70.353 62.172  -136.196 1.00 37.82 ? 136 GLY A N   1 
ATOM   969  C CA  . GLY A 1 136 ? -69.132 61.970  -135.435 1.00 34.49 ? 136 GLY A CA  1 
ATOM   970  C C   . GLY A 1 136 ? -68.715 60.521  -135.267 1.00 38.99 ? 136 GLY A C   1 
ATOM   971  O O   . GLY A 1 136 ? -68.013 60.179  -134.313 1.00 41.75 ? 136 GLY A O   1 
ATOM   972  N N   . VAL A 1 137 ? -69.135 59.666  -136.194 1.00 42.33 ? 137 VAL A N   1 
ATOM   973  C CA  . VAL A 1 137 ? -68.834 58.243  -136.098 1.00 44.98 ? 137 VAL A CA  1 
ATOM   974  C C   . VAL A 1 137 ? -68.041 57.749  -137.314 1.00 45.59 ? 137 VAL A C   1 
ATOM   975  O O   . VAL A 1 137 ? -67.235 56.822  -137.205 1.00 45.28 ? 137 VAL A O   1 
ATOM   976  C CB  . VAL A 1 137 ? -70.134 57.421  -135.932 1.00 47.13 ? 137 VAL A CB  1 
ATOM   977  C CG1 . VAL A 1 137 ? -69.838 55.930  -135.873 1.00 48.80 ? 137 VAL A CG1 1 
ATOM   978  C CG2 . VAL A 1 137 ? -70.876 57.862  -134.674 1.00 45.98 ? 137 VAL A CG2 1 
ATOM   979  N N   . VAL A 1 138 ? -68.251 58.381  -138.466 1.00 44.72 ? 138 VAL A N   1 
ATOM   980  C CA  . VAL A 1 138 ? -67.549 57.988  -139.688 1.00 37.11 ? 138 VAL A CA  1 
ATOM   981  C C   . VAL A 1 138 ? -66.378 58.918  -139.998 1.00 34.92 ? 138 VAL A C   1 
ATOM   982  O O   . VAL A 1 138 ? -66.564 60.116  -140.218 1.00 30.90 ? 138 VAL A O   1 
ATOM   983  C CB  . VAL A 1 138 ? -68.494 57.961  -140.903 1.00 35.75 ? 138 VAL A CB  1 
ATOM   984  C CG1 . VAL A 1 138 ? -67.745 57.501  -142.144 1.00 36.69 ? 138 VAL A CG1 1 
ATOM   985  C CG2 . VAL A 1 138 ? -69.678 57.049  -140.627 1.00 33.98 ? 138 VAL A CG2 1 
ATOM   986  N N   . ALA A 1 139 ? -65.174 58.350  -140.027 1.00 36.43 ? 139 ALA A N   1 
ATOM   987  C CA  . ALA A 1 139 ? -63.955 59.119  -140.254 1.00 35.36 ? 139 ALA A CA  1 
ATOM   988  C C   . ALA A 1 139 ? -63.820 59.569  -141.704 1.00 34.77 ? 139 ALA A C   1 
ATOM   989  O O   . ALA A 1 139 ? -64.004 58.780  -142.634 1.00 32.11 ? 139 ALA A O   1 
ATOM   990  C CB  . ALA A 1 139 ? -62.735 58.306  -139.844 1.00 37.18 ? 139 ALA A CB  1 
ATOM   991  N N   . ARG A 1 140 ? -63.493 60.844  -141.884 1.00 37.54 ? 140 ARG A N   1 
ATOM   992  C CA  . ARG A 1 140 ? -63.227 61.399  -143.205 1.00 42.43 ? 140 ARG A CA  1 
ATOM   993  C C   . ARG A 1 140 ? -61.857 60.934  -143.686 1.00 43.60 ? 140 ARG A C   1 
ATOM   994  O O   . ARG A 1 140 ? -60.901 60.889  -142.910 1.00 47.48 ? 140 ARG A O   1 
ATOM   995  C CB  . ARG A 1 140 ? -63.300 62.926  -143.163 1.00 43.63 ? 140 ARG A CB  1 
ATOM   996  C CG  . ARG A 1 140 ? -63.140 63.636  -144.494 1.00 46.73 ? 140 ARG A CG  1 
ATOM   997  C CD  . ARG A 1 140 ? -63.361 65.127  -144.288 1.00 49.28 ? 140 ARG A CD  1 
ATOM   998  N NE  . ARG A 1 140 ? -64.667 65.388  -143.685 1.00 47.49 ? 140 ARG A NE  1 
ATOM   999  C CZ  . ARG A 1 140 ? -64.962 66.453  -142.944 1.00 42.75 ? 140 ARG A CZ  1 
ATOM   1000 N NH1 . ARG A 1 140 ? -64.041 67.374  -142.695 1.00 42.53 ? 140 ARG A NH1 1 
ATOM   1001 N NH2 . ARG A 1 140 ? -66.183 66.594  -142.443 1.00 37.22 ? 140 ARG A NH2 1 
ATOM   1002 N N   . LEU A 1 141 ? -61.770 60.583  -144.964 1.00 41.09 ? 141 LEU A N   1 
ATOM   1003 C CA  . LEU A 1 141 ? -60.536 60.053  -145.533 1.00 38.47 ? 141 LEU A CA  1 
ATOM   1004 C C   . LEU A 1 141 ? -59.419 61.099  -145.577 1.00 41.22 ? 141 LEU A C   1 
ATOM   1005 O O   . LEU A 1 141 ? -59.625 62.232  -146.015 1.00 44.08 ? 141 LEU A O   1 
ATOM   1006 C CB  . LEU A 1 141 ? -60.801 59.506  -146.936 1.00 39.19 ? 141 LEU A CB  1 
ATOM   1007 C CG  . LEU A 1 141 ? -61.813 58.361  -147.035 1.00 41.92 ? 141 LEU A CG  1 
ATOM   1008 C CD1 . LEU A 1 141 ? -62.325 58.211  -148.462 1.00 46.69 ? 141 LEU A CD1 1 
ATOM   1009 C CD2 . LEU A 1 141 ? -61.202 57.056  -146.546 1.00 39.44 ? 141 LEU A CD2 1 
ATOM   1010 N N   . SER A 1 142 ? -58.235 60.704  -145.118 1.00 39.26 ? 142 SER A N   1 
ATOM   1011 C CA  . SER A 1 142 ? -57.076 61.592  -145.091 1.00 34.58 ? 142 SER A CA  1 
ATOM   1012 C C   . SER A 1 142 ? -55.858 60.899  -145.697 1.00 36.78 ? 142 SER A C   1 
ATOM   1013 O O   . SER A 1 142 ? -55.357 59.917  -145.147 1.00 35.92 ? 142 SER A O   1 
ATOM   1014 C CB  . SER A 1 142 ? -56.780 62.038  -143.657 1.00 29.95 ? 142 SER A CB  1 
ATOM   1015 O OG  . SER A 1 142 ? -55.597 62.812  -143.590 1.00 29.27 ? 142 SER A OG  1 
ATOM   1016 N N   . THR A 1 143 ? -55.383 61.412  -146.829 1.00 37.09 ? 143 THR A N   1 
ATOM   1017 C CA  . THR A 1 143 ? -54.303 60.758  -147.562 1.00 39.24 ? 143 THR A CA  1 
ATOM   1018 C C   . THR A 1 143 ? -53.157 61.703  -147.923 1.00 46.22 ? 143 THR A C   1 
ATOM   1019 O O   . THR A 1 143 ? -53.179 62.886  -147.581 1.00 51.69 ? 143 THR A O   1 
ATOM   1020 C CB  . THR A 1 143 ? -54.827 60.113  -148.858 1.00 46.33 ? 143 THR A CB  1 
ATOM   1021 O OG1 . THR A 1 143 ? -55.685 61.039  -149.535 1.00 51.32 ? 143 THR A OG1 1 
ATOM   1022 C CG2 . THR A 1 143 ? -55.610 58.850  -148.545 1.00 48.04 ? 143 THR A CG2 1 
ATOM   1023 N N   . ASP A 1 144 ? -52.158 61.163  -148.618 1.00 48.53 ? 144 ASP A N   1 
ATOM   1024 C CA  . ASP A 1 144 ? -51.021 61.947  -149.089 1.00 48.02 ? 144 ASP A CA  1 
ATOM   1025 C C   . ASP A 1 144 ? -51.427 62.860  -150.239 1.00 49.50 ? 144 ASP A C   1 
ATOM   1026 O O   . ASP A 1 144 ? -52.048 62.417  -151.204 1.00 52.03 ? 144 ASP A O   1 
ATOM   1027 C CB  . ASP A 1 144 ? -49.879 61.029  -149.530 1.00 47.17 ? 144 ASP A CB  1 
ATOM   1028 C CG  . ASP A 1 144 ? -49.179 60.364  -148.362 1.00 44.67 ? 144 ASP A CG  1 
ATOM   1029 O OD1 . ASP A 1 144 ? -49.128 60.976  -147.275 1.00 43.10 ? 144 ASP A OD1 1 
ATOM   1030 O OD2 . ASP A 1 144 ? -48.677 59.233  -148.532 1.00 42.97 ? 144 ASP A OD2 1 
ATOM   1031 N N   . GLN A 1 148 ? -51.969 57.746  -150.527 1.00 36.19 ? 148 GLN A N   1 
ATOM   1032 C CA  . GLN A 1 148 ? -51.773 56.743  -149.488 1.00 34.26 ? 148 GLN A CA  1 
ATOM   1033 C C   . GLN A 1 148 ? -52.354 57.212  -148.160 1.00 34.71 ? 148 GLN A C   1 
ATOM   1034 O O   . GLN A 1 148 ? -52.227 58.383  -147.798 1.00 37.11 ? 148 GLN A O   1 
ATOM   1035 C CB  . GLN A 1 148 ? -50.285 56.418  -149.329 1.00 32.02 ? 148 GLN A CB  1 
ATOM   1036 C CG  . GLN A 1 148 ? -49.982 55.335  -148.301 1.00 38.49 ? 148 GLN A CG  1 
ATOM   1037 C CD  . GLN A 1 148 ? -48.547 54.851  -148.369 1.00 47.96 ? 148 GLN A CD  1 
ATOM   1038 O OE1 . GLN A 1 148 ? -47.740 55.375  -149.138 1.00 52.39 ? 148 GLN A OE1 1 
ATOM   1039 N NE2 . GLN A 1 148 ? -48.222 53.842  -147.567 1.00 49.77 ? 148 GLN A NE2 1 
ATOM   1040 N N   . GLU A 1 149 ? -52.999 56.290  -147.450 1.00 33.02 ? 149 GLU A N   1 
ATOM   1041 C CA  . GLU A 1 149 ? -53.568 56.555  -146.132 1.00 31.25 ? 149 GLU A CA  1 
ATOM   1042 C C   . GLU A 1 149 ? -52.550 57.219  -145.212 1.00 32.53 ? 149 GLU A C   1 
ATOM   1043 O O   . GLU A 1 149 ? -51.437 56.716  -145.044 1.00 39.80 ? 149 GLU A O   1 
ATOM   1044 C CB  . GLU A 1 149 ? -54.070 55.251  -145.502 1.00 30.64 ? 149 GLU A CB  1 
ATOM   1045 C CG  . GLU A 1 149 ? -54.856 55.420  -144.206 1.00 31.76 ? 149 GLU A CG  1 
ATOM   1046 C CD  . GLU A 1 149 ? -55.322 54.093  -143.632 1.00 36.39 ? 149 GLU A CD  1 
ATOM   1047 O OE1 . GLU A 1 149 ? -54.498 53.389  -143.014 1.00 34.60 ? 149 GLU A OE1 1 
ATOM   1048 O OE2 . GLU A 1 149 ? -56.510 53.750  -143.805 1.00 40.29 ? 149 GLU A OE2 1 
ATOM   1049 N N   . ASP A 1 150 ? -52.925 58.361  -144.640 1.00 26.12 ? 150 ASP A N   1 
ATOM   1050 C CA  . ASP A 1 150 ? -52.076 59.033  -143.664 1.00 28.63 ? 150 ASP A CA  1 
ATOM   1051 C C   . ASP A 1 150 ? -51.776 58.091  -142.507 1.00 33.45 ? 150 ASP A C   1 
ATOM   1052 O O   . ASP A 1 150 ? -52.680 57.444  -141.976 1.00 37.15 ? 150 ASP A O   1 
ATOM   1053 C CB  . ASP A 1 150 ? -52.731 60.316  -143.151 1.00 27.32 ? 150 ASP A CB  1 
ATOM   1054 C CG  . ASP A 1 150 ? -52.623 61.459  -144.139 1.00 32.11 ? 150 ASP A CG  1 
ATOM   1055 O OD1 . ASP A 1 150 ? -51.634 61.500  -144.904 1.00 32.78 ? 150 ASP A OD1 1 
ATOM   1056 O OD2 . ASP A 1 150 ? -53.528 62.317  -144.150 1.00 33.13 ? 150 ASP A OD2 1 
ATOM   1057 N N   . PRO A 1 151 ? -50.492 57.993  -142.129 1.00 35.53 ? 151 PRO A N   1 
ATOM   1058 C CA  . PRO A 1 151 ? -50.050 57.083  -141.065 1.00 37.04 ? 151 PRO A CA  1 
ATOM   1059 C C   . PRO A 1 151 ? -50.848 57.185  -139.765 1.00 40.48 ? 151 PRO A C   1 
ATOM   1060 O O   . PRO A 1 151 ? -50.976 56.180  -139.067 1.00 43.01 ? 151 PRO A O   1 
ATOM   1061 C CB  . PRO A 1 151 ? -48.586 57.498  -140.828 1.00 36.04 ? 151 PRO A CB  1 
ATOM   1062 C CG  . PRO A 1 151 ? -48.373 58.760  -141.623 1.00 37.02 ? 151 PRO A CG  1 
ATOM   1063 C CD  . PRO A 1 151 ? -49.358 58.699  -142.744 1.00 36.73 ? 151 PRO A CD  1 
ATOM   1064 N N   . HIS A 1 152 ? -51.384 58.360  -139.450 1.00 39.18 ? 152 HIS A N   1 
ATOM   1065 C CA  . HIS A 1 152 ? -52.082 58.547  -138.182 1.00 35.58 ? 152 HIS A CA  1 
ATOM   1066 C C   . HIS A 1 152 ? -53.582 58.255  -138.278 1.00 34.01 ? 152 HIS A C   1 
ATOM   1067 O O   . HIS A 1 152 ? -54.283 58.258  -137.267 1.00 34.80 ? 152 HIS A O   1 
ATOM   1068 C CB  . HIS A 1 152 ? -51.871 59.972  -137.668 1.00 29.92 ? 152 HIS A CB  1 
ATOM   1069 C CG  . HIS A 1 152 ? -52.665 61.009  -138.405 1.00 28.67 ? 152 HIS A CG  1 
ATOM   1070 N ND1 . HIS A 1 152 ? -52.206 61.632  -139.543 1.00 30.79 ? 152 HIS A ND1 1 
ATOM   1071 C CD2 . HIS A 1 152 ? -53.887 61.536  -138.154 1.00 26.88 ? 152 HIS A CD2 1 
ATOM   1072 C CE1 . HIS A 1 152 ? -53.111 62.499  -139.966 1.00 26.49 ? 152 HIS A CE1 1 
ATOM   1073 N NE2 . HIS A 1 152 ? -54.142 62.459  -139.139 1.00 24.88 ? 152 HIS A NE2 1 
ATOM   1074 N N   . PHE A 1 153 ? -54.068 57.990  -139.487 1.00 30.67 ? 153 PHE A N   1 
ATOM   1075 C CA  . PHE A 1 153 ? -55.505 57.835  -139.728 1.00 30.89 ? 153 PHE A CA  1 
ATOM   1076 C C   . PHE A 1 153 ? -56.119 56.635  -139.008 1.00 33.27 ? 153 PHE A C   1 
ATOM   1077 O O   . PHE A 1 153 ? -57.162 56.754  -138.368 1.00 32.01 ? 153 PHE A O   1 
ATOM   1078 C CB  . PHE A 1 153 ? -55.777 57.717  -141.234 1.00 29.50 ? 153 PHE A CB  1 
ATOM   1079 C CG  . PHE A 1 153 ? -57.216 57.443  -141.575 1.00 27.26 ? 153 PHE A CG  1 
ATOM   1080 C CD1 . PHE A 1 153 ? -58.131 58.479  -141.652 1.00 26.64 ? 153 PHE A CD1 1 
ATOM   1081 C CD2 . PHE A 1 153 ? -57.650 56.151  -141.834 1.00 23.93 ? 153 PHE A CD2 1 
ATOM   1082 C CE1 . PHE A 1 153 ? -59.455 58.235  -141.964 1.00 26.44 ? 153 PHE A CE1 1 
ATOM   1083 C CE2 . PHE A 1 153 ? -58.973 55.901  -142.146 1.00 25.39 ? 153 PHE A CE2 1 
ATOM   1084 C CZ  . PHE A 1 153 ? -59.875 56.946  -142.213 1.00 26.14 ? 153 PHE A CZ  1 
ATOM   1085 N N   . ALA A 1 154 ? -55.463 55.485  -139.121 1.00 35.93 ? 154 ALA A N   1 
ATOM   1086 C CA  . ALA A 1 154 ? -56.051 54.210  -138.718 1.00 33.01 ? 154 ALA A CA  1 
ATOM   1087 C C   . ALA A 1 154 ? -56.343 54.110  -137.221 1.00 30.53 ? 154 ALA A C   1 
ATOM   1088 O O   . ALA A 1 154 ? -57.448 53.730  -136.830 1.00 28.86 ? 154 ALA A O   1 
ATOM   1089 C CB  . ALA A 1 154 ? -55.147 53.070  -139.144 1.00 30.27 ? 154 ALA A CB  1 
ATOM   1090 N N   . LYS A 1 155 ? -55.353 54.427  -136.389 1.00 28.68 ? 155 LYS A N   1 
ATOM   1091 C CA  . LYS A 1 155 ? -55.535 54.371  -134.943 1.00 31.45 ? 155 LYS A CA  1 
ATOM   1092 C C   . LYS A 1 155 ? -56.673 55.281  -134.503 1.00 31.62 ? 155 LYS A C   1 
ATOM   1093 O O   . LYS A 1 155 ? -57.540 54.871  -133.737 1.00 33.36 ? 155 LYS A O   1 
ATOM   1094 C CB  . LYS A 1 155 ? -54.247 54.754  -134.210 1.00 37.18 ? 155 LYS A CB  1 
ATOM   1095 C CG  . LYS A 1 155 ? -54.437 54.955  -132.708 1.00 43.27 ? 155 LYS A CG  1 
ATOM   1096 C CD  . LYS A 1 155 ? -53.102 55.076  -131.991 1.00 45.49 ? 155 LYS A CD  1 
ATOM   1097 C CE  . LYS A 1 155 ? -53.284 55.562  -130.564 1.00 42.85 ? 155 LYS A CE  1 
ATOM   1098 N NZ  . LYS A 1 155 ? -52.267 56.590  -130.204 1.00 38.53 ? 155 LYS A NZ  1 
ATOM   1099 N N   . LEU A 1 156 ? -56.671 56.510  -135.009 1.00 30.13 ? 156 LEU A N   1 
ATOM   1100 C CA  . LEU A 1 156 ? -57.667 57.504  -134.626 1.00 26.42 ? 156 LEU A CA  1 
ATOM   1101 C C   . LEU A 1 156 ? -59.059 57.178  -135.164 1.00 25.92 ? 156 LEU A C   1 
ATOM   1102 O O   . LEU A 1 156 ? -60.063 57.453  -134.507 1.00 31.80 ? 156 LEU A O   1 
ATOM   1103 C CB  . LEU A 1 156 ? -57.240 58.890  -135.107 1.00 25.03 ? 156 LEU A CB  1 
ATOM   1104 C CG  . LEU A 1 156 ? -55.896 59.396  -134.582 1.00 26.40 ? 156 LEU A CG  1 
ATOM   1105 C CD1 . LEU A 1 156 ? -55.593 60.776  -135.139 1.00 21.88 ? 156 LEU A CD1 1 
ATOM   1106 C CD2 . LEU A 1 156 ? -55.870 59.416  -133.059 1.00 27.38 ? 156 LEU A CD2 1 
ATOM   1107 N N   . ALA A 1 157 ? -59.116 56.596  -136.357 1.00 24.53 ? 157 ALA A N   1 
ATOM   1108 C CA  . ALA A 1 157 ? -60.396 56.283  -136.988 1.00 27.41 ? 157 ALA A CA  1 
ATOM   1109 C C   . ALA A 1 157 ? -61.115 55.160  -136.244 1.00 32.10 ? 157 ALA A C   1 
ATOM   1110 O O   . ALA A 1 157 ? -62.343 55.131  -136.183 1.00 32.30 ? 157 ALA A O   1 
ATOM   1111 C CB  . ALA A 1 157 ? -60.192 55.907  -138.448 1.00 27.92 ? 157 ALA A CB  1 
ATOM   1112 N N   . GLN A 1 158 ? -60.339 54.241  -135.681 1.00 35.38 ? 158 GLN A N   1 
ATOM   1113 C CA  . GLN A 1 158 ? -60.882 53.128  -134.911 1.00 37.31 ? 158 GLN A CA  1 
ATOM   1114 C C   . GLN A 1 158 ? -61.525 53.613  -133.610 1.00 32.57 ? 158 GLN A C   1 
ATOM   1115 O O   . GLN A 1 158 ? -62.428 52.974  -133.065 1.00 27.90 ? 158 GLN A O   1 
ATOM   1116 C CB  . GLN A 1 158 ? -59.770 52.107  -134.629 1.00 41.73 ? 158 GLN A CB  1 
ATOM   1117 C CG  . GLN A 1 158 ? -59.892 51.367  -133.303 1.00 46.92 ? 158 GLN A CG  1 
ATOM   1118 C CD  . GLN A 1 158 ? -58.979 50.160  -133.221 1.00 52.36 ? 158 GLN A CD  1 
ATOM   1119 O OE1 . GLN A 1 158 ? -58.337 49.783  -134.202 1.00 56.87 ? 158 GLN A OE1 1 
ATOM   1120 N NE2 . GLN A 1 158 ? -58.921 49.543  -132.047 1.00 53.22 ? 158 GLN A NE2 1 
ATOM   1121 N N   . LEU A 1 159 ? -61.064 54.765  -133.136 1.00 34.93 ? 159 LEU A N   1 
ATOM   1122 C CA  . LEU A 1 159 ? -61.508 55.312  -131.859 1.00 37.64 ? 159 LEU A CA  1 
ATOM   1123 C C   . LEU A 1 159 ? -62.976 55.720  -131.863 1.00 45.18 ? 159 LEU A C   1 
ATOM   1124 O O   . LEU A 1 159 ? -63.519 56.140  -132.887 1.00 53.19 ? 159 LEU A O   1 
ATOM   1125 C CB  . LEU A 1 159 ? -60.650 56.518  -131.470 1.00 34.04 ? 159 LEU A CB  1 
ATOM   1126 C CG  . LEU A 1 159 ? -59.138 56.298  -131.463 1.00 34.10 ? 159 LEU A CG  1 
ATOM   1127 C CD1 . LEU A 1 159 ? -58.418 57.528  -130.944 1.00 32.60 ? 159 LEU A CD1 1 
ATOM   1128 C CD2 . LEU A 1 159 ? -58.771 55.074  -130.643 1.00 36.66 ? 159 LEU A CD2 1 
ATOM   1129 N N   . VAL A 1 160 ? -63.606 55.592  -130.699 1.00 40.75 ? 160 VAL A N   1 
ATOM   1130 C CA  . VAL A 1 160 ? -64.984 56.016  -130.500 1.00 35.08 ? 160 VAL A CA  1 
ATOM   1131 C C   . VAL A 1 160 ? -65.028 57.058  -129.384 1.00 35.98 ? 160 VAL A C   1 
ATOM   1132 O O   . VAL A 1 160 ? -64.260 56.971  -128.428 1.00 39.63 ? 160 VAL A O   1 
ATOM   1133 C CB  . VAL A 1 160 ? -65.893 54.816  -130.155 1.00 34.78 ? 160 VAL A CB  1 
ATOM   1134 C CG1 . VAL A 1 160 ? -67.298 55.278  -129.792 1.00 33.98 ? 160 VAL A CG1 1 
ATOM   1135 C CG2 . VAL A 1 160 ? -65.933 53.835  -131.319 1.00 37.14 ? 160 VAL A CG2 1 
ATOM   1136 N N   . TYR A 1 161 ? -65.892 58.062  -129.522 1.00 33.65 ? 161 TYR A N   1 
ATOM   1137 C CA  . TYR A 1 161 ? -66.104 59.045  -128.462 1.00 27.06 ? 161 TYR A CA  1 
ATOM   1138 C C   . TYR A 1 161 ? -66.813 58.388  -127.287 1.00 27.00 ? 161 TYR A C   1 
ATOM   1139 O O   . TYR A 1 161 ? -67.974 57.998  -127.406 1.00 32.31 ? 161 TYR A O   1 
ATOM   1140 C CB  . TYR A 1 161 ? -66.923 60.229  -128.977 1.00 24.95 ? 161 TYR A CB  1 
ATOM   1141 C CG  . TYR A 1 161 ? -67.391 61.186  -127.899 1.00 27.63 ? 161 TYR A CG  1 
ATOM   1142 C CD1 . TYR A 1 161 ? -66.499 62.041  -127.266 1.00 30.31 ? 161 TYR A CD1 1 
ATOM   1143 C CD2 . TYR A 1 161 ? -68.728 61.243  -127.525 1.00 27.01 ? 161 TYR A CD2 1 
ATOM   1144 C CE1 . TYR A 1 161 ? -66.920 62.918  -126.288 1.00 31.42 ? 161 TYR A CE1 1 
ATOM   1145 C CE2 . TYR A 1 161 ? -69.161 62.119  -126.548 1.00 27.26 ? 161 TYR A CE2 1 
ATOM   1146 C CZ  . TYR A 1 161 ? -68.252 62.954  -125.934 1.00 31.13 ? 161 TYR A CZ  1 
ATOM   1147 O OH  . TYR A 1 161 ? -68.671 63.830  -124.960 1.00 31.00 ? 161 TYR A OH  1 
ATOM   1148 N N   . GLU A 1 162 ? -66.121 58.267  -126.157 1.00 24.19 ? 162 GLU A N   1 
ATOM   1149 C CA  . GLU A 1 162 ? -66.657 57.532  -125.013 1.00 28.40 ? 162 GLU A CA  1 
ATOM   1150 C C   . GLU A 1 162 ? -67.150 58.446  -123.893 1.00 30.78 ? 162 GLU A C   1 
ATOM   1151 O O   . GLU A 1 162 ? -67.175 58.047  -122.724 1.00 30.15 ? 162 GLU A O   1 
ATOM   1152 C CB  . GLU A 1 162 ? -65.599 56.571  -124.468 1.00 29.43 ? 162 GLU A CB  1 
ATOM   1153 C CG  . GLU A 1 162 ? -64.721 55.976  -125.550 1.00 36.33 ? 162 GLU A CG  1 
ATOM   1154 C CD  . GLU A 1 162 ? -64.050 54.683  -125.136 1.00 46.83 ? 162 GLU A CD  1 
ATOM   1155 O OE1 . GLU A 1 162 ? -63.181 54.717  -124.239 1.00 50.72 ? 162 GLU A OE1 1 
ATOM   1156 O OE2 . GLU A 1 162 ? -64.392 53.631  -125.717 1.00 51.13 ? 162 GLU A OE2 1 
ATOM   1157 N N   . GLY A 1 163 ? -67.543 59.665  -124.252 1.00 30.62 ? 163 GLY A N   1 
ATOM   1158 C CA  . GLY A 1 163 ? -68.072 60.605  -123.281 1.00 32.47 ? 163 GLY A CA  1 
ATOM   1159 C C   . GLY A 1 163 ? -67.052 61.618  -122.794 1.00 28.93 ? 163 GLY A C   1 
ATOM   1160 O O   . GLY A 1 163 ? -65.844 61.432  -122.966 1.00 25.17 ? 163 GLY A O   1 
ATOM   1161 N N   . GLY A 1 164 ? -67.547 62.682  -122.164 1.00 26.04 ? 164 GLY A N   1 
ATOM   1162 C CA  . GLY A 1 164 ? -66.721 63.799  -121.738 1.00 25.22 ? 164 GLY A CA  1 
ATOM   1163 C C   . GLY A 1 164 ? -65.587 63.490  -120.776 1.00 23.13 ? 164 GLY A C   1 
ATOM   1164 O O   . GLY A 1 164 ? -64.488 64.026  -120.929 1.00 21.59 ? 164 GLY A O   1 
ATOM   1165 N N   . ASP A 1 165 ? -65.838 62.639  -119.785 1.00 24.03 ? 165 ASP A N   1 
ATOM   1166 C CA  . ASP A 1 165 ? -64.824 62.351  -118.773 1.00 27.50 ? 165 ASP A CA  1 
ATOM   1167 C C   . ASP A 1 165 ? -63.627 61.592  -119.348 1.00 28.54 ? 165 ASP A C   1 
ATOM   1168 O O   . ASP A 1 165 ? -62.505 61.724  -118.854 1.00 28.70 ? 165 ASP A O   1 
ATOM   1169 C CB  . ASP A 1 165 ? -65.430 61.562  -117.612 1.00 31.65 ? 165 ASP A CB  1 
ATOM   1170 C CG  . ASP A 1 165 ? -66.051 62.460  -116.555 1.00 39.58 ? 165 ASP A CG  1 
ATOM   1171 O OD1 . ASP A 1 165 ? -65.836 63.688  -116.622 1.00 41.26 ? 165 ASP A OD1 1 
ATOM   1172 O OD2 . ASP A 1 165 ? -66.742 61.933  -115.654 1.00 43.17 ? 165 ASP A OD2 1 
ATOM   1173 N N   . SER A 1 166 ? -63.865 60.799  -120.387 1.00 25.27 ? 166 SER A N   1 
ATOM   1174 C CA  . SER A 1 166 ? -62.782 60.098  -121.065 1.00 22.77 ? 166 SER A CA  1 
ATOM   1175 C C   . SER A 1 166 ? -61.874 61.118  -121.737 1.00 21.67 ? 166 SER A C   1 
ATOM   1176 O O   . SER A 1 166 ? -60.651 60.976  -121.746 1.00 17.33 ? 166 SER A O   1 
ATOM   1177 C CB  . SER A 1 166 ? -63.325 59.108  -122.096 1.00 24.88 ? 166 SER A CB  1 
ATOM   1178 O OG  . SER A 1 166 ? -63.837 59.790  -123.228 1.00 25.89 ? 166 SER A OG  1 
ATOM   1179 N N   . VAL A 1 167 ? -62.498 62.152  -122.293 1.00 22.03 ? 167 VAL A N   1 
ATOM   1180 C CA  . VAL A 1 167 ? -61.785 63.248  -122.935 1.00 21.91 ? 167 VAL A CA  1 
ATOM   1181 C C   . VAL A 1 167 ? -60.923 64.004  -121.924 1.00 23.02 ? 167 VAL A C   1 
ATOM   1182 O O   . VAL A 1 167 ? -59.770 64.340  -122.206 1.00 25.47 ? 167 VAL A O   1 
ATOM   1183 C CB  . VAL A 1 167 ? -62.775 64.212  -123.622 1.00 22.65 ? 167 VAL A CB  1 
ATOM   1184 C CG1 . VAL A 1 167 ? -62.103 65.512  -123.994 1.00 15.80 ? 167 VAL A CG1 1 
ATOM   1185 C CG2 . VAL A 1 167 ? -63.385 63.552  -124.846 1.00 23.72 ? 167 VAL A CG2 1 
ATOM   1186 N N   . ARG A 1 168 ? -61.481 64.257  -120.743 1.00 23.25 ? 168 ARG A N   1 
ATOM   1187 C CA  . ARG A 1 168 ? -60.727 64.872  -119.654 1.00 22.12 ? 168 ARG A CA  1 
ATOM   1188 C C   . ARG A 1 168 ? -59.525 64.015  -119.273 1.00 20.84 ? 168 ARG A C   1 
ATOM   1189 O O   . ARG A 1 168 ? -58.410 64.520  -119.135 1.00 19.66 ? 168 ARG A O   1 
ATOM   1190 C CB  . ARG A 1 168 ? -61.618 65.091  -118.429 1.00 23.06 ? 168 ARG A CB  1 
ATOM   1191 C CG  . ARG A 1 168 ? -60.834 65.312  -117.143 1.00 26.77 ? 168 ARG A CG  1 
ATOM   1192 C CD  . ARG A 1 168 ? -61.745 65.244  -115.933 1.00 31.60 ? 168 ARG A CD  1 
ATOM   1193 N NE  . ARG A 1 168 ? -62.509 64.000  -115.913 1.00 37.91 ? 168 ARG A NE  1 
ATOM   1194 C CZ  . ARG A 1 168 ? -62.352 63.035  -115.012 1.00 39.36 ? 168 ARG A CZ  1 
ATOM   1195 N NH1 . ARG A 1 168 ? -61.459 63.167  -114.040 1.00 40.11 ? 168 ARG A NH1 1 
ATOM   1196 N NH2 . ARG A 1 168 ? -63.092 61.937  -115.079 1.00 38.41 ? 168 ARG A NH2 1 
ATOM   1197 N N   . ASP A 1 169 ? -59.763 62.717  -119.105 1.00 21.51 ? 169 ASP A N   1 
ATOM   1198 C CA  . ASP A 1 169 ? -58.705 61.778  -118.755 1.00 18.93 ? 169 ASP A CA  1 
ATOM   1199 C C   . ASP A 1 169 ? -57.651 61.689  -119.857 1.00 16.55 ? 169 ASP A C   1 
ATOM   1200 O O   . ASP A 1 169 ? -56.468 61.490  -119.585 1.00 19.79 ? 169 ASP A O   1 
ATOM   1201 C CB  . ASP A 1 169 ? -59.292 60.392  -118.476 1.00 17.72 ? 169 ASP A CB  1 
ATOM   1202 C CG  . ASP A 1 169 ? -60.030 60.324  -117.153 1.00 19.71 ? 169 ASP A CG  1 
ATOM   1203 O OD1 . ASP A 1 169 ? -60.367 61.392  -116.608 1.00 19.14 ? 169 ASP A OD1 1 
ATOM   1204 O OD2 . ASP A 1 169 ? -60.270 59.202  -116.661 1.00 21.33 ? 169 ASP A OD2 1 
ATOM   1205 N N   . GLN A 1 170 ? -58.086 61.839  -121.102 1.00 16.16 ? 170 GLN A N   1 
ATOM   1206 C CA  . GLN A 1 170 ? -57.158 61.856  -122.225 1.00 20.18 ? 170 GLN A CA  1 
ATOM   1207 C C   . GLN A 1 170 ? -56.244 63.072  -122.145 1.00 22.22 ? 170 GLN A C   1 
ATOM   1208 O O   . GLN A 1 170 ? -55.039 62.967  -122.368 1.00 25.17 ? 170 GLN A O   1 
ATOM   1209 C CB  . GLN A 1 170 ? -57.915 61.843  -123.555 1.00 22.36 ? 170 GLN A CB  1 
ATOM   1210 C CG  . GLN A 1 170 ? -58.445 60.472  -123.952 1.00 23.39 ? 170 GLN A CG  1 
ATOM   1211 C CD  . GLN A 1 170 ? -59.477 60.555  -125.054 1.00 21.93 ? 170 GLN A CD  1 
ATOM   1212 O OE1 . GLN A 1 170 ? -59.754 61.633  -125.580 1.00 23.21 ? 170 GLN A OE1 1 
ATOM   1213 N NE2 . GLN A 1 170 ? -60.062 59.417  -125.405 1.00 20.88 ? 170 GLN A NE2 1 
ATOM   1214 N N   . MET A 1 171 ? -56.813 64.227  -121.834 1.00 21.47 ? 171 MET A N   1 
ATOM   1215 C CA  . MET A 1 171 ? -56.044 65.444  -121.672 1.00 19.51 ? 171 MET A CA  1 
ATOM   1216 C C   . MET A 1 171 ? -55.063 65.344  -120.520 1.00 19.05 ? 171 MET A C   1 
ATOM   1217 O O   . MET A 1 171 ? -53.955 65.812  -120.616 1.00 19.66 ? 171 MET A O   1 
ATOM   1218 C CB  . MET A 1 171 ? -56.962 66.644  -121.476 1.00 23.30 ? 171 MET A CB  1 
ATOM   1219 C CG  . MET A 1 171 ? -56.236 67.968  -121.416 1.00 22.28 ? 171 MET A CG  1 
ATOM   1220 S SD  . MET A 1 171 ? -55.711 68.540  -123.030 1.00 26.35 ? 171 MET A SD  1 
ATOM   1221 C CE  . MET A 1 171 ? -53.945 68.413  -122.926 1.00 26.07 ? 171 MET A CE  1 
ATOM   1222 N N   . VAL A 1 172 ? -55.490 64.725  -119.435 1.00 18.99 ? 172 VAL A N   1 
ATOM   1223 C CA  . VAL A 1 172 ? -54.661 64.575  -118.254 1.00 20.26 ? 172 VAL A CA  1 
ATOM   1224 C C   . VAL A 1 172 ? -53.495 63.643  -118.559 1.00 18.46 ? 172 VAL A C   1 
ATOM   1225 O O   . VAL A 1 172 ? -52.372 63.871  -118.110 1.00 19.34 ? 172 VAL A O   1 
ATOM   1226 C CB  . VAL A 1 172 ? -55.480 64.042  -117.067 1.00 23.30 ? 172 VAL A CB  1 
ATOM   1227 C CG1 . VAL A 1 172 ? -54.575 63.691  -115.907 1.00 22.03 ? 172 VAL A CG1 1 
ATOM   1228 C CG2 . VAL A 1 172 ? -56.521 65.070  -116.640 1.00 26.86 ? 172 VAL A CG2 1 
ATOM   1229 N N   . THR A 1 173 ? -53.767 62.601  -119.340 1.00 16.06 ? 173 THR A N   1 
ATOM   1230 C CA  . THR A 1 173 ? -52.729 61.670  -119.774 1.00 18.69 ? 173 THR A CA  1 
ATOM   1231 C C   . THR A 1 173 ? -51.644 62.384  -120.579 1.00 18.47 ? 173 THR A C   1 
ATOM   1232 O O   . THR A 1 173 ? -50.449 62.186  -120.346 1.00 19.58 ? 173 THR A O   1 
ATOM   1233 C CB  . THR A 1 173 ? -53.314 60.523  -120.627 1.00 21.99 ? 173 THR A CB  1 
ATOM   1234 O OG1 . THR A 1 173 ? -54.033 59.618  -119.782 1.00 25.68 ? 173 THR A OG1 1 
ATOM   1235 C CG2 . THR A 1 173 ? -52.207 59.762  -121.339 1.00 22.29 ? 173 THR A CG2 1 
ATOM   1236 N N   . ILE A 1 174 ? -52.070 63.220  -121.519 1.00 14.37 ? 174 ILE A N   1 
ATOM   1237 C CA  . ILE A 1 174 ? -51.142 63.927  -122.393 1.00 14.59 ? 174 ILE A CA  1 
ATOM   1238 C C   . ILE A 1 174 ? -50.235 64.859  -121.599 1.00 15.76 ? 174 ILE A C   1 
ATOM   1239 O O   . ILE A 1 174 ? -49.027 64.905  -121.835 1.00 22.10 ? 174 ILE A O   1 
ATOM   1240 C CB  . ILE A 1 174 ? -51.897 64.719  -123.482 1.00 11.56 ? 174 ILE A CB  1 
ATOM   1241 C CG1 . ILE A 1 174 ? -52.115 63.825  -124.703 1.00 11.56 ? 174 ILE A CG1 1 
ATOM   1242 C CG2 . ILE A 1 174 ? -51.122 65.964  -123.893 1.00 11.16 ? 174 ILE A CG2 1 
ATOM   1243 C CD1 . ILE A 1 174 ? -53.544 63.716  -125.138 1.00 12.58 ? 174 ILE A CD1 1 
ATOM   1244 N N   . VAL A 1 175 ? -50.811 65.575  -120.641 1.00 12.84 ? 175 VAL A N   1 
ATOM   1245 C CA  . VAL A 1 175 ? -50.044 66.515  -119.831 1.00 12.41 ? 175 VAL A CA  1 
ATOM   1246 C C   . VAL A 1 175 ? -49.031 65.798  -118.944 1.00 15.69 ? 175 VAL A C   1 
ATOM   1247 O O   . VAL A 1 175 ? -47.871 66.208  -118.858 1.00 17.95 ? 175 VAL A O   1 
ATOM   1248 C CB  . VAL A 1 175 ? -50.969 67.374  -118.970 1.00 14.69 ? 175 VAL A CB  1 
ATOM   1249 C CG1 . VAL A 1 175 ? -50.162 68.269  -118.040 1.00 18.32 ? 175 VAL A CG1 1 
ATOM   1250 C CG2 . VAL A 1 175 ? -51.865 68.191  -119.875 1.00 14.60 ? 175 VAL A CG2 1 
ATOM   1251 N N   . ARG A 1 176 ? -49.466 64.722  -118.296 1.00 15.12 ? 176 ARG A N   1 
ATOM   1252 C CA  . ARG A 1 176 ? -48.567 63.932  -117.463 1.00 19.52 ? 176 ARG A CA  1 
ATOM   1253 C C   . ARG A 1 176 ? -47.470 63.289  -118.303 1.00 20.99 ? 176 ARG A C   1 
ATOM   1254 O O   . ARG A 1 176 ? -46.327 63.174  -117.863 1.00 22.17 ? 176 ARG A O   1 
ATOM   1255 C CB  . ARG A 1 176 ? -49.343 62.860  -116.695 1.00 21.56 ? 176 ARG A CB  1 
ATOM   1256 C CG  . ARG A 1 176 ? -50.314 63.418  -115.678 1.00 26.91 ? 176 ARG A CG  1 
ATOM   1257 C CD  . ARG A 1 176 ? -50.503 62.463  -114.514 1.00 30.96 ? 176 ARG A CD  1 
ATOM   1258 N NE  . ARG A 1 176 ? -51.080 63.146  -113.361 1.00 34.88 ? 176 ARG A NE  1 
ATOM   1259 C CZ  . ARG A 1 176 ? -52.322 62.962  -112.928 1.00 40.09 ? 176 ARG A CZ  1 
ATOM   1260 N NH1 . ARG A 1 176 ? -53.118 62.098  -113.541 1.00 43.54 ? 176 ARG A NH1 1 
ATOM   1261 N NH2 . ARG A 1 176 ? -52.765 63.632  -111.873 1.00 40.82 ? 176 ARG A NH2 1 
ATOM   1262 N N   . SER A 1 177 ? -47.823 62.878  -119.516 1.00 21.46 ? 177 SER A N   1 
ATOM   1263 C CA  . SER A 1 177 ? -46.863 62.271  -120.429 1.00 22.57 ? 177 SER A CA  1 
ATOM   1264 C C   . SER A 1 177 ? -45.771 63.245  -120.871 1.00 21.88 ? 177 SER A C   1 
ATOM   1265 O O   . SER A 1 177 ? -44.591 62.887  -120.942 1.00 19.72 ? 177 SER A O   1 
ATOM   1266 C CB  . SER A 1 177 ? -47.588 61.721  -121.653 1.00 28.38 ? 177 SER A CB  1 
ATOM   1267 O OG  . SER A 1 177 ? -46.677 61.459  -122.703 1.00 33.42 ? 177 SER A OG  1 
ATOM   1268 N N   . VAL A 1 178 ? -46.177 64.472  -121.182 1.00 23.08 ? 178 VAL A N   1 
ATOM   1269 C CA  . VAL A 1 178 ? -45.230 65.514  -121.558 1.00 20.49 ? 178 VAL A CA  1 
ATOM   1270 C C   . VAL A 1 178 ? -44.270 65.776  -120.406 1.00 18.75 ? 178 VAL A C   1 
ATOM   1271 O O   . VAL A 1 178 ? -43.060 65.906  -120.608 1.00 19.23 ? 178 VAL A O   1 
ATOM   1272 C CB  . VAL A 1 178 ? -45.939 66.824  -121.945 1.00 11.80 ? 178 VAL A CB  1 
ATOM   1273 C CG1 . VAL A 1 178 ? -44.924 67.929  -122.176 1.00 18.55 ? 178 VAL A CG1 1 
ATOM   1274 C CG2 . VAL A 1 178 ? -46.794 66.615  -123.188 1.00 11.29 ? 178 VAL A CG2 1 
ATOM   1275 N N   . GLN A 1 179 ? -44.817 65.838  -119.197 1.00 13.56 ? 179 GLN A N   1 
ATOM   1276 C CA  . GLN A 1 179 ? -44.005 66.001  -117.997 1.00 15.49 ? 179 GLN A CA  1 
ATOM   1277 C C   . GLN A 1 179 ? -43.050 64.825  -117.825 1.00 17.37 ? 179 GLN A C   1 
ATOM   1278 O O   . GLN A 1 179 ? -41.882 65.015  -117.494 1.00 15.41 ? 179 GLN A O   1 
ATOM   1279 C CB  . GLN A 1 179 ? -44.894 66.144  -116.757 1.00 16.31 ? 179 GLN A CB  1 
ATOM   1280 C CG  . GLN A 1 179 ? -45.696 67.438  -116.712 1.00 18.27 ? 179 GLN A CG  1 
ATOM   1281 C CD  . GLN A 1 179 ? -46.727 67.458  -115.596 1.00 21.42 ? 179 GLN A CD  1 
ATOM   1282 O OE1 . GLN A 1 179 ? -46.958 66.450  -114.925 1.00 25.24 ? 179 GLN A OE1 1 
ATOM   1283 N NE2 . GLN A 1 179 ? -47.355 68.610  -115.395 1.00 20.78 ? 179 GLN A NE2 1 
ATOM   1284 N N   . PHE A 1 180 ? -43.554 63.616  -118.054 1.00 14.75 ? 180 PHE A N   1 
ATOM   1285 C CA  . PHE A 1 180 ? -42.743 62.409  -117.924 1.00 16.88 ? 180 PHE A CA  1 
ATOM   1286 C C   . PHE A 1 180 ? -41.582 62.371  -118.913 1.00 16.03 ? 180 PHE A C   1 
ATOM   1287 O O   . PHE A 1 180 ? -40.444 62.092  -118.530 1.00 16.74 ? 180 PHE A O   1 
ATOM   1288 C CB  . PHE A 1 180 ? -43.606 61.156  -118.103 1.00 15.87 ? 180 PHE A CB  1 
ATOM   1289 C CG  . PHE A 1 180 ? -42.807 59.890  -118.226 1.00 16.33 ? 180 PHE A CG  1 
ATOM   1290 C CD1 . PHE A 1 180 ? -42.099 59.396  -117.141 1.00 20.07 ? 180 PHE A CD1 1 
ATOM   1291 C CD2 . PHE A 1 180 ? -42.760 59.195  -119.425 1.00 18.35 ? 180 PHE A CD2 1 
ATOM   1292 C CE1 . PHE A 1 180 ? -41.359 58.234  -117.249 1.00 21.85 ? 180 PHE A CE1 1 
ATOM   1293 C CE2 . PHE A 1 180 ? -42.023 58.030  -119.539 1.00 19.59 ? 180 PHE A CE2 1 
ATOM   1294 C CZ  . PHE A 1 180 ? -41.323 57.551  -118.448 1.00 20.95 ? 180 PHE A CZ  1 
ATOM   1295 N N   . LEU A 1 181 ? -41.873 62.640  -120.183 1.00 16.51 ? 181 LEU A N   1 
ATOM   1296 C CA  . LEU A 1 181 ? -40.849 62.619  -121.225 1.00 19.05 ? 181 LEU A CA  1 
ATOM   1297 C C   . LEU A 1 181 ? -39.725 63.612  -120.953 1.00 28.80 ? 181 LEU A C   1 
ATOM   1298 O O   . LEU A 1 181 ? -38.549 63.287  -121.113 1.00 32.88 ? 181 LEU A O   1 
ATOM   1299 C CB  . LEU A 1 181 ? -41.464 62.915  -122.593 1.00 14.06 ? 181 LEU A CB  1 
ATOM   1300 C CG  . LEU A 1 181 ? -42.256 61.790  -123.256 1.00 13.71 ? 181 LEU A CG  1 
ATOM   1301 C CD1 . LEU A 1 181 ? -42.644 62.180  -124.669 1.00 13.09 ? 181 LEU A CD1 1 
ATOM   1302 C CD2 . LEU A 1 181 ? -41.451 60.501  -123.256 1.00 14.64 ? 181 LEU A CD2 1 
ATOM   1303 N N   . CYS A 1 182 ? -40.091 64.821  -120.543 1.00 30.44 ? 182 CYS A N   1 
ATOM   1304 C CA  . CYS A 1 182 ? -39.110 65.882  -120.337 1.00 30.49 ? 182 CYS A CA  1 
ATOM   1305 C C   . CYS A 1 182 ? -38.260 65.672  -119.090 1.00 33.24 ? 182 CYS A C   1 
ATOM   1306 O O   . CYS A 1 182 ? -37.084 66.024  -119.071 1.00 37.13 ? 182 CYS A O   1 
ATOM   1307 C CB  . CYS A 1 182 ? -39.807 67.242  -120.256 1.00 26.45 ? 182 CYS A CB  1 
ATOM   1308 S SG  . CYS A 1 182 ? -40.619 67.757  -121.780 1.00 20.20 ? 182 CYS A SG  1 
ATOM   1309 N N   . THR A 1 183 ? -38.853 65.099  -118.050 1.00 32.15 ? 183 THR A N   1 
ATOM   1310 C CA  . THR A 1 183 ? -38.151 64.933  -116.780 1.00 26.46 ? 183 THR A CA  1 
ATOM   1311 C C   . THR A 1 183 ? -37.269 63.683  -116.752 1.00 22.88 ? 183 THR A C   1 
ATOM   1312 O O   . THR A 1 183 ? -36.171 63.698  -116.188 1.00 20.89 ? 183 THR A O   1 
ATOM   1313 C CB  . THR A 1 183 ? -39.154 64.885  -115.611 1.00 26.17 ? 183 THR A CB  1 
ATOM   1314 O OG1 . THR A 1 183 ? -39.661 66.202  -115.371 1.00 29.83 ? 183 THR A OG1 1 
ATOM   1315 C CG2 . THR A 1 183 ? -38.507 64.368  -114.332 1.00 27.75 ? 183 THR A CG2 1 
ATOM   1316 N N   . LYS A 1 184 ? -37.730 62.611  -117.387 1.00 24.19 ? 184 LYS A N   1 
ATOM   1317 C CA  . LYS A 1 184 ? -37.080 61.315  -117.221 1.00 29.38 ? 184 LYS A CA  1 
ATOM   1318 C C   . LYS A 1 184 ? -36.485 60.716  -118.496 1.00 32.06 ? 184 LYS A C   1 
ATOM   1319 O O   . LYS A 1 184 ? -35.504 59.981  -118.425 1.00 37.30 ? 184 LYS A O   1 
ATOM   1320 C CB  . LYS A 1 184 ? -38.075 60.320  -116.610 1.00 33.07 ? 184 LYS A CB  1 
ATOM   1321 C CG  . LYS A 1 184 ? -38.666 60.770  -115.284 1.00 33.92 ? 184 LYS A CG  1 
ATOM   1322 C CD  . LYS A 1 184 ? -38.273 59.836  -114.153 1.00 42.16 ? 184 LYS A CD  1 
ATOM   1323 C CE  . LYS A 1 184 ? -38.894 58.462  -114.336 1.00 46.04 ? 184 LYS A CE  1 
ATOM   1324 N NZ  . LYS A 1 184 ? -39.198 57.817  -113.027 1.00 46.60 ? 184 LYS A NZ  1 
ATOM   1325 N N   . VAL A 1 185 ? -37.061 61.022  -119.654 1.00 29.76 ? 185 VAL A N   1 
ATOM   1326 C CA  . VAL A 1 185 ? -36.653 60.345  -120.888 1.00 28.12 ? 185 VAL A CA  1 
ATOM   1327 C C   . VAL A 1 185 ? -35.751 61.177  -121.808 1.00 29.10 ? 185 VAL A C   1 
ATOM   1328 O O   . VAL A 1 185 ? -34.716 60.692  -122.274 1.00 26.28 ? 185 VAL A O   1 
ATOM   1329 C CB  . VAL A 1 185 ? -37.891 59.883  -121.693 1.00 23.54 ? 185 VAL A CB  1 
ATOM   1330 C CG1 . VAL A 1 185 ? -37.496 59.435  -123.094 1.00 21.24 ? 185 VAL A CG1 1 
ATOM   1331 C CG2 . VAL A 1 185 ? -38.602 58.760  -120.953 1.00 20.85 ? 185 VAL A CG2 1 
ATOM   1332 N N   . LEU A 1 186 ? -36.138 62.423  -122.066 1.00 31.28 ? 186 LEU A N   1 
ATOM   1333 C CA  . LEU A 1 186 ? -35.420 63.260  -123.026 1.00 29.15 ? 186 LEU A CA  1 
ATOM   1334 C C   . LEU A 1 186 ? -34.116 63.825  -122.460 1.00 29.55 ? 186 LEU A C   1 
ATOM   1335 O O   . LEU A 1 186 ? -34.101 64.434  -121.391 1.00 31.03 ? 186 LEU A O   1 
ATOM   1336 C CB  . LEU A 1 186 ? -36.315 64.406  -123.502 1.00 27.98 ? 186 LEU A CB  1 
ATOM   1337 C CG  . LEU A 1 186 ? -37.458 64.001  -124.431 1.00 22.30 ? 186 LEU A CG  1 
ATOM   1338 C CD1 . LEU A 1 186 ? -38.421 65.156  -124.658 1.00 17.66 ? 186 LEU A CD1 1 
ATOM   1339 C CD2 . LEU A 1 186 ? -36.908 63.498  -125.756 1.00 22.41 ? 186 LEU A CD2 1 
ATOM   1340 N N   . GLU A 1 187 ? -33.026 63.620  -123.193 1.00 27.60 ? 187 GLU A N   1 
ATOM   1341 C CA  . GLU A 1 187 ? -31.724 64.159  -122.829 1.00 29.39 ? 187 GLU A CA  1 
ATOM   1342 C C   . GLU A 1 187 ? -31.719 65.674  -123.042 1.00 27.43 ? 187 GLU A C   1 
ATOM   1343 O O   . GLU A 1 187 ? -32.559 66.188  -123.776 1.00 25.21 ? 187 GLU A O   1 
ATOM   1344 C CB  . GLU A 1 187 ? -30.622 63.476  -123.651 1.00 29.59 ? 187 GLU A CB  1 
ATOM   1345 C CG  . GLU A 1 187 ? -30.520 61.981  -123.413 1.00 35.04 ? 187 GLU A CG  1 
ATOM   1346 C CD  . GLU A 1 187 ? -29.423 61.324  -124.234 1.00 45.10 ? 187 GLU A CD  1 
ATOM   1347 O OE1 . GLU A 1 187 ? -29.151 61.789  -125.364 1.00 45.54 ? 187 GLU A OE1 1 
ATOM   1348 O OE2 . GLU A 1 187 ? -28.831 60.338  -123.747 1.00 52.21 ? 187 GLU A OE2 1 
ATOM   1349 N N   . PRO A 1 188 ? -30.778 66.400  -122.398 1.00 26.16 ? 188 PRO A N   1 
ATOM   1350 C CA  . PRO A 1 188 ? -30.807 67.867  -122.495 1.00 25.73 ? 188 PRO A CA  1 
ATOM   1351 C C   . PRO A 1 188 ? -30.568 68.367  -123.918 1.00 29.38 ? 188 PRO A C   1 
ATOM   1352 O O   . PRO A 1 188 ? -29.762 67.804  -124.656 1.00 30.35 ? 188 PRO A O   1 
ATOM   1353 C CB  . PRO A 1 188 ? -29.671 68.310  -121.563 1.00 27.23 ? 188 PRO A CB  1 
ATOM   1354 C CG  . PRO A 1 188 ? -28.806 67.123  -121.417 1.00 27.23 ? 188 PRO A CG  1 
ATOM   1355 C CD  . PRO A 1 188 ? -29.696 65.935  -121.513 1.00 27.01 ? 188 PRO A CD  1 
ATOM   1356 N N   . LEU A 1 189 ? -31.301 69.406  -124.296 1.00 34.13 ? 189 LEU A N   1 
ATOM   1357 C CA  . LEU A 1 189 ? -31.187 70.014  -125.612 1.00 34.16 ? 189 LEU A CA  1 
ATOM   1358 C C   . LEU A 1 189 ? -29.812 70.639  -125.812 1.00 32.51 ? 189 LEU A C   1 
ATOM   1359 O O   . LEU A 1 189 ? -29.131 70.956  -124.838 1.00 35.18 ? 189 LEU A O   1 
ATOM   1360 C CB  . LEU A 1 189 ? -32.279 71.071  -125.794 1.00 32.04 ? 189 LEU A CB  1 
ATOM   1361 C CG  . LEU A 1 189 ? -33.687 70.545  -126.061 1.00 27.17 ? 189 LEU A CG  1 
ATOM   1362 C CD1 . LEU A 1 189 ? -34.706 71.665  -125.933 1.00 18.88 ? 189 LEU A CD1 1 
ATOM   1363 C CD2 . LEU A 1 189 ? -33.778 69.896  -127.437 1.00 28.61 ? 189 LEU A CD2 1 
ATOM   1364 N N   . PRO A 1 190 ? -29.394 70.823  -127.080 1.00 29.79 ? 190 PRO A N   1 
ATOM   1365 C CA  . PRO A 1 190 ? -28.078 71.427  -127.316 1.00 28.67 ? 190 PRO A CA  1 
ATOM   1366 C C   . PRO A 1 190 ? -28.071 72.888  -126.894 1.00 27.90 ? 190 PRO A C   1 
ATOM   1367 O O   . PRO A 1 190 ? -29.140 73.481  -126.748 1.00 28.33 ? 190 PRO A O   1 
ATOM   1368 C CB  . PRO A 1 190 ? -27.886 71.282  -128.829 1.00 29.64 ? 190 PRO A CB  1 
ATOM   1369 C CG  . PRO A 1 190 ? -29.266 71.218  -129.371 1.00 31.09 ? 190 PRO A CG  1 
ATOM   1370 C CD  . PRO A 1 190 ? -30.084 70.506  -128.343 1.00 29.65 ? 190 PRO A CD  1 
ATOM   1371 N N   . GLU A 1 191 ? -26.886 73.448  -126.678 1.00 29.25 ? 191 GLU A N   1 
ATOM   1372 C CA  . GLU A 1 191 ? -26.760 74.830  -126.237 1.00 29.43 ? 191 GLU A CA  1 
ATOM   1373 C C   . GLU A 1 191 ? -27.371 75.797  -127.246 1.00 32.18 ? 191 GLU A C   1 
ATOM   1374 O O   . GLU A 1 191 ? -27.991 76.792  -126.868 1.00 35.04 ? 191 GLU A O   1 
ATOM   1375 C CB  . GLU A 1 191 ? -25.290 75.166  -125.992 1.00 31.31 ? 191 GLU A CB  1 
ATOM   1376 C CG  . GLU A 1 191 ? -24.662 74.320  -124.891 1.00 33.48 ? 191 GLU A CG  1 
ATOM   1377 C CD  . GLU A 1 191 ? -23.145 74.332  -124.926 1.00 37.31 ? 191 GLU A CD  1 
ATOM   1378 O OE1 . GLU A 1 191 ? -22.567 75.201  -125.613 1.00 37.97 ? 191 GLU A OE1 1 
ATOM   1379 O OE2 . GLU A 1 191 ? -22.534 73.465  -124.265 1.00 36.23 ? 191 GLU A OE2 1 
ATOM   1380 N N   . GLU A 1 192 ? -27.206 75.498  -128.530 1.00 32.76 ? 192 GLU A N   1 
ATOM   1381 C CA  . GLU A 1 192 ? -27.800 76.321  -129.576 1.00 29.17 ? 192 GLU A CA  1 
ATOM   1382 C C   . GLU A 1 192 ? -28.809 75.529  -130.398 1.00 27.52 ? 192 GLU A C   1 
ATOM   1383 O O   . GLU A 1 192 ? -28.547 74.390  -130.792 1.00 27.85 ? 192 GLU A O   1 
ATOM   1384 C CB  . GLU A 1 192 ? -26.718 76.901  -130.487 1.00 27.42 ? 192 GLU A CB  1 
ATOM   1385 C CG  . GLU A 1 192 ? -25.790 77.882  -129.788 1.00 30.46 ? 192 GLU A CG  1 
ATOM   1386 C CD  . GLU A 1 192 ? -24.859 78.596  -130.750 1.00 34.46 ? 192 GLU A CD  1 
ATOM   1387 O OE1 . GLU A 1 192 ? -24.461 77.981  -131.763 1.00 34.02 ? 192 GLU A OE1 1 
ATOM   1388 O OE2 . GLU A 1 192 ? -24.531 79.774  -130.494 1.00 29.03 ? 192 GLU A OE2 1 
ATOM   1389 N N   . PHE A 1 193 ? -29.966 76.139  -130.643 1.00 27.12 ? 193 PHE A N   1 
ATOM   1390 C CA  . PHE A 1 193 ? -31.003 75.530  -131.470 1.00 25.61 ? 193 PHE A CA  1 
ATOM   1391 C C   . PHE A 1 193 ? -32.015 76.574  -131.933 1.00 28.20 ? 193 PHE A C   1 
ATOM   1392 O O   . PHE A 1 193 ? -32.005 77.714  -131.462 1.00 29.33 ? 193 PHE A O   1 
ATOM   1393 C CB  . PHE A 1 193 ? -31.714 74.396  -130.714 1.00 21.83 ? 193 PHE A CB  1 
ATOM   1394 C CG  . PHE A 1 193 ? -32.459 74.841  -129.478 1.00 21.45 ? 193 PHE A CG  1 
ATOM   1395 C CD1 . PHE A 1 193 ? -33.748 75.350  -129.568 1.00 21.32 ? 193 PHE A CD1 1 
ATOM   1396 C CD2 . PHE A 1 193 ? -31.884 74.711  -128.223 1.00 23.18 ? 193 PHE A CD2 1 
ATOM   1397 C CE1 . PHE A 1 193 ? -34.437 75.746  -128.436 1.00 21.88 ? 193 PHE A CE1 1 
ATOM   1398 C CE2 . PHE A 1 193 ? -32.570 75.103  -127.085 1.00 23.80 ? 193 PHE A CE2 1 
ATOM   1399 C CZ  . PHE A 1 193 ? -33.850 75.619  -127.193 1.00 24.66 ? 193 PHE A CZ  1 
ATOM   1400 N N   . THR A 1 194 ? -32.886 76.175  -132.855 1.00 26.25 ? 194 THR A N   1 
ATOM   1401 C CA  . THR A 1 194 ? -33.957 77.041  -133.331 1.00 21.17 ? 194 THR A CA  1 
ATOM   1402 C C   . THR A 1 194 ? -35.277 76.280  -133.320 1.00 18.85 ? 194 THR A C   1 
ATOM   1403 O O   . THR A 1 194 ? -35.362 75.162  -133.832 1.00 16.57 ? 194 THR A O   1 
ATOM   1404 C CB  . THR A 1 194 ? -33.676 77.571  -134.747 1.00 25.00 ? 194 THR A CB  1 
ATOM   1405 O OG1 . THR A 1 194 ? -32.542 78.447  -134.714 1.00 31.05 ? 194 THR A OG1 1 
ATOM   1406 C CG2 . THR A 1 194 ? -34.880 78.330  -135.286 1.00 23.53 ? 194 THR A CG2 1 
ATOM   1407 N N   . ALA A 1 195 ? -36.303 76.885  -132.728 1.00 18.41 ? 195 ALA A N   1 
ATOM   1408 C CA  . ALA A 1 195 ? -37.602 76.235  -132.601 1.00 18.84 ? 195 ALA A CA  1 
ATOM   1409 C C   . ALA A 1 195 ? -38.711 77.066  -133.233 1.00 20.42 ? 195 ALA A C   1 
ATOM   1410 O O   . ALA A 1 195 ? -38.842 78.262  -132.957 1.00 21.49 ? 195 ALA A O   1 
ATOM   1411 C CB  . ALA A 1 195 ? -37.921 75.968  -131.141 1.00 15.46 ? 195 ALA A CB  1 
ATOM   1412 N N   . ASN A 1 196 ? -39.508 76.426  -134.083 1.00 17.26 ? 196 ASN A N   1 
ATOM   1413 C CA  . ASN A 1 196 ? -40.674 77.082  -134.658 1.00 19.78 ? 196 ASN A CA  1 
ATOM   1414 C C   . ASN A 1 196 ? -41.843 76.115  -134.821 1.00 21.40 ? 196 ASN A C   1 
ATOM   1415 O O   . ASN A 1 196 ? -41.715 74.916  -134.561 1.00 19.52 ? 196 ASN A O   1 
ATOM   1416 C CB  . ASN A 1 196 ? -40.324 77.720  -136.008 1.00 15.48 ? 196 ASN A CB  1 
ATOM   1417 C CG  . ASN A 1 196 ? -39.894 76.697  -137.056 1.00 16.88 ? 196 ASN A CG  1 
ATOM   1418 O OD1 . ASN A 1 196 ? -39.780 75.500  -136.779 1.00 15.31 ? 196 ASN A OD1 1 
ATOM   1419 N ND2 . ASN A 1 196 ? -39.661 77.172  -138.272 1.00 16.99 ? 196 ASN A ND2 1 
ATOM   1420 N N   . PHE A 1 197 ? -42.978 76.646  -135.260 1.00 23.00 ? 197 PHE A N   1 
ATOM   1421 C CA  . PHE A 1 197 ? -44.152 75.825  -135.510 1.00 18.69 ? 197 PHE A CA  1 
ATOM   1422 C C   . PHE A 1 197 ? -44.367 75.632  -137.004 1.00 13.84 ? 197 PHE A C   1 
ATOM   1423 O O   . PHE A 1 197 ? -44.367 76.596  -137.776 1.00 14.55 ? 197 PHE A O   1 
ATOM   1424 C CB  . PHE A 1 197 ? -45.393 76.445  -134.866 1.00 17.23 ? 197 PHE A CB  1 
ATOM   1425 C CG  . PHE A 1 197 ? -45.483 76.214  -133.382 1.00 18.82 ? 197 PHE A CG  1 
ATOM   1426 C CD1 . PHE A 1 197 ? -44.920 77.114  -132.488 1.00 13.02 ? 197 PHE A CD1 1 
ATOM   1427 C CD2 . PHE A 1 197 ? -46.126 75.090  -132.881 1.00 19.23 ? 197 PHE A CD2 1 
ATOM   1428 C CE1 . PHE A 1 197 ? -45.000 76.899  -131.120 1.00 17.90 ? 197 PHE A CE1 1 
ATOM   1429 C CE2 . PHE A 1 197 ? -46.207 74.868  -131.514 1.00 20.45 ? 197 PHE A CE2 1 
ATOM   1430 C CZ  . PHE A 1 197 ? -45.646 75.775  -130.634 1.00 19.79 ? 197 PHE A CZ  1 
ATOM   1431 N N   . ARG A 1 198 ? -44.533 74.376  -137.404 1.00 19.39 ? 198 ARG A N   1 
ATOM   1432 C CA  . ARG A 1 198 ? -44.758 74.039  -138.801 1.00 21.59 ? 198 ARG A CA  1 
ATOM   1433 C C   . ARG A 1 198 ? -46.022 73.194  -138.925 1.00 20.74 ? 198 ARG A C   1 
ATOM   1434 O O   . ARG A 1 198 ? -46.251 72.287  -138.116 1.00 16.10 ? 198 ARG A O   1 
ATOM   1435 C CB  . ARG A 1 198 ? -43.539 73.307  -139.373 1.00 17.53 ? 198 ARG A CB  1 
ATOM   1436 C CG  . ARG A 1 198 ? -42.213 74.012  -139.087 1.00 18.77 ? 198 ARG A CG  1 
ATOM   1437 C CD  . ARG A 1 198 ? -41.027 73.338  -139.767 1.00 15.56 ? 198 ARG A CD  1 
ATOM   1438 N NE  . ARG A 1 198 ? -39.755 73.867  -139.279 1.00 15.88 ? 198 ARG A NE  1 
ATOM   1439 C CZ  . ARG A 1 198 ? -38.562 73.504  -139.743 1.00 23.67 ? 198 ARG A CZ  1 
ATOM   1440 N NH1 . ARG A 1 198 ? -38.468 72.612  -140.719 1.00 17.15 ? 198 ARG A NH1 1 
ATOM   1441 N NH2 . ARG A 1 198 ? -37.461 74.038  -139.233 1.00 24.72 ? 198 ARG A NH2 1 
ATOM   1442 N N   . LEU A 1 199 ? -46.847 73.496  -139.928 1.00 21.97 ? 199 LEU A N   1 
ATOM   1443 C CA  . LEU A 1 199 ? -48.113 72.784  -140.091 1.00 21.15 ? 199 LEU A CA  1 
ATOM   1444 C C   . LEU A 1 199 ? -48.364 72.283  -141.511 1.00 17.97 ? 199 LEU A C   1 
ATOM   1445 O O   . LEU A 1 199 ? -47.702 72.702  -142.460 1.00 19.19 ? 199 LEU A O   1 
ATOM   1446 C CB  . LEU A 1 199 ? -49.284 73.671  -139.642 1.00 20.28 ? 199 LEU A CB  1 
ATOM   1447 C CG  . LEU A 1 199 ? -49.631 74.982  -140.348 1.00 22.55 ? 199 LEU A CG  1 
ATOM   1448 C CD1 . LEU A 1 199 ? -50.462 74.769  -141.614 1.00 30.32 ? 199 LEU A CD1 1 
ATOM   1449 C CD2 . LEU A 1 199 ? -50.379 75.864  -139.372 1.00 15.09 ? 199 LEU A CD2 1 
ATOM   1450 N N   . GLU A 1 200 ? -49.345 71.395  -141.639 1.00 15.46 ? 200 GLU A N   1 
ATOM   1451 C CA  . GLU A 1 200 ? -49.764 70.886  -142.936 1.00 20.15 ? 200 GLU A CA  1 
ATOM   1452 C C   . GLU A 1 200 ? -51.285 70.947  -143.063 1.00 21.81 ? 200 GLU A C   1 
ATOM   1453 O O   . GLU A 1 200 ? -52.004 70.687  -142.098 1.00 20.60 ? 200 GLU A O   1 
ATOM   1454 C CB  . GLU A 1 200 ? -49.270 69.452  -143.139 1.00 22.71 ? 200 GLU A CB  1 
ATOM   1455 C CG  . GLU A 1 200 ? -49.622 68.873  -144.494 1.00 29.17 ? 200 GLU A CG  1 
ATOM   1456 C CD  . GLU A 1 200 ? -49.039 67.492  -144.711 1.00 34.46 ? 200 GLU A CD  1 
ATOM   1457 O OE1 . GLU A 1 200 ? -48.598 66.865  -143.724 1.00 31.34 ? 200 GLU A OE1 1 
ATOM   1458 O OE2 . GLU A 1 200 ? -49.018 67.034  -145.872 1.00 43.35 ? 200 GLU A OE2 1 
ATOM   1459 N N   . TYR A 1 201 ? -51.768 71.294  -144.252 1.00 24.34 ? 201 TYR A N   1 
ATOM   1460 C CA  . TYR A 1 201 ? -53.202 71.353  -144.518 1.00 23.29 ? 201 TYR A CA  1 
ATOM   1461 C C   . TYR A 1 201 ? -53.733 70.010  -145.012 1.00 23.92 ? 201 TYR A C   1 
ATOM   1462 O O   . TYR A 1 201 ? -52.967 69.162  -145.470 1.00 22.11 ? 201 TYR A O   1 
ATOM   1463 C CB  . TYR A 1 201 ? -53.512 72.443  -145.549 1.00 23.54 ? 201 TYR A CB  1 
ATOM   1464 C CG  . TYR A 1 201 ? -53.124 73.840  -145.113 1.00 23.78 ? 201 TYR A CG  1 
ATOM   1465 C CD1 . TYR A 1 201 ? -54.015 74.643  -144.414 1.00 21.50 ? 201 TYR A CD1 1 
ATOM   1466 C CD2 . TYR A 1 201 ? -51.867 74.356  -145.405 1.00 25.39 ? 201 TYR A CD2 1 
ATOM   1467 C CE1 . TYR A 1 201 ? -53.666 75.918  -144.014 1.00 24.87 ? 201 TYR A CE1 1 
ATOM   1468 C CE2 . TYR A 1 201 ? -51.508 75.630  -145.010 1.00 26.64 ? 201 TYR A CE2 1 
ATOM   1469 C CZ  . TYR A 1 201 ? -52.412 76.407  -144.314 1.00 27.07 ? 201 TYR A CZ  1 
ATOM   1470 O OH  . TYR A 1 201 ? -52.060 77.676  -143.917 1.00 24.72 ? 201 TYR A OH  1 
ATOM   1471 N N   . THR A 1 202 ? -55.048 69.824  -144.917 1.00 25.67 ? 202 THR A N   1 
ATOM   1472 C CA  . THR A 1 202 ? -55.700 68.639  -145.473 1.00 25.60 ? 202 THR A CA  1 
ATOM   1473 C C   . THR A 1 202 ? -55.874 68.792  -146.981 1.00 36.74 ? 202 THR A C   1 
ATOM   1474 O O   . THR A 1 202 ? -55.591 69.854  -147.535 1.00 38.45 ? 202 THR A O   1 
ATOM   1475 C CB  . THR A 1 202 ? -57.078 68.385  -144.828 1.00 21.27 ? 202 THR A CB  1 
ATOM   1476 O OG1 . THR A 1 202 ? -57.839 69.600  -144.823 1.00 21.13 ? 202 THR A OG1 1 
ATOM   1477 C CG2 . THR A 1 202 ? -56.918 67.890  -143.401 1.00 20.43 ? 202 THR A CG2 1 
ATOM   1478 N N   . ASN A 1 203 ? -56.337 67.735  -147.644 1.00 43.46 ? 203 ASN A N   1 
ATOM   1479 C CA  . ASN A 1 203 ? -56.616 67.807  -149.074 1.00 45.84 ? 203 ASN A CA  1 
ATOM   1480 C C   . ASN A 1 203 ? -57.815 68.713  -149.334 1.00 50.09 ? 203 ASN A C   1 
ATOM   1481 O O   . ASN A 1 203 ? -57.841 69.469  -150.311 1.00 56.69 ? 203 ASN A O   1 
ATOM   1482 C CB  . ASN A 1 203 ? -56.879 66.414  -149.656 1.00 47.39 ? 203 ASN A CB  1 
ATOM   1483 C CG  . ASN A 1 203 ? -56.158 65.312  -148.899 1.00 50.83 ? 203 ASN A CG  1 
ATOM   1484 O OD1 . ASN A 1 203 ? -56.644 64.827  -147.876 1.00 56.38 ? 203 ASN A OD1 1 
ATOM   1485 N ND2 . ASN A 1 203 ? -55.003 64.896  -149.409 1.00 48.18 ? 203 ASN A ND2 1 
ATOM   1486 N N   . ASP A 1 204 ? -58.802 68.622  -148.443 1.00 49.27 ? 204 ASP A N   1 
ATOM   1487 C CA  . ASP A 1 204 ? -60.052 69.377  -148.550 1.00 49.55 ? 204 ASP A CA  1 
ATOM   1488 C C   . ASP A 1 204 ? -59.817 70.881  -148.510 1.00 50.31 ? 204 ASP A C   1 
ATOM   1489 O O   . ASP A 1 204 ? -60.565 71.650  -149.101 1.00 55.16 ? 204 ASP A O   1 
ATOM   1490 C CB  . ASP A 1 204 ? -61.016 68.988  -147.426 1.00 48.80 ? 204 ASP A CB  1 
ATOM   1491 C CG  . ASP A 1 204 ? -61.434 67.534  -147.487 1.00 50.92 ? 204 ASP A CG  1 
ATOM   1492 O OD1 . ASP A 1 204 ? -61.300 66.921  -148.569 1.00 52.30 ? 204 ASP A OD1 1 
ATOM   1493 O OD2 . ASP A 1 204 ? -61.905 67.006  -146.456 1.00 50.23 ? 204 ASP A OD2 1 
ATOM   1494 N N   . ALA A 1 205 ? -58.775 71.286  -147.791 1.00 46.79 ? 205 ALA A N   1 
ATOM   1495 C CA  . ALA A 1 205 ? -58.443 72.692  -147.620 1.00 43.68 ? 205 ALA A CA  1 
ATOM   1496 C C   . ALA A 1 205 ? -58.320 73.395  -148.966 1.00 44.40 ? 205 ALA A C   1 
ATOM   1497 O O   . ALA A 1 205 ? -57.578 72.954  -149.832 1.00 39.07 ? 205 ALA A O   1 
ATOM   1498 C CB  . ALA A 1 205 ? -57.161 72.836  -146.828 1.00 39.62 ? 205 ALA A CB  1 
ATOM   1499 N N   . PRO A 1 206 ? -59.063 74.498  -149.148 1.00 48.65 ? 206 PRO A N   1 
ATOM   1500 C CA  . PRO A 1 206 ? -58.942 75.308  -150.366 1.00 49.15 ? 206 PRO A CA  1 
ATOM   1501 C C   . PRO A 1 206 ? -57.552 75.919  -150.490 1.00 47.15 ? 206 PRO A C   1 
ATOM   1502 O O   . PRO A 1 206 ? -56.872 76.092  -149.476 1.00 45.77 ? 206 PRO A O   1 
ATOM   1503 C CB  . PRO A 1 206 ? -59.995 76.405  -150.167 1.00 49.33 ? 206 PRO A CB  1 
ATOM   1504 C CG  . PRO A 1 206 ? -60.931 75.850  -149.141 1.00 47.55 ? 206 PRO A CG  1 
ATOM   1505 C CD  . PRO A 1 206 ? -60.088 75.035  -148.239 1.00 47.70 ? 206 PRO A CD  1 
ATOM   1506 N N   . SER A 1 207 ? -57.130 76.230  -151.710 1.00 46.69 ? 207 SER A N   1 
ATOM   1507 C CA  . SER A 1 207 ? -55.843 76.878  -151.921 1.00 43.41 ? 207 SER A CA  1 
ATOM   1508 C C   . SER A 1 207 ? -55.842 78.265  -151.293 1.00 42.79 ? 207 SER A C   1 
ATOM   1509 O O   . SER A 1 207 ? -54.820 78.725  -150.784 1.00 42.67 ? 207 SER A O   1 
ATOM   1510 C CB  . SER A 1 207 ? -55.520 76.977  -153.413 1.00 44.01 ? 207 SER A CB  1 
ATOM   1511 O OG  . SER A 1 207 ? -55.310 75.699  -153.983 1.00 40.88 ? 207 SER A OG  1 
ATOM   1512 N N   . ASN A 1 208 ? -56.996 78.925  -151.326 1.00 43.85 ? 208 ASN A N   1 
ATOM   1513 C CA  . ASN A 1 208 ? -57.114 80.277  -150.800 1.00 44.82 ? 208 ASN A CA  1 
ATOM   1514 C C   . ASN A 1 208 ? -57.014 80.329  -149.276 1.00 43.57 ? 208 ASN A C   1 
ATOM   1515 O O   . ASN A 1 208 ? -56.458 81.279  -148.723 1.00 47.93 ? 208 ASN A O   1 
ATOM   1516 C CB  . ASN A 1 208 ? -58.430 80.914  -151.254 1.00 49.84 ? 208 ASN A CB  1 
ATOM   1517 C CG  . ASN A 1 208 ? -59.651 80.232  -150.657 1.00 53.90 ? 208 ASN A CG  1 
ATOM   1518 O OD1 . ASN A 1 208 ? -60.024 80.493  -149.513 1.00 55.20 ? 208 ASN A OD1 1 
ATOM   1519 N ND2 . ASN A 1 208 ? -60.289 79.369  -151.438 1.00 56.08 ? 208 ASN A ND2 1 
ATOM   1520 N N   . PHE A 1 209 ? -57.549 79.313  -148.600 1.00 39.68 ? 209 PHE A N   1 
ATOM   1521 C CA  . PHE A 1 209 ? -57.546 79.290  -147.139 1.00 36.66 ? 209 PHE A CA  1 
ATOM   1522 C C   . PHE A 1 209 ? -56.135 79.170  -146.589 1.00 40.75 ? 209 PHE A C   1 
ATOM   1523 O O   . PHE A 1 209 ? -55.336 78.356  -147.049 1.00 45.10 ? 209 PHE A O   1 
ATOM   1524 C CB  . PHE A 1 209 ? -58.402 78.145  -146.590 1.00 30.29 ? 209 PHE A CB  1 
ATOM   1525 C CG  . PHE A 1 209 ? -58.325 77.999  -145.091 1.00 23.74 ? 209 PHE A CG  1 
ATOM   1526 C CD1 . PHE A 1 209 ? -59.157 78.742  -144.267 1.00 23.71 ? 209 PHE A CD1 1 
ATOM   1527 C CD2 . PHE A 1 209 ? -57.418 77.125  -144.507 1.00 22.29 ? 209 PHE A CD2 1 
ATOM   1528 C CE1 . PHE A 1 209 ? -59.086 78.614  -142.889 1.00 22.44 ? 209 PHE A CE1 1 
ATOM   1529 C CE2 . PHE A 1 209 ? -57.341 76.995  -143.132 1.00 20.84 ? 209 PHE A CE2 1 
ATOM   1530 C CZ  . PHE A 1 209 ? -58.177 77.740  -142.324 1.00 20.95 ? 209 PHE A CZ  1 
ATOM   1531 N N   . ARG A 1 210 ? -55.858 79.978  -145.575 1.00 37.86 ? 210 ARG A N   1 
ATOM   1532 C CA  . ARG A 1 210 ? -54.552 80.027  -144.947 1.00 35.41 ? 210 ARG A CA  1 
ATOM   1533 C C   . ARG A 1 210 ? -54.695 80.391  -143.483 1.00 32.37 ? 210 ARG A C   1 
ATOM   1534 O O   . ARG A 1 210 ? -55.441 81.304  -143.127 1.00 34.06 ? 210 ARG A O   1 
ATOM   1535 C CB  . ARG A 1 210 ? -53.667 81.037  -145.666 1.00 37.85 ? 210 ARG A CB  1 
ATOM   1536 C CG  . ARG A 1 210 ? -52.427 81.474  -144.909 1.00 40.73 ? 210 ARG A CG  1 
ATOM   1537 C CD  . ARG A 1 210 ? -51.655 82.508  -145.719 1.00 46.36 ? 210 ARG A CD  1 
ATOM   1538 N NE  . ARG A 1 210 ? -51.362 82.024  -147.066 1.00 51.33 ? 210 ARG A NE  1 
ATOM   1539 C CZ  . ARG A 1 210 ? -52.069 82.335  -148.151 1.00 54.97 ? 210 ARG A CZ  1 
ATOM   1540 N NH1 . ARG A 1 210 ? -53.121 83.140  -148.057 1.00 57.49 ? 210 ARG A NH1 1 
ATOM   1541 N NH2 . ARG A 1 210 ? -51.729 81.837  -149.331 1.00 56.23 ? 210 ARG A NH2 1 
ATOM   1542 N N   . ILE A 1 211 ? -53.984 79.664  -142.633 1.00 28.55 ? 211 ILE A N   1 
ATOM   1543 C CA  . ILE A 1 211 ? -54.000 79.944  -141.210 1.00 27.83 ? 211 ILE A CA  1 
ATOM   1544 C C   . ILE A 1 211 ? -53.153 81.177  -140.919 1.00 32.77 ? 211 ILE A C   1 
ATOM   1545 O O   . ILE A 1 211 ? -51.960 81.213  -141.230 1.00 36.24 ? 211 ILE A O   1 
ATOM   1546 C CB  . ILE A 1 211 ? -53.498 78.739  -140.408 1.00 22.41 ? 211 ILE A CB  1 
ATOM   1547 C CG1 . ILE A 1 211 ? -54.393 77.532  -140.694 1.00 19.19 ? 211 ILE A CG1 1 
ATOM   1548 C CG2 . ILE A 1 211 ? -53.461 79.058  -138.921 1.00 20.11 ? 211 ILE A CG2 1 
ATOM   1549 C CD1 . ILE A 1 211 ? -53.783 76.211  -140.326 1.00 18.48 ? 211 ILE A CD1 1 
ATOM   1550 N N   . ASP A 1 212 ? -53.796 82.194  -140.355 1.00 31.98 ? 212 ASP A N   1 
ATOM   1551 C CA  . ASP A 1 212 ? -53.125 83.430  -139.982 1.00 30.06 ? 212 ASP A CA  1 
ATOM   1552 C C   . ASP A 1 212 ? -51.932 83.134  -139.075 1.00 27.19 ? 212 ASP A C   1 
ATOM   1553 O O   . ASP A 1 212 ? -52.065 82.424  -138.074 1.00 23.48 ? 212 ASP A O   1 
ATOM   1554 C CB  . ASP A 1 212 ? -54.106 84.369  -139.284 1.00 35.38 ? 212 ASP A CB  1 
ATOM   1555 C CG  . ASP A 1 212 ? -53.849 85.826  -139.602 1.00 44.82 ? 212 ASP A CG  1 
ATOM   1556 O OD1 . ASP A 1 212 ? -52.670 86.213  -139.763 1.00 47.98 ? 212 ASP A OD1 1 
ATOM   1557 O OD2 . ASP A 1 212 ? -54.837 86.584  -139.690 1.00 48.61 ? 212 ASP A OD2 1 
ATOM   1558 N N   . GLY A 1 213 ? -50.765 83.657  -139.444 1.00 27.53 ? 213 GLY A N   1 
ATOM   1559 C CA  . GLY A 1 213 ? -49.558 83.457  -138.660 1.00 30.19 ? 213 GLY A CA  1 
ATOM   1560 C C   . GLY A 1 213 ? -48.581 82.480  -139.291 1.00 31.38 ? 213 GLY A C   1 
ATOM   1561 O O   . GLY A 1 213 ? -47.419 82.400  -138.889 1.00 26.25 ? 213 GLY A O   1 
ATOM   1562 N N   . PHE A 1 214 ? -49.052 81.734  -140.285 1.00 33.21 ? 214 PHE A N   1 
ATOM   1563 C CA  . PHE A 1 214 ? -48.211 80.753  -140.960 1.00 28.03 ? 214 PHE A CA  1 
ATOM   1564 C C   . PHE A 1 214 ? -48.068 81.058  -142.451 1.00 31.29 ? 214 PHE A C   1 
ATOM   1565 O O   . PHE A 1 214 ? -49.054 81.064  -143.192 1.00 32.88 ? 214 PHE A O   1 
ATOM   1566 C CB  . PHE A 1 214 ? -48.777 79.343  -140.769 1.00 21.85 ? 214 PHE A CB  1 
ATOM   1567 C CG  . PHE A 1 214 ? -48.739 78.856  -139.347 1.00 18.02 ? 214 PHE A CG  1 
ATOM   1568 C CD1 . PHE A 1 214 ? -49.712 79.245  -138.438 1.00 19.51 ? 214 PHE A CD1 1 
ATOM   1569 C CD2 . PHE A 1 214 ? -47.740 77.991  -138.926 1.00 17.26 ? 214 PHE A CD2 1 
ATOM   1570 C CE1 . PHE A 1 214 ? -49.683 78.790  -137.130 1.00 23.67 ? 214 PHE A CE1 1 
ATOM   1571 C CE2 . PHE A 1 214 ? -47.707 77.528  -137.619 1.00 21.10 ? 214 PHE A CE2 1 
ATOM   1572 C CZ  . PHE A 1 214 ? -48.679 77.930  -136.722 1.00 22.46 ? 214 PHE A CZ  1 
ATOM   1573 N N   . GLU A 1 215 ? -46.834 81.308  -142.882 1.00 31.50 ? 215 GLU A N   1 
ATOM   1574 C CA  . GLU A 1 215 ? -46.540 81.550  -144.288 1.00 30.67 ? 215 GLU A CA  1 
ATOM   1575 C C   . GLU A 1 215 ? -46.552 80.245  -145.073 1.00 27.26 ? 215 GLU A C   1 
ATOM   1576 O O   . GLU A 1 215 ? -46.079 79.218  -144.587 1.00 25.25 ? 215 GLU A O   1 
ATOM   1577 C CB  . GLU A 1 215 ? -45.186 82.246  -144.444 1.00 34.63 ? 215 GLU A CB  1 
ATOM   1578 C CG  . GLU A 1 215 ? -45.267 83.710  -144.857 1.00 44.59 ? 215 GLU A CG  1 
ATOM   1579 C CD  . GLU A 1 215 ? -45.781 84.614  -143.749 1.00 52.39 ? 215 GLU A CD  1 
ATOM   1580 O OE1 . GLU A 1 215 ? -45.924 84.143  -142.600 1.00 51.53 ? 215 GLU A OE1 1 
ATOM   1581 O OE2 . GLU A 1 215 ? -46.038 85.803  -144.030 1.00 56.87 ? 215 GLU A OE2 1 
ATOM   1582 N N   . ASP A 1 216 ? -47.094 80.292  -146.286 1.00 26.00 ? 216 ASP A N   1 
ATOM   1583 C CA  . ASP A 1 216 ? -47.158 79.115  -147.144 1.00 26.45 ? 216 ASP A CA  1 
ATOM   1584 C C   . ASP A 1 216 ? -45.767 78.599  -147.487 1.00 25.98 ? 216 ASP A C   1 
ATOM   1585 O O   . ASP A 1 216 ? -44.838 79.377  -147.699 1.00 25.20 ? 216 ASP A O   1 
ATOM   1586 C CB  . ASP A 1 216 ? -47.930 79.425  -148.427 1.00 30.49 ? 216 ASP A CB  1 
ATOM   1587 C CG  . ASP A 1 216 ? -49.420 79.176  -148.285 1.00 33.67 ? 216 ASP A CG  1 
ATOM   1588 O OD1 . ASP A 1 216 ? -49.888 78.997  -147.141 1.00 32.64 ? 216 ASP A OD1 1 
ATOM   1589 O OD2 . ASP A 1 216 ? -50.121 79.163  -149.319 1.00 35.84 ? 216 ASP A OD2 1 
ATOM   1590 N N   . SER A 1 217 ? -45.634 77.279  -147.533 1.00 21.94 ? 217 SER A N   1 
ATOM   1591 C CA  . SER A 1 217 ? -44.368 76.646  -147.870 1.00 23.88 ? 217 SER A CA  1 
ATOM   1592 C C   . SER A 1 217 ? -44.601 75.285  -148.511 1.00 29.58 ? 217 SER A C   1 
ATOM   1593 O O   . SER A 1 217 ? -45.587 74.610  -148.214 1.00 34.43 ? 217 SER A O   1 
ATOM   1594 C CB  . SER A 1 217 ? -43.492 76.500  -146.625 1.00 27.48 ? 217 SER A CB  1 
ATOM   1595 O OG  . SER A 1 217 ? -42.332 75.739  -146.909 1.00 30.22 ? 217 SER A OG  1 
ATOM   1596 N N   . SER A 1 218 ? -43.693 74.885  -149.393 1.00 31.94 ? 218 SER A N   1 
ATOM   1597 C CA  . SER A 1 218 ? -43.794 73.581  -150.033 1.00 30.20 ? 218 SER A CA  1 
ATOM   1598 C C   . SER A 1 218 ? -42.908 72.565  -149.324 1.00 27.32 ? 218 SER A C   1 
ATOM   1599 O O   . SER A 1 218 ? -42.796 71.417  -149.756 1.00 28.69 ? 218 SER A O   1 
ATOM   1600 C CB  . SER A 1 218 ? -43.424 73.674  -151.513 1.00 31.98 ? 218 SER A CB  1 
ATOM   1601 O OG  . SER A 1 218 ? -42.147 74.263  -151.683 1.00 34.08 ? 218 SER A OG  1 
ATOM   1602 N N   . THR A 1 219 ? -42.276 72.993  -148.235 1.00 26.95 ? 219 THR A N   1 
ATOM   1603 C CA  . THR A 1 219 ? -41.539 72.070  -147.380 1.00 30.44 ? 219 THR A CA  1 
ATOM   1604 C C   . THR A 1 219 ? -42.114 72.068  -145.967 1.00 28.52 ? 219 THR A C   1 
ATOM   1605 O O   . THR A 1 219 ? -42.760 73.027  -145.543 1.00 19.38 ? 219 THR A O   1 
ATOM   1606 C CB  . THR A 1 219 ? -40.036 72.404  -147.323 1.00 34.47 ? 219 THR A CB  1 
ATOM   1607 O OG1 . THR A 1 219 ? -39.858 73.790  -147.013 1.00 35.29 ? 219 THR A OG1 1 
ATOM   1608 C CG2 . THR A 1 219 ? -39.368 72.093  -148.654 1.00 23.63 ? 219 THR A CG2 1 
ATOM   1609 N N   . PHE A 1 220 ? -41.873 70.975  -145.251 1.00 30.50 ? 220 PHE A N   1 
ATOM   1610 C CA  . PHE A 1 220 ? -42.417 70.768  -143.916 1.00 29.05 ? 220 PHE A CA  1 
ATOM   1611 C C   . PHE A 1 220 ? -41.265 70.578  -142.942 1.00 29.16 ? 220 PHE A C   1 
ATOM   1612 O O   . PHE A 1 220 ? -40.554 71.527  -142.598 1.00 27.60 ? 220 PHE A O   1 
ATOM   1613 C CB  . PHE A 1 220 ? -43.342 69.545  -143.906 1.00 28.95 ? 220 PHE A CB  1 
ATOM   1614 C CG  . PHE A 1 220 ? -44.281 69.490  -142.732 1.00 30.86 ? 220 PHE A CG  1 
ATOM   1615 C CD1 . PHE A 1 220 ? -44.595 70.633  -142.016 1.00 30.72 ? 220 PHE A CD1 1 
ATOM   1616 C CD2 . PHE A 1 220 ? -44.852 68.284  -142.347 1.00 31.15 ? 220 PHE A CD2 1 
ATOM   1617 C CE1 . PHE A 1 220 ? -45.461 70.575  -140.940 1.00 29.19 ? 220 PHE A CE1 1 
ATOM   1618 C CE2 . PHE A 1 220 ? -45.719 68.221  -141.269 1.00 29.53 ? 220 PHE A CE2 1 
ATOM   1619 C CZ  . PHE A 1 220 ? -46.023 69.371  -140.565 1.00 26.45 ? 220 PHE A CZ  1 
ATOM   1620 N N   . TYR A 1 221 ? -41.087 69.335  -142.508 1.00 28.05 ? 221 TYR A N   1 
ATOM   1621 C CA  . TYR A 1 221 ? -39.896 68.933  -141.777 1.00 25.09 ? 221 TYR A CA  1 
ATOM   1622 C C   . TYR A 1 221 ? -39.582 67.483  -142.122 1.00 26.22 ? 221 TYR A C   1 
ATOM   1623 O O   . TYR A 1 221 ? -40.430 66.773  -142.668 1.00 27.29 ? 221 TYR A O   1 
ATOM   1624 C CB  . TYR A 1 221 ? -40.078 69.105  -140.263 1.00 16.07 ? 221 TYR A CB  1 
ATOM   1625 C CG  . TYR A 1 221 ? -41.105 68.179  -139.636 1.00 20.89 ? 221 TYR A CG  1 
ATOM   1626 C CD1 . TYR A 1 221 ? -40.782 66.866  -139.303 1.00 17.28 ? 221 TYR A CD1 1 
ATOM   1627 C CD2 . TYR A 1 221 ? -42.389 68.627  -139.354 1.00 21.90 ? 221 TYR A CD2 1 
ATOM   1628 C CE1 . TYR A 1 221 ? -41.711 66.024  -138.728 1.00 15.46 ? 221 TYR A CE1 1 
ATOM   1629 C CE2 . TYR A 1 221 ? -43.324 67.792  -138.775 1.00 19.44 ? 221 TYR A CE2 1 
ATOM   1630 C CZ  . TYR A 1 221 ? -42.979 66.493  -138.466 1.00 16.64 ? 221 TYR A CZ  1 
ATOM   1631 O OH  . TYR A 1 221 ? -43.908 65.660  -137.888 1.00 18.12 ? 221 TYR A OH  1 
ATOM   1632 N N   . THR A 1 222 ? -38.366 67.046  -141.808 1.00 25.50 ? 222 THR A N   1 
ATOM   1633 C CA  . THR A 1 222 ? -38.011 65.638  -141.940 1.00 19.01 ? 222 THR A CA  1 
ATOM   1634 C C   . THR A 1 222 ? -37.285 65.168  -140.686 1.00 20.76 ? 222 THR A C   1 
ATOM   1635 O O   . THR A 1 222 ? -36.770 65.977  -139.913 1.00 20.10 ? 222 THR A O   1 
ATOM   1636 C CB  . THR A 1 222 ? -37.127 65.368  -143.173 1.00 20.60 ? 222 THR A CB  1 
ATOM   1637 O OG1 . THR A 1 222 ? -35.947 66.173  -143.101 1.00 21.02 ? 222 THR A OG1 1 
ATOM   1638 C CG2 . THR A 1 222 ? -37.878 65.682  -144.455 1.00 31.86 ? 222 THR A CG2 1 
ATOM   1639 N N   . LEU A 1 223 ? -37.247 63.855  -140.495 1.00 22.45 ? 223 LEU A N   1 
ATOM   1640 C CA  . LEU A 1 223 ? -36.548 63.263  -139.366 1.00 22.70 ? 223 LEU A CA  1 
ATOM   1641 C C   . LEU A 1 223 ? -35.409 62.390  -139.879 1.00 24.62 ? 223 LEU A C   1 
ATOM   1642 O O   . LEU A 1 223 ? -35.527 61.777  -140.939 1.00 22.66 ? 223 LEU A O   1 
ATOM   1643 C CB  . LEU A 1 223 ? -37.511 62.440  -138.508 1.00 20.42 ? 223 LEU A CB  1 
ATOM   1644 C CG  . LEU A 1 223 ? -38.854 63.095  -138.182 1.00 22.18 ? 223 LEU A CG  1 
ATOM   1645 C CD1 . LEU A 1 223 ? -39.796 62.108  -137.503 1.00 23.47 ? 223 LEU A CD1 1 
ATOM   1646 C CD2 . LEU A 1 223 ? -38.663 64.332  -137.318 1.00 16.17 ? 223 LEU A CD2 1 
ATOM   1647 N N   . PRO A 1 224 ? -34.291 62.338  -139.138 1.00 29.31 ? 224 PRO A N   1 
ATOM   1648 C CA  . PRO A 1 224 ? -33.222 61.418  -139.539 1.00 31.40 ? 224 PRO A CA  1 
ATOM   1649 C C   . PRO A 1 224 ? -33.679 59.975  -139.373 1.00 34.92 ? 224 PRO A C   1 
ATOM   1650 O O   . PRO A 1 224 ? -34.572 59.719  -138.566 1.00 31.15 ? 224 PRO A O   1 
ATOM   1651 C CB  . PRO A 1 224 ? -32.079 61.755  -138.576 1.00 31.37 ? 224 PRO A CB  1 
ATOM   1652 C CG  . PRO A 1 224 ? -32.411 63.116  -138.040 1.00 28.95 ? 224 PRO A CG  1 
ATOM   1653 C CD  . PRO A 1 224 ? -33.903 63.152  -137.975 1.00 20.23 ? 224 PRO A CD  1 
ATOM   1654 N N   . ASP A 1 225 ? -33.071 59.053  -140.110 1.00 40.48 ? 225 ASP A N   1 
ATOM   1655 C CA  . ASP A 1 225 ? -33.584 57.691  -140.209 1.00 44.44 ? 225 ASP A CA  1 
ATOM   1656 C C   . ASP A 1 225 ? -33.532 56.899  -138.904 1.00 41.91 ? 225 ASP A C   1 
ATOM   1657 O O   . ASP A 1 225 ? -34.313 55.967  -138.711 1.00 43.07 ? 225 ASP A O   1 
ATOM   1658 C CB  . ASP A 1 225 ? -32.817 56.939  -141.292 1.00 49.94 ? 225 ASP A CB  1 
ATOM   1659 C CG  . ASP A 1 225 ? -32.145 57.871  -142.274 1.00 52.20 ? 225 ASP A CG  1 
ATOM   1660 O OD1 . ASP A 1 225 ? -32.821 58.335  -143.216 1.00 50.52 ? 225 ASP A OD1 1 
ATOM   1661 O OD2 . ASP A 1 225 ? -30.942 58.151  -142.093 1.00 55.77 ? 225 ASP A OD2 1 
ATOM   1662 N N   . ASP A 1 226 ? -32.616 57.258  -138.012 1.00 37.97 ? 226 ASP A N   1 
ATOM   1663 C CA  . ASP A 1 226 ? -32.507 56.548  -136.741 1.00 40.64 ? 226 ASP A CA  1 
ATOM   1664 C C   . ASP A 1 226 ? -33.305 57.255  -135.641 1.00 38.85 ? 226 ASP A C   1 
ATOM   1665 O O   . ASP A 1 226 ? -32.985 57.139  -134.456 1.00 42.45 ? 226 ASP A O   1 
ATOM   1666 C CB  . ASP A 1 226 ? -31.035 56.397  -136.327 1.00 45.27 ? 226 ASP A CB  1 
ATOM   1667 C CG  . ASP A 1 226 ? -30.352 57.729  -136.068 1.00 53.23 ? 226 ASP A CG  1 
ATOM   1668 O OD1 . ASP A 1 226 ? -30.453 58.234  -134.931 1.00 57.12 ? 226 ASP A OD1 1 
ATOM   1669 O OD2 . ASP A 1 226 ? -29.694 58.262  -136.989 1.00 56.78 ? 226 ASP A OD2 1 
ATOM   1670 N N   . ILE A 1 227 ? -34.359 57.967  -136.035 1.00 30.79 ? 227 ILE A N   1 
ATOM   1671 C CA  . ILE A 1 227 ? -35.143 58.753  -135.084 1.00 32.65 ? 227 ILE A CA  1 
ATOM   1672 C C   . ILE A 1 227 ? -35.914 57.855  -134.119 1.00 35.01 ? 227 ILE A C   1 
ATOM   1673 O O   . ILE A 1 227 ? -36.383 56.774  -134.484 1.00 36.19 ? 227 ILE A O   1 
ATOM   1674 C CB  . ILE A 1 227 ? -36.120 59.720  -135.813 1.00 28.24 ? 227 ILE A CB  1 
ATOM   1675 C CG1 . ILE A 1 227 ? -36.726 60.736  -134.837 1.00 28.67 ? 227 ILE A CG1 1 
ATOM   1676 C CG2 . ILE A 1 227 ? -37.196 58.959  -136.576 1.00 30.56 ? 227 ILE A CG2 1 
ATOM   1677 C CD1 . ILE A 1 227 ? -35.775 61.841  -134.430 1.00 27.50 ? 227 ILE A CD1 1 
ATOM   1678 N N   . GLN A 1 228 ? -36.008 58.301  -132.871 1.00 35.75 ? 228 GLN A N   1 
ATOM   1679 C CA  . GLN A 1 228 ? -36.765 57.587  -131.856 1.00 33.91 ? 228 GLN A CA  1 
ATOM   1680 C C   . GLN A 1 228 ? -38.104 58.278  -131.651 1.00 34.47 ? 228 GLN A C   1 
ATOM   1681 O O   . GLN A 1 228 ? -38.261 59.455  -131.987 1.00 35.51 ? 228 GLN A O   1 
ATOM   1682 C CB  . GLN A 1 228 ? -35.984 57.519  -130.546 1.00 29.35 ? 228 GLN A CB  1 
ATOM   1683 C CG  . GLN A 1 228 ? -34.629 56.839  -130.680 1.00 34.58 ? 228 GLN A CG  1 
ATOM   1684 C CD  . GLN A 1 228 ? -34.741 55.419  -131.198 1.00 36.72 ? 228 GLN A CD  1 
ATOM   1685 O OE1 . GLN A 1 228 ? -35.191 54.521  -130.486 1.00 32.79 ? 228 GLN A OE1 1 
ATOM   1686 N NE2 . GLN A 1 228 ? -34.337 55.210  -132.447 1.00 41.90 ? 228 GLN A NE2 1 
ATOM   1687 N N   . SER A 1 229 ? -39.071 57.549  -131.108 1.00 33.26 ? 229 SER A N   1 
ATOM   1688 C CA  . SER A 1 229 ? -40.394 58.115  -130.902 1.00 31.12 ? 229 SER A CA  1 
ATOM   1689 C C   . SER A 1 229 ? -41.019 57.644  -129.598 1.00 30.83 ? 229 SER A C   1 
ATOM   1690 O O   . SER A 1 229 ? -40.608 56.634  -129.026 1.00 35.47 ? 229 SER A O   1 
ATOM   1691 C CB  . SER A 1 229 ? -41.314 57.766  -132.073 1.00 30.79 ? 229 SER A CB  1 
ATOM   1692 O OG  . SER A 1 229 ? -41.633 56.387  -132.079 1.00 35.65 ? 229 SER A OG  1 
ATOM   1693 N N   . ALA A 1 230 ? -42.015 58.393  -129.139 1.00 23.26 ? 230 ALA A N   1 
ATOM   1694 C CA  . ALA A 1 230 ? -42.800 58.015  -127.977 1.00 21.81 ? 230 ALA A CA  1 
ATOM   1695 C C   . ALA A 1 230 ? -44.189 58.624  -128.099 1.00 23.28 ? 230 ALA A C   1 
ATOM   1696 O O   . ALA A 1 230 ? -44.330 59.819  -128.356 1.00 25.80 ? 230 ALA A O   1 
ATOM   1697 C CB  . ALA A 1 230 ? -42.123 58.467  -126.695 1.00 19.96 ? 230 ALA A CB  1 
ATOM   1698 N N   . THR A 1 231 ? -45.214 57.797  -127.935 1.00 25.78 ? 231 THR A N   1 
ATOM   1699 C CA  . THR A 1 231 ? -46.584 58.286  -127.971 1.00 25.41 ? 231 THR A CA  1 
ATOM   1700 C C   . THR A 1 231 ? -46.879 59.087  -126.711 1.00 23.90 ? 231 THR A C   1 
ATOM   1701 O O   . THR A 1 231 ? -46.654 58.612  -125.599 1.00 25.48 ? 231 THR A O   1 
ATOM   1702 C CB  . THR A 1 231 ? -47.597 57.136  -128.101 1.00 27.42 ? 231 THR A CB  1 
ATOM   1703 O OG1 . THR A 1 231 ? -47.439 56.502  -129.376 1.00 28.26 ? 231 THR A OG1 1 
ATOM   1704 C CG2 . THR A 1 231 ? -49.020 57.659  -127.972 1.00 27.75 ? 231 THR A CG2 1 
ATOM   1705 N N   . ILE A 1 232 ? -47.368 60.309  -126.887 1.00 20.99 ? 232 ILE A N   1 
ATOM   1706 C CA  . ILE A 1 232 ? -47.713 61.148  -125.750 1.00 22.96 ? 232 ILE A CA  1 
ATOM   1707 C C   . ILE A 1 232 ? -49.158 60.895  -125.320 1.00 23.80 ? 232 ILE A C   1 
ATOM   1708 O O   . ILE A 1 232 ? -49.446 60.760  -124.131 1.00 25.40 ? 232 ILE A O   1 
ATOM   1709 C CB  . ILE A 1 232 ? -47.501 62.644  -126.067 1.00 22.30 ? 232 ILE A CB  1 
ATOM   1710 C CG1 . ILE A 1 232 ? -46.022 62.912  -126.369 1.00 22.33 ? 232 ILE A CG1 1 
ATOM   1711 C CG2 . ILE A 1 232 ? -47.976 63.511  -124.913 1.00 23.29 ? 232 ILE A CG2 1 
ATOM   1712 C CD1 . ILE A 1 232 ? -45.646 64.375  -126.398 1.00 19.52 ? 232 ILE A CD1 1 
ATOM   1713 N N   . GLY A 1 233 ? -50.060 60.816  -126.292 1.00 21.42 ? 233 GLY A N   1 
ATOM   1714 C CA  . GLY A 1 233 ? -51.454 60.524  -126.014 1.00 21.34 ? 233 GLY A CA  1 
ATOM   1715 C C   . GLY A 1 233 ? -52.376 60.925  -127.150 1.00 19.90 ? 233 GLY A C   1 
ATOM   1716 O O   . GLY A 1 233 ? -51.971 61.644  -128.068 1.00 22.48 ? 233 GLY A O   1 
ATOM   1717 N N   . HIS A 1 234 ? -53.621 60.463  -127.087 1.00 13.04 ? 234 HIS A N   1 
ATOM   1718 C CA  . HIS A 1 234 ? -54.595 60.780  -128.124 1.00 17.10 ? 234 HIS A CA  1 
ATOM   1719 C C   . HIS A 1 234 ? -55.829 61.461  -127.542 1.00 22.19 ? 234 HIS A C   1 
ATOM   1720 O O   . HIS A 1 234 ? -56.141 61.301  -126.360 1.00 26.85 ? 234 HIS A O   1 
ATOM   1721 C CB  . HIS A 1 234 ? -55.006 59.517  -128.882 1.00 18.49 ? 234 HIS A CB  1 
ATOM   1722 C CG  . HIS A 1 234 ? -55.728 58.513  -128.037 1.00 24.72 ? 234 HIS A CG  1 
ATOM   1723 N ND1 . HIS A 1 234 ? -55.093 57.453  -127.433 1.00 27.00 ? 234 HIS A ND1 1 
ATOM   1724 C CD2 . HIS A 1 234 ? -57.037 58.411  -127.697 1.00 23.07 ? 234 HIS A CD2 1 
ATOM   1725 C CE1 . HIS A 1 234 ? -55.975 56.738  -126.756 1.00 24.25 ? 234 HIS A CE1 1 
ATOM   1726 N NE2 . HIS A 1 234 ? -57.162 57.299  -126.901 1.00 20.76 ? 234 HIS A NE2 1 
ATOM   1727 N N   . LEU A 1 235 ? -56.523 62.220  -128.386 1.00 20.84 ? 235 LEU A N   1 
ATOM   1728 C CA  . LEU A 1 235 ? -57.736 62.923  -127.990 1.00 19.39 ? 235 LEU A CA  1 
ATOM   1729 C C   . LEU A 1 235 ? -58.900 62.521  -128.895 1.00 17.13 ? 235 LEU A C   1 
ATOM   1730 O O   . LEU A 1 235 ? -58.755 62.440  -130.113 1.00 17.54 ? 235 LEU A O   1 
ATOM   1731 C CB  . LEU A 1 235 ? -57.518 64.436  -128.045 1.00 18.84 ? 235 LEU A CB  1 
ATOM   1732 C CG  . LEU A 1 235 ? -56.402 65.018  -127.180 1.00 19.96 ? 235 LEU A CG  1 
ATOM   1733 C CD1 . LEU A 1 235 ? -56.020 66.406  -127.671 1.00 11.97 ? 235 LEU A CD1 1 
ATOM   1734 C CD2 . LEU A 1 235 ? -56.823 65.066  -125.714 1.00 26.64 ? 235 LEU A CD2 1 
ATOM   1735 N N   . ARG A 1 236 ? -60.056 62.264  -128.296 1.00 17.77 ? 236 ARG A N   1 
ATOM   1736 C CA  . ARG A 1 236 ? -61.249 61.920  -129.061 1.00 16.33 ? 236 ARG A CA  1 
ATOM   1737 C C   . ARG A 1 236 ? -62.482 62.592  -128.473 1.00 18.00 ? 236 ARG A C   1 
ATOM   1738 O O   . ARG A 1 236 ? -63.210 61.990  -127.695 1.00 17.24 ? 236 ARG A O   1 
ATOM   1739 C CB  . ARG A 1 236 ? -61.440 60.406  -129.108 1.00 16.75 ? 236 ARG A CB  1 
ATOM   1740 C CG  . ARG A 1 236 ? -62.663 59.929  -129.906 1.00 22.13 ? 236 ARG A CG  1 
ATOM   1741 C CD  . ARG A 1 236 ? -62.643 60.452  -131.344 1.00 21.06 ? 236 ARG A CD  1 
ATOM   1742 N NE  . ARG A 1 236 ? -63.520 59.689  -132.233 1.00 20.43 ? 236 ARG A NE  1 
ATOM   1743 C CZ  . ARG A 1 236 ? -64.733 60.078  -132.622 1.00 22.72 ? 236 ARG A CZ  1 
ATOM   1744 N NH1 . ARG A 1 236 ? -65.233 61.234  -132.206 1.00 20.76 ? 236 ARG A NH1 1 
ATOM   1745 N NH2 . ARG A 1 236 ? -65.451 59.309  -133.432 1.00 21.75 ? 236 ARG A NH2 1 
ATOM   1746 N N   . PRO A 1 237 ? -62.709 63.868  -128.828 1.00 20.49 ? 237 PRO A N   1 
ATOM   1747 C CA  . PRO A 1 237 ? -64.006 64.470  -128.500 1.00 17.85 ? 237 PRO A CA  1 
ATOM   1748 C C   . PRO A 1 237 ? -65.075 64.004  -129.485 1.00 18.43 ? 237 PRO A C   1 
ATOM   1749 O O   . PRO A 1 237 ? -64.838 63.081  -130.272 1.00 18.60 ? 237 PRO A O   1 
ATOM   1750 C CB  . PRO A 1 237 ? -63.743 65.974  -128.625 1.00 20.33 ? 237 PRO A CB  1 
ATOM   1751 C CG  . PRO A 1 237 ? -62.613 66.066  -129.588 1.00 26.45 ? 237 PRO A CG  1 
ATOM   1752 C CD  . PRO A 1 237 ? -61.762 64.857  -129.371 1.00 27.02 ? 237 PRO A CD  1 
ATOM   1753 N N   . GLY A 1 238 ? -66.238 64.641  -129.433 1.00 19.37 ? 238 GLY A N   1 
ATOM   1754 C CA  . GLY A 1 238 ? -67.382 64.208  -130.210 1.00 21.07 ? 238 GLY A CA  1 
ATOM   1755 C C   . GLY A 1 238 ? -67.182 64.093  -131.711 1.00 24.74 ? 238 GLY A C   1 
ATOM   1756 O O   . GLY A 1 238 ? -67.671 63.147  -132.328 1.00 27.41 ? 238 GLY A O   1 
ATOM   1757 N N   . CYS A 1 239 ? -66.461 65.041  -132.303 1.00 24.17 ? 239 CYS A N   1 
ATOM   1758 C CA  . CYS A 1 239 ? -66.403 65.140  -133.759 1.00 26.35 ? 239 CYS A CA  1 
ATOM   1759 C C   . CYS A 1 239 ? -64.995 65.343  -134.308 1.00 29.16 ? 239 CYS A C   1 
ATOM   1760 O O   . CYS A 1 239 ? -64.822 65.747  -135.461 1.00 34.10 ? 239 CYS A O   1 
ATOM   1761 C CB  . CYS A 1 239 ? -67.307 66.281  -134.230 1.00 27.69 ? 239 CYS A CB  1 
ATOM   1762 S SG  . CYS A 1 239 ? -69.020 66.145  -133.670 1.00 34.53 ? 239 CYS A SG  1 
ATOM   1763 N N   . HIS A 1 240 ? -63.992 65.070  -133.481 1.00 24.83 ? 240 HIS A N   1 
ATOM   1764 C CA  . HIS A 1 240 ? -62.603 65.209  -133.900 1.00 22.93 ? 240 HIS A CA  1 
ATOM   1765 C C   . HIS A 1 240 ? -61.733 64.153  -133.233 1.00 25.16 ? 240 HIS A C   1 
ATOM   1766 O O   . HIS A 1 240 ? -62.137 63.538  -132.243 1.00 27.65 ? 240 HIS A O   1 
ATOM   1767 C CB  . HIS A 1 240 ? -62.071 66.611  -133.577 1.00 17.97 ? 240 HIS A CB  1 
ATOM   1768 C CG  . HIS A 1 240 ? -62.793 67.712  -134.291 1.00 19.29 ? 240 HIS A CG  1 
ATOM   1769 N ND1 . HIS A 1 240 ? -64.003 68.210  -133.861 1.00 18.82 ? 240 HIS A ND1 1 
ATOM   1770 C CD2 . HIS A 1 240 ? -62.475 68.407  -135.410 1.00 19.77 ? 240 HIS A CD2 1 
ATOM   1771 C CE1 . HIS A 1 240 ? -64.401 69.165  -134.683 1.00 23.22 ? 240 HIS A CE1 1 
ATOM   1772 N NE2 . HIS A 1 240 ? -63.492 69.304  -135.631 1.00 23.49 ? 240 HIS A NE2 1 
ATOM   1773 N N   . ALA A 1 241 ? -60.543 63.944  -133.787 1.00 16.07 ? 241 ALA A N   1 
ATOM   1774 C CA  . ALA A 1 241 ? -59.569 63.028  -133.207 1.00 17.49 ? 241 ALA A CA  1 
ATOM   1775 C C   . ALA A 1 241 ? -58.161 63.531  -133.481 1.00 21.33 ? 241 ALA A C   1 
ATOM   1776 O O   . ALA A 1 241 ? -57.898 64.142  -134.522 1.00 23.66 ? 241 ALA A O   1 
ATOM   1777 C CB  . ALA A 1 241 ? -59.750 61.624  -133.758 1.00 18.51 ? 241 ALA A CB  1 
ATOM   1778 N N   . ALA A 1 242 ? -57.253 63.271  -132.547 1.00 20.73 ? 242 ALA A N   1 
ATOM   1779 C CA  . ALA A 1 242 ? -55.876 63.716  -132.696 1.00 20.55 ? 242 ALA A CA  1 
ATOM   1780 C C   . ALA A 1 242 ? -54.903 62.796  -131.963 1.00 23.52 ? 242 ALA A C   1 
ATOM   1781 O O   . ALA A 1 242 ? -55.268 62.138  -130.987 1.00 24.69 ? 242 ALA A O   1 
ATOM   1782 C CB  . ALA A 1 242 ? -55.727 65.145  -132.202 1.00 23.30 ? 242 ALA A CB  1 
ATOM   1783 N N   . ASN A 1 243 ? -53.666 62.753  -132.445 1.00 27.60 ? 243 ASN A N   1 
ATOM   1784 C CA  . ASN A 1 243 ? -52.608 62.002  -131.781 1.00 28.04 ? 243 ASN A CA  1 
ATOM   1785 C C   . ASN A 1 243 ? -51.358 62.854  -131.592 1.00 25.97 ? 243 ASN A C   1 
ATOM   1786 O O   . ASN A 1 243 ? -50.873 63.481  -132.538 1.00 23.31 ? 243 ASN A O   1 
ATOM   1787 C CB  . ASN A 1 243 ? -52.263 60.738  -132.571 1.00 28.39 ? 243 ASN A CB  1 
ATOM   1788 C CG  . ASN A 1 243 ? -51.376 59.790  -131.788 1.00 30.57 ? 243 ASN A CG  1 
ATOM   1789 O OD1 . ASN A 1 243 ? -51.478 59.695  -130.564 1.00 38.27 ? 243 ASN A OD1 1 
ATOM   1790 N ND2 . ASN A 1 243 ? -50.498 59.084  -132.489 1.00 26.92 ? 243 ASN A ND2 1 
ATOM   1791 N N   . MET A 1 244 ? -50.838 62.876  -130.369 1.00 26.94 ? 244 MET A N   1 
ATOM   1792 C CA  . MET A 1 244 ? -49.642 63.652  -130.077 1.00 26.32 ? 244 MET A CA  1 
ATOM   1793 C C   . MET A 1 244 ? -48.453 62.733  -129.856 1.00 24.45 ? 244 MET A C   1 
ATOM   1794 O O   . MET A 1 244 ? -48.516 61.814  -129.036 1.00 11.88 ? 244 MET A O   1 
ATOM   1795 C CB  . MET A 1 244 ? -49.848 64.542  -128.854 1.00 25.15 ? 244 MET A CB  1 
ATOM   1796 C CG  . MET A 1 244 ? -48.714 65.529  -128.624 1.00 20.71 ? 244 MET A CG  1 
ATOM   1797 S SD  . MET A 1 244 ? -49.145 66.764  -127.386 1.00 16.39 ? 244 MET A SD  1 
ATOM   1798 C CE  . MET A 1 244 ? -47.747 67.879  -127.520 1.00 23.96 ? 244 MET A CE  1 
ATOM   1799 N N   . GLU A 1 245 ? -47.372 62.986  -130.587 1.00 15.71 ? 245 GLU A N   1 
ATOM   1800 C CA  . GLU A 1 245 ? -46.183 62.149  -130.491 1.00 23.26 ? 245 GLU A CA  1 
ATOM   1801 C C   . GLU A 1 245 ? -44.915 62.977  -130.312 1.00 25.32 ? 245 GLU A C   1 
ATOM   1802 O O   . GLU A 1 245 ? -44.868 64.152  -130.681 1.00 22.23 ? 245 GLU A O   1 
ATOM   1803 C CB  . GLU A 1 245 ? -46.061 61.261  -131.732 1.00 12.82 ? 245 GLU A CB  1 
ATOM   1804 C CG  . GLU A 1 245 ? -47.062 60.117  -131.780 1.00 23.40 ? 245 GLU A CG  1 
ATOM   1805 C CD  . GLU A 1 245 ? -47.197 59.511  -133.166 1.00 28.48 ? 245 GLU A CD  1 
ATOM   1806 O OE1 . GLU A 1 245 ? -47.498 60.266  -134.115 1.00 35.64 ? 245 GLU A OE1 1 
ATOM   1807 O OE2 . GLU A 1 245 ? -47.007 58.284  -133.307 1.00 24.46 ? 245 GLU A OE2 1 
ATOM   1808 N N   . CYS A 1 246 ? -43.890 62.351  -129.742 1.00 30.05 ? 246 CYS A N   1 
ATOM   1809 C CA  . CYS A 1 246 ? -42.590 62.986  -129.596 1.00 12.59 ? 246 CYS A CA  1 
ATOM   1810 C C   . CYS A 1 246 ? -41.554 62.255  -130.440 1.00 19.04 ? 246 CYS A C   1 
ATOM   1811 O O   . CYS A 1 246 ? -41.365 61.046  -130.295 1.00 21.32 ? 246 CYS A O   1 
ATOM   1812 C CB  . CYS A 1 246 ? -42.157 63.012  -128.130 1.00 15.80 ? 246 CYS A CB  1 
ATOM   1813 S SG  . CYS A 1 246 ? -40.500 63.697  -127.850 1.00 18.16 ? 246 CYS A SG  1 
ATOM   1814 N N   . TRP A 1 247 ? -40.899 62.992  -131.330 1.00 20.42 ? 247 TRP A N   1 
ATOM   1815 C CA  . TRP A 1 247 ? -39.836 62.443  -132.162 1.00 23.14 ? 247 TRP A CA  1 
ATOM   1816 C C   . TRP A 1 247 ? -38.527 63.099  -131.762 1.00 24.84 ? 247 TRP A C   1 
ATOM   1817 O O   . TRP A 1 247 ? -38.423 64.327  -131.772 1.00 23.70 ? 247 TRP A O   1 
ATOM   1818 C CB  . TRP A 1 247 ? -40.126 62.682  -133.644 1.00 21.30 ? 247 TRP A CB  1 
ATOM   1819 C CG  . TRP A 1 247 ? -41.464 62.180  -134.073 1.00 20.90 ? 247 TRP A CG  1 
ATOM   1820 C CD1 . TRP A 1 247 ? -42.655 62.841  -133.992 1.00 22.13 ? 247 TRP A CD1 1 
ATOM   1821 C CD2 . TRP A 1 247 ? -41.754 60.900  -134.657 1.00 25.80 ? 247 TRP A CD2 1 
ATOM   1822 N NE1 . TRP A 1 247 ? -43.667 62.052  -134.487 1.00 21.91 ? 247 TRP A NE1 1 
ATOM   1823 C CE2 . TRP A 1 247 ? -43.142 60.862  -134.897 1.00 24.87 ? 247 TRP A CE2 1 
ATOM   1824 C CE3 . TRP A 1 247 ? -40.973 59.793  -134.994 1.00 30.89 ? 247 TRP A CE3 1 
ATOM   1825 C CZ2 . TRP A 1 247 ? -43.763 59.747  -135.466 1.00 25.52 ? 247 TRP A CZ2 1 
ATOM   1826 C CZ3 . TRP A 1 247 ? -41.594 58.691  -135.556 1.00 31.38 ? 247 TRP A CZ3 1 
ATOM   1827 C CH2 . TRP A 1 247 ? -42.975 58.677  -135.787 1.00 27.57 ? 247 TRP A CH2 1 
ATOM   1828 N N   . SER A 1 248 ? -37.524 62.300  -131.409 1.00 25.30 ? 248 SER A N   1 
ATOM   1829 C CA  . SER A 1 248 ? -36.297 62.884  -130.880 1.00 24.51 ? 248 SER A CA  1 
ATOM   1830 C C   . SER A 1 248 ? -35.032 62.062  -131.099 1.00 25.90 ? 248 SER A C   1 
ATOM   1831 O O   . SER A 1 248 ? -35.068 60.837  -131.234 1.00 22.19 ? 248 SER A O   1 
ATOM   1832 C CB  . SER A 1 248 ? -36.462 63.157  -129.381 1.00 27.64 ? 248 SER A CB  1 
ATOM   1833 O OG  . SER A 1 248 ? -35.400 63.957  -128.893 1.00 31.59 ? 248 SER A OG  1 
ATOM   1834 N N   . MET A 1 249 ? -33.907 62.760  -131.132 1.00 18.02 ? 249 MET A N   1 
ATOM   1835 C CA  . MET A 1 249 ? -32.601 62.149  -131.202 1.00 20.72 ? 249 MET A CA  1 
ATOM   1836 C C   . MET A 1 249 ? -31.985 62.075  -129.816 1.00 22.40 ? 249 MET A C   1 
ATOM   1837 O O   . MET A 1 249 ? -30.864 61.639  -129.652 1.00 21.20 ? 249 MET A O   1 
ATOM   1838 C CB  . MET A 1 249 ? -31.686 62.938  -132.142 1.00 24.37 ? 249 MET A CB  1 
ATOM   1839 C CG  . MET A 1 249 ? -32.106 62.952  -133.601 1.00 25.52 ? 249 MET A CG  1 
ATOM   1840 S SD  . MET A 1 249 ? -31.823 61.433  -134.522 1.00 31.65 ? 249 MET A SD  1 
ATOM   1841 C CE  . MET A 1 249 ? -30.311 60.855  -133.811 1.00 27.71 ? 249 MET A CE  1 
ATOM   1842 N N   . LEU A 1 250 ? -32.745 62.510  -128.820 1.00 27.23 ? 250 LEU A N   1 
ATOM   1843 C CA  . LEU A 1 250 ? -32.226 62.716  -127.479 1.00 29.09 ? 250 LEU A CA  1 
ATOM   1844 C C   . LEU A 1 250 ? -32.971 61.893  -126.440 1.00 26.37 ? 250 LEU A C   1 
ATOM   1845 O O   . LEU A 1 250 ? -33.220 62.362  -125.331 1.00 26.40 ? 250 LEU A O   1 
ATOM   1846 C CB  . LEU A 1 250 ? -32.302 64.201  -127.124 1.00 29.08 ? 250 LEU A CB  1 
ATOM   1847 C CG  . LEU A 1 250 ? -31.576 65.133  -128.092 1.00 30.11 ? 250 LEU A CG  1 
ATOM   1848 C CD1 . LEU A 1 250 ? -32.062 66.566  -127.927 1.00 27.90 ? 250 LEU A CD1 1 
ATOM   1849 C CD2 . LEU A 1 250 ? -30.069 65.047  -127.890 1.00 20.63 ? 250 LEU A CD2 1 
ATOM   1850 N N   . MET A 1 251 ? -33.318 60.661  -126.798 1.00 27.71 ? 251 MET A N   1 
ATOM   1851 C CA  . MET A 1 251 ? -34.063 59.801  -125.887 1.00 30.16 ? 251 MET A CA  1 
ATOM   1852 C C   . MET A 1 251 ? -33.164 58.893  -125.048 1.00 40.72 ? 251 MET A C   1 
ATOM   1853 O O   . MET A 1 251 ? -31.976 58.726  -125.348 1.00 42.14 ? 251 MET A O   1 
ATOM   1854 C CB  . MET A 1 251 ? -35.073 58.955  -126.668 1.00 25.66 ? 251 MET A CB  1 
ATOM   1855 C CG  . MET A 1 251 ? -36.189 59.761  -127.315 1.00 17.57 ? 251 MET A CG  1 
ATOM   1856 S SD  . MET A 1 251 ? -37.732 58.829  -127.437 1.00 30.29 ? 251 MET A SD  1 
ATOM   1857 C CE  . MET A 1 251 ? -38.840 60.080  -128.085 1.00 18.96 ? 251 MET A CE  1 
ATOM   1858 N N   . SER A 1 252 ? -33.754 58.332  -123.991 1.00 47.71 ? 252 SER A N   1 
ATOM   1859 C CA  . SER A 1 252 ? -33.100 57.378  -123.090 1.00 48.39 ? 252 SER A CA  1 
ATOM   1860 C C   . SER A 1 252 ? -31.998 58.004  -122.230 1.00 49.23 ? 252 SER A C   1 
ATOM   1861 O O   . SER A 1 252 ? -31.500 59.093  -122.510 1.00 50.20 ? 252 SER A O   1 
ATOM   1862 C CB  . SER A 1 252 ? -32.528 56.197  -123.881 1.00 50.65 ? 252 SER A CB  1 
ATOM   1863 O OG  . SER A 1 252 ? -31.505 56.623  -124.765 1.00 56.50 ? 252 SER A OG  1 
ATOM   1864 N N   . ALA B 2 3   ? -48.262 68.189  -149.691 1.00 37.18 ? 487 ALA B N   1 
ATOM   1865 C CA  . ALA B 2 3   ? -48.743 69.041  -150.772 1.00 37.94 ? 487 ALA B CA  1 
ATOM   1866 C C   . ALA B 2 3   ? -48.655 70.514  -150.391 1.00 35.06 ? 487 ALA B C   1 
ATOM   1867 O O   . ALA B 2 3   ? -48.012 71.306  -151.083 1.00 39.59 ? 487 ALA B O   1 
ATOM   1868 C CB  . ALA B 2 3   ? -50.168 68.672  -151.144 1.00 39.60 ? 487 ALA B CB  1 
ATOM   1869 N N   . ARG B 2 4   ? -49.299 70.881  -149.287 1.00 27.57 ? 488 ARG B N   1 
ATOM   1870 C CA  . ARG B 2 4   ? -49.276 72.267  -148.833 1.00 27.20 ? 488 ARG B CA  1 
ATOM   1871 C C   . ARG B 2 4   ? -48.933 72.380  -147.348 1.00 21.68 ? 488 ARG B C   1 
ATOM   1872 O O   . ARG B 2 4   ? -49.485 71.661  -146.511 1.00 21.40 ? 488 ARG B O   1 
ATOM   1873 C CB  . ARG B 2 4   ? -50.617 72.939  -149.122 1.00 35.73 ? 488 ARG B CB  1 
ATOM   1874 C CG  . ARG B 2 4   ? -50.637 74.425  -148.822 1.00 37.47 ? 488 ARG B CG  1 
ATOM   1875 C CD  . ARG B 2 4   ? -51.694 75.133  -149.646 1.00 38.54 ? 488 ARG B CD  1 
ATOM   1876 N NE  . ARG B 2 4   ? -52.042 76.422  -149.062 1.00 40.72 ? 488 ARG B NE  1 
ATOM   1877 C CZ  . ARG B 2 4   ? -53.015 76.594  -148.174 1.00 41.19 ? 488 ARG B CZ  1 
ATOM   1878 N NH1 . ARG B 2 4   ? -53.742 75.558  -147.771 1.00 40.26 ? 488 ARG B NH1 1 
ATOM   1879 N NH2 . ARG B 2 4   ? -53.264 77.801  -147.689 1.00 42.99 ? 488 ARG B NH2 1 
ATOM   1880 N N   . TYR B 2 5   ? -48.011 73.287  -147.035 1.00 21.54 ? 489 TYR B N   1 
ATOM   1881 C CA  . TYR B 2 5   ? -47.539 73.464  -145.668 1.00 24.28 ? 489 TYR B CA  1 
ATOM   1882 C C   . TYR B 2 5   ? -47.528 74.928  -145.255 1.00 24.70 ? 489 TYR B C   1 
ATOM   1883 O O   . TYR B 2 5   ? -47.563 75.827  -146.102 1.00 19.99 ? 489 TYR B O   1 
ATOM   1884 C CB  . TYR B 2 5   ? -46.133 72.884  -145.503 1.00 28.98 ? 489 TYR B CB  1 
ATOM   1885 C CG  . TYR B 2 5   ? -45.964 71.496  -146.069 1.00 32.17 ? 489 TYR B CG  1 
ATOM   1886 C CD1 . TYR B 2 5   ? -46.426 70.385  -145.380 1.00 34.39 ? 489 TYR B CD1 1 
ATOM   1887 C CD2 . TYR B 2 5   ? -45.333 71.297  -147.289 1.00 32.96 ? 489 TYR B CD2 1 
ATOM   1888 C CE1 . TYR B 2 5   ? -46.270 69.114  -145.891 1.00 34.59 ? 489 TYR B CE1 1 
ATOM   1889 C CE2 . TYR B 2 5   ? -45.172 70.029  -147.808 1.00 34.42 ? 489 TYR B CE2 1 
ATOM   1890 C CZ  . TYR B 2 5   ? -45.642 68.942  -147.104 1.00 35.99 ? 489 TYR B CZ  1 
ATOM   1891 O OH  . TYR B 2 5   ? -45.485 67.678  -147.618 1.00 39.04 ? 489 TYR B OH  1 
ATOM   1892 N N   . GLY B 2 6   ? -47.465 75.153  -143.945 1.00 24.14 ? 490 GLY B N   1 
ATOM   1893 C CA  . GLY B 2 6   ? -47.351 76.490  -143.397 1.00 24.27 ? 490 GLY B CA  1 
ATOM   1894 C C   . GLY B 2 6   ? -46.252 76.544  -142.354 1.00 23.23 ? 490 GLY B C   1 
ATOM   1895 O O   . GLY B 2 6   ? -46.091 75.613  -141.560 1.00 18.82 ? 490 GLY B O   1 
ATOM   1896 N N   . VAL B 2 7   ? -45.486 77.631  -142.363 1.00 26.84 ? 491 VAL B N   1 
ATOM   1897 C CA  . VAL B 2 7   ? -44.407 77.821  -141.401 1.00 26.45 ? 491 VAL B CA  1 
ATOM   1898 C C   . VAL B 2 7   ? -44.625 79.116  -140.620 1.00 27.84 ? 491 VAL B C   1 
ATOM   1899 O O   . VAL B 2 7   ? -44.849 80.177  -141.209 1.00 18.19 ? 491 VAL B O   1 
ATOM   1900 C CB  . VAL B 2 7   ? -43.029 77.851  -142.093 1.00 27.43 ? 491 VAL B CB  1 
ATOM   1901 C CG1 . VAL B 2 7   ? -41.923 78.089  -141.073 1.00 28.43 ? 491 VAL B CG1 1 
ATOM   1902 C CG2 . VAL B 2 7   ? -42.788 76.553  -142.852 1.00 29.71 ? 491 VAL B CG2 1 
ATOM   1903 N N   . SER B 2 8   ? -44.568 79.018  -139.295 1.00 30.54 ? 492 SER B N   1 
ATOM   1904 C CA  . SER B 2 8   ? -44.768 80.174  -138.428 1.00 32.03 ? 492 SER B CA  1 
ATOM   1905 C C   . SER B 2 8   ? -43.687 81.223  -138.630 1.00 34.16 ? 492 SER B C   1 
ATOM   1906 O O   . SER B 2 8   ? -42.504 80.892  -138.683 1.00 33.60 ? 492 SER B O   1 
ATOM   1907 C CB  . SER B 2 8   ? -44.783 79.743  -136.963 1.00 28.77 ? 492 SER B CB  1 
ATOM   1908 O OG  . SER B 2 8   ? -43.468 79.523  -136.482 1.00 27.70 ? 492 SER B OG  1 
ATOM   1909 N N   . ASN B 2 9   ? -44.086 82.485  -138.734 1.00 37.84 ? 493 ASN B N   1 
ATOM   1910 C CA  . ASN B 2 9   ? -43.104 83.558  -138.824 1.00 43.86 ? 493 ASN B CA  1 
ATOM   1911 C C   . ASN B 2 9   ? -42.383 83.739  -137.492 1.00 43.63 ? 493 ASN B C   1 
ATOM   1912 O O   . ASN B 2 9   ? -41.201 84.083  -137.453 1.00 48.85 ? 493 ASN B O   1 
ATOM   1913 C CB  . ASN B 2 9   ? -43.771 84.859  -139.261 1.00 50.88 ? 493 ASN B CB  1 
ATOM   1914 C CG  . ASN B 2 9   ? -45.178 85.006  -138.713 1.00 55.97 ? 493 ASN B CG  1 
ATOM   1915 O OD1 . ASN B 2 9   ? -45.436 84.727  -137.541 1.00 56.49 ? 493 ASN B OD1 1 
ATOM   1916 N ND2 . ASN B 2 9   ? -46.099 85.441  -139.564 1.00 57.76 ? 493 ASN B ND2 1 
ATOM   1917 N N   . THR B 2 10  ? -43.110 83.493  -136.406 1.00 38.23 ? 494 THR B N   1 
ATOM   1918 C CA  . THR B 2 10  ? -42.543 83.492  -135.062 1.00 38.99 ? 494 THR B CA  1 
ATOM   1919 C C   . THR B 2 10  ? -41.613 82.294  -134.877 1.00 38.28 ? 494 THR B C   1 
ATOM   1920 O O   . THR B 2 10  ? -41.904 81.196  -135.354 1.00 40.28 ? 494 THR B O   1 
ATOM   1921 C CB  . THR B 2 10  ? -43.655 83.452  -133.989 1.00 38.79 ? 494 THR B CB  1 
ATOM   1922 O OG1 . THR B 2 10  ? -44.455 84.634  -134.091 1.00 41.11 ? 494 THR B OG1 1 
ATOM   1923 C CG2 . THR B 2 10  ? -43.070 83.368  -132.589 1.00 40.67 ? 494 THR B CG2 1 
ATOM   1924 N N   . SER B 2 11  ? -40.488 82.510  -134.201 1.00 34.12 ? 495 SER B N   1 
ATOM   1925 C CA  . SER B 2 11  ? -39.584 81.418  -133.860 1.00 30.31 ? 495 SER B CA  1 
ATOM   1926 C C   . SER B 2 11  ? -38.851 81.713  -132.559 1.00 30.15 ? 495 SER B C   1 
ATOM   1927 O O   . SER B 2 11  ? -38.821 82.854  -132.096 1.00 31.27 ? 495 SER B O   1 
ATOM   1928 C CB  . SER B 2 11  ? -38.579 81.167  -134.985 1.00 26.04 ? 495 SER B CB  1 
ATOM   1929 O OG  . SER B 2 11  ? -37.626 82.210  -135.062 1.00 31.09 ? 495 SER B OG  1 
ATOM   1930 N N   . ILE B 2 12  ? -38.260 80.674  -131.979 1.00 26.68 ? 496 ILE B N   1 
ATOM   1931 C CA  . ILE B 2 12  ? -37.532 80.805  -130.723 1.00 28.61 ? 496 ILE B CA  1 
ATOM   1932 C C   . ILE B 2 12  ? -36.069 80.388  -130.888 1.00 30.51 ? 496 ILE B C   1 
ATOM   1933 O O   . ILE B 2 12  ? -35.776 79.301  -131.393 1.00 32.18 ? 496 ILE B O   1 
ATOM   1934 C CB  . ILE B 2 12  ? -38.188 79.965  -129.619 1.00 27.86 ? 496 ILE B CB  1 
ATOM   1935 C CG1 . ILE B 2 12  ? -39.659 80.354  -129.468 1.00 28.46 ? 496 ILE B CG1 1 
ATOM   1936 C CG2 . ILE B 2 12  ? -37.444 80.136  -128.309 1.00 26.04 ? 496 ILE B CG2 1 
ATOM   1937 C CD1 . ILE B 2 12  ? -40.452 79.427  -128.575 1.00 26.81 ? 496 ILE B CD1 1 
ATOM   1938 N N   . ASN B 2 13  ? -35.155 81.254  -130.459 1.00 32.27 ? 497 ASN B N   1 
ATOM   1939 C CA  . ASN B 2 13  ? -33.729 81.026  -130.660 1.00 36.51 ? 497 ASN B CA  1 
ATOM   1940 C C   . ASN B 2 13  ? -32.939 80.939  -129.361 1.00 35.74 ? 497 ASN B C   1 
ATOM   1941 O O   . ASN B 2 13  ? -33.073 81.795  -128.485 1.00 35.87 ? 497 ASN B O   1 
ATOM   1942 C CB  . ASN B 2 13  ? -33.134 82.137  -131.530 1.00 42.02 ? 497 ASN B CB  1 
ATOM   1943 C CG  . ASN B 2 13  ? -32.906 81.701  -132.962 1.00 47.48 ? 497 ASN B CG  1 
ATOM   1944 O OD1 . ASN B 2 13  ? -33.809 81.767  -133.794 1.00 50.48 ? 497 ASN B OD1 1 
ATOM   1945 N ND2 . ASN B 2 13  ? -31.687 81.260  -133.259 1.00 51.02 ? 497 ASN B ND2 1 
ATOM   1946 N N   . ARG B 2 14  ? -32.112 79.904  -129.250 1.00 34.66 ? 498 ARG B N   1 
ATOM   1947 C CA  . ARG B 2 14  ? -31.155 79.795  -128.154 1.00 37.89 ? 498 ARG B CA  1 
ATOM   1948 C C   . ARG B 2 14  ? -29.728 79.853  -128.684 1.00 35.16 ? 498 ARG B C   1 
ATOM   1949 O O   . ARG B 2 14  ? -29.379 79.130  -129.617 1.00 31.36 ? 498 ARG B O   1 
ATOM   1950 C CB  . ARG B 2 14  ? -31.363 78.499  -127.368 1.00 41.05 ? 498 ARG B CB  1 
ATOM   1951 C CG  . ARG B 2 14  ? -32.429 78.578  -126.292 1.00 46.15 ? 498 ARG B CG  1 
ATOM   1952 C CD  . ARG B 2 14  ? -32.146 79.700  -125.310 1.00 49.27 ? 498 ARG B CD  1 
ATOM   1953 N NE  . ARG B 2 14  ? -32.967 80.879  -125.571 1.00 47.61 ? 498 ARG B NE  1 
ATOM   1954 C CZ  . ARG B 2 14  ? -32.680 82.099  -125.128 1.00 46.58 ? 498 ARG B CZ  1 
ATOM   1955 N NH1 . ARG B 2 14  ? -31.584 82.303  -124.410 1.00 44.58 ? 498 ARG B NH1 1 
ATOM   1956 N NH2 . ARG B 2 14  ? -33.482 83.116  -125.410 1.00 45.67 ? 498 ARG B NH2 1 
ATOM   1957 N N   . LYS B 2 15  ? -28.909 80.714  -128.087 1.00 34.57 ? 499 LYS B N   1 
ATOM   1958 C CA  . LYS B 2 15  ? -27.505 80.834  -128.467 1.00 39.05 ? 499 LYS B CA  1 
ATOM   1959 C C   . LYS B 2 15  ? -26.624 81.019  -127.242 1.00 44.99 ? 499 LYS B C   1 
ATOM   1960 O O   . LYS B 2 15  ? -27.078 81.469  -126.195 1.00 48.53 ? 499 LYS B O   1 
ATOM   1961 C CB  . LYS B 2 15  ? -27.295 82.001  -129.434 1.00 37.39 ? 499 LYS B CB  1 
ATOM   1962 C CG  . LYS B 2 15  ? -27.797 81.740  -130.841 1.00 38.96 ? 499 LYS B CG  1 
ATOM   1963 C CD  . LYS B 2 15  ? -27.273 82.775  -131.827 1.00 44.23 ? 499 LYS B CD  1 
ATOM   1964 C CE  . LYS B 2 15  ? -26.669 82.119  -133.069 1.00 45.66 ? 499 LYS B CE  1 
ATOM   1965 N NZ  . LYS B 2 15  ? -26.058 83.130  -133.983 1.00 47.06 ? 499 LYS B NZ  1 
ATOM   1966 N N   . ALA C 1 16  ? -55.529 113.047 -178.706 1.00 47.99 ? 16  ALA C N   1 
ATOM   1967 C CA  . ALA C 1 16  ? -54.987 113.629 -177.485 1.00 43.72 ? 16  ALA C CA  1 
ATOM   1968 C C   . ALA C 1 16  ? -54.912 112.604 -176.362 1.00 44.42 ? 16  ALA C C   1 
ATOM   1969 O O   . ALA C 1 16  ? -54.159 112.779 -175.405 1.00 45.80 ? 16  ALA C O   1 
ATOM   1970 C CB  . ALA C 1 16  ? -55.826 114.820 -177.051 1.00 43.50 ? 16  ALA C CB  1 
ATOM   1971 N N   . ASP C 1 17  ? -55.689 111.532 -176.484 1.00 44.61 ? 17  ASP C N   1 
ATOM   1972 C CA  . ASP C 1 17  ? -55.828 110.566 -175.399 1.00 45.32 ? 17  ASP C CA  1 
ATOM   1973 C C   . ASP C 1 17  ? -55.101 109.249 -175.657 1.00 40.98 ? 17  ASP C C   1 
ATOM   1974 O O   . ASP C 1 17  ? -54.535 108.661 -174.738 1.00 40.77 ? 17  ASP C O   1 
ATOM   1975 C CB  . ASP C 1 17  ? -57.310 110.290 -175.135 1.00 48.52 ? 17  ASP C CB  1 
ATOM   1976 C CG  . ASP C 1 17  ? -57.730 110.673 -173.734 1.00 48.82 ? 17  ASP C CG  1 
ATOM   1977 O OD1 . ASP C 1 17  ? -56.885 110.579 -172.824 1.00 48.26 ? 17  ASP C OD1 1 
ATOM   1978 O OD2 . ASP C 1 17  ? -58.899 111.068 -173.544 1.00 51.18 ? 17  ASP C OD2 1 
ATOM   1979 N N   . SER C 1 18  ? -55.119 108.785 -176.903 1.00 36.78 ? 18  SER C N   1 
ATOM   1980 C CA  . SER C 1 18  ? -54.481 107.515 -177.242 1.00 37.41 ? 18  SER C CA  1 
ATOM   1981 C C   . SER C 1 18  ? -52.977 107.670 -177.459 1.00 39.77 ? 18  SER C C   1 
ATOM   1982 O O   . SER C 1 18  ? -52.525 108.567 -178.176 1.00 45.77 ? 18  SER C O   1 
ATOM   1983 C CB  . SER C 1 18  ? -55.114 106.901 -178.493 1.00 37.75 ? 18  SER C CB  1 
ATOM   1984 O OG  . SER C 1 18  ? -54.360 107.219 -179.648 1.00 38.48 ? 18  SER C OG  1 
ATOM   1985 N N   . ILE C 1 19  ? -52.213 106.785 -176.829 1.00 35.97 ? 19  ILE C N   1 
ATOM   1986 C CA  . ILE C 1 19  ? -50.769 106.742 -176.998 1.00 32.07 ? 19  ILE C CA  1 
ATOM   1987 C C   . ILE C 1 19  ? -50.441 105.763 -178.123 1.00 30.61 ? 19  ILE C C   1 
ATOM   1988 O O   . ILE C 1 19  ? -50.713 104.569 -178.005 1.00 32.64 ? 19  ILE C O   1 
ATOM   1989 C CB  . ILE C 1 19  ? -50.069 106.319 -175.691 1.00 28.44 ? 19  ILE C CB  1 
ATOM   1990 C CG1 . ILE C 1 19  ? -50.683 107.069 -174.506 1.00 25.40 ? 19  ILE C CG1 1 
ATOM   1991 C CG2 . ILE C 1 19  ? -48.567 106.552 -175.780 1.00 28.16 ? 19  ILE C CG2 1 
ATOM   1992 C CD1 . ILE C 1 19  ? -50.186 106.618 -173.158 1.00 25.63 ? 19  ILE C CD1 1 
ATOM   1993 N N   . ASP C 1 20  ? -49.919 106.294 -179.222 1.00 27.09 ? 20  ASP C N   1 
ATOM   1994 C CA  . ASP C 1 20  ? -49.642 105.495 -180.410 1.00 31.30 ? 20  ASP C CA  1 
ATOM   1995 C C   . ASP C 1 20  ? -48.210 104.951 -180.544 1.00 29.99 ? 20  ASP C C   1 
ATOM   1996 O O   . ASP C 1 20  ? -47.896 104.258 -181.498 1.00 28.44 ? 20  ASP C O   1 
ATOM   1997 C CB  . ASP C 1 20  ? -50.063 106.236 -181.676 1.00 39.73 ? 20  ASP C CB  1 
ATOM   1998 C CG  . ASP C 1 20  ? -49.950 107.732 -181.543 1.00 49.12 ? 20  ASP C CG  1 
ATOM   1999 O OD1 . ASP C 1 20  ? -49.839 108.240 -180.409 1.00 51.53 ? 20  ASP C OD1 1 
ATOM   2000 O OD2 . ASP C 1 20  ? -49.987 108.409 -182.581 1.00 52.87 ? 20  ASP C OD2 1 
ATOM   2001 N N   . ASP C 1 21  ? -47.356 105.253 -179.579 1.00 28.67 ? 21  ASP C N   1 
ATOM   2002 C CA  . ASP C 1 21  ? -45.992 104.734 -179.586 1.00 27.82 ? 21  ASP C CA  1 
ATOM   2003 C C   . ASP C 1 21  ? -46.042 103.214 -179.661 1.00 30.24 ? 21  ASP C C   1 
ATOM   2004 O O   . ASP C 1 21  ? -46.631 102.561 -178.796 1.00 23.34 ? 21  ASP C O   1 
ATOM   2005 C CB  . ASP C 1 21  ? -45.225 105.186 -178.343 1.00 27.24 ? 21  ASP C CB  1 
ATOM   2006 C CG  . ASP C 1 21  ? -43.773 104.746 -178.357 1.00 29.59 ? 21  ASP C CG  1 
ATOM   2007 O OD1 . ASP C 1 21  ? -43.501 103.554 -178.094 1.00 27.84 ? 21  ASP C OD1 1 
ATOM   2008 O OD2 . ASP C 1 21  ? -42.906 105.601 -178.630 1.00 33.46 ? 21  ASP C OD2 1 
ATOM   2009 N N   . LYS C 1 22  ? -45.429 102.661 -180.704 1.00 31.07 ? 22  LYS C N   1 
ATOM   2010 C CA  . LYS C 1 22  ? -45.513 101.232 -180.990 1.00 31.85 ? 22  LYS C CA  1 
ATOM   2011 C C   . LYS C 1 22  ? -44.929 100.352 -179.888 1.00 29.98 ? 22  LYS C C   1 
ATOM   2012 O O   . LYS C 1 22  ? -45.406 99.243  -179.660 1.00 32.85 ? 22  LYS C O   1 
ATOM   2013 C CB  . LYS C 1 22  ? -44.808 100.926 -182.312 1.00 40.64 ? 22  LYS C CB  1 
ATOM   2014 C CG  . LYS C 1 22  ? -45.480 101.538 -183.531 1.00 42.08 ? 22  LYS C CG  1 
ATOM   2015 C CD  . LYS C 1 22  ? -44.716 101.216 -184.804 1.00 47.71 ? 22  LYS C CD  1 
ATOM   2016 C CE  . LYS C 1 22  ? -45.400 101.808 -186.025 1.00 52.91 ? 22  LYS C CE  1 
ATOM   2017 N NZ  . LYS C 1 22  ? -44.649 101.520 -187.278 1.00 60.10 ? 22  LYS C NZ  1 
ATOM   2018 N N   . LYS C 1 23  ? -43.896 100.836 -179.211 1.00 25.59 ? 23  LYS C N   1 
ATOM   2019 C CA  . LYS C 1 23  ? -43.260 100.046 -178.162 1.00 27.10 ? 23  LYS C CA  1 
ATOM   2020 C C   . LYS C 1 23  ? -43.924 100.247 -176.809 1.00 28.33 ? 23  LYS C C   1 
ATOM   2021 O O   . LYS C 1 23  ? -43.891 99.362  -175.955 1.00 20.92 ? 23  LYS C O   1 
ATOM   2022 C CB  . LYS C 1 23  ? -41.771 100.377 -178.083 1.00 27.96 ? 23  LYS C CB  1 
ATOM   2023 C CG  . LYS C 1 23  ? -40.925 99.394  -178.857 1.00 33.37 ? 23  LYS C CG  1 
ATOM   2024 C CD  . LYS C 1 23  ? -39.915 100.090 -179.738 1.00 36.65 ? 23  LYS C CD  1 
ATOM   2025 C CE  . LYS C 1 23  ? -39.458 99.174  -180.858 1.00 41.33 ? 23  LYS C CE  1 
ATOM   2026 N NZ  . LYS C 1 23  ? -38.993 97.866  -180.323 1.00 46.33 ? 23  LYS C NZ  1 
ATOM   2027 N N   . TRP C 1 24  ? -44.532 101.413 -176.629 1.00 26.96 ? 24  TRP C N   1 
ATOM   2028 C CA  . TRP C 1 24  ? -45.312 101.712 -175.437 1.00 22.80 ? 24  TRP C CA  1 
ATOM   2029 C C   . TRP C 1 24  ? -46.382 100.649 -175.199 1.00 24.40 ? 24  TRP C C   1 
ATOM   2030 O O   . TRP C 1 24  ? -46.669 100.286 -174.057 1.00 19.80 ? 24  TRP C O   1 
ATOM   2031 C CB  . TRP C 1 24  ? -45.957 103.095 -175.566 1.00 21.82 ? 24  TRP C CB  1 
ATOM   2032 C CG  . TRP C 1 24  ? -46.931 103.422 -174.485 1.00 23.34 ? 24  TRP C CG  1 
ATOM   2033 C CD1 . TRP C 1 24  ? -48.287 103.261 -174.523 1.00 23.07 ? 24  TRP C CD1 1 
ATOM   2034 C CD2 . TRP C 1 24  ? -46.625 103.969 -173.193 1.00 21.15 ? 24  TRP C CD2 1 
ATOM   2035 N NE1 . TRP C 1 24  ? -48.841 103.671 -173.333 1.00 23.27 ? 24  TRP C NE1 1 
ATOM   2036 C CE2 . TRP C 1 24  ? -47.849 104.110 -172.508 1.00 21.00 ? 24  TRP C CE2 1 
ATOM   2037 C CE3 . TRP C 1 24  ? -45.441 104.346 -172.560 1.00 21.23 ? 24  TRP C CE3 1 
ATOM   2038 C CZ2 . TRP C 1 24  ? -47.910 104.619 -171.206 1.00 19.51 ? 24  TRP C CZ2 1 
ATOM   2039 C CZ3 . TRP C 1 24  ? -45.510 104.849 -171.273 1.00 20.59 ? 24  TRP C CZ3 1 
ATOM   2040 C CH2 . TRP C 1 24  ? -46.736 104.981 -170.610 1.00 18.69 ? 24  TRP C CH2 1 
ATOM   2041 N N   . SER C 1 25  ? -46.948 100.139 -176.290 1.00 34.53 ? 25  SER C N   1 
ATOM   2042 C CA  . SER C 1 25  ? -48.050 99.183  -176.226 1.00 41.93 ? 25  SER C CA  1 
ATOM   2043 C C   . SER C 1 25  ? -47.679 97.861  -175.558 1.00 39.86 ? 25  SER C C   1 
ATOM   2044 O O   . SER C 1 25  ? -48.550 97.153  -175.059 1.00 37.98 ? 25  SER C O   1 
ATOM   2045 C CB  . SER C 1 25  ? -48.580 98.897  -177.632 1.00 48.55 ? 25  SER C CB  1 
ATOM   2046 O OG  . SER C 1 25  ? -48.874 100.094 -178.326 1.00 51.67 ? 25  SER C OG  1 
ATOM   2047 N N   . LYS C 1 26  ? -46.391 97.530  -175.560 1.00 40.19 ? 26  LYS C N   1 
ATOM   2048 C CA  . LYS C 1 26  ? -45.918 96.250  -175.039 1.00 39.18 ? 26  LYS C CA  1 
ATOM   2049 C C   . LYS C 1 26  ? -46.081 96.115  -173.526 1.00 38.27 ? 26  LYS C C   1 
ATOM   2050 O O   . LYS C 1 26  ? -46.543 95.087  -173.030 1.00 41.72 ? 26  LYS C O   1 
ATOM   2051 C CB  . LYS C 1 26  ? -44.449 96.041  -175.423 1.00 38.48 ? 26  LYS C CB  1 
ATOM   2052 C CG  . LYS C 1 26  ? -43.749 94.926  -174.654 1.00 40.26 ? 26  LYS C CG  1 
ATOM   2053 C CD  . LYS C 1 26  ? -42.449 94.519  -175.336 1.00 45.72 ? 26  LYS C CD  1 
ATOM   2054 C CE  . LYS C 1 26  ? -41.637 93.559  -174.477 1.00 50.09 ? 26  LYS C CE  1 
ATOM   2055 N NZ  . LYS C 1 26  ? -42.444 92.419  -173.965 1.00 54.91 ? 26  LYS C NZ  1 
ATOM   2056 N N   . LEU C 1 27  ? -45.697 97.159  -172.800 1.00 34.50 ? 27  LEU C N   1 
ATOM   2057 C CA  . LEU C 1 27  ? -45.696 97.123  -171.342 1.00 34.78 ? 27  LEU C CA  1 
ATOM   2058 C C   . LEU C 1 27  ? -46.869 97.889  -170.736 1.00 33.66 ? 27  LEU C C   1 
ATOM   2059 O O   . LEU C 1 27  ? -47.201 97.688  -169.570 1.00 31.01 ? 27  LEU C O   1 
ATOM   2060 C CB  . LEU C 1 27  ? -44.387 97.697  -170.792 1.00 34.22 ? 27  LEU C CB  1 
ATOM   2061 C CG  . LEU C 1 27  ? -43.156 96.797  -170.750 1.00 31.42 ? 27  LEU C CG  1 
ATOM   2062 C CD1 . LEU C 1 27  ? -41.929 97.582  -170.301 1.00 25.82 ? 27  LEU C CD1 1 
ATOM   2063 C CD2 . LEU C 1 27  ? -43.402 95.624  -169.822 1.00 31.86 ? 27  LEU C CD2 1 
ATOM   2064 N N   . PHE C 1 28  ? -47.489 98.768  -171.517 1.00 34.70 ? 28  PHE C N   1 
ATOM   2065 C CA  . PHE C 1 28  ? -48.517 99.654  -170.980 1.00 31.95 ? 28  PHE C CA  1 
ATOM   2066 C C   . PHE C 1 28  ? -49.846 99.549  -171.719 1.00 35.41 ? 28  PHE C C   1 
ATOM   2067 O O   . PHE C 1 28  ? -49.887 99.100  -172.861 1.00 36.71 ? 28  PHE C O   1 
ATOM   2068 C CB  . PHE C 1 28  ? -48.033 101.105 -171.022 1.00 28.34 ? 28  PHE C CB  1 
ATOM   2069 C CG  . PHE C 1 28  ? -46.831 101.372 -170.169 1.00 23.94 ? 28  PHE C CG  1 
ATOM   2070 C CD1 . PHE C 1 28  ? -46.968 101.638 -168.814 1.00 16.31 ? 28  PHE C CD1 1 
ATOM   2071 C CD2 . PHE C 1 28  ? -45.563 101.369 -170.725 1.00 17.63 ? 28  PHE C CD2 1 
ATOM   2072 C CE1 . PHE C 1 28  ? -45.857 101.889 -168.029 1.00 17.04 ? 28  PHE C CE1 1 
ATOM   2073 C CE2 . PHE C 1 28  ? -44.450 101.620 -169.949 1.00 16.10 ? 28  PHE C CE2 1 
ATOM   2074 C CZ  . PHE C 1 28  ? -44.595 101.881 -168.600 1.00 17.58 ? 28  PHE C CZ  1 
ATOM   2075 N N   . PRO C 1 29  ? -50.946 99.966  -171.062 1.00 32.72 ? 29  PRO C N   1 
ATOM   2076 C CA  . PRO C 1 29  ? -52.205 100.094 -171.803 1.00 29.11 ? 29  PRO C CA  1 
ATOM   2077 C C   . PRO C 1 29  ? -52.132 101.282 -172.753 1.00 25.68 ? 29  PRO C C   1 
ATOM   2078 O O   . PRO C 1 29  ? -51.455 102.268 -172.462 1.00 22.78 ? 29  PRO C O   1 
ATOM   2079 C CB  . PRO C 1 29  ? -53.252 100.309 -170.702 1.00 29.70 ? 29  PRO C CB  1 
ATOM   2080 C CG  . PRO C 1 29  ? -52.482 100.838 -169.546 1.00 30.20 ? 29  PRO C CG  1 
ATOM   2081 C CD  . PRO C 1 29  ? -51.121 100.224 -169.622 1.00 32.99 ? 29  PRO C CD  1 
ATOM   2082 N N   . ARG C 1 30  ? -52.805 101.168 -173.890 1.00 25.34 ? 30  ARG C N   1 
ATOM   2083 C CA  . ARG C 1 30  ? -52.735 102.172 -174.941 1.00 27.91 ? 30  ARG C CA  1 
ATOM   2084 C C   . ARG C 1 30  ? -53.458 103.462 -174.554 1.00 28.06 ? 30  ARG C C   1 
ATOM   2085 O O   . ARG C 1 30  ? -53.099 104.549 -175.008 1.00 26.08 ? 30  ARG C O   1 
ATOM   2086 C CB  . ARG C 1 30  ? -53.313 101.584 -176.231 1.00 32.08 ? 30  ARG C CB  1 
ATOM   2087 C CG  . ARG C 1 30  ? -53.657 102.580 -177.315 1.00 35.71 ? 30  ARG C CG  1 
ATOM   2088 C CD  . ARG C 1 30  ? -54.186 101.846 -178.536 1.00 39.00 ? 30  ARG C CD  1 
ATOM   2089 N NE  . ARG C 1 30  ? -54.935 102.729 -179.419 1.00 39.56 ? 30  ARG C NE  1 
ATOM   2090 C CZ  . ARG C 1 30  ? -56.259 102.837 -179.413 1.00 40.47 ? 30  ARG C CZ  1 
ATOM   2091 N NH1 . ARG C 1 30  ? -56.985 102.111 -178.571 1.00 42.39 ? 30  ARG C NH1 1 
ATOM   2092 N NH2 . ARG C 1 30  ? -56.858 103.669 -180.252 1.00 41.75 ? 30  ARG C NH2 1 
ATOM   2093 N N   . ILE C 1 31  ? -54.470 103.333 -173.703 1.00 31.57 ? 31  ILE C N   1 
ATOM   2094 C CA  . ILE C 1 31  ? -55.244 104.477 -173.219 1.00 30.42 ? 31  ILE C CA  1 
ATOM   2095 C C   . ILE C 1 31  ? -55.378 104.393 -171.701 1.00 30.38 ? 31  ILE C C   1 
ATOM   2096 O O   . ILE C 1 31  ? -55.634 103.317 -171.164 1.00 26.97 ? 31  ILE C O   1 
ATOM   2097 C CB  . ILE C 1 31  ? -56.645 104.530 -173.876 1.00 33.00 ? 31  ILE C CB  1 
ATOM   2098 C CG1 . ILE C 1 31  ? -56.531 104.986 -175.331 1.00 33.99 ? 31  ILE C CG1 1 
ATOM   2099 C CG2 . ILE C 1 31  ? -57.585 105.449 -173.104 1.00 33.59 ? 31  ILE C CG2 1 
ATOM   2100 C CD1 . ILE C 1 31  ? -57.772 104.719 -176.148 1.00 29.72 ? 31  ILE C CD1 1 
ATOM   2101 N N   . VAL C 1 32  ? -55.196 105.517 -171.008 1.00 34.92 ? 32  VAL C N   1 
ATOM   2102 C CA  . VAL C 1 32  ? -55.231 105.517 -169.546 1.00 36.19 ? 32  VAL C CA  1 
ATOM   2103 C C   . VAL C 1 32  ? -56.271 106.470 -168.946 1.00 38.61 ? 32  VAL C C   1 
ATOM   2104 O O   . VAL C 1 32  ? -56.183 106.817 -167.769 1.00 37.06 ? 32  VAL C O   1 
ATOM   2105 C CB  . VAL C 1 32  ? -53.849 105.886 -168.966 1.00 37.53 ? 32  VAL C CB  1 
ATOM   2106 C CG1 . VAL C 1 32  ? -52.802 104.890 -169.424 1.00 40.55 ? 32  VAL C CG1 1 
ATOM   2107 C CG2 . VAL C 1 32  ? -53.458 107.306 -169.375 1.00 34.11 ? 32  VAL C CG2 1 
ATOM   2108 N N   . SER C 1 33  ? -57.256 106.878 -169.743 1.00 39.06 ? 33  SER C N   1 
ATOM   2109 C CA  . SER C 1 33  ? -58.221 107.889 -169.307 1.00 37.86 ? 33  SER C CA  1 
ATOM   2110 C C   . SER C 1 33  ? -59.266 107.338 -168.338 1.00 36.02 ? 33  SER C C   1 
ATOM   2111 O O   . SER C 1 33  ? -59.655 108.010 -167.386 1.00 35.41 ? 33  SER C O   1 
ATOM   2112 C CB  . SER C 1 33  ? -58.926 108.511 -170.514 1.00 40.68 ? 33  SER C CB  1 
ATOM   2113 O OG  . SER C 1 33  ? -59.583 107.519 -171.283 1.00 42.62 ? 33  SER C OG  1 
ATOM   2114 N N   . ASP C 1 34  ? -59.720 106.116 -168.588 1.00 33.56 ? 34  ASP C N   1 
ATOM   2115 C CA  . ASP C 1 34  ? -60.746 105.491 -167.759 1.00 32.78 ? 34  ASP C CA  1 
ATOM   2116 C C   . ASP C 1 34  ? -60.129 104.839 -166.513 1.00 33.44 ? 34  ASP C C   1 
ATOM   2117 O O   . ASP C 1 34  ? -58.953 104.484 -166.522 1.00 37.03 ? 34  ASP C O   1 
ATOM   2118 C CB  . ASP C 1 34  ? -61.518 104.454 -168.571 1.00 36.52 ? 34  ASP C CB  1 
ATOM   2119 C CG  . ASP C 1 34  ? -60.717 103.199 -168.809 1.00 40.47 ? 34  ASP C CG  1 
ATOM   2120 O OD1 . ASP C 1 34  ? -59.988 103.150 -169.820 1.00 42.70 ? 34  ASP C OD1 1 
ATOM   2121 O OD2 . ASP C 1 34  ? -60.815 102.257 -167.993 1.00 42.49 ? 34  ASP C OD2 1 
ATOM   2122 N N   . PRO C 1 35  ? -60.928 104.671 -165.438 1.00 32.93 ? 35  PRO C N   1 
ATOM   2123 C CA  . PRO C 1 35  ? -60.402 104.221 -164.139 1.00 28.37 ? 35  PRO C CA  1 
ATOM   2124 C C   . PRO C 1 35  ? -59.709 102.863 -164.168 1.00 28.70 ? 35  PRO C C   1 
ATOM   2125 O O   . PRO C 1 35  ? -58.636 102.741 -163.578 1.00 28.08 ? 35  PRO C O   1 
ATOM   2126 C CB  . PRO C 1 35  ? -61.654 104.167 -163.250 1.00 28.50 ? 35  PRO C CB  1 
ATOM   2127 C CG  . PRO C 1 35  ? -62.809 104.185 -164.189 1.00 30.49 ? 35  PRO C CG  1 
ATOM   2128 C CD  . PRO C 1 35  ? -62.368 104.962 -165.367 1.00 38.42 ? 35  PRO C CD  1 
ATOM   2129 N N   . ASP C 1 36  ? -60.292 101.873 -164.836 1.00 30.26 ? 36  ASP C N   1 
ATOM   2130 C CA  . ASP C 1 36  ? -59.676 100.553 -164.912 1.00 30.27 ? 36  ASP C CA  1 
ATOM   2131 C C   . ASP C 1 36  ? -58.319 100.589 -165.619 1.00 27.57 ? 36  ASP C C   1 
ATOM   2132 O O   . ASP C 1 36  ? -57.352 99.997  -165.138 1.00 25.14 ? 36  ASP C O   1 
ATOM   2133 C CB  . ASP C 1 36  ? -60.613 99.564  -165.611 1.00 35.23 ? 36  ASP C CB  1 
ATOM   2134 C CG  . ASP C 1 36  ? -61.622 98.947  -164.661 1.00 40.30 ? 36  ASP C CG  1 
ATOM   2135 O OD1 . ASP C 1 36  ? -61.767 99.457  -163.532 1.00 42.35 ? 36  ASP C OD1 1 
ATOM   2136 O OD2 . ASP C 1 36  ? -62.272 97.953  -165.051 1.00 42.67 ? 36  ASP C OD2 1 
ATOM   2137 N N   . ARG C 1 37  ? -58.247 101.280 -166.752 1.00 28.21 ? 37  ARG C N   1 
ATOM   2138 C CA  . ARG C 1 37  ? -56.988 101.396 -167.484 1.00 29.81 ? 37  ARG C CA  1 
ATOM   2139 C C   . ARG C 1 37  ? -56.057 102.435 -166.869 1.00 29.82 ? 37  ARG C C   1 
ATOM   2140 O O   . ARG C 1 37  ? -54.854 102.430 -167.122 1.00 30.53 ? 37  ARG C O   1 
ATOM   2141 C CB  . ARG C 1 37  ? -57.246 101.738 -168.954 1.00 30.26 ? 37  ARG C CB  1 
ATOM   2142 C CG  . ARG C 1 37  ? -57.462 100.529 -169.849 1.00 31.17 ? 37  ARG C CG  1 
ATOM   2143 C CD  . ARG C 1 37  ? -57.709 100.931 -171.293 1.00 32.48 ? 37  ARG C CD  1 
ATOM   2144 N NE  . ARG C 1 37  ? -58.933 101.711 -171.436 1.00 39.37 ? 37  ARG C NE  1 
ATOM   2145 C CZ  . ARG C 1 37  ? -59.444 102.101 -172.600 1.00 44.62 ? 37  ARG C CZ  1 
ATOM   2146 N NH1 . ARG C 1 37  ? -58.837 101.788 -173.739 1.00 44.02 ? 37  ARG C NH1 1 
ATOM   2147 N NH2 . ARG C 1 37  ? -60.567 102.806 -172.623 1.00 46.82 ? 37  ARG C NH2 1 
ATOM   2148 N N   . SER C 1 38  ? -56.612 103.337 -166.070 1.00 29.30 ? 38  SER C N   1 
ATOM   2149 C CA  . SER C 1 38  ? -55.777 104.284 -165.339 1.00 28.81 ? 38  SER C CA  1 
ATOM   2150 C C   . SER C 1 38  ? -55.033 103.558 -164.234 1.00 24.40 ? 38  SER C C   1 
ATOM   2151 O O   . SER C 1 38  ? -53.854 103.807 -163.989 1.00 23.79 ? 38  SER C O   1 
ATOM   2152 C CB  . SER C 1 38  ? -56.606 105.426 -164.745 1.00 30.95 ? 38  SER C CB  1 
ATOM   2153 O OG  . SER C 1 38  ? -55.849 106.144 -163.787 1.00 29.13 ? 38  SER C OG  1 
ATOM   2154 N N   . SER C 1 39  ? -55.737 102.648 -163.573 1.00 26.67 ? 39  SER C N   1 
ATOM   2155 C CA  . SER C 1 39  ? -55.184 101.938 -162.426 1.00 27.08 ? 39  SER C CA  1 
ATOM   2156 C C   . SER C 1 39  ? -54.107 100.932 -162.807 1.00 28.72 ? 39  SER C C   1 
ATOM   2157 O O   . SER C 1 39  ? -53.081 100.833 -162.139 1.00 24.92 ? 39  SER C O   1 
ATOM   2158 C CB  . SER C 1 39  ? -56.293 101.225 -161.655 1.00 28.98 ? 39  SER C CB  1 
ATOM   2159 O OG  . SER C 1 39  ? -55.737 100.406 -160.647 1.00 30.45 ? 39  SER C OG  1 
ATOM   2160 N N   . ASN C 1 40  ? -54.330 100.178 -163.874 1.00 36.77 ? 40  ASN C N   1 
ATOM   2161 C CA  . ASN C 1 40  ? -53.353 99.168  -164.250 1.00 37.31 ? 40  ASN C CA  1 
ATOM   2162 C C   . ASN C 1 40  ? -52.131 99.800  -164.925 1.00 32.99 ? 40  ASN C C   1 
ATOM   2163 O O   . ASN C 1 40  ? -51.063 99.189  -164.980 1.00 32.35 ? 40  ASN C O   1 
ATOM   2164 C CB  . ASN C 1 40  ? -53.991 98.106  -165.149 1.00 39.52 ? 40  ASN C CB  1 
ATOM   2165 C CG  . ASN C 1 40  ? -54.240 98.603  -166.557 1.00 44.60 ? 40  ASN C CG  1 
ATOM   2166 O OD1 . ASN C 1 40  ? -54.362 99.803  -166.794 1.00 48.86 ? 40  ASN C OD1 1 
ATOM   2167 N ND2 . ASN C 1 40  ? -54.320 97.676  -167.502 1.00 46.41 ? 40  ASN C ND2 1 
ATOM   2168 N N   . PHE C 1 41  ? -52.288 101.022 -165.433 1.00 28.59 ? 41  PHE C N   1 
ATOM   2169 C CA  . PHE C 1 41  ? -51.129 101.787 -165.878 1.00 25.38 ? 41  PHE C CA  1 
ATOM   2170 C C   . PHE C 1 41  ? -50.238 102.075 -164.682 1.00 21.05 ? 41  PHE C C   1 
ATOM   2171 O O   . PHE C 1 41  ? -49.011 102.041 -164.783 1.00 16.84 ? 41  PHE C O   1 
ATOM   2172 C CB  . PHE C 1 41  ? -51.511 103.113 -166.543 1.00 28.48 ? 41  PHE C CB  1 
ATOM   2173 C CG  . PHE C 1 41  ? -50.380 104.107 -166.555 1.00 30.07 ? 41  PHE C CG  1 
ATOM   2174 C CD1 . PHE C 1 41  ? -49.354 103.994 -167.480 1.00 31.78 ? 41  PHE C CD1 1 
ATOM   2175 C CD2 . PHE C 1 41  ? -50.314 105.121 -165.610 1.00 31.24 ? 41  PHE C CD2 1 
ATOM   2176 C CE1 . PHE C 1 41  ? -48.299 104.885 -167.475 1.00 33.25 ? 41  PHE C CE1 1 
ATOM   2177 C CE2 . PHE C 1 41  ? -49.261 106.013 -165.603 1.00 34.04 ? 41  PHE C CE2 1 
ATOM   2178 C CZ  . PHE C 1 41  ? -48.252 105.890 -166.533 1.00 33.90 ? 41  PHE C CZ  1 
ATOM   2179 N N   . MET C 1 42  ? -50.867 102.392 -163.554 1.00 20.52 ? 42  MET C N   1 
ATOM   2180 C CA  . MET C 1 42  ? -50.124 102.698 -162.344 1.00 16.58 ? 42  MET C CA  1 
ATOM   2181 C C   . MET C 1 42  ? -49.321 101.486 -161.904 1.00 15.31 ? 42  MET C C   1 
ATOM   2182 O O   . MET C 1 42  ? -48.181 101.624 -161.475 1.00 19.04 ? 42  MET C O   1 
ATOM   2183 C CB  . MET C 1 42  ? -51.049 103.147 -161.206 1.00 18.08 ? 42  MET C CB  1 
ATOM   2184 C CG  . MET C 1 42  ? -51.635 104.551 -161.333 1.00 20.85 ? 42  MET C CG  1 
ATOM   2185 S SD  . MET C 1 42  ? -50.442 105.907 -161.465 1.00 26.07 ? 42  MET C SD  1 
ATOM   2186 C CE  . MET C 1 42  ? -49.145 105.383 -160.351 1.00 31.76 ? 42  MET C CE  1 
ATOM   2187 N N   . THR C 1 43  ? -49.915 100.302 -162.021 1.00 18.43 ? 43  THR C N   1 
ATOM   2188 C CA  . THR C 1 43  ? -49.251 99.075  -161.598 1.00 21.86 ? 43  THR C CA  1 
ATOM   2189 C C   . THR C 1 43  ? -48.004 98.803  -162.441 1.00 17.52 ? 43  THR C C   1 
ATOM   2190 O O   . THR C 1 43  ? -46.958 98.444  -161.898 1.00 18.69 ? 43  THR C O   1 
ATOM   2191 C CB  . THR C 1 43  ? -50.197 97.863  -161.672 1.00 30.01 ? 43  THR C CB  1 
ATOM   2192 O OG1 . THR C 1 43  ? -51.463 98.202  -161.090 1.00 32.13 ? 43  THR C OG1 1 
ATOM   2193 C CG2 . THR C 1 43  ? -49.600 96.675  -160.927 1.00 29.83 ? 43  THR C CG2 1 
ATOM   2194 N N   . ARG C 1 44  ? -48.106 98.978  -163.758 1.00 21.45 ? 44  ARG C N   1 
ATOM   2195 C CA  . ARG C 1 44  ? -46.937 98.814  -164.622 1.00 21.11 ? 44  ARG C CA  1 
ATOM   2196 C C   . ARG C 1 44  ? -45.922 99.914  -164.334 1.00 15.16 ? 44  ARG C C   1 
ATOM   2197 O O   . ARG C 1 44  ? -44.717 99.681  -164.361 1.00 14.37 ? 44  ARG C O   1 
ATOM   2198 C CB  . ARG C 1 44  ? -47.319 98.832  -166.109 1.00 27.43 ? 44  ARG C CB  1 
ATOM   2199 C CG  . ARG C 1 44  ? -48.318 97.763  -166.556 1.00 35.68 ? 44  ARG C CG  1 
ATOM   2200 C CD  . ARG C 1 44  ? -48.048 96.379  -165.958 1.00 39.34 ? 44  ARG C CD  1 
ATOM   2201 N NE  . ARG C 1 44  ? -46.854 95.715  -166.485 1.00 45.13 ? 44  ARG C NE  1 
ATOM   2202 C CZ  . ARG C 1 44  ? -46.826 94.960  -167.581 1.00 47.98 ? 44  ARG C CZ  1 
ATOM   2203 N NH1 . ARG C 1 44  ? -47.924 94.776  -168.306 1.00 49.89 ? 44  ARG C NH1 1 
ATOM   2204 N NH2 . ARG C 1 44  ? -45.692 94.390  -167.961 1.00 47.79 ? 44  ARG C NH2 1 
ATOM   2205 N N   . ALA C 1 45  ? -46.421 101.115 -164.057 1.00 15.12 ? 45  ALA C N   1 
ATOM   2206 C CA  . ALA C 1 45  ? -45.558 102.249 -163.740 1.00 18.70 ? 45  ALA C CA  1 
ATOM   2207 C C   . ALA C 1 45  ? -44.762 101.991 -162.463 1.00 20.73 ? 45  ALA C C   1 
ATOM   2208 O O   . ALA C 1 45  ? -43.586 102.340 -162.375 1.00 20.44 ? 45  ALA C O   1 
ATOM   2209 C CB  . ALA C 1 45  ? -46.374 103.515 -163.603 1.00 19.91 ? 45  ALA C CB  1 
ATOM   2210 N N   . ILE C 1 46  ? -45.415 101.390 -161.474 1.00 13.48 ? 46  ILE C N   1 
ATOM   2211 C CA  . ILE C 1 46  ? -44.746 100.973 -160.248 1.00 13.24 ? 46  ILE C CA  1 
ATOM   2212 C C   . ILE C 1 46  ? -43.676 99.926  -160.559 1.00 13.33 ? 46  ILE C C   1 
ATOM   2213 O O   . ILE C 1 46  ? -42.562 99.979  -160.035 1.00 13.11 ? 46  ILE C O   1 
ATOM   2214 C CB  . ILE C 1 46  ? -45.754 100.402 -159.226 1.00 21.70 ? 46  ILE C CB  1 
ATOM   2215 C CG1 . ILE C 1 46  ? -46.686 101.504 -158.717 1.00 24.08 ? 46  ILE C CG1 1 
ATOM   2216 C CG2 . ILE C 1 46  ? -45.028 99.733  -158.067 1.00 22.10 ? 46  ILE C CG2 1 
ATOM   2217 C CD1 . ILE C 1 46  ? -47.955 100.978 -158.077 1.00 27.90 ? 46  ILE C CD1 1 
ATOM   2218 N N   . TYR C 1 47  ? -44.026 98.979  -161.423 1.00 20.79 ? 47  TYR C N   1 
ATOM   2219 C CA  . TYR C 1 47  ? -43.107 97.929  -161.849 1.00 22.40 ? 47  TYR C CA  1 
ATOM   2220 C C   . TYR C 1 47  ? -41.867 98.499  -162.536 1.00 23.77 ? 47  TYR C C   1 
ATOM   2221 O O   . TYR C 1 47  ? -40.744 98.114  -162.216 1.00 27.45 ? 47  TYR C O   1 
ATOM   2222 C CB  . TYR C 1 47  ? -43.825 96.949  -162.782 1.00 17.10 ? 47  TYR C CB  1 
ATOM   2223 C CG  . TYR C 1 47  ? -42.911 96.007  -163.538 1.00 18.80 ? 47  TYR C CG  1 
ATOM   2224 C CD1 . TYR C 1 47  ? -42.271 94.957  -162.892 1.00 20.38 ? 47  TYR C CD1 1 
ATOM   2225 C CD2 . TYR C 1 47  ? -42.704 96.158  -164.903 1.00 18.88 ? 47  TYR C CD2 1 
ATOM   2226 C CE1 . TYR C 1 47  ? -41.441 94.091  -163.581 1.00 16.89 ? 47  TYR C CE1 1 
ATOM   2227 C CE2 . TYR C 1 47  ? -41.879 95.298  -165.600 1.00 18.18 ? 47  TYR C CE2 1 
ATOM   2228 C CZ  . TYR C 1 47  ? -41.249 94.266  -164.933 1.00 19.87 ? 47  TYR C CZ  1 
ATOM   2229 O OH  . TYR C 1 47  ? -40.425 93.403  -165.619 1.00 22.54 ? 47  TYR C OH  1 
ATOM   2230 N N   . VAL C 1 48  ? -42.076 99.421  -163.472 1.00 19.25 ? 48  VAL C N   1 
ATOM   2231 C CA  . VAL C 1 48  ? -40.979 99.987  -164.251 1.00 17.35 ? 48  VAL C CA  1 
ATOM   2232 C C   . VAL C 1 48  ? -40.089 100.910 -163.423 1.00 19.95 ? 48  VAL C C   1 
ATOM   2233 O O   . VAL C 1 48  ? -38.860 100.819 -163.483 1.00 20.31 ? 48  VAL C O   1 
ATOM   2234 C CB  . VAL C 1 48  ? -41.508 100.770 -165.470 1.00 13.94 ? 48  VAL C CB  1 
ATOM   2235 C CG1 . VAL C 1 48  ? -40.361 101.452 -166.214 1.00 14.04 ? 48  VAL C CG1 1 
ATOM   2236 C CG2 . VAL C 1 48  ? -42.273 99.848  -166.403 1.00 14.62 ? 48  VAL C CG2 1 
ATOM   2237 N N   . ALA C 1 49  ? -40.714 101.799 -162.656 1.00 18.78 ? 49  ALA C N   1 
ATOM   2238 C CA  . ALA C 1 49  ? -39.983 102.797 -161.877 1.00 16.53 ? 49  ALA C CA  1 
ATOM   2239 C C   . ALA C 1 49  ? -39.034 102.168 -160.857 1.00 14.40 ? 49  ALA C C   1 
ATOM   2240 O O   . ALA C 1 49  ? -37.869 102.551 -160.764 1.00 13.23 ? 49  ALA C O   1 
ATOM   2241 C CB  . ALA C 1 49  ? -40.959 103.734 -161.177 1.00 12.34 ? 49  ALA C CB  1 
ATOM   2242 N N   . PHE C 1 50  ? -39.533 101.204 -160.090 1.00 12.75 ? 50  PHE C N   1 
ATOM   2243 C CA  . PHE C 1 50  ? -38.703 100.546 -159.084 1.00 16.00 ? 50  PHE C CA  1 
ATOM   2244 C C   . PHE C 1 50  ? -37.713 99.577  -159.725 1.00 17.17 ? 50  PHE C C   1 
ATOM   2245 O O   . PHE C 1 50  ? -36.678 99.264  -159.143 1.00 17.82 ? 50  PHE C O   1 
ATOM   2246 C CB  . PHE C 1 50  ? -39.571 99.822  -158.050 1.00 15.74 ? 50  PHE C CB  1 
ATOM   2247 C CG  . PHE C 1 50  ? -40.221 100.747 -157.058 1.00 15.21 ? 50  PHE C CG  1 
ATOM   2248 C CD1 . PHE C 1 50  ? -39.456 101.417 -156.114 1.00 12.75 ? 50  PHE C CD1 1 
ATOM   2249 C CD2 . PHE C 1 50  ? -41.595 100.939 -157.060 1.00 16.72 ? 50  PHE C CD2 1 
ATOM   2250 C CE1 . PHE C 1 50  ? -40.048 102.268 -155.196 1.00 12.65 ? 50  PHE C CE1 1 
ATOM   2251 C CE2 . PHE C 1 50  ? -42.193 101.787 -156.140 1.00 14.69 ? 50  PHE C CE2 1 
ATOM   2252 C CZ  . PHE C 1 50  ? -41.416 102.451 -155.209 1.00 15.30 ? 50  PHE C CZ  1 
ATOM   2253 N N   . SER C 1 51  ? -38.035 99.100  -160.923 1.00 17.73 ? 51  SER C N   1 
ATOM   2254 C CA  . SER C 1 51  ? -37.083 98.315  -161.703 1.00 19.30 ? 51  SER C CA  1 
ATOM   2255 C C   . SER C 1 51  ? -35.860 99.157  -162.031 1.00 16.93 ? 51  SER C C   1 
ATOM   2256 O O   . SER C 1 51  ? -34.724 98.703  -161.895 1.00 19.57 ? 51  SER C O   1 
ATOM   2257 C CB  . SER C 1 51  ? -37.724 97.790  -162.992 1.00 22.32 ? 51  SER C CB  1 
ATOM   2258 O OG  . SER C 1 51  ? -38.383 96.559  -162.760 1.00 28.98 ? 51  SER C OG  1 
ATOM   2259 N N   . ALA C 1 52  ? -36.105 100.391 -162.455 1.00 14.80 ? 52  ALA C N   1 
ATOM   2260 C CA  . ALA C 1 52  ? -35.031 101.309 -162.802 1.00 15.57 ? 52  ALA C CA  1 
ATOM   2261 C C   . ALA C 1 52  ? -34.157 101.624 -161.593 1.00 14.74 ? 52  ALA C C   1 
ATOM   2262 O O   . ALA C 1 52  ? -32.932 101.662 -161.697 1.00 15.11 ? 52  ALA C O   1 
ATOM   2263 C CB  . ALA C 1 52  ? -35.603 102.584 -163.386 1.00 16.33 ? 52  ALA C CB  1 
ATOM   2264 N N   . VAL C 1 53  ? -34.797 101.846 -160.448 1.00 17.26 ? 53  VAL C N   1 
ATOM   2265 C CA  . VAL C 1 53  ? -34.092 102.183 -159.218 1.00 16.62 ? 53  VAL C CA  1 
ATOM   2266 C C   . VAL C 1 53  ? -33.229 101.029 -158.730 1.00 21.11 ? 53  VAL C C   1 
ATOM   2267 O O   . VAL C 1 53  ? -32.063 101.222 -158.385 1.00 24.59 ? 53  VAL C O   1 
ATOM   2268 C CB  . VAL C 1 53  ? -35.073 102.580 -158.100 1.00 19.08 ? 53  VAL C CB  1 
ATOM   2269 C CG1 . VAL C 1 53  ? -34.327 102.828 -156.799 1.00 19.50 ? 53  VAL C CG1 1 
ATOM   2270 C CG2 . VAL C 1 53  ? -35.863 103.809 -158.507 1.00 18.83 ? 53  VAL C CG2 1 
ATOM   2271 N N   . LEU C 1 54  ? -33.804 99.831  -158.703 1.00 23.29 ? 54  LEU C N   1 
ATOM   2272 C CA  . LEU C 1 54  ? -33.078 98.651  -158.243 1.00 26.25 ? 54  LEU C CA  1 
ATOM   2273 C C   . LEU C 1 54  ? -31.824 98.404  -159.075 1.00 26.06 ? 54  LEU C C   1 
ATOM   2274 O O   . LEU C 1 54  ? -30.778 98.040  -158.540 1.00 29.20 ? 54  LEU C O   1 
ATOM   2275 C CB  . LEU C 1 54  ? -33.979 97.414  -158.279 1.00 26.46 ? 54  LEU C CB  1 
ATOM   2276 C CG  . LEU C 1 54  ? -35.033 97.311  -157.175 1.00 25.10 ? 54  LEU C CG  1 
ATOM   2277 C CD1 . LEU C 1 54  ? -36.008 96.170  -157.449 1.00 25.37 ? 54  LEU C CD1 1 
ATOM   2278 C CD2 . LEU C 1 54  ? -34.366 97.138  -155.817 1.00 21.87 ? 54  LEU C CD2 1 
ATOM   2279 N N   . ARG C 1 55  ? -31.934 98.613  -160.384 1.00 22.71 ? 55  ARG C N   1 
ATOM   2280 C CA  . ARG C 1 55  ? -30.833 98.336  -161.303 1.00 22.94 ? 55  ARG C CA  1 
ATOM   2281 C C   . ARG C 1 55  ? -29.780 99.440  -161.323 1.00 24.27 ? 55  ARG C C   1 
ATOM   2282 O O   . ARG C 1 55  ? -28.595 99.172  -161.143 1.00 29.10 ? 55  ARG C O   1 
ATOM   2283 C CB  . ARG C 1 55  ? -31.364 98.109  -162.724 1.00 22.18 ? 55  ARG C CB  1 
ATOM   2284 C CG  . ARG C 1 55  ? -30.262 97.870  -163.739 1.00 25.77 ? 55  ARG C CG  1 
ATOM   2285 C CD  . ARG C 1 55  ? -29.418 96.659  -163.360 1.00 33.82 ? 55  ARG C CD  1 
ATOM   2286 N NE  . ARG C 1 55  ? -28.043 96.765  -163.841 1.00 41.27 ? 55  ARG C NE  1 
ATOM   2287 C CZ  . ARG C 1 55  ? -26.971 96.587  -163.075 1.00 40.36 ? 55  ARG C CZ  1 
ATOM   2288 N NH1 . ARG C 1 55  ? -27.115 96.285  -161.791 1.00 37.58 ? 55  ARG C NH1 1 
ATOM   2289 N NH2 . ARG C 1 55  ? -25.754 96.707  -163.591 1.00 41.29 ? 55  ARG C NH2 1 
ATOM   2290 N N   . ASN C 1 56  ? -30.218 100.675 -161.551 1.00 22.98 ? 56  ASN C N   1 
ATOM   2291 C CA  . ASN C 1 56  ? -29.303 101.810 -161.661 1.00 28.87 ? 56  ASN C CA  1 
ATOM   2292 C C   . ASN C 1 56  ? -28.565 102.130 -160.361 1.00 33.78 ? 56  ASN C C   1 
ATOM   2293 O O   . ASN C 1 56  ? -27.453 102.657 -160.383 1.00 39.45 ? 56  ASN C O   1 
ATOM   2294 C CB  . ASN C 1 56  ? -30.054 103.053 -162.141 1.00 25.79 ? 56  ASN C CB  1 
ATOM   2295 C CG  . ASN C 1 56  ? -30.203 103.094 -163.650 1.00 29.87 ? 56  ASN C CG  1 
ATOM   2296 O OD1 . ASN C 1 56  ? -29.362 103.655 -164.351 1.00 36.36 ? 56  ASN C OD1 1 
ATOM   2297 N ND2 . ASN C 1 56  ? -31.275 102.496 -164.158 1.00 26.58 ? 56  ASN C ND2 1 
ATOM   2298 N N   . ARG C 1 57  ? -29.178 101.813 -159.226 1.00 32.13 ? 57  ARG C N   1 
ATOM   2299 C CA  . ARG C 1 57  ? -28.524 102.031 -157.938 1.00 35.64 ? 57  ARG C CA  1 
ATOM   2300 C C   . ARG C 1 57  ? -27.680 100.809 -157.594 1.00 38.50 ? 57  ARG C C   1 
ATOM   2301 O O   . ARG C 1 57  ? -26.999 100.773 -156.565 1.00 38.51 ? 57  ARG C O   1 
ATOM   2302 C CB  . ARG C 1 57  ? -29.552 102.310 -156.836 1.00 34.85 ? 57  ARG C CB  1 
ATOM   2303 C CG  . ARG C 1 57  ? -28.998 103.036 -155.620 1.00 34.00 ? 57  ARG C CG  1 
ATOM   2304 C CD  . ARG C 1 57  ? -28.415 104.380 -156.013 1.00 31.24 ? 57  ARG C CD  1 
ATOM   2305 N NE  . ARG C 1 57  ? -28.210 105.261 -154.868 1.00 30.45 ? 57  ARG C NE  1 
ATOM   2306 C CZ  . ARG C 1 57  ? -27.033 105.469 -154.290 1.00 35.88 ? 57  ARG C CZ  1 
ATOM   2307 N NH1 . ARG C 1 57  ? -25.948 104.858 -154.749 1.00 37.47 ? 57  ARG C NH1 1 
ATOM   2308 N NH2 . ARG C 1 57  ? -26.939 106.290 -153.254 1.00 38.38 ? 57  ARG C NH2 1 
ATOM   2309 N N   . ASN C 1 58  ? -27.739 99.817  -158.480 1.00 41.59 ? 58  ASN C N   1 
ATOM   2310 C CA  . ASN C 1 58  ? -27.020 98.553  -158.342 1.00 42.59 ? 58  ASN C CA  1 
ATOM   2311 C C   . ASN C 1 58  ? -27.319 97.824  -157.036 1.00 41.59 ? 58  ASN C C   1 
ATOM   2312 O O   . ASN C 1 58  ? -26.420 97.268  -156.403 1.00 44.73 ? 58  ASN C O   1 
ATOM   2313 C CB  . ASN C 1 58  ? -25.515 98.777  -158.475 1.00 46.35 ? 58  ASN C CB  1 
ATOM   2314 C CG  . ASN C 1 58  ? -24.845 97.711  -159.318 1.00 54.30 ? 58  ASN C CG  1 
ATOM   2315 O OD1 . ASN C 1 58  ? -24.705 96.564  -158.893 1.00 57.84 ? 58  ASN C OD1 1 
ATOM   2316 N ND2 . ASN C 1 58  ? -24.429 98.084  -160.522 1.00 56.02 ? 58  ASN C ND2 1 
ATOM   2317 N N   . ILE C 1 59  ? -28.589 97.826  -156.644 1.00 36.11 ? 59  ILE C N   1 
ATOM   2318 C CA  . ILE C 1 59  ? -29.043 97.033  -155.510 1.00 30.32 ? 59  ILE C CA  1 
ATOM   2319 C C   . ILE C 1 59  ? -29.181 95.581  -155.969 1.00 31.63 ? 59  ILE C C   1 
ATOM   2320 O O   . ILE C 1 59  ? -28.990 94.644  -155.191 1.00 38.30 ? 59  ILE C O   1 
ATOM   2321 C CB  . ILE C 1 59  ? -30.374 97.576  -154.948 1.00 24.97 ? 59  ILE C CB  1 
ATOM   2322 C CG1 . ILE C 1 59  ? -30.135 98.921  -154.259 1.00 18.13 ? 59  ILE C CG1 1 
ATOM   2323 C CG2 . ILE C 1 59  ? -31.007 96.603  -153.965 1.00 26.08 ? 59  ILE C CG2 1 
ATOM   2324 C CD1 . ILE C 1 59  ? -31.382 99.736  -154.031 1.00 16.86 ? 59  ILE C CD1 1 
ATOM   2325 N N   . LEU C 1 60  ? -29.489 95.408  -157.251 1.00 26.00 ? 60  LEU C N   1 
ATOM   2326 C CA  . LEU C 1 60  ? -29.506 94.090  -157.877 1.00 26.76 ? 60  LEU C CA  1 
ATOM   2327 C C   . LEU C 1 60  ? -28.647 94.079  -159.137 1.00 28.04 ? 60  LEU C C   1 
ATOM   2328 O O   . LEU C 1 60  ? -28.511 95.103  -159.813 1.00 25.03 ? 60  LEU C O   1 
ATOM   2329 C CB  . LEU C 1 60  ? -30.934 93.666  -158.218 1.00 24.10 ? 60  LEU C CB  1 
ATOM   2330 C CG  . LEU C 1 60  ? -31.854 93.300  -157.055 1.00 20.42 ? 60  LEU C CG  1 
ATOM   2331 C CD1 . LEU C 1 60  ? -33.242 92.984  -157.576 1.00 19.75 ? 60  LEU C CD1 1 
ATOM   2332 C CD2 . LEU C 1 60  ? -31.296 92.118  -156.275 1.00 21.97 ? 60  LEU C CD2 1 
ATOM   2333 N N   . GLY C 1 61  ? -28.073 92.921  -159.448 1.00 31.45 ? 61  GLY C N   1 
ATOM   2334 C CA  . GLY C 1 61  ? -27.255 92.776  -160.637 1.00 35.41 ? 61  GLY C CA  1 
ATOM   2335 C C   . GLY C 1 61  ? -28.071 92.707  -161.915 1.00 39.71 ? 61  GLY C C   1 
ATOM   2336 O O   . GLY C 1 61  ? -29.273 92.439  -161.885 1.00 44.42 ? 61  GLY C O   1 
ATOM   2337 N N   . GLN C 1 62  ? -27.402 92.946  -163.037 1.00 39.72 ? 62  GLN C N   1 
ATOM   2338 C CA  . GLN C 1 62  ? -28.023 92.950  -164.356 1.00 38.24 ? 62  GLN C CA  1 
ATOM   2339 C C   . GLN C 1 62  ? -28.742 91.637  -164.690 1.00 36.10 ? 62  GLN C C   1 
ATOM   2340 O O   . GLN C 1 62  ? -29.728 91.632  -165.433 1.00 36.18 ? 62  GLN C O   1 
ATOM   2341 C CB  . GLN C 1 62  ? -26.950 93.268  -165.403 1.00 39.59 ? 62  GLN C CB  1 
ATOM   2342 C CG  . GLN C 1 62  ? -27.093 92.567  -166.739 1.00 44.40 ? 62  GLN C CG  1 
ATOM   2343 C CD  . GLN C 1 62  ? -25.867 92.754  -167.613 1.00 50.70 ? 62  GLN C CD  1 
ATOM   2344 O OE1 . GLN C 1 62  ? -24.734 92.705  -167.131 1.00 53.60 ? 62  GLN C OE1 1 
ATOM   2345 N NE2 . GLN C 1 62  ? -26.088 92.982  -168.902 1.00 50.89 ? 62  GLN C NE2 1 
ATOM   2346 N N   . GLU C 1 63  ? -28.261 90.535  -164.118 1.00 34.31 ? 63  GLU C N   1 
ATOM   2347 C CA  . GLU C 1 63  ? -28.847 89.216  -164.354 1.00 38.49 ? 63  GLU C CA  1 
ATOM   2348 C C   . GLU C 1 63  ? -30.295 89.117  -163.878 1.00 38.71 ? 63  GLU C C   1 
ATOM   2349 O O   . GLU C 1 63  ? -30.993 88.155  -164.192 1.00 42.76 ? 63  GLU C O   1 
ATOM   2350 C CB  . GLU C 1 63  ? -28.013 88.130  -163.665 1.00 40.68 ? 63  GLU C CB  1 
ATOM   2351 C CG  . GLU C 1 63  ? -28.112 88.127  -162.141 1.00 38.18 ? 63  GLU C CG  1 
ATOM   2352 C CD  . GLU C 1 63  ? -26.886 88.714  -161.464 1.00 45.34 ? 63  GLU C CD  1 
ATOM   2353 O OE1 . GLU C 1 63  ? -26.294 89.667  -162.014 1.00 47.68 ? 63  GLU C OE1 1 
ATOM   2354 O OE2 . GLU C 1 63  ? -26.509 88.218  -160.380 1.00 48.82 ? 63  GLU C OE2 1 
ATOM   2355 N N   . TYR C 1 64  ? -30.740 90.108  -163.112 1.00 36.60 ? 64  TYR C N   1 
ATOM   2356 C CA  . TYR C 1 64  ? -32.087 90.097  -162.554 1.00 33.40 ? 64  TYR C CA  1 
ATOM   2357 C C   . TYR C 1 64  ? -33.062 90.948  -163.359 1.00 30.36 ? 64  TYR C C   1 
ATOM   2358 O O   . TYR C 1 64  ? -34.191 91.184  -162.929 1.00 29.35 ? 64  TYR C O   1 
ATOM   2359 C CB  . TYR C 1 64  ? -32.055 90.578  -161.101 1.00 29.43 ? 64  TYR C CB  1 
ATOM   2360 C CG  . TYR C 1 64  ? -31.405 89.600  -160.155 1.00 27.11 ? 64  TYR C CG  1 
ATOM   2361 C CD1 . TYR C 1 64  ? -32.008 88.385  -159.868 1.00 32.06 ? 64  TYR C CD1 1 
ATOM   2362 C CD2 . TYR C 1 64  ? -30.190 89.891  -159.546 1.00 25.31 ? 64  TYR C CD2 1 
ATOM   2363 C CE1 . TYR C 1 64  ? -31.422 87.483  -159.005 1.00 34.96 ? 64  TYR C CE1 1 
ATOM   2364 C CE2 . TYR C 1 64  ? -29.595 88.993  -158.678 1.00 31.33 ? 64  TYR C CE2 1 
ATOM   2365 C CZ  . TYR C 1 64  ? -30.218 87.790  -158.413 1.00 34.91 ? 64  TYR C CZ  1 
ATOM   2366 O OH  . TYR C 1 64  ? -29.636 86.890  -157.550 1.00 37.75 ? 64  TYR C OH  1 
ATOM   2367 N N   . PHE C 1 65  ? -32.627 91.402  -164.529 1.00 27.85 ? 65  PHE C N   1 
ATOM   2368 C CA  . PHE C 1 65  ? -33.446 92.290  -165.346 1.00 29.13 ? 65  PHE C CA  1 
ATOM   2369 C C   . PHE C 1 65  ? -33.486 91.848  -166.803 1.00 33.05 ? 65  PHE C C   1 
ATOM   2370 O O   . PHE C 1 65  ? -32.638 91.078  -167.254 1.00 37.24 ? 65  PHE C O   1 
ATOM   2371 C CB  . PHE C 1 65  ? -32.927 93.729  -165.255 1.00 25.69 ? 65  PHE C CB  1 
ATOM   2372 C CG  . PHE C 1 65  ? -32.961 94.299  -163.866 1.00 27.90 ? 65  PHE C CG  1 
ATOM   2373 C CD1 . PHE C 1 65  ? -31.924 94.062  -162.978 1.00 29.69 ? 65  PHE C CD1 1 
ATOM   2374 C CD2 . PHE C 1 65  ? -34.031 95.073  -163.447 1.00 26.24 ? 65  PHE C CD2 1 
ATOM   2375 C CE1 . PHE C 1 65  ? -31.954 94.583  -161.697 1.00 26.69 ? 65  PHE C CE1 1 
ATOM   2376 C CE2 . PHE C 1 65  ? -34.065 95.599  -162.166 1.00 23.02 ? 65  PHE C CE2 1 
ATOM   2377 C CZ  . PHE C 1 65  ? -33.025 95.352  -161.291 1.00 20.21 ? 65  PHE C CZ  1 
ATOM   2378 N N   . THR C 1 66  ? -34.487 92.338  -167.529 1.00 32.80 ? 66  THR C N   1 
ATOM   2379 C CA  . THR C 1 66  ? -34.570 92.138  -168.969 1.00 35.14 ? 66  THR C CA  1 
ATOM   2380 C C   . THR C 1 66  ? -34.711 93.477  -169.681 1.00 37.46 ? 66  THR C C   1 
ATOM   2381 O O   . THR C 1 66  ? -35.379 94.389  -169.187 1.00 35.42 ? 66  THR C O   1 
ATOM   2382 C CB  . THR C 1 66  ? -35.748 91.235  -169.362 1.00 35.89 ? 66  THR C CB  1 
ATOM   2383 O OG1 . THR C 1 66  ? -36.921 91.630  -168.640 1.00 37.63 ? 66  THR C OG1 1 
ATOM   2384 C CG2 . THR C 1 66  ? -35.431 89.786  -169.053 1.00 37.94 ? 66  THR C CG2 1 
ATOM   2385 N N   . LYS C 1 67  ? -34.070 93.583  -170.841 1.00 39.54 ? 67  LYS C N   1 
ATOM   2386 C CA  . LYS C 1 67  ? -34.142 94.784  -171.659 1.00 40.18 ? 67  LYS C CA  1 
ATOM   2387 C C   . LYS C 1 67  ? -35.575 95.025  -172.115 1.00 42.97 ? 67  LYS C C   1 
ATOM   2388 O O   . LYS C 1 67  ? -36.314 94.077  -172.386 1.00 45.78 ? 67  LYS C O   1 
ATOM   2389 C CB  . LYS C 1 67  ? -33.214 94.664  -172.868 1.00 38.98 ? 67  LYS C CB  1 
ATOM   2390 C CG  . LYS C 1 67  ? -33.651 93.624  -173.890 1.00 40.45 ? 67  LYS C CG  1 
ATOM   2391 C CD  . LYS C 1 67  ? -32.577 93.359  -174.932 1.00 41.78 ? 67  LYS C CD  1 
ATOM   2392 C CE  . LYS C 1 67  ? -31.465 92.477  -174.380 1.00 41.88 ? 67  LYS C CE  1 
ATOM   2393 N NZ  . LYS C 1 67  ? -30.520 92.045  -175.450 1.00 43.66 ? 67  LYS C NZ  1 
ATOM   2394 N N   . ASN C 1 68  ? -35.965 96.294  -172.187 1.00 40.07 ? 68  ASN C N   1 
ATOM   2395 C CA  . ASN C 1 68  ? -37.311 96.666  -172.613 1.00 34.77 ? 68  ASN C CA  1 
ATOM   2396 C C   . ASN C 1 68  ? -37.392 98.117  -173.067 1.00 31.39 ? 68  ASN C C   1 
ATOM   2397 O O   . ASN C 1 68  ? -36.736 98.990  -172.498 1.00 34.50 ? 68  ASN C O   1 
ATOM   2398 C CB  . ASN C 1 68  ? -38.316 96.429  -171.484 1.00 34.85 ? 68  ASN C CB  1 
ATOM   2399 C CG  . ASN C 1 68  ? -39.048 95.112  -171.621 1.00 41.49 ? 68  ASN C CG  1 
ATOM   2400 O OD1 . ASN C 1 68  ? -40.136 95.054  -172.189 1.00 45.18 ? 68  ASN C OD1 1 
ATOM   2401 N ND2 . ASN C 1 68  ? -38.455 94.046  -171.096 1.00 43.80 ? 68  ASN C ND2 1 
ATOM   2402 N N   . TYR C 1 69  ? -38.199 98.368  -174.095 1.00 27.22 ? 69  TYR C N   1 
ATOM   2403 C CA  . TYR C 1 69  ? -38.463 99.729  -174.541 1.00 25.49 ? 69  TYR C CA  1 
ATOM   2404 C C   . TYR C 1 69  ? -39.611 100.313 -173.734 1.00 30.69 ? 69  TYR C C   1 
ATOM   2405 O O   . TYR C 1 69  ? -40.658 99.682  -173.595 1.00 38.87 ? 69  TYR C O   1 
ATOM   2406 C CB  . TYR C 1 69  ? -38.817 99.773  -176.031 1.00 24.90 ? 69  TYR C CB  1 
ATOM   2407 C CG  . TYR C 1 69  ? -37.718 99.350  -176.985 1.00 25.21 ? 69  TYR C CG  1 
ATOM   2408 C CD1 . TYR C 1 69  ? -37.570 98.021  -177.359 1.00 23.33 ? 69  TYR C CD1 1 
ATOM   2409 C CD2 . TYR C 1 69  ? -36.855 100.285 -177.538 1.00 27.09 ? 69  TYR C CD2 1 
ATOM   2410 C CE1 . TYR C 1 69  ? -36.579 97.631  -178.239 1.00 27.99 ? 69  TYR C CE1 1 
ATOM   2411 C CE2 . TYR C 1 69  ? -35.861 99.908  -178.420 1.00 30.19 ? 69  TYR C CE2 1 
ATOM   2412 C CZ  . TYR C 1 69  ? -35.727 98.579  -178.767 1.00 30.44 ? 69  TYR C CZ  1 
ATOM   2413 O OH  . TYR C 1 69  ? -34.740 98.197  -179.643 1.00 31.56 ? 69  TYR C OH  1 
ATOM   2414 N N   . ILE C 1 70  ? -39.416 101.511 -173.198 1.00 27.30 ? 70  ILE C N   1 
ATOM   2415 C CA  . ILE C 1 70  ? -40.532 102.274 -172.671 1.00 29.95 ? 70  ILE C CA  1 
ATOM   2416 C C   . ILE C 1 70  ? -41.230 102.921 -173.859 1.00 30.90 ? 70  ILE C C   1 
ATOM   2417 O O   . ILE C 1 70  ? -42.456 102.860 -173.995 1.00 31.33 ? 70  ILE C O   1 
ATOM   2418 C CB  . ILE C 1 70  ? -40.075 103.342 -171.661 1.00 35.49 ? 70  ILE C CB  1 
ATOM   2419 C CG1 . ILE C 1 70  ? -39.495 102.674 -170.413 1.00 48.44 ? 70  ILE C CG1 1 
ATOM   2420 C CG2 . ILE C 1 70  ? -41.222 104.281 -171.306 1.00 28.79 ? 70  ILE C CG2 1 
ATOM   2421 C CD1 . ILE C 1 70  ? -38.777 103.633 -169.471 1.00 57.21 ? 70  ILE C CD1 1 
ATOM   2422 N N   . THR C 1 71  ? -40.425 103.539 -174.718 1.00 31.47 ? 71  THR C N   1 
ATOM   2423 C CA  . THR C 1 71  ? -40.897 104.131 -175.965 1.00 26.49 ? 71  THR C CA  1 
ATOM   2424 C C   . THR C 1 71  ? -39.913 103.828 -177.090 1.00 25.61 ? 71  THR C C   1 
ATOM   2425 O O   . THR C 1 71  ? -39.053 102.955 -176.956 1.00 28.04 ? 71  THR C O   1 
ATOM   2426 C CB  . THR C 1 71  ? -41.067 105.658 -175.852 1.00 28.35 ? 71  THR C CB  1 
ATOM   2427 O OG1 . THR C 1 71  ? -39.779 106.277 -175.731 1.00 28.83 ? 71  THR C OG1 1 
ATOM   2428 C CG2 . THR C 1 71  ? -41.910 106.019 -174.647 1.00 29.84 ? 71  THR C CG2 1 
ATOM   2429 N N   . GLU C 1 72  ? -40.042 104.560 -178.194 1.00 27.21 ? 72  GLU C N   1 
ATOM   2430 C CA  . GLU C 1 72  ? -39.096 104.464 -179.302 1.00 28.32 ? 72  GLU C CA  1 
ATOM   2431 C C   . GLU C 1 72  ? -37.796 105.179 -178.955 1.00 30.33 ? 72  GLU C C   1 
ATOM   2432 O O   . GLU C 1 72  ? -36.760 104.940 -179.574 1.00 37.30 ? 72  GLU C O   1 
ATOM   2433 C CB  . GLU C 1 72  ? -39.683 105.068 -180.581 1.00 31.78 ? 72  GLU C CB  1 
ATOM   2434 C CG  . GLU C 1 72  ? -40.862 104.313 -181.167 1.00 41.23 ? 72  GLU C CG  1 
ATOM   2435 C CD  . GLU C 1 72  ? -41.449 104.991 -182.387 1.00 57.56 ? 72  GLU C CD  1 
ATOM   2436 O OE1 . GLU C 1 72  ? -41.064 106.147 -182.673 1.00 69.03 ? 72  GLU C OE1 1 
ATOM   2437 O OE2 . GLU C 1 72  ? -42.294 104.367 -183.062 1.00 57.71 ? 72  GLU C OE2 1 
ATOM   2438 N N   . LYS C 1 73  ? -37.863 106.062 -177.961 1.00 25.62 ? 73  LYS C N   1 
ATOM   2439 C CA  . LYS C 1 73  ? -36.743 106.934 -177.626 1.00 27.41 ? 73  LYS C CA  1 
ATOM   2440 C C   . LYS C 1 73  ? -35.999 106.481 -176.379 1.00 28.19 ? 73  LYS C C   1 
ATOM   2441 O O   . LYS C 1 73  ? -34.898 106.954 -176.103 1.00 33.09 ? 73  LYS C O   1 
ATOM   2442 C CB  . LYS C 1 73  ? -37.234 108.368 -177.425 1.00 30.13 ? 73  LYS C CB  1 
ATOM   2443 C CG  . LYS C 1 73  ? -38.009 108.941 -178.599 1.00 34.83 ? 73  LYS C CG  1 
ATOM   2444 C CD  . LYS C 1 73  ? -37.094 109.258 -179.764 1.00 41.92 ? 73  LYS C CD  1 
ATOM   2445 C CE  . LYS C 1 73  ? -37.843 109.993 -180.864 1.00 47.65 ? 73  LYS C CE  1 
ATOM   2446 N NZ  . LYS C 1 73  ? -38.933 109.169 -181.460 1.00 48.85 ? 73  LYS C NZ  1 
ATOM   2447 N N   . LEU C 1 74  ? -36.599 105.567 -175.623 1.00 23.44 ? 74  LEU C N   1 
ATOM   2448 C CA  . LEU C 1 74  ? -36.022 105.161 -174.346 1.00 19.45 ? 74  LEU C CA  1 
ATOM   2449 C C   . LEU C 1 74  ? -36.121 103.660 -174.092 1.00 20.82 ? 74  LEU C C   1 
ATOM   2450 O O   . LEU C 1 74  ? -37.190 103.063 -174.241 1.00 20.22 ? 74  LEU C O   1 
ATOM   2451 C CB  . LEU C 1 74  ? -36.701 105.914 -173.196 1.00 21.82 ? 74  LEU C CB  1 
ATOM   2452 C CG  . LEU C 1 74  ? -36.102 105.719 -171.799 1.00 27.25 ? 74  LEU C CG  1 
ATOM   2453 C CD1 . LEU C 1 74  ? -34.747 106.407 -171.701 1.00 31.42 ? 74  LEU C CD1 1 
ATOM   2454 C CD2 . LEU C 1 74  ? -37.048 106.220 -170.714 1.00 22.53 ? 74  LEU C CD2 1 
ATOM   2455 N N   . LYS C 1 75  ? -34.998 103.058 -173.713 1.00 29.06 ? 75  LYS C N   1 
ATOM   2456 C CA  . LYS C 1 75  ? -34.999 101.691 -173.210 1.00 32.87 ? 75  LYS C CA  1 
ATOM   2457 C C   . LYS C 1 75  ? -34.886 101.707 -171.693 1.00 35.51 ? 75  LYS C C   1 
ATOM   2458 O O   . LYS C 1 75  ? -34.545 102.732 -171.100 1.00 39.38 ? 75  LYS C O   1 
ATOM   2459 C CB  . LYS C 1 75  ? -33.855 100.875 -173.807 1.00 29.57 ? 75  LYS C CB  1 
ATOM   2460 C CG  . LYS C 1 75  ? -34.219 100.093 -175.058 1.00 31.43 ? 75  LYS C CG  1 
ATOM   2461 C CD  . LYS C 1 75  ? -33.012 99.319  -175.580 1.00 31.73 ? 75  LYS C CD  1 
ATOM   2462 C CE  . LYS C 1 75  ? -33.243 97.813  -175.559 1.00 35.41 ? 75  LYS C CE  1 
ATOM   2463 N NZ  . LYS C 1 75  ? -32.007 97.073  -175.962 1.00 37.44 ? 75  LYS C NZ  1 
ATOM   2464 N N   . CYS C 1 76  ? -35.163 100.566 -171.071 1.00 32.02 ? 76  CYS C N   1 
ATOM   2465 C CA  . CYS C 1 76  ? -35.059 100.443 -169.623 1.00 29.24 ? 76  CYS C CA  1 
ATOM   2466 C C   . CYS C 1 76  ? -34.949 98.984  -169.196 1.00 32.10 ? 76  CYS C C   1 
ATOM   2467 O O   . CYS C 1 76  ? -35.401 98.082  -169.902 1.00 30.82 ? 76  CYS C O   1 
ATOM   2468 C CB  . CYS C 1 76  ? -36.261 101.099 -168.936 1.00 24.16 ? 76  CYS C CB  1 
ATOM   2469 S SG  . CYS C 1 76  ? -36.258 100.956 -167.126 1.00 26.57 ? 76  CYS C SG  1 
ATOM   2470 N N   . MET C 1 77  ? -34.342 98.765  -168.035 1.00 36.22 ? 77  MET C N   1 
ATOM   2471 C CA  . MET C 1 77  ? -34.221 97.428  -167.473 1.00 39.37 ? 77  MET C CA  1 
ATOM   2472 C C   . MET C 1 77  ? -35.380 97.163  -166.525 1.00 38.67 ? 77  MET C C   1 
ATOM   2473 O O   . MET C 1 77  ? -35.518 97.839  -165.504 1.00 38.83 ? 77  MET C O   1 
ATOM   2474 C CB  . MET C 1 77  ? -32.889 97.265  -166.736 1.00 36.95 ? 77  MET C CB  1 
ATOM   2475 C CG  . MET C 1 77  ? -31.657 97.540  -167.585 1.00 31.15 ? 77  MET C CG  1 
ATOM   2476 S SD  . MET C 1 77  ? -31.301 96.232  -168.776 1.00 40.11 ? 77  MET C SD  1 
ATOM   2477 C CE  . MET C 1 77  ? -29.842 96.897  -169.581 1.00 45.38 ? 77  MET C CE  1 
ATOM   2478 N N   . THR C 1 78  ? -36.219 96.191  -166.866 1.00 34.66 ? 78  THR C N   1 
ATOM   2479 C CA  . THR C 1 78  ? -37.335 95.830  -166.006 1.00 30.58 ? 78  THR C CA  1 
ATOM   2480 C C   . THR C 1 78  ? -37.086 94.464  -165.375 1.00 26.65 ? 78  THR C C   1 
ATOM   2481 O O   . THR C 1 78  ? -36.455 93.601  -165.987 1.00 26.34 ? 78  THR C O   1 
ATOM   2482 C CB  . THR C 1 78  ? -38.668 95.823  -166.776 1.00 31.53 ? 78  THR C CB  1 
ATOM   2483 O OG1 . THR C 1 78  ? -38.560 94.981  -167.930 1.00 37.64 ? 78  THR C OG1 1 
ATOM   2484 C CG2 . THR C 1 78  ? -39.036 97.228  -167.217 1.00 26.19 ? 78  THR C CG2 1 
ATOM   2485 N N   . LEU C 1 79  ? -37.576 94.286  -164.148 1.00 22.63 ? 79  LEU C N   1 
ATOM   2486 C CA  . LEU C 1 79  ? -37.360 93.061  -163.379 1.00 18.46 ? 79  LEU C CA  1 
ATOM   2487 C C   . LEU C 1 79  ? -37.763 91.815  -164.157 1.00 19.68 ? 79  LEU C C   1 
ATOM   2488 O O   . LEU C 1 79  ? -38.867 91.734  -164.694 1.00 22.56 ? 79  LEU C O   1 
ATOM   2489 C CB  . LEU C 1 79  ? -38.129 93.122  -162.057 1.00 21.67 ? 79  LEU C CB  1 
ATOM   2490 C CG  . LEU C 1 79  ? -37.513 93.963  -160.935 1.00 21.97 ? 79  LEU C CG  1 
ATOM   2491 C CD1 . LEU C 1 79  ? -38.539 94.234  -159.847 1.00 16.51 ? 79  LEU C CD1 1 
ATOM   2492 C CD2 . LEU C 1 79  ? -36.291 93.270  -160.355 1.00 18.08 ? 79  LEU C CD2 1 
ATOM   2493 N N   . CYS C 1 80  ? -36.853 90.846  -164.208 1.00 21.56 ? 80  CYS C N   1 
ATOM   2494 C CA  . CYS C 1 80  ? -37.039 89.648  -165.018 1.00 24.24 ? 80  CYS C CA  1 
ATOM   2495 C C   . CYS C 1 80  ? -38.091 88.709  -164.440 1.00 22.94 ? 80  CYS C C   1 
ATOM   2496 O O   . CYS C 1 80  ? -37.986 88.267  -163.295 1.00 23.14 ? 80  CYS C O   1 
ATOM   2497 C CB  . CYS C 1 80  ? -35.710 88.903  -165.172 1.00 23.97 ? 80  CYS C CB  1 
ATOM   2498 S SG  . CYS C 1 80  ? -35.795 87.454  -166.252 1.00 33.13 ? 80  CYS C SG  1 
ATOM   2499 N N   . PHE C 1 81  ? -39.100 88.401  -165.249 1.00 23.28 ? 81  PHE C N   1 
ATOM   2500 C CA  . PHE C 1 81  ? -40.176 87.506  -164.840 1.00 30.24 ? 81  PHE C CA  1 
ATOM   2501 C C   . PHE C 1 81  ? -39.758 86.036  -164.878 1.00 28.76 ? 81  PHE C C   1 
ATOM   2502 O O   . PHE C 1 81  ? -40.472 85.175  -164.367 1.00 29.90 ? 81  PHE C O   1 
ATOM   2503 C CB  . PHE C 1 81  ? -41.409 87.708  -165.728 1.00 32.41 ? 81  PHE C CB  1 
ATOM   2504 C CG  . PHE C 1 81  ? -42.105 89.025  -165.521 1.00 34.16 ? 81  PHE C CG  1 
ATOM   2505 C CD1 . PHE C 1 81  ? -42.853 89.254  -164.378 1.00 33.29 ? 81  PHE C CD1 1 
ATOM   2506 C CD2 . PHE C 1 81  ? -42.029 90.025  -166.477 1.00 34.41 ? 81  PHE C CD2 1 
ATOM   2507 C CE1 . PHE C 1 81  ? -43.502 90.461  -164.185 1.00 28.26 ? 81  PHE C CE1 1 
ATOM   2508 C CE2 . PHE C 1 81  ? -42.677 91.235  -166.290 1.00 31.15 ? 81  PHE C CE2 1 
ATOM   2509 C CZ  . PHE C 1 81  ? -43.415 91.451  -165.143 1.00 25.55 ? 81  PHE C CZ  1 
ATOM   2510 N N   . ARG C 1 82  ? -38.606 85.749  -165.478 1.00 26.88 ? 82  ARG C N   1 
ATOM   2511 C CA  . ARG C 1 82  ? -38.160 84.367  -165.649 1.00 29.06 ? 82  ARG C CA  1 
ATOM   2512 C C   . ARG C 1 82  ? -37.033 83.967  -164.702 1.00 37.38 ? 82  ARG C C   1 
ATOM   2513 O O   . ARG C 1 82  ? -36.495 82.858  -164.789 1.00 39.33 ? 82  ARG C O   1 
ATOM   2514 C CB  . ARG C 1 82  ? -37.728 84.137  -167.095 1.00 36.92 ? 82  ARG C CB  1 
ATOM   2515 C CG  . ARG C 1 82  ? -38.901 83.943  -168.032 1.00 36.13 ? 82  ARG C CG  1 
ATOM   2516 C CD  . ARG C 1 82  ? -38.537 84.236  -169.472 1.00 38.57 ? 82  ARG C CD  1 
ATOM   2517 N NE  . ARG C 1 82  ? -39.736 84.346  -170.296 1.00 41.31 ? 82  ARG C NE  1 
ATOM   2518 C CZ  . ARG C 1 82  ? -39.732 84.646  -171.589 1.00 46.12 ? 82  ARG C CZ  1 
ATOM   2519 N NH1 . ARG C 1 82  ? -38.585 84.866  -172.217 1.00 45.12 ? 82  ARG C NH1 1 
ATOM   2520 N NH2 . ARG C 1 82  ? -40.876 84.725  -172.256 1.00 51.18 ? 82  ARG C NH2 1 
ATOM   2521 N N   . ASN C 1 83  ? -36.674 84.878  -163.807 1.00 31.90 ? 83  ASN C N   1 
ATOM   2522 C CA  . ASN C 1 83  ? -35.787 84.556  -162.697 1.00 33.55 ? 83  ASN C CA  1 
ATOM   2523 C C   . ASN C 1 83  ? -36.620 84.509  -161.427 1.00 34.63 ? 83  ASN C C   1 
ATOM   2524 O O   . ASN C 1 83  ? -37.436 85.398  -161.204 1.00 35.14 ? 83  ASN C O   1 
ATOM   2525 C CB  . ASN C 1 83  ? -34.664 85.589  -162.572 1.00 33.00 ? 83  ASN C CB  1 
ATOM   2526 C CG  . ASN C 1 83  ? -33.709 85.286  -161.434 1.00 37.06 ? 83  ASN C CG  1 
ATOM   2527 O OD1 . ASN C 1 83  ? -34.062 85.396  -160.258 1.00 42.20 ? 83  ASN C OD1 1 
ATOM   2528 N ND2 . ASN C 1 83  ? -32.481 84.918  -161.780 1.00 36.81 ? 83  ASN C ND2 1 
ATOM   2529 N N   . LEU C 1 84  ? -36.420 83.483  -160.604 1.00 34.69 ? 84  LEU C N   1 
ATOM   2530 C CA  . LEU C 1 84  ? -37.232 83.285  -159.399 1.00 36.14 ? 84  LEU C CA  1 
ATOM   2531 C C   . LEU C 1 84  ? -37.289 84.510  -158.487 1.00 33.50 ? 84  LEU C C   1 
ATOM   2532 O O   . LEU C 1 84  ? -38.369 84.937  -158.079 1.00 30.62 ? 84  LEU C O   1 
ATOM   2533 C CB  . LEU C 1 84  ? -36.710 82.089  -158.595 1.00 38.57 ? 84  LEU C CB  1 
ATOM   2534 C CG  . LEU C 1 84  ? -37.252 81.972  -157.165 1.00 39.33 ? 84  LEU C CG  1 
ATOM   2535 C CD1 . LEU C 1 84  ? -38.650 81.362  -157.144 1.00 42.08 ? 84  LEU C CD1 1 
ATOM   2536 C CD2 . LEU C 1 84  ? -36.302 81.191  -156.263 1.00 37.67 ? 84  LEU C CD2 1 
ATOM   2537 N N   . ARG C 1 85  ? -36.127 85.070  -158.168 1.00 27.25 ? 85  ARG C N   1 
ATOM   2538 C CA  . ARG C 1 85  ? -36.060 86.139  -157.179 1.00 28.25 ? 85  ARG C CA  1 
ATOM   2539 C C   . ARG C 1 85  ? -36.665 87.443  -157.677 1.00 26.20 ? 85  ARG C C   1 
ATOM   2540 O O   . ARG C 1 85  ? -37.478 88.058  -156.990 1.00 25.66 ? 85  ARG C O   1 
ATOM   2541 C CB  . ARG C 1 85  ? -34.618 86.384  -156.746 1.00 30.56 ? 85  ARG C CB  1 
ATOM   2542 C CG  . ARG C 1 85  ? -34.517 87.256  -155.507 1.00 41.03 ? 85  ARG C CG  1 
ATOM   2543 C CD  . ARG C 1 85  ? -33.246 88.077  -155.512 1.00 46.44 ? 85  ARG C CD  1 
ATOM   2544 N NE  . ARG C 1 85  ? -32.599 88.080  -154.205 1.00 49.37 ? 85  ARG C NE  1 
ATOM   2545 C CZ  . ARG C 1 85  ? -31.315 88.360  -154.017 1.00 52.14 ? 85  ARG C CZ  1 
ATOM   2546 N NH1 . ARG C 1 85  ? -30.543 88.657  -155.053 1.00 49.43 ? 85  ARG C NH1 1 
ATOM   2547 N NH2 . ARG C 1 85  ? -30.800 88.336  -152.795 1.00 57.14 ? 85  ARG C NH2 1 
ATOM   2548 N N   . SER C 1 86  ? -36.252 87.869  -158.865 1.00 25.86 ? 86  SER C N   1 
ATOM   2549 C CA  . SER C 1 86  ? -36.771 89.098  -159.450 1.00 21.92 ? 86  SER C CA  1 
ATOM   2550 C C   . SER C 1 86  ? -38.268 88.994  -159.714 1.00 21.52 ? 86  SER C C   1 
ATOM   2551 O O   . SER C 1 86  ? -38.994 89.978  -159.593 1.00 28.81 ? 86  SER C O   1 
ATOM   2552 C CB  . SER C 1 86  ? -36.025 89.434  -160.742 1.00 22.04 ? 86  SER C CB  1 
ATOM   2553 O OG  . SER C 1 86  ? -35.919 88.297  -161.573 1.00 23.55 ? 86  SER C OG  1 
ATOM   2554 N N   . ASN C 1 87  ? -38.722 87.799  -160.082 1.00 22.82 ? 87  ASN C N   1 
ATOM   2555 C CA  . ASN C 1 87  ? -40.147 87.539  -160.266 1.00 30.08 ? 87  ASN C CA  1 
ATOM   2556 C C   . ASN C 1 87  ? -40.922 87.744  -158.969 1.00 29.09 ? 87  ASN C C   1 
ATOM   2557 O O   . ASN C 1 87  ? -42.042 88.258  -158.971 1.00 28.54 ? 87  ASN C O   1 
ATOM   2558 C CB  . ASN C 1 87  ? -40.371 86.114  -160.787 1.00 31.53 ? 87  ASN C CB  1 
ATOM   2559 C CG  . ASN C 1 87  ? -41.836 85.778  -160.967 1.00 33.70 ? 87  ASN C CG  1 
ATOM   2560 O OD1 . ASN C 1 87  ? -42.497 85.310  -160.040 1.00 36.34 ? 87  ASN C OD1 1 
ATOM   2561 N ND2 . ASN C 1 87  ? -42.351 86.011  -162.168 1.00 35.58 ? 87  ASN C ND2 1 
ATOM   2562 N N   . GLN C 1 88  ? -40.313 87.331  -157.863 1.00 28.89 ? 88  GLN C N   1 
ATOM   2563 C CA  . GLN C 1 88  ? -40.923 87.468  -156.549 1.00 31.61 ? 88  GLN C CA  1 
ATOM   2564 C C   . GLN C 1 88  ? -41.061 88.940  -156.171 1.00 29.25 ? 88  GLN C C   1 
ATOM   2565 O O   . GLN C 1 88  ? -42.050 89.345  -155.561 1.00 29.86 ? 88  GLN C O   1 
ATOM   2566 C CB  . GLN C 1 88  ? -40.097 86.722  -155.500 1.00 33.41 ? 88  GLN C CB  1 
ATOM   2567 C CG  . GLN C 1 88  ? -40.914 86.115  -154.373 1.00 37.96 ? 88  GLN C CG  1 
ATOM   2568 C CD  . GLN C 1 88  ? -40.055 85.364  -153.375 1.00 50.33 ? 88  GLN C CD  1 
ATOM   2569 O OE1 . GLN C 1 88  ? -38.852 85.197  -153.577 1.00 58.75 ? 88  GLN C OE1 1 
ATOM   2570 N NE2 . GLN C 1 88  ? -40.669 84.909  -152.287 1.00 50.98 ? 88  GLN C NE2 1 
ATOM   2571 N N   . ILE C 1 89  ? -40.062 89.736  -156.542 1.00 22.24 ? 89  ILE C N   1 
ATOM   2572 C CA  . ILE C 1 89  ? -40.084 91.168  -156.268 1.00 22.24 ? 89  ILE C CA  1 
ATOM   2573 C C   . ILE C 1 89  ? -41.123 91.854  -157.151 1.00 27.39 ? 89  ILE C C   1 
ATOM   2574 O O   . ILE C 1 89  ? -41.830 92.760  -156.707 1.00 28.61 ? 89  ILE C O   1 
ATOM   2575 C CB  . ILE C 1 89  ? -38.697 91.809  -156.491 1.00 21.09 ? 89  ILE C CB  1 
ATOM   2576 C CG1 . ILE C 1 89  ? -37.676 91.213  -155.521 1.00 19.40 ? 89  ILE C CG1 1 
ATOM   2577 C CG2 . ILE C 1 89  ? -38.758 93.318  -156.313 1.00 17.15 ? 89  ILE C CG2 1 
ATOM   2578 C CD1 . ILE C 1 89  ? -36.328 91.899  -155.550 1.00 19.24 ? 89  ILE C CD1 1 
ATOM   2579 N N   . ALA C 1 90  ? -41.221 91.404  -158.398 1.00 28.46 ? 90  ALA C N   1 
ATOM   2580 C CA  . ALA C 1 90  ? -42.220 91.927  -159.324 1.00 23.94 ? 90  ALA C CA  1 
ATOM   2581 C C   . ALA C 1 90  ? -43.630 91.617  -158.831 1.00 21.95 ? 90  ALA C C   1 
ATOM   2582 O O   . ALA C 1 90  ? -44.548 92.416  -159.012 1.00 17.71 ? 90  ALA C O   1 
ATOM   2583 C CB  . ALA C 1 90  ? -42.006 91.356  -160.720 1.00 18.60 ? 90  ALA C CB  1 
ATOM   2584 N N   . GLN C 1 91  ? -43.798 90.450  -158.215 1.00 19.35 ? 91  GLN C N   1 
ATOM   2585 C CA  . GLN C 1 91  ? -45.092 90.048  -157.677 1.00 24.99 ? 91  GLN C CA  1 
ATOM   2586 C C   . GLN C 1 91  ? -45.475 90.931  -156.498 1.00 23.47 ? 91  GLN C C   1 
ATOM   2587 O O   . GLN C 1 91  ? -46.638 91.298  -156.331 1.00 27.63 ? 91  GLN C O   1 
ATOM   2588 C CB  . GLN C 1 91  ? -45.064 88.578  -157.251 1.00 32.28 ? 91  GLN C CB  1 
ATOM   2589 C CG  . GLN C 1 91  ? -46.419 88.022  -156.853 1.00 33.38 ? 91  GLN C CG  1 
ATOM   2590 C CD  . GLN C 1 91  ? -47.358 87.886  -158.035 1.00 35.32 ? 91  GLN C CD  1 
ATOM   2591 O OE1 . GLN C 1 91  ? -48.444 88.466  -158.049 1.00 35.06 ? 91  GLN C OE1 1 
ATOM   2592 N NE2 . GLN C 1 91  ? -46.944 87.116  -159.034 1.00 36.81 ? 91  GLN C NE2 1 
ATOM   2593 N N   . LEU C 1 92  ? -44.482 91.257  -155.678 1.00 21.46 ? 92  LEU C N   1 
ATOM   2594 C CA  . LEU C 1 92  ? -44.655 92.191  -154.572 1.00 24.67 ? 92  LEU C CA  1 
ATOM   2595 C C   . LEU C 1 92  ? -45.204 93.525  -155.066 1.00 21.19 ? 92  LEU C C   1 
ATOM   2596 O O   . LEU C 1 92  ? -46.203 94.035  -154.552 1.00 18.94 ? 92  LEU C O   1 
ATOM   2597 C CB  . LEU C 1 92  ? -43.324 92.410  -153.847 1.00 30.25 ? 92  LEU C CB  1 
ATOM   2598 C CG  . LEU C 1 92  ? -43.236 91.962  -152.389 1.00 36.04 ? 92  LEU C CG  1 
ATOM   2599 C CD1 . LEU C 1 92  ? -43.767 90.546  -152.234 1.00 41.40 ? 92  LEU C CD1 1 
ATOM   2600 C CD2 . LEU C 1 92  ? -41.800 92.060  -151.901 1.00 32.98 ? 92  LEU C CD2 1 
ATOM   2601 N N   . LEU C 1 93  ? -44.539 94.077  -156.075 1.00 20.57 ? 93  LEU C N   1 
ATOM   2602 C CA  . LEU C 1 93  ? -44.914 95.363  -156.641 1.00 21.46 ? 93  LEU C CA  1 
ATOM   2603 C C   . LEU C 1 93  ? -46.270 95.328  -157.336 1.00 20.76 ? 93  LEU C C   1 
ATOM   2604 O O   . LEU C 1 93  ? -47.015 96.305  -157.290 1.00 16.65 ? 93  LEU C O   1 
ATOM   2605 C CB  . LEU C 1 93  ? -43.840 95.832  -157.621 1.00 20.16 ? 93  LEU C CB  1 
ATOM   2606 C CG  . LEU C 1 93  ? -42.480 96.082  -156.973 1.00 18.78 ? 93  LEU C CG  1 
ATOM   2607 C CD1 . LEU C 1 93  ? -41.423 96.454  -158.006 1.00 19.04 ? 93  LEU C CD1 1 
ATOM   2608 C CD2 . LEU C 1 93  ? -42.586 97.154  -155.892 1.00 14.89 ? 93  LEU C CD2 1 
ATOM   2609 N N   . ARG C 1 94  ? -46.590 94.209  -157.979 1.00 25.64 ? 94  ARG C N   1 
ATOM   2610 C CA  . ARG C 1 94  ? -47.850 94.101  -158.710 1.00 27.12 ? 94  ARG C CA  1 
ATOM   2611 C C   . ARG C 1 94  ? -49.044 94.068  -157.756 1.00 25.29 ? 94  ARG C C   1 
ATOM   2612 O O   . ARG C 1 94  ? -50.091 94.655  -158.038 1.00 24.21 ? 94  ARG C O   1 
ATOM   2613 C CB  . ARG C 1 94  ? -47.861 92.858  -159.605 1.00 29.21 ? 94  ARG C CB  1 
ATOM   2614 C CG  . ARG C 1 94  ? -48.791 92.988  -160.803 1.00 35.56 ? 94  ARG C CG  1 
ATOM   2615 C CD  . ARG C 1 94  ? -48.986 91.664  -161.518 1.00 40.37 ? 94  ARG C CD  1 
ATOM   2616 N NE  . ARG C 1 94  ? -49.909 90.797  -160.796 1.00 43.31 ? 94  ARG C NE  1 
ATOM   2617 C CZ  . ARG C 1 94  ? -49.726 89.493  -160.626 1.00 49.11 ? 94  ARG C CZ  1 
ATOM   2618 N NH1 . ARG C 1 94  ? -50.619 88.778  -159.954 1.00 49.91 ? 94  ARG C NH1 1 
ATOM   2619 N NH2 . ARG C 1 94  ? -48.648 88.904  -161.126 1.00 52.16 ? 94  ARG C NH2 1 
ATOM   2620 N N   . ASN C 1 95  ? -48.884 93.382  -156.628 1.00 18.49 ? 95  ASN C N   1 
ATOM   2621 C CA  . ASN C 1 95  ? -49.931 93.337  -155.613 1.00 21.17 ? 95  ASN C CA  1 
ATOM   2622 C C   . ASN C 1 95  ? -50.187 94.724  -155.036 1.00 24.35 ? 95  ASN C C   1 
ATOM   2623 O O   . ASN C 1 95  ? -51.329 95.108  -154.790 1.00 30.31 ? 95  ASN C O   1 
ATOM   2624 C CB  . ASN C 1 95  ? -49.562 92.362  -154.490 1.00 19.90 ? 95  ASN C CB  1 
ATOM   2625 C CG  . ASN C 1 95  ? -49.334 90.951  -154.994 1.00 28.37 ? 95  ASN C CG  1 
ATOM   2626 O OD1 . ASN C 1 95  ? -49.736 90.601  -156.107 1.00 31.96 ? 95  ASN C OD1 1 
ATOM   2627 N ND2 . ASN C 1 95  ? -48.693 90.127  -154.172 1.00 26.40 ? 95  ASN C ND2 1 
ATOM   2628 N N   . ALA C 1 96  ? -49.106 95.463  -154.816 1.00 17.50 ? 96  ALA C N   1 
ATOM   2629 C CA  . ALA C 1 96  ? -49.188 96.832  -154.329 1.00 17.42 ? 96  ALA C CA  1 
ATOM   2630 C C   . ALA C 1 96  ? -49.961 97.706  -155.313 1.00 21.11 ? 96  ALA C C   1 
ATOM   2631 O O   . ALA C 1 96  ? -50.766 98.553  -154.914 1.00 25.42 ? 96  ALA C O   1 
ATOM   2632 C CB  . ALA C 1 96  ? -47.800 97.389  -154.105 1.00 16.07 ? 96  ALA C CB  1 
ATOM   2633 N N   . GLY C 1 97  ? -49.705 97.491  -156.601 1.00 19.21 ? 97  GLY C N   1 
ATOM   2634 C CA  . GLY C 1 97  ? -50.379 98.216  -157.661 1.00 19.98 ? 97  GLY C CA  1 
ATOM   2635 C C   . GLY C 1 97  ? -51.853 97.879  -157.770 1.00 17.81 ? 97  GLY C C   1 
ATOM   2636 O O   . GLY C 1 97  ? -52.676 98.759  -158.027 1.00 18.15 ? 97  GLY C O   1 
ATOM   2637 N N   . ASP C 1 98  ? -52.188 96.605  -157.575 1.00 20.97 ? 98  ASP C N   1 
ATOM   2638 C CA  . ASP C 1 98  ? -53.582 96.168  -157.587 1.00 26.20 ? 98  ASP C CA  1 
ATOM   2639 C C   . ASP C 1 98  ? -54.410 96.949  -156.573 1.00 27.31 ? 98  ASP C C   1 
ATOM   2640 O O   . ASP C 1 98  ? -55.590 97.208  -156.793 1.00 26.88 ? 98  ASP C O   1 
ATOM   2641 C CB  . ASP C 1 98  ? -53.688 94.668  -157.295 1.00 32.09 ? 98  ASP C CB  1 
ATOM   2642 C CG  . ASP C 1 98  ? -53.277 93.809  -158.478 1.00 40.04 ? 98  ASP C CG  1 
ATOM   2643 O OD1 . ASP C 1 98  ? -53.197 94.339  -159.608 1.00 43.16 ? 98  ASP C OD1 1 
ATOM   2644 O OD2 . ASP C 1 98  ? -53.049 92.597  -158.276 1.00 42.23 ? 98  ASP C OD2 1 
ATOM   2645 N N   . ALA C 1 99  ? -53.779 97.330  -155.466 1.00 31.00 ? 99  ALA C N   1 
ATOM   2646 C CA  . ALA C 1 99  ? -54.464 98.050  -154.396 1.00 31.13 ? 99  ALA C CA  1 
ATOM   2647 C C   . ALA C 1 99  ? -54.884 99.459  -154.810 1.00 35.78 ? 99  ALA C C   1 
ATOM   2648 O O   . ALA C 1 99  ? -55.773 100.046 -154.196 1.00 41.70 ? 99  ALA C O   1 
ATOM   2649 C CB  . ALA C 1 99  ? -53.584 98.111  -153.164 1.00 26.89 ? 99  ALA C CB  1 
ATOM   2650 N N   . THR C 1 100 ? -54.252 100.002 -155.848 1.00 32.27 ? 100 THR C N   1 
ATOM   2651 C CA  . THR C 1 100 ? -54.599 101.344 -156.314 1.00 30.37 ? 100 THR C CA  1 
ATOM   2652 C C   . THR C 1 100 ? -55.973 101.358 -156.962 1.00 35.08 ? 100 THR C C   1 
ATOM   2653 O O   . THR C 1 100 ? -56.607 102.408 -157.060 1.00 43.19 ? 100 THR C O   1 
ATOM   2654 C CB  . THR C 1 100 ? -53.576 101.902 -157.324 1.00 25.48 ? 100 THR C CB  1 
ATOM   2655 O OG1 . THR C 1 100 ? -53.791 101.308 -158.610 1.00 22.69 ? 100 THR C OG1 1 
ATOM   2656 C CG2 . THR C 1 100 ? -52.158 101.634 -156.856 1.00 26.89 ? 100 THR C CG2 1 
ATOM   2657 N N   . LYS C 1 101 ? -56.423 100.190 -157.409 1.00 31.02 ? 101 LYS C N   1 
ATOM   2658 C CA  . LYS C 1 101 ? -57.703 100.078 -158.099 1.00 33.08 ? 101 LYS C CA  1 
ATOM   2659 C C   . LYS C 1 101 ? -58.873 100.510 -157.220 1.00 33.76 ? 101 LYS C C   1 
ATOM   2660 O O   . LYS C 1 101 ? -59.750 101.245 -157.669 1.00 35.33 ? 101 LYS C O   1 
ATOM   2661 C CB  . LYS C 1 101 ? -57.933 98.646  -158.593 1.00 33.87 ? 101 LYS C CB  1 
ATOM   2662 C CG  . LYS C 1 101 ? -59.195 98.504  -159.426 1.00 37.39 ? 101 LYS C CG  1 
ATOM   2663 C CD  . LYS C 1 101 ? -59.779 97.105  -159.343 1.00 44.32 ? 101 LYS C CD  1 
ATOM   2664 C CE  . LYS C 1 101 ? -61.090 97.021  -160.113 1.00 54.73 ? 101 LYS C CE  1 
ATOM   2665 N NZ  . LYS C 1 101 ? -61.744 95.685  -160.000 1.00 60.00 ? 101 LYS C NZ  1 
ATOM   2666 N N   . ASP C 1 102 ? -58.882 100.054 -155.971 1.00 34.95 ? 102 ASP C N   1 
ATOM   2667 C CA  . ASP C 1 102 ? -59.921 100.451 -155.023 1.00 38.90 ? 102 ASP C CA  1 
ATOM   2668 C C   . ASP C 1 102 ? -59.468 101.587 -154.104 1.00 39.05 ? 102 ASP C C   1 
ATOM   2669 O O   . ASP C 1 102 ? -60.146 101.913 -153.127 1.00 42.06 ? 102 ASP C O   1 
ATOM   2670 C CB  . ASP C 1 102 ? -60.367 99.253  -154.183 1.00 41.03 ? 102 ASP C CB  1 
ATOM   2671 C CG  . ASP C 1 102 ? -61.426 98.420  -154.876 1.00 44.36 ? 102 ASP C CG  1 
ATOM   2672 O OD1 . ASP C 1 102 ? -62.605 98.822  -154.837 1.00 48.76 ? 102 ASP C OD1 1 
ATOM   2673 O OD2 . ASP C 1 102 ? -61.082 97.369  -155.457 1.00 45.06 ? 102 ASP C OD2 1 
ATOM   2674 N N   . GLY C 1 103 ? -58.322 102.185 -154.419 1.00 35.79 ? 103 GLY C N   1 
ATOM   2675 C CA  . GLY C 1 103 ? -57.826 103.331 -153.676 1.00 32.27 ? 103 GLY C CA  1 
ATOM   2676 C C   . GLY C 1 103 ? -57.405 103.028 -152.252 1.00 29.11 ? 103 GLY C C   1 
ATOM   2677 O O   . GLY C 1 103 ? -57.652 103.820 -151.342 1.00 27.21 ? 103 GLY C O   1 
ATOM   2678 N N   . PHE C 1 104 ? -56.756 101.884 -152.058 1.00 22.78 ? 104 PHE C N   1 
ATOM   2679 C CA  . PHE C 1 104 ? -56.348 101.456 -150.725 1.00 29.05 ? 104 PHE C CA  1 
ATOM   2680 C C   . PHE C 1 104 ? -54.851 101.653 -150.463 1.00 26.77 ? 104 PHE C C   1 
ATOM   2681 O O   . PHE C 1 104 ? -54.360 101.358 -149.371 1.00 25.19 ? 104 PHE C O   1 
ATOM   2682 C CB  . PHE C 1 104 ? -56.717 99.987  -150.513 1.00 28.78 ? 104 PHE C CB  1 
ATOM   2683 C CG  . PHE C 1 104 ? -58.199 99.722  -150.495 1.00 28.84 ? 104 PHE C CG  1 
ATOM   2684 C CD1 . PHE C 1 104 ? -59.109 100.742 -150.247 1.00 31.83 ? 104 PHE C CD1 1 
ATOM   2685 C CD2 . PHE C 1 104 ? -58.680 98.442  -150.716 1.00 27.74 ? 104 PHE C CD2 1 
ATOM   2686 C CE1 . PHE C 1 104 ? -60.473 100.485 -150.227 1.00 35.52 ? 104 PHE C CE1 1 
ATOM   2687 C CE2 . PHE C 1 104 ? -60.038 98.179  -150.698 1.00 32.02 ? 104 PHE C CE2 1 
ATOM   2688 C CZ  . PHE C 1 104 ? -60.935 99.201  -150.452 1.00 35.91 ? 104 PHE C CZ  1 
ATOM   2689 N N   . LEU C 1 105 ? -54.128 102.149 -151.461 1.00 24.63 ? 105 LEU C N   1 
ATOM   2690 C CA  . LEU C 1 105 ? -52.683 102.315 -151.336 1.00 26.07 ? 105 LEU C CA  1 
ATOM   2691 C C   . LEU C 1 105 ? -52.289 103.781 -151.223 1.00 23.77 ? 105 LEU C C   1 
ATOM   2692 O O   . LEU C 1 105 ? -52.455 104.553 -152.166 1.00 24.76 ? 105 LEU C O   1 
ATOM   2693 C CB  . LEU C 1 105 ? -51.961 101.680 -152.529 1.00 28.96 ? 105 LEU C CB  1 
ATOM   2694 C CG  . LEU C 1 105 ? -50.474 102.026 -152.644 1.00 32.39 ? 105 LEU C CG  1 
ATOM   2695 C CD1 . LEU C 1 105 ? -49.696 101.421 -151.488 1.00 31.24 ? 105 LEU C CD1 1 
ATOM   2696 C CD2 . LEU C 1 105 ? -49.902 101.579 -153.981 1.00 35.36 ? 105 LEU C CD2 1 
ATOM   2697 N N   . LYS C 1 106 ? -51.756 104.160 -150.068 1.00 24.56 ? 106 LYS C N   1 
ATOM   2698 C CA  . LYS C 1 106 ? -51.300 105.525 -149.868 1.00 29.05 ? 106 LYS C CA  1 
ATOM   2699 C C   . LYS C 1 106 ? -49.874 105.697 -150.383 1.00 25.43 ? 106 LYS C C   1 
ATOM   2700 O O   . LYS C 1 106 ? -49.568 106.658 -151.090 1.00 27.90 ? 106 LYS C O   1 
ATOM   2701 C CB  . LYS C 1 106 ? -51.384 105.904 -148.388 1.00 32.73 ? 106 LYS C CB  1 
ATOM   2702 C CG  . LYS C 1 106 ? -51.178 107.384 -148.130 1.00 34.89 ? 106 LYS C CG  1 
ATOM   2703 C CD  . LYS C 1 106 ? -52.346 107.976 -147.354 1.00 37.32 ? 106 LYS C CD  1 
ATOM   2704 C CE  . LYS C 1 106 ? -52.088 107.948 -145.863 1.00 39.13 ? 106 LYS C CE  1 
ATOM   2705 N NZ  . LYS C 1 106 ? -50.871 108.733 -145.521 1.00 41.16 ? 106 LYS C NZ  1 
ATOM   2706 N N   . GLU C 1 107 ? -49.010 104.753 -150.032 1.00 24.36 ? 107 GLU C N   1 
ATOM   2707 C CA  . GLU C 1 107 ? -47.601 104.838 -150.392 1.00 24.24 ? 107 GLU C CA  1 
ATOM   2708 C C   . GLU C 1 107 ? -46.945 103.463 -150.451 1.00 24.31 ? 107 GLU C C   1 
ATOM   2709 O O   . GLU C 1 107 ? -47.247 102.594 -149.639 1.00 15.86 ? 107 GLU C O   1 
ATOM   2710 C CB  . GLU C 1 107 ? -46.854 105.731 -149.393 1.00 24.68 ? 107 GLU C CB  1 
ATOM   2711 C CG  . GLU C 1 107 ? -45.345 105.743 -149.573 1.00 25.27 ? 107 GLU C CG  1 
ATOM   2712 C CD  . GLU C 1 107 ? -44.641 106.648 -148.587 1.00 25.16 ? 107 GLU C CD  1 
ATOM   2713 O OE1 . GLU C 1 107 ? -45.323 107.466 -147.934 1.00 27.54 ? 107 GLU C OE1 1 
ATOM   2714 O OE2 . GLU C 1 107 ? -43.402 106.538 -148.464 1.00 15.17 ? 107 GLU C OE2 1 
ATOM   2715 N N   . VAL C 1 108 ? -46.067 103.277 -151.433 1.00 21.03 ? 108 VAL C N   1 
ATOM   2716 C CA  . VAL C 1 108 ? -45.177 102.123 -151.490 1.00 22.67 ? 108 VAL C CA  1 
ATOM   2717 C C   . VAL C 1 108 ? -43.759 102.649 -151.686 1.00 26.38 ? 108 VAL C C   1 
ATOM   2718 O O   . VAL C 1 108 ? -43.531 103.533 -152.516 1.00 25.93 ? 108 VAL C O   1 
ATOM   2719 C CB  . VAL C 1 108 ? -45.565 101.140 -152.622 1.00 25.20 ? 108 VAL C CB  1 
ATOM   2720 C CG1 . VAL C 1 108 ? -45.438 101.794 -153.993 1.00 24.85 ? 108 VAL C CG1 1 
ATOM   2721 C CG2 . VAL C 1 108 ? -44.708 99.892  -152.554 1.00 28.55 ? 108 VAL C CG2 1 
ATOM   2722 N N   . SER C 1 109 ? -42.810 102.130 -150.912 1.00 25.41 ? 109 SER C N   1 
ATOM   2723 C CA  . SER C 1 109 ? -41.457 102.670 -150.941 1.00 21.83 ? 109 SER C CA  1 
ATOM   2724 C C   . SER C 1 109 ? -40.369 101.623 -150.734 1.00 22.28 ? 109 SER C C   1 
ATOM   2725 O O   . SER C 1 109 ? -40.481 100.749 -149.874 1.00 19.03 ? 109 SER C O   1 
ATOM   2726 C CB  . SER C 1 109 ? -41.306 103.762 -149.879 1.00 23.80 ? 109 SER C CB  1 
ATOM   2727 O OG  . SER C 1 109 ? -42.256 104.794 -150.070 1.00 26.73 ? 109 SER C OG  1 
ATOM   2728 N N   . LEU C 1 110 ? -39.315 101.728 -151.538 1.00 25.77 ? 110 LEU C N   1 
ATOM   2729 C CA  . LEU C 1 110 ? -38.098 100.960 -151.324 1.00 25.91 ? 110 LEU C CA  1 
ATOM   2730 C C   . LEU C 1 110 ? -37.285 101.636 -150.230 1.00 21.77 ? 110 LEU C C   1 
ATOM   2731 O O   . LEU C 1 110 ? -36.869 102.784 -150.380 1.00 15.38 ? 110 LEU C O   1 
ATOM   2732 C CB  . LEU C 1 110 ? -37.281 100.851 -152.611 1.00 26.40 ? 110 LEU C CB  1 
ATOM   2733 C CG  . LEU C 1 110 ? -35.926 100.153 -152.486 1.00 32.41 ? 110 LEU C CG  1 
ATOM   2734 C CD1 . LEU C 1 110 ? -36.113 98.694  -152.100 1.00 35.09 ? 110 LEU C CD1 1 
ATOM   2735 C CD2 . LEU C 1 110 ? -35.136 100.277 -153.781 1.00 33.06 ? 110 LEU C CD2 1 
ATOM   2736 N N   . VAL C 1 111 ? -37.064 100.923 -149.131 1.00 25.50 ? 111 VAL C N   1 
ATOM   2737 C CA  . VAL C 1 111 ? -36.438 101.514 -147.952 1.00 22.11 ? 111 VAL C CA  1 
ATOM   2738 C C   . VAL C 1 111 ? -35.071 100.902 -147.657 1.00 20.51 ? 111 VAL C C   1 
ATOM   2739 O O   . VAL C 1 111 ? -34.963 99.706  -147.381 1.00 24.36 ? 111 VAL C O   1 
ATOM   2740 C CB  . VAL C 1 111 ? -37.345 101.355 -146.714 1.00 19.08 ? 111 VAL C CB  1 
ATOM   2741 C CG1 . VAL C 1 111 ? -36.681 101.954 -145.488 1.00 17.05 ? 111 VAL C CG1 1 
ATOM   2742 C CG2 . VAL C 1 111 ? -38.704 102.004 -146.966 1.00 15.76 ? 111 VAL C CG2 1 
ATOM   2743 N N   . ILE C 1 112 ? -34.030 101.729 -147.712 1.00 16.83 ? 112 ILE C N   1 
ATOM   2744 C CA  . ILE C 1 112 ? -32.669 101.266 -147.460 1.00 18.84 ? 112 ILE C CA  1 
ATOM   2745 C C   . ILE C 1 112 ? -32.208 101.635 -146.052 1.00 21.80 ? 112 ILE C C   1 
ATOM   2746 O O   . ILE C 1 112 ? -32.254 102.807 -145.670 1.00 19.76 ? 112 ILE C O   1 
ATOM   2747 C CB  . ILE C 1 112 ? -31.663 101.862 -148.467 1.00 23.20 ? 112 ILE C CB  1 
ATOM   2748 C CG1 . ILE C 1 112 ? -31.931 101.351 -149.885 1.00 33.58 ? 112 ILE C CG1 1 
ATOM   2749 C CG2 . ILE C 1 112 ? -30.240 101.546 -148.032 1.00 23.18 ? 112 ILE C CG2 1 
ATOM   2750 C CD1 . ILE C 1 112 ? -31.165 102.083 -150.950 1.00 45.45 ? 112 ILE C CD1 1 
ATOM   2751 N N   . THR C 1 113 ? -31.761 100.639 -145.288 1.00 19.79 ? 113 THR C N   1 
ATOM   2752 C CA  . THR C 1 113 ? -31.248 100.875 -143.940 1.00 23.73 ? 113 THR C CA  1 
ATOM   2753 C C   . THR C 1 113 ? -29.863 100.249 -143.764 1.00 29.88 ? 113 THR C C   1 
ATOM   2754 O O   . THR C 1 113 ? -29.409 99.483  -144.614 1.00 22.39 ? 113 THR C O   1 
ATOM   2755 C CB  . THR C 1 113 ? -32.207 100.319 -142.857 1.00 23.27 ? 113 THR C CB  1 
ATOM   2756 O OG1 . THR C 1 113 ? -32.269 98.892  -142.949 1.00 21.74 ? 113 THR C OG1 1 
ATOM   2757 C CG2 . THR C 1 113 ? -33.604 100.890 -143.029 1.00 27.05 ? 113 THR C CG2 1 
ATOM   2758 N N   . ASN C 1 114 ? -29.189 100.594 -142.668 1.00 33.25 ? 114 ASN C N   1 
ATOM   2759 C CA  . ASN C 1 114 ? -27.923 99.956  -142.308 1.00 36.84 ? 114 ASN C CA  1 
ATOM   2760 C C   . ASN C 1 114 ? -28.147 98.502  -141.931 1.00 35.02 ? 114 ASN C C   1 
ATOM   2761 O O   . ASN C 1 114 ? -27.505 97.593  -142.463 1.00 33.90 ? 114 ASN C O   1 
ATOM   2762 C CB  . ASN C 1 114 ? -27.248 100.679 -141.137 1.00 44.41 ? 114 ASN C CB  1 
ATOM   2763 C CG  . ASN C 1 114 ? -26.532 101.948 -141.559 1.00 50.45 ? 114 ASN C CG  1 
ATOM   2764 O OD1 . ASN C 1 114 ? -25.561 101.906 -142.318 1.00 52.39 ? 114 ASN C OD1 1 
ATOM   2765 N ND2 . ASN C 1 114 ? -27.003 103.085 -141.061 1.00 51.56 ? 114 ASN C ND2 1 
ATOM   2766 N N   . ASN C 1 115 ? -29.068 98.305  -140.995 1.00 35.59 ? 115 ASN C N   1 
ATOM   2767 C CA  . ASN C 1 115 ? -29.386 96.989  -140.466 1.00 35.08 ? 115 ASN C CA  1 
ATOM   2768 C C   . ASN C 1 115 ? -30.842 96.641  -140.713 1.00 32.44 ? 115 ASN C C   1 
ATOM   2769 O O   . ASN C 1 115 ? -31.688 97.531  -140.837 1.00 37.20 ? 115 ASN C O   1 
ATOM   2770 C CB  . ASN C 1 115 ? -29.076 96.930  -138.970 1.00 36.00 ? 115 ASN C CB  1 
ATOM   2771 C CG  . ASN C 1 115 ? -27.589 96.938  -138.686 1.00 40.93 ? 115 ASN C CG  1 
ATOM   2772 O OD1 . ASN C 1 115 ? -26.849 96.080  -139.168 1.00 45.20 ? 115 ASN C OD1 1 
ATOM   2773 N ND2 . ASN C 1 115 ? -27.140 97.916  -137.910 1.00 42.48 ? 115 ASN C ND2 1 
ATOM   2774 N N   . GLU C 1 116 ? -31.126 95.344  -140.787 1.00 29.68 ? 116 GLU C N   1 
ATOM   2775 C CA  . GLU C 1 116 ? -32.492 94.865  -140.957 1.00 31.92 ? 116 GLU C CA  1 
ATOM   2776 C C   . GLU C 1 116 ? -33.368 95.332  -139.804 1.00 33.84 ? 116 GLU C C   1 
ATOM   2777 O O   . GLU C 1 116 ? -32.974 95.239  -138.640 1.00 41.29 ? 116 GLU C O   1 
ATOM   2778 C CB  . GLU C 1 116 ? -32.527 93.337  -141.054 1.00 40.13 ? 116 GLU C CB  1 
ATOM   2779 C CG  . GLU C 1 116 ? -33.932 92.754  -141.137 1.00 47.56 ? 116 GLU C CG  1 
ATOM   2780 C CD  . GLU C 1 116 ? -33.946 91.262  -141.406 1.00 53.54 ? 116 GLU C CD  1 
ATOM   2781 O OE1 . GLU C 1 116 ? -32.999 90.564  -140.988 1.00 57.60 ? 116 GLU C OE1 1 
ATOM   2782 O OE2 . GLU C 1 116 ? -34.909 90.792  -142.047 1.00 53.02 ? 116 GLU C OE2 1 
ATOM   2783 N N   . GLY C 1 117 ? -34.544 95.856  -140.131 1.00 24.39 ? 117 GLY C N   1 
ATOM   2784 C CA  . GLY C 1 117 ? -35.522 96.216  -139.121 1.00 24.64 ? 117 GLY C CA  1 
ATOM   2785 C C   . GLY C 1 117 ? -35.394 97.614  -138.542 1.00 31.24 ? 117 GLY C C   1 
ATOM   2786 O O   . GLY C 1 117 ? -36.190 97.999  -137.681 1.00 36.51 ? 117 GLY C O   1 
ATOM   2787 N N   . ASP C 1 118 ? -34.404 98.377  -139.000 1.00 25.26 ? 118 ASP C N   1 
ATOM   2788 C CA  . ASP C 1 118 ? -34.226 99.745  -138.521 1.00 24.55 ? 118 ASP C CA  1 
ATOM   2789 C C   . ASP C 1 118 ? -35.371 100.642 -138.979 1.00 24.72 ? 118 ASP C C   1 
ATOM   2790 O O   . ASP C 1 118 ? -35.832 100.538 -140.117 1.00 21.70 ? 118 ASP C O   1 
ATOM   2791 C CB  . ASP C 1 118 ? -32.890 100.323 -138.999 1.00 24.08 ? 118 ASP C CB  1 
ATOM   2792 C CG  . ASP C 1 118 ? -31.697 99.630  -138.377 1.00 32.81 ? 118 ASP C CG  1 
ATOM   2793 O OD1 . ASP C 1 118 ? -31.892 98.861  -137.412 1.00 35.40 ? 118 ASP C OD1 1 
ATOM   2794 O OD2 . ASP C 1 118 ? -30.564 99.865  -138.848 1.00 30.86 ? 118 ASP C OD2 1 
ATOM   2795 N N   . LEU C 1 119 ? -35.824 101.523 -138.090 1.00 23.33 ? 119 LEU C N   1 
ATOM   2796 C CA  . LEU C 1 119 ? -36.895 102.458 -138.418 1.00 22.53 ? 119 LEU C CA  1 
ATOM   2797 C C   . LEU C 1 119 ? -36.401 103.574 -139.331 1.00 21.66 ? 119 LEU C C   1 
ATOM   2798 O O   . LEU C 1 119 ? -37.036 103.898 -140.336 1.00 20.58 ? 119 LEU C O   1 
ATOM   2799 C CB  . LEU C 1 119 ? -37.497 103.060 -137.147 1.00 29.16 ? 119 LEU C CB  1 
ATOM   2800 C CG  . LEU C 1 119 ? -38.307 102.131 -136.241 1.00 38.46 ? 119 LEU C CG  1 
ATOM   2801 C CD1 . LEU C 1 119 ? -39.061 102.934 -135.187 1.00 42.79 ? 119 LEU C CD1 1 
ATOM   2802 C CD2 . LEU C 1 119 ? -39.262 101.269 -137.057 1.00 39.30 ? 119 LEU C CD2 1 
ATOM   2803 N N   . GLU C 1 120 ? -35.261 104.156 -138.973 1.00 24.24 ? 120 GLU C N   1 
ATOM   2804 C CA  . GLU C 1 120 ? -34.717 105.296 -139.701 1.00 26.22 ? 120 GLU C CA  1 
ATOM   2805 C C   . GLU C 1 120 ? -33.893 104.867 -140.910 1.00 26.23 ? 120 GLU C C   1 
ATOM   2806 O O   . GLU C 1 120 ? -32.882 104.170 -140.777 1.00 21.71 ? 120 GLU C O   1 
ATOM   2807 C CB  . GLU C 1 120 ? -33.861 106.157 -138.776 1.00 34.06 ? 120 GLU C CB  1 
ATOM   2808 C CG  . GLU C 1 120 ? -33.274 107.384 -139.446 1.00 37.07 ? 120 GLU C CG  1 
ATOM   2809 C CD  . GLU C 1 120 ? -32.313 108.122 -138.542 1.00 41.06 ? 120 GLU C CD  1 
ATOM   2810 O OE1 . GLU C 1 120 ? -31.109 107.792 -138.567 1.00 40.70 ? 120 GLU C OE1 1 
ATOM   2811 O OE2 . GLU C 1 120 ? -32.763 109.022 -137.803 1.00 44.85 ? 120 GLU C OE2 1 
ATOM   2812 N N   . ALA C 1 121 ? -34.319 105.307 -142.088 1.00 25.79 ? 121 ALA C N   1 
ATOM   2813 C CA  . ALA C 1 121 ? -33.688 104.878 -143.326 1.00 25.54 ? 121 ALA C CA  1 
ATOM   2814 C C   . ALA C 1 121 ? -32.472 105.727 -143.708 1.00 27.02 ? 121 ALA C C   1 
ATOM   2815 O O   . ALA C 1 121 ? -32.365 106.891 -143.325 1.00 23.78 ? 121 ALA C O   1 
ATOM   2816 C CB  . ALA C 1 121 ? -34.706 104.890 -144.446 1.00 21.05 ? 121 ALA C CB  1 
ATOM   2817 N N   . ILE C 1 122 ? -31.559 105.108 -144.455 1.00 28.54 ? 122 ILE C N   1 
ATOM   2818 C CA  . ILE C 1 122 ? -30.429 105.779 -145.093 1.00 27.79 ? 122 ILE C CA  1 
ATOM   2819 C C   . ILE C 1 122 ? -30.914 106.489 -146.352 1.00 22.43 ? 122 ILE C C   1 
ATOM   2820 O O   . ILE C 1 122 ? -30.563 107.643 -146.623 1.00 23.79 ? 122 ILE C O   1 
ATOM   2821 C CB  . ILE C 1 122 ? -29.302 104.769 -145.471 1.00 36.88 ? 122 ILE C CB  1 
ATOM   2822 C CG1 . ILE C 1 122 ? -28.494 104.354 -144.230 1.00 38.75 ? 122 ILE C CG1 1 
ATOM   2823 C CG2 . ILE C 1 122 ? -28.403 105.352 -146.562 1.00 40.90 ? 122 ILE C CG2 1 
ATOM   2824 C CD1 . ILE C 1 122 ? -27.533 103.187 -144.462 1.00 40.98 ? 122 ILE C CD1 1 
ATOM   2825 N N   . GLU C 1 123 ? -31.740 105.778 -147.106 1.00 19.79 ? 123 GLU C N   1 
ATOM   2826 C CA  . GLU C 1 123 ? -32.159 106.218 -148.418 1.00 19.00 ? 123 GLU C CA  1 
ATOM   2827 C C   . GLU C 1 123 ? -33.506 105.608 -148.735 1.00 16.16 ? 123 GLU C C   1 
ATOM   2828 O O   . GLU C 1 123 ? -33.748 104.432 -148.455 1.00 16.68 ? 123 GLU C O   1 
ATOM   2829 C CB  . GLU C 1 123 ? -31.123 105.827 -149.469 1.00 21.72 ? 123 GLU C CB  1 
ATOM   2830 C CG  . GLU C 1 123 ? -31.462 106.288 -150.866 1.00 23.06 ? 123 GLU C CG  1 
ATOM   2831 C CD  . GLU C 1 123 ? -30.318 106.080 -151.826 1.00 26.23 ? 123 GLU C CD  1 
ATOM   2832 O OE1 . GLU C 1 123 ? -29.442 106.967 -151.905 1.00 31.72 ? 123 GLU C OE1 1 
ATOM   2833 O OE2 . GLU C 1 123 ? -30.291 105.027 -152.496 1.00 25.79 ? 123 GLU C OE2 1 
ATOM   2834 N N   . VAL C 1 124 ? -34.380 106.423 -149.314 1.00 15.48 ? 124 VAL C N   1 
ATOM   2835 C CA  . VAL C 1 124 ? -35.742 106.019 -149.622 1.00 14.83 ? 124 VAL C CA  1 
ATOM   2836 C C   . VAL C 1 124 ? -36.142 106.446 -151.030 1.00 22.30 ? 124 VAL C C   1 
ATOM   2837 O O   . VAL C 1 124 ? -35.863 107.569 -151.464 1.00 22.88 ? 124 VAL C O   1 
ATOM   2838 C CB  . VAL C 1 124 ? -36.740 106.612 -148.602 1.00 18.08 ? 124 VAL C CB  1 
ATOM   2839 C CG1 . VAL C 1 124 ? -38.161 106.575 -149.138 1.00 22.61 ? 124 VAL C CG1 1 
ATOM   2840 C CG2 . VAL C 1 124 ? -36.651 105.868 -147.285 1.00 15.71 ? 124 VAL C CG2 1 
ATOM   2841 N N   . PHE C 1 125 ? -36.775 105.525 -151.746 1.00 18.55 ? 125 PHE C N   1 
ATOM   2842 C CA  . PHE C 1 125 ? -37.447 105.854 -152.989 1.00 18.20 ? 125 PHE C CA  1 
ATOM   2843 C C   . PHE C 1 125 ? -38.950 105.659 -152.806 1.00 13.53 ? 125 PHE C C   1 
ATOM   2844 O O   . PHE C 1 125 ? -39.436 104.528 -152.718 1.00 13.00 ? 125 PHE C O   1 
ATOM   2845 C CB  . PHE C 1 125 ? -36.916 104.995 -154.134 1.00 19.68 ? 125 PHE C CB  1 
ATOM   2846 C CG  . PHE C 1 125 ? -35.495 105.296 -154.505 1.00 15.97 ? 125 PHE C CG  1 
ATOM   2847 C CD1 . PHE C 1 125 ? -34.444 104.756 -153.779 1.00 16.14 ? 125 PHE C CD1 1 
ATOM   2848 C CD2 . PHE C 1 125 ? -35.208 106.119 -155.582 1.00 17.15 ? 125 PHE C CD2 1 
ATOM   2849 C CE1 . PHE C 1 125 ? -33.129 105.033 -154.122 1.00 16.21 ? 125 PHE C CE1 1 
ATOM   2850 C CE2 . PHE C 1 125 ? -33.896 106.401 -155.929 1.00 15.52 ? 125 PHE C CE2 1 
ATOM   2851 C CZ  . PHE C 1 125 ? -32.857 105.856 -155.198 1.00 15.44 ? 125 PHE C CZ  1 
ATOM   2852 N N   . SER C 1 126 ? -39.683 106.768 -152.751 1.00 13.10 ? 126 SER C N   1 
ATOM   2853 C CA  . SER C 1 126 ? -41.095 106.729 -152.385 1.00 21.86 ? 126 SER C CA  1 
ATOM   2854 C C   . SER C 1 126 ? -42.048 107.063 -153.528 1.00 22.39 ? 126 SER C C   1 
ATOM   2855 O O   . SER C 1 126 ? -41.824 108.005 -154.291 1.00 18.89 ? 126 SER C O   1 
ATOM   2856 C CB  . SER C 1 126 ? -41.358 107.692 -151.224 1.00 21.86 ? 126 SER C CB  1 
ATOM   2857 O OG  . SER C 1 126 ? -41.294 109.040 -151.659 1.00 23.14 ? 126 SER C OG  1 
ATOM   2858 N N   . MET C 1 127 ? -43.117 106.281 -153.636 1.00 22.04 ? 127 MET C N   1 
ATOM   2859 C CA  . MET C 1 127 ? -44.215 106.615 -154.531 1.00 19.12 ? 127 MET C CA  1 
ATOM   2860 C C   . MET C 1 127 ? -45.465 106.846 -153.691 1.00 20.76 ? 127 MET C C   1 
ATOM   2861 O O   . MET C 1 127 ? -45.904 105.953 -152.964 1.00 18.87 ? 127 MET C O   1 
ATOM   2862 C CB  . MET C 1 127 ? -44.445 105.511 -155.568 1.00 19.70 ? 127 MET C CB  1 
ATOM   2863 C CG  . MET C 1 127 ? -43.292 105.320 -156.548 1.00 20.11 ? 127 MET C CG  1 
ATOM   2864 S SD  . MET C 1 127 ? -43.708 104.266 -157.958 1.00 27.19 ? 127 MET C SD  1 
ATOM   2865 C CE  . MET C 1 127 ? -45.080 105.175 -158.667 1.00 12.89 ? 127 MET C CE  1 
ATOM   2866 N N   . LYS C 1 128 ? -46.023 108.050 -153.773 1.00 26.87 ? 128 LYS C N   1 
ATOM   2867 C CA  . LYS C 1 128 ? -47.196 108.395 -152.977 1.00 26.87 ? 128 LYS C CA  1 
ATOM   2868 C C   . LYS C 1 128 ? -48.401 108.662 -153.869 1.00 27.16 ? 128 LYS C C   1 
ATOM   2869 O O   . LYS C 1 128 ? -48.307 109.384 -154.862 1.00 30.54 ? 128 LYS C O   1 
ATOM   2870 C CB  . LYS C 1 128 ? -46.901 109.604 -152.092 1.00 23.27 ? 128 LYS C CB  1 
ATOM   2871 C CG  . LYS C 1 128 ? -45.748 109.377 -151.129 1.00 17.80 ? 128 LYS C CG  1 
ATOM   2872 C CD  . LYS C 1 128 ? -45.517 110.589 -150.241 1.00 20.13 ? 128 LYS C CD  1 
ATOM   2873 C CE  . LYS C 1 128 ? -44.286 110.412 -149.366 1.00 22.56 ? 128 LYS C CE  1 
ATOM   2874 N NZ  . LYS C 1 128 ? -44.097 111.566 -148.442 1.00 26.65 ? 128 LYS C NZ  1 
ATOM   2875 N N   . PHE C 1 129 ? -49.538 108.086 -153.497 1.00 20.12 ? 129 PHE C N   1 
ATOM   2876 C CA  . PHE C 1 129 ? -50.682 108.030 -154.391 1.00 19.87 ? 129 PHE C CA  1 
ATOM   2877 C C   . PHE C 1 129 ? -51.887 108.806 -153.870 1.00 23.19 ? 129 PHE C C   1 
ATOM   2878 O O   . PHE C 1 129 ? -52.144 108.849 -152.665 1.00 28.07 ? 129 PHE C O   1 
ATOM   2879 C CB  . PHE C 1 129 ? -51.073 106.570 -154.638 1.00 22.25 ? 129 PHE C CB  1 
ATOM   2880 C CG  . PHE C 1 129 ? -49.966 105.733 -155.218 1.00 23.11 ? 129 PHE C CG  1 
ATOM   2881 C CD1 . PHE C 1 129 ? -48.928 105.270 -154.420 1.00 23.70 ? 129 PHE C CD1 1 
ATOM   2882 C CD2 . PHE C 1 129 ? -49.969 105.399 -156.559 1.00 25.91 ? 129 PHE C CD2 1 
ATOM   2883 C CE1 . PHE C 1 129 ? -47.911 104.501 -154.955 1.00 27.01 ? 129 PHE C CE1 1 
ATOM   2884 C CE2 . PHE C 1 129 ? -48.956 104.627 -157.094 1.00 28.07 ? 129 PHE C CE2 1 
ATOM   2885 C CZ  . PHE C 1 129 ? -47.928 104.181 -156.292 1.00 28.35 ? 129 PHE C CZ  1 
ATOM   2886 N N   . ILE C 1 130 ? -52.616 109.420 -154.795 1.00 22.77 ? 130 ILE C N   1 
ATOM   2887 C CA  . ILE C 1 130 ? -53.864 110.094 -154.476 1.00 22.48 ? 130 ILE C CA  1 
ATOM   2888 C C   . ILE C 1 130 ? -54.938 109.512 -155.389 1.00 22.55 ? 130 ILE C C   1 
ATOM   2889 O O   . ILE C 1 130 ? -54.631 109.020 -156.478 1.00 20.63 ? 130 ILE C O   1 
ATOM   2890 C CB  . ILE C 1 130 ? -53.744 111.627 -154.644 1.00 28.16 ? 130 ILE C CB  1 
ATOM   2891 C CG1 . ILE C 1 130 ? -54.224 112.339 -153.384 1.00 32.92 ? 130 ILE C CG1 1 
ATOM   2892 C CG2 . ILE C 1 130 ? -54.496 112.124 -155.869 1.00 30.50 ? 130 ILE C CG2 1 
ATOM   2893 C CD1 . ILE C 1 130 ? -53.380 112.040 -152.175 1.00 28.79 ? 130 ILE C CD1 1 
ATOM   2894 N N   . TYR C 1 131 ? -56.189 109.540 -154.943 1.00 25.29 ? 131 TYR C N   1 
ATOM   2895 C CA  . TYR C 1 131 ? -57.267 108.935 -155.715 1.00 29.42 ? 131 TYR C CA  1 
ATOM   2896 C C   . TYR C 1 131 ? -58.377 109.936 -156.011 1.00 35.53 ? 131 TYR C C   1 
ATOM   2897 O O   . TYR C 1 131 ? -58.464 110.989 -155.377 1.00 39.65 ? 131 TYR C O   1 
ATOM   2898 C CB  . TYR C 1 131 ? -57.811 107.711 -154.977 1.00 29.42 ? 131 TYR C CB  1 
ATOM   2899 C CG  . TYR C 1 131 ? -56.741 106.671 -154.730 1.00 29.07 ? 131 TYR C CG  1 
ATOM   2900 C CD1 . TYR C 1 131 ? -56.341 105.808 -155.743 1.00 28.38 ? 131 TYR C CD1 1 
ATOM   2901 C CD2 . TYR C 1 131 ? -56.115 106.565 -153.494 1.00 28.28 ? 131 TYR C CD2 1 
ATOM   2902 C CE1 . TYR C 1 131 ? -55.357 104.864 -155.530 1.00 27.31 ? 131 TYR C CE1 1 
ATOM   2903 C CE2 . TYR C 1 131 ? -55.130 105.623 -153.271 1.00 27.89 ? 131 TYR C CE2 1 
ATOM   2904 C CZ  . TYR C 1 131 ? -54.756 104.775 -154.293 1.00 27.66 ? 131 TYR C CZ  1 
ATOM   2905 O OH  . TYR C 1 131 ? -53.777 103.834 -154.075 1.00 26.18 ? 131 TYR C OH  1 
ATOM   2906 N N   . PHE C 1 132 ? -59.218 109.606 -156.987 1.00 37.36 ? 132 PHE C N   1 
ATOM   2907 C CA  . PHE C 1 132 ? -60.221 110.544 -157.476 1.00 41.76 ? 132 PHE C CA  1 
ATOM   2908 C C   . PHE C 1 132 ? -61.617 109.931 -157.524 1.00 45.42 ? 132 PHE C C   1 
ATOM   2909 O O   . PHE C 1 132 ? -61.768 108.712 -157.633 1.00 49.07 ? 132 PHE C O   1 
ATOM   2910 C CB  . PHE C 1 132 ? -59.830 111.051 -158.868 1.00 41.61 ? 132 PHE C CB  1 
ATOM   2911 C CG  . PHE C 1 132 ? -58.601 111.917 -158.877 1.00 38.80 ? 132 PHE C CG  1 
ATOM   2912 C CD1 . PHE C 1 132 ? -57.334 111.355 -158.834 1.00 33.59 ? 132 PHE C CD1 1 
ATOM   2913 C CD2 . PHE C 1 132 ? -58.714 113.295 -158.937 1.00 40.44 ? 132 PHE C CD2 1 
ATOM   2914 C CE1 . PHE C 1 132 ? -56.205 112.155 -158.844 1.00 30.74 ? 132 PHE C CE1 1 
ATOM   2915 C CE2 . PHE C 1 132 ? -57.589 114.100 -158.947 1.00 37.88 ? 132 PHE C CE2 1 
ATOM   2916 C CZ  . PHE C 1 132 ? -56.334 113.529 -158.900 1.00 33.00 ? 132 PHE C CZ  1 
ATOM   2917 N N   . GLU C 1 133 ? -62.633 110.786 -157.440 1.00 46.11 ? 133 GLU C N   1 
ATOM   2918 C CA  . GLU C 1 133 ? -64.013 110.354 -157.620 1.00 47.12 ? 133 GLU C CA  1 
ATOM   2919 C C   . GLU C 1 133 ? -64.289 110.096 -159.097 1.00 48.53 ? 133 GLU C C   1 
ATOM   2920 O O   . GLU C 1 133 ? -63.443 110.370 -159.953 1.00 47.70 ? 133 GLU C O   1 
ATOM   2921 C CB  . GLU C 1 133 ? -64.994 111.395 -157.070 1.00 48.74 ? 133 GLU C CB  1 
ATOM   2922 C CG  . GLU C 1 133 ? -65.564 111.064 -155.690 1.00 53.03 ? 133 GLU C CG  1 
ATOM   2923 C CD  . GLU C 1 133 ? -64.946 111.891 -154.577 1.00 59.46 ? 133 GLU C CD  1 
ATOM   2924 O OE1 . GLU C 1 133 ? -64.385 112.965 -154.875 1.00 62.66 ? 133 GLU C OE1 1 
ATOM   2925 O OE2 . GLU C 1 133 ? -65.025 111.467 -153.404 1.00 61.48 ? 133 GLU C OE2 1 
ATOM   2926 N N   . ASN C 1 134 ? -65.474 109.564 -159.385 1.00 49.52 ? 134 ASN C N   1 
ATOM   2927 C CA  . ASN C 1 134 ? -65.887 109.273 -160.756 1.00 50.52 ? 134 ASN C CA  1 
ATOM   2928 C C   . ASN C 1 134 ? -65.722 110.472 -161.686 1.00 53.38 ? 134 ASN C C   1 
ATOM   2929 O O   . ASN C 1 134 ? -66.162 111.580 -161.366 1.00 55.53 ? 134 ASN C O   1 
ATOM   2930 C CB  . ASN C 1 134 ? -67.340 108.800 -160.780 1.00 53.13 ? 134 ASN C CB  1 
ATOM   2931 C CG  . ASN C 1 134 ? -67.526 107.457 -160.104 1.00 55.58 ? 134 ASN C CG  1 
ATOM   2932 O OD1 . ASN C 1 134 ? -66.600 106.645 -160.037 1.00 53.14 ? 134 ASN C OD1 1 
ATOM   2933 N ND2 . ASN C 1 134 ? -68.730 107.210 -159.607 1.00 60.44 ? 134 ASN C ND2 1 
ATOM   2934 N N   . GLY C 1 135 ? -65.090 110.243 -162.835 1.00 54.60 ? 135 GLY C N   1 
ATOM   2935 C CA  . GLY C 1 135 ? -64.760 111.317 -163.757 1.00 54.98 ? 135 GLY C CA  1 
ATOM   2936 C C   . GLY C 1 135 ? -63.278 111.652 -163.709 1.00 52.99 ? 135 GLY C C   1 
ATOM   2937 O O   . GLY C 1 135 ? -62.711 112.191 -164.664 1.00 55.99 ? 135 GLY C O   1 
ATOM   2938 N N   . GLY C 1 136 ? -62.654 111.335 -162.578 1.00 47.21 ? 136 GLY C N   1 
ATOM   2939 C CA  . GLY C 1 136 ? -61.220 111.494 -162.409 1.00 44.51 ? 136 GLY C CA  1 
ATOM   2940 C C   . GLY C 1 136 ? -60.736 112.925 -162.255 1.00 43.53 ? 136 GLY C C   1 
ATOM   2941 O O   . GLY C 1 136 ? -59.536 113.188 -162.338 1.00 43.66 ? 136 GLY C O   1 
ATOM   2942 N N   . VAL C 1 137 ? -61.666 113.847 -162.022 1.00 41.57 ? 137 VAL C N   1 
ATOM   2943 C CA  . VAL C 1 137 ? -61.347 115.271 -161.949 1.00 42.73 ? 137 VAL C CA  1 
ATOM   2944 C C   . VAL C 1 137 ? -61.205 115.756 -160.503 1.00 48.18 ? 137 VAL C C   1 
ATOM   2945 O O   . VAL C 1 137 ? -60.373 116.619 -160.207 1.00 52.36 ? 137 VAL C O   1 
ATOM   2946 C CB  . VAL C 1 137 ? -62.424 116.106 -162.692 1.00 53.00 ? 137 VAL C CB  1 
ATOM   2947 C CG1 . VAL C 1 137 ? -62.403 117.571 -162.265 1.00 54.94 ? 137 VAL C CG1 1 
ATOM   2948 C CG2 . VAL C 1 137 ? -62.236 115.984 -164.195 1.00 50.81 ? 137 VAL C CG2 1 
ATOM   2949 N N   . VAL C 1 138 ? -61.999 115.180 -159.604 1.00 49.23 ? 138 VAL C N   1 
ATOM   2950 C CA  . VAL C 1 138 ? -62.024 115.620 -158.211 1.00 46.99 ? 138 VAL C CA  1 
ATOM   2951 C C   . VAL C 1 138 ? -61.333 114.643 -157.266 1.00 43.75 ? 138 VAL C C   1 
ATOM   2952 O O   . VAL C 1 138 ? -61.702 113.471 -157.183 1.00 45.35 ? 138 VAL C O   1 
ATOM   2953 C CB  . VAL C 1 138 ? -63.467 115.838 -157.720 1.00 46.37 ? 138 VAL C CB  1 
ATOM   2954 C CG1 . VAL C 1 138 ? -63.491 116.083 -156.218 1.00 45.86 ? 138 VAL C CG1 1 
ATOM   2955 C CG2 . VAL C 1 138 ? -64.105 116.997 -158.461 1.00 47.17 ? 138 VAL C CG2 1 
ATOM   2956 N N   . ALA C 1 139 ? -60.342 115.149 -156.540 1.00 38.90 ? 139 ALA C N   1 
ATOM   2957 C CA  . ALA C 1 139 ? -59.570 114.339 -155.605 1.00 38.20 ? 139 ALA C CA  1 
ATOM   2958 C C   . ALA C 1 139 ? -60.350 114.013 -154.334 1.00 39.57 ? 139 ALA C C   1 
ATOM   2959 O O   . ALA C 1 139 ? -61.006 114.879 -153.755 1.00 33.49 ? 139 ALA C O   1 
ATOM   2960 C CB  . ALA C 1 139 ? -58.275 115.049 -155.250 1.00 36.95 ? 139 ALA C CB  1 
ATOM   2961 N N   . ARG C 1 140 ? -60.273 112.756 -153.906 1.00 40.58 ? 140 ARG C N   1 
ATOM   2962 C CA  . ARG C 1 140 ? -60.771 112.369 -152.594 1.00 43.20 ? 140 ARG C CA  1 
ATOM   2963 C C   . ARG C 1 140 ? -59.758 112.825 -151.556 1.00 42.33 ? 140 ARG C C   1 
ATOM   2964 O O   . ARG C 1 140 ? -58.552 112.794 -151.810 1.00 28.84 ? 140 ARG C O   1 
ATOM   2965 C CB  . ARG C 1 140 ? -60.989 110.857 -152.507 1.00 43.83 ? 140 ARG C CB  1 
ATOM   2966 C CG  . ARG C 1 140 ? -61.938 110.306 -153.554 1.00 45.57 ? 140 ARG C CG  1 
ATOM   2967 C CD  . ARG C 1 140 ? -61.625 108.851 -153.876 1.00 48.19 ? 140 ARG C CD  1 
ATOM   2968 N NE  . ARG C 1 140 ? -61.669 107.995 -152.695 1.00 54.19 ? 140 ARG C NE  1 
ATOM   2969 C CZ  . ARG C 1 140 ? -61.402 106.692 -152.708 1.00 55.71 ? 140 ARG C CZ  1 
ATOM   2970 N NH1 . ARG C 1 140 ? -61.070 106.091 -153.842 1.00 51.96 ? 140 ARG C NH1 1 
ATOM   2971 N NH2 . ARG C 1 140 ? -61.466 105.989 -151.586 1.00 58.46 ? 140 ARG C NH2 1 
ATOM   2972 N N   . LEU C 1 141 ? -60.239 113.254 -150.394 1.00 40.47 ? 141 LEU C N   1 
ATOM   2973 C CA  . LEU C 1 141 ? -59.345 113.736 -149.348 1.00 41.29 ? 141 LEU C CA  1 
ATOM   2974 C C   . LEU C 1 141 ? -58.479 112.606 -148.797 1.00 43.31 ? 141 LEU C C   1 
ATOM   2975 O O   . LEU C 1 141 ? -58.980 111.535 -148.455 1.00 47.30 ? 141 LEU C O   1 
ATOM   2976 C CB  . LEU C 1 141 ? -60.139 114.385 -148.213 1.00 43.48 ? 141 LEU C CB  1 
ATOM   2977 C CG  . LEU C 1 141 ? -61.016 115.590 -148.555 1.00 36.42 ? 141 LEU C CG  1 
ATOM   2978 C CD1 . LEU C 1 141 ? -61.660 116.152 -147.297 1.00 38.77 ? 141 LEU C CD1 1 
ATOM   2979 C CD2 . LEU C 1 141 ? -60.215 116.664 -149.272 1.00 35.82 ? 141 LEU C CD2 1 
ATOM   2980 N N   . SER C 1 142 ? -57.175 112.849 -148.725 1.00 43.81 ? 142 SER C N   1 
ATOM   2981 C CA  . SER C 1 142 ? -56.252 111.913 -148.095 1.00 44.08 ? 142 SER C CA  1 
ATOM   2982 C C   . SER C 1 142 ? -55.677 112.556 -146.841 1.00 47.26 ? 142 SER C C   1 
ATOM   2983 O O   . SER C 1 142 ? -55.068 113.621 -146.924 1.00 50.92 ? 142 SER C O   1 
ATOM   2984 C CB  . SER C 1 142 ? -55.134 111.520 -149.059 1.00 39.11 ? 142 SER C CB  1 
ATOM   2985 O OG  . SER C 1 142 ? -54.205 110.660 -148.427 1.00 38.07 ? 142 SER C OG  1 
ATOM   2986 N N   . THR C 1 143 ? -55.860 111.918 -145.685 1.00 45.43 ? 143 THR C N   1 
ATOM   2987 C CA  . THR C 1 143 ? -55.508 112.551 -144.414 1.00 45.64 ? 143 THR C CA  1 
ATOM   2988 C C   . THR C 1 143 ? -54.731 111.683 -143.420 1.00 48.21 ? 143 THR C C   1 
ATOM   2989 O O   . THR C 1 143 ? -54.701 110.452 -143.519 1.00 52.51 ? 143 THR C O   1 
ATOM   2990 C CB  . THR C 1 143 ? -56.775 113.051 -143.684 1.00 44.53 ? 143 THR C CB  1 
ATOM   2991 O OG1 . THR C 1 143 ? -57.788 112.039 -143.735 1.00 43.76 ? 143 THR C OG1 1 
ATOM   2992 C CG2 . THR C 1 143 ? -57.308 114.318 -144.330 1.00 44.07 ? 143 THR C CG2 1 
ATOM   2993 N N   . ASP C 1 144 ? -54.097 112.376 -142.475 1.00 47.93 ? 144 ASP C N   1 
ATOM   2994 C CA  . ASP C 1 144 ? -53.611 111.826 -141.217 1.00 49.69 ? 144 ASP C CA  1 
ATOM   2995 C C   . ASP C 1 144 ? -54.843 111.245 -140.474 1.00 55.00 ? 144 ASP C C   1 
ATOM   2996 O O   . ASP C 1 144 ? -55.948 111.635 -140.845 1.00 56.71 ? 144 ASP C O   1 
ATOM   2997 C CB  . ASP C 1 144 ? -52.888 112.933 -140.443 1.00 51.02 ? 144 ASP C CB  1 
ATOM   2998 C CG  . ASP C 1 144 ? -51.466 113.143 -140.925 1.00 55.10 ? 144 ASP C CG  1 
ATOM   2999 O OD1 . ASP C 1 144 ? -50.850 112.156 -141.382 1.00 57.55 ? 144 ASP C OD1 1 
ATOM   3000 O OD2 . ASP C 1 144 ? -50.954 114.279 -140.842 1.00 57.71 ? 144 ASP C OD2 1 
ATOM   3001 N N   . LYS C 1 145 ? -54.774 110.393 -139.433 1.00 54.79 ? 145 LYS C N   1 
ATOM   3002 C CA  . LYS C 1 145 ? -53.754 110.152 -138.378 1.00 50.50 ? 145 LYS C CA  1 
ATOM   3003 C C   . LYS C 1 145 ? -53.908 111.225 -137.298 1.00 52.99 ? 145 LYS C C   1 
ATOM   3004 O O   . LYS C 1 145 ? -54.182 110.918 -136.137 1.00 53.95 ? 145 LYS C O   1 
ATOM   3005 C CB  . LYS C 1 145 ? -52.341 110.168 -138.962 1.00 43.66 ? 145 LYS C CB  1 
ATOM   3006 C CG  . LYS C 1 145 ? -52.036 108.999 -139.885 1.00 40.86 ? 145 LYS C CG  1 
ATOM   3007 C CD  . LYS C 1 145 ? -50.627 109.091 -140.447 1.00 43.64 ? 145 LYS C CD  1 
ATOM   3008 C CE  . LYS C 1 145 ? -50.314 107.910 -141.351 1.00 45.70 ? 145 LYS C CE  1 
ATOM   3009 N NZ  . LYS C 1 145 ? -48.945 107.999 -141.928 1.00 47.27 ? 145 LYS C NZ  1 
ATOM   3010 N N   . ASN C 1 146 ? -53.740 112.477 -137.698 1.00 49.86 ? 146 ASN C N   1 
ATOM   3011 C CA  . ASN C 1 146 ? -54.059 113.633 -136.876 1.00 49.53 ? 146 ASN C CA  1 
ATOM   3012 C C   . ASN C 1 146 ? -55.182 114.441 -137.519 1.00 49.73 ? 146 ASN C C   1 
ATOM   3013 O O   . ASN C 1 146 ? -55.569 115.496 -137.013 1.00 46.33 ? 146 ASN C O   1 
ATOM   3014 C CB  . ASN C 1 146 ? -52.832 114.527 -136.676 1.00 47.77 ? 146 ASN C CB  1 
ATOM   3015 C CG  . ASN C 1 146 ? -51.817 113.928 -135.727 1.00 49.99 ? 146 ASN C CG  1 
ATOM   3016 O OD1 . ASN C 1 146 ? -52.125 113.009 -134.971 1.00 51.89 ? 146 ASN C OD1 1 
ATOM   3017 N ND2 . ASN C 1 146 ? -50.597 114.453 -135.757 1.00 50.37 ? 146 ASN C ND2 1 
ATOM   3018 N N   . GLY C 1 147 ? -55.696 113.945 -138.641 1.00 52.38 ? 147 GLY C N   1 
ATOM   3019 C CA  . GLY C 1 147 ? -56.716 114.657 -139.390 1.00 50.61 ? 147 GLY C CA  1 
ATOM   3020 C C   . GLY C 1 147 ? -56.110 115.663 -140.351 1.00 44.53 ? 147 GLY C C   1 
ATOM   3021 O O   . GLY C 1 147 ? -56.821 116.384 -141.053 1.00 47.24 ? 147 GLY C O   1 
ATOM   3022 N N   . GLN C 1 148 ? -54.783 115.702 -140.381 1.00 38.87 ? 148 GLN C N   1 
ATOM   3023 C CA  . GLN C 1 148 ? -54.057 116.654 -141.209 1.00 36.40 ? 148 GLN C CA  1 
ATOM   3024 C C   . GLN C 1 148 ? -53.890 116.147 -142.637 1.00 36.24 ? 148 GLN C C   1 
ATOM   3025 O O   . GLN C 1 148 ? -53.667 114.957 -142.871 1.00 29.95 ? 148 GLN C O   1 
ATOM   3026 C CB  . GLN C 1 148 ? -52.689 116.958 -140.590 1.00 35.18 ? 148 GLN C CB  1 
ATOM   3027 C CG  . GLN C 1 148 ? -51.886 118.026 -141.325 1.00 40.57 ? 148 GLN C CG  1 
ATOM   3028 C CD  . GLN C 1 148 ? -50.697 118.519 -140.523 1.00 47.12 ? 148 GLN C CD  1 
ATOM   3029 O OE1 . GLN C 1 148 ? -50.356 117.955 -139.483 1.00 49.90 ? 148 GLN C OE1 1 
ATOM   3030 N NE2 . GLN C 1 148 ? -50.060 119.580 -141.003 1.00 50.19 ? 148 GLN C NE2 1 
ATOM   3031 N N   . GLU C 1 149 ? -54.012 117.066 -143.587 1.00 31.70 ? 149 GLU C N   1 
ATOM   3032 C CA  . GLU C 1 149 ? -53.832 116.759 -145.000 1.00 32.53 ? 149 GLU C CA  1 
ATOM   3033 C C   . GLU C 1 149 ? -52.434 116.192 -145.268 1.00 30.61 ? 149 GLU C C   1 
ATOM   3034 O O   . GLU C 1 149 ? -51.439 116.720 -144.767 1.00 28.53 ? 149 GLU C O   1 
ATOM   3035 C CB  . GLU C 1 149 ? -54.067 118.018 -145.832 1.00 31.07 ? 149 GLU C CB  1 
ATOM   3036 C CG  . GLU C 1 149 ? -53.849 117.870 -147.326 1.00 29.70 ? 149 GLU C CG  1 
ATOM   3037 C CD  . GLU C 1 149 ? -53.884 119.213 -148.032 1.00 36.18 ? 149 GLU C CD  1 
ATOM   3038 O OE1 . GLU C 1 149 ? -52.805 119.706 -148.421 1.00 33.72 ? 149 GLU C OE1 1 
ATOM   3039 O OE2 . GLU C 1 149 ? -54.986 119.781 -148.183 1.00 32.63 ? 149 GLU C OE2 1 
ATOM   3040 N N   . ASP C 1 150 ? -52.367 115.112 -146.040 1.00 33.83 ? 150 ASP C N   1 
ATOM   3041 C CA  . ASP C 1 150 ? -51.093 114.504 -146.399 1.00 31.77 ? 150 ASP C CA  1 
ATOM   3042 C C   . ASP C 1 150 ? -50.239 115.478 -147.203 1.00 32.61 ? 150 ASP C C   1 
ATOM   3043 O O   . ASP C 1 150 ? -50.758 116.223 -148.026 1.00 28.78 ? 150 ASP C O   1 
ATOM   3044 C CB  . ASP C 1 150 ? -51.308 113.221 -147.204 1.00 30.75 ? 150 ASP C CB  1 
ATOM   3045 C CG  . ASP C 1 150 ? -51.927 112.111 -146.388 1.00 38.44 ? 150 ASP C CG  1 
ATOM   3046 O OD1 . ASP C 1 150 ? -51.772 112.112 -145.149 1.00 46.69 ? 150 ASP C OD1 1 
ATOM   3047 O OD2 . ASP C 1 150 ? -52.565 111.226 -146.997 1.00 37.80 ? 150 ASP C OD2 1 
ATOM   3048 N N   . PRO C 1 151 ? -48.917 115.469 -146.964 1.00 37.62 ? 151 PRO C N   1 
ATOM   3049 C CA  . PRO C 1 151 ? -47.998 116.402 -147.628 1.00 37.24 ? 151 PRO C CA  1 
ATOM   3050 C C   . PRO C 1 151 ? -47.957 116.215 -149.137 1.00 32.33 ? 151 PRO C C   1 
ATOM   3051 O O   . PRO C 1 151 ? -47.756 117.195 -149.848 1.00 29.55 ? 151 PRO C O   1 
ATOM   3052 C CB  . PRO C 1 151 ? -46.637 116.072 -146.996 1.00 41.65 ? 151 PRO C CB  1 
ATOM   3053 C CG  . PRO C 1 151 ? -46.805 114.715 -146.405 1.00 42.39 ? 151 PRO C CG  1 
ATOM   3054 C CD  . PRO C 1 151 ? -48.225 114.598 -146.002 1.00 41.41 ? 151 PRO C CD  1 
ATOM   3055 N N   . HIS C 1 152 ? -48.167 114.993 -149.616 1.00 29.46 ? 152 HIS C N   1 
ATOM   3056 C CA  . HIS C 1 152 ? -48.098 114.722 -151.048 1.00 25.79 ? 152 HIS C CA  1 
ATOM   3057 C C   . HIS C 1 152 ? -49.408 115.049 -151.769 1.00 26.51 ? 152 HIS C C   1 
ATOM   3058 O O   . HIS C 1 152 ? -49.449 115.128 -152.998 1.00 25.35 ? 152 HIS C O   1 
ATOM   3059 C CB  . HIS C 1 152 ? -47.723 113.259 -151.298 1.00 24.52 ? 152 HIS C CB  1 
ATOM   3060 C CG  . HIS C 1 152 ? -48.845 112.292 -151.054 1.00 25.50 ? 152 HIS C CG  1 
ATOM   3061 N ND1 . HIS C 1 152 ? -49.111 111.753 -149.818 1.00 25.64 ? 152 HIS C ND1 1 
ATOM   3062 C CD2 . HIS C 1 152 ? -49.757 111.760 -151.904 1.00 29.44 ? 152 HIS C CD2 1 
ATOM   3063 C CE1 . HIS C 1 152 ? -50.147 110.932 -149.908 1.00 28.42 ? 152 HIS C CE1 1 
ATOM   3064 N NE2 . HIS C 1 152 ? -50.552 110.919 -151.165 1.00 31.64 ? 152 HIS C NE2 1 
ATOM   3065 N N   . PHE C 1 153 ? -50.473 115.248 -150.997 1.00 26.12 ? 153 PHE C N   1 
ATOM   3066 C CA  . PHE C 1 153 ? -51.812 115.457 -151.550 1.00 27.21 ? 153 PHE C CA  1 
ATOM   3067 C C   . PHE C 1 153 ? -51.922 116.704 -152.423 1.00 34.44 ? 153 PHE C C   1 
ATOM   3068 O O   . PHE C 1 153 ? -52.496 116.658 -153.512 1.00 38.62 ? 153 PHE C O   1 
ATOM   3069 C CB  . PHE C 1 153 ? -52.840 115.540 -150.413 1.00 26.11 ? 153 PHE C CB  1 
ATOM   3070 C CG  . PHE C 1 153 ? -54.235 115.880 -150.869 1.00 27.64 ? 153 PHE C CG  1 
ATOM   3071 C CD1 . PHE C 1 153 ? -54.663 117.200 -150.934 1.00 28.04 ? 153 PHE C CD1 1 
ATOM   3072 C CD2 . PHE C 1 153 ? -55.127 114.877 -151.210 1.00 29.51 ? 153 PHE C CD2 1 
ATOM   3073 C CE1 . PHE C 1 153 ? -55.943 117.508 -151.349 1.00 36.88 ? 153 PHE C CE1 1 
ATOM   3074 C CE2 . PHE C 1 153 ? -56.408 115.181 -151.625 1.00 32.69 ? 153 PHE C CE2 1 
ATOM   3075 C CZ  . PHE C 1 153 ? -56.815 116.496 -151.694 1.00 36.11 ? 153 PHE C CZ  1 
ATOM   3076 N N   . ALA C 1 154 ? -51.380 117.815 -151.932 1.00 36.58 ? 154 ALA C N   1 
ATOM   3077 C CA  . ALA C 1 154 ? -51.621 119.128 -152.525 1.00 36.92 ? 154 ALA C CA  1 
ATOM   3078 C C   . ALA C 1 154 ? -51.218 119.234 -153.995 1.00 36.93 ? 154 ALA C C   1 
ATOM   3079 O O   . ALA C 1 154 ? -52.025 119.647 -154.825 1.00 37.88 ? 154 ALA C O   1 
ATOM   3080 C CB  . ALA C 1 154 ? -50.909 120.194 -151.720 1.00 38.63 ? 154 ALA C CB  1 
ATOM   3081 N N   . LYS C 1 155 ? -49.978 118.879 -154.319 1.00 41.24 ? 155 LYS C N   1 
ATOM   3082 C CA  . LYS C 1 155 ? -49.510 118.979 -155.699 1.00 44.43 ? 155 LYS C CA  1 
ATOM   3083 C C   . LYS C 1 155 ? -50.312 118.078 -156.633 1.00 44.28 ? 155 LYS C C   1 
ATOM   3084 O O   . LYS C 1 155 ? -50.642 118.464 -157.753 1.00 49.12 ? 155 LYS C O   1 
ATOM   3085 C CB  . LYS C 1 155 ? -48.022 118.632 -155.801 1.00 44.42 ? 155 LYS C CB  1 
ATOM   3086 C CG  . LYS C 1 155 ? -47.509 118.599 -157.238 1.00 44.58 ? 155 LYS C CG  1 
ATOM   3087 C CD  . LYS C 1 155 ? -46.005 118.393 -157.293 1.00 43.37 ? 155 LYS C CD  1 
ATOM   3088 C CE  . LYS C 1 155 ? -45.648 117.069 -157.947 1.00 41.18 ? 155 LYS C CE  1 
ATOM   3089 N NZ  . LYS C 1 155 ? -44.195 116.769 -157.814 1.00 43.33 ? 155 LYS C NZ  1 
ATOM   3090 N N   . LEU C 1 156 ? -50.632 116.879 -156.159 1.00 37.90 ? 156 LEU C N   1 
ATOM   3091 C CA  . LEU C 1 156 ? -51.299 115.881 -156.988 1.00 32.94 ? 156 LEU C CA  1 
ATOM   3092 C C   . LEU C 1 156 ? -52.752 116.237 -157.289 1.00 34.59 ? 156 LEU C C   1 
ATOM   3093 O O   . LEU C 1 156 ? -53.231 116.027 -158.403 1.00 34.85 ? 156 LEU C O   1 
ATOM   3094 C CB  . LEU C 1 156 ? -51.228 114.511 -156.316 1.00 26.23 ? 156 LEU C CB  1 
ATOM   3095 C CG  . LEU C 1 156 ? -49.810 113.962 -156.156 1.00 25.24 ? 156 LEU C CG  1 
ATOM   3096 C CD1 . LEU C 1 156 ? -49.835 112.578 -155.531 1.00 26.47 ? 156 LEU C CD1 1 
ATOM   3097 C CD2 . LEU C 1 156 ? -49.077 113.939 -157.494 1.00 21.24 ? 156 LEU C CD2 1 
ATOM   3098 N N   . ALA C 1 157 ? -53.448 116.775 -156.295 1.00 34.66 ? 157 ALA C N   1 
ATOM   3099 C CA  . ALA C 1 157 ? -54.842 117.160 -156.466 1.00 37.54 ? 157 ALA C CA  1 
ATOM   3100 C C   . ALA C 1 157 ? -54.985 118.273 -157.504 1.00 39.57 ? 157 ALA C C   1 
ATOM   3101 O O   . ALA C 1 157 ? -55.938 118.283 -158.283 1.00 35.61 ? 157 ALA C O   1 
ATOM   3102 C CB  . ALA C 1 157 ? -55.439 117.594 -155.135 1.00 38.93 ? 157 ALA C CB  1 
ATOM   3103 N N   . GLN C 1 158 ? -54.031 119.200 -157.517 1.00 43.15 ? 158 GLN C N   1 
ATOM   3104 C CA  . GLN C 1 158 ? -54.083 120.343 -158.427 1.00 46.50 ? 158 GLN C CA  1 
ATOM   3105 C C   . GLN C 1 158 ? -53.800 119.949 -159.875 1.00 45.33 ? 158 GLN C C   1 
ATOM   3106 O O   . GLN C 1 158 ? -54.170 120.668 -160.803 1.00 48.40 ? 158 GLN C O   1 
ATOM   3107 C CB  . GLN C 1 158 ? -53.093 121.425 -157.982 1.00 49.40 ? 158 GLN C CB  1 
ATOM   3108 C CG  . GLN C 1 158 ? -53.737 122.649 -157.343 1.00 56.04 ? 158 GLN C CG  1 
ATOM   3109 C CD  . GLN C 1 158 ? -53.350 122.832 -155.889 1.00 57.36 ? 158 GLN C CD  1 
ATOM   3110 O OE1 . GLN C 1 158 ? -53.454 121.907 -155.087 1.00 57.13 ? 158 GLN C OE1 1 
ATOM   3111 N NE2 . GLN C 1 158 ? -52.895 124.031 -155.543 1.00 57.90 ? 158 GLN C NE2 1 
ATOM   3112 N N   . LEU C 1 159 ? -53.141 118.811 -160.064 1.00 38.52 ? 159 LEU C N   1 
ATOM   3113 C CA  . LEU C 1 159 ? -52.832 118.323 -161.406 1.00 36.09 ? 159 LEU C CA  1 
ATOM   3114 C C   . LEU C 1 159 ? -54.098 117.974 -162.176 1.00 43.21 ? 159 LEU C C   1 
ATOM   3115 O O   . LEU C 1 159 ? -55.077 117.493 -161.600 1.00 49.72 ? 159 LEU C O   1 
ATOM   3116 C CB  . LEU C 1 159 ? -51.917 117.097 -161.343 1.00 29.81 ? 159 LEU C CB  1 
ATOM   3117 C CG  . LEU C 1 159 ? -50.453 117.333 -160.975 1.00 31.45 ? 159 LEU C CG  1 
ATOM   3118 C CD1 . LEU C 1 159 ? -49.755 116.006 -160.737 1.00 29.02 ? 159 LEU C CD1 1 
ATOM   3119 C CD2 . LEU C 1 159 ? -49.745 118.126 -162.062 1.00 32.56 ? 159 LEU C CD2 1 
ATOM   3120 N N   . VAL C 1 160 ? -54.073 118.224 -163.481 1.00 41.94 ? 160 VAL C N   1 
ATOM   3121 C CA  . VAL C 1 160 ? -55.173 117.840 -164.350 1.00 40.45 ? 160 VAL C CA  1 
ATOM   3122 C C   . VAL C 1 160 ? -54.694 116.807 -165.363 1.00 37.45 ? 160 VAL C C   1 
ATOM   3123 O O   . VAL C 1 160 ? -53.558 116.875 -165.839 1.00 39.72 ? 160 VAL C O   1 
ATOM   3124 C CB  . VAL C 1 160 ? -55.771 119.055 -165.089 1.00 44.76 ? 160 VAL C CB  1 
ATOM   3125 C CG1 . VAL C 1 160 ? -56.568 119.923 -164.127 1.00 48.76 ? 160 VAL C CG1 1 
ATOM   3126 C CG2 . VAL C 1 160 ? -54.674 119.867 -165.765 1.00 45.09 ? 160 VAL C CG2 1 
ATOM   3127 N N   . TYR C 1 161 ? -55.553 115.841 -165.674 1.00 34.03 ? 161 TYR C N   1 
ATOM   3128 C CA  . TYR C 1 161 ? -55.235 114.836 -166.683 1.00 33.74 ? 161 TYR C CA  1 
ATOM   3129 C C   . TYR C 1 161 ? -55.080 115.507 -168.045 1.00 33.51 ? 161 TYR C C   1 
ATOM   3130 O O   . TYR C 1 161 ? -56.001 116.170 -168.524 1.00 32.75 ? 161 TYR C O   1 
ATOM   3131 C CB  . TYR C 1 161 ? -56.314 113.755 -166.737 1.00 35.27 ? 161 TYR C CB  1 
ATOM   3132 C CG  . TYR C 1 161 ? -56.140 112.804 -167.898 1.00 39.34 ? 161 TYR C CG  1 
ATOM   3133 C CD1 . TYR C 1 161 ? -55.096 111.889 -167.917 1.00 38.80 ? 161 TYR C CD1 1 
ATOM   3134 C CD2 . TYR C 1 161 ? -57.011 112.827 -168.977 1.00 43.48 ? 161 TYR C CD2 1 
ATOM   3135 C CE1 . TYR C 1 161 ? -54.925 111.022 -168.975 1.00 37.73 ? 161 TYR C CE1 1 
ATOM   3136 C CE2 . TYR C 1 161 ? -56.851 111.963 -170.040 1.00 45.27 ? 161 TYR C CE2 1 
ATOM   3137 C CZ  . TYR C 1 161 ? -55.805 111.062 -170.033 1.00 42.34 ? 161 TYR C CZ  1 
ATOM   3138 O OH  . TYR C 1 161 ? -55.634 110.196 -171.086 1.00 43.58 ? 161 TYR C OH  1 
ATOM   3139 N N   . GLU C 1 162 ? -53.914 115.333 -168.663 1.00 30.98 ? 162 GLU C N   1 
ATOM   3140 C CA  . GLU C 1 162 ? -53.560 116.096 -169.858 1.00 37.20 ? 162 GLU C CA  1 
ATOM   3141 C C   . GLU C 1 162 ? -53.474 115.274 -171.141 1.00 38.16 ? 162 GLU C C   1 
ATOM   3142 O O   . GLU C 1 162 ? -52.890 115.723 -172.131 1.00 32.68 ? 162 GLU C O   1 
ATOM   3143 C CB  . GLU C 1 162 ? -52.227 116.811 -169.633 1.00 39.41 ? 162 GLU C CB  1 
ATOM   3144 C CG  . GLU C 1 162 ? -52.369 118.234 -169.131 1.00 46.36 ? 162 GLU C CG  1 
ATOM   3145 C CD  . GLU C 1 162 ? -51.063 118.799 -168.615 1.00 50.81 ? 162 GLU C CD  1 
ATOM   3146 O OE1 . GLU C 1 162 ? -50.002 118.461 -169.180 1.00 53.00 ? 162 GLU C OE1 1 
ATOM   3147 O OE2 . GLU C 1 162 ? -51.100 119.572 -167.635 1.00 50.80 ? 162 GLU C OE2 1 
ATOM   3148 N N   . GLY C 1 163 ? -54.056 114.080 -171.129 1.00 40.51 ? 163 GLY C N   1 
ATOM   3149 C CA  . GLY C 1 163 ? -54.034 113.232 -172.305 1.00 37.09 ? 163 GLY C CA  1 
ATOM   3150 C C   . GLY C 1 163 ? -52.924 112.200 -172.268 1.00 36.76 ? 163 GLY C C   1 
ATOM   3151 O O   . GLY C 1 163 ? -52.051 112.243 -171.397 1.00 35.43 ? 163 GLY C O   1 
ATOM   3152 N N   . GLY C 1 164 ? -52.950 111.282 -173.230 1.00 37.35 ? 164 GLY C N   1 
ATOM   3153 C CA  . GLY C 1 164 ? -52.068 110.129 -173.228 1.00 34.10 ? 164 GLY C CA  1 
ATOM   3154 C C   . GLY C 1 164 ? -50.577 110.406 -173.296 1.00 32.41 ? 164 GLY C C   1 
ATOM   3155 O O   . GLY C 1 164 ? -49.805 109.824 -172.531 1.00 31.38 ? 164 GLY C O   1 
ATOM   3156 N N   . ASP C 1 165 ? -50.165 111.282 -174.208 1.00 22.75 ? 165 ASP C N   1 
ATOM   3157 C CA  . ASP C 1 165 ? -48.743 111.536 -174.421 1.00 23.62 ? 165 ASP C CA  1 
ATOM   3158 C C   . ASP C 1 165 ? -48.086 112.243 -173.239 1.00 21.20 ? 165 ASP C C   1 
ATOM   3159 O O   . ASP C 1 165 ? -46.890 112.082 -172.999 1.00 20.31 ? 165 ASP C O   1 
ATOM   3160 C CB  . ASP C 1 165 ? -48.529 112.359 -175.691 1.00 32.42 ? 165 ASP C CB  1 
ATOM   3161 C CG  . ASP C 1 165 ? -48.592 111.519 -176.949 1.00 39.18 ? 165 ASP C CG  1 
ATOM   3162 O OD1 . ASP C 1 165 ? -48.595 110.277 -176.831 1.00 42.16 ? 165 ASP C OD1 1 
ATOM   3163 O OD2 . ASP C 1 165 ? -48.621 112.102 -178.055 1.00 40.94 ? 165 ASP C OD2 1 
ATOM   3164 N N   . SER C 1 166 ? -48.867 113.033 -172.510 1.00 21.65 ? 166 SER C N   1 
ATOM   3165 C CA  . SER C 1 166 ? -48.363 113.681 -171.308 1.00 23.97 ? 166 SER C CA  1 
ATOM   3166 C C   . SER C 1 166 ? -47.973 112.604 -170.306 1.00 25.29 ? 166 SER C C   1 
ATOM   3167 O O   . SER C 1 166 ? -46.945 112.700 -169.633 1.00 27.13 ? 166 SER C O   1 
ATOM   3168 C CB  . SER C 1 166 ? -49.409 114.620 -170.706 1.00 27.99 ? 166 SER C CB  1 
ATOM   3169 O OG  . SER C 1 166 ? -50.476 113.888 -170.129 1.00 29.93 ? 166 SER C OG  1 
ATOM   3170 N N   . VAL C 1 167 ? -48.802 111.568 -170.236 1.00 23.37 ? 167 VAL C N   1 
ATOM   3171 C CA  . VAL C 1 167 ? -48.562 110.440 -169.350 1.00 22.19 ? 167 VAL C CA  1 
ATOM   3172 C C   . VAL C 1 167 ? -47.316 109.677 -169.791 1.00 21.84 ? 167 VAL C C   1 
ATOM   3173 O O   . VAL C 1 167 ? -46.499 109.272 -168.961 1.00 19.41 ? 167 VAL C O   1 
ATOM   3174 C CB  . VAL C 1 167 ? -49.777 109.497 -169.318 1.00 21.95 ? 167 VAL C CB  1 
ATOM   3175 C CG1 . VAL C 1 167 ? -49.505 108.311 -168.428 1.00 17.78 ? 167 VAL C CG1 1 
ATOM   3176 C CG2 . VAL C 1 167 ? -51.018 110.248 -168.848 1.00 22.03 ? 167 VAL C CG2 1 
ATOM   3177 N N   . ARG C 1 168 ? -47.174 109.492 -171.101 1.00 23.55 ? 168 ARG C N   1 
ATOM   3178 C CA  . ARG C 1 168 ? -45.970 108.889 -171.661 1.00 24.88 ? 168 ARG C CA  1 
ATOM   3179 C C   . ARG C 1 168 ? -44.733 109.692 -171.271 1.00 21.77 ? 168 ARG C C   1 
ATOM   3180 O O   . ARG C 1 168 ? -43.743 109.130 -170.798 1.00 21.10 ? 168 ARG C O   1 
ATOM   3181 C CB  . ARG C 1 168 ? -46.062 108.781 -173.189 1.00 25.86 ? 168 ARG C CB  1 
ATOM   3182 C CG  . ARG C 1 168 ? -44.698 108.599 -173.843 1.00 25.95 ? 168 ARG C CG  1 
ATOM   3183 C CD  . ARG C 1 168 ? -44.764 108.069 -175.274 1.00 30.38 ? 168 ARG C CD  1 
ATOM   3184 N NE  . ARG C 1 168 ? -45.434 108.974 -176.205 1.00 34.46 ? 168 ARG C NE  1 
ATOM   3185 C CZ  . ARG C 1 168 ? -44.949 110.147 -176.608 1.00 36.32 ? 168 ARG C CZ  1 
ATOM   3186 N NH1 . ARG C 1 168 ? -43.787 110.598 -176.149 1.00 36.64 ? 168 ARG C NH1 1 
ATOM   3187 N NH2 . ARG C 1 168 ? -45.637 110.882 -177.470 1.00 39.50 ? 168 ARG C NH2 1 
ATOM   3188 N N   . ASP C 1 169 ? -44.803 111.006 -171.470 1.00 20.09 ? 169 ASP C N   1 
ATOM   3189 C CA  . ASP C 1 169 ? -43.699 111.900 -171.132 1.00 20.16 ? 169 ASP C CA  1 
ATOM   3190 C C   . ASP C 1 169 ? -43.396 111.884 -169.634 1.00 17.66 ? 169 ASP C C   1 
ATOM   3191 O O   . ASP C 1 169 ? -42.251 112.060 -169.223 1.00 19.56 ? 169 ASP C O   1 
ATOM   3192 C CB  . ASP C 1 169 ? -44.004 113.333 -171.582 1.00 22.02 ? 169 ASP C CB  1 
ATOM   3193 C CG  . ASP C 1 169 ? -44.060 113.477 -173.091 1.00 24.76 ? 169 ASP C CG  1 
ATOM   3194 O OD1 . ASP C 1 169 ? -43.696 112.515 -173.795 1.00 23.99 ? 169 ASP C OD1 1 
ATOM   3195 O OD2 . ASP C 1 169 ? -44.460 114.560 -173.567 1.00 25.99 ? 169 ASP C OD2 1 
ATOM   3196 N N   . GLN C 1 170 ? -44.426 111.679 -168.822 1.00 16.91 ? 170 GLN C N   1 
ATOM   3197 C CA  . GLN C 1 170 ? -44.240 111.581 -167.379 1.00 19.99 ? 170 GLN C CA  1 
ATOM   3198 C C   . GLN C 1 170 ? -43.475 110.309 -167.016 1.00 20.04 ? 170 GLN C C   1 
ATOM   3199 O O   . GLN C 1 170 ? -42.541 110.343 -166.214 1.00 22.82 ? 170 GLN C O   1 
ATOM   3200 C CB  . GLN C 1 170 ? -45.589 111.620 -166.659 1.00 21.24 ? 170 GLN C CB  1 
ATOM   3201 C CG  . GLN C 1 170 ? -46.213 113.010 -166.604 1.00 22.14 ? 170 GLN C CG  1 
ATOM   3202 C CD  . GLN C 1 170 ? -47.693 112.978 -166.274 1.00 26.25 ? 170 GLN C CD  1 
ATOM   3203 O OE1 . GLN C 1 170 ? -48.252 111.924 -165.970 1.00 28.67 ? 170 GLN C OE1 1 
ATOM   3204 N NE2 . GLN C 1 170 ? -48.338 114.137 -166.340 1.00 19.02 ? 170 GLN C NE2 1 
ATOM   3205 N N   . MET C 1 171 ? -43.868 109.192 -167.620 1.00 18.75 ? 171 MET C N   1 
ATOM   3206 C CA  . MET C 1 171 ? -43.199 107.915 -167.392 1.00 20.38 ? 171 MET C CA  1 
ATOM   3207 C C   . MET C 1 171 ? -41.746 107.968 -167.859 1.00 18.36 ? 171 MET C C   1 
ATOM   3208 O O   . MET C 1 171 ? -40.856 107.426 -167.207 1.00 16.98 ? 171 MET C O   1 
ATOM   3209 C CB  . MET C 1 171 ? -43.943 106.784 -168.108 1.00 24.81 ? 171 MET C CB  1 
ATOM   3210 C CG  . MET C 1 171 ? -43.426 105.383 -167.802 1.00 23.68 ? 171 MET C CG  1 
ATOM   3211 S SD  . MET C 1 171 ? -43.865 104.792 -166.154 1.00 17.54 ? 171 MET C SD  1 
ATOM   3212 C CE  . MET C 1 171 ? -42.344 105.096 -165.251 1.00 13.29 ? 171 MET C CE  1 
ATOM   3213 N N   . VAL C 1 172 ? -41.517 108.629 -168.991 1.00 17.79 ? 172 VAL C N   1 
ATOM   3214 C CA  . VAL C 1 172 ? -40.172 108.779 -169.540 1.00 22.91 ? 172 VAL C CA  1 
ATOM   3215 C C   . VAL C 1 172 ? -39.301 109.647 -168.634 1.00 23.21 ? 172 VAL C C   1 
ATOM   3216 O O   . VAL C 1 172 ? -38.130 109.336 -168.393 1.00 17.01 ? 172 VAL C O   1 
ATOM   3217 C CB  . VAL C 1 172 ? -40.212 109.391 -170.957 1.00 26.67 ? 172 VAL C CB  1 
ATOM   3218 C CG1 . VAL C 1 172 ? -38.828 109.828 -171.397 1.00 26.66 ? 172 VAL C CG1 1 
ATOM   3219 C CG2 . VAL C 1 172 ? -40.798 108.396 -171.948 1.00 27.02 ? 172 VAL C CG2 1 
ATOM   3220 N N   . THR C 1 173 ? -39.887 110.730 -168.130 1.00 24.55 ? 173 THR C N   1 
ATOM   3221 C CA  . THR C 1 173 ? -39.197 111.649 -167.227 1.00 21.05 ? 173 THR C CA  1 
ATOM   3222 C C   . THR C 1 173 ? -38.688 110.936 -165.978 1.00 15.48 ? 173 THR C C   1 
ATOM   3223 O O   . THR C 1 173 ? -37.551 111.141 -165.550 1.00 14.68 ? 173 THR C O   1 
ATOM   3224 C CB  . THR C 1 173 ? -40.120 112.811 -166.802 1.00 26.79 ? 173 THR C CB  1 
ATOM   3225 O OG1 . THR C 1 173 ? -40.498 113.572 -167.957 1.00 33.88 ? 173 THR C OG1 1 
ATOM   3226 C CG2 . THR C 1 173 ? -39.419 113.723 -165.805 1.00 22.76 ? 173 THR C CG2 1 
ATOM   3227 N N   . ILE C 1 174 ? -39.538 110.091 -165.405 1.00 17.01 ? 174 ILE C N   1 
ATOM   3228 C CA  . ILE C 1 174 ? -39.209 109.371 -164.179 1.00 19.83 ? 174 ILE C CA  1 
ATOM   3229 C C   . ILE C 1 174 ? -38.018 108.430 -164.359 1.00 20.71 ? 174 ILE C C   1 
ATOM   3230 O O   . ILE C 1 174 ? -37.121 108.385 -163.515 1.00 16.85 ? 174 ILE C O   1 
ATOM   3231 C CB  . ILE C 1 174 ? -40.427 108.574 -163.673 1.00 17.51 ? 174 ILE C CB  1 
ATOM   3232 C CG1 . ILE C 1 174 ? -41.431 109.525 -163.020 1.00 16.94 ? 174 ILE C CG1 1 
ATOM   3233 C CG2 . ILE C 1 174 ? -40.003 107.493 -162.688 1.00 16.16 ? 174 ILE C CG2 1 
ATOM   3234 C CD1 . ILE C 1 174 ? -42.744 108.882 -162.668 1.00 13.25 ? 174 ILE C CD1 1 
ATOM   3235 N N   . VAL C 1 175 ? -38.005 107.689 -165.462 1.00 21.93 ? 175 VAL C N   1 
ATOM   3236 C CA  . VAL C 1 175 ? -36.920 106.754 -165.730 1.00 18.79 ? 175 VAL C CA  1 
ATOM   3237 C C   . VAL C 1 175 ? -35.595 107.491 -165.917 1.00 19.98 ? 175 VAL C C   1 
ATOM   3238 O O   . VAL C 1 175 ? -34.568 107.082 -165.372 1.00 20.34 ? 175 VAL C O   1 
ATOM   3239 C CB  . VAL C 1 175 ? -37.210 105.894 -166.972 1.00 26.38 ? 175 VAL C CB  1 
ATOM   3240 C CG1 . VAL C 1 175 ? -36.025 104.987 -167.282 1.00 28.22 ? 175 VAL C CG1 1 
ATOM   3241 C CG2 . VAL C 1 175 ? -38.476 105.072 -166.764 1.00 28.22 ? 175 VAL C CG2 1 
ATOM   3242 N N   . ARG C 1 176 ? -35.621 108.587 -166.672 1.00 19.24 ? 176 ARG C N   1 
ATOM   3243 C CA  . ARG C 1 176 ? -34.410 109.365 -166.919 1.00 22.77 ? 176 ARG C CA  1 
ATOM   3244 C C   . ARG C 1 176 ? -33.910 110.053 -165.648 1.00 20.23 ? 176 ARG C C   1 
ATOM   3245 O O   . ARG C 1 176 ? -32.704 110.205 -165.451 1.00 19.97 ? 176 ARG C O   1 
ATOM   3246 C CB  . ARG C 1 176 ? -34.647 110.398 -168.026 1.00 25.75 ? 176 ARG C CB  1 
ATOM   3247 C CG  . ARG C 1 176 ? -34.970 109.777 -169.378 1.00 28.25 ? 176 ARG C CG  1 
ATOM   3248 C CD  . ARG C 1 176 ? -34.463 110.629 -170.534 1.00 33.92 ? 176 ARG C CD  1 
ATOM   3249 N NE  . ARG C 1 176 ? -34.288 109.836 -171.749 1.00 39.54 ? 176 ARG C NE  1 
ATOM   3250 C CZ  . ARG C 1 176 ? -35.076 109.910 -172.818 1.00 42.48 ? 176 ARG C CZ  1 
ATOM   3251 N NH1 . ARG C 1 176 ? -36.095 110.757 -172.840 1.00 41.83 ? 176 ARG C NH1 1 
ATOM   3252 N NH2 . ARG C 1 176 ? -34.838 109.142 -173.873 1.00 43.92 ? 176 ARG C NH2 1 
ATOM   3253 N N   . SER C 1 177 ? -34.838 110.459 -164.787 1.00 16.62 ? 177 SER C N   1 
ATOM   3254 C CA  . SER C 1 177 ? -34.479 111.072 -163.512 1.00 16.75 ? 177 SER C CA  1 
ATOM   3255 C C   . SER C 1 177 ? -33.781 110.068 -162.599 1.00 16.03 ? 177 SER C C   1 
ATOM   3256 O O   . SER C 1 177 ? -32.774 110.390 -161.967 1.00 21.20 ? 177 SER C O   1 
ATOM   3257 C CB  . SER C 1 177 ? -35.718 111.645 -162.820 1.00 20.02 ? 177 SER C CB  1 
ATOM   3258 O OG  . SER C 1 177 ? -36.304 112.670 -163.600 1.00 27.76 ? 177 SER C OG  1 
ATOM   3259 N N   . VAL C 1 178 ? -34.329 108.857 -162.532 1.00 15.12 ? 178 VAL C N   1 
ATOM   3260 C CA  . VAL C 1 178 ? -33.710 107.761 -161.790 1.00 15.44 ? 178 VAL C CA  1 
ATOM   3261 C C   . VAL C 1 178 ? -32.296 107.495 -162.298 1.00 18.43 ? 178 VAL C C   1 
ATOM   3262 O O   . VAL C 1 178 ? -31.358 107.349 -161.510 1.00 22.57 ? 178 VAL C O   1 
ATOM   3263 C CB  . VAL C 1 178 ? -34.543 106.467 -161.895 1.00 16.67 ? 178 VAL C CB  1 
ATOM   3264 C CG1 . VAL C 1 178 ? -33.769 105.276 -161.342 1.00 20.65 ? 178 VAL C CG1 1 
ATOM   3265 C CG2 . VAL C 1 178 ? -35.871 106.635 -161.175 1.00 13.09 ? 178 VAL C CG2 1 
ATOM   3266 N N   . GLN C 1 179 ? -32.154 107.443 -163.620 1.00 16.61 ? 179 GLN C N   1 
ATOM   3267 C CA  . GLN C 1 179 ? -30.849 107.301 -164.255 1.00 19.01 ? 179 GLN C CA  1 
ATOM   3268 C C   . GLN C 1 179 ? -29.921 108.444 -163.857 1.00 19.81 ? 179 GLN C C   1 
ATOM   3269 O O   . GLN C 1 179 ? -28.774 108.213 -163.488 1.00 20.84 ? 179 GLN C O   1 
ATOM   3270 C CB  . GLN C 1 179 ? -30.991 107.249 -165.781 1.00 20.51 ? 179 GLN C CB  1 
ATOM   3271 C CG  . GLN C 1 179 ? -31.706 106.008 -166.296 1.00 26.98 ? 179 GLN C CG  1 
ATOM   3272 C CD  . GLN C 1 179 ? -31.925 106.031 -167.801 1.00 28.52 ? 179 GLN C CD  1 
ATOM   3273 O OE1 . GLN C 1 179 ? -31.939 107.091 -168.427 1.00 28.05 ? 179 GLN C OE1 1 
ATOM   3274 N NE2 . GLN C 1 179 ? -32.101 104.853 -168.386 1.00 27.04 ? 179 GLN C NE2 1 
ATOM   3275 N N   . PHE C 1 180 ? -30.432 109.670 -163.928 1.00 19.21 ? 180 PHE C N   1 
ATOM   3276 C CA  . PHE C 1 180 ? -29.652 110.862 -163.601 1.00 22.60 ? 180 PHE C CA  1 
ATOM   3277 C C   . PHE C 1 180 ? -29.191 110.886 -162.144 1.00 20.12 ? 180 PHE C C   1 
ATOM   3278 O O   . PHE C 1 180 ? -28.006 111.083 -161.863 1.00 23.58 ? 180 PHE C O   1 
ATOM   3279 C CB  . PHE C 1 180 ? -30.462 112.125 -163.911 1.00 20.28 ? 180 PHE C CB  1 
ATOM   3280 C CG  . PHE C 1 180 ? -29.907 113.371 -163.282 1.00 19.37 ? 180 PHE C CG  1 
ATOM   3281 C CD1 . PHE C 1 180 ? -28.749 113.956 -163.772 1.00 22.75 ? 180 PHE C CD1 1 
ATOM   3282 C CD2 . PHE C 1 180 ? -30.550 113.966 -162.205 1.00 23.92 ? 180 PHE C CD2 1 
ATOM   3283 C CE1 . PHE C 1 180 ? -28.237 115.107 -163.195 1.00 25.17 ? 180 PHE C CE1 1 
ATOM   3284 C CE2 . PHE C 1 180 ? -30.043 115.116 -161.623 1.00 26.35 ? 180 PHE C CE2 1 
ATOM   3285 C CZ  . PHE C 1 180 ? -28.885 115.686 -162.120 1.00 25.21 ? 180 PHE C CZ  1 
ATOM   3286 N N   . LEU C 1 181 ? -30.131 110.692 -161.224 1.00 17.88 ? 181 LEU C N   1 
ATOM   3287 C CA  . LEU C 1 181 ? -29.826 110.694 -159.797 1.00 18.25 ? 181 LEU C CA  1 
ATOM   3288 C C   . LEU C 1 181 ? -28.795 109.633 -159.429 1.00 22.51 ? 181 LEU C C   1 
ATOM   3289 O O   . LEU C 1 181 ? -27.887 109.888 -158.639 1.00 25.18 ? 181 LEU C O   1 
ATOM   3290 C CB  . LEU C 1 181 ? -31.097 110.476 -158.970 1.00 18.40 ? 181 LEU C CB  1 
ATOM   3291 C CG  . LEU C 1 181 ? -31.999 111.679 -158.693 1.00 19.56 ? 181 LEU C CG  1 
ATOM   3292 C CD1 . LEU C 1 181 ? -33.175 111.268 -157.825 1.00 19.26 ? 181 LEU C CD1 1 
ATOM   3293 C CD2 . LEU C 1 181 ? -31.220 112.802 -158.032 1.00 16.68 ? 181 LEU C CD2 1 
ATOM   3294 N N   . CYS C 1 182 ? -28.937 108.442 -160.001 1.00 23.97 ? 182 CYS C N   1 
ATOM   3295 C CA  . CYS C 1 182 ? -28.060 107.330 -159.651 1.00 23.03 ? 182 CYS C CA  1 
ATOM   3296 C C   . CYS C 1 182 ? -26.648 107.486 -160.196 1.00 25.40 ? 182 CYS C C   1 
ATOM   3297 O O   . CYS C 1 182 ? -25.700 106.969 -159.612 1.00 28.96 ? 182 CYS C O   1 
ATOM   3298 C CB  . CYS C 1 182 ? -28.649 106.009 -160.148 1.00 20.60 ? 182 CYS C CB  1 
ATOM   3299 S SG  . CYS C 1 182 ? -30.048 105.419 -159.188 1.00 19.63 ? 182 CYS C SG  1 
ATOM   3300 N N   . THR C 1 183 ? -26.498 108.192 -161.310 1.00 24.53 ? 183 THR C N   1 
ATOM   3301 C CA  . THR C 1 183 ? -25.190 108.256 -161.954 1.00 24.81 ? 183 THR C CA  1 
ATOM   3302 C C   . THR C 1 183 ? -24.458 109.577 -161.696 1.00 26.27 ? 183 THR C C   1 
ATOM   3303 O O   . THR C 1 183 ? -23.228 109.616 -161.695 1.00 23.21 ? 183 THR C O   1 
ATOM   3304 C CB  . THR C 1 183 ? -25.313 108.011 -163.480 1.00 27.42 ? 183 THR C CB  1 
ATOM   3305 O OG1 . THR C 1 183 ? -24.022 107.715 -164.029 1.00 41.08 ? 183 THR C OG1 1 
ATOM   3306 C CG2 . THR C 1 183 ? -25.907 109.219 -164.187 1.00 22.24 ? 183 THR C CG2 1 
ATOM   3307 N N   . LYS C 1 184 ? -25.205 110.650 -161.450 1.00 27.90 ? 184 LYS C N   1 
ATOM   3308 C CA  . LYS C 1 184 ? -24.591 111.959 -161.237 1.00 31.75 ? 184 LYS C CA  1 
ATOM   3309 C C   . LYS C 1 184 ? -24.686 112.451 -159.794 1.00 35.45 ? 184 LYS C C   1 
ATOM   3310 O O   . LYS C 1 184 ? -23.690 112.872 -159.213 1.00 39.66 ? 184 LYS C O   1 
ATOM   3311 C CB  . LYS C 1 184 ? -25.220 113.008 -162.161 1.00 31.87 ? 184 LYS C CB  1 
ATOM   3312 C CG  . LYS C 1 184 ? -25.213 112.652 -163.635 1.00 30.36 ? 184 LYS C CG  1 
ATOM   3313 C CD  . LYS C 1 184 ? -23.814 112.366 -164.149 1.00 35.66 ? 184 LYS C CD  1 
ATOM   3314 C CE  . LYS C 1 184 ? -23.696 112.759 -165.612 1.00 40.84 ? 184 LYS C CE  1 
ATOM   3315 N NZ  . LYS C 1 184 ? -23.936 114.222 -165.795 1.00 43.70 ? 184 LYS C NZ  1 
ATOM   3316 N N   . VAL C 1 185 ? -25.882 112.399 -159.217 1.00 34.25 ? 185 VAL C N   1 
ATOM   3317 C CA  . VAL C 1 185 ? -26.123 113.011 -157.910 1.00 36.18 ? 185 VAL C CA  1 
ATOM   3318 C C   . VAL C 1 185 ? -25.729 112.130 -156.721 1.00 34.30 ? 185 VAL C C   1 
ATOM   3319 O O   . VAL C 1 185 ? -25.098 112.603 -155.773 1.00 34.53 ? 185 VAL C O   1 
ATOM   3320 C CB  . VAL C 1 185 ? -27.613 113.408 -157.762 1.00 34.20 ? 185 VAL C CB  1 
ATOM   3321 C CG1 . VAL C 1 185 ? -27.930 113.842 -156.336 1.00 31.04 ? 185 VAL C CG1 1 
ATOM   3322 C CG2 . VAL C 1 185 ? -27.961 114.515 -158.741 1.00 33.45 ? 185 VAL C CG2 1 
ATOM   3323 N N   . LEU C 1 186 ? -26.095 110.854 -156.777 1.00 33.86 ? 186 LEU C N   1 
ATOM   3324 C CA  . LEU C 1 186 ? -25.990 109.976 -155.612 1.00 31.01 ? 186 LEU C CA  1 
ATOM   3325 C C   . LEU C 1 186 ? -24.619 109.323 -155.432 1.00 33.17 ? 186 LEU C C   1 
ATOM   3326 O O   . LEU C 1 186 ? -24.032 108.797 -156.381 1.00 33.89 ? 186 LEU C O   1 
ATOM   3327 C CB  . LEU C 1 186 ? -27.065 108.887 -155.680 1.00 25.14 ? 186 LEU C CB  1 
ATOM   3328 C CG  . LEU C 1 186 ? -28.480 109.345 -155.326 1.00 19.07 ? 186 LEU C CG  1 
ATOM   3329 C CD1 . LEU C 1 186 ? -29.494 108.275 -155.684 1.00 17.09 ? 186 LEU C CD1 1 
ATOM   3330 C CD2 . LEU C 1 186 ? -28.566 109.692 -153.848 1.00 18.01 ? 186 LEU C CD2 1 
ATOM   3331 N N   . GLU C 1 187 ? -24.127 109.365 -154.196 1.00 31.01 ? 187 GLU C N   1 
ATOM   3332 C CA  . GLU C 1 187 ? -22.894 108.692 -153.805 1.00 32.27 ? 187 GLU C CA  1 
ATOM   3333 C C   . GLU C 1 187 ? -23.174 107.206 -153.559 1.00 28.08 ? 187 GLU C C   1 
ATOM   3334 O O   . GLU C 1 187 ? -24.316 106.834 -153.299 1.00 25.39 ? 187 GLU C O   1 
ATOM   3335 C CB  . GLU C 1 187 ? -22.308 109.359 -152.556 1.00 37.63 ? 187 GLU C CB  1 
ATOM   3336 C CG  . GLU C 1 187 ? -21.972 110.832 -152.741 1.00 43.00 ? 187 GLU C CG  1 
ATOM   3337 C CD  . GLU C 1 187 ? -21.622 111.521 -151.436 1.00 53.06 ? 187 GLU C CD  1 
ATOM   3338 O OE1 . GLU C 1 187 ? -20.559 111.208 -150.859 1.00 57.86 ? 187 GLU C OE1 1 
ATOM   3339 O OE2 . GLU C 1 187 ? -22.414 112.372 -150.981 1.00 55.67 ? 187 GLU C OE2 1 
ATOM   3340 N N   . PRO C 1 188 ? -22.137 106.350 -153.647 1.00 32.97 ? 188 PRO C N   1 
ATOM   3341 C CA  . PRO C 1 188 ? -22.338 104.896 -153.538 1.00 36.04 ? 188 PRO C CA  1 
ATOM   3342 C C   . PRO C 1 188 ? -22.934 104.432 -152.206 1.00 38.54 ? 188 PRO C C   1 
ATOM   3343 O O   . PRO C 1 188 ? -22.702 105.045 -151.165 1.00 42.33 ? 188 PRO C O   1 
ATOM   3344 C CB  . PRO C 1 188 ? -20.922 104.333 -153.704 1.00 37.17 ? 188 PRO C CB  1 
ATOM   3345 C CG  . PRO C 1 188 ? -20.180 105.385 -154.447 1.00 36.92 ? 188 PRO C CG  1 
ATOM   3346 C CD  . PRO C 1 188 ? -20.733 106.681 -153.950 1.00 35.67 ? 188 PRO C CD  1 
ATOM   3347 N N   . LEU C 1 189 ? -23.701 103.347 -152.258 1.00 35.05 ? 189 LEU C N   1 
ATOM   3348 C CA  . LEU C 1 189 ? -24.268 102.736 -151.062 1.00 31.02 ? 189 LEU C CA  1 
ATOM   3349 C C   . LEU C 1 189 ? -23.170 102.142 -150.184 1.00 36.05 ? 189 LEU C C   1 
ATOM   3350 O O   . LEU C 1 189 ? -22.130 101.726 -150.691 1.00 39.56 ? 189 LEU C O   1 
ATOM   3351 C CB  . LEU C 1 189 ? -25.282 101.654 -151.446 1.00 28.28 ? 189 LEU C CB  1 
ATOM   3352 C CG  . LEU C 1 189 ? -26.656 102.124 -151.928 1.00 25.70 ? 189 LEU C CG  1 
ATOM   3353 C CD1 . LEU C 1 189 ? -27.474 100.945 -152.437 1.00 27.19 ? 189 LEU C CD1 1 
ATOM   3354 C CD2 . LEU C 1 189 ? -27.399 102.851 -150.815 1.00 22.69 ? 189 LEU C CD2 1 
ATOM   3355 N N   . PRO C 1 190 ? -23.397 102.104 -148.860 1.00 37.46 ? 190 PRO C N   1 
ATOM   3356 C CA  . PRO C 1 190 ? -22.431 101.522 -147.920 1.00 39.18 ? 190 PRO C CA  1 
ATOM   3357 C C   . PRO C 1 190 ? -22.116 100.061 -148.232 1.00 38.55 ? 190 PRO C C   1 
ATOM   3358 O O   . PRO C 1 190 ? -22.888 99.403  -148.934 1.00 34.75 ? 190 PRO C O   1 
ATOM   3359 C CB  . PRO C 1 190 ? -23.141 101.642 -146.566 1.00 37.58 ? 190 PRO C CB  1 
ATOM   3360 C CG  . PRO C 1 190 ? -24.096 102.766 -146.742 1.00 35.91 ? 190 PRO C CG  1 
ATOM   3361 C CD  . PRO C 1 190 ? -24.561 102.679 -148.162 1.00 35.04 ? 190 PRO C CD  1 
ATOM   3362 N N   . GLU C 1 191 ? -20.995 99.568  -147.712 1.00 39.77 ? 191 GLU C N   1 
ATOM   3363 C CA  . GLU C 1 191 ? -20.571 98.190  -147.940 1.00 41.02 ? 191 GLU C CA  1 
ATOM   3364 C C   . GLU C 1 191 ? -21.598 97.191  -147.423 1.00 43.50 ? 191 GLU C C   1 
ATOM   3365 O O   . GLU C 1 191 ? -21.704 96.076  -147.932 1.00 43.84 ? 191 GLU C O   1 
ATOM   3366 C CB  . GLU C 1 191 ? -19.219 97.931  -147.276 1.00 42.39 ? 191 GLU C CB  1 
ATOM   3367 C CG  . GLU C 1 191 ? -18.086 97.662  -148.251 1.00 48.14 ? 191 GLU C CG  1 
ATOM   3368 C CD  . GLU C 1 191 ? -16.778 97.354  -147.547 1.00 52.52 ? 191 GLU C CD  1 
ATOM   3369 O OE1 . GLU C 1 191 ? -16.360 98.160  -146.688 1.00 51.75 ? 191 GLU C OE1 1 
ATOM   3370 O OE2 . GLU C 1 191 ? -16.173 96.302  -147.844 1.00 54.40 ? 191 GLU C OE2 1 
ATOM   3371 N N   . GLU C 1 192 ? -22.346 97.597  -146.404 1.00 46.63 ? 192 GLU C N   1 
ATOM   3372 C CA  . GLU C 1 192 ? -23.394 96.756  -145.847 1.00 47.98 ? 192 GLU C CA  1 
ATOM   3373 C C   . GLU C 1 192 ? -24.708 97.520  -145.745 1.00 27.45 ? 192 GLU C C   1 
ATOM   3374 O O   . GLU C 1 192 ? -24.751 98.643  -145.239 1.00 27.04 ? 192 GLU C O   1 
ATOM   3375 C CB  . GLU C 1 192 ? -22.983 96.226  -144.472 1.00 44.95 ? 192 GLU C CB  1 
ATOM   3376 C CG  . GLU C 1 192 ? -21.818 95.249  -144.505 1.00 52.46 ? 192 GLU C CG  1 
ATOM   3377 C CD  . GLU C 1 192 ? -21.394 94.804  -143.118 1.00 61.26 ? 192 GLU C CD  1 
ATOM   3378 O OE1 . GLU C 1 192 ? -21.875 95.394  -142.129 1.00 65.25 ? 192 GLU C OE1 1 
ATOM   3379 O OE2 . GLU C 1 192 ? -20.577 93.864  -143.018 1.00 63.76 ? 192 GLU C OE2 1 
ATOM   3380 N N   . PHE C 1 193 ? -25.785 96.917  -146.232 1.00 26.33 ? 193 PHE C N   1 
ATOM   3381 C CA  . PHE C 1 193 ? -27.128 97.505  -146.154 1.00 28.75 ? 193 PHE C CA  1 
ATOM   3382 C C   . PHE C 1 193 ? -28.229 96.457  -146.272 1.00 32.11 ? 193 PHE C C   1 
ATOM   3383 O O   . PHE C 1 193 ? -27.966 95.332  -146.657 1.00 37.64 ? 193 PHE C O   1 
ATOM   3384 C CB  . PHE C 1 193 ? -27.333 98.607  -147.200 1.00 24.33 ? 193 PHE C CB  1 
ATOM   3385 C CG  . PHE C 1 193 ? -27.511 98.100  -148.595 1.00 24.05 ? 193 PHE C CG  1 
ATOM   3386 C CD1 . PHE C 1 193 ? -28.692 97.510  -148.987 1.00 26.27 ? 193 PHE C CD1 1 
ATOM   3387 C CD2 . PHE C 1 193 ? -26.499 98.216  -149.514 1.00 23.54 ? 193 PHE C CD2 1 
ATOM   3388 C CE1 . PHE C 1 193 ? -28.856 97.042  -150.265 1.00 26.41 ? 193 PHE C CE1 1 
ATOM   3389 C CE2 . PHE C 1 193 ? -26.649 97.745  -150.788 1.00 22.87 ? 193 PHE C CE2 1 
ATOM   3390 C CZ  . PHE C 1 193 ? -27.833 97.163  -151.172 1.00 26.36 ? 193 PHE C CZ  1 
ATOM   3391 N N   . THR C 1 194 ? -29.450 96.836  -145.915 1.00 26.21 ? 194 THR C N   1 
ATOM   3392 C CA  . THR C 1 194 ? -30.635 96.027  -146.146 1.00 23.32 ? 194 THR C CA  1 
ATOM   3393 C C   . THR C 1 194 ? -31.713 96.833  -146.862 1.00 20.73 ? 194 THR C C   1 
ATOM   3394 O O   . THR C 1 194 ? -31.990 97.954  -146.499 1.00 20.10 ? 194 THR C O   1 
ATOM   3395 C CB  . THR C 1 194 ? -31.248 95.481  -144.843 1.00 30.76 ? 194 THR C CB  1 
ATOM   3396 O OG1 . THR C 1 194 ? -30.290 94.688  -144.144 1.00 39.38 ? 194 THR C OG1 1 
ATOM   3397 C CG2 . THR C 1 194 ? -32.455 94.622  -145.154 1.00 26.81 ? 194 THR C CG2 1 
ATOM   3398 N N   . ALA C 1 195 ? -32.318 96.251  -147.882 1.00 21.56 ? 195 ALA C N   1 
ATOM   3399 C CA  . ALA C 1 195 ? -33.361 96.931  -148.616 1.00 22.13 ? 195 ALA C CA  1 
ATOM   3400 C C   . ALA C 1 195 ? -34.647 96.117  -148.674 1.00 25.93 ? 195 ALA C C   1 
ATOM   3401 O O   . ALA C 1 195 ? -34.626 94.961  -149.050 1.00 22.36 ? 195 ALA C O   1 
ATOM   3402 C CB  . ALA C 1 195 ? -32.879 97.258  -150.014 1.00 22.10 ? 195 ALA C CB  1 
ATOM   3403 N N   . ASN C 1 196 ? -35.762 96.746  -148.316 1.00 28.61 ? 196 ASN C N   1 
ATOM   3404 C CA  . ASN C 1 196 ? -37.074 96.112  -148.357 1.00 24.83 ? 196 ASN C CA  1 
ATOM   3405 C C   . ASN C 1 196 ? -38.151 97.083  -148.823 1.00 20.45 ? 196 ASN C C   1 
ATOM   3406 O O   . ASN C 1 196 ? -37.910 98.287  -148.931 1.00 23.09 ? 196 ASN C O   1 
ATOM   3407 C CB  . ASN C 1 196 ? -37.438 95.541  -146.983 1.00 28.48 ? 196 ASN C CB  1 
ATOM   3408 C CG  . ASN C 1 196 ? -37.746 96.623  -145.958 1.00 32.23 ? 196 ASN C CG  1 
ATOM   3409 O OD1 . ASN C 1 196 ? -37.355 97.781  -146.114 1.00 36.33 ? 196 ASN C OD1 1 
ATOM   3410 N ND2 . ASN C 1 196 ? -38.446 96.244  -144.896 1.00 32.81 ? 196 ASN C ND2 1 
ATOM   3411 N N   . PHE C 1 197 ? -39.339 96.556  -149.094 1.00 20.05 ? 197 PHE C N   1 
ATOM   3412 C CA  . PHE C 1 197 ? -40.457 97.386  -149.521 1.00 18.97 ? 197 PHE C CA  1 
ATOM   3413 C C   . PHE C 1 197 ? -41.457 97.581  -148.391 1.00 24.52 ? 197 PHE C C   1 
ATOM   3414 O O   . PHE C 1 197 ? -41.921 96.615  -147.777 1.00 23.78 ? 197 PHE C O   1 
ATOM   3415 C CB  . PHE C 1 197 ? -41.144 96.775  -150.742 1.00 16.26 ? 197 PHE C CB  1 
ATOM   3416 C CG  . PHE C 1 197 ? -40.427 97.046  -152.032 1.00 18.22 ? 197 PHE C CG  1 
ATOM   3417 C CD1 . PHE C 1 197 ? -40.578 98.265  -152.677 1.00 21.39 ? 197 PHE C CD1 1 
ATOM   3418 C CD2 . PHE C 1 197 ? -39.596 96.091  -152.597 1.00 15.67 ? 197 PHE C CD2 1 
ATOM   3419 C CE1 . PHE C 1 197 ? -39.916 98.526  -153.862 1.00 21.88 ? 197 PHE C CE1 1 
ATOM   3420 C CE2 . PHE C 1 197 ? -38.934 96.345  -153.783 1.00 18.63 ? 197 PHE C CE2 1 
ATOM   3421 C CZ  . PHE C 1 197 ? -39.095 97.563  -154.417 1.00 21.87 ? 197 PHE C CZ  1 
ATOM   3422 N N   . ARG C 1 198 ? -41.776 98.843  -148.117 1.00 25.98 ? 198 ARG C N   1 
ATOM   3423 C CA  . ARG C 1 198 ? -42.702 99.189  -147.050 1.00 25.77 ? 198 ARG C CA  1 
ATOM   3424 C C   . ARG C 1 198 ? -43.828 100.056 -147.595 1.00 26.19 ? 198 ARG C C   1 
ATOM   3425 O O   . ARG C 1 198 ? -43.596 100.941 -148.424 1.00 22.68 ? 198 ARG C O   1 
ATOM   3426 C CB  . ARG C 1 198 ? -41.967 99.908  -145.920 1.00 27.31 ? 198 ARG C CB  1 
ATOM   3427 C CG  . ARG C 1 198 ? -40.665 99.235  -145.519 1.00 30.05 ? 198 ARG C CG  1 
ATOM   3428 C CD  . ARG C 1 198 ? -40.052 99.880  -144.295 1.00 31.86 ? 198 ARG C CD  1 
ATOM   3429 N NE  . ARG C 1 198 ? -38.684 99.422  -144.071 1.00 33.14 ? 198 ARG C NE  1 
ATOM   3430 C CZ  . ARG C 1 198 ? -37.985 99.681  -142.971 1.00 37.51 ? 198 ARG C CZ  1 
ATOM   3431 N NH1 . ARG C 1 198 ? -38.531 100.392 -141.994 1.00 40.89 ? 198 ARG C NH1 1 
ATOM   3432 N NH2 . ARG C 1 198 ? -36.745 99.228  -142.846 1.00 38.66 ? 198 ARG C NH2 1 
ATOM   3433 N N   . LEU C 1 199 ? -45.048 99.797  -147.133 1.00 27.58 ? 199 LEU C N   1 
ATOM   3434 C CA  . LEU C 1 199 ? -46.204 100.515 -147.649 1.00 24.94 ? 199 LEU C CA  1 
ATOM   3435 C C   . LEU C 1 199 ? -47.108 101.060 -146.553 1.00 26.38 ? 199 LEU C C   1 
ATOM   3436 O O   . LEU C 1 199 ? -47.025 100.643 -145.399 1.00 18.34 ? 199 LEU C O   1 
ATOM   3437 C CB  . LEU C 1 199 ? -47.014 99.614  -148.591 1.00 22.56 ? 199 LEU C CB  1 
ATOM   3438 C CG  . LEU C 1 199 ? -47.666 98.316  -148.114 1.00 22.40 ? 199 LEU C CG  1 
ATOM   3439 C CD1 . LEU C 1 199 ? -48.999 98.557  -147.414 1.00 22.38 ? 199 LEU C CD1 1 
ATOM   3440 C CD2 . LEU C 1 199 ? -47.856 97.389  -149.301 1.00 19.83 ? 199 LEU C CD2 1 
ATOM   3441 N N   . GLU C 1 200 ? -47.981 101.988 -146.936 1.00 27.26 ? 200 GLU C N   1 
ATOM   3442 C CA  . GLU C 1 200 ? -49.001 102.498 -146.031 1.00 27.67 ? 200 GLU C CA  1 
ATOM   3443 C C   . GLU C 1 200 ? -50.383 102.391 -146.676 1.00 24.61 ? 200 GLU C C   1 
ATOM   3444 O O   . GLU C 1 200 ? -50.547 102.677 -147.863 1.00 18.73 ? 200 GLU C O   1 
ATOM   3445 C CB  . GLU C 1 200 ? -48.703 103.946 -145.636 1.00 24.84 ? 200 GLU C CB  1 
ATOM   3446 C CG  . GLU C 1 200 ? -49.694 104.523 -144.643 1.00 25.08 ? 200 GLU C CG  1 
ATOM   3447 C CD  . GLU C 1 200 ? -49.252 105.862 -144.086 1.00 28.50 ? 200 GLU C CD  1 
ATOM   3448 O OE1 . GLU C 1 200 ? -48.463 106.559 -144.759 1.00 32.41 ? 200 GLU C OE1 1 
ATOM   3449 O OE2 . GLU C 1 200 ? -49.696 106.214 -142.974 1.00 30.52 ? 200 GLU C OE2 1 
ATOM   3450 N N   . TYR C 1 201 ? -51.369 101.971 -145.889 1.00 20.55 ? 201 TYR C N   1 
ATOM   3451 C CA  . TYR C 1 201 ? -52.740 101.854 -146.368 1.00 29.52 ? 201 TYR C CA  1 
ATOM   3452 C C   . TYR C 1 201 ? -53.485 103.175 -146.213 1.00 29.81 ? 201 TYR C C   1 
ATOM   3453 O O   . TYR C 1 201 ? -53.137 103.996 -145.363 1.00 26.37 ? 201 TYR C O   1 
ATOM   3454 C CB  . TYR C 1 201 ? -53.485 100.751 -145.611 1.00 32.42 ? 201 TYR C CB  1 
ATOM   3455 C CG  . TYR C 1 201 ? -53.014 99.340  -145.893 1.00 29.58 ? 201 TYR C CG  1 
ATOM   3456 C CD1 . TYR C 1 201 ? -52.000 98.760  -145.142 1.00 31.44 ? 201 TYR C CD1 1 
ATOM   3457 C CD2 . TYR C 1 201 ? -53.605 98.580  -146.892 1.00 22.46 ? 201 TYR C CD2 1 
ATOM   3458 C CE1 . TYR C 1 201 ? -51.580 97.468  -145.387 1.00 29.78 ? 201 TYR C CE1 1 
ATOM   3459 C CE2 . TYR C 1 201 ? -53.189 97.288  -147.147 1.00 22.38 ? 201 TYR C CE2 1 
ATOM   3460 C CZ  . TYR C 1 201 ? -52.177 96.738  -146.392 1.00 25.11 ? 201 TYR C CZ  1 
ATOM   3461 O OH  . TYR C 1 201 ? -51.759 95.452  -146.642 1.00 22.33 ? 201 TYR C OH  1 
ATOM   3462 N N   . THR C 1 202 ? -54.513 103.373 -147.033 1.00 30.84 ? 202 THR C N   1 
ATOM   3463 C CA  . THR C 1 202 ? -55.380 104.536 -146.893 1.00 30.76 ? 202 THR C CA  1 
ATOM   3464 C C   . THR C 1 202 ? -56.358 104.306 -145.752 1.00 34.45 ? 202 THR C C   1 
ATOM   3465 O O   . THR C 1 202 ? -56.504 103.180 -145.275 1.00 33.72 ? 202 THR C O   1 
ATOM   3466 C CB  . THR C 1 202 ? -56.167 104.828 -148.183 1.00 31.00 ? 202 THR C CB  1 
ATOM   3467 O OG1 . THR C 1 202 ? -57.021 103.720 -148.490 1.00 31.74 ? 202 THR C OG1 1 
ATOM   3468 C CG2 . THR C 1 202 ? -55.220 105.069 -149.349 1.00 30.58 ? 202 THR C CG2 1 
ATOM   3469 N N   . ASN C 1 203 ? -57.023 105.370 -145.314 1.00 40.08 ? 203 ASN C N   1 
ATOM   3470 C CA  . ASN C 1 203 ? -58.076 105.245 -144.316 1.00 43.42 ? 203 ASN C CA  1 
ATOM   3471 C C   . ASN C 1 203 ? -59.223 104.382 -144.845 1.00 46.55 ? 203 ASN C C   1 
ATOM   3472 O O   . ASN C 1 203 ? -59.924 103.724 -144.075 1.00 47.34 ? 203 ASN C O   1 
ATOM   3473 C CB  . ASN C 1 203 ? -58.604 106.622 -143.905 1.00 46.28 ? 203 ASN C CB  1 
ATOM   3474 C CG  . ASN C 1 203 ? -57.515 107.535 -143.362 1.00 49.30 ? 203 ASN C CG  1 
ATOM   3475 O OD1 . ASN C 1 203 ? -56.402 107.097 -143.070 1.00 48.60 ? 203 ASN C OD1 1 
ATOM   3476 N ND2 . ASN C 1 203 ? -57.841 108.814 -143.213 1.00 51.84 ? 203 ASN C ND2 1 
ATOM   3477 N N   . ASP C 1 204 ? -59.405 104.392 -146.165 1.00 47.13 ? 204 ASP C N   1 
ATOM   3478 C CA  . ASP C 1 204 ? -60.495 103.665 -146.813 1.00 44.57 ? 204 ASP C CA  1 
ATOM   3479 C C   . ASP C 1 204 ? -60.362 102.155 -146.673 1.00 40.81 ? 204 ASP C C   1 
ATOM   3480 O O   . ASP C 1 204 ? -61.359 101.437 -146.688 1.00 45.81 ? 204 ASP C O   1 
ATOM   3481 C CB  . ASP C 1 204 ? -60.569 104.026 -148.297 1.00 45.68 ? 204 ASP C CB  1 
ATOM   3482 C CG  . ASP C 1 204 ? -61.026 105.448 -148.530 1.00 52.89 ? 204 ASP C CG  1 
ATOM   3483 O OD1 . ASP C 1 204 ? -61.878 105.938 -147.758 1.00 56.59 ? 204 ASP C OD1 1 
ATOM   3484 O OD2 . ASP C 1 204 ? -60.533 106.076 -149.490 1.00 55.00 ? 204 ASP C OD2 1 
ATOM   3485 N N   . ALA C 1 205 ? -59.128 101.679 -146.547 1.00 37.04 ? 205 ALA C N   1 
ATOM   3486 C CA  . ALA C 1 205 ? -58.861 100.246 -146.509 1.00 37.10 ? 205 ALA C CA  1 
ATOM   3487 C C   . ALA C 1 205 ? -59.542 99.552  -145.336 1.00 37.00 ? 205 ALA C C   1 
ATOM   3488 O O   . ALA C 1 205 ? -59.361 99.940  -144.180 1.00 38.24 ? 205 ALA C O   1 
ATOM   3489 C CB  . ALA C 1 205 ? -57.366 99.994  -146.461 1.00 35.65 ? 205 ALA C CB  1 
ATOM   3490 N N   . PRO C 1 206 ? -60.341 98.522  -145.641 1.00 36.31 ? 206 PRO C N   1 
ATOM   3491 C CA  . PRO C 1 206 ? -60.938 97.668  -144.612 1.00 39.47 ? 206 PRO C CA  1 
ATOM   3492 C C   . PRO C 1 206 ? -59.868 96.825  -143.920 1.00 41.38 ? 206 PRO C C   1 
ATOM   3493 O O   . PRO C 1 206 ? -58.929 96.386  -144.585 1.00 40.20 ? 206 PRO C O   1 
ATOM   3494 C CB  . PRO C 1 206 ? -61.913 96.789  -145.406 1.00 39.21 ? 206 PRO C CB  1 
ATOM   3495 C CG  . PRO C 1 206 ? -62.138 97.511  -146.695 1.00 35.63 ? 206 PRO C CG  1 
ATOM   3496 C CD  . PRO C 1 206 ? -60.836 98.185  -146.986 1.00 33.96 ? 206 PRO C CD  1 
ATOM   3497 N N   . SER C 1 207 ? -60.011 96.606  -142.614 1.00 44.22 ? 207 SER C N   1 
ATOM   3498 C CA  . SER C 1 207 ? -59.019 95.868  -141.834 1.00 48.95 ? 207 SER C CA  1 
ATOM   3499 C C   . SER C 1 207 ? -58.757 94.470  -142.386 1.00 47.24 ? 207 SER C C   1 
ATOM   3500 O O   . SER C 1 207 ? -57.640 93.959  -142.299 1.00 49.76 ? 207 SER C O   1 
ATOM   3501 C CB  . SER C 1 207 ? -59.460 95.766  -140.373 1.00 60.99 ? 207 SER C CB  1 
ATOM   3502 O OG  . SER C 1 207 ? -59.501 97.042  -139.762 1.00 69.83 ? 207 SER C OG  1 
ATOM   3503 N N   . ASN C 1 208 ? -59.790 93.854  -142.951 1.00 46.30 ? 208 ASN C N   1 
ATOM   3504 C CA  . ASN C 1 208 ? -59.655 92.528  -143.541 1.00 48.35 ? 208 ASN C CA  1 
ATOM   3505 C C   . ASN C 1 208 ? -58.869 92.543  -144.853 1.00 43.24 ? 208 ASN C C   1 
ATOM   3506 O O   . ASN C 1 208 ? -58.383 91.504  -145.303 1.00 40.04 ? 208 ASN C O   1 
ATOM   3507 C CB  . ASN C 1 208 ? -61.035 91.908  -143.764 1.00 52.69 ? 208 ASN C CB  1 
ATOM   3508 C CG  . ASN C 1 208 ? -62.079 92.938  -144.150 1.00 56.11 ? 208 ASN C CG  1 
ATOM   3509 O OD1 . ASN C 1 208 ? -61.939 94.122  -143.846 1.00 56.00 ? 208 ASN C OD1 1 
ATOM   3510 N ND2 . ASN C 1 208 ? -63.137 92.489  -144.813 1.00 59.53 ? 208 ASN C ND2 1 
ATOM   3511 N N   . PHE C 1 209 ? -58.739 93.717  -145.463 1.00 40.28 ? 209 PHE C N   1 
ATOM   3512 C CA  . PHE C 1 209 ? -57.977 93.835  -146.703 1.00 36.99 ? 209 PHE C CA  1 
ATOM   3513 C C   . PHE C 1 209 ? -56.486 93.961  -146.433 1.00 33.70 ? 209 PHE C C   1 
ATOM   3514 O O   . PHE C 1 209 ? -56.031 94.953  -145.859 1.00 33.39 ? 209 PHE C O   1 
ATOM   3515 C CB  . PHE C 1 209 ? -58.443 95.037  -147.526 1.00 36.17 ? 209 PHE C CB  1 
ATOM   3516 C CG  . PHE C 1 209 ? -57.600 95.295  -148.745 1.00 34.69 ? 209 PHE C CG  1 
ATOM   3517 C CD1 . PHE C 1 209 ? -57.811 94.575  -149.909 1.00 33.47 ? 209 PHE C CD1 1 
ATOM   3518 C CD2 . PHE C 1 209 ? -56.596 96.253  -148.726 1.00 33.51 ? 209 PHE C CD2 1 
ATOM   3519 C CE1 . PHE C 1 209 ? -57.039 94.805  -151.032 1.00 33.12 ? 209 PHE C CE1 1 
ATOM   3520 C CE2 . PHE C 1 209 ? -55.820 96.487  -149.845 1.00 31.95 ? 209 PHE C CE2 1 
ATOM   3521 C CZ  . PHE C 1 209 ? -56.043 95.763  -150.999 1.00 33.12 ? 209 PHE C CZ  1 
ATOM   3522 N N   . ARG C 1 210 ? -55.730 92.957  -146.861 1.00 32.12 ? 210 ARG C N   1 
ATOM   3523 C CA  . ARG C 1 210 ? -54.277 93.006  -146.781 1.00 32.89 ? 210 ARG C CA  1 
ATOM   3524 C C   . ARG C 1 210 ? -53.676 92.795  -148.166 1.00 32.42 ? 210 ARG C C   1 
ATOM   3525 O O   . ARG C 1 210 ? -54.219 92.050  -148.981 1.00 36.09 ? 210 ARG C O   1 
ATOM   3526 C CB  . ARG C 1 210 ? -53.751 91.954  -145.803 1.00 34.71 ? 210 ARG C CB  1 
ATOM   3527 C CG  . ARG C 1 210 ? -52.262 92.071  -145.499 1.00 39.15 ? 210 ARG C CG  1 
ATOM   3528 C CD  . ARG C 1 210 ? -51.782 90.897  -144.663 1.00 47.02 ? 210 ARG C CD  1 
ATOM   3529 N NE  . ARG C 1 210 ? -52.044 89.626  -145.332 1.00 52.36 ? 210 ARG C NE  1 
ATOM   3530 C CZ  . ARG C 1 210 ? -51.164 88.982  -146.092 1.00 52.57 ? 210 ARG C CZ  1 
ATOM   3531 N NH1 . ARG C 1 210 ? -49.948 89.482  -146.278 1.00 47.63 ? 210 ARG C NH1 1 
ATOM   3532 N NH2 . ARG C 1 210 ? -51.496 87.832  -146.663 1.00 56.13 ? 210 ARG C NH2 1 
ATOM   3533 N N   . ILE C 1 211 ? -52.558 93.463  -148.429 1.00 31.11 ? 211 ILE C N   1 
ATOM   3534 C CA  . ILE C 1 211 ? -51.849 93.309  -149.692 1.00 28.31 ? 211 ILE C CA  1 
ATOM   3535 C C   . ILE C 1 211 ? -50.858 92.153  -149.598 1.00 33.19 ? 211 ILE C C   1 
ATOM   3536 O O   . ILE C 1 211 ? -49.939 92.180  -148.776 1.00 35.40 ? 211 ILE C O   1 
ATOM   3537 C CB  . ILE C 1 211 ? -51.121 94.607  -150.083 1.00 21.20 ? 211 ILE C CB  1 
ATOM   3538 C CG1 . ILE C 1 211 ? -52.143 95.700  -150.411 1.00 21.35 ? 211 ILE C CG1 1 
ATOM   3539 C CG2 . ILE C 1 211 ? -50.189 94.367  -151.262 1.00 19.72 ? 211 ILE C CG2 1 
ATOM   3540 C CD1 . ILE C 1 211 ? -51.578 97.099  -150.377 1.00 23.30 ? 211 ILE C CD1 1 
ATOM   3541 N N   . ASP C 1 212 ? -51.067 91.136  -150.433 1.00 33.90 ? 212 ASP C N   1 
ATOM   3542 C CA  . ASP C 1 212 ? -50.274 89.907  -150.399 1.00 34.63 ? 212 ASP C CA  1 
ATOM   3543 C C   . ASP C 1 212 ? -48.769 90.161  -150.449 1.00 27.20 ? 212 ASP C C   1 
ATOM   3544 O O   . ASP C 1 212 ? -48.279 90.886  -151.320 1.00 22.01 ? 212 ASP C O   1 
ATOM   3545 C CB  . ASP C 1 212 ? -50.670 88.990  -151.557 1.00 43.38 ? 212 ASP C CB  1 
ATOM   3546 C CG  . ASP C 1 212 ? -52.025 88.344  -151.353 1.00 51.62 ? 212 ASP C CG  1 
ATOM   3547 O OD1 . ASP C 1 212 ? -52.896 88.964  -150.703 1.00 53.93 ? 212 ASP C OD1 1 
ATOM   3548 O OD2 . ASP C 1 212 ? -52.218 87.215  -151.854 1.00 54.97 ? 212 ASP C OD2 1 
ATOM   3549 N N   . GLY C 1 213 ? -48.047 89.556  -149.508 1.00 27.52 ? 213 GLY C N   1 
ATOM   3550 C CA  . GLY C 1 213 ? -46.604 89.698  -149.439 1.00 29.91 ? 213 GLY C CA  1 
ATOM   3551 C C   . GLY C 1 213 ? -46.151 90.715  -148.406 1.00 31.30 ? 213 GLY C C   1 
ATOM   3552 O O   . GLY C 1 213 ? -44.959 90.826  -148.109 1.00 33.20 ? 213 GLY C O   1 
ATOM   3553 N N   . PHE C 1 214 ? -47.105 91.459  -147.857 1.00 28.72 ? 214 PHE C N   1 
ATOM   3554 C CA  . PHE C 1 214 ? -46.787 92.492  -146.880 1.00 29.65 ? 214 PHE C CA  1 
ATOM   3555 C C   . PHE C 1 214 ? -47.401 92.213  -145.513 1.00 36.35 ? 214 PHE C C   1 
ATOM   3556 O O   . PHE C 1 214 ? -48.619 92.077  -145.377 1.00 41.52 ? 214 PHE C O   1 
ATOM   3557 C CB  . PHE C 1 214 ? -47.246 93.858  -147.387 1.00 27.43 ? 214 PHE C CB  1 
ATOM   3558 C CG  . PHE C 1 214 ? -46.433 94.382  -148.532 1.00 27.05 ? 214 PHE C CG  1 
ATOM   3559 C CD1 . PHE C 1 214 ? -45.297 95.140  -148.297 1.00 27.53 ? 214 PHE C CD1 1 
ATOM   3560 C CD2 . PHE C 1 214 ? -46.804 94.121  -149.842 1.00 27.02 ? 214 PHE C CD2 1 
ATOM   3561 C CE1 . PHE C 1 214 ? -44.544 95.630  -149.349 1.00 30.47 ? 214 PHE C CE1 1 
ATOM   3562 C CE2 . PHE C 1 214 ? -46.057 94.608  -150.899 1.00 26.94 ? 214 PHE C CE2 1 
ATOM   3563 C CZ  . PHE C 1 214 ? -44.925 95.363  -150.651 1.00 26.47 ? 214 PHE C CZ  1 
ATOM   3564 N N   . GLU C 1 215 ? -46.537 92.132  -144.506 1.00 36.30 ? 215 GLU C N   1 
ATOM   3565 C CA  . GLU C 1 215 ? -46.961 91.968  -143.123 1.00 39.94 ? 215 GLU C CA  1 
ATOM   3566 C C   . GLU C 1 215 ? -47.571 93.252  -142.595 1.00 38.84 ? 215 GLU C C   1 
ATOM   3567 O O   . GLU C 1 215 ? -47.085 94.339  -142.898 1.00 37.65 ? 215 GLU C O   1 
ATOM   3568 C CB  . GLU C 1 215 ? -45.777 91.568  -142.241 1.00 44.05 ? 215 GLU C CB  1 
ATOM   3569 C CG  . GLU C 1 215 ? -45.239 90.179  -142.505 1.00 48.03 ? 215 GLU C CG  1 
ATOM   3570 C CD  . GLU C 1 215 ? -46.140 89.100  -141.946 1.00 53.46 ? 215 GLU C CD  1 
ATOM   3571 O OE1 . GLU C 1 215 ? -46.384 89.105  -140.721 1.00 59.29 ? 215 GLU C OE1 1 
ATOM   3572 O OE2 . GLU C 1 215 ? -46.606 88.251  -142.732 1.00 53.73 ? 215 GLU C OE2 1 
ATOM   3573 N N   . ASP C 1 216 ? -48.633 93.132  -141.807 1.00 37.80 ? 216 ASP C N   1 
ATOM   3574 C CA  . ASP C 1 216 ? -49.142 94.284  -141.078 1.00 34.58 ? 216 ASP C CA  1 
ATOM   3575 C C   . ASP C 1 216 ? -48.083 94.736  -140.080 1.00 28.48 ? 216 ASP C C   1 
ATOM   3576 O O   . ASP C 1 216 ? -47.501 93.918  -139.366 1.00 32.09 ? 216 ASP C O   1 
ATOM   3577 C CB  . ASP C 1 216 ? -50.455 93.959  -140.361 1.00 38.74 ? 216 ASP C CB  1 
ATOM   3578 C CG  . ASP C 1 216 ? -51.649 93.972  -141.294 1.00 40.80 ? 216 ASP C CG  1 
ATOM   3579 O OD1 . ASP C 1 216 ? -51.446 93.874  -142.524 1.00 42.08 ? 216 ASP C OD1 1 
ATOM   3580 O OD2 . ASP C 1 216 ? -52.791 94.074  -140.797 1.00 39.12 ? 216 ASP C OD2 1 
ATOM   3581 N N   . SER C 1 217 ? -47.817 96.036  -140.058 1.00 25.83 ? 217 SER C N   1 
ATOM   3582 C CA  . SER C 1 217 ? -46.910 96.622  -139.080 1.00 30.05 ? 217 SER C CA  1 
ATOM   3583 C C   . SER C 1 217 ? -47.492 97.942  -138.601 1.00 31.39 ? 217 SER C C   1 
ATOM   3584 O O   . SER C 1 217 ? -48.217 98.611  -139.338 1.00 37.47 ? 217 SER C O   1 
ATOM   3585 C CB  . SER C 1 217 ? -45.512 96.832  -139.675 1.00 34.77 ? 217 SER C CB  1 
ATOM   3586 O OG  . SER C 1 217 ? -44.644 97.458  -138.744 1.00 36.34 ? 217 SER C OG  1 
ATOM   3587 N N   . SER C 1 218 ? -47.184 98.312  -137.364 1.00 28.42 ? 218 SER C N   1 
ATOM   3588 C CA  . SER C 1 218 ? -47.610 99.601  -136.839 1.00 29.61 ? 218 SER C CA  1 
ATOM   3589 C C   . SER C 1 218 ? -46.482 100.612 -136.987 1.00 28.19 ? 218 SER C C   1 
ATOM   3590 O O   . SER C 1 218 ? -46.594 101.755 -136.544 1.00 33.62 ? 218 SER C O   1 
ATOM   3591 C CB  . SER C 1 218 ? -48.044 99.473  -135.378 1.00 30.73 ? 218 SER C CB  1 
ATOM   3592 O OG  . SER C 1 218 ? -47.047 98.832  -134.607 1.00 29.62 ? 218 SER C OG  1 
ATOM   3593 N N   . THR C 1 219 ? -45.394 100.172 -137.614 1.00 25.77 ? 219 THR C N   1 
ATOM   3594 C CA  . THR C 1 219 ? -44.248 101.037 -137.878 1.00 25.88 ? 219 THR C CA  1 
ATOM   3595 C C   . THR C 1 219 ? -43.914 101.069 -139.370 1.00 21.91 ? 219 THR C C   1 
ATOM   3596 O O   . THR C 1 219 ? -44.207 100.125 -140.104 1.00 22.62 ? 219 THR C O   1 
ATOM   3597 C CB  . THR C 1 219 ? -43.009 100.594 -137.080 1.00 33.01 ? 219 THR C CB  1 
ATOM   3598 O OG1 . THR C 1 219 ? -42.781 99.196  -137.286 1.00 32.54 ? 219 THR C OG1 1 
ATOM   3599 C CG2 . THR C 1 219 ? -43.221 100.850 -135.601 1.00 25.66 ? 219 THR C CG2 1 
ATOM   3600 N N   . PHE C 1 220 ? -43.289 102.159 -139.802 1.00 26.35 ? 220 PHE C N   1 
ATOM   3601 C CA  . PHE C 1 220 ? -43.066 102.430 -141.218 1.00 27.11 ? 220 PHE C CA  1 
ATOM   3602 C C   . PHE C 1 220 ? -41.579 102.624 -141.486 1.00 28.40 ? 220 PHE C C   1 
ATOM   3603 O O   . PHE C 1 220 ? -40.780 101.689 -141.387 1.00 23.86 ? 220 PHE C O   1 
ATOM   3604 C CB  . PHE C 1 220 ? -43.849 103.680 -141.632 1.00 28.63 ? 220 PHE C CB  1 
ATOM   3605 C CG  . PHE C 1 220 ? -44.138 103.776 -143.103 1.00 28.90 ? 220 PHE C CG  1 
ATOM   3606 C CD1 . PHE C 1 220 ? -43.906 102.706 -143.952 1.00 28.39 ? 220 PHE C CD1 1 
ATOM   3607 C CD2 . PHE C 1 220 ? -44.650 104.950 -143.636 1.00 30.34 ? 220 PHE C CD2 1 
ATOM   3608 C CE1 . PHE C 1 220 ? -44.180 102.806 -145.304 1.00 21.80 ? 220 PHE C CE1 1 
ATOM   3609 C CE2 . PHE C 1 220 ? -44.924 105.057 -144.987 1.00 26.66 ? 220 PHE C CE2 1 
ATOM   3610 C CZ  . PHE C 1 220 ? -44.689 103.983 -145.821 1.00 20.80 ? 220 PHE C CZ  1 
ATOM   3611 N N   . TYR C 1 221 ? -41.225 103.857 -141.830 1.00 31.67 ? 221 TYR C N   1 
ATOM   3612 C CA  . TYR C 1 221 ? -39.838 104.286 -141.907 1.00 29.32 ? 221 TYR C CA  1 
ATOM   3613 C C   . TYR C 1 221 ? -39.779 105.744 -141.473 1.00 26.57 ? 221 TYR C C   1 
ATOM   3614 O O   . TYR C 1 221 ? -40.770 106.472 -141.574 1.00 27.57 ? 221 TYR C O   1 
ATOM   3615 C CB  . TYR C 1 221 ? -39.271 104.115 -143.323 1.00 28.72 ? 221 TYR C CB  1 
ATOM   3616 C CG  . TYR C 1 221 ? -39.836 105.083 -144.344 1.00 29.12 ? 221 TYR C CG  1 
ATOM   3617 C CD1 . TYR C 1 221 ? -39.231 106.315 -144.576 1.00 27.54 ? 221 TYR C CD1 1 
ATOM   3618 C CD2 . TYR C 1 221 ? -40.971 104.764 -145.081 1.00 27.56 ? 221 TYR C CD2 1 
ATOM   3619 C CE1 . TYR C 1 221 ? -39.745 107.202 -145.504 1.00 24.80 ? 221 TYR C CE1 1 
ATOM   3620 C CE2 . TYR C 1 221 ? -41.491 105.647 -146.014 1.00 23.87 ? 221 TYR C CE2 1 
ATOM   3621 C CZ  . TYR C 1 221 ? -40.873 106.864 -146.221 1.00 20.73 ? 221 TYR C CZ  1 
ATOM   3622 O OH  . TYR C 1 221 ? -41.384 107.746 -147.148 1.00 17.19 ? 221 TYR C OH  1 
ATOM   3623 N N   . THR C 1 222 ? -38.624 106.170 -140.976 1.00 22.19 ? 222 THR C N   1 
ATOM   3624 C CA  . THR C 1 222 ? -38.417 107.580 -140.675 1.00 20.57 ? 222 THR C CA  1 
ATOM   3625 C C   . THR C 1 222 ? -37.144 108.067 -141.359 1.00 22.55 ? 222 THR C C   1 
ATOM   3626 O O   . THR C 1 222 ? -36.307 107.269 -141.773 1.00 20.92 ? 222 THR C O   1 
ATOM   3627 C CB  . THR C 1 222 ? -38.332 107.848 -139.154 1.00 25.76 ? 222 THR C CB  1 
ATOM   3628 O OG1 . THR C 1 222 ? -37.181 107.195 -138.601 1.00 29.28 ? 222 THR C OG1 1 
ATOM   3629 C CG2 . THR C 1 222 ? -39.587 107.356 -138.450 1.00 22.88 ? 222 THR C CG2 1 
ATOM   3630 N N   . LEU C 1 223 ? -37.007 109.380 -141.483 1.00 25.47 ? 223 LEU C N   1 
ATOM   3631 C CA  . LEU C 1 223 ? -35.826 109.967 -142.093 1.00 25.14 ? 223 LEU C CA  1 
ATOM   3632 C C   . LEU C 1 223 ? -35.060 110.797 -141.072 1.00 21.64 ? 223 LEU C C   1 
ATOM   3633 O O   . LEU C 1 223 ? -35.664 111.389 -140.186 1.00 22.51 ? 223 LEU C O   1 
ATOM   3634 C CB  . LEU C 1 223 ? -36.214 110.833 -143.295 1.00 25.38 ? 223 LEU C CB  1 
ATOM   3635 C CG  . LEU C 1 223 ? -36.783 110.103 -144.509 1.00 24.95 ? 223 LEU C CG  1 
ATOM   3636 C CD1 . LEU C 1 223 ? -37.182 111.101 -145.587 1.00 24.27 ? 223 LEU C CD1 1 
ATOM   3637 C CD2 . LEU C 1 223 ? -35.781 109.087 -145.046 1.00 22.06 ? 223 LEU C CD2 1 
ATOM   3638 N N   . PRO C 1 224 ? -33.720 110.845 -141.188 1.00 28.49 ? 224 PRO C N   1 
ATOM   3639 C CA  . PRO C 1 224 ? -32.945 111.755 -140.333 1.00 31.63 ? 224 PRO C CA  1 
ATOM   3640 C C   . PRO C 1 224 ? -33.298 113.211 -140.623 1.00 33.48 ? 224 PRO C C   1 
ATOM   3641 O O   . PRO C 1 224 ? -33.818 113.514 -141.699 1.00 23.72 ? 224 PRO C O   1 
ATOM   3642 C CB  . PRO C 1 224 ? -31.492 111.457 -140.720 1.00 31.39 ? 224 PRO C CB  1 
ATOM   3643 C CG  . PRO C 1 224 ? -31.539 110.094 -141.351 1.00 28.27 ? 224 PRO C CG  1 
ATOM   3644 C CD  . PRO C 1 224 ? -32.848 110.031 -142.051 1.00 26.09 ? 224 PRO C CD  1 
ATOM   3645 N N   . ASP C 1 225 ? -33.022 114.102 -139.679 1.00 39.16 ? 225 ASP C N   1 
ATOM   3646 C CA  . ASP C 1 225 ? -33.403 115.498 -139.835 1.00 40.07 ? 225 ASP C CA  1 
ATOM   3647 C C   . ASP C 1 225 ? -32.614 116.181 -140.950 1.00 36.13 ? 225 ASP C C   1 
ATOM   3648 O O   . ASP C 1 225 ? -33.078 117.156 -141.542 1.00 35.15 ? 225 ASP C O   1 
ATOM   3649 C CB  . ASP C 1 225 ? -33.210 116.248 -138.517 1.00 45.00 ? 225 ASP C CB  1 
ATOM   3650 C CG  . ASP C 1 225 ? -33.864 115.541 -137.345 1.00 49.08 ? 225 ASP C CG  1 
ATOM   3651 O OD1 . ASP C 1 225 ? -34.866 114.828 -137.566 1.00 52.50 ? 225 ASP C OD1 1 
ATOM   3652 O OD2 . ASP C 1 225 ? -33.374 115.693 -136.205 1.00 49.39 ? 225 ASP C OD2 1 
ATOM   3653 N N   . ASP C 1 226 ? -31.428 115.660 -141.243 1.00 34.18 ? 226 ASP C N   1 
ATOM   3654 C CA  . ASP C 1 226 ? -30.576 116.253 -142.270 1.00 38.06 ? 226 ASP C CA  1 
ATOM   3655 C C   . ASP C 1 226 ? -30.680 115.517 -143.607 1.00 36.24 ? 226 ASP C C   1 
ATOM   3656 O O   . ASP C 1 226 ? -29.793 115.628 -144.455 1.00 42.03 ? 226 ASP C O   1 
ATOM   3657 C CB  . ASP C 1 226 ? -29.119 116.285 -141.795 1.00 41.68 ? 226 ASP C CB  1 
ATOM   3658 C CG  . ASP C 1 226 ? -28.702 115.002 -141.101 1.00 45.27 ? 226 ASP C CG  1 
ATOM   3659 O OD1 . ASP C 1 226 ? -29.566 114.124 -140.883 1.00 42.52 ? 226 ASP C OD1 1 
ATOM   3660 O OD2 . ASP C 1 226 ? -27.508 114.877 -140.758 1.00 50.91 ? 226 ASP C OD2 1 
ATOM   3661 N N   . ILE C 1 227 ? -31.770 114.779 -143.800 1.00 31.56 ? 227 ILE C N   1 
ATOM   3662 C CA  . ILE C 1 227 ? -31.978 114.046 -145.047 1.00 33.96 ? 227 ILE C CA  1 
ATOM   3663 C C   . ILE C 1 227 ? -32.220 115.021 -146.204 1.00 34.21 ? 227 ILE C C   1 
ATOM   3664 O O   . ILE C 1 227 ? -32.782 116.103 -146.015 1.00 35.00 ? 227 ILE C O   1 
ATOM   3665 C CB  . ILE C 1 227 ? -33.161 113.047 -144.932 1.00 32.19 ? 227 ILE C CB  1 
ATOM   3666 C CG1 . ILE C 1 227 ? -33.119 112.004 -146.053 1.00 30.22 ? 227 ILE C CG1 1 
ATOM   3667 C CG2 . ILE C 1 227 ? -34.500 113.777 -144.898 1.00 33.36 ? 227 ILE C CG2 1 
ATOM   3668 C CD1 . ILE C 1 227 ? -32.288 110.778 -145.731 1.00 32.91 ? 227 ILE C CD1 1 
ATOM   3669 N N   . GLN C 1 228 ? -31.767 114.644 -147.395 1.00 32.74 ? 228 GLN C N   1 
ATOM   3670 C CA  . GLN C 1 228 ? -31.954 115.468 -148.583 1.00 26.40 ? 228 GLN C CA  1 
ATOM   3671 C C   . GLN C 1 228 ? -32.979 114.827 -149.510 1.00 26.93 ? 228 GLN C C   1 
ATOM   3672 O O   . GLN C 1 228 ? -33.185 113.613 -149.470 1.00 31.83 ? 228 GLN C O   1 
ATOM   3673 C CB  . GLN C 1 228 ? -30.627 115.668 -149.315 1.00 21.20 ? 228 GLN C CB  1 
ATOM   3674 C CG  . GLN C 1 228 ? -29.569 116.417 -148.515 1.00 24.06 ? 228 GLN C CG  1 
ATOM   3675 C CD  . GLN C 1 228 ? -29.772 117.919 -148.539 1.00 32.47 ? 228 GLN C CD  1 
ATOM   3676 O OE1 . GLN C 1 228 ? -29.109 118.633 -149.292 1.00 39.31 ? 228 GLN C OE1 1 
ATOM   3677 N NE2 . GLN C 1 228 ? -30.689 118.408 -147.712 1.00 34.07 ? 228 GLN C NE2 1 
ATOM   3678 N N   . SER C 1 229 ? -33.617 115.641 -150.347 1.00 22.82 ? 229 SER C N   1 
ATOM   3679 C CA  . SER C 1 229 ? -34.647 115.133 -151.245 1.00 24.08 ? 229 SER C CA  1 
ATOM   3680 C C   . SER C 1 229 ? -34.463 115.600 -152.685 1.00 27.01 ? 229 SER C C   1 
ATOM   3681 O O   . SER C 1 229 ? -33.760 116.575 -152.955 1.00 18.56 ? 229 SER C O   1 
ATOM   3682 C CB  . SER C 1 229 ? -36.032 115.551 -150.752 1.00 25.18 ? 229 SER C CB  1 
ATOM   3683 O OG  . SER C 1 229 ? -36.220 116.946 -150.898 1.00 30.45 ? 229 SER C OG  1 
ATOM   3684 N N   . ALA C 1 230 ? -35.109 114.889 -153.603 1.00 24.66 ? 230 ALA C N   1 
ATOM   3685 C CA  . ALA C 1 230 ? -35.114 115.254 -155.012 1.00 21.14 ? 230 ALA C CA  1 
ATOM   3686 C C   . ALA C 1 230 ? -36.334 114.644 -155.692 1.00 15.86 ? 230 ALA C C   1 
ATOM   3687 O O   . ALA C 1 230 ? -36.527 113.428 -155.666 1.00 16.91 ? 230 ALA C O   1 
ATOM   3688 C CB  . ALA C 1 230 ? -33.831 114.798 -155.693 1.00 16.69 ? 230 ALA C CB  1 
ATOM   3689 N N   . THR C 1 231 ? -37.163 115.490 -156.289 1.00 16.19 ? 231 THR C N   1 
ATOM   3690 C CA  . THR C 1 231 ? -38.345 115.013 -156.996 1.00 23.52 ? 231 THR C CA  1 
ATOM   3691 C C   . THR C 1 231 ? -37.945 114.222 -158.234 1.00 26.15 ? 231 THR C C   1 
ATOM   3692 O O   . THR C 1 231 ? -37.234 114.728 -159.101 1.00 32.15 ? 231 THR C O   1 
ATOM   3693 C CB  . THR C 1 231 ? -39.269 116.176 -157.412 1.00 24.88 ? 231 THR C CB  1 
ATOM   3694 O OG1 . THR C 1 231 ? -39.831 116.782 -156.242 1.00 33.33 ? 231 THR C OG1 1 
ATOM   3695 C CG2 . THR C 1 231 ? -40.396 115.676 -158.301 1.00 22.62 ? 231 THR C CG2 1 
ATOM   3696 N N   . ILE C 1 232 ? -38.403 112.979 -158.318 1.00 24.64 ? 232 ILE C N   1 
ATOM   3697 C CA  . ILE C 1 232 ? -38.105 112.148 -159.477 1.00 26.08 ? 232 ILE C CA  1 
ATOM   3698 C C   . ILE C 1 232 ? -39.084 112.455 -160.610 1.00 28.82 ? 232 ILE C C   1 
ATOM   3699 O O   . ILE C 1 232 ? -38.683 112.587 -161.770 1.00 29.99 ? 232 ILE C O   1 
ATOM   3700 C CB  . ILE C 1 232 ? -38.155 110.653 -159.126 1.00 24.84 ? 232 ILE C CB  1 
ATOM   3701 C CG1 . ILE C 1 232 ? -37.165 110.354 -158.000 1.00 24.84 ? 232 ILE C CG1 1 
ATOM   3702 C CG2 . ILE C 1 232 ? -37.842 109.804 -160.344 1.00 22.46 ? 232 ILE C CG2 1 
ATOM   3703 C CD1 . ILE C 1 232 ? -36.813 108.892 -157.845 1.00 23.93 ? 232 ILE C CD1 1 
ATOM   3704 N N   . GLY C 1 233 ? -40.363 112.582 -160.264 1.00 24.63 ? 233 GLY C N   1 
ATOM   3705 C CA  . GLY C 1 233 ? -41.390 112.913 -161.237 1.00 22.63 ? 233 GLY C CA  1 
ATOM   3706 C C   . GLY C 1 233 ? -42.759 112.439 -160.791 1.00 29.57 ? 233 GLY C C   1 
ATOM   3707 O O   . GLY C 1 233 ? -42.880 111.667 -159.833 1.00 31.61 ? 233 GLY C O   1 
ATOM   3708 N N   . HIS C 1 234 ? -43.796 112.892 -161.489 1.00 29.60 ? 234 HIS C N   1 
ATOM   3709 C CA  . HIS C 1 234 ? -45.155 112.524 -161.122 1.00 28.81 ? 234 HIS C CA  1 
ATOM   3710 C C   . HIS C 1 234 ? -45.913 111.860 -162.266 1.00 28.84 ? 234 HIS C C   1 
ATOM   3711 O O   . HIS C 1 234 ? -45.513 111.941 -163.430 1.00 28.59 ? 234 HIS C O   1 
ATOM   3712 C CB  . HIS C 1 234 ? -45.927 113.750 -160.633 1.00 27.58 ? 234 HIS C CB  1 
ATOM   3713 C CG  . HIS C 1 234 ? -46.181 114.772 -161.696 1.00 28.79 ? 234 HIS C CG  1 
ATOM   3714 N ND1 . HIS C 1 234 ? -45.407 115.903 -161.841 1.00 28.59 ? 234 HIS C ND1 1 
ATOM   3715 C CD2 . HIS C 1 234 ? -47.132 114.842 -162.658 1.00 33.12 ? 234 HIS C CD2 1 
ATOM   3716 C CE1 . HIS C 1 234 ? -45.865 116.622 -162.850 1.00 34.19 ? 234 HIS C CE1 1 
ATOM   3717 N NE2 . HIS C 1 234 ? -46.912 116.001 -163.363 1.00 36.73 ? 234 HIS C NE2 1 
ATOM   3718 N N   . LEU C 1 235 ? -47.015 111.207 -161.912 1.00 23.96 ? 235 LEU C N   1 
ATOM   3719 C CA  . LEU C 1 235 ? -47.853 110.505 -162.871 1.00 17.43 ? 235 LEU C CA  1 
ATOM   3720 C C   . LEU C 1 235 ? -49.294 111.000 -162.778 1.00 16.93 ? 235 LEU C C   1 
ATOM   3721 O O   . LEU C 1 235 ? -49.858 111.108 -161.689 1.00 20.00 ? 235 LEU C O   1 
ATOM   3722 C CB  . LEU C 1 235 ? -47.787 108.998 -162.625 1.00 15.15 ? 235 LEU C CB  1 
ATOM   3723 C CG  . LEU C 1 235 ? -46.394 108.385 -162.755 1.00 19.69 ? 235 LEU C CG  1 
ATOM   3724 C CD1 . LEU C 1 235 ? -46.344 106.989 -162.148 1.00 13.85 ? 235 LEU C CD1 1 
ATOM   3725 C CD2 . LEU C 1 235 ? -45.965 108.356 -164.222 1.00 23.56 ? 235 LEU C CD2 1 
ATOM   3726 N N   . ARG C 1 236 ? -49.887 111.309 -163.926 1.00 17.72 ? 236 ARG C N   1 
ATOM   3727 C CA  . ARG C 1 236 ? -51.273 111.762 -163.955 1.00 19.04 ? 236 ARG C CA  1 
ATOM   3728 C C   . ARG C 1 236 ? -52.084 111.054 -165.037 1.00 19.63 ? 236 ARG C C   1 
ATOM   3729 O O   . ARG C 1 236 ? -52.359 111.623 -166.082 1.00 20.48 ? 236 ARG C O   1 
ATOM   3730 C CB  . ARG C 1 236 ? -51.333 113.273 -164.158 1.00 20.05 ? 236 ARG C CB  1 
ATOM   3731 C CG  . ARG C 1 236 ? -52.731 113.878 -164.027 1.00 25.36 ? 236 ARG C CG  1 
ATOM   3732 C CD  . ARG C 1 236 ? -53.443 113.331 -162.797 1.00 27.31 ? 236 ARG C CD  1 
ATOM   3733 N NE  . ARG C 1 236 ? -54.542 114.188 -162.359 1.00 29.34 ? 236 ARG C NE  1 
ATOM   3734 C CZ  . ARG C 1 236 ? -55.829 113.857 -162.423 1.00 27.52 ? 236 ARG C CZ  1 
ATOM   3735 N NH1 . ARG C 1 236 ? -56.190 112.676 -162.906 1.00 26.32 ? 236 ARG C NH1 1 
ATOM   3736 N NH2 . ARG C 1 236 ? -56.757 114.705 -161.998 1.00 26.45 ? 236 ARG C NH2 1 
ATOM   3737 N N   . PRO C 1 237 ? -52.469 109.790 -164.787 1.00 22.65 ? 237 PRO C N   1 
ATOM   3738 C CA  . PRO C 1 237 ? -53.456 109.129 -165.647 1.00 20.21 ? 237 PRO C CA  1 
ATOM   3739 C C   . PRO C 1 237 ? -54.845 109.708 -165.410 1.00 25.65 ? 237 PRO C C   1 
ATOM   3740 O O   . PRO C 1 237 ? -55.002 110.675 -164.656 1.00 27.98 ? 237 PRO C O   1 
ATOM   3741 C CB  . PRO C 1 237 ? -53.406 107.660 -165.201 1.00 21.37 ? 237 PRO C CB  1 
ATOM   3742 C CG  . PRO C 1 237 ? -52.226 107.559 -164.279 1.00 21.35 ? 237 PRO C CG  1 
ATOM   3743 C CD  . PRO C 1 237 ? -52.002 108.902 -163.712 1.00 20.24 ? 237 PRO C CD  1 
ATOM   3744 N N   . GLY C 1 238 ? -55.848 109.107 -166.036 1.00 25.51 ? 238 GLY C N   1 
ATOM   3745 C CA  . GLY C 1 238 ? -57.202 109.615 -165.955 1.00 27.78 ? 238 GLY C CA  1 
ATOM   3746 C C   . GLY C 1 238 ? -57.789 109.737 -164.560 1.00 30.99 ? 238 GLY C C   1 
ATOM   3747 O O   . GLY C 1 238 ? -58.454 110.725 -164.253 1.00 34.62 ? 238 GLY C O   1 
ATOM   3748 N N   . CYS C 1 239 ? -57.544 108.744 -163.707 1.00 28.37 ? 239 CYS C N   1 
ATOM   3749 C CA  . CYS C 1 239 ? -58.244 108.670 -162.427 1.00 30.21 ? 239 CYS C CA  1 
ATOM   3750 C C   . CYS C 1 239 ? -57.337 108.423 -161.225 1.00 30.67 ? 239 CYS C C   1 
ATOM   3751 O O   . CYS C 1 239 ? -57.805 108.010 -160.162 1.00 33.93 ? 239 CYS C O   1 
ATOM   3752 C CB  . CYS C 1 239 ? -59.311 107.576 -162.494 1.00 30.67 ? 239 CYS C CB  1 
ATOM   3753 S SG  . CYS C 1 239 ? -60.478 107.779 -163.857 1.00 27.97 ? 239 CYS C SG  1 
ATOM   3754 N N   . HIS C 1 240 ? -56.043 108.667 -161.394 1.00 26.18 ? 240 HIS C N   1 
ATOM   3755 C CA  . HIS C 1 240 ? -55.101 108.528 -160.290 1.00 22.86 ? 240 HIS C CA  1 
ATOM   3756 C C   . HIS C 1 240 ? -53.995 109.565 -160.413 1.00 21.19 ? 240 HIS C C   1 
ATOM   3757 O O   . HIS C 1 240 ? -53.823 110.177 -161.468 1.00 21.51 ? 240 HIS C O   1 
ATOM   3758 C CB  . HIS C 1 240 ? -54.505 107.114 -160.248 1.00 19.76 ? 240 HIS C CB  1 
ATOM   3759 C CG  . HIS C 1 240 ? -55.532 106.027 -160.289 1.00 22.13 ? 240 HIS C CG  1 
ATOM   3760 N ND1 . HIS C 1 240 ? -56.082 105.570 -161.467 1.00 26.72 ? 240 HIS C ND1 1 
ATOM   3761 C CD2 . HIS C 1 240 ? -56.123 105.320 -159.298 1.00 20.99 ? 240 HIS C CD2 1 
ATOM   3762 C CE1 . HIS C 1 240 ? -56.963 104.624 -161.200 1.00 27.95 ? 240 HIS C CE1 1 
ATOM   3763 N NE2 . HIS C 1 240 ? -57.007 104.451 -159.892 1.00 21.91 ? 240 HIS C NE2 1 
ATOM   3764 N N   . ALA C 1 241 ? -53.258 109.764 -159.324 1.00 19.43 ? 241 ALA C N   1 
ATOM   3765 C CA  . ALA C 1 241 ? -52.114 110.664 -159.319 1.00 18.70 ? 241 ALA C CA  1 
ATOM   3766 C C   . ALA C 1 241 ? -51.044 110.107 -158.395 1.00 17.55 ? 241 ALA C C   1 
ATOM   3767 O O   . ALA C 1 241 ? -51.350 109.532 -157.347 1.00 17.63 ? 241 ALA C O   1 
ATOM   3768 C CB  . ALA C 1 241 ? -52.520 112.067 -158.889 1.00 25.54 ? 241 ALA C CB  1 
ATOM   3769 N N   . ALA C 1 242 ? -49.789 110.273 -158.787 1.00 18.55 ? 242 ALA C N   1 
ATOM   3770 C CA  . ALA C 1 242 ? -48.684 109.734 -158.014 1.00 21.86 ? 242 ALA C CA  1 
ATOM   3771 C C   . ALA C 1 242 ? -47.477 110.653 -158.107 1.00 23.63 ? 242 ALA C C   1 
ATOM   3772 O O   . ALA C 1 242 ? -47.201 111.221 -159.161 1.00 25.21 ? 242 ALA C O   1 
ATOM   3773 C CB  . ALA C 1 242 ? -48.330 108.338 -158.495 1.00 22.47 ? 242 ALA C CB  1 
ATOM   3774 N N   . ASN C 1 243 ? -46.768 110.804 -156.995 1.00 23.92 ? 243 ASN C N   1 
ATOM   3775 C CA  . ASN C 1 243 ? -45.532 111.571 -156.981 1.00 25.19 ? 243 ASN C CA  1 
ATOM   3776 C C   . ASN C 1 243 ? -44.386 110.688 -156.517 1.00 23.64 ? 243 ASN C C   1 
ATOM   3777 O O   . ASN C 1 243 ? -44.489 110.022 -155.487 1.00 25.59 ? 243 ASN C O   1 
ATOM   3778 C CB  . ASN C 1 243 ? -45.658 112.798 -156.075 1.00 28.13 ? 243 ASN C CB  1 
ATOM   3779 C CG  . ASN C 1 243 ? -44.493 113.759 -156.230 1.00 31.98 ? 243 ASN C CG  1 
ATOM   3780 O OD1 . ASN C 1 243 ? -44.020 114.004 -157.341 1.00 29.24 ? 243 ASN C OD1 1 
ATOM   3781 N ND2 . ASN C 1 243 ? -44.021 114.303 -155.114 1.00 37.35 ? 243 ASN C ND2 1 
ATOM   3782 N N   . MET C 1 244 ? -43.296 110.678 -157.276 1.00 21.81 ? 244 MET C N   1 
ATOM   3783 C CA  . MET C 1 244 ? -42.156 109.847 -156.919 1.00 23.05 ? 244 MET C CA  1 
ATOM   3784 C C   . MET C 1 244 ? -40.966 110.701 -156.493 1.00 24.92 ? 244 MET C C   1 
ATOM   3785 O O   . MET C 1 244 ? -40.528 111.592 -157.225 1.00 25.12 ? 244 MET C O   1 
ATOM   3786 C CB  . MET C 1 244 ? -41.768 108.934 -158.081 1.00 22.59 ? 244 MET C CB  1 
ATOM   3787 C CG  . MET C 1 244 ? -40.691 107.931 -157.722 1.00 25.68 ? 244 MET C CG  1 
ATOM   3788 S SD  . MET C 1 244 ? -40.424 106.665 -158.977 1.00 24.21 ? 244 MET C SD  1 
ATOM   3789 C CE  . MET C 1 244 ? -38.908 105.930 -158.370 1.00 14.25 ? 244 MET C CE  1 
ATOM   3790 N N   . GLU C 1 245 ? -40.447 110.420 -155.302 1.00 25.60 ? 245 GLU C N   1 
ATOM   3791 C CA  . GLU C 1 245 ? -39.363 111.214 -154.740 1.00 25.78 ? 245 GLU C CA  1 
ATOM   3792 C C   . GLU C 1 245 ? -38.240 110.333 -154.209 1.00 27.43 ? 245 GLU C C   1 
ATOM   3793 O O   . GLU C 1 245 ? -38.465 109.185 -153.821 1.00 33.17 ? 245 GLU C O   1 
ATOM   3794 C CB  . GLU C 1 245 ? -39.891 112.114 -153.620 1.00 26.57 ? 245 GLU C CB  1 
ATOM   3795 C CG  . GLU C 1 245 ? -40.974 113.093 -154.051 1.00 31.10 ? 245 GLU C CG  1 
ATOM   3796 C CD  . GLU C 1 245 ? -41.668 113.748 -152.870 1.00 33.65 ? 245 GLU C CD  1 
ATOM   3797 O OE1 . GLU C 1 245 ? -42.489 113.072 -152.214 1.00 38.28 ? 245 GLU C OE1 1 
ATOM   3798 O OE2 . GLU C 1 245 ? -41.395 114.935 -152.600 1.00 29.99 ? 245 GLU C OE2 1 
ATOM   3799 N N   . CYS C 1 246 ? -37.031 110.885 -154.193 1.00 23.37 ? 246 CYS C N   1 
ATOM   3800 C CA  . CYS C 1 246 ? -35.886 110.210 -153.600 1.00 21.75 ? 246 CYS C CA  1 
ATOM   3801 C C   . CYS C 1 246 ? -35.384 110.962 -152.369 1.00 18.86 ? 246 CYS C C   1 
ATOM   3802 O O   . CYS C 1 246 ? -35.048 112.145 -152.452 1.00 19.14 ? 246 CYS C O   1 
ATOM   3803 C CB  . CYS C 1 246 ? -34.755 110.066 -154.620 1.00 14.45 ? 246 CYS C CB  1 
ATOM   3804 S SG  . CYS C 1 246 ? -33.145 109.687 -153.878 1.00 20.91 ? 246 CYS C SG  1 
ATOM   3805 N N   . TRP C 1 247 ? -35.342 110.276 -151.230 1.00 20.16 ? 247 TRP C N   1 
ATOM   3806 C CA  . TRP C 1 247 ? -34.750 110.835 -150.019 1.00 18.70 ? 247 TRP C CA  1 
ATOM   3807 C C   . TRP C 1 247 ? -33.459 110.084 -149.723 1.00 21.84 ? 247 TRP C C   1 
ATOM   3808 O O   . TRP C 1 247 ? -33.452 108.854 -149.716 1.00 23.93 ? 247 TRP C O   1 
ATOM   3809 C CB  . TRP C 1 247 ? -35.704 110.731 -148.827 1.00 23.12 ? 247 TRP C CB  1 
ATOM   3810 C CG  . TRP C 1 247 ? -37.138 111.033 -149.145 1.00 24.29 ? 247 TRP C CG  1 
ATOM   3811 C CD1 . TRP C 1 247 ? -38.048 110.185 -149.707 1.00 27.37 ? 247 TRP C CD1 1 
ATOM   3812 C CD2 . TRP C 1 247 ? -37.835 112.262 -148.898 1.00 24.43 ? 247 TRP C CD2 1 
ATOM   3813 N NE1 . TRP C 1 247 ? -39.264 110.813 -149.837 1.00 27.65 ? 247 TRP C NE1 1 
ATOM   3814 C CE2 . TRP C 1 247 ? -39.160 112.086 -149.347 1.00 25.50 ? 247 TRP C CE2 1 
ATOM   3815 C CE3 . TRP C 1 247 ? -37.466 113.490 -148.345 1.00 26.64 ? 247 TRP C CE3 1 
ATOM   3816 C CZ2 . TRP C 1 247 ? -40.117 113.102 -149.260 1.00 22.74 ? 247 TRP C CZ2 1 
ATOM   3817 C CZ3 . TRP C 1 247 ? -38.417 114.494 -148.260 1.00 27.74 ? 247 TRP C CZ3 1 
ATOM   3818 C CH2 . TRP C 1 247 ? -39.726 114.294 -148.716 1.00 23.52 ? 247 TRP C CH2 1 
ATOM   3819 N N   . SER C 1 248 ? -32.370 110.806 -149.479 1.00 23.53 ? 248 SER C N   1 
ATOM   3820 C CA  . SER C 1 248 ? -31.090 110.148 -149.221 1.00 22.87 ? 248 SER C CA  1 
ATOM   3821 C C   . SER C 1 248 ? -30.136 110.980 -148.374 1.00 20.24 ? 248 SER C C   1 
ATOM   3822 O O   . SER C 1 248 ? -30.185 112.212 -148.381 1.00 19.67 ? 248 SER C O   1 
ATOM   3823 C CB  . SER C 1 248 ? -30.400 109.782 -150.541 1.00 25.53 ? 248 SER C CB  1 
ATOM   3824 O OG  . SER C 1 248 ? -29.162 109.134 -150.293 1.00 26.43 ? 248 SER C OG  1 
ATOM   3825 N N   . MET C 1 249 ? -29.275 110.278 -147.640 1.00 20.43 ? 249 MET C N   1 
ATOM   3826 C CA  . MET C 1 249 ? -28.163 110.893 -146.928 1.00 21.67 ? 249 MET C CA  1 
ATOM   3827 C C   . MET C 1 249 ? -26.925 110.926 -147.817 1.00 27.23 ? 249 MET C C   1 
ATOM   3828 O O   . MET C 1 249 ? -25.890 111.477 -147.442 1.00 31.83 ? 249 MET C O   1 
ATOM   3829 C CB  . MET C 1 249 ? -27.854 110.126 -145.643 1.00 22.14 ? 249 MET C CB  1 
ATOM   3830 C CG  . MET C 1 249 ? -28.950 110.169 -144.600 1.00 21.95 ? 249 MET C CG  1 
ATOM   3831 S SD  . MET C 1 249 ? -29.206 111.824 -143.931 1.00 40.05 ? 249 MET C SD  1 
ATOM   3832 C CE  . MET C 1 249 ? -27.534 112.264 -143.456 1.00 25.24 ? 249 MET C CE  1 
ATOM   3833 N N   . LEU C 1 250 ? -27.046 110.333 -149.000 1.00 26.82 ? 250 LEU C N   1 
ATOM   3834 C CA  . LEU C 1 250 ? -25.903 110.105 -149.874 1.00 27.49 ? 250 LEU C CA  1 
ATOM   3835 C C   . LEU C 1 250 ? -25.882 111.009 -151.102 1.00 32.01 ? 250 LEU C C   1 
ATOM   3836 O O   . LEU C 1 250 ? -25.344 110.632 -152.143 1.00 37.91 ? 250 LEU C O   1 
ATOM   3837 C CB  . LEU C 1 250 ? -25.878 108.641 -150.316 1.00 24.54 ? 250 LEU C CB  1 
ATOM   3838 C CG  . LEU C 1 250 ? -25.229 107.668 -149.338 1.00 27.38 ? 250 LEU C CG  1 
ATOM   3839 C CD1 . LEU C 1 250 ? -25.780 106.265 -149.532 1.00 21.58 ? 250 LEU C CD1 1 
ATOM   3840 C CD2 . LEU C 1 250 ? -23.719 107.688 -149.530 1.00 31.65 ? 250 LEU C CD2 1 
ATOM   3841 N N   . MET C 1 251 ? -26.449 112.204 -150.982 1.00 29.23 ? 251 MET C N   1 
ATOM   3842 C CA  . MET C 1 251 ? -26.459 113.137 -152.103 1.00 30.54 ? 251 MET C CA  1 
ATOM   3843 C C   . MET C 1 251 ? -25.215 114.029 -152.125 1.00 38.22 ? 251 MET C C   1 
ATOM   3844 O O   . MET C 1 251 ? -24.756 114.497 -151.077 1.00 39.47 ? 251 MET C O   1 
ATOM   3845 C CB  . MET C 1 251 ? -27.724 113.993 -152.068 1.00 23.04 ? 251 MET C CB  1 
ATOM   3846 C CG  . MET C 1 251 ? -29.010 113.190 -152.237 1.00 19.83 ? 251 MET C CG  1 
ATOM   3847 S SD  . MET C 1 251 ? -30.415 114.243 -152.658 1.00 25.86 ? 251 MET C SD  1 
ATOM   3848 C CE  . MET C 1 251 ? -31.758 113.054 -152.708 1.00 34.69 ? 251 MET C CE  1 
ATOM   3849 N N   . SER C 1 252 ? -24.687 114.239 -153.333 1.00 41.22 ? 252 SER C N   1 
ATOM   3850 C CA  . SER C 1 252 ? -23.504 115.069 -153.594 1.00 46.95 ? 252 SER C CA  1 
ATOM   3851 C C   . SER C 1 252 ? -22.220 114.418 -153.092 1.00 54.14 ? 252 SER C C   1 
ATOM   3852 O O   . SER C 1 252 ? -21.398 113.962 -153.888 1.00 57.77 ? 252 SER C O   1 
ATOM   3853 C CB  . SER C 1 252 ? -23.662 116.461 -152.972 1.00 46.48 ? 252 SER C CB  1 
ATOM   3854 O OG  . SER C 1 252 ? -24.863 117.064 -153.412 1.00 46.21 ? 252 SER C OG  1 
ATOM   3855 N N   . ALA D 2 3   ? -52.962 104.565 -137.943 1.00 28.65 ? 487 ALA D N   1 
ATOM   3856 C CA  . ALA D 2 3   ? -52.033 104.404 -139.055 1.00 35.11 ? 487 ALA D CA  1 
ATOM   3857 C C   . ALA D 2 3   ? -51.636 102.943 -139.223 1.00 39.57 ? 487 ALA D C   1 
ATOM   3858 O O   . ALA D 2 3   ? -51.170 102.305 -138.278 1.00 46.88 ? 487 ALA D O   1 
ATOM   3859 C CB  . ALA D 2 3   ? -50.801 105.266 -138.849 1.00 31.66 ? 487 ALA D CB  1 
ATOM   3860 N N   . ARG D 2 4   ? -51.816 102.424 -140.434 1.00 35.94 ? 488 ARG D N   1 
ATOM   3861 C CA  . ARG D 2 4   ? -51.564 101.016 -140.731 1.00 33.87 ? 488 ARG D CA  1 
ATOM   3862 C C   . ARG D 2 4   ? -50.558 100.856 -141.866 1.00 30.72 ? 488 ARG D C   1 
ATOM   3863 O O   . ARG D 2 4   ? -50.725 101.440 -142.940 1.00 22.19 ? 488 ARG D O   1 
ATOM   3864 C CB  . ARG D 2 4   ? -52.874 100.315 -141.093 1.00 36.57 ? 488 ARG D CB  1 
ATOM   3865 C CG  . ARG D 2 4   ? -52.711 98.906  -141.638 1.00 39.07 ? 488 ARG D CG  1 
ATOM   3866 C CD  . ARG D 2 4   ? -54.021 98.406  -142.225 1.00 42.64 ? 488 ARG D CD  1 
ATOM   3867 N NE  . ARG D 2 4   ? -53.932 97.035  -142.716 1.00 45.45 ? 488 ARG D NE  1 
ATOM   3868 C CZ  . ARG D 2 4   ? -54.937 96.385  -143.296 1.00 49.37 ? 488 ARG D CZ  1 
ATOM   3869 N NH1 . ARG D 2 4   ? -56.110 96.982  -143.460 1.00 51.52 ? 488 ARG D NH1 1 
ATOM   3870 N NH2 . ARG D 2 4   ? -54.771 95.137  -143.713 1.00 50.80 ? 488 ARG D NH2 1 
ATOM   3871 N N   . TYR D 2 5   ? -49.519 100.059 -141.631 1.00 30.73 ? 489 TYR D N   1 
ATOM   3872 C CA  . TYR D 2 5   ? -48.472 99.874  -142.630 1.00 24.79 ? 489 TYR D CA  1 
ATOM   3873 C C   . TYR D 2 5   ? -48.279 98.418  -143.036 1.00 22.00 ? 489 TYR D C   1 
ATOM   3874 O O   . TYR D 2 5   ? -48.811 97.503  -142.400 1.00 27.20 ? 489 TYR D O   1 
ATOM   3875 C CB  . TYR D 2 5   ? -47.143 100.425 -142.117 1.00 25.55 ? 489 TYR D CB  1 
ATOM   3876 C CG  . TYR D 2 5   ? -47.232 101.794 -141.486 1.00 29.34 ? 489 TYR D CG  1 
ATOM   3877 C CD1 . TYR D 2 5   ? -47.252 102.941 -142.266 1.00 29.61 ? 489 TYR D CD1 1 
ATOM   3878 C CD2 . TYR D 2 5   ? -47.278 101.939 -140.105 1.00 32.19 ? 489 TYR D CD2 1 
ATOM   3879 C CE1 . TYR D 2 5   ? -47.326 104.194 -141.690 1.00 30.07 ? 489 TYR D CE1 1 
ATOM   3880 C CE2 . TYR D 2 5   ? -47.351 103.186 -139.521 1.00 34.02 ? 489 TYR D CE2 1 
ATOM   3881 C CZ  . TYR D 2 5   ? -47.373 104.310 -140.318 1.00 32.69 ? 489 TYR D CZ  1 
ATOM   3882 O OH  . TYR D 2 5   ? -47.445 105.552 -139.735 1.00 36.11 ? 489 TYR D OH  1 
ATOM   3883 N N   . GLY D 2 6   ? -47.498 98.220  -144.094 1.00 24.12 ? 490 GLY D N   1 
ATOM   3884 C CA  . GLY D 2 6   ? -47.134 96.892  -144.549 1.00 29.68 ? 490 GLY D CA  1 
ATOM   3885 C C   . GLY D 2 6   ? -45.637 96.788  -144.782 1.00 29.55 ? 490 GLY D C   1 
ATOM   3886 O O   . GLY D 2 6   ? -45.026 97.703  -145.340 1.00 29.10 ? 490 GLY D O   1 
ATOM   3887 N N   . VAL D 2 7   ? -45.043 95.682  -144.343 1.00 31.28 ? 491 VAL D N   1 
ATOM   3888 C CA  . VAL D 2 7   ? -43.621 95.431  -144.562 1.00 31.71 ? 491 VAL D CA  1 
ATOM   3889 C C   . VAL D 2 7   ? -43.445 94.112  -145.309 1.00 31.45 ? 491 VAL D C   1 
ATOM   3890 O O   . VAL D 2 7   ? -44.035 93.097  -144.938 1.00 33.31 ? 491 VAL D O   1 
ATOM   3891 C CB  . VAL D 2 7   ? -42.832 95.391  -143.237 1.00 33.88 ? 491 VAL D CB  1 
ATOM   3892 C CG1 . VAL D 2 7   ? -41.357 95.144  -143.504 1.00 36.57 ? 491 VAL D CG1 1 
ATOM   3893 C CG2 . VAL D 2 7   ? -43.013 96.691  -142.467 1.00 33.81 ? 491 VAL D CG2 1 
ATOM   3894 N N   . SER D 2 8   ? -42.632 94.133  -146.361 1.00 31.97 ? 492 SER D N   1 
ATOM   3895 C CA  . SER D 2 8   ? -42.473 92.978  -147.241 1.00 32.05 ? 492 SER D CA  1 
ATOM   3896 C C   . SER D 2 8   ? -41.778 91.791  -146.579 1.00 35.35 ? 492 SER D C   1 
ATOM   3897 O O   . SER D 2 8   ? -40.851 91.962  -145.783 1.00 37.80 ? 492 SER D O   1 
ATOM   3898 C CB  . SER D 2 8   ? -41.691 93.374  -148.494 1.00 32.04 ? 492 SER D CB  1 
ATOM   3899 O OG  . SER D 2 8   ? -40.311 93.526  -148.206 1.00 30.05 ? 492 SER D OG  1 
ATOM   3900 N N   . ASN D 2 9   ? -42.235 90.588  -146.920 1.00 39.12 ? 493 ASN D N   1 
ATOM   3901 C CA  . ASN D 2 9   ? -41.526 89.369  -146.550 1.00 42.90 ? 493 ASN D CA  1 
ATOM   3902 C C   . ASN D 2 9   ? -40.113 89.397  -147.117 1.00 45.27 ? 493 ASN D C   1 
ATOM   3903 O O   . ASN D 2 9   ? -39.144 89.051  -146.442 1.00 49.16 ? 493 ASN D O   1 
ATOM   3904 C CB  . ASN D 2 9   ? -42.253 88.124  -147.068 1.00 47.62 ? 493 ASN D CB  1 
ATOM   3905 C CG  . ASN D 2 9   ? -43.734 88.123  -146.744 1.00 52.22 ? 493 ASN D CG  1 
ATOM   3906 O OD1 . ASN D 2 9   ? -44.161 88.642  -145.711 1.00 54.37 ? 493 ASN D OD1 1 
ATOM   3907 N ND2 . ASN D 2 9   ? -44.527 87.522  -147.625 1.00 52.47 ? 493 ASN D ND2 1 
ATOM   3908 N N   . THR D 2 10  ? -40.025 89.812  -148.377 1.00 45.89 ? 494 THR D N   1 
ATOM   3909 C CA  . THR D 2 10  ? -38.786 89.815  -149.146 1.00 45.90 ? 494 THR D CA  1 
ATOM   3910 C C   . THR D 2 10  ? -37.815 90.907  -148.698 1.00 46.80 ? 494 THR D C   1 
ATOM   3911 O O   . THR D 2 10  ? -38.228 92.011  -148.340 1.00 44.31 ? 494 THR D O   1 
ATOM   3912 C CB  . THR D 2 10  ? -39.104 89.979  -150.653 1.00 42.51 ? 494 THR D CB  1 
ATOM   3913 O OG1 . THR D 2 10  ? -39.671 88.763  -151.156 1.00 46.22 ? 494 THR D OG1 1 
ATOM   3914 C CG2 . THR D 2 10  ? -37.861 90.324  -151.462 1.00 40.29 ? 494 THR D CG2 1 
ATOM   3915 N N   . SER D 2 11  ? -36.526 90.582  -148.697 1.00 47.12 ? 495 SER D N   1 
ATOM   3916 C CA  . SER D 2 11  ? -35.489 91.567  -148.421 1.00 46.58 ? 495 SER D CA  1 
ATOM   3917 C C   . SER D 2 11  ? -34.274 91.357  -149.317 1.00 43.63 ? 495 SER D C   1 
ATOM   3918 O O   . SER D 2 11  ? -33.947 90.225  -149.677 1.00 48.30 ? 495 SER D O   1 
ATOM   3919 C CB  . SER D 2 11  ? -35.074 91.512  -146.951 1.00 51.39 ? 495 SER D CB  1 
ATOM   3920 O OG  . SER D 2 11  ? -36.084 92.051  -146.120 1.00 55.49 ? 495 SER D OG  1 
ATOM   3921 N N   . ILE D 2 12  ? -33.619 92.455  -149.683 1.00 36.58 ? 496 ILE D N   1 
ATOM   3922 C CA  . ILE D 2 12  ? -32.364 92.396  -150.424 1.00 35.87 ? 496 ILE D CA  1 
ATOM   3923 C C   . ILE D 2 12  ? -31.225 92.782  -149.486 1.00 36.03 ? 496 ILE D C   1 
ATOM   3924 O O   . ILE D 2 12  ? -31.226 93.875  -148.919 1.00 35.81 ? 496 ILE D O   1 
ATOM   3925 C CB  . ILE D 2 12  ? -32.372 93.330  -151.651 1.00 35.85 ? 496 ILE D CB  1 
ATOM   3926 C CG1 . ILE D 2 12  ? -33.662 93.148  -152.452 1.00 34.58 ? 496 ILE D CG1 1 
ATOM   3927 C CG2 . ILE D 2 12  ? -31.148 93.079  -152.526 1.00 37.18 ? 496 ILE D CG2 1 
ATOM   3928 C CD1 . ILE D 2 12  ? -33.762 94.047  -153.663 1.00 30.50 ? 496 ILE D CD1 1 
ATOM   3929 N N   . ASN D 2 13  ? -30.265 91.880  -149.310 1.00 37.61 ? 497 ASN D N   1 
ATOM   3930 C CA  . ASN D 2 13  ? -29.222 92.078  -148.309 1.00 39.98 ? 497 ASN D CA  1 
ATOM   3931 C C   . ASN D 2 13  ? -27.820 92.151  -148.903 1.00 40.44 ? 497 ASN D C   1 
ATOM   3932 O O   . ASN D 2 13  ? -27.439 91.308  -149.715 1.00 39.89 ? 497 ASN D O   1 
ATOM   3933 C CB  . ASN D 2 13  ? -29.276 90.955  -147.268 1.00 42.04 ? 497 ASN D CB  1 
ATOM   3934 C CG  . ASN D 2 13  ? -30.613 90.878  -146.555 1.00 43.46 ? 497 ASN D CG  1 
ATOM   3935 O OD1 . ASN D 2 13  ? -31.669 91.052  -147.163 1.00 44.57 ? 497 ASN D OD1 1 
ATOM   3936 N ND2 . ASN D 2 13  ? -30.573 90.615  -145.254 1.00 44.25 ? 497 ASN D ND2 1 
ATOM   3937 N N   . ARG D 2 14  ? -27.053 93.158  -148.493 1.00 40.98 ? 498 ARG D N   1 
ATOM   3938 C CA  . ARG D 2 14  ? -25.657 93.264  -148.903 1.00 43.29 ? 498 ARG D CA  1 
ATOM   3939 C C   . ARG D 2 14  ? -24.725 93.076  -147.715 1.00 48.48 ? 498 ARG D C   1 
ATOM   3940 O O   . ARG D 2 14  ? -24.765 93.848  -146.756 1.00 50.45 ? 498 ARG D O   1 
ATOM   3941 C CB  . ARG D 2 14  ? -25.378 94.610  -149.570 1.00 41.54 ? 498 ARG D CB  1 
ATOM   3942 C CG  . ARG D 2 14  ? -23.903 94.839  -149.875 1.00 47.16 ? 498 ARG D CG  1 
ATOM   3943 C CD  . ARG D 2 14  ? -23.717 95.849  -150.992 1.00 49.13 ? 498 ARG D CD  1 
ATOM   3944 N NE  . ARG D 2 14  ? -24.245 95.352  -152.260 1.00 49.00 ? 498 ARG D NE  1 
ATOM   3945 C CZ  . ARG D 2 14  ? -24.425 96.101  -153.345 1.00 48.18 ? 498 ARG D CZ  1 
ATOM   3946 N NH1 . ARG D 2 14  ? -24.129 97.393  -153.320 1.00 47.40 ? 498 ARG D NH1 1 
ATOM   3947 N NH2 . ARG D 2 14  ? -24.908 95.559  -154.455 1.00 47.28 ? 498 ARG D NH2 1 
ATOM   3948 N N   . LYS D 2 15  ? -23.884 92.048  -147.787 1.00 49.99 ? 499 LYS D N   1 
ATOM   3949 C CA  . LYS D 2 15  ? -22.936 91.753  -146.720 1.00 51.95 ? 499 LYS D CA  1 
ATOM   3950 C C   . LYS D 2 15  ? -21.497 91.896  -147.203 1.00 54.97 ? 499 LYS D C   1 
ATOM   3951 O O   . LYS D 2 15  ? -21.201 91.660  -148.373 1.00 57.32 ? 499 LYS D O   1 
ATOM   3952 C CB  . LYS D 2 15  ? -23.168 90.345  -146.173 1.00 52.34 ? 499 LYS D CB  1 
ATOM   3953 C CG  . LYS D 2 15  ? -22.208 89.946  -145.064 1.00 53.69 ? 499 LYS D CG  1 
ATOM   3954 C CD  . LYS D 2 15  ? -22.956 89.324  -143.896 1.00 52.91 ? 499 LYS D CD  1 
ATOM   3955 C CE  . LYS D 2 15  ? -23.974 88.300  -144.373 1.00 53.32 ? 499 LYS D CE  1 
ATOM   3956 N NZ  . LYS D 2 15  ? -24.367 87.362  -143.284 1.00 56.69 ? 499 LYS D NZ  1 
HETATM 3957 O O   . HOH E 3 .   ? -35.286 75.965  -145.382 1.00 21.25 ? 301 HOH A O   1 
HETATM 3958 O O   . HOH E 3 .   ? -57.525 51.603  -143.109 1.00 28.88 ? 302 HOH A O   1 
HETATM 3959 O O   . HOH E 3 .   ? -37.988 56.030  -111.702 1.00 39.66 ? 303 HOH A O   1 
HETATM 3960 O O   . HOH E 3 .   ? -45.820 56.225  -125.106 1.00 39.53 ? 304 HOH A O   1 
HETATM 3961 O O   . HOH E 3 .   ? -55.632 88.948  -118.743 1.00 44.03 ? 305 HOH A O   1 
HETATM 3962 O O   . HOH E 3 .   ? -57.866 68.698  -152.828 1.00 37.81 ? 306 HOH A O   1 
HETATM 3963 O O   . HOH E 3 .   ? -58.105 88.127  -116.413 1.00 42.46 ? 307 HOH A O   1 
HETATM 3964 O O   . HOH E 3 .   ? -30.602 60.806  -141.969 1.00 42.05 ? 308 HOH A O   1 
HETATM 3965 O O   . HOH E 3 .   ? -52.985 54.967  -137.571 1.00 25.20 ? 309 HOH A O   1 
HETATM 3966 O O   . HOH E 3 .   ? -45.226 91.589  -122.297 1.00 21.14 ? 310 HOH A O   1 
HETATM 3967 O O   . HOH E 3 .   ? -60.948 67.239  -143.315 1.00 29.19 ? 311 HOH A O   1 
HETATM 3968 O O   . HOH E 3 .   ? -49.251 89.404  -128.641 1.00 19.94 ? 312 HOH A O   1 
HETATM 3969 O O   . HOH E 3 .   ? -52.914 54.890  -140.822 1.00 32.78 ? 313 HOH A O   1 
HETATM 3970 O O   . HOH E 3 .   ? -62.039 76.446  -108.220 1.00 25.26 ? 314 HOH A O   1 
HETATM 3971 O O   . HOH E 3 .   ? -71.699 63.918  -143.275 1.00 43.55 ? 315 HOH A O   1 
HETATM 3972 O O   . HOH E 3 .   ? -29.390 62.678  -140.911 1.00 50.71 ? 316 HOH A O   1 
HETATM 3973 O O   . HOH E 3 .   ? -48.413 54.636  -138.569 1.00 24.13 ? 317 HOH A O   1 
HETATM 3974 O O   . HOH E 3 .   ? -53.563 85.687  -117.272 1.00 41.19 ? 318 HOH A O   1 
HETATM 3975 O O   . HOH E 3 .   ? -65.862 64.048  -146.342 1.00 37.72 ? 319 HOH A O   1 
HETATM 3976 O O   . HOH E 3 .   ? -49.279 59.570  -118.831 1.00 29.08 ? 320 HOH A O   1 
HETATM 3977 O O   . HOH E 3 .   ? -64.419 69.192  -139.224 1.00 36.05 ? 321 HOH A O   1 
HETATM 3978 O O   . HOH E 3 .   ? -29.718 67.939  -138.204 1.00 32.20 ? 322 HOH A O   1 
HETATM 3979 O O   . HOH E 3 .   ? -46.547 71.777  -108.203 1.00 32.03 ? 323 HOH A O   1 
HETATM 3980 O O   . HOH E 3 .   ? -34.311 85.213  -118.517 1.00 31.82 ? 324 HOH A O   1 
HETATM 3981 O O   . HOH E 3 .   ? -48.984 71.411  -108.743 1.00 19.48 ? 325 HOH A O   1 
HETATM 3982 O O   . HOH E 3 .   ? -33.328 80.138  -144.250 1.00 25.51 ? 326 HOH A O   1 
HETATM 3983 O O   . HOH E 3 .   ? -56.604 72.860  -156.949 1.00 56.96 ? 327 HOH A O   1 
HETATM 3984 O O   . HOH E 3 .   ? -54.068 68.740  -154.625 1.00 47.09 ? 328 HOH A O   1 
HETATM 3985 O O   . HOH E 3 .   ? -29.923 78.003  -133.995 1.00 22.25 ? 329 HOH A O   1 
HETATM 3986 O O   . HOH E 3 .   ? -36.358 68.501  -120.643 1.00 14.56 ? 330 HOH A O   1 
HETATM 3987 O O   . HOH E 3 .   ? -36.865 58.518  -140.381 1.00 38.18 ? 331 HOH A O   1 
HETATM 3988 O O   . HOH E 3 .   ? -65.348 66.897  -138.008 1.00 17.61 ? 332 HOH A O   1 
HETATM 3989 O O   . HOH E 3 .   ? -48.861 64.915  -141.409 1.00 17.45 ? 333 HOH A O   1 
HETATM 3990 O O   . HOH E 3 .   ? -76.252 65.160  -119.243 1.00 18.47 ? 334 HOH A O   1 
HETATM 3991 O O   . HOH E 3 .   ? -27.055 73.142  -132.582 1.00 24.64 ? 335 HOH A O   1 
HETATM 3992 O O   . HOH E 3 .   ? -42.218 68.640  -149.710 1.00 37.79 ? 336 HOH A O   1 
HETATM 3993 O O   . HOH E 3 .   ? -41.174 66.375  -144.964 1.00 32.91 ? 337 HOH A O   1 
HETATM 3994 O O   . HOH E 3 .   ? -49.752 78.995  -144.700 1.00 22.10 ? 338 HOH A O   1 
HETATM 3995 O O   . HOH E 3 .   ? -50.166 68.640  -110.842 1.00 29.05 ? 339 HOH A O   1 
HETATM 3996 O O   . HOH E 3 .   ? -72.010 65.389  -135.364 1.00 27.73 ? 340 HOH A O   1 
HETATM 3997 O O   . HOH E 3 .   ? -64.831 55.508  -140.529 1.00 37.65 ? 341 HOH A O   1 
HETATM 3998 O O   . HOH E 3 .   ? -49.203 85.310  -133.466 1.00 25.40 ? 342 HOH A O   1 
HETATM 3999 O O   . HOH E 3 .   ? -37.308 79.890  -115.545 1.00 33.51 ? 343 HOH A O   1 
HETATM 4000 O O   . HOH E 3 .   ? -61.792 76.105  -140.082 1.00 35.81 ? 344 HOH A O   1 
HETATM 4001 O O   . HOH E 3 .   ? -47.504 59.182  -136.274 1.00 41.87 ? 345 HOH A O   1 
HETATM 4002 O O   . HOH E 3 .   ? -52.659 57.406  -127.952 1.00 39.43 ? 346 HOH A O   1 
HETATM 4003 O O   . HOH E 3 .   ? -53.948 78.927  -128.097 1.00 18.82 ? 347 HOH A O   1 
HETATM 4004 O O   . HOH E 3 .   ? -31.235 75.228  -124.029 1.00 28.05 ? 348 HOH A O   1 
HETATM 4005 O O   . HOH E 3 .   ? -36.558 75.026  -136.417 1.00 8.41  ? 349 HOH A O   1 
HETATM 4006 O O   . HOH E 3 .   ? -57.297 82.057  -145.305 1.00 30.95 ? 350 HOH A O   1 
HETATM 4007 O O   . HOH E 3 .   ? -37.343 83.458  -139.597 1.00 49.74 ? 351 HOH A O   1 
HETATM 4008 O O   . HOH E 3 .   ? -45.795 72.601  -116.038 1.00 19.37 ? 352 HOH A O   1 
HETATM 4009 O O   . HOH E 3 .   ? -40.566 68.829  -146.350 1.00 21.44 ? 353 HOH A O   1 
HETATM 4010 O O   . HOH E 3 .   ? -32.488 61.434  -119.060 1.00 48.71 ? 354 HOH A O   1 
HETATM 4011 O O   . HOH E 3 .   ? -62.602 58.417  -112.380 1.00 40.77 ? 355 HOH A O   1 
HETATM 4012 O O   . HOH E 3 .   ? -41.900 75.702  -114.646 1.00 37.83 ? 356 HOH A O   1 
HETATM 4013 O O   . HOH E 3 .   ? -63.598 59.785  -126.440 1.00 15.51 ? 357 HOH A O   1 
HETATM 4014 O O   . HOH E 3 .   ? -63.060 77.811  -125.007 1.00 29.57 ? 358 HOH A O   1 
HETATM 4015 O O   . HOH E 3 .   ? -28.037 78.217  -121.149 1.00 31.14 ? 359 HOH A O   1 
HETATM 4016 O O   . HOH E 3 .   ? -56.797 64.936  -141.853 1.00 21.86 ? 360 HOH A O   1 
HETATM 4017 O O   . HOH E 3 .   ? -69.837 61.358  -132.141 1.00 28.47 ? 361 HOH A O   1 
HETATM 4018 O O   . HOH E 3 .   ? -49.881 85.519  -141.581 1.00 25.55 ? 362 HOH A O   1 
HETATM 4019 O O   . HOH E 3 .   ? -48.829 56.520  -131.576 1.00 45.71 ? 363 HOH A O   1 
HETATM 4020 O O   . HOH E 3 .   ? -64.408 60.295  -112.857 1.00 36.60 ? 364 HOH A O   1 
HETATM 4021 O O   . HOH E 3 .   ? -55.376 62.402  -112.742 1.00 34.86 ? 365 HOH A O   1 
HETATM 4022 O O   . HOH E 3 .   ? -52.258 84.029  -118.709 1.00 37.62 ? 366 HOH A O   1 
HETATM 4023 O O   . HOH E 3 .   ? -52.702 60.001  -112.261 1.00 40.46 ? 367 HOH A O   1 
HETATM 4024 O O   . HOH E 3 .   ? -54.688 76.818  -129.543 1.00 27.30 ? 368 HOH A O   1 
HETATM 4025 O O   . HOH E 3 .   ? -32.604 66.322  -119.942 1.00 22.88 ? 369 HOH A O   1 
HETATM 4026 O O   . HOH E 3 .   ? -66.440 76.046  -119.779 1.00 32.60 ? 370 HOH A O   1 
HETATM 4027 O O   . HOH E 3 .   ? -53.291 81.130  -119.446 1.00 40.92 ? 371 HOH A O   1 
HETATM 4028 O O   . HOH E 3 .   ? -66.271 75.767  -111.978 1.00 40.83 ? 372 HOH A O   1 
HETATM 4029 O O   . HOH E 3 .   ? -36.201 82.914  -119.474 1.00 44.94 ? 373 HOH A O   1 
HETATM 4030 O O   . HOH E 3 .   ? -41.859 79.381  -146.860 1.00 37.86 ? 374 HOH A O   1 
HETATM 4031 O O   . HOH E 3 .   ? -42.526 76.983  -150.509 1.00 37.11 ? 375 HOH A O   1 
HETATM 4032 O O   . HOH E 3 .   ? -66.029 56.440  -134.059 1.00 39.72 ? 376 HOH A O   1 
HETATM 4033 O O   . HOH E 3 .   ? -60.044 63.014  -141.544 1.00 15.96 ? 377 HOH A O   1 
HETATM 4034 O O   . HOH E 3 .   ? -59.790 62.364  -112.237 1.00 46.44 ? 378 HOH A O   1 
HETATM 4035 O O   . HOH E 3 .   ? -61.600 58.046  -115.128 1.00 37.51 ? 379 HOH A O   1 
HETATM 4036 O O   . HOH E 3 .   ? -39.336 73.262  -144.266 1.00 37.90 ? 380 HOH A O   1 
HETATM 4037 O O   . HOH E 3 .   ? -44.404 58.072  -132.841 1.00 36.92 ? 381 HOH A O   1 
HETATM 4038 O O   . HOH E 3 .   ? -58.690 61.520  -149.336 1.00 40.61 ? 382 HOH A O   1 
HETATM 4039 O O   . HOH E 3 .   ? -55.349 64.974  -146.029 1.00 40.58 ? 383 HOH A O   1 
HETATM 4040 O O   . HOH E 3 .   ? -59.060 74.685  -116.340 1.00 45.95 ? 384 HOH A O   1 
HETATM 4041 O O   . HOH E 3 .   ? -23.617 76.743  -137.406 1.00 31.58 ? 385 HOH A O   1 
HETATM 4042 O O   . HOH E 3 .   ? -66.560 59.485  -120.585 1.00 35.83 ? 386 HOH A O   1 
HETATM 4043 O O   . HOH E 3 .   ? -68.928 64.256  -115.029 1.00 34.39 ? 387 HOH A O   1 
HETATM 4044 O O   . HOH E 3 .   ? -66.164 71.148  -136.212 1.00 29.57 ? 388 HOH A O   1 
HETATM 4045 O O   . HOH E 3 .   ? -48.493 62.990  -133.855 1.00 11.32 ? 389 HOH A O   1 
HETATM 4046 O O   . HOH E 3 .   ? -51.143 59.374  -116.803 1.00 27.24 ? 390 HOH A O   1 
HETATM 4047 O O   . HOH E 3 .   ? -45.846 62.976  -115.188 1.00 19.64 ? 391 HOH A O   1 
HETATM 4048 O O   . HOH E 3 .   ? -34.117 81.727  -118.148 1.00 34.75 ? 392 HOH A O   1 
HETATM 4049 O O   . HOH E 3 .   ? -58.405 76.269  -113.236 1.00 33.15 ? 393 HOH A O   1 
HETATM 4050 O O   . HOH E 3 .   ? -66.809 71.801  -115.277 1.00 33.30 ? 394 HOH A O   1 
HETATM 4051 O O   . HOH E 3 .   ? -57.326 79.324  -138.873 1.00 25.71 ? 395 HOH A O   1 
HETATM 4052 O O   . HOH E 3 .   ? -56.415 82.074  -139.118 1.00 31.28 ? 396 HOH A O   1 
HETATM 4053 O O   . HOH E 3 .   ? -53.005 86.481  -135.733 1.00 31.85 ? 397 HOH A O   1 
HETATM 4054 O O   . HOH E 3 .   ? -38.339 77.210  -141.217 1.00 25.13 ? 398 HOH A O   1 
HETATM 4055 O O   . HOH E 3 .   ? -61.119 50.654  -129.401 1.00 34.69 ? 399 HOH A O   1 
HETATM 4056 O O   . HOH E 3 .   ? -33.894 85.468  -128.288 1.00 42.96 ? 400 HOH A O   1 
HETATM 4057 O O   . HOH E 3 .   ? -58.628 81.709  -119.576 1.00 47.40 ? 401 HOH A O   1 
HETATM 4058 O O   . HOH E 3 .   ? -72.154 72.126  -132.661 1.00 28.27 ? 402 HOH A O   1 
HETATM 4059 O O   . HOH E 3 .   ? -66.050 76.019  -132.930 1.00 32.20 ? 403 HOH A O   1 
HETATM 4060 O O   . HOH E 3 .   ? -50.928 67.915  -147.326 1.00 39.19 ? 404 HOH A O   1 
HETATM 4061 O O   . HOH E 3 .   ? -47.220 76.593  -150.763 1.00 46.81 ? 405 HOH A O   1 
HETATM 4062 O O   . HOH E 3 .   ? -48.218 79.920  -152.910 1.00 45.89 ? 406 HOH A O   1 
HETATM 4063 O O   . HOH E 3 .   ? -28.550 63.343  -120.379 1.00 42.93 ? 407 HOH A O   1 
HETATM 4064 O O   . HOH E 3 .   ? -30.438 68.478  -116.967 1.00 47.14 ? 408 HOH A O   1 
HETATM 4065 O O   . HOH F 3 .   ? -26.474 80.008  -121.565 1.00 22.08 ? 601 HOH B O   1 
HETATM 4066 O O   . HOH F 3 .   ? -28.973 80.841  -122.929 1.00 29.87 ? 602 HOH B O   1 
HETATM 4067 O O   . HOH F 3 .   ? -39.660 80.916  -138.151 1.00 32.98 ? 603 HOH B O   1 
HETATM 4068 O O   . HOH F 3 .   ? -35.080 84.512  -134.509 1.00 33.06 ? 604 HOH B O   1 
HETATM 4069 O O   . HOH F 3 .   ? -37.404 85.944  -132.814 1.00 54.07 ? 605 HOH B O   1 
HETATM 4070 O O   . HOH F 3 .   ? -29.418 79.678  -132.474 1.00 23.71 ? 606 HOH B O   1 
HETATM 4071 O O   . HOH F 3 .   ? -32.180 85.925  -133.347 1.00 23.71 ? 607 HOH B O   1 
HETATM 4072 O O   . HOH F 3 .   ? -24.211 83.675  -127.423 1.00 46.47 ? 608 HOH B O   1 
HETATM 4073 O O   . HOH F 3 .   ? -23.695 82.832  -123.415 1.00 56.80 ? 609 HOH B O   1 
HETATM 4074 O O   . HOH G 3 .   ? -40.567 104.658 -184.556 1.00 19.56 ? 301 HOH C O   1 
HETATM 4075 O O   . HOH G 3 .   ? -33.266 107.413 -174.482 1.00 35.04 ? 302 HOH C O   1 
HETATM 4076 O O   . HOH G 3 .   ? -48.401 118.365 -151.882 1.00 30.22 ? 303 HOH C O   1 
HETATM 4077 O O   . HOH G 3 .   ? -50.367 118.452 -149.018 1.00 25.71 ? 304 HOH C O   1 
HETATM 4078 O O   . HOH G 3 .   ? -55.490 121.418 -149.982 1.00 39.69 ? 305 HOH C O   1 
HETATM 4079 O O   . HOH G 3 .   ? -51.081 111.703 -133.132 1.00 41.23 ? 306 HOH C O   1 
HETATM 4080 O O   . HOH G 3 .   ? -33.501 96.368  -178.501 1.00 56.18 ? 307 HOH C O   1 
HETATM 4081 O O   . HOH G 3 .   ? -49.059 102.590 -177.996 1.00 26.87 ? 308 HOH C O   1 
HETATM 4082 O O   . HOH G 3 .   ? -34.751 81.637  -161.219 1.00 27.09 ? 309 HOH C O   1 
HETATM 4083 O O   . HOH G 3 .   ? -57.356 118.656 -147.483 1.00 34.56 ? 310 HOH C O   1 
HETATM 4084 O O   . HOH G 3 .   ? -33.186 103.251 -137.414 1.00 24.52 ? 311 HOH C O   1 
HETATM 4085 O O   . HOH G 3 .   ? -31.834 112.819 -137.370 1.00 30.39 ? 312 HOH C O   1 
HETATM 4086 O O   . HOH G 3 .   ? -32.462 104.506 -173.354 1.00 36.42 ? 313 HOH C O   1 
HETATM 4087 O O   . HOH G 3 .   ? -57.539 110.216 -178.376 1.00 37.29 ? 314 HOH C O   1 
HETATM 4088 O O   . HOH G 3 .   ? -24.751 100.899 -139.019 1.00 31.10 ? 315 HOH C O   1 
HETATM 4089 O O   . HOH G 3 .   ? -63.382 108.330 -167.061 1.00 43.00 ? 316 HOH C O   1 
HETATM 4090 O O   . HOH G 3 .   ? -59.133 112.174 -177.907 1.00 21.15 ? 317 HOH C O   1 
HETATM 4091 O O   . HOH G 3 .   ? -42.234 97.537  -182.347 1.00 27.14 ? 318 HOH C O   1 
HETATM 4092 O O   . HOH G 3 .   ? -36.115 114.121 -168.760 1.00 30.22 ? 319 HOH C O   1 
HETATM 4093 O O   . HOH G 3 .   ? -53.370 96.895  -161.340 1.00 24.17 ? 320 HOH C O   1 
HETATM 4094 O O   . HOH G 3 .   ? -40.877 110.372 -147.140 1.00 31.59 ? 321 HOH C O   1 
HETATM 4095 O O   . HOH G 3 .   ? -46.442 116.335 -166.338 1.00 31.53 ? 322 HOH C O   1 
HETATM 4096 O O   . HOH G 3 .   ? -25.713 104.108 -158.570 1.00 25.59 ? 323 HOH C O   1 
HETATM 4097 O O   . HOH G 3 .   ? -44.144 114.044 -150.366 1.00 19.74 ? 324 HOH C O   1 
HETATM 4098 O O   . HOH G 3 .   ? -41.596 98.676  -139.888 1.00 30.94 ? 325 HOH C O   1 
HETATM 4099 O O   . HOH G 3 .   ? -50.966 114.637 -173.741 1.00 21.12 ? 326 HOH C O   1 
HETATM 4100 O O   . HOH G 3 .   ? -27.630 95.083  -143.351 1.00 21.90 ? 327 HOH C O   1 
HETATM 4101 O O   . HOH G 3 .   ? -53.908 108.672 -150.062 1.00 38.68 ? 328 HOH C O   1 
HETATM 4102 O O   . HOH G 3 .   ? -45.041 94.300  -161.044 1.00 20.97 ? 329 HOH C O   1 
HETATM 4103 O O   . HOH G 3 .   ? -58.547 110.295 -146.220 1.00 40.33 ? 330 HOH C O   1 
HETATM 4104 O O   . HOH G 3 .   ? -42.974 110.325 -152.790 1.00 19.27 ? 331 HOH C O   1 
HETATM 4105 O O   . HOH G 3 .   ? -37.235 111.092 -174.970 1.00 31.13 ? 332 HOH C O   1 
HETATM 4106 O O   . HOH G 3 .   ? -49.954 94.818  -144.776 1.00 18.24 ? 333 HOH C O   1 
HETATM 4107 O O   . HOH G 3 .   ? -50.598 109.540 -143.393 1.00 26.39 ? 334 HOH C O   1 
HETATM 4108 O O   . HOH G 3 .   ? -59.582 102.534 -160.393 1.00 25.99 ? 335 HOH C O   1 
HETATM 4109 O O   . HOH G 3 .   ? -30.514 114.488 -138.199 1.00 32.84 ? 336 HOH C O   1 
HETATM 4110 O O   . HOH G 3 .   ? -46.140 96.547  -160.232 1.00 33.26 ? 337 HOH C O   1 
HETATM 4111 O O   . HOH G 3 .   ? -34.410 98.167  -144.757 1.00 18.47 ? 338 HOH C O   1 
HETATM 4112 O O   . HOH G 3 .   ? -56.988 110.322 -152.279 1.00 25.55 ? 339 HOH C O   1 
HETATM 4113 O O   . HOH G 3 .   ? -56.791 108.310 -150.417 1.00 37.68 ? 340 HOH C O   1 
HETATM 4114 O O   . HOH G 3 .   ? -42.436 116.734 -154.870 1.00 32.24 ? 341 HOH C O   1 
HETATM 4115 O O   . HOH G 3 .   ? -31.878 103.813 -170.878 1.00 19.77 ? 342 HOH C O   1 
HETATM 4116 O O   . HOH G 3 .   ? -24.255 100.345 -143.308 1.00 25.00 ? 343 HOH C O   1 
HETATM 4117 O O   . HOH G 3 .   ? -39.207 93.926  -140.837 1.00 28.12 ? 344 HOH C O   1 
HETATM 4118 O O   . HOH G 3 .   ? -28.799 89.815  -151.882 1.00 54.81 ? 345 HOH C O   1 
HETATM 4119 O O   . HOH G 3 .   ? -41.317 112.720 -145.668 1.00 21.71 ? 346 HOH C O   1 
HETATM 4120 O O   . HOH G 3 .   ? -47.593 108.171 -146.741 1.00 16.48 ? 347 HOH C O   1 
HETATM 4121 O O   . HOH G 3 .   ? -47.093 108.159 -178.213 1.00 30.01 ? 348 HOH C O   1 
HETATM 4122 O O   . HOH G 3 .   ? -46.418 111.139 -146.493 1.00 35.07 ? 349 HOH C O   1 
HETATM 4123 O O   . HOH G 3 .   ? -32.035 101.211 -166.947 1.00 22.84 ? 350 HOH C O   1 
HETATM 4124 O O   . HOH G 3 .   ? -38.306 96.586  -141.485 1.00 29.96 ? 351 HOH C O   1 
HETATM 4125 O O   . HOH G 3 .   ? -54.779 96.836  -169.853 1.00 41.38 ? 352 HOH C O   1 
HETATM 4126 O O   . HOH G 3 .   ? -55.092 107.838 -172.244 1.00 41.11 ? 353 HOH C O   1 
HETATM 4127 O O   . HOH G 3 .   ? -22.917 106.634 -156.512 1.00 32.69 ? 354 HOH C O   1 
HETATM 4128 O O   . HOH G 3 .   ? -39.998 92.062  -168.439 1.00 29.62 ? 355 HOH C O   1 
HETATM 4129 O O   . HOH G 3 .   ? -43.729 87.626  -153.587 1.00 26.07 ? 356 HOH C O   1 
HETATM 4130 O O   . HOH G 3 .   ? -39.250 88.586  -168.625 1.00 38.99 ? 357 HOH C O   1 
HETATM 4131 O O   . HOH G 3 .   ? -50.108 94.212  -174.194 1.00 31.06 ? 358 HOH C O   1 
HETATM 4132 O O   . HOH G 3 .   ? -36.907 87.109  -153.365 1.00 39.25 ? 359 HOH C O   1 
HETATM 4133 O O   . HOH G 3 .   ? -52.461 88.439  -142.494 1.00 35.96 ? 360 HOH C O   1 
HETATM 4134 O O   . HOH G 3 .   ? -29.648 90.450  -168.901 1.00 37.26 ? 361 HOH C O   1 
HETATM 4135 O O   . HOH G 3 .   ? -40.183 109.028 -175.945 1.00 38.21 ? 362 HOH C O   1 
HETATM 4136 O O   . HOH G 3 .   ? -52.012 92.723  -162.259 1.00 43.04 ? 363 HOH C O   1 
HETATM 4137 O O   . HOH G 3 .   ? -53.725 93.824  -153.365 1.00 28.00 ? 364 HOH C O   1 
HETATM 4138 O O   . HOH G 3 .   ? -57.821 97.216  -154.234 1.00 45.12 ? 365 HOH C O   1 
HETATM 4139 O O   . HOH G 3 .   ? -60.569 112.824 -141.041 1.00 36.10 ? 366 HOH C O   1 
HETATM 4140 O O   . HOH G 3 .   ? -42.947 112.412 -164.379 1.00 23.54 ? 367 HOH C O   1 
HETATM 4141 O O   . HOH G 3 .   ? -65.190 102.978 -167.290 1.00 54.48 ? 368 HOH C O   1 
HETATM 4142 O O   . HOH G 3 .   ? -59.713 119.369 -153.555 1.00 49.71 ? 369 HOH C O   1 
HETATM 4143 O O   . HOH G 3 .   ? -56.915 121.329 -153.503 1.00 40.81 ? 370 HOH C O   1 
HETATM 4144 O O   . HOH G 3 .   ? -45.185 93.730  -164.708 1.00 44.85 ? 371 HOH C O   1 
HETATM 4145 O O   . HOH G 3 .   ? -22.517 102.320 -157.418 1.00 54.34 ? 372 HOH C O   1 
HETATM 4146 O O   . HOH G 3 .   ? -30.164 102.565 -140.704 1.00 23.71 ? 373 HOH C O   1 
HETATM 4147 O O   . HOH G 3 .   ? -37.340 92.488  -138.109 1.00 45.33 ? 374 HOH C O   1 
HETATM 4148 O O   . HOH G 3 .   ? -40.164 113.365 -170.803 1.00 23.71 ? 375 HOH C O   1 
HETATM 4149 O O   . HOH H 3 .   ? -23.734 90.360  -149.693 1.00 39.71 ? 601 HOH D O   1 
HETATM 4150 O O   . HOH H 3 .   ? -40.618 91.642  -142.602 1.00 36.34 ? 602 HOH D O   1 
HETATM 4151 O O   . HOH H 3 .   ? -50.303 101.588 -136.323 1.00 52.18 ? 603 HOH D O   1 
HETATM 4152 O O   . HOH H 3 .   ? -37.961 92.680  -144.656 1.00 32.76 ? 604 HOH D O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . ASP A 17  ? 0.3287 0.6899 0.5404 -0.0549 0.0766  0.0270  17  ASP A N   
2    C CA  . ASP A 17  ? 0.3670 0.6884 0.5555 -0.0536 0.0664  0.0209  17  ASP A CA  
3    C C   . ASP A 17  ? 0.4465 0.7534 0.6236 -0.0329 0.0692  0.0135  17  ASP A C   
4    O O   . ASP A 17  ? 0.4430 0.7497 0.6259 -0.0236 0.0616  0.0110  17  ASP A O   
5    C CB  . ASP A 17  ? 0.3353 0.6559 0.5319 -0.0627 0.0510  0.0209  17  ASP A CB  
6    C CG  . ASP A 17  ? 0.3497 0.6306 0.5226 -0.0617 0.0418  0.0147  17  ASP A CG  
7    O OD1 . ASP A 17  ? 0.3551 0.6083 0.5070 -0.0609 0.0459  0.0125  17  ASP A OD1 
8    O OD2 . ASP A 17  ? 0.2981 0.5773 0.4737 -0.0618 0.0305  0.0125  17  ASP A OD2 
9    N N   . SER A 18  ? 0.4653 0.7599 0.6253 -0.0266 0.0798  0.0105  18  SER A N   
10   C CA  . SER A 18  ? 0.4120 0.6882 0.5581 -0.0094 0.0827  0.0025  18  SER A CA  
11   C C   . SER A 18  ? 0.4360 0.6848 0.5540 -0.0116 0.0868  -0.0008 18  SER A C   
12   O O   . SER A 18  ? 0.5102 0.7619 0.6220 -0.0228 0.0915  0.0041  18  SER A O   
13   C CB  . SER A 18  ? 0.3568 0.6582 0.5180 0.0064  0.0942  0.0006  18  SER A CB  
14   O OG  . SER A 18  ? 0.4072 0.7257 0.5676 0.0034  0.1081  0.0026  18  SER A OG  
15   N N   . ILE A 19  ? 0.3847 0.6077 0.4862 -0.0016 0.0843  -0.0082 19  ILE A N   
16   C CA  . ILE A 19  ? 0.3548 0.5535 0.4303 -0.0033 0.0865  -0.0115 19  ILE A CA  
17   C C   . ILE A 19  ? 0.4005 0.6046 0.4672 0.0073  0.0995  -0.0178 19  ILE A C   
18   O O   . ILE A 19  ? 0.4447 0.6428 0.5113 0.0211  0.1017  -0.0255 19  ILE A O   
19   C CB  . ILE A 19  ? 0.3213 0.4890 0.3834 -0.0007 0.0763  -0.0161 19  ILE A CB  
20   C CG1 . ILE A 19  ? 0.3404 0.5026 0.4095 -0.0106 0.0649  -0.0112 19  ILE A CG1 
21   C CG2 . ILE A 19  ? 0.2950 0.4414 0.3326 -0.0035 0.0773  -0.0184 19  ILE A CG2 
22   C CD1 . ILE A 19  ? 0.3219 0.4662 0.3888 -0.0045 0.0558  -0.0151 19  ILE A CD1 
23   N N   . ASP A 20  ? 0.3872 0.6017 0.4456 0.0005  0.1084  -0.0144 20  ASP A N   
24   C CA  . ASP A 20  ? 0.3529 0.5780 0.4031 0.0092  0.1228  -0.0202 20  ASP A CA  
25   C C   . ASP A 20  ? 0.3352 0.5354 0.3544 0.0107  0.1238  -0.0277 20  ASP A C   
26   O O   . ASP A 20  ? 0.3933 0.5987 0.3996 0.0164  0.1356  -0.0340 20  ASP A O   
27   C CB  . ASP A 20  ? 0.3839 0.6382 0.4418 0.0008  0.1335  -0.0118 20  ASP A CB  
28   C CG  . ASP A 20  ? 0.4696 0.7528 0.5603 -0.0022 0.1325  -0.0044 20  ASP A CG  
29   O OD1 . ASP A 20  ? 0.4911 0.7839 0.6000 0.0100  0.1319  -0.0082 20  ASP A OD1 
30   O OD2 . ASP A 20  ? 0.5206 0.8168 0.6191 -0.0171 0.1318  0.0059  20  ASP A OD2 
31   N N   . ASP A 21  ? 0.3173 0.4916 0.3243 0.0054  0.1115  -0.0273 21  ASP A N   
32   C CA  . ASP A 21  ? 0.3801 0.5321 0.3597 0.0058  0.1100  -0.0338 21  ASP A CA  
33   C C   . ASP A 21  ? 0.4366 0.5792 0.4107 0.0198  0.1150  -0.0476 21  ASP A C   
34   O O   . ASP A 21  ? 0.4056 0.5409 0.3931 0.0281  0.1106  -0.0510 21  ASP A O   
35   C CB  . ASP A 21  ? 0.2445 0.3733 0.2181 -0.0010 0.0957  -0.0302 21  ASP A CB  
36   C CG  . ASP A 21  ? 0.2980 0.4082 0.2455 -0.0027 0.0927  -0.0348 21  ASP A CG  
37   O OD1 . ASP A 21  ? 0.3286 0.4249 0.2682 0.0051  0.0921  -0.0456 21  ASP A OD1 
38   O OD2 . ASP A 21  ? 0.2942 0.4034 0.2294 -0.0122 0.0903  -0.0270 21  ASP A OD2 
39   N N   . LYS A 22  ? 0.4905 0.6322 0.4436 0.0222  0.1242  -0.0552 22  LYS A N   
40   C CA  . LYS A 22  ? 0.5078 0.6389 0.4534 0.0352  0.1313  -0.0699 22  LYS A CA  
41   C C   . LYS A 22  ? 0.4916 0.5927 0.4305 0.0377  0.1203  -0.0768 22  LYS A C   
42   O O   . LYS A 22  ? 0.5496 0.6397 0.4933 0.0494  0.1233  -0.0860 22  LYS A O   
43   C CB  . LYS A 22  ? 0.5709 0.7044 0.4896 0.0344  0.1425  -0.0778 22  LYS A CB  
44   C CG  . LYS A 22  ? 0.6077 0.7596 0.5354 0.0425  0.1575  -0.0775 22  LYS A CG  
45   C CD  . LYS A 22  ? 0.5308 0.7132 0.4799 0.0356  0.1605  -0.0631 22  LYS A CD  
46   C CE  . LYS A 22  ? 0.5096 0.7100 0.4722 0.0437  0.1750  -0.0624 22  LYS A CE  
47   N NZ  . LYS A 22  ? 0.5141 0.7058 0.4493 0.0454  0.1854  -0.0691 22  LYS A NZ  
48   N N   . LYS A 23  ? 0.4369 0.5248 0.3658 0.0269  0.1082  -0.0715 23  LYS A N   
49   C CA  . LYS A 23  ? 0.3952 0.4572 0.3185 0.0274  0.0978  -0.0765 23  LYS A CA  
50   C C   . LYS A 23  ? 0.3300 0.3885 0.2762 0.0305  0.0899  -0.0707 23  LYS A C   
51   O O   . LYS A 23  ? 0.2687 0.3092 0.2169 0.0360  0.0857  -0.0761 23  LYS A O   
52   C CB  . LYS A 23  ? 0.4167 0.4692 0.3216 0.0154  0.0883  -0.0725 23  LYS A CB  
53   C CG  . LYS A 23  ? 0.4450 0.5005 0.3233 0.0109  0.0939  -0.0776 23  LYS A CG  
54   C CD  . LYS A 23  ? 0.4862 0.5271 0.3493 0.0180  0.0995  -0.0946 23  LYS A CD  
55   C CE  . LYS A 23  ? 0.5329 0.5766 0.3656 0.0123  0.1043  -0.1008 23  LYS A CE  
56   N NZ  . LYS A 23  ? 0.5829 0.6084 0.4003 0.0191  0.1085  -0.1173 23  LYS A NZ  
57   N N   . TRP A 24  ? 0.3153 0.3908 0.2776 0.0261  0.0881  -0.0598 24  TRP A N   
58   C CA  . TRP A 24  ? 0.3016 0.3759 0.2827 0.0267  0.0798  -0.0538 24  TRP A CA  
59   C C   . TRP A 24  ? 0.3413 0.4161 0.3373 0.0398  0.0825  -0.0580 24  TRP A C   
60   O O   . TRP A 24  ? 0.3675 0.4320 0.3714 0.0421  0.0747  -0.0561 24  TRP A O   
61   C CB  . TRP A 24  ? 0.2392 0.3332 0.2336 0.0186  0.0789  -0.0430 24  TRP A CB  
62   C CG  . TRP A 24  ? 0.2206 0.3149 0.2317 0.0175  0.0703  -0.0375 24  TRP A CG  
63   C CD1 . TRP A 24  ? 0.2532 0.3632 0.2844 0.0231  0.0708  -0.0356 24  TRP A CD1 
64   C CD2 . TRP A 24  ? 0.1937 0.2731 0.2022 0.0103  0.0600  -0.0334 24  TRP A CD2 
65   N NE1 . TRP A 24  ? 0.2245 0.3297 0.2631 0.0188  0.0608  -0.0310 24  TRP A NE1 
66   C CE2 . TRP A 24  ? 0.1847 0.2705 0.2093 0.0113  0.0550  -0.0302 24  TRP A CE2 
67   C CE3 . TRP A 24  ? 0.1930 0.2556 0.1874 0.0036  0.0547  -0.0321 24  TRP A CE3 
68   C CZ2 . TRP A 24  ? 0.1727 0.2467 0.1974 0.0057  0.0460  -0.0271 24  TRP A CZ2 
69   C CZ3 . TRP A 24  ? 0.1827 0.2345 0.1803 -0.0007 0.0463  -0.0282 24  TRP A CZ3 
70   C CH2 . TRP A 24  ? 0.1734 0.2301 0.1848 0.0003  0.0426  -0.0265 24  TRP A CH2 
71   N N   . SER A 25  ? 0.3215 0.4082 0.3210 0.0489  0.0940  -0.0633 25  SER A N   
72   C CA  . SER A 25  ? 0.3689 0.4600 0.3864 0.0631  0.0977  -0.0654 25  SER A CA  
73   C C   . SER A 25  ? 0.4201 0.4828 0.4305 0.0712  0.0952  -0.0732 25  SER A C   
74   O O   . SER A 25  ? 0.4067 0.4678 0.4325 0.0818  0.0943  -0.0718 25  SER A O   
75   C CB  . SER A 25  ? 0.4032 0.5153 0.4271 0.0719  0.1125  -0.0692 25  SER A CB  
76   O OG  . SER A 25  ? 0.4311 0.5284 0.4331 0.0753  0.1211  -0.0813 25  SER A OG  
77   N N   . LYS A 26  ? 0.4625 0.5034 0.4503 0.0658  0.0937  -0.0807 26  LYS A N   
78   C CA  . LYS A 26  ? 0.4758 0.4883 0.4561 0.0713  0.0916  -0.0888 26  LYS A CA  
79   C C   . LYS A 26  ? 0.4050 0.4064 0.3942 0.0691  0.0799  -0.0813 26  LYS A C   
80   O O   . LYS A 26  ? 0.4387 0.4283 0.4366 0.0784  0.0793  -0.0817 26  LYS A O   
81   C CB  . LYS A 26  ? 0.5299 0.5243 0.4838 0.0634  0.0914  -0.0985 26  LYS A CB  
82   C CG  . LYS A 26  ? 0.5856 0.5493 0.5317 0.0665  0.0886  -0.1073 26  LYS A CG  
83   C CD  . LYS A 26  ? 0.6308 0.5791 0.5506 0.0573  0.0876  -0.1178 26  LYS A CD  
84   C CE  . LYS A 26  ? 0.6562 0.5739 0.5698 0.0586  0.0838  -0.1260 26  LYS A CE  
85   N NZ  . LYS A 26  ? 0.6866 0.5972 0.6084 0.0732  0.0893  -0.1305 26  LYS A NZ  
86   N N   . LEU A 27  ? 0.3547 0.3595 0.3411 0.0571  0.0712  -0.0741 27  LEU A N   
87   C CA  . LEU A 27  ? 0.3737 0.3684 0.3656 0.0540  0.0611  -0.0676 27  LEU A CA  
88   C C   . LEU A 27  ? 0.3507 0.3641 0.3606 0.0550  0.0575  -0.0577 27  LEU A C   
89   O O   . LEU A 27  ? 0.4282 0.4357 0.4456 0.0578  0.0518  -0.0531 27  LEU A O   
90   C CB  . LEU A 27  ? 0.3554 0.3413 0.3343 0.0415  0.0539  -0.0661 27  LEU A CB  
91   C CG  . LEU A 27  ? 0.3550 0.3213 0.3168 0.0381  0.0533  -0.0747 27  LEU A CG  
92   C CD1 . LEU A 27  ? 0.3586 0.3229 0.3116 0.0263  0.0457  -0.0706 27  LEU A CD1 
93   C CD2 . LEU A 27  ? 0.3244 0.2695 0.2885 0.0439  0.0519  -0.0783 27  LEU A CD2 
94   N N   . PHE A 28  ? 0.2509 0.2870 0.2670 0.0518  0.0608  -0.0542 28  PHE A N   
95   C CA  . PHE A 28  ? 0.2624 0.3164 0.2937 0.0487  0.0559  -0.0454 28  PHE A CA  
96   C C   . PHE A 28  ? 0.2565 0.3366 0.3060 0.0558  0.0618  -0.0429 28  PHE A C   
97   O O   . PHE A 28  ? 0.2616 0.3494 0.3109 0.0615  0.0718  -0.0477 28  PHE A O   
98   C CB  . PHE A 28  ? 0.3017 0.3598 0.3271 0.0350  0.0521  -0.0411 28  PHE A CB  
99   C CG  . PHE A 28  ? 0.2908 0.3276 0.3024 0.0286  0.0460  -0.0418 28  PHE A CG  
100  C CD1 . PHE A 28  ? 0.2825 0.3097 0.2964 0.0272  0.0384  -0.0385 28  PHE A CD1 
101  C CD2 . PHE A 28  ? 0.2788 0.3069 0.2751 0.0240  0.0479  -0.0452 28  PHE A CD2 
102  C CE1 . PHE A 28  ? 0.2861 0.2965 0.2899 0.0221  0.0338  -0.0387 28  PHE A CE1 
103  C CE2 . PHE A 28  ? 0.2926 0.3046 0.2793 0.0185  0.0418  -0.0447 28  PHE A CE2 
104  C CZ  . PHE A 28  ? 0.3111 0.3146 0.3028 0.0179  0.0353  -0.0414 28  PHE A CZ  
105  N N   . PRO A 29  ? 0.2589 0.3541 0.3242 0.0554  0.0557  -0.0355 29  PRO A N   
106  C CA  . PRO A 29  ? 0.2788 0.4045 0.3648 0.0596  0.0595  -0.0312 29  PRO A CA  
107  C C   . PRO A 29  ? 0.2606 0.4045 0.3475 0.0484  0.0637  -0.0292 29  PRO A C   
108  O O   . PRO A 29  ? 0.2827 0.4171 0.3580 0.0359  0.0593  -0.0280 29  PRO A O   
109  C CB  . PRO A 29  ? 0.3320 0.4662 0.4301 0.0584  0.0487  -0.0238 29  PRO A CB  
110  C CG  . PRO A 29  ? 0.3189 0.4245 0.4029 0.0587  0.0420  -0.0251 29  PRO A CG  
111  C CD  . PRO A 29  ? 0.2706 0.3558 0.3352 0.0517  0.0449  -0.0311 29  PRO A CD  
112  N N   . ARG A 30  ? 0.2210 0.3909 0.3225 0.0533  0.0725  -0.0282 30  ARG A N   
113  C CA  . ARG A 30  ? 0.2770 0.4658 0.3804 0.0423  0.0778  -0.0250 30  ARG A CA  
114  C C   . ARG A 30  ? 0.3102 0.5180 0.4289 0.0304  0.0695  -0.0166 30  ARG A C   
115  O O   . ARG A 30  ? 0.3719 0.5857 0.4884 0.0167  0.0700  -0.0129 30  ARG A O   
116  C CB  . ARG A 30  ? 0.2991 0.5104 0.4125 0.0517  0.0921  -0.0271 30  ARG A CB  
117  C CG  . ARG A 30  ? 0.3730 0.5649 0.4684 0.0621  0.1017  -0.0375 30  ARG A CG  
118  C CD  . ARG A 30  ? 0.4367 0.6517 0.5392 0.0698  0.1177  -0.0402 30  ARG A CD  
119  N NE  . ARG A 30  ? 0.5197 0.7186 0.6132 0.0855  0.1267  -0.0513 30  ARG A NE  
120  C CZ  . ARG A 30  ? 0.5599 0.7604 0.6700 0.1020  0.1289  -0.0528 30  ARG A CZ  
121  N NH1 . ARG A 30  ? 0.5611 0.7817 0.6973 0.1048  0.1218  -0.0431 30  ARG A NH1 
122  N NH2 . ARG A 30  ? 0.5840 0.7622 0.6838 0.1135  0.1366  -0.0634 30  ARG A NH2 
123  N N   . ILE A 31  ? 0.2847 0.5014 0.4185 0.0350  0.0616  -0.0132 31  ILE A N   
124  C CA  . ILE A 31  ? 0.2818 0.5160 0.4288 0.0230  0.0520  -0.0066 31  ILE A CA  
125  C C   . ILE A 31  ? 0.1576 0.3729 0.2965 0.0213  0.0392  -0.0066 31  ILE A C   
126  O O   . ILE A 31  ? 0.1591 0.3662 0.2979 0.0338  0.0369  -0.0074 31  ILE A O   
127  C CB  . ILE A 31  ? 0.3090 0.5823 0.4851 0.0282  0.0538  -0.0008 31  ILE A CB  
128  C CG1 . ILE A 31  ? 0.1672 0.4632 0.3523 0.0268  0.0672  0.0003  31  ILE A CG1 
129  C CG2 . ILE A 31  ? 0.2960 0.5860 0.4845 0.0155  0.0410  0.0052  31  ILE A CG2 
130  C CD1 . ILE A 31  ? 0.1949 0.5339 0.4120 0.0305  0.0698  0.0069  31  ILE A CD1 
131  N N   . VAL A 32  ? 0.1545 0.3616 0.2859 0.0061  0.0317  -0.0057 32  VAL A N   
132  C CA  . VAL A 32  ? 0.1526 0.3393 0.2722 0.0035  0.0213  -0.0069 32  VAL A CA  
133  C C   . VAL A 32  ? 0.2300 0.4309 0.3577 -0.0085 0.0109  -0.0038 32  VAL A C   
134  O O   . VAL A 32  ? 0.2393 0.4231 0.3545 -0.0140 0.0030  -0.0057 32  VAL A O   
135  C CB  . VAL A 32  ? 0.1741 0.3291 0.2715 -0.0024 0.0221  -0.0111 32  VAL A CB  
136  C CG1 . VAL A 32  ? 0.1894 0.3291 0.2765 0.0083  0.0301  -0.0151 32  VAL A CG1 
137  C CG2 . VAL A 32  ? 0.1548 0.3113 0.2508 -0.0173 0.0239  -0.0096 32  VAL A CG2 
138  N N   . SER A 33  ? 0.2843 0.5172 0.4326 -0.0131 0.0111  0.0007  33  SER A N   
139  C CA  . SER A 33  ? 0.3153 0.5640 0.4720 -0.0272 0.0006  0.0032  33  SER A CA  
140  C C   . SER A 33  ? 0.3498 0.6088 0.5113 -0.0211 -0.0104 0.0056  33  SER A C   
141  O O   . SER A 33  ? 0.3895 0.6377 0.5393 -0.0298 -0.0203 0.0034  33  SER A O   
142  C CB  . SER A 33  ? 0.2826 0.5652 0.4622 -0.0354 0.0042  0.0081  33  SER A CB  
143  O OG  . SER A 33  ? 0.3059 0.6135 0.5039 -0.0203 0.0118  0.0118  33  SER A OG  
144  N N   . ASP A 34  ? 0.3432 0.6228 0.5212 -0.0057 -0.0082 0.0104  34  ASP A N   
145  C CA  . ASP A 34  ? 0.2872 0.5787 0.4714 0.0025  -0.0183 0.0153  34  ASP A CA  
146  C C   . ASP A 34  ? 0.2246 0.4823 0.3845 0.0078  -0.0220 0.0122  34  ASP A C   
147  O O   . ASP A 34  ? 0.2666 0.4956 0.4111 0.0120  -0.0141 0.0071  34  ASP A O   
148  C CB  . ASP A 34  ? 0.3011 0.6175 0.5087 0.0208  -0.0128 0.0215  34  ASP A CB  
149  C CG  . ASP A 34  ? 0.3116 0.6050 0.5110 0.0359  0.0004  0.0173  34  ASP A CG  
150  O OD1 . ASP A 34  ? 0.3082 0.5992 0.5066 0.0334  0.0115  0.0132  34  ASP A OD1 
151  O OD2 . ASP A 34  ? 0.3435 0.6206 0.5365 0.0496  -0.0006 0.0182  34  ASP A OD2 
152  N N   . PRO A 35  ? 0.1791 0.4420 0.3357 0.0071  -0.0340 0.0158  35  PRO A N   
153  C CA  . PRO A 35  ? 0.2026 0.4363 0.3358 0.0100  -0.0378 0.0138  35  PRO A CA  
154  C C   . PRO A 35  ? 0.2496 0.4630 0.3782 0.0276  -0.0302 0.0150  35  PRO A C   
155  O O   . PRO A 35  ? 0.2491 0.4318 0.3578 0.0270  -0.0269 0.0101  35  PRO A O   
156  C CB  . PRO A 35  ? 0.2099 0.4639 0.3458 0.0081  -0.0519 0.0203  35  PRO A CB  
157  C CG  . PRO A 35  ? 0.2174 0.5039 0.3713 -0.0046 -0.0574 0.0215  35  PRO A CG  
158  C CD  . PRO A 35  ? 0.2067 0.5056 0.3807 0.0012  -0.0455 0.0222  35  PRO A CD  
159  N N   . ASP A 36  ? 0.2530 0.4832 0.4005 0.0428  -0.0273 0.0213  36  ASP A N   
160  C CA  . ASP A 36  ? 0.2467 0.4559 0.3909 0.0593  -0.0198 0.0218  36  ASP A CA  
161  C C   . ASP A 36  ? 0.2257 0.4096 0.3582 0.0579  -0.0082 0.0125  36  ASP A C   
162  O O   . ASP A 36  ? 0.2551 0.4094 0.3708 0.0605  -0.0057 0.0092  36  ASP A O   
163  C CB  . ASP A 36  ? 0.2632 0.4953 0.4325 0.0763  -0.0168 0.0291  36  ASP A CB  
164  C CG  . ASP A 36  ? 0.2809 0.5340 0.4605 0.0816  -0.0291 0.0408  36  ASP A CG  
165  O OD1 . ASP A 36  ? 0.3087 0.5574 0.4729 0.0715  -0.0398 0.0423  36  ASP A OD1 
166  O OD2 . ASP A 36  ? 0.2788 0.5530 0.4813 0.0965  -0.0278 0.0485  36  ASP A OD2 
167  N N   . ARG A 37  ? 0.2089 0.4063 0.3503 0.0531  -0.0014 0.0089  37  ARG A N   
168  C CA  . ARG A 37  ? 0.2587 0.4363 0.3888 0.0515  0.0090  0.0011  37  ARG A CA  
169  C C   . ARG A 37  ? 0.2578 0.4145 0.3679 0.0367  0.0061  -0.0036 37  ARG A C   
170  O O   . ARG A 37  ? 0.1982 0.3305 0.2936 0.0367  0.0112  -0.0088 37  ARG A O   
171  C CB  . ARG A 37  ? 0.2935 0.4943 0.4389 0.0514  0.0178  0.0003  37  ARG A CB  
172  C CG  . ARG A 37  ? 0.3076 0.5237 0.4714 0.0692  0.0252  0.0027  37  ARG A CG  
173  C CD  . ARG A 37  ? 0.2998 0.5357 0.4748 0.0693  0.0368  0.0004  37  ARG A CD  
174  N NE  . ARG A 37  ? 0.3276 0.6003 0.5233 0.0604  0.0331  0.0067  37  ARG A NE  
175  C CZ  . ARG A 37  ? 0.3397 0.6456 0.5604 0.0682  0.0398  0.0107  37  ARG A CZ  
176  N NH1 . ARG A 37  ? 0.3803 0.6848 0.6068 0.0863  0.0514  0.0081  37  ARG A NH1 
177  N NH2 . ARG A 37  ? 0.2644 0.6048 0.5047 0.0578  0.0352  0.0170  37  ARG A NH2 
178  N N   . SER A 38  ? 0.2608 0.4275 0.3710 0.0241  -0.0022 -0.0020 38  SER A N   
179  C CA  . SER A 38  ? 0.2527 0.3983 0.3446 0.0116  -0.0052 -0.0064 38  SER A CA  
180  C C   . SER A 38  ? 0.2289 0.3481 0.3043 0.0171  -0.0066 -0.0077 38  SER A C   
181  O O   . SER A 38  ? 0.2181 0.3146 0.2796 0.0136  -0.0033 -0.0120 38  SER A O   
182  C CB  . SER A 38  ? 0.2786 0.4373 0.3723 -0.0019 -0.0145 -0.0055 38  SER A CB  
183  O OG  . SER A 38  ? 0.3312 0.4660 0.4056 -0.0104 -0.0175 -0.0101 38  SER A OG  
184  N N   . SER A 39  ? 0.1807 0.3044 0.2588 0.0257  -0.0115 -0.0028 39  SER A N   
185  C CA  . SER A 39  ? 0.1920 0.2928 0.2558 0.0306  -0.0126 -0.0022 39  SER A CA  
186  C C   . SER A 39  ? 0.2669 0.3492 0.3284 0.0400  -0.0042 -0.0045 39  SER A C   
187  O O   . SER A 39  ? 0.2664 0.3259 0.3144 0.0385  -0.0023 -0.0074 39  SER A O   
188  C CB  . SER A 39  ? 0.1857 0.2971 0.2528 0.0372  -0.0204 0.0056  39  SER A CB  
189  O OG  . SER A 39  ? 0.2455 0.3348 0.3011 0.0437  -0.0194 0.0077  39  SER A OG  
190  N N   . ASN A 40  ? 0.3355 0.4284 0.4106 0.0497  0.0009  -0.0037 40  ASN A N   
191  C CA  . ASN A 40  ? 0.3255 0.4000 0.3974 0.0583  0.0090  -0.0075 40  ASN A CA  
192  C C   . ASN A 40  ? 0.2768 0.3383 0.3375 0.0501  0.0142  -0.0149 40  ASN A C   
193  O O   . ASN A 40  ? 0.2997 0.3394 0.3499 0.0514  0.0173  -0.0187 40  ASN A O   
194  C CB  . ASN A 40  ? 0.4245 0.5133 0.5130 0.0710  0.0148  -0.0064 40  ASN A CB  
195  C CG  . ASN A 40  ? 0.5129 0.5789 0.5963 0.0809  0.0225  -0.0112 40  ASN A CG  
196  O OD1 . ASN A 40  ? 0.5577 0.6024 0.6333 0.0843  0.0205  -0.0097 40  ASN A OD1 
197  N ND2 . ASN A 40  ? 0.5059 0.5756 0.5926 0.0845  0.0317  -0.0175 40  ASN A ND2 
198  N N   . PHE A 41  ? 0.2462 0.3217 0.3097 0.0409  0.0147  -0.0161 41  PHE A N   
199  C CA  . PHE A 41  ? 0.2263 0.2908 0.2792 0.0325  0.0185  -0.0209 41  PHE A CA  
200  C C   . PHE A 41  ? 0.2312 0.2747 0.2700 0.0268  0.0145  -0.0217 41  PHE A C   
201  O O   . PHE A 41  ? 0.1586 0.1863 0.1879 0.0253  0.0174  -0.0250 41  PHE A O   
202  C CB  . PHE A 41  ? 0.2591 0.3409 0.3177 0.0225  0.0188  -0.0199 41  PHE A CB  
203  C CG  . PHE A 41  ? 0.2806 0.3488 0.3273 0.0124  0.0197  -0.0220 41  PHE A CG  
204  C CD1 . PHE A 41  ? 0.3028 0.3653 0.3431 0.0125  0.0261  -0.0246 41  PHE A CD1 
205  C CD2 . PHE A 41  ? 0.2538 0.3140 0.2948 0.0034  0.0141  -0.0213 41  PHE A CD2 
206  C CE1 . PHE A 41  ? 0.2348 0.2859 0.2652 0.0042  0.0260  -0.0245 41  PHE A CE1 
207  C CE2 . PHE A 41  ? 0.2110 0.2578 0.2429 -0.0039 0.0152  -0.0222 41  PHE A CE2 
208  C CZ  . PHE A 41  ? 0.1883 0.2313 0.2158 -0.0034 0.0207  -0.0229 41  PHE A CZ  
209  N N   . MET A 42  ? 0.1877 0.2330 0.2255 0.0233  0.0079  -0.0188 42  MET A N   
210  C CA  . MET A 42  ? 0.2141 0.2415 0.2394 0.0188  0.0054  -0.0196 42  MET A CA  
211  C C   . MET A 42  ? 0.2762 0.2867 0.2961 0.0259  0.0074  -0.0196 42  MET A C   
212  O O   . MET A 42  ? 0.2762 0.2717 0.2880 0.0228  0.0089  -0.0216 42  MET A O   
213  C CB  . MET A 42  ? 0.1946 0.2274 0.2175 0.0149  -0.0013 -0.0172 42  MET A CB  
214  C CG  . MET A 42  ? 0.2452 0.2885 0.2699 0.0042  -0.0042 -0.0189 42  MET A CG  
215  S SD  . MET A 42  ? 0.2823 0.3126 0.3016 -0.0046 0.0005  -0.0228 42  MET A SD  
216  C CE  . MET A 42  ? 0.1587 0.1650 0.1646 -0.0025 0.0018  -0.0244 42  MET A CE  
217  N N   . THR A 43  ? 0.2812 0.2946 0.3072 0.0353  0.0075  -0.0168 43  THR A N   
218  C CA  . THR A 43  ? 0.3080 0.3038 0.3303 0.0417  0.0097  -0.0165 43  THR A CA  
219  C C   . THR A 43  ? 0.3072 0.2916 0.3255 0.0407  0.0150  -0.0228 43  THR A C   
220  O O   . THR A 43  ? 0.1765 0.1445 0.1874 0.0383  0.0155  -0.0241 43  THR A O   
221  C CB  . THR A 43  ? 0.3775 0.3777 0.4092 0.0533  0.0097  -0.0121 43  THR A CB  
222  O OG1 . THR A 43  ? 0.3678 0.3798 0.4019 0.0539  0.0031  -0.0050 43  THR A OG1 
223  C CG2 . THR A 43  ? 0.4231 0.4010 0.4507 0.0589  0.0124  -0.0121 43  THR A CG2 
224  N N   . ARG A 44  ? 0.2446 0.2394 0.2674 0.0418  0.0190  -0.0263 44  ARG A N   
225  C CA  . ARG A 44  ? 0.2862 0.2727 0.3027 0.0404  0.0239  -0.0326 44  ARG A CA  
226  C C   . ARG A 44  ? 0.3185 0.3003 0.3265 0.0302  0.0221  -0.0333 44  ARG A C   
227  O O   . ARG A 44  ? 0.3359 0.3055 0.3362 0.0277  0.0228  -0.0365 44  ARG A O   
228  C CB  . ARG A 44  ? 0.3468 0.3486 0.3692 0.0439  0.0296  -0.0354 44  ARG A CB  
229  C CG  . ARG A 44  ? 0.4310 0.4400 0.4650 0.0561  0.0325  -0.0343 44  ARG A CG  
230  C CD  . ARG A 44  ? 0.5069 0.4975 0.5364 0.0641  0.0379  -0.0405 44  ARG A CD  
231  N NE  . ARG A 44  ? 0.5689 0.5372 0.5920 0.0634  0.0340  -0.0393 44  ARG A NE  
232  C CZ  . ARG A 44  ? 0.6083 0.5551 0.6229 0.0642  0.0366  -0.0455 44  ARG A CZ  
233  N NH1 . ARG A 44  ? 0.6412 0.5849 0.6503 0.0661  0.0432  -0.0545 44  ARG A NH1 
234  N NH2 . ARG A 44  ? 0.5912 0.5199 0.6020 0.0622  0.0330  -0.0431 44  ARG A NH2 
235  N N   . ALA A 45  ? 0.3270 0.3187 0.3372 0.0244  0.0194  -0.0301 45  ALA A N   
236  C CA  . ALA A 45  ? 0.2754 0.2621 0.2797 0.0161  0.0178  -0.0295 45  ALA A CA  
237  C C   . ALA A 45  ? 0.2643 0.2358 0.2632 0.0154  0.0158  -0.0290 45  ALA A C   
238  O O   . ALA A 45  ? 0.3102 0.2747 0.3044 0.0120  0.0160  -0.0299 45  ALA A O   
239  C CB  . ALA A 45  ? 0.2943 0.2900 0.3019 0.0106  0.0152  -0.0269 45  ALA A CB  
240  N N   . ILE A 46  ? 0.2312 0.1995 0.2311 0.0185  0.0137  -0.0266 46  ILE A N   
241  C CA  . ILE A 46  ? 0.2270 0.1828 0.2231 0.0181  0.0128  -0.0250 46  ILE A CA  
242  C C   . ILE A 46  ? 0.2267 0.1718 0.2210 0.0191  0.0144  -0.0275 46  ILE A C   
243  O O   . ILE A 46  ? 0.1936 0.1319 0.1856 0.0151  0.0138  -0.0273 46  ILE A O   
244  C CB  . ILE A 46  ? 0.2266 0.1822 0.2230 0.0219  0.0109  -0.0210 46  ILE A CB  
245  C CG1 . ILE A 46  ? 0.2476 0.2127 0.2428 0.0186  0.0083  -0.0198 46  ILE A CG1 
246  C CG2 . ILE A 46  ? 0.1998 0.1431 0.1927 0.0215  0.0114  -0.0183 46  ILE A CG2 
247  C CD1 . ILE A 46  ? 0.2334 0.2011 0.2264 0.0215  0.0054  -0.0154 46  ILE A CD1 
248  N N   . TYR A 47  ? 0.2282 0.1725 0.2241 0.0245  0.0164  -0.0303 47  TYR A N   
249  C CA  . TYR A 47  ? 0.2476 0.1795 0.2401 0.0251  0.0180  -0.0347 47  TYR A CA  
250  C C   . TYR A 47  ? 0.2193 0.1520 0.2061 0.0186  0.0178  -0.0386 47  TYR A C   
251  O O   . TYR A 47  ? 0.1987 0.1228 0.1824 0.0140  0.0160  -0.0396 47  TYR A O   
252  C CB  . TYR A 47  ? 0.2477 0.1787 0.2428 0.0334  0.0216  -0.0382 47  TYR A CB  
253  C CG  . TYR A 47  ? 0.2549 0.1733 0.2439 0.0335  0.0245  -0.0460 47  TYR A CG  
254  C CD1 . TYR A 47  ? 0.2981 0.1981 0.2841 0.0312  0.0233  -0.0474 47  TYR A CD1 
255  C CD2 . TYR A 47  ? 0.2151 0.1397 0.2003 0.0349  0.0286  -0.0525 47  TYR A CD2 
256  C CE1 . TYR A 47  ? 0.2639 0.1506 0.2427 0.0298  0.0253  -0.0561 47  TYR A CE1 
257  C CE2 . TYR A 47  ? 0.2321 0.1443 0.2086 0.0345  0.0314  -0.0613 47  TYR A CE2 
258  C CZ  . TYR A 47  ? 0.2719 0.1644 0.2449 0.0316  0.0293  -0.0637 47  TYR A CZ  
259  O OH  . TYR A 47  ? 0.2692 0.1475 0.2319 0.0297  0.0315  -0.0740 47  TYR A OH  
260  N N   . VAL A 48  ? 0.1891 0.1335 0.1749 0.0176  0.0193  -0.0397 48  VAL A N   
261  C CA  . VAL A 48  ? 0.1901 0.1368 0.1691 0.0119  0.0190  -0.0419 48  VAL A CA  
262  C C   . VAL A 48  ? 0.1833 0.1305 0.1628 0.0059  0.0151  -0.0367 48  VAL A C   
263  O O   . VAL A 48  ? 0.2152 0.1601 0.1904 0.0013  0.0126  -0.0371 48  VAL A O   
264  C CB  . VAL A 48  ? 0.2397 0.1994 0.2175 0.0122  0.0225  -0.0428 48  VAL A CB  
265  C CG1 . VAL A 48  ? 0.1867 0.1494 0.1556 0.0060  0.0218  -0.0430 48  VAL A CG1 
266  C CG2 . VAL A 48  ? 0.1923 0.1532 0.1707 0.0195  0.0278  -0.0483 48  VAL A CG2 
267  N N   . ALA A 49  ? 0.1862 0.1368 0.1712 0.0060  0.0145  -0.0321 49  ALA A N   
268  C CA  . ALA A 49  ? 0.1935 0.1436 0.1803 0.0022  0.0124  -0.0277 49  ALA A CA  
269  C C   . ALA A 49  ? 0.2438 0.1868 0.2323 0.0011  0.0106  -0.0264 49  ALA A C   
270  O O   . ALA A 49  ? 0.2041 0.1482 0.1935 -0.0023 0.0084  -0.0241 49  ALA A O   
271  C CB  . ALA A 49  ? 0.1550 0.1075 0.1452 0.0027  0.0130  -0.0252 49  ALA A CB  
272  N N   . PHE A 50  ? 0.1634 0.1005 0.1534 0.0039  0.0113  -0.0268 50  PHE A N   
273  C CA  . PHE A 50  ? 0.2024 0.1336 0.1953 0.0019  0.0104  -0.0248 50  PHE A CA  
274  C C   . PHE A 50  ? 0.1969 0.1234 0.1873 -0.0017 0.0083  -0.0284 50  PHE A C   
275  O O   . PHE A 50  ? 0.2142 0.1393 0.2082 -0.0061 0.0062  -0.0266 50  PHE A O   
276  C CB  . PHE A 50  ? 0.1680 0.0936 0.1620 0.0053  0.0121  -0.0227 50  PHE A CB  
277  C CG  . PHE A 50  ? 0.2129 0.1426 0.2075 0.0066  0.0135  -0.0192 50  PHE A CG  
278  C CD1 . PHE A 50  ? 0.2202 0.1511 0.2179 0.0045  0.0147  -0.0161 50  PHE A CD1 
279  C CD2 . PHE A 50  ? 0.1832 0.1162 0.1752 0.0099  0.0137  -0.0194 50  PHE A CD2 
280  C CE1 . PHE A 50  ? 0.2298 0.1624 0.2257 0.0059  0.0171  -0.0147 50  PHE A CE1 
281  C CE2 . PHE A 50  ? 0.2008 0.1364 0.1905 0.0098  0.0145  -0.0178 50  PHE A CE2 
282  C CZ  . PHE A 50  ? 0.2424 0.1763 0.2328 0.0080  0.0168  -0.0162 50  PHE A CZ  
283  N N   . SER A 51  ? 0.2423 0.1671 0.2267 -0.0002 0.0090  -0.0341 51  SER A N   
284  C CA  . SER A 51  ? 0.2241 0.1440 0.2024 -0.0044 0.0071  -0.0397 51  SER A CA  
285  C C   . SER A 51  ? 0.2394 0.1685 0.2161 -0.0103 0.0030  -0.0375 51  SER A C   
286  O O   . SER A 51  ? 0.2544 0.1824 0.2311 -0.0164 -0.0012 -0.0380 51  SER A O   
287  C CB  . SER A 51  ? 0.2305 0.1478 0.2013 -0.0003 0.0106  -0.0470 51  SER A CB  
288  O OG  . SER A 51  ? 0.2846 0.1919 0.2582 0.0058  0.0137  -0.0486 51  SER A OG  
289  N N   . ALA A 52  ? 0.1838 0.1223 0.1600 -0.0090 0.0038  -0.0342 52  ALA A N   
290  C CA  . ALA A 52  ? 0.1829 0.1302 0.1584 -0.0132 0.0000  -0.0297 52  ALA A CA  
291  C C   . ALA A 52  ? 0.1771 0.1268 0.1632 -0.0150 -0.0030 -0.0232 52  ALA A C   
292  O O   . ALA A 52  ? 0.1809 0.1368 0.1684 -0.0196 -0.0081 -0.0204 52  ALA A O   
293  C CB  . ALA A 52  ? 0.1777 0.1317 0.1521 -0.0112 0.0023  -0.0260 52  ALA A CB  
294  N N   . VAL A 53  ? 0.1881 0.1348 0.1819 -0.0113 0.0003  -0.0206 53  VAL A N   
295  C CA  . VAL A 53  ? 0.1645 0.1145 0.1692 -0.0116 -0.0001 -0.0147 53  VAL A CA  
296  C C   . VAL A 53  ? 0.1702 0.1193 0.1790 -0.0167 -0.0031 -0.0153 53  VAL A C   
297  O O   . VAL A 53  ? 0.2574 0.2150 0.2744 -0.0202 -0.0067 -0.0107 53  VAL A O   
298  C CB  . VAL A 53  ? 0.1914 0.1377 0.1998 -0.0068 0.0051  -0.0132 53  VAL A CB  
299  C CG1 . VAL A 53  ? 0.2847 0.2346 0.3037 -0.0067 0.0065  -0.0081 53  VAL A CG1 
300  C CG2 . VAL A 53  ? 0.1549 0.1020 0.1608 -0.0038 0.0073  -0.0126 53  VAL A CG2 
301  N N   . LEU A 54  ? 0.1792 0.1179 0.1835 -0.0173 -0.0017 -0.0204 54  LEU A N   
302  C CA  . LEU A 54  ? 0.1939 0.1282 0.2019 -0.0234 -0.0042 -0.0213 54  LEU A CA  
303  C C   . LEU A 54  ? 0.2349 0.1734 0.2392 -0.0312 -0.0110 -0.0245 54  LEU A C   
304  O O   . LEU A 54  ? 0.2662 0.2094 0.2783 -0.0383 -0.0152 -0.0221 54  LEU A O   
305  C CB  . LEU A 54  ? 0.2246 0.1434 0.2273 -0.0217 -0.0010 -0.0260 54  LEU A CB  
306  C CG  . LEU A 54  ? 0.2858 0.2012 0.2933 -0.0169 0.0040  -0.0209 54  LEU A CG  
307  C CD1 . LEU A 54  ? 0.3181 0.2196 0.3197 -0.0124 0.0066  -0.0241 54  LEU A CD1 
308  C CD2 . LEU A 54  ? 0.3291 0.2471 0.3470 -0.0221 0.0041  -0.0149 54  LEU A CD2 
309  N N   . ARG A 55  ? 0.2000 0.1383 0.1921 -0.0306 -0.0122 -0.0296 55  ARG A N   
310  C CA  . ARG A 55  ? 0.2129 0.1553 0.1970 -0.0383 -0.0189 -0.0335 55  ARG A CA  
311  C C   . ARG A 55  ? 0.2170 0.1772 0.2072 -0.0404 -0.0245 -0.0250 55  ARG A C   
312  O O   . ARG A 55  ? 0.2138 0.1824 0.2083 -0.0481 -0.0317 -0.0231 55  ARG A O   
313  C CB  . ARG A 55  ? 0.2237 0.1599 0.1906 -0.0366 -0.0168 -0.0425 55  ARG A CB  
314  C CG  . ARG A 55  ? 0.2407 0.1812 0.1948 -0.0449 -0.0235 -0.0474 55  ARG A CG  
315  C CD  . ARG A 55  ? 0.3198 0.2539 0.2753 -0.0547 -0.0291 -0.0521 55  ARG A CD  
316  N NE  . ARG A 55  ? 0.4138 0.3621 0.3664 -0.0643 -0.0392 -0.0501 55  ARG A NE  
317  C CZ  . ARG A 55  ? 0.4637 0.4217 0.4301 -0.0718 -0.0462 -0.0442 55  ARG A CZ  
318  N NH1 . ARG A 55  ? 0.4705 0.4245 0.4536 -0.0710 -0.0431 -0.0401 55  ARG A NH1 
319  N NH2 . ARG A 55  ? 0.5256 0.4993 0.4895 -0.0803 -0.0564 -0.0416 55  ARG A NH2 
320  N N   . ASN A 56  ? 0.2393 0.2052 0.2307 -0.0339 -0.0216 -0.0194 56  ASN A N   
321  C CA  . ASN A 56  ? 0.3201 0.3007 0.3168 -0.0343 -0.0265 -0.0103 56  ASN A CA  
322  C C   . ASN A 56  ? 0.3912 0.3813 0.4076 -0.0336 -0.0279 -0.0015 56  ASN A C   
323  O O   . ASN A 56  ? 0.3878 0.3920 0.4116 -0.0349 -0.0338 0.0065  56  ASN A O   
324  C CB  . ASN A 56  ? 0.3172 0.2979 0.3103 -0.0278 -0.0222 -0.0065 56  ASN A CB  
325  C CG  . ASN A 56  ? 0.4075 0.3883 0.3828 -0.0302 -0.0230 -0.0106 56  ASN A CG  
326  O OD1 . ASN A 56  ? 0.5529 0.5435 0.5226 -0.0338 -0.0288 -0.0059 56  ASN A OD1 
327  N ND2 . ASN A 56  ? 0.3547 0.3264 0.3213 -0.0278 -0.0169 -0.0187 56  ASN A ND2 
328  N N   . ARG A 57  ? 0.3950 0.3788 0.4201 -0.0310 -0.0223 -0.0022 57  ARG A N   
329  C CA  . ARG A 57  ? 0.4052 0.3990 0.4492 -0.0302 -0.0217 0.0054  57  ARG A CA  
330  C C   . ARG A 57  ? 0.3693 0.3679 0.4192 -0.0400 -0.0273 0.0042  57  ARG A C   
331  O O   . ARG A 57  ? 0.3148 0.3261 0.3823 -0.0418 -0.0282 0.0111  57  ARG A O   
332  C CB  . ARG A 57  ? 0.4085 0.3945 0.4573 -0.0233 -0.0123 0.0058  57  ARG A CB  
333  C CG  . ARG A 57  ? 0.3897 0.3866 0.4566 -0.0189 -0.0086 0.0140  57  ARG A CG  
334  C CD  . ARG A 57  ? 0.3301 0.3335 0.4015 -0.0126 -0.0092 0.0202  57  ARG A CD  
335  N NE  . ARG A 57  ? 0.2845 0.2944 0.3721 -0.0054 -0.0030 0.0265  57  ARG A NE  
336  C CZ  . ARG A 57  ? 0.3050 0.3322 0.4113 -0.0046 -0.0055 0.0350  57  ARG A CZ  
337  N NH1 . ARG A 57  ? 0.3320 0.3725 0.4423 -0.0120 -0.0158 0.0384  57  ARG A NH1 
338  N NH2 . ARG A 57  ? 0.2593 0.2915 0.3803 0.0036  0.0022  0.0399  57  ARG A NH2 
339  N N   . ASN A 58  ? 0.3933 0.3813 0.4286 -0.0466 -0.0305 -0.0050 58  ASN A N   
340  C CA  . ASN A 58  ? 0.3963 0.3828 0.4334 -0.0577 -0.0357 -0.0089 58  ASN A CA  
341  C C   . ASN A 58  ? 0.3408 0.3215 0.3899 -0.0584 -0.0300 -0.0068 58  ASN A C   
342  O O   . ASN A 58  ? 0.2873 0.2774 0.3503 -0.0663 -0.0334 -0.0028 58  ASN A O   
343  C CB  . ASN A 58  ? 0.4288 0.4360 0.4751 -0.0657 -0.0462 -0.0033 58  ASN A CB  
344  C CG  . ASN A 58  ? 0.5115 0.5160 0.5554 -0.0799 -0.0536 -0.0097 58  ASN A CG  
345  O OD1 . ASN A 58  ? 0.5454 0.5299 0.5734 -0.0836 -0.0523 -0.0210 58  ASN A OD1 
346  N ND2 . ASN A 58  ? 0.5267 0.5512 0.5878 -0.0880 -0.0611 -0.0027 58  ASN A ND2 
347  N N   . ILE A 59  ? 0.3147 0.2812 0.3584 -0.0507 -0.0215 -0.0088 59  ILE A N   
348  C CA  . ILE A 59  ? 0.2986 0.2572 0.3493 -0.0515 -0.0158 -0.0067 59  ILE A CA  
349  C C   . ILE A 59  ? 0.3179 0.2580 0.3593 -0.0590 -0.0180 -0.0148 59  ILE A C   
350  O O   . ILE A 59  ? 0.3383 0.2733 0.3873 -0.0660 -0.0174 -0.0128 59  ILE A O   
351  C CB  . ILE A 59  ? 0.2487 0.2007 0.2962 -0.0406 -0.0069 -0.0048 59  ILE A CB  
352  C CG1 . ILE A 59  ? 0.2090 0.1763 0.2665 -0.0341 -0.0039 0.0023  59  ILE A CG1 
353  C CG2 . ILE A 59  ? 0.1946 0.1365 0.2449 -0.0417 -0.0015 -0.0024 59  ILE A CG2 
354  C CD1 . ILE A 59  ? 0.1691 0.1304 0.2191 -0.0242 0.0027  0.0016  59  ILE A CD1 
355  N N   . LEU A 60  ? 0.3153 0.2449 0.3405 -0.0577 -0.0199 -0.0239 60  LEU A N   
356  C CA  . LEU A 60  ? 0.3355 0.2456 0.3501 -0.0640 -0.0216 -0.0337 60  LEU A CA  
357  C C   . LEU A 60  ? 0.3155 0.2283 0.3175 -0.0702 -0.0289 -0.0421 60  LEU A C   
358  O O   . LEU A 60  ? 0.2501 0.1735 0.2456 -0.0653 -0.0298 -0.0418 60  LEU A O   
359  C CB  . LEU A 60  ? 0.3302 0.2213 0.3353 -0.0544 -0.0143 -0.0380 60  LEU A CB  
360  C CG  . LEU A 60  ? 0.3449 0.2307 0.3582 -0.0488 -0.0077 -0.0301 60  LEU A CG  
361  C CD1 . LEU A 60  ? 0.3392 0.2101 0.3432 -0.0386 -0.0023 -0.0337 60  LEU A CD1 
362  C CD2 . LEU A 60  ? 0.3570 0.2346 0.3792 -0.0585 -0.0084 -0.0267 60  LEU A CD2 
363  N N   . GLY A 61  ? 0.3355 0.2378 0.3330 -0.0818 -0.0339 -0.0496 61  GLY A N   
364  C CA  . GLY A 61  ? 0.3966 0.3001 0.3789 -0.0895 -0.0413 -0.0592 61  GLY A CA  
365  C C   . GLY A 61  ? 0.4694 0.3601 0.4315 -0.0813 -0.0362 -0.0694 61  GLY A C   
366  O O   . GLY A 61  ? 0.5052 0.3836 0.4667 -0.0705 -0.0275 -0.0700 61  GLY A O   
367  N N   . GLN A 62  ? 0.4797 0.3753 0.4255 -0.0865 -0.0416 -0.0770 62  GLN A N   
368  C CA  . GLN A 62  ? 0.4676 0.3552 0.3939 -0.0791 -0.0361 -0.0864 62  GLN A CA  
369  C C   . GLN A 62  ? 0.4489 0.3075 0.3661 -0.0763 -0.0290 -0.0990 62  GLN A C   
370  O O   . GLN A 62  ? 0.4472 0.2986 0.3565 -0.0652 -0.0205 -0.1037 62  GLN A O   
371  C CB  . GLN A 62  ? 0.5550 0.4540 0.4633 -0.0872 -0.0437 -0.0919 62  GLN A CB  
372  C CG  . GLN A 62  ? 0.6250 0.5520 0.5431 -0.0912 -0.0527 -0.0785 62  GLN A CG  
373  C CD  . GLN A 62  ? 0.6734 0.6126 0.5721 -0.0994 -0.0612 -0.0826 62  GLN A CD  
374  O OE1 . GLN A 62  ? 0.6754 0.6234 0.5739 -0.1124 -0.0725 -0.0830 62  GLN A OE1 
375  N NE2 . GLN A 62  ? 0.6850 0.6263 0.5671 -0.0926 -0.0561 -0.0848 62  GLN A NE2 
376  N N   . GLU A 63  ? 0.4541 0.2965 0.3742 -0.0862 -0.0322 -0.1038 63  GLU A N   
377  C CA  . GLU A 63  ? 0.4828 0.2969 0.3968 -0.0827 -0.0261 -0.1147 63  GLU A CA  
378  C C   . GLU A 63  ? 0.4456 0.2476 0.3687 -0.0685 -0.0160 -0.1094 63  GLU A C   
379  O O   . GLU A 63  ? 0.5084 0.2937 0.4293 -0.0593 -0.0102 -0.1151 63  GLU A O   
380  C CB  . GLU A 63  ? 0.5387 0.3435 0.4609 -0.0944 -0.0324 -0.1163 63  GLU A CB  
381  C CG  . GLU A 63  ? 0.5599 0.3613 0.5029 -0.0970 -0.0314 -0.1044 63  GLU A CG  
382  C CD  . GLU A 63  ? 0.5628 0.3861 0.5179 -0.1109 -0.0404 -0.0952 63  GLU A CD  
383  O OE1 . GLU A 63  ? 0.5704 0.4165 0.5217 -0.1126 -0.0459 -0.0926 63  GLU A OE1 
384  O OE2 . GLU A 63  ? 0.5460 0.3669 0.5171 -0.1184 -0.0419 -0.0888 63  GLU A OE2 
385  N N   . TYR A 64  ? 0.4125 0.2305 0.3503 -0.0636 -0.0150 -0.0954 64  TYR A N   
386  C CA  . TYR A 64  ? 0.4342 0.2465 0.3809 -0.0500 -0.0069 -0.0886 64  TYR A CA  
387  C C   . TYR A 64  ? 0.4467 0.2703 0.3877 -0.0376 -0.0016 -0.0892 64  TYR A C   
388  O O   . TYR A 64  ? 0.3899 0.2143 0.3383 -0.0264 0.0040  -0.0830 64  TYR A O   
389  C CB  . TYR A 64  ? 0.4242 0.2488 0.3887 -0.0507 -0.0081 -0.0736 64  TYR A CB  
390  C CG  . TYR A 64  ? 0.4495 0.2638 0.4228 -0.0623 -0.0115 -0.0708 64  TYR A CG  
391  C CD1 . TYR A 64  ? 0.5163 0.3055 0.4917 -0.0608 -0.0071 -0.0711 64  TYR A CD1 
392  C CD2 . TYR A 64  ? 0.4525 0.2831 0.4335 -0.0747 -0.0190 -0.0667 64  TYR A CD2 
393  C CE1 . TYR A 64  ? 0.5422 0.3213 0.5261 -0.0727 -0.0097 -0.0676 64  TYR A CE1 
394  C CE2 . TYR A 64  ? 0.4782 0.3019 0.4693 -0.0866 -0.0218 -0.0635 64  TYR A CE2 
395  C CZ  . TYR A 64  ? 0.5214 0.3186 0.5134 -0.0862 -0.0170 -0.0641 64  TYR A CZ  
396  O OH  . TYR A 64  ? 0.5403 0.3300 0.5429 -0.0992 -0.0194 -0.0600 64  TYR A OH  
397  N N   . PHE A 65  ? 0.4770 0.3105 0.4048 -0.0402 -0.0035 -0.0959 65  PHE A N   
398  C CA  . PHE A 65  ? 0.4773 0.3248 0.4010 -0.0305 0.0014  -0.0948 65  PHE A CA  
399  C C   . PHE A 65  ? 0.4874 0.3274 0.3929 -0.0278 0.0063  -0.1086 65  PHE A C   
400  O O   . PHE A 65  ? 0.5243 0.3516 0.4163 -0.0359 0.0038  -0.1200 65  PHE A O   
401  C CB  . PHE A 65  ? 0.4551 0.3273 0.3815 -0.0346 -0.0042 -0.0857 65  PHE A CB  
402  C CG  . PHE A 65  ? 0.4200 0.3018 0.3643 -0.0329 -0.0056 -0.0724 65  PHE A CG  
403  C CD1 . PHE A 65  ? 0.4027 0.2870 0.3566 -0.0413 -0.0115 -0.0669 65  PHE A CD1 
404  C CD2 . PHE A 65  ? 0.3925 0.2817 0.3438 -0.0232 -0.0005 -0.0658 65  PHE A CD2 
405  C CE1 . PHE A 65  ? 0.4073 0.3006 0.3764 -0.0389 -0.0110 -0.0555 65  PHE A CE1 
406  C CE2 . PHE A 65  ? 0.4192 0.3156 0.3838 -0.0217 -0.0011 -0.0553 65  PHE A CE2 
407  C CZ  . PHE A 65  ? 0.4342 0.3323 0.4072 -0.0289 -0.0057 -0.0504 65  PHE A CZ  
408  N N   . THR A 66  ? 0.4653 0.3140 0.3707 -0.0168 0.0136  -0.1077 66  THR A N   
409  C CA  . THR A 66  ? 0.5068 0.3544 0.3959 -0.0129 0.0202  -0.1192 66  THR A CA  
410  C C   . THR A 66  ? 0.4854 0.3584 0.3710 -0.0129 0.0202  -0.1129 66  THR A C   
411  O O   . THR A 66  ? 0.3737 0.2605 0.2729 -0.0084 0.0206  -0.1013 66  THR A O   
412  C CB  . THR A 66  ? 0.5297 0.3656 0.4238 0.0013  0.0307  -0.1238 66  THR A CB  
413  O OG1 . THR A 66  ? 0.5828 0.3997 0.4876 0.0031  0.0286  -0.1220 66  THR A OG1 
414  C CG2 . THR A 66  ? 0.5133 0.3480 0.3931 0.0058  0.0361  -0.1352 66  THR A CG2 
415  N N   . LYS A 67  ? 0.5489 0.4270 0.4150 -0.0187 0.0197  -0.1202 67  LYS A N   
416  C CA  . LYS A 67  ? 0.5576 0.4586 0.4191 -0.0191 0.0202  -0.1131 67  LYS A CA  
417  C C   . LYS A 67  ? 0.5126 0.4205 0.3775 -0.0075 0.0319  -0.1137 67  LYS A C   
418  O O   . LYS A 67  ? 0.5076 0.4050 0.3653 -0.0008 0.0405  -0.1253 67  LYS A O   
419  C CB  . LYS A 67  ? 0.5794 0.4854 0.4171 -0.0290 0.0160  -0.1194 67  LYS A CB  
420  C CG  . LYS A 67  ? 0.5760 0.4959 0.4160 -0.0391 0.0038  -0.1080 67  LYS A CG  
421  C CD  . LYS A 67  ? 0.6435 0.5789 0.4631 -0.0453 0.0012  -0.1069 67  LYS A CD  
422  C CE  . LYS A 67  ? 0.6601 0.6105 0.4856 -0.0533 -0.0112 -0.0929 67  LYS A CE  
423  N NZ  . LYS A 67  ? 0.6430 0.6087 0.4813 -0.0484 -0.0096 -0.0770 67  LYS A NZ  
424  N N   . ASN A 68  ? 0.4716 0.3973 0.3485 -0.0050 0.0322  -0.1012 68  ASN A N   
425  C CA  . ASN A 68  ? 0.4542 0.3907 0.3386 0.0045  0.0420  -0.0994 68  ASN A CA  
426  C C   . ASN A 68  ? 0.4558 0.4135 0.3377 0.0009  0.0428  -0.0904 68  ASN A C   
427  O O   . ASN A 68  ? 0.4272 0.3904 0.3044 -0.0076 0.0350  -0.0832 68  ASN A O   
428  C CB  . ASN A 68  ? 0.4638 0.3987 0.3705 0.0118  0.0421  -0.0926 68  ASN A CB  
429  C CG  . ASN A 68  ? 0.6031 0.5248 0.5145 0.0224  0.0491  -0.1007 68  ASN A CG  
430  O OD1 . ASN A 68  ? 0.6433 0.5730 0.5567 0.0308  0.0584  -0.1040 68  ASN A OD1 
431  N ND2 . ASN A 68  ? 0.6813 0.5834 0.5961 0.0223  0.0452  -0.1030 68  ASN A ND2 
432  N N   . TYR A 69  ? 0.5019 0.4721 0.3884 0.0074  0.0523  -0.0898 69  TYR A N   
433  C CA  . TYR A 69  ? 0.4685 0.4585 0.3577 0.0040  0.0538  -0.0792 69  TYR A CA  
434  C C   . TYR A 69  ? 0.4244 0.4211 0.3368 0.0079  0.0533  -0.0702 69  TYR A C   
435  O O   . TYR A 69  ? 0.4530 0.4491 0.3774 0.0166  0.0580  -0.0735 69  TYR A O   
436  C CB  . TYR A 69  ? 0.4815 0.4844 0.3598 0.0066  0.0652  -0.0839 69  TYR A CB  
437  C CG  . TYR A 69  ? 0.5057 0.5063 0.3567 0.0007  0.0659  -0.0914 69  TYR A CG  
438  C CD1 . TYR A 69  ? 0.5515 0.5372 0.3881 0.0039  0.0696  -0.1072 69  TYR A CD1 
439  C CD2 . TYR A 69  ? 0.4530 0.4658 0.2915 -0.0082 0.0628  -0.0826 69  TYR A CD2 
440  C CE1 . TYR A 69  ? 0.5682 0.5518 0.3770 -0.0025 0.0697  -0.1154 69  TYR A CE1 
441  C CE2 . TYR A 69  ? 0.4850 0.4975 0.2963 -0.0141 0.0625  -0.0888 69  TYR A CE2 
442  C CZ  . TYR A 69  ? 0.5437 0.5420 0.3394 -0.0117 0.0657  -0.1060 69  TYR A CZ  
443  O OH  . TYR A 69  ? 0.5833 0.5812 0.3492 -0.0187 0.0649  -0.1136 69  TYR A OH  
444  N N   . ILE A 70  ? 0.3599 0.3627 0.2783 0.0017  0.0475  -0.0590 70  ILE A N   
445  C CA  . ILE A 70  ? 0.3668 0.3782 0.3037 0.0033  0.0478  -0.0513 70  ILE A CA  
446  C C   . ILE A 70  ? 0.3803 0.4107 0.3183 0.0019  0.0555  -0.0475 70  ILE A C   
447  O O   . ILE A 70  ? 0.3639 0.4057 0.3158 0.0066  0.0606  -0.0469 70  ILE A O   
448  C CB  . ILE A 70  ? 0.3955 0.4021 0.3383 -0.0025 0.0391  -0.0423 70  ILE A CB  
449  C CG1 . ILE A 70  ? 0.4927 0.4844 0.4402 0.0003  0.0336  -0.0452 70  ILE A CG1 
450  C CG2 . ILE A 70  ? 0.3256 0.3423 0.2824 -0.0041 0.0400  -0.0347 70  ILE A CG2 
451  C CD1 . ILE A 70  ? 0.5698 0.5554 0.5186 -0.0048 0.0260  -0.0389 70  ILE A CD1 
452  N N   . THR A 71  ? 0.3619 0.3971 0.2855 -0.0048 0.0562  -0.0439 71  THR A N   
453  C CA  . THR A 71  ? 0.3569 0.4102 0.2781 -0.0070 0.0649  -0.0401 71  THR A CA  
454  C C   . THR A 71  ? 0.3314 0.3862 0.2284 -0.0098 0.0685  -0.0442 71  THR A C   
455  O O   . THR A 71  ? 0.2865 0.3282 0.1693 -0.0101 0.0637  -0.0511 71  THR A O   
456  C CB  . THR A 71  ? 0.3501 0.4109 0.2798 -0.0152 0.0623  -0.0265 71  THR A CB  
457  O OG1 . THR A 71  ? 0.3418 0.3941 0.2595 -0.0219 0.0551  -0.0199 71  THR A OG1 
458  C CG2 . THR A 71  ? 0.2992 0.3570 0.2495 -0.0142 0.0576  -0.0236 71  THR A CG2 
459  N N   . GLU A 72  ? 0.3345 0.4061 0.2263 -0.0128 0.0770  -0.0396 72  GLU A N   
460  C CA  . GLU A 72  ? 0.4042 0.4803 0.2704 -0.0164 0.0813  -0.0421 72  GLU A CA  
461  C C   . GLU A 72  ? 0.4114 0.4805 0.2636 -0.0252 0.0704  -0.0335 72  GLU A C   
462  O O   . GLU A 72  ? 0.4517 0.5208 0.2799 -0.0287 0.0698  -0.0367 72  GLU A O   
463  C CB  . GLU A 72  ? 0.4138 0.5121 0.2798 -0.0183 0.0936  -0.0365 72  GLU A CB  
464  C CG  . GLU A 72  ? 0.4728 0.5815 0.3440 -0.0083 0.1072  -0.0477 72  GLU A CG  
465  C CD  . GLU A 72  ? 0.5284 0.6623 0.4141 -0.0096 0.1180  -0.0393 72  GLU A CD  
466  O OE1 . GLU A 72  ? 0.5520 0.6930 0.4420 -0.0195 0.1150  -0.0250 72  GLU A OE1 
467  O OE2 . GLU A 72  ? 0.5578 0.7043 0.4519 -0.0007 0.1298  -0.0467 72  GLU A OE2 
468  N N   . LYS A 73  ? 0.3577 0.4214 0.2249 -0.0285 0.0618  -0.0227 73  LYS A N   
469  C CA  . LYS A 73  ? 0.3654 0.4241 0.2243 -0.0354 0.0518  -0.0119 73  LYS A CA  
470  C C   . LYS A 73  ? 0.3737 0.4170 0.2387 -0.0339 0.0405  -0.0144 73  LYS A C   
471  O O   . LYS A 73  ? 0.3934 0.4336 0.2520 -0.0381 0.0316  -0.0069 73  LYS A O   
472  C CB  . LYS A 73  ? 0.3394 0.4031 0.2098 -0.0407 0.0519  0.0041  73  LYS A CB  
473  C CG  . LYS A 73  ? 0.3682 0.4477 0.2268 -0.0461 0.0605  0.0120  73  LYS A CG  
474  C CD  . LYS A 73  ? 0.3708 0.4557 0.2477 -0.0504 0.0644  0.0236  73  LYS A CD  
475  C CE  . LYS A 73  ? 0.4108 0.5111 0.2765 -0.0574 0.0728  0.0343  73  LYS A CE  
476  N NZ  . LYS A 73  ? 0.4682 0.5845 0.3217 -0.0541 0.0847  0.0241  73  LYS A NZ  
477  N N   . LEU A 74  ? 0.3472 0.3823 0.2252 -0.0277 0.0408  -0.0236 74  LEU A N   
478  C CA  . LEU A 74  ? 0.3439 0.3657 0.2297 -0.0266 0.0314  -0.0249 74  LEU A CA  
479  C C   . LEU A 74  ? 0.3302 0.3421 0.2141 -0.0217 0.0319  -0.0392 74  LEU A C   
480  O O   . LEU A 74  ? 0.3800 0.3917 0.2711 -0.0155 0.0390  -0.0462 74  LEU A O   
481  C CB  . LEU A 74  ? 0.3665 0.3846 0.2737 -0.0252 0.0295  -0.0179 74  LEU A CB  
482  C CG  . LEU A 74  ? 0.4195 0.4255 0.3355 -0.0238 0.0212  -0.0178 74  LEU A CG  
483  C CD1 . LEU A 74  ? 0.4690 0.4748 0.3772 -0.0285 0.0132  -0.0107 74  LEU A CD1 
484  C CD2 . LEU A 74  ? 0.3850 0.3870 0.3189 -0.0221 0.0209  -0.0128 74  LEU A CD2 
485  N N   . LYS A 75  ? 0.3178 0.3218 0.1932 -0.0249 0.0242  -0.0427 75  LYS A N   
486  C CA  . LYS A 75  ? 0.3947 0.3857 0.2696 -0.0220 0.0233  -0.0550 75  LYS A CA  
487  C C   . LYS A 75  ? 0.4245 0.4067 0.3156 -0.0218 0.0159  -0.0509 75  LYS A C   
488  O O   . LYS A 75  ? 0.4657 0.4517 0.3634 -0.0250 0.0096  -0.0403 75  LYS A O   
489  C CB  . LYS A 75  ? 0.3944 0.3822 0.2469 -0.0273 0.0204  -0.0640 75  LYS A CB  
490  C CG  . LYS A 75  ? 0.4367 0.4254 0.2728 -0.0242 0.0309  -0.0760 75  LYS A CG  
491  C CD  . LYS A 75  ? 0.4728 0.4609 0.2817 -0.0317 0.0275  -0.0837 75  LYS A CD  
492  C CE  . LYS A 75  ? 0.5363 0.5056 0.3386 -0.0328 0.0246  -0.0988 75  LYS A CE  
493  N NZ  . LYS A 75  ? 0.5484 0.5065 0.3495 -0.0236 0.0369  -0.1129 75  LYS A NZ  
494  N N   . CYS A 76  ? 0.3654 0.3358 0.2631 -0.0174 0.0173  -0.0589 76  CYS A N   
495  C CA  . CYS A 76  ? 0.3775 0.3398 0.2892 -0.0172 0.0117  -0.0555 76  CYS A CA  
496  C C   . CYS A 76  ? 0.4519 0.3990 0.3628 -0.0156 0.0121  -0.0658 76  CYS A C   
497  O O   . CYS A 76  ? 0.4573 0.3983 0.3645 -0.0100 0.0190  -0.0743 76  CYS A O   
498  C CB  . CYS A 76  ? 0.3490 0.3142 0.2774 -0.0122 0.0143  -0.0483 76  CYS A CB  
499  S SG  . CYS A 76  ? 0.7144 0.6708 0.6580 -0.0114 0.0094  -0.0442 76  CYS A SG  
500  N N   . MET A 77  ? 0.4891 0.4299 0.4045 -0.0204 0.0050  -0.0643 77  MET A N   
501  C CA  . MET A 77  ? 0.4992 0.4237 0.4162 -0.0205 0.0047  -0.0718 77  MET A CA  
502  C C   . MET A 77  ? 0.4116 0.3305 0.3437 -0.0127 0.0086  -0.0681 77  MET A C   
503  O O   . MET A 77  ? 0.3498 0.2763 0.2933 -0.0114 0.0073  -0.0587 77  MET A O   
504  C CB  . MET A 77  ? 0.5126 0.4356 0.4314 -0.0298 -0.0044 -0.0699 77  MET A CB  
505  C CG  . MET A 77  ? 0.5183 0.4473 0.4209 -0.0386 -0.0104 -0.0739 77  MET A CG  
506  S SD  . MET A 77  ? 0.5892 0.4989 0.4748 -0.0444 -0.0105 -0.0913 77  MET A SD  
507  C CE  . MET A 77  ? 0.7330 0.6488 0.6202 -0.0589 -0.0243 -0.0882 77  MET A CE  
508  N N   . THR A 78  ? 0.3802 0.2854 0.3118 -0.0073 0.0135  -0.0755 78  THR A N   
509  C CA  . THR A 78  ? 0.4217 0.3220 0.3664 0.0003  0.0164  -0.0710 78  THR A CA  
510  C C   . THR A 78  ? 0.4303 0.3103 0.3765 -0.0002 0.0159  -0.0750 78  THR A C   
511  O O   . THR A 78  ? 0.4165 0.2838 0.3525 -0.0041 0.0157  -0.0846 78  THR A O   
512  C CB  . THR A 78  ? 0.4664 0.3723 0.4134 0.0103  0.0238  -0.0725 78  THR A CB  
513  O OG1 . THR A 78  ? 0.4802 0.3781 0.4166 0.0133  0.0292  -0.0837 78  THR A OG1 
514  C CG2 . THR A 78  ? 0.4524 0.3780 0.4010 0.0095  0.0243  -0.0665 78  THR A CG2 
515  N N   . LEU A 79  ? 0.4057 0.2821 0.3635 0.0030  0.0156  -0.0675 79  LEU A N   
516  C CA  . LEU A 79  ? 0.3317 0.1887 0.2925 0.0018  0.0152  -0.0682 79  LEU A CA  
517  C C   . LEU A 79  ? 0.3266 0.1651 0.2814 0.0077  0.0204  -0.0782 79  LEU A C   
518  O O   . LEU A 79  ? 0.2907 0.1319 0.2475 0.0185  0.0260  -0.0791 79  LEU A O   
519  C CB  . LEU A 79  ? 0.3294 0.1876 0.3017 0.0062  0.0155  -0.0575 79  LEU A CB  
520  C CG  . LEU A 79  ? 0.3253 0.1959 0.3037 0.0001  0.0115  -0.0487 79  LEU A CG  
521  C CD1 . LEU A 79  ? 0.3602 0.2334 0.3459 0.0056  0.0131  -0.0395 79  LEU A CD1 
522  C CD2 . LEU A 79  ? 0.2582 0.1221 0.2376 -0.0104 0.0074  -0.0490 79  LEU A CD2 
523  N N   . CYS A 80  ? 0.3122 0.1320 0.2605 0.0005  0.0186  -0.0857 80  CYS A N   
524  C CA  . CYS A 80  ? 0.3767 0.1757 0.3172 0.0053  0.0238  -0.0974 80  CYS A CA  
525  C C   . CYS A 80  ? 0.4285 0.2151 0.3803 0.0157  0.0265  -0.0914 80  CYS A C   
526  O O   . CYS A 80  ? 0.3471 0.1245 0.3065 0.0120  0.0235  -0.0835 80  CYS A O   
527  C CB  . CYS A 80  ? 0.4112 0.1988 0.3426 -0.0068 0.0180  -0.1058 80  CYS A CB  
528  S SG  . CYS A 80  ? 0.5429 0.3131 0.4657 -0.0007 0.0212  -0.1190 80  CYS A SG  
529  N N   . PHE A 81  ? 0.4083 0.1958 0.3616 0.0287  0.0323  -0.0943 81  PHE A N   
530  C CA  . PHE A 81  ? 0.4040 0.1815 0.3684 0.0398  0.0345  -0.0881 81  PHE A CA  
531  C C   . PHE A 81  ? 0.4432 0.1964 0.4050 0.0382  0.0331  -0.0941 81  PHE A C   
532  O O   . PHE A 81  ? 0.4061 0.1466 0.3765 0.0451  0.0336  -0.0880 81  PHE A O   
533  C CB  . PHE A 81  ? 0.3872 0.1773 0.3570 0.0547  0.0411  -0.0884 81  PHE A CB  
534  C CG  . PHE A 81  ? 0.4025 0.2156 0.3763 0.0565  0.0427  -0.0821 81  PHE A CG  
535  C CD1 . PHE A 81  ? 0.3882 0.2077 0.3711 0.0568  0.0395  -0.0693 81  PHE A CD1 
536  C CD2 . PHE A 81  ? 0.4459 0.2755 0.4141 0.0574  0.0471  -0.0885 81  PHE A CD2 
537  C CE1 . PHE A 81  ? 0.3803 0.2271 0.3679 0.0565  0.0371  -0.0626 81  PHE A CE1 
538  C CE2 . PHE A 81  ? 0.4351 0.2909 0.4092 0.0571  0.0454  -0.0807 81  PHE A CE2 
539  C CZ  . PHE A 81  ? 0.3843 0.2483 0.3682 0.0563  0.0399  -0.0682 81  PHE A CZ  
540  N N   . ARG A 82  ? 0.4102 0.1569 0.3599 0.0286  0.0308  -0.1058 82  ARG A N   
541  C CA  . ARG A 82  ? 0.4439 0.1666 0.3897 0.0259  0.0292  -0.1137 82  ARG A CA  
542  C C   . ARG A 82  ? 0.4490 0.1605 0.3956 0.0104  0.0219  -0.1109 82  ARG A C   
543  O O   . ARG A 82  ? 0.6441 0.3356 0.5874 0.0049  0.0194  -0.1178 82  ARG A O   
544  C CB  . ARG A 82  ? 0.4646 0.1863 0.3955 0.0258  0.0316  -0.1297 82  ARG A CB  
545  C CG  . ARG A 82  ? 0.5311 0.2620 0.4627 0.0418  0.0402  -0.1333 82  ARG A CG  
546  C CD  . ARG A 82  ? 0.5412 0.2771 0.4555 0.0403  0.0432  -0.1478 82  ARG A CD  
547  N NE  . ARG A 82  ? 0.5840 0.3319 0.5006 0.0554  0.0525  -0.1505 82  ARG A NE  
548  C CZ  . ARG A 82  ? 0.5957 0.3516 0.4984 0.0573  0.0576  -0.1615 82  ARG A CZ  
549  N NH1 . ARG A 82  ? 0.5689 0.3214 0.4527 0.0450  0.0536  -0.1710 82  ARG A NH1 
550  N NH2 . ARG A 82  ? 0.4977 0.2666 0.4055 0.0714  0.0668  -0.1626 82  ARG A NH2 
551  N N   . ASN A 83  ? 0.4226 0.1474 0.3743 0.0032  0.0187  -0.1009 83  ASN A N   
552  C CA  . ASN A 83  ? 0.5825 0.3006 0.5391 -0.0107 0.0128  -0.0953 83  ASN A CA  
553  C C   . ASN A 83  ? 0.4113 0.1288 0.3802 -0.0067 0.0141  -0.0794 83  ASN A C   
554  O O   . ASN A 83  ? 0.5356 0.2686 0.5081 0.0003  0.0169  -0.0720 83  ASN A O   
555  C CB  . ASN A 83  ? 0.5449 0.2801 0.4972 -0.0242 0.0078  -0.0970 83  ASN A CB  
556  C CG  . ASN A 83  ? 0.5446 0.2774 0.5052 -0.0387 0.0021  -0.0902 83  ASN A CG  
557  O OD1 . ASN A 83  ? 0.5517 0.2908 0.5221 -0.0392 0.0030  -0.0777 83  ASN A OD1 
558  N ND2 . ASN A 83  ? 0.5219 0.2470 0.4790 -0.0509 -0.0036 -0.0985 83  ASN A ND2 
559  N N   . LEU A 84  ? 0.4295 0.1293 0.4040 -0.0118 0.0119  -0.0742 84  LEU A N   
560  C CA  . LEU A 84  ? 0.4822 0.1792 0.4661 -0.0081 0.0134  -0.0584 84  LEU A CA  
561  C C   . LEU A 84  ? 0.3931 0.1104 0.3815 -0.0123 0.0135  -0.0481 84  LEU A C   
562  O O   . LEU A 84  ? 0.3780 0.1040 0.3701 -0.0027 0.0168  -0.0386 84  LEU A O   
563  C CB  . LEU A 84  ? 0.5237 0.1989 0.5114 -0.0169 0.0104  -0.0544 84  LEU A CB  
564  C CG  . LEU A 84  ? 0.5269 0.2000 0.5224 -0.0171 0.0116  -0.0366 84  LEU A CG  
565  C CD1 . LEU A 84  ? 0.5004 0.1656 0.4976 -0.0006 0.0152  -0.0291 84  LEU A CD1 
566  C CD2 . LEU A 84  ? 0.5458 0.2031 0.5449 -0.0317 0.0078  -0.0327 84  LEU A CD2 
567  N N   . ARG A 85  ? 0.4454 0.1709 0.4342 -0.0266 0.0098  -0.0501 85  ARG A N   
568  C CA  . ARG A 85  ? 0.4478 0.1915 0.4427 -0.0313 0.0106  -0.0407 85  ARG A CA  
569  C C   . ARG A 85  ? 0.4613 0.2246 0.4533 -0.0219 0.0128  -0.0417 85  ARG A C   
570  O O   . ARG A 85  ? 0.4953 0.2743 0.4921 -0.0164 0.0141  -0.0312 85  ARG A O   
571  C CB  . ARG A 85  ? 0.5501 0.3012 0.5483 -0.0484 0.0056  -0.0430 85  ARG A CB  
572  C CG  . ARG A 85  ? 0.6342 0.4019 0.6443 -0.0542 0.0061  -0.0294 85  ARG A CG  
573  C CD  . ARG A 85  ? 0.6364 0.4333 0.6502 -0.0593 0.0017  -0.0298 85  ARG A CD  
574  N NE  . ARG A 85  ? 0.6453 0.4528 0.6718 -0.0725 -0.0009 -0.0227 85  ARG A NE  
575  C CZ  . ARG A 85  ? 0.6565 0.4754 0.6935 -0.0722 0.0031  -0.0097 85  ARG A CZ  
576  N NH1 . ARG A 85  ? 0.6445 0.4644 0.6784 -0.0600 0.0088  -0.0028 85  ARG A NH1 
577  N NH2 . ARG A 85  ? 0.6913 0.5220 0.7415 -0.0845 0.0014  -0.0036 85  ARG A NH2 
578  N N   . SER A 86  ? 0.4258 0.1921 0.4092 -0.0202 0.0121  -0.0538 86  SER A N   
579  C CA  . SER A 86  ? 0.3547 0.1437 0.3358 -0.0122 0.0128  -0.0540 86  SER A CA  
580  C C   . SER A 86  ? 0.3304 0.1177 0.3128 0.0030  0.0178  -0.0508 86  SER A C   
581  O O   . SER A 86  ? 0.2911 0.0981 0.2760 0.0090  0.0181  -0.0456 86  SER A O   
582  C CB  . SER A 86  ? 0.3905 0.1840 0.3610 -0.0158 0.0109  -0.0667 86  SER A CB  
583  O OG  . SER A 86  ? 0.4521 0.2260 0.4145 -0.0112 0.0144  -0.0777 86  SER A OG  
584  N N   . ASN A 87  ? 0.3573 0.1232 0.3393 0.0091  0.0208  -0.0535 87  ASN A N   
585  C CA  . ASN A 87  ? 0.4219 0.1887 0.4080 0.0242  0.0245  -0.0489 87  ASN A CA  
586  C C   . ASN A 87  ? 0.4340 0.2057 0.4273 0.0275  0.0245  -0.0338 87  ASN A C   
587  O O   . ASN A 87  ? 0.4489 0.2356 0.4455 0.0373  0.0251  -0.0280 87  ASN A O   
588  C CB  . ASN A 87  ? 0.4531 0.2012 0.4393 0.0303  0.0254  -0.0535 87  ASN A CB  
589  C CG  . ASN A 87  ? 0.5086 0.2600 0.5014 0.0467  0.0290  -0.0485 87  ASN A CG  
590  O OD1 . ASN A 87  ? 0.5534 0.2962 0.5525 0.0521  0.0286  -0.0381 87  ASN A OD1 
591  N ND2 . ASN A 87  ? 0.5342 0.2998 0.5261 0.0543  0.0324  -0.0551 87  ASN A ND2 
592  N N   . GLN A 88  ? 0.3896 0.1527 0.3850 0.0183  0.0228  -0.0268 88  GLN A N   
593  C CA  . GLN A 88  ? 0.3978 0.1691 0.3976 0.0196  0.0222  -0.0120 88  GLN A CA  
594  C C   . GLN A 88  ? 0.3208 0.1210 0.3201 0.0197  0.0204  -0.0093 88  GLN A C   
595  O O   . GLN A 88  ? 0.2924 0.1037 0.2923 0.0269  0.0203  -0.0013 88  GLN A O   
596  C CB  . GLN A 88  ? 0.4670 0.2268 0.4693 0.0076  0.0217  -0.0056 88  GLN A CB  
597  C CG  . GLN A 88  ? 0.5462 0.2810 0.5495 0.0072  0.0215  -0.0041 88  GLN A CG  
598  C CD  . GLN A 88  ? 0.5595 0.2867 0.5661 -0.0066 0.0204  0.0025  88  GLN A CD  
599  O OE1 . GLN A 88  ? 0.5495 0.2883 0.5588 -0.0173 0.0201  0.0022  88  GLN A OE1 
600  N NE2 . GLN A 88  ? 0.5636 0.2722 0.5711 -0.0065 0.0199  0.0090  88  GLN A NE2 
601  N N   . ILE A 89  ? 0.2801 0.0917 0.2780 0.0113  0.0185  -0.0158 89  ILE A N   
602  C CA  . ILE A 89  ? 0.2995 0.1349 0.2972 0.0109  0.0172  -0.0140 89  ILE A CA  
603  C C   . ILE A 89  ? 0.3087 0.1553 0.3047 0.0204  0.0176  -0.0171 89  ILE A C   
604  O O   . ILE A 89  ? 0.3291 0.1897 0.3253 0.0240  0.0171  -0.0118 89  ILE A O   
605  C CB  . ILE A 89  ? 0.2475 0.0915 0.2453 0.0011  0.0148  -0.0197 89  ILE A CB  
606  C CG1 . ILE A 89  ? 0.3419 0.1795 0.3446 -0.0092 0.0140  -0.0157 89  ILE A CG1 
607  C CG2 . ILE A 89  ? 0.2263 0.0914 0.2244 0.0020  0.0142  -0.0177 89  ILE A CG2 
608  C CD1 . ILE A 89  ? 0.2817 0.1303 0.2870 -0.0187 0.0105  -0.0197 89  ILE A CD1 
609  N N   . ALA A 90  ? 0.3252 0.1657 0.3191 0.0238  0.0188  -0.0262 90  ALA A N   
610  C CA  . ALA A 90  ? 0.3861 0.2386 0.3804 0.0324  0.0202  -0.0291 90  ALA A CA  
611  C C   . ALA A 90  ? 0.2520 0.1067 0.2514 0.0427  0.0207  -0.0208 90  ALA A C   
612  O O   . ALA A 90  ? 0.2396 0.1125 0.2413 0.0468  0.0196  -0.0182 90  ALA A O   
613  C CB  . ALA A 90  ? 0.2624 0.1062 0.2531 0.0348  0.0231  -0.0404 90  ALA A CB  
614  N N   . GLN A 91  ? 0.2702 0.1065 0.2716 0.0464  0.0217  -0.0160 91  GLN A N   
615  C CA  . GLN A 91  ? 0.4543 0.2921 0.4606 0.0566  0.0213  -0.0058 91  GLN A CA  
616  C C   . GLN A 91  ? 0.4221 0.2760 0.4264 0.0535  0.0177  0.0039  91  GLN A C   
617  O O   . GLN A 91  ? 0.4413 0.3109 0.4478 0.0597  0.0154  0.0091  91  GLN A O   
618  C CB  . GLN A 91  ? 0.4342 0.2457 0.4423 0.0600  0.0232  -0.0011 91  GLN A CB  
619  C CG  . GLN A 91  ? 0.4895 0.3017 0.5030 0.0717  0.0222  0.0115  91  GLN A CG  
620  C CD  . GLN A 91  ? 0.5537 0.3754 0.5751 0.0851  0.0238  0.0086  91  GLN A CD  
621  O OE1 . GLN A 91  ? 0.6168 0.4239 0.6408 0.0908  0.0286  -0.0001 91  GLN A OE1 
622  N NE2 . GLN A 91  ? 0.5247 0.3717 0.5499 0.0898  0.0200  0.0152  91  GLN A NE2 
623  N N   . LEU A 92  ? 0.3739 0.2243 0.3740 0.0436  0.0175  0.0057  92  LEU A N   
624  C CA  . LEU A 92  ? 0.4105 0.2736 0.4064 0.0397  0.0158  0.0131  92  LEU A CA  
625  C C   . LEU A 92  ? 0.4080 0.2921 0.4022 0.0389  0.0140  0.0085  92  LEU A C   
626  O O   . LEU A 92  ? 0.4899 0.3865 0.4808 0.0405  0.0117  0.0136  92  LEU A O   
627  C CB  . LEU A 92  ? 0.4627 0.3187 0.4570 0.0295  0.0176  0.0143  92  LEU A CB  
628  C CG  . LEU A 92  ? 0.5587 0.4238 0.5485 0.0251  0.0184  0.0220  92  LEU A CG  
629  C CD1 . LEU A 92  ? 0.6034 0.4555 0.5952 0.0183  0.0212  0.0275  92  LEU A CD1 
630  C CD2 . LEU A 92  ? 0.5811 0.4616 0.5695 0.0207  0.0185  0.0156  92  LEU A CD2 
631  N N   . LEU A 93  ? 0.3308 0.2180 0.3263 0.0357  0.0147  -0.0010 93  LEU A N   
632  C CA  . LEU A 93  ? 0.2913 0.1957 0.2862 0.0344  0.0134  -0.0053 93  LEU A CA  
633  C C   . LEU A 93  ? 0.2678 0.1834 0.2668 0.0422  0.0119  -0.0045 93  LEU A C   
634  O O   . LEU A 93  ? 0.2199 0.1508 0.2183 0.0412  0.0095  -0.0039 93  LEU A O   
635  C CB  . LEU A 93  ? 0.2772 0.1817 0.2723 0.0294  0.0145  -0.0138 93  LEU A CB  
636  C CG  . LEU A 93  ? 0.2803 0.1820 0.2738 0.0211  0.0147  -0.0140 93  LEU A CG  
637  C CD1 . LEU A 93  ? 0.2631 0.1612 0.2565 0.0168  0.0146  -0.0210 93  LEU A CD1 
638  C CD2 . LEU A 93  ? 0.3084 0.2222 0.3002 0.0184  0.0142  -0.0126 93  LEU A CD2 
639  N N   . ARG A 94  ? 0.2865 0.1943 0.2905 0.0499  0.0135  -0.0047 94  ARG A N   
640  C CA  . ARG A 94  ? 0.3336 0.2540 0.3451 0.0589  0.0127  -0.0032 94  ARG A CA  
641  C C   . ARG A 94  ? 0.3315 0.2604 0.3436 0.0629  0.0082  0.0076  94  ARG A C   
642  O O   . ARG A 94  ? 0.3368 0.2852 0.3535 0.0655  0.0048  0.0098  94  ARG A O   
643  C CB  . ARG A 94  ? 0.3650 0.2730 0.3823 0.0678  0.0170  -0.0064 94  ARG A CB  
644  C CG  . ARG A 94  ? 0.4013 0.3257 0.4289 0.0776  0.0181  -0.0068 94  ARG A CG  
645  C CD  . ARG A 94  ? 0.4803 0.3898 0.5141 0.0890  0.0235  -0.0092 94  ARG A CD  
646  N NE  . ARG A 94  ? 0.5738 0.4567 0.5992 0.0844  0.0269  -0.0161 94  ARG A NE  
647  C CZ  . ARG A 94  ? 0.6448 0.5232 0.6639 0.0789  0.0304  -0.0278 94  ARG A CZ  
648  N NH1 . ARG A 94  ? 0.6320 0.4870 0.6434 0.0735  0.0320  -0.0338 94  ARG A NH1 
649  N NH2 . ARG A 94  ? 0.6945 0.5924 0.7144 0.0778  0.0321  -0.0329 94  ARG A NH2 
650  N N   . ASN A 95  ? 0.3214 0.2368 0.3287 0.0625  0.0077  0.0149  95  ASN A N   
651  C CA  . ASN A 95  ? 0.3489 0.2719 0.3531 0.0650  0.0032  0.0261  95  ASN A CA  
652  C C   . ASN A 95  ? 0.3452 0.2856 0.3418 0.0574  -0.0004 0.0246  95  ASN A C   
653  O O   . ASN A 95  ? 0.3806 0.3369 0.3763 0.0594  -0.0057 0.0300  95  ASN A O   
654  C CB  . ASN A 95  ? 0.3584 0.2629 0.3566 0.0636  0.0047  0.0344  95  ASN A CB  
655  C CG  . ASN A 95  ? 0.3847 0.2690 0.3901 0.0715  0.0075  0.0374  95  ASN A CG  
656  O OD1 . ASN A 95  ? 0.4019 0.2883 0.4167 0.0812  0.0078  0.0358  95  ASN A OD1 
657  N ND2 . ASN A 95  ? 0.4082 0.2724 0.4098 0.0675  0.0101  0.0418  95  ASN A ND2 
658  N N   . ALA A 96  ? 0.2489 0.1861 0.2402 0.0486  0.0024  0.0172  96  ALA A N   
659  C CA  . ALA A 96  ? 0.2723 0.2215 0.2563 0.0414  0.0005  0.0139  96  ALA A CA  
660  C C   . ALA A 96  ? 0.2884 0.2546 0.2786 0.0416  -0.0026 0.0093  96  ALA A C   
661  O O   . ALA A 96  ? 0.2970 0.2765 0.2829 0.0382  -0.0071 0.0099  96  ALA A O   
662  C CB  . ALA A 96  ? 0.2636 0.2045 0.2438 0.0340  0.0048  0.0078  96  ALA A CB  
663  N N   . GLY A 97  ? 0.2518 0.2178 0.2515 0.0445  0.0000  0.0045  97  GLY A N   
664  C CA  . GLY A 97  ? 0.2619 0.2449 0.2693 0.0444  -0.0014 0.0008  97  GLY A CA  
665  C C   . GLY A 97  ? 0.2601 0.2606 0.2749 0.0503  -0.0067 0.0074  97  GLY A C   
666  O O   . GLY A 97  ? 0.2920 0.3106 0.3094 0.0459  -0.0109 0.0065  97  GLY A O   
667  N N   . ASP A 98  ? 0.2288 0.2241 0.2475 0.0598  -0.0072 0.0148  98  ASP A N   
668  C CA  . ASP A 98  ? 0.2127 0.2256 0.2399 0.0672  -0.0130 0.0234  98  ASP A CA  
669  C C   . ASP A 98  ? 0.2154 0.2412 0.2327 0.0604  -0.0209 0.0278  98  ASP A C   
670  O O   . ASP A 98  ? 0.2462 0.2937 0.2703 0.0625  -0.0279 0.0331  98  ASP A O   
671  C CB  . ASP A 98  ? 0.2835 0.2836 0.3151 0.0791  -0.0117 0.0321  98  ASP A CB  
672  C CG  . ASP A 98  ? 0.3636 0.3526 0.4058 0.0874  -0.0042 0.0269  98  ASP A CG  
673  O OD1 . ASP A 98  ? 0.3541 0.3522 0.4022 0.0856  -0.0008 0.0183  98  ASP A OD1 
674  O OD2 . ASP A 98  ? 0.4201 0.3903 0.4638 0.0954  -0.0014 0.0313  98  ASP A OD2 
675  N N   . ALA A 99  ? 0.2158 0.2294 0.2171 0.0521  -0.0199 0.0252  99  ALA A N   
676  C CA  . ALA A 99  ? 0.2728 0.2958 0.2607 0.0451  -0.0261 0.0271  99  ALA A CA  
677  C C   . ALA A 99  ? 0.2927 0.3318 0.2819 0.0361  -0.0298 0.0193  99  ALA A C   
678  O O   . ALA A 99  ? 0.3655 0.4167 0.3460 0.0302  -0.0368 0.0201  99  ALA A O   
679  C CB  . ALA A 99  ? 0.2265 0.2318 0.1975 0.0397  -0.0218 0.0257  99  ALA A CB  
680  N N   . THR A 100 ? 0.2311 0.2699 0.2302 0.0342  -0.0252 0.0120  100 THR A N   
681  C CA  . THR A 100 ? 0.2234 0.2751 0.2251 0.0247  -0.0277 0.0053  100 THR A CA  
682  C C   . THR A 100 ? 0.2824 0.3613 0.2979 0.0261  -0.0350 0.0099  100 THR A C   
683  O O   . THR A 100 ? 0.3657 0.4583 0.3826 0.0163  -0.0395 0.0059  100 THR A O   
684  C CB  . THR A 100 ? 0.2217 0.2657 0.2296 0.0222  -0.0204 -0.0020 100 THR A CB  
685  O OG1 . THR A 100 ? 0.1810 0.2282 0.2028 0.0318  -0.0166 0.0004  100 THR A OG1 
686  C CG2 . THR A 100 ? 0.2597 0.2807 0.2558 0.0195  -0.0146 -0.0063 100 THR A CG2 
687  N N   . LYS A 101 ? 0.2746 0.3612 0.3016 0.0381  -0.0361 0.0185  101 LYS A N   
688  C CA  . LYS A 101 ? 0.3452 0.4606 0.3892 0.0420  -0.0428 0.0248  101 LYS A CA  
689  C C   . LYS A 101 ? 0.4040 0.5365 0.4397 0.0341  -0.0546 0.0284  101 LYS A C   
690  O O   . LYS A 101 ? 0.4596 0.6157 0.5043 0.0267  -0.0609 0.0272  101 LYS A O   
691  C CB  . LYS A 101 ? 0.4010 0.5176 0.4583 0.0587  -0.0411 0.0343  101 LYS A CB  
692  C CG  . LYS A 101 ? 0.4587 0.5694 0.5299 0.0666  -0.0308 0.0300  101 LYS A CG  
693  C CD  . LYS A 101 ? 0.5006 0.5853 0.5685 0.0778  -0.0244 0.0324  101 LYS A CD  
694  C CE  . LYS A 101 ? 0.5306 0.6239 0.6178 0.0944  -0.0227 0.0398  101 LYS A CE  
695  N NZ  . LYS A 101 ? 0.5841 0.6488 0.6667 0.1043  -0.0176 0.0430  101 LYS A NZ  
696  N N   . ASP A 102 ? 0.3941 0.5151 0.4118 0.0349  -0.0575 0.0328  102 ASP A N   
697  C CA  . ASP A 102 ? 0.3974 0.5328 0.4021 0.0275  -0.0687 0.0360  102 ASP A CA  
698  C C   . ASP A 102 ? 0.3948 0.5167 0.3775 0.0129  -0.0677 0.0241  102 ASP A C   
699  O O   . ASP A 102 ? 0.4819 0.6139 0.4507 0.0036  -0.0763 0.0226  102 ASP A O   
700  C CB  . ASP A 102 ? 0.4324 0.5647 0.4284 0.0368  -0.0724 0.0488  102 ASP A CB  
701  C CG  . ASP A 102 ? 0.4450 0.5901 0.4634 0.0524  -0.0741 0.0616  102 ASP A CG  
702  O OD1 . ASP A 102 ? 0.4106 0.5788 0.4506 0.0544  -0.0769 0.0619  102 ASP A OD1 
703  O OD2 . ASP A 102 ? 0.4856 0.6178 0.5009 0.0629  -0.0723 0.0717  102 ASP A OD2 
704  N N   . GLY A 103 ? 0.3103 0.4090 0.2894 0.0113  -0.0571 0.0157  103 GLY A N   
705  C CA  . GLY A 103 ? 0.2969 0.3806 0.2583 -0.0004 -0.0542 0.0044  103 GLY A CA  
706  C C   . GLY A 103 ? 0.2846 0.3511 0.2235 0.0002  -0.0511 0.0050  103 GLY A C   
707  O O   . GLY A 103 ? 0.2655 0.3275 0.1854 -0.0089 -0.0526 -0.0020 103 GLY A O   
708  N N   . PHE A 104 ? 0.2894 0.3456 0.2304 0.0106  -0.0461 0.0129  104 PHE A N   
709  C CA  . PHE A 104 ? 0.2862 0.3289 0.2082 0.0118  -0.0426 0.0163  104 PHE A CA  
710  C C   . PHE A 104 ? 0.2671 0.2870 0.1857 0.0112  -0.0310 0.0100  104 PHE A C   
711  O O   . PHE A 104 ? 0.2938 0.3030 0.1991 0.0119  -0.0262 0.0126  104 PHE A O   
712  C CB  . PHE A 104 ? 0.3474 0.3929 0.2735 0.0225  -0.0450 0.0312  104 PHE A CB  
713  C CG  . PHE A 104 ? 0.4062 0.4756 0.3338 0.0243  -0.0572 0.0403  104 PHE A CG  
714  C CD1 . PHE A 104 ? 0.4394 0.5255 0.3577 0.0141  -0.0659 0.0347  104 PHE A CD1 
715  C CD2 . PHE A 104 ? 0.4310 0.5058 0.3695 0.0361  -0.0603 0.0548  104 PHE A CD2 
716  C CE1 . PHE A 104 ? 0.4593 0.5706 0.3799 0.0150  -0.0786 0.0439  104 PHE A CE1 
717  C CE2 . PHE A 104 ? 0.4304 0.5294 0.3721 0.0389  -0.0722 0.0650  104 PHE A CE2 
718  C CZ  . PHE A 104 ? 0.4434 0.5624 0.3764 0.0281  -0.0819 0.0598  104 PHE A CZ  
719  N N   . LEU A 105 ? 0.2739 0.2885 0.2053 0.0099  -0.0266 0.0029  105 LEU A N   
720  C CA  . LEU A 105 ? 0.3290 0.3252 0.2606 0.0101  -0.0170 -0.0016 105 LEU A CA  
721  C C   . LEU A 105 ? 0.3709 0.3608 0.2966 0.0019  -0.0139 -0.0128 105 LEU A C   
722  O O   . LEU A 105 ? 0.4283 0.4220 0.3633 -0.0018 -0.0153 -0.0179 105 LEU A O   
723  C CB  . LEU A 105 ? 0.3240 0.3166 0.2736 0.0160  -0.0138 0.0000  105 LEU A CB  
724  C CG  . LEU A 105 ? 0.3786 0.3560 0.3308 0.0150  -0.0058 -0.0047 105 LEU A CG  
725  C CD1 . LEU A 105 ? 0.3979 0.3640 0.3414 0.0162  -0.0008 -0.0009 105 LEU A CD1 
726  C CD2 . LEU A 105 ? 0.4172 0.3929 0.3841 0.0193  -0.0039 -0.0045 105 LEU A CD2 
727  N N   . LYS A 106 ? 0.3163 0.2969 0.2262 -0.0009 -0.0096 -0.0164 106 LYS A N   
728  C CA  . LYS A 106 ? 0.3137 0.2837 0.2189 -0.0065 -0.0046 -0.0269 106 LYS A CA  
729  C C   . LYS A 106 ? 0.2806 0.2393 0.1979 -0.0039 0.0028  -0.0284 106 LYS A C   
730  O O   . LYS A 106 ? 0.2719 0.2264 0.1947 -0.0076 0.0038  -0.0342 106 LYS A O   
731  C CB  . LYS A 106 ? 0.3243 0.2876 0.2082 -0.0094 -0.0008 -0.0316 106 LYS A CB  
732  C CG  . LYS A 106 ? 0.3018 0.2516 0.1813 -0.0138 0.0052  -0.0430 106 LYS A CG  
733  C CD  . LYS A 106 ? 0.3309 0.2744 0.1871 -0.0169 0.0091  -0.0501 106 LYS A CD  
734  C CE  . LYS A 106 ? 0.3949 0.3479 0.2363 -0.0248 -0.0008 -0.0541 106 LYS A CE  
735  N NZ  . LYS A 106 ? 0.4952 0.4484 0.3113 -0.0258 0.0011  -0.0557 106 LYS A NZ  
736  N N   . GLU A 107 ? 0.2576 0.2119 0.1790 0.0017  0.0075  -0.0223 107 GLU A N   
737  C CA  . GLU A 107 ? 0.2646 0.2104 0.1967 0.0035  0.0136  -0.0231 107 GLU A CA  
738  C C   . GLU A 107 ? 0.2050 0.1498 0.1454 0.0083  0.0150  -0.0154 107 GLU A C   
739  O O   . GLU A 107 ? 0.2776 0.2228 0.2121 0.0104  0.0156  -0.0094 107 GLU A O   
740  C CB  . GLU A 107 ? 0.2210 0.1577 0.1457 0.0026  0.0212  -0.0279 107 GLU A CB  
741  C CG  . GLU A 107 ? 0.2756 0.2066 0.2126 0.0053  0.0271  -0.0266 107 GLU A CG  
742  C CD  . GLU A 107 ? 0.3472 0.2712 0.2796 0.0063  0.0355  -0.0305 107 GLU A CD  
743  O OE1 . GLU A 107 ? 0.3875 0.3084 0.3050 0.0044  0.0373  -0.0364 107 GLU A OE1 
744  O OE2 . GLU A 107 ? 0.3235 0.2458 0.2671 0.0091  0.0403  -0.0280 107 GLU A OE2 
745  N N   . VAL A 108 ? 0.1985 0.1412 0.1516 0.0093  0.0154  -0.0155 108 VAL A N   
746  C CA  . VAL A 108 ? 0.1998 0.1386 0.1603 0.0120  0.0173  -0.0103 108 VAL A CA  
747  C C   . VAL A 108 ? 0.2458 0.1804 0.2139 0.0105  0.0211  -0.0125 108 VAL A C   
748  O O   . VAL A 108 ? 0.2919 0.2273 0.2637 0.0090  0.0202  -0.0166 108 VAL A O   
749  C CB  . VAL A 108 ? 0.2260 0.1669 0.1934 0.0150  0.0131  -0.0081 108 VAL A CB  
750  C CG1 . VAL A 108 ? 0.1758 0.1204 0.1498 0.0138  0.0114  -0.0132 108 VAL A CG1 
751  C CG2 . VAL A 108 ? 0.2624 0.1953 0.2351 0.0168  0.0150  -0.0038 108 VAL A CG2 
752  N N   . SER A 109 ? 0.2861 0.2178 0.2573 0.0106  0.0251  -0.0087 109 SER A N   
753  C CA  . SER A 109 ? 0.2788 0.2099 0.2586 0.0095  0.0282  -0.0094 109 SER A CA  
754  C C   . SER A 109 ? 0.3007 0.2310 0.2889 0.0082  0.0293  -0.0045 109 SER A C   
755  O O   . SER A 109 ? 0.2628 0.1912 0.2487 0.0080  0.0310  0.0003  109 SER A O   
756  C CB  . SER A 109 ? 0.2347 0.1658 0.2105 0.0102  0.0341  -0.0114 109 SER A CB  
757  O OG  . SER A 109 ? 0.2042 0.1336 0.1717 0.0097  0.0328  -0.0172 109 SER A OG  
758  N N   . LEU A 110 ? 0.3132 0.2452 0.3111 0.0064  0.0279  -0.0052 110 LEU A N   
759  C CA  . LEU A 110 ? 0.2621 0.1952 0.2694 0.0032  0.0282  -0.0013 110 LEU A CA  
760  C C   . LEU A 110 ? 0.2260 0.1660 0.2406 0.0036  0.0339  0.0018  110 LEU A C   
761  O O   . LEU A 110 ? 0.1923 0.1360 0.2112 0.0056  0.0348  0.0002  110 LEU A O   
762  C CB  . LEU A 110 ? 0.2309 0.1646 0.2438 0.0004  0.0229  -0.0036 110 LEU A CB  
763  C CG  . LEU A 110 ? 0.2237 0.1597 0.2466 -0.0049 0.0217  -0.0003 110 LEU A CG  
764  C CD1 . LEU A 110 ? 0.2121 0.1390 0.2327 -0.0075 0.0216  0.0014  110 LEU A CD1 
765  C CD2 . LEU A 110 ? 0.2494 0.1889 0.2760 -0.0082 0.0159  -0.0029 110 LEU A CD2 
766  N N   . VAL A 111 ? 0.2346 0.1763 0.2515 0.0021  0.0384  0.0070  111 VAL A N   
767  C CA  . VAL A 111 ? 0.2140 0.1641 0.2379 0.0036  0.0459  0.0101  111 VAL A CA  
768  C C   . VAL A 111 ? 0.1780 0.1370 0.2188 -0.0012 0.0461  0.0159  111 VAL A C   
769  O O   . VAL A 111 ? 0.1862 0.1428 0.2285 -0.0064 0.0454  0.0201  111 VAL A O   
770  C CB  . VAL A 111 ? 0.1903 0.1390 0.2026 0.0056  0.0530  0.0119  111 VAL A CB  
771  C CG1 . VAL A 111 ? 0.1948 0.1531 0.2144 0.0080  0.0627  0.0144  111 VAL A CG1 
772  C CG2 . VAL A 111 ? 0.1977 0.1399 0.1935 0.0089  0.0515  0.0058  111 VAL A CG2 
773  N N   . ILE A 112 ? 0.1841 0.1534 0.2383 0.0003  0.0467  0.0168  112 ILE A N   
774  C CA  . ILE A 112 ? 0.1781 0.1601 0.2510 -0.0047 0.0456  0.0228  112 ILE A CA  
775  C C   . ILE A 112 ? 0.2608 0.2560 0.3452 -0.0012 0.0559  0.0280  112 ILE A C   
776  O O   . ILE A 112 ? 0.1753 0.1730 0.2604 0.0068  0.0616  0.0260  112 ILE A O   
777  C CB  . ILE A 112 ? 0.1641 0.1525 0.2466 -0.0056 0.0376  0.0221  112 ILE A CB  
778  C CG1 . ILE A 112 ? 0.1698 0.1459 0.2389 -0.0076 0.0295  0.0159  112 ILE A CG1 
779  C CG2 . ILE A 112 ? 0.1710 0.1742 0.2724 -0.0128 0.0340  0.0282  112 ILE A CG2 
780  C CD1 . ILE A 112 ? 0.1716 0.1536 0.2459 -0.0088 0.0218  0.0155  112 ILE A CD1 
781  N N   . THR A 113 ? 0.2145 0.2176 0.3083 -0.0072 0.0591  0.0346  113 THR A N   
782  C CA  . THR A 113 ? 0.2176 0.2360 0.3236 -0.0045 0.0704  0.0405  113 THR A CA  
783  C C   . THR A 113 ? 0.2428 0.2799 0.3737 -0.0121 0.0683  0.0485  113 THR A C   
784  O O   . THR A 113 ? 0.2850 0.3199 0.4199 -0.0212 0.0579  0.0488  113 THR A O   
785  C CB  . THR A 113 ? 0.2449 0.2572 0.3363 -0.0048 0.0794  0.0425  113 THR A CB  
786  O OG1 . THR A 113 ? 0.2600 0.2640 0.3478 -0.0142 0.0741  0.0463  113 THR A OG1 
787  C CG2 . THR A 113 ? 0.2002 0.1980 0.2678 0.0024  0.0813  0.0348  113 THR A CG2 
788  N N   . ASN A 114 ? 0.2581 0.3143 0.4061 -0.0087 0.0782  0.0544  114 ASN A N   
789  C CA  . ASN A 114 ? 0.3007 0.3789 0.4750 -0.0169 0.0772  0.0634  114 ASN A CA  
790  C C   . ASN A 114 ? 0.2994 0.3724 0.4704 -0.0290 0.0776  0.0681  114 ASN A C   
791  O O   . ASN A 114 ? 0.2877 0.3650 0.4707 -0.0410 0.0692  0.0715  114 ASN A O   
792  C CB  . ASN A 114 ? 0.3508 0.4526 0.5455 -0.0089 0.0898  0.0693  114 ASN A CB  
793  C CG  . ASN A 114 ? 0.4039 0.5129 0.6091 0.0025  0.0884  0.0672  114 ASN A CG  
794  O OD1 . ASN A 114 ? 0.4457 0.5566 0.6509 0.0149  0.1001  0.0654  114 ASN A OD1 
795  N ND2 . ASN A 114 ? 0.3691 0.4813 0.5825 -0.0015 0.0743  0.0676  114 ASN A ND2 
796  N N   . ASN A 115 ? 0.2781 0.3410 0.4320 -0.0263 0.0874  0.0686  115 ASN A N   
797  C CA  . ASN A 115 ? 0.2732 0.3287 0.4221 -0.0366 0.0889  0.0749  115 ASN A CA  
798  C C   . ASN A 115 ? 0.2447 0.2743 0.3646 -0.0343 0.0873  0.0705  115 ASN A C   
799  O O   . ASN A 115 ? 0.2612 0.2835 0.3640 -0.0242 0.0899  0.0639  115 ASN A O   
800  C CB  . ASN A 115 ? 0.3825 0.4565 0.5421 -0.0374 0.1037  0.0845  115 ASN A CB  
801  C CG  . ASN A 115 ? 0.4747 0.5743 0.6669 -0.0464 0.1033  0.0929  115 ASN A CG  
802  O OD1 . ASN A 115 ? 0.5517 0.6492 0.7523 -0.0605 0.0969  0.0980  115 ASN A OD1 
803  N ND2 . ASN A 115 ? 0.4683 0.5921 0.6801 -0.0383 0.1100  0.0946  115 ASN A ND2 
804  N N   . GLU A 116 ? 0.2644 0.2803 0.3798 -0.0439 0.0827  0.0744  116 GLU A N   
805  C CA  . GLU A 116 ? 0.2945 0.2876 0.3855 -0.0415 0.0809  0.0729  116 GLU A CA  
806  C C   . GLU A 116 ? 0.2826 0.2778 0.3576 -0.0349 0.0925  0.0766  116 GLU A C   
807  O O   . GLU A 116 ? 0.2886 0.2961 0.3699 -0.0383 0.1028  0.0857  116 GLU A O   
808  C CB  . GLU A 116 ? 0.4355 0.4136 0.5278 -0.0527 0.0761  0.0787  116 GLU A CB  
809  C CG  . GLU A 116 ? 0.6417 0.6003 0.7122 -0.0498 0.0776  0.0825  116 GLU A CG  
810  C CD  . GLU A 116 ? 0.7923 0.7285 0.8619 -0.0573 0.0699  0.0842  116 GLU A CD  
811  O OE1 . GLU A 116 ? 0.8385 0.7740 0.9234 -0.0667 0.0641  0.0820  116 GLU A OE1 
812  O OE2 . GLU A 116 ? 0.8322 0.7511 0.8857 -0.0535 0.0694  0.0875  116 GLU A OE2 
813  N N   . GLY A 117 ? 0.2785 0.2627 0.3322 -0.0263 0.0907  0.0696  117 GLY A N   
814  C CA  . GLY A 117 ? 0.3473 0.3315 0.3810 -0.0210 0.0995  0.0719  117 GLY A CA  
815  C C   . GLY A 117 ? 0.3446 0.3415 0.3760 -0.0126 0.1088  0.0657  117 GLY A C   
816  O O   . GLY A 117 ? 0.3723 0.3687 0.3838 -0.0081 0.1162  0.0650  117 GLY A O   
817  N N   . ASP A 118 ? 0.3186 0.3263 0.3694 -0.0105 0.1085  0.0614  118 ASP A N   
818  C CA  . ASP A 118 ? 0.3241 0.3412 0.3754 -0.0011 0.1174  0.0550  118 ASP A CA  
819  C C   . ASP A 118 ? 0.3715 0.3741 0.3986 0.0059  0.1147  0.0441  118 ASP A C   
820  O O   . ASP A 118 ? 0.2400 0.2296 0.2600 0.0048  0.1031  0.0397  118 ASP A O   
821  C CB  . ASP A 118 ? 0.3109 0.3402 0.3885 0.0007  0.1146  0.0535  118 ASP A CB  
822  C CG  . ASP A 118 ? 0.3410 0.3916 0.4450 -0.0050 0.1202  0.0638  118 ASP A CG  
823  O OD1 . ASP A 118 ? 0.3661 0.4226 0.4677 -0.0092 0.1293  0.0717  118 ASP A OD1 
824  O OD2 . ASP A 118 ? 0.3369 0.3999 0.4644 -0.0056 0.1153  0.0648  118 ASP A OD2 
825  N N   . LEU A 119 ? 0.3582 0.3633 0.3725 0.0125  0.1260  0.0394  119 LEU A N   
826  C CA  . LEU A 119 ? 0.3268 0.3186 0.3182 0.0178  0.1239  0.0281  119 LEU A CA  
827  C C   . LEU A 119 ? 0.2545 0.2426 0.2571 0.0230  0.1194  0.0195  119 LEU A C   
828  O O   . LEU A 119 ? 0.2504 0.2259 0.2420 0.0234  0.1106  0.0123  119 LEU A O   
829  C CB  . LEU A 119 ? 0.3042 0.2983 0.2761 0.0223  0.1378  0.0243  119 LEU A CB  
830  C CG  . LEU A 119 ? 0.4168 0.4147 0.3716 0.0179  0.1439  0.0328  119 LEU A CG  
831  C CD1 . LEU A 119 ? 0.3311 0.3339 0.2687 0.0233  0.1599  0.0275  119 LEU A CD1 
832  C CD2 . LEU A 119 ? 0.5236 0.5088 0.4569 0.0138  0.1318  0.0338  119 LEU A CD2 
833  N N   . GLU A 120 ? 0.2497 0.2502 0.2753 0.0269  0.1257  0.0217  120 GLU A N   
834  C CA  . GLU A 120 ? 0.2663 0.2640 0.3033 0.0334  0.1235  0.0156  120 GLU A CA  
835  C C   . GLU A 120 ? 0.2410 0.2422 0.2975 0.0291  0.1107  0.0201  120 GLU A C   
836  O O   . GLU A 120 ? 0.2266 0.2421 0.3027 0.0245  0.1094  0.0289  120 GLU A O   
837  C CB  . GLU A 120 ? 0.2511 0.2608 0.3028 0.0423  0.1379  0.0157  120 GLU A CB  
838  C CG  . GLU A 120 ? 0.3374 0.3412 0.3991 0.0509  0.1371  0.0098  120 GLU A CG  
839  C CD  . GLU A 120 ? 0.3711 0.3867 0.4497 0.0617  0.1522  0.0105  120 GLU A CD  
840  O OE1 . GLU A 120 ? 0.3582 0.3952 0.4649 0.0622  0.1538  0.0206  120 GLU A OE1 
841  O OE2 . GLU A 120 ? 0.3752 0.3789 0.4397 0.0697  0.1626  0.0006  120 GLU A OE2 
842  N N   . ALA A 121 ? 0.2260 0.2148 0.2765 0.0299  0.1013  0.0139  121 ALA A N   
843  C CA  . ALA A 121 ? 0.2137 0.2037 0.2760 0.0250  0.0885  0.0169  121 ALA A CA  
844  C C   . ALA A 121 ? 0.2722 0.2720 0.3567 0.0298  0.0876  0.0197  121 ALA A C   
845  O O   . ALA A 121 ? 0.2706 0.2694 0.3584 0.0386  0.0953  0.0168  121 ALA A O   
846  C CB  . ALA A 121 ? 0.1968 0.1708 0.2416 0.0229  0.0792  0.0103  121 ALA A CB  
847  N N   . ILE A 122 ? 0.3159 0.3245 0.4150 0.0240  0.0780  0.0254  122 ILE A N   
848  C CA  . ILE A 122 ? 0.3861 0.4049 0.5046 0.0274  0.0736  0.0293  122 ILE A CA  
849  C C   . ILE A 122 ? 0.3736 0.3779 0.4808 0.0282  0.0651  0.0241  122 ILE A C   
850  O O   . ILE A 122 ? 0.4109 0.4143 0.5251 0.0349  0.0651  0.0247  122 ILE A O   
851  C CB  . ILE A 122 ? 0.4529 0.4893 0.5906 0.0192  0.0658  0.0374  122 ILE A CB  
852  C CG1 . ILE A 122 ? 0.4930 0.5470 0.6463 0.0178  0.0749  0.0441  122 ILE A CG1 
853  C CG2 . ILE A 122 ? 0.4890 0.5359 0.6432 0.0218  0.0581  0.0418  122 ILE A CG2 
854  C CD1 . ILE A 122 ? 0.5462 0.6154 0.7159 0.0062  0.0669  0.0513  122 ILE A CD1 
855  N N   . GLU A 123 ? 0.3175 0.3104 0.4078 0.0215  0.0584  0.0197  123 GLU A N   
856  C CA  . GLU A 123 ? 0.3056 0.2874 0.3855 0.0205  0.0503  0.0154  123 GLU A CA  
857  C C   . GLU A 123 ? 0.2848 0.2533 0.3442 0.0168  0.0484  0.0092  123 GLU A C   
858  O O   . GLU A 123 ? 0.3184 0.2874 0.3740 0.0122  0.0481  0.0103  123 GLU A O   
859  C CB  . GLU A 123 ? 0.3329 0.3234 0.4224 0.0151  0.0397  0.0198  123 GLU A CB  
860  C CG  . GLU A 123 ? 0.3596 0.3409 0.4385 0.0139  0.0322  0.0164  123 GLU A CG  
861  C CD  . GLU A 123 ? 0.3978 0.3897 0.4855 0.0096  0.0227  0.0213  123 GLU A CD  
862  O OE1 . GLU A 123 ? 0.3558 0.3558 0.4556 0.0141  0.0217  0.0272  123 GLU A OE1 
863  O OE2 . GLU A 123 ? 0.4492 0.4406 0.5309 0.0021  0.0162  0.0191  123 GLU A OE2 
864  N N   . VAL A 124 ? 0.2435 0.2007 0.2910 0.0188  0.0471  0.0035  124 VAL A N   
865  C CA  . VAL A 124 ? 0.2437 0.1915 0.2741 0.0158  0.0445  -0.0018 124 VAL A CA  
866  C C   . VAL A 124 ? 0.2489 0.1913 0.2743 0.0141  0.0376  -0.0047 124 VAL A C   
867  O O   . VAL A 124 ? 0.2097 0.1492 0.2381 0.0165  0.0378  -0.0051 124 VAL A O   
868  C CB  . VAL A 124 ? 0.2460 0.1867 0.2635 0.0189  0.0516  -0.0068 124 VAL A CB  
869  C CG1 . VAL A 124 ? 0.3065 0.2404 0.3081 0.0158  0.0470  -0.0113 124 VAL A CG1 
870  C CG2 . VAL A 124 ? 0.2113 0.1579 0.2303 0.0202  0.0595  -0.0037 124 VAL A CG2 
871  N N   . PHE A 125 ? 0.2570 0.1979 0.2756 0.0102  0.0323  -0.0062 125 PHE A N   
872  C CA  . PHE A 125 ? 0.2197 0.1570 0.2320 0.0086  0.0275  -0.0096 125 PHE A CA  
873  C C   . PHE A 125 ? 0.2222 0.1552 0.2227 0.0084  0.0277  -0.0137 125 PHE A C   
874  O O   . PHE A 125 ? 0.2017 0.1352 0.1989 0.0077  0.0262  -0.0131 125 PHE A O   
875  C CB  . PHE A 125 ? 0.1956 0.1365 0.2104 0.0053  0.0216  -0.0084 125 PHE A CB  
876  C CG  . PHE A 125 ? 0.1835 0.1306 0.2080 0.0044  0.0190  -0.0042 125 PHE A CG  
877  C CD1 . PHE A 125 ? 0.1827 0.1367 0.2176 0.0035  0.0193  0.0001  125 PHE A CD1 
878  C CD2 . PHE A 125 ? 0.2123 0.1600 0.2363 0.0041  0.0161  -0.0033 125 PHE A CD2 
879  C CE1 . PHE A 125 ? 0.2163 0.1791 0.2613 0.0025  0.0156  0.0049  125 PHE A CE1 
880  C CE2 . PHE A 125 ? 0.2259 0.1810 0.2583 0.0035  0.0127  0.0022  125 PHE A CE2 
881  C CZ  . PHE A 125 ? 0.1526 0.1159 0.1958 0.0029  0.0119  0.0062  125 PHE A CZ  
882  N N   . SER A 126 ? 0.2402 0.1687 0.2350 0.0088  0.0293  -0.0175 126 SER A N   
883  C CA  . SER A 126 ? 0.3264 0.2529 0.3098 0.0078  0.0291  -0.0213 126 SER A CA  
884  C C   . SER A 126 ? 0.2924 0.2200 0.2728 0.0048  0.0243  -0.0242 126 SER A C   
885  O O   . SER A 126 ? 0.2964 0.2219 0.2801 0.0031  0.0237  -0.0249 126 SER A O   
886  C CB  . SER A 126 ? 0.3802 0.3008 0.3569 0.0092  0.0349  -0.0251 126 SER A CB  
887  O OG  . SER A 126 ? 0.3880 0.3019 0.3680 0.0093  0.0366  -0.0276 126 SER A OG  
888  N N   . MET A 127 ? 0.2395 0.1717 0.2151 0.0043  0.0210  -0.0245 127 MET A N   
889  C CA  . MET A 127 ? 0.2044 0.1412 0.1784 0.0013  0.0169  -0.0270 127 MET A CA  
890  C C   . MET A 127 ? 0.2334 0.1716 0.1973 -0.0004 0.0155  -0.0296 127 MET A C   
891  O O   . MET A 127 ? 0.2404 0.1816 0.1999 0.0021  0.0147  -0.0269 127 MET A O   
892  C CB  . MET A 127 ? 0.2203 0.1645 0.1995 0.0028  0.0137  -0.0246 127 MET A CB  
893  C CG  . MET A 127 ? 0.3072 0.2503 0.2929 0.0036  0.0145  -0.0230 127 MET A CG  
894  S SD  . MET A 127 ? 0.4665 0.4168 0.4559 0.0052  0.0124  -0.0232 127 MET A SD  
895  C CE  . MET A 127 ? 0.2229 0.1828 0.2129 0.0022  0.0105  -0.0248 127 MET A CE  
896  N N   . LYS A 128 ? 0.2596 0.1956 0.2194 -0.0053 0.0145  -0.0346 128 LYS A N   
897  C CA  . LYS A 128 ? 0.2282 0.1655 0.1761 -0.0087 0.0122  -0.0386 128 LYS A CA  
898  C C   . LYS A 128 ? 0.2549 0.2026 0.2049 -0.0144 0.0055  -0.0400 128 LYS A C   
899  O O   . LYS A 128 ? 0.2810 0.2285 0.2385 -0.0182 0.0052  -0.0410 128 LYS A O   
900  C CB  . LYS A 128 ? 0.2511 0.1750 0.1902 -0.0107 0.0173  -0.0452 128 LYS A CB  
901  C CG  . LYS A 128 ? 0.2882 0.2049 0.2285 -0.0046 0.0249  -0.0432 128 LYS A CG  
902  C CD  . LYS A 128 ? 0.2674 0.1707 0.1994 -0.0049 0.0314  -0.0504 128 LYS A CD  
903  C CE  . LYS A 128 ? 0.2960 0.1959 0.2332 0.0021  0.0397  -0.0474 128 LYS A CE  
904  N NZ  . LYS A 128 ? 0.3678 0.2548 0.2968 0.0039  0.0478  -0.0549 128 LYS A NZ  
905  N N   . PHE A 129 ? 0.2861 0.2442 0.2301 -0.0153 0.0002  -0.0392 129 PHE A N   
906  C CA  . PHE A 129 ? 0.3312 0.3049 0.2815 -0.0194 -0.0068 -0.0383 129 PHE A CA  
907  C C   . PHE A 129 ? 0.2786 0.2561 0.2185 -0.0283 -0.0124 -0.0440 129 PHE A C   
908  O O   . PHE A 129 ? 0.2613 0.2319 0.1853 -0.0295 -0.0119 -0.0479 129 PHE A O   
909  C CB  . PHE A 129 ? 0.3718 0.3590 0.3284 -0.0122 -0.0102 -0.0306 129 PHE A CB  
910  C CG  . PHE A 129 ? 0.3543 0.3368 0.3199 -0.0047 -0.0053 -0.0264 129 PHE A CG  
911  C CD1 . PHE A 129 ? 0.3388 0.3101 0.2996 0.0000  -0.0009 -0.0243 129 PHE A CD1 
912  C CD2 . PHE A 129 ? 0.3318 0.3216 0.3103 -0.0032 -0.0050 -0.0250 129 PHE A CD2 
913  C CE1 . PHE A 129 ? 0.3629 0.3296 0.3314 0.0050  0.0025  -0.0214 129 PHE A CE1 
914  C CE2 . PHE A 129 ? 0.2901 0.2743 0.2740 0.0026  -0.0009 -0.0229 129 PHE A CE2 
915  C CZ  . PHE A 129 ? 0.3226 0.2949 0.3015 0.0062  0.0022  -0.0213 129 PHE A CZ  
916  N N   . ILE A 130 ? 0.2606 0.2500 0.2091 -0.0352 -0.0176 -0.0448 130 ILE A N   
917  C CA  . ILE A 130 ? 0.3037 0.3008 0.2448 -0.0456 -0.0252 -0.0498 130 ILE A CA  
918  C C   . ILE A 130 ? 0.2500 0.2739 0.2060 -0.0463 -0.0329 -0.0435 130 ILE A C   
919  O O   . ILE A 130 ? 0.2168 0.2486 0.1890 -0.0408 -0.0302 -0.0379 130 ILE A O   
920  C CB  . ILE A 130 ? 0.4551 0.4374 0.3932 -0.0566 -0.0233 -0.0586 130 ILE A CB  
921  C CG1 . ILE A 130 ? 0.5331 0.5050 0.4501 -0.0642 -0.0256 -0.0684 130 ILE A CG1 
922  C CG2 . ILE A 130 ? 0.5378 0.5347 0.4914 -0.0654 -0.0279 -0.0570 130 ILE A CG2 
923  C CD1 . ILE A 130 ? 0.5677 0.5238 0.4693 -0.0562 -0.0184 -0.0706 130 ILE A CD1 
924  N N   . TYR A 131 ? 0.2454 0.2845 0.1961 -0.0528 -0.0422 -0.0442 131 TYR A N   
925  C CA  . TYR A 131 ? 0.2643 0.3324 0.2315 -0.0519 -0.0500 -0.0367 131 TYR A CA  
926  C C   . TYR A 131 ? 0.3202 0.4035 0.2910 -0.0669 -0.0587 -0.0409 131 TYR A C   
927  O O   . TYR A 131 ? 0.3767 0.4485 0.3312 -0.0783 -0.0615 -0.0502 131 TYR A O   
928  C CB  . TYR A 131 ? 0.2770 0.3566 0.2393 -0.0426 -0.0550 -0.0288 131 TYR A CB  
929  C CG  . TYR A 131 ? 0.2653 0.3303 0.2263 -0.0290 -0.0467 -0.0239 131 TYR A CG  
930  C CD1 . TYR A 131 ? 0.2330 0.3026 0.2120 -0.0192 -0.0423 -0.0178 131 TYR A CD1 
931  C CD2 . TYR A 131 ? 0.2601 0.3066 0.2019 -0.0269 -0.0426 -0.0261 131 TYR A CD2 
932  C CE1 . TYR A 131 ? 0.2395 0.2945 0.2170 -0.0087 -0.0353 -0.0143 131 TYR A CE1 
933  C CE2 . TYR A 131 ? 0.2319 0.2662 0.1742 -0.0163 -0.0354 -0.0212 131 TYR A CE2 
934  C CZ  . TYR A 131 ? 0.2173 0.2551 0.1773 -0.0079 -0.0323 -0.0156 131 TYR A CZ  
935  O OH  . TYR A 131 ? 0.2380 0.2625 0.1981 0.0008  -0.0258 -0.0117 131 TYR A OH  
936  N N   . PHE A 132 ? 0.3171 0.4265 0.3100 -0.0673 -0.0625 -0.0345 132 PHE A N   
937  C CA  . PHE A 132 ? 0.3575 0.4854 0.3587 -0.0826 -0.0709 -0.0371 132 PHE A CA  
938  C C   . PHE A 132 ? 0.3958 0.5587 0.4074 -0.0814 -0.0828 -0.0292 132 PHE A C   
939  O O   . PHE A 132 ? 0.3973 0.5752 0.4218 -0.0669 -0.0820 -0.0191 132 PHE A O   
940  C CB  . PHE A 132 ? 0.3447 0.4769 0.3658 -0.0870 -0.0649 -0.0359 132 PHE A CB  
941  C CG  . PHE A 132 ? 0.3813 0.4812 0.3930 -0.0910 -0.0554 -0.0428 132 PHE A CG  
942  C CD1 . PHE A 132 ? 0.3414 0.4232 0.3507 -0.0783 -0.0452 -0.0408 132 PHE A CD1 
943  C CD2 . PHE A 132 ? 0.4132 0.5004 0.4187 -0.1075 -0.0572 -0.0510 132 PHE A CD2 
944  C CE1 . PHE A 132 ? 0.3089 0.3634 0.3110 -0.0811 -0.0374 -0.0455 132 PHE A CE1 
945  C CE2 . PHE A 132 ? 0.4143 0.4709 0.4124 -0.1097 -0.0485 -0.0559 132 PHE A CE2 
946  C CZ  . PHE A 132 ? 0.3586 0.4002 0.3555 -0.0960 -0.0388 -0.0525 132 PHE A CZ  
947  N N   . GLU A 133 ? 0.4253 0.6003 0.4310 -0.0967 -0.0941 -0.0338 133 GLU A N   
948  C CA  . GLU A 133 ? 0.4756 0.6883 0.4935 -0.0980 -0.1074 -0.0257 133 GLU A CA  
949  C C   . GLU A 133 ? 0.4638 0.7061 0.5157 -0.0969 -0.1065 -0.0177 133 GLU A C   
950  O O   . GLU A 133 ? 0.4379 0.6698 0.4999 -0.0975 -0.0960 -0.0196 133 GLU A O   
951  C CB  . GLU A 133 ? 0.5267 0.7446 0.5284 -0.1173 -0.1203 -0.0342 133 GLU A CB  
952  C CG  . GLU A 133 ? 0.5841 0.7745 0.5502 -0.1179 -0.1202 -0.0427 133 GLU A CG  
953  C CD  . GLU A 133 ? 0.7043 0.8791 0.6511 -0.1366 -0.1246 -0.0570 133 GLU A CD  
954  O OE1 . GLU A 133 ? 0.7810 0.9592 0.7427 -0.1481 -0.1255 -0.0601 133 GLU A OE1 
955  O OE2 . GLU A 133 ? 0.7306 0.8857 0.6485 -0.1368 -0.1244 -0.0642 133 GLU A OE2 
956  N N   . ASN A 134 ? 0.4821 0.7628 0.5517 -0.0948 -0.1173 -0.0080 134 ASN A N   
957  C CA  . ASN A 134 ? 0.4657 0.7794 0.5700 -0.0908 -0.1158 0.0010  134 ASN A CA  
958  C C   . ASN A 134 ? 0.4186 0.7358 0.5354 -0.1085 -0.1128 -0.0047 134 ASN A C   
959  O O   . ASN A 134 ? 0.4666 0.7820 0.5760 -0.1264 -0.1204 -0.0113 134 ASN A O   
960  C CB  . ASN A 134 ? 0.4982 0.8535 0.6190 -0.0880 -0.1297 0.0119  134 ASN A CB  
961  C CG  . ASN A 134 ? 0.5340 0.8890 0.6454 -0.0700 -0.1332 0.0205  134 ASN A CG  
962  O OD1 . ASN A 134 ? 0.5621 0.9182 0.6562 -0.0732 -0.1440 0.0215  134 ASN A OD1 
963  N ND2 . ASN A 134 ? 0.5376 0.8820 0.6573 -0.0499 -0.1212 0.0263  134 ASN A ND2 
964  N N   . GLY A 135 ? 0.3319 0.6469 0.4647 -0.1014 -0.0995 -0.0020 135 GLY A N   
965  C CA  . GLY A 135 ? 0.3493 0.6644 0.4929 -0.1168 -0.0943 -0.0056 135 GLY A CA  
966  C C   . GLY A 135 ? 0.3831 0.6575 0.5110 -0.1140 -0.0803 -0.0117 135 GLY A C   
967  O O   . GLY A 135 ? 0.4011 0.6749 0.5405 -0.1183 -0.0713 -0.0106 135 GLY A O   
968  N N   . GLY A 136 ? 0.3644 0.6062 0.4662 -0.1069 -0.0787 -0.0173 136 GLY A N   
969  C CA  . GLY A 136 ? 0.3391 0.5445 0.4268 -0.1013 -0.0663 -0.0217 136 GLY A CA  
970  C C   . GLY A 136 ? 0.4086 0.5878 0.4850 -0.1180 -0.0640 -0.0302 136 GLY A C   
971  O O   . GLY A 136 ? 0.4520 0.6092 0.5252 -0.1155 -0.0535 -0.0310 136 GLY A O   
972  N N   . VAL A 137 ? 0.4528 0.6333 0.5224 -0.1350 -0.0741 -0.0366 137 VAL A N   
973  C CA  . VAL A 137 ? 0.4987 0.6522 0.5582 -0.1518 -0.0722 -0.0452 137 VAL A CA  
974  C C   . VAL A 137 ? 0.5254 0.6506 0.5561 -0.1568 -0.0767 -0.0571 137 VAL A C   
975  O O   . VAL A 137 ? 0.5379 0.6284 0.5544 -0.1620 -0.0707 -0.0650 137 VAL A O   
976  C CB  . VAL A 137 ? 0.5116 0.6889 0.5902 -0.1719 -0.0785 -0.0439 137 VAL A CB  
977  C CG1 . VAL A 137 ? 0.5485 0.6900 0.6155 -0.1850 -0.0750 -0.0517 137 VAL A CG1 
978  C CG2 . VAL A 137 ? 0.4783 0.6837 0.5850 -0.1664 -0.0715 -0.0322 137 VAL A CG2 
979  N N   . VAL A 138 ? 0.5125 0.6526 0.5342 -0.1544 -0.0866 -0.0579 138 VAL A N   
980  C CA  . VAL A 138 ? 0.4338 0.5503 0.4260 -0.1589 -0.0905 -0.0694 138 VAL A CA  
981  C C   . VAL A 138 ? 0.4165 0.5176 0.3927 -0.1397 -0.0842 -0.0679 138 VAL A C   
982  O O   . VAL A 138 ? 0.3567 0.4790 0.3385 -0.1272 -0.0873 -0.0589 138 VAL A O   
983  C CB  . VAL A 138 ? 0.4111 0.5479 0.3994 -0.1657 -0.1039 -0.0702 138 VAL A CB  
984  C CG1 . VAL A 138 ? 0.4429 0.5520 0.3991 -0.1673 -0.1049 -0.0819 138 VAL A CG1 
985  C CG2 . VAL A 138 ? 0.3787 0.5274 0.3850 -0.1797 -0.1078 -0.0696 138 VAL A CG2 
986  N N   . ALA A 139 ? 0.4540 0.5183 0.4117 -0.1377 -0.0751 -0.0764 139 ALA A N   
987  C CA  . ALA A 139 ? 0.4503 0.4988 0.3943 -0.1210 -0.0677 -0.0751 139 ALA A CA  
988  C C   . ALA A 139 ? 0.4487 0.5016 0.3708 -0.1203 -0.0748 -0.0784 139 ALA A C   
989  O O   . ALA A 139 ? 0.4232 0.4693 0.3273 -0.1336 -0.0809 -0.0892 139 ALA A O   
990  C CB  . ALA A 139 ? 0.4893 0.5004 0.4230 -0.1192 -0.0558 -0.0824 139 ALA A CB  
991  N N   . ARG A 140 ? 0.4803 0.5434 0.4027 -0.1050 -0.0740 -0.0690 140 ARG A N   
992  C CA  . ARG A 140 ? 0.5484 0.6147 0.4489 -0.1022 -0.0792 -0.0694 140 ARG A CA  
993  C C   . ARG A 140 ? 0.5825 0.6157 0.4583 -0.0999 -0.0692 -0.0794 140 ARG A C   
994  O O   . ARG A 140 ? 0.6366 0.6501 0.5173 -0.0915 -0.0573 -0.0791 140 ARG A O   
995  C CB  . ARG A 140 ? 0.5539 0.6392 0.4646 -0.0863 -0.0804 -0.0546 140 ARG A CB  
996  C CG  . ARG A 140 ? 0.5977 0.6901 0.4878 -0.0827 -0.0866 -0.0511 140 ARG A CG  
997  C CD  . ARG A 140 ? 0.6189 0.7292 0.5243 -0.0671 -0.0879 -0.0349 140 ARG A CD  
998  N NE  . ARG A 140 ? 0.5773 0.7168 0.5102 -0.0673 -0.0953 -0.0272 140 ARG A NE  
999  C CZ  . ARG A 140 ? 0.5059 0.6575 0.4610 -0.0535 -0.0928 -0.0155 140 ARG A CZ  
1000 N NH1 . ARG A 140 ? 0.5092 0.6447 0.4620 -0.0396 -0.0839 -0.0102 140 ARG A NH1 
1001 N NH2 . ARG A 140 ? 0.4180 0.5979 0.3984 -0.0540 -0.0987 -0.0093 140 ARG A NH2 
1002 N N   . LEU A 141 ? 0.5611 0.5899 0.4104 -0.1074 -0.0739 -0.0880 141 LEU A N   
1003 C CA  . LEU A 141 ? 0.5461 0.5448 0.3707 -0.1057 -0.0636 -0.0990 141 LEU A CA  
1004 C C   . LEU A 141 ? 0.5836 0.5773 0.4052 -0.0888 -0.0542 -0.0905 141 LEU A C   
1005 O O   . LEU A 141 ? 0.6137 0.6263 0.4347 -0.0819 -0.0593 -0.0793 141 LEU A O   
1006 C CB  . LEU A 141 ? 0.5642 0.5617 0.3632 -0.1150 -0.0700 -0.1087 141 LEU A CB  
1007 C CG  . LEU A 141 ? 0.5963 0.5945 0.4019 -0.1286 -0.0774 -0.1159 141 LEU A CG  
1008 C CD1 . LEU A 141 ? 0.6602 0.6675 0.4462 -0.1346 -0.0868 -0.1201 141 LEU A CD1 
1009 C CD2 . LEU A 141 ? 0.5754 0.5407 0.3822 -0.1311 -0.0665 -0.1270 141 LEU A CD2 
1010 N N   . SER A 142 ? 0.5675 0.5359 0.3882 -0.0825 -0.0406 -0.0950 142 SER A N   
1011 C CA  . SER A 142 ? 0.5104 0.4732 0.3303 -0.0681 -0.0309 -0.0876 142 SER A CA  
1012 C C   . SER A 142 ? 0.5533 0.4912 0.3528 -0.0666 -0.0191 -0.0986 142 SER A C   
1013 O O   . SER A 142 ? 0.5480 0.4652 0.3517 -0.0677 -0.0113 -0.1067 142 SER A O   
1014 C CB  . SER A 142 ? 0.4429 0.4052 0.2899 -0.0591 -0.0255 -0.0785 142 SER A CB  
1015 O OG  . SER A 142 ? 0.4365 0.3920 0.2835 -0.0472 -0.0163 -0.0724 142 SER A OG  
1016 N N   . THR A 143 ? 0.5638 0.5041 0.3415 -0.0636 -0.0171 -0.0982 143 THR A N   
1017 C CA  . THR A 143 ? 0.6052 0.5247 0.3611 -0.0622 -0.0052 -0.1096 143 THR A CA  
1018 C C   . THR A 143 ? 0.6946 0.6153 0.4460 -0.0503 0.0047  -0.1010 143 THR A C   
1019 O O   . THR A 143 ? 0.7545 0.6898 0.5198 -0.0436 0.0020  -0.0861 143 THR A O   
1020 C CB  . THR A 143 ? 0.7033 0.6232 0.4338 -0.0717 -0.0112 -0.1204 143 THR A CB  
1021 O OG1 . THR A 143 ? 0.7615 0.7063 0.4822 -0.0754 -0.0240 -0.1118 143 THR A OG1 
1022 C CG2 . THR A 143 ? 0.7247 0.6364 0.4644 -0.0814 -0.0168 -0.1300 143 THR A CG2 
1023 N N   . ASP A 144 ? 0.7355 0.6403 0.4681 -0.0481 0.0169  -0.1106 144 ASP A N   
1024 C CA  . ASP A 144 ? 0.7302 0.6371 0.4571 -0.0383 0.0278  -0.1033 144 ASP A CA  
1025 C C   . ASP A 144 ? 0.7505 0.6748 0.4555 -0.0405 0.0211  -0.0959 144 ASP A C   
1026 O O   . ASP A 144 ? 0.7887 0.7163 0.4717 -0.0483 0.0144  -0.1038 144 ASP A O   
1027 C CB  . ASP A 144 ? 0.7280 0.6174 0.4469 -0.0335 0.0429  -0.1144 144 ASP A CB  
1028 C CG  . ASP A 144 ? 0.6931 0.5673 0.4367 -0.0275 0.0513  -0.1164 144 ASP A CG  
1029 O OD1 . ASP A 144 ? 0.6643 0.5434 0.4298 -0.0239 0.0496  -0.1061 144 ASP A OD1 
1030 O OD2 . ASP A 144 ? 0.6753 0.5360 0.4212 -0.0251 0.0579  -0.1258 144 ASP A OD2 
1031 N N   . GLN A 148 ? 0.6016 0.4690 0.3044 -0.0568 0.0240  -0.1487 148 GLN A N   
1032 C CA  . GLN A 148 ? 0.5764 0.4256 0.3000 -0.0558 0.0283  -0.1529 148 GLN A CA  
1033 C C   . GLN A 148 ? 0.5722 0.4284 0.3181 -0.0582 0.0219  -0.1433 148 GLN A C   
1034 O O   . GLN A 148 ? 0.5969 0.4660 0.3470 -0.0542 0.0216  -0.1327 148 GLN A O   
1035 C CB  . GLN A 148 ? 0.5503 0.3856 0.2808 -0.0430 0.0449  -0.1539 148 GLN A CB  
1036 C CG  . GLN A 148 ? 0.6315 0.4479 0.3832 -0.0403 0.0494  -0.1565 148 GLN A CG  
1037 C CD  . GLN A 148 ? 0.7537 0.5579 0.5107 -0.0277 0.0646  -0.1586 148 GLN A CD  
1038 O OE1 . GLN A 148 ? 0.8110 0.6221 0.5574 -0.0210 0.0729  -0.1580 148 GLN A OE1 
1039 N NE2 . GLN A 148 ? 0.7765 0.5639 0.5506 -0.0244 0.0684  -0.1602 148 GLN A NE2 
1040 N N   . GLU A 149 ? 0.5495 0.3965 0.3087 -0.0649 0.0172  -0.1471 149 GLU A N   
1041 C CA  . GLU A 149 ? 0.5180 0.3706 0.2989 -0.0677 0.0120  -0.1390 149 GLU A CA  
1042 C C   . GLU A 149 ? 0.5300 0.3806 0.3254 -0.0561 0.0215  -0.1300 149 GLU A C   
1043 O O   . GLU A 149 ? 0.6250 0.4611 0.4260 -0.0469 0.0328  -0.1314 149 GLU A O   
1044 C CB  . GLU A 149 ? 0.5110 0.3489 0.3043 -0.0747 0.0099  -0.1443 149 GLU A CB  
1045 C CG  . GLU A 149 ? 0.5155 0.3613 0.3299 -0.0801 0.0035  -0.1363 149 GLU A CG  
1046 C CD  . GLU A 149 ? 0.5756 0.4062 0.4010 -0.0875 0.0023  -0.1403 149 GLU A CD  
1047 O OE1 . GLU A 149 ? 0.5561 0.3676 0.3910 -0.0805 0.0113  -0.1398 149 GLU A OE1 
1048 O OE2 . GLU A 149 ? 0.6222 0.4609 0.4476 -0.1003 -0.0080 -0.1430 149 GLU A OE2 
1049 N N   . ASP A 150 ? 0.4411 0.3078 0.2436 -0.0559 0.0164  -0.1204 150 ASP A N   
1050 C CA  . ASP A 150 ? 0.4647 0.3347 0.2885 -0.0439 0.0227  -0.1083 150 ASP A CA  
1051 C C   . ASP A 150 ? 0.5254 0.3791 0.3666 -0.0428 0.0275  -0.1095 150 ASP A C   
1052 O O   . ASP A 150 ? 0.5710 0.4220 0.4186 -0.0517 0.0212  -0.1118 150 ASP A O   
1053 C CB  . ASP A 150 ? 0.4352 0.3295 0.2734 -0.0419 0.0138  -0.0944 150 ASP A CB  
1054 C CG  . ASP A 150 ? 0.4955 0.4040 0.3207 -0.0383 0.0120  -0.0884 150 ASP A CG  
1055 O OD1 . ASP A 150 ? 0.5110 0.4121 0.3223 -0.0336 0.0211  -0.0912 150 ASP A OD1 
1056 O OD2 . ASP A 150 ? 0.5006 0.4281 0.3303 -0.0397 0.0021  -0.0802 150 ASP A OD2 
1057 N N   . PRO A 151 ? 0.5525 0.3959 0.4018 -0.0321 0.0386  -0.1070 151 PRO A N   
1058 C CA  . PRO A 151 ? 0.5712 0.3992 0.4370 -0.0291 0.0434  -0.1061 151 PRO A CA  
1059 C C   . PRO A 151 ? 0.6057 0.4421 0.4901 -0.0334 0.0356  -0.0976 151 PRO A C   
1060 O O   . PRO A 151 ? 0.6401 0.4620 0.5322 -0.0365 0.0366  -0.0992 151 PRO A O   
1061 C CB  . PRO A 151 ? 0.5554 0.3832 0.4306 -0.0158 0.0539  -0.0999 151 PRO A CB  
1062 C CG  . PRO A 151 ? 0.5648 0.4103 0.4314 -0.0129 0.0535  -0.0954 151 PRO A CG  
1063 C CD  . PRO A 151 ? 0.5680 0.4155 0.4119 -0.0223 0.0472  -0.1040 151 PRO A CD  
1064 N N   . HIS A 152 ? 0.5795 0.4383 0.4708 -0.0331 0.0284  -0.0885 152 HIS A N   
1065 C CA  . HIS A 152 ? 0.5248 0.3936 0.4336 -0.0356 0.0226  -0.0803 152 HIS A CA  
1066 C C   . HIS A 152 ? 0.5027 0.3798 0.4099 -0.0479 0.0132  -0.0833 152 HIS A C   
1067 O O   . HIS A 152 ? 0.5051 0.3908 0.4263 -0.0512 0.0093  -0.0774 152 HIS A O   
1068 C CB  . HIS A 152 ? 0.4436 0.3307 0.3625 -0.0282 0.0209  -0.0694 152 HIS A CB  
1069 C CG  . HIS A 152 ? 0.4241 0.3289 0.3364 -0.0300 0.0139  -0.0674 152 HIS A CG  
1070 N ND1 . HIS A 152 ? 0.4545 0.3618 0.3534 -0.0265 0.0157  -0.0682 152 HIS A ND1 
1071 C CD2 . HIS A 152 ? 0.3938 0.3157 0.3120 -0.0340 0.0055  -0.0636 152 HIS A CD2 
1072 C CE1 . HIS A 152 ? 0.3953 0.3193 0.2917 -0.0283 0.0078  -0.0642 152 HIS A CE1 
1073 N NE2 . HIS A 152 ? 0.3676 0.3011 0.2766 -0.0324 0.0016  -0.0615 152 HIS A NE2 
1074 N N   . PHE A 153 ? 0.4665 0.3425 0.3565 -0.0550 0.0097  -0.0923 153 PHE A N   
1075 C CA  . PHE A 153 ? 0.4653 0.3542 0.3541 -0.0674 -0.0009 -0.0947 153 PHE A CA  
1076 C C   . PHE A 153 ? 0.4963 0.3742 0.3935 -0.0780 -0.0021 -0.0979 153 PHE A C   
1077 O O   . PHE A 153 ? 0.4704 0.3648 0.3809 -0.0844 -0.0086 -0.0924 153 PHE A O   
1078 C CB  . PHE A 153 ? 0.4555 0.3443 0.3211 -0.0738 -0.0049 -0.1047 153 PHE A CB  
1079 C CG  . PHE A 153 ? 0.4230 0.3258 0.2870 -0.0882 -0.0170 -0.1079 153 PHE A CG  
1080 C CD1 . PHE A 153 ? 0.4027 0.3353 0.2742 -0.0882 -0.0266 -0.0990 153 PHE A CD1 
1081 C CD2 . PHE A 153 ? 0.3884 0.2756 0.2454 -0.1012 -0.0187 -0.1192 153 PHE A CD2 
1082 C CE1 . PHE A 153 ? 0.3940 0.3437 0.2670 -0.1014 -0.0382 -0.1009 153 PHE A CE1 
1083 C CE2 . PHE A 153 ? 0.4005 0.3043 0.2599 -0.1142 -0.0305 -0.1203 153 PHE A CE2 
1084 C CZ  . PHE A 153 ? 0.3975 0.3330 0.2630 -0.1165 -0.0407 -0.1127 153 PHE A CZ  
1085 N N   . ALA A 154 ? 0.5417 0.3916 0.4319 -0.0794 0.0050  -0.1063 154 ALA A N   
1086 C CA  . ALA A 154 ? 0.5069 0.3440 0.4032 -0.0895 0.0034  -0.1091 154 ALA A CA  
1087 C C   . ALA A 154 ? 0.4683 0.3076 0.3840 -0.0916 0.0041  -0.0994 154 ALA A C   
1088 O O   . ALA A 154 ? 0.4418 0.2892 0.3655 -0.1038 -0.0019 -0.0979 154 ALA A O   
1089 C CB  . ALA A 154 ? 0.4828 0.2942 0.3732 -0.0838 0.0109  -0.1151 154 ALA A CB  
1090 N N   . LYS A 155 ? 0.4429 0.2789 0.3678 -0.0787 0.0109  -0.0909 155 LYS A N   
1091 C CA  . LYS A 155 ? 0.4703 0.3119 0.4128 -0.0781 0.0115  -0.0794 155 LYS A CA  
1092 C C   . LYS A 155 ? 0.4590 0.3314 0.4112 -0.0820 0.0042  -0.0725 155 LYS A C   
1093 O O   . LYS A 155 ? 0.4753 0.3542 0.4380 -0.0907 0.0018  -0.0680 155 LYS A O   
1094 C CB  . LYS A 155 ? 0.5419 0.3796 0.4910 -0.0634 0.0183  -0.0714 155 LYS A CB  
1095 C CG  . LYS A 155 ? 0.6104 0.4589 0.5746 -0.0622 0.0178  -0.0590 155 LYS A CG  
1096 C CD  . LYS A 155 ? 0.6390 0.4807 0.6087 -0.0497 0.0236  -0.0518 155 LYS A CD  
1097 C CE  . LYS A 155 ? 0.5968 0.4539 0.5775 -0.0482 0.0220  -0.0401 155 LYS A CE  
1098 N NZ  . LYS A 155 ? 0.5380 0.4046 0.5215 -0.0366 0.0234  -0.0351 155 LYS A NZ  
1099 N N   . LEU A 156 ? 0.4348 0.3259 0.3842 -0.0752 0.0013  -0.0713 156 LEU A N   
1100 C CA  . LEU A 156 ? 0.3746 0.2947 0.3344 -0.0756 -0.0045 -0.0645 156 LEU A CA  
1101 C C   . LEU A 156 ? 0.3633 0.2975 0.3241 -0.0893 -0.0128 -0.0682 156 LEU A C   
1102 O O   . LEU A 156 ? 0.4261 0.3815 0.4009 -0.0932 -0.0161 -0.0620 156 LEU A O   
1103 C CB  . LEU A 156 ? 0.3542 0.2867 0.3103 -0.0642 -0.0051 -0.0618 156 LEU A CB  
1104 C CG  . LEU A 156 ? 0.3742 0.2975 0.3314 -0.0518 0.0020  -0.0575 156 LEU A CG  
1105 C CD1 . LEU A 156 ? 0.3142 0.2491 0.2681 -0.0430 0.0008  -0.0547 156 LEU A CD1 
1106 C CD2 . LEU A 156 ? 0.3810 0.3076 0.3516 -0.0496 0.0046  -0.0496 156 LEU A CD2 
1107 N N   . ALA A 157 ? 0.3541 0.2777 0.3001 -0.0968 -0.0160 -0.0785 157 ALA A N   
1108 C CA  . ALA A 157 ? 0.3859 0.3241 0.3314 -0.1113 -0.0255 -0.0828 157 ALA A CA  
1109 C C   . ALA A 157 ? 0.4433 0.3762 0.4000 -0.1253 -0.0259 -0.0826 157 ALA A C   
1110 O O   . ALA A 157 ? 0.4349 0.3901 0.4023 -0.1362 -0.0332 -0.0804 157 ALA A O   
1111 C CB  . ALA A 157 ? 0.4039 0.3299 0.3270 -0.1167 -0.0288 -0.0952 157 ALA A CB  
1112 N N   . GLN A 158 ? 0.4950 0.3991 0.4501 -0.1247 -0.0180 -0.0839 158 GLN A N   
1113 C CA  . GLN A 158 ? 0.5195 0.4138 0.4845 -0.1375 -0.0170 -0.0820 158 GLN A CA  
1114 C C   . GLN A 158 ? 0.4445 0.3633 0.4297 -0.1362 -0.0162 -0.0685 158 GLN A C   
1115 O O   . GLN A 158 ? 0.3795 0.3046 0.3761 -0.1493 -0.0178 -0.0649 158 GLN A O   
1116 C CB  . GLN A 158 ? 0.5892 0.4475 0.5490 -0.1318 -0.0082 -0.0835 158 GLN A CB  
1117 C CG  . GLN A 158 ? 0.6529 0.5032 0.6266 -0.1353 -0.0039 -0.0735 158 GLN A CG  
1118 C CD  . GLN A 158 ? 0.7341 0.5511 0.7043 -0.1297 0.0020  -0.0744 158 GLN A CD  
1119 O OE1 . GLN A 158 ? 0.8007 0.6011 0.7589 -0.1242 0.0033  -0.0838 158 GLN A OE1 
1120 N NE2 . GLN A 158 ? 0.7442 0.5527 0.7253 -0.1308 0.0059  -0.0639 158 GLN A NE2 
1121 N N   . LEU A 159 ? 0.4684 0.4013 0.4574 -0.1208 -0.0134 -0.0614 159 LEU A N   
1122 C CA  . LEU A 159 ? 0.4906 0.4442 0.4954 -0.1171 -0.0109 -0.0499 159 LEU A CA  
1123 C C   . LEU A 159 ? 0.5702 0.5576 0.5888 -0.1251 -0.0170 -0.0468 159 LEU A C   
1124 O O   . LEU A 159 ? 0.6675 0.6696 0.6839 -0.1275 -0.0246 -0.0514 159 LEU A O   
1125 C CB  . LEU A 159 ? 0.4437 0.4025 0.4471 -0.0993 -0.0070 -0.0454 159 LEU A CB  
1126 C CG  . LEU A 159 ? 0.4570 0.3887 0.4500 -0.0898 -0.0012 -0.0470 159 LEU A CG  
1127 C CD1 . LEU A 159 ? 0.4346 0.3751 0.4290 -0.0751 0.0017  -0.0417 159 LEU A CD1 
1128 C CD2 . LEU A 159 ? 0.4959 0.4061 0.4911 -0.0946 0.0038  -0.0436 159 LEU A CD2 
1129 N N   . VAL A 160 ? 0.5047 0.5057 0.5378 -0.1288 -0.0136 -0.0381 160 VAL A N   
1130 C CA  . VAL A 160 ? 0.4153 0.4520 0.4656 -0.1345 -0.0173 -0.0333 160 VAL A CA  
1131 C C   . VAL A 160 ? 0.4173 0.4729 0.4768 -0.1213 -0.0109 -0.0247 160 VAL A C   
1132 O O   . VAL A 160 ? 0.4698 0.5109 0.5250 -0.1152 -0.0037 -0.0207 160 VAL A O   
1133 C CB  . VAL A 160 ? 0.4073 0.4461 0.4680 -0.1541 -0.0181 -0.0312 160 VAL A CB  
1134 C CG1 . VAL A 160 ? 0.3762 0.4563 0.4584 -0.1591 -0.0202 -0.0244 160 VAL A CG1 
1135 C CG2 . VAL A 160 ? 0.4471 0.4666 0.4976 -0.1684 -0.0251 -0.0418 160 VAL A CG2 
1136 N N   . TYR A 161 ? 0.3733 0.4606 0.4447 -0.1162 -0.0138 -0.0222 161 TYR A N   
1137 C CA  . TYR A 161 ? 0.2805 0.3864 0.3612 -0.1043 -0.0070 -0.0155 161 TYR A CA  
1138 C C   . TYR A 161 ? 0.2718 0.3895 0.3647 -0.1136 -0.0007 -0.0084 161 TYR A C   
1139 O O   . TYR A 161 ? 0.3263 0.4669 0.4346 -0.1252 -0.0036 -0.0060 161 TYR A O   
1140 C CB  . TYR A 161 ? 0.2399 0.3760 0.3321 -0.0959 -0.0112 -0.0143 161 TYR A CB  
1141 C CG  . TYR A 161 ? 0.2625 0.4202 0.3671 -0.0846 -0.0034 -0.0084 161 TYR A CG  
1142 C CD1 . TYR A 161 ? 0.3041 0.4486 0.3990 -0.0700 0.0031  -0.0088 161 TYR A CD1 
1143 C CD2 . TYR A 161 ? 0.2362 0.4280 0.3622 -0.0887 -0.0021 -0.0031 161 TYR A CD2 
1144 C CE1 . TYR A 161 ? 0.3096 0.4712 0.4132 -0.0599 0.0108  -0.0055 161 TYR A CE1 
1145 C CE2 . TYR A 161 ? 0.2294 0.4404 0.3659 -0.0773 0.0067  0.0011  161 TYR A CE2 
1146 C CZ  . TYR A 161 ? 0.2883 0.4825 0.4122 -0.0628 0.0132  -0.0008 161 TYR A CZ  
1147 O OH  . TYR A 161 ? 0.2786 0.4892 0.4103 -0.0515 0.0226  0.0014  161 TYR A OH  
1148 N N   . GLU A 162 ? 0.2431 0.3469 0.3293 -0.1091 0.0075  -0.0045 162 GLU A N   
1149 C CA  . GLU A 162 ? 0.2914 0.4024 0.3853 -0.1187 0.0141  0.0034  162 GLU A CA  
1150 C C   . GLU A 162 ? 0.3104 0.4468 0.4122 -0.1093 0.0225  0.0088  162 GLU A C   
1151 O O   . GLU A 162 ? 0.3027 0.4396 0.4034 -0.1125 0.0302  0.0156  162 GLU A O   
1152 C CB  . GLU A 162 ? 0.3201 0.3980 0.4002 -0.1220 0.0174  0.0058  162 GLU A CB  
1153 C CG  . GLU A 162 ? 0.4217 0.4689 0.4897 -0.1239 0.0114  -0.0018 162 GLU A CG  
1154 C CD  . GLU A 162 ? 0.5673 0.5841 0.6281 -0.1315 0.0141  0.0017  162 GLU A CD  
1155 O OE1 . GLU A 162 ? 0.6229 0.6278 0.6763 -0.1236 0.0192  0.0072  162 GLU A OE1 
1156 O OE2 . GLU A 162 ? 0.6252 0.6296 0.6877 -0.1456 0.0108  -0.0010 162 GLU A OE2 
1157 N N   . GLY A 163 ? 0.2995 0.4559 0.4081 -0.0974 0.0214  0.0060  163 GLY A N   
1158 C CA  . GLY A 163 ? 0.3126 0.4923 0.4289 -0.0871 0.0301  0.0092  163 GLY A CA  
1159 C C   . GLY A 163 ? 0.2780 0.4423 0.3790 -0.0711 0.0341  0.0057  163 GLY A C   
1160 O O   . GLY A 163 ? 0.2453 0.3811 0.3300 -0.0693 0.0313  0.0029  163 GLY A O   
1161 N N   . GLY A 164 ? 0.2329 0.4165 0.3400 -0.0596 0.0412  0.0057  164 GLY A N   
1162 C CA  . GLY A 164 ? 0.2313 0.4019 0.3252 -0.0447 0.0448  0.0010  164 GLY A CA  
1163 C C   . GLY A 164 ? 0.2191 0.3666 0.2931 -0.0455 0.0484  0.0012  164 GLY A C   
1164 O O   . GLY A 164 ? 0.2109 0.3376 0.2717 -0.0382 0.0456  -0.0032 164 GLY A O   
1165 N N   . ASP A 165 ? 0.2293 0.3818 0.3018 -0.0546 0.0542  0.0074  165 ASP A N   
1166 C CA  . ASP A 165 ? 0.2857 0.4199 0.3393 -0.0551 0.0572  0.0096  165 ASP A CA  
1167 C C   . ASP A 165 ? 0.3118 0.4170 0.3555 -0.0594 0.0491  0.0100  165 ASP A C   
1168 O O   . ASP A 165 ? 0.3245 0.4125 0.3533 -0.0553 0.0486  0.0097  165 ASP A O   
1169 C CB  . ASP A 165 ? 0.3337 0.4811 0.3877 -0.0645 0.0653  0.0182  165 ASP A CB  
1170 C CG  . ASP A 165 ? 0.4275 0.5962 0.4803 -0.0567 0.0763  0.0167  165 ASP A CG  
1171 O OD1 . ASP A 165 ? 0.4504 0.6181 0.4993 -0.0436 0.0773  0.0083  165 ASP A OD1 
1172 O OD2 . ASP A 165 ? 0.4667 0.6519 0.5216 -0.0638 0.0845  0.0238  165 ASP A OD2 
1173 N N   . SER A 166 ? 0.2692 0.3697 0.3214 -0.0676 0.0430  0.0104  166 SER A N   
1174 C CA  . SER A 166 ? 0.2495 0.3223 0.2934 -0.0703 0.0366  0.0093  166 SER A CA  
1175 C C   . SER A 166 ? 0.2415 0.3034 0.2784 -0.0583 0.0326  0.0019  166 SER A C   
1176 O O   . SER A 166 ? 0.1969 0.2381 0.2233 -0.0553 0.0305  0.0015  166 SER A O   
1177 C CB  . SER A 166 ? 0.2741 0.3441 0.3270 -0.0819 0.0313  0.0088  166 SER A CB  
1178 O OG  . SER A 166 ? 0.2807 0.3620 0.3411 -0.0785 0.0263  0.0025  166 SER A OG  
1179 N N   . VAL A 167 ? 0.2386 0.3156 0.2828 -0.0515 0.0318  -0.0027 167 VAL A N   
1180 C CA  . VAL A 167 ? 0.2417 0.3101 0.2807 -0.0404 0.0286  -0.0085 167 VAL A CA  
1181 C C   . VAL A 167 ? 0.2622 0.3227 0.2897 -0.0325 0.0326  -0.0096 167 VAL A C   
1182 O O   . VAL A 167 ? 0.3019 0.3452 0.3207 -0.0280 0.0296  -0.0121 167 VAL A O   
1183 C CB  . VAL A 167 ? 0.2407 0.3284 0.2914 -0.0342 0.0274  -0.0111 167 VAL A CB  
1184 C CG1 . VAL A 167 ? 0.1588 0.2377 0.2038 -0.0218 0.0263  -0.0156 167 VAL A CG1 
1185 C CG2 . VAL A 167 ? 0.2497 0.3430 0.3087 -0.0422 0.0205  -0.0111 167 VAL A CG2 
1186 N N   . ARG A 168 ? 0.2607 0.3347 0.2879 -0.0316 0.0395  -0.0079 168 ARG A N   
1187 C CA  . ARG A 168 ? 0.2533 0.3205 0.2669 -0.0264 0.0431  -0.0095 168 ARG A CA  
1188 C C   . ARG A 168 ? 0.2466 0.2960 0.2491 -0.0315 0.0399  -0.0051 168 ARG A C   
1189 O O   . ARG A 168 ? 0.2391 0.2757 0.2321 -0.0270 0.0372  -0.0076 168 ARG A O   
1190 C CB  . ARG A 168 ? 0.2590 0.3449 0.2722 -0.0261 0.0521  -0.0083 168 ARG A CB  
1191 C CG  . ARG A 168 ? 0.3145 0.3933 0.3095 -0.0251 0.0552  -0.0087 168 ARG A CG  
1192 C CD  . ARG A 168 ? 0.3703 0.4680 0.3626 -0.0271 0.0651  -0.0062 168 ARG A CD  
1193 N NE  . ARG A 168 ? 0.4431 0.5521 0.4453 -0.0376 0.0668  0.0032  168 ARG A NE  
1194 C CZ  . ARG A 168 ? 0.4645 0.5730 0.4582 -0.0463 0.0690  0.0120  168 ARG A CZ  
1195 N NH1 . ARG A 168 ? 0.4834 0.5829 0.4577 -0.0452 0.0691  0.0129  168 ARG A NH1 
1196 N NH2 . ARG A 168 ? 0.4460 0.5630 0.4503 -0.0567 0.0706  0.0206  168 ARG A NH2 
1197 N N   . ASP A 169 ? 0.2545 0.3034 0.2595 -0.0410 0.0400  0.0021  169 ASP A N   
1198 C CA  . ASP A 169 ? 0.2300 0.2620 0.2271 -0.0451 0.0372  0.0083  169 ASP A CA  
1199 C C   . ASP A 169 ? 0.2060 0.2195 0.2034 -0.0419 0.0309  0.0051  169 ASP A C   
1200 O O   . ASP A 169 ? 0.2534 0.2542 0.2441 -0.0399 0.0283  0.0078  169 ASP A O   
1201 C CB  . ASP A 169 ? 0.2129 0.2458 0.2146 -0.0560 0.0391  0.0171  169 ASP A CB  
1202 C CG  . ASP A 169 ? 0.2337 0.2833 0.2318 -0.0599 0.0462  0.0231  169 ASP A CG  
1203 O OD1 . ASP A 169 ? 0.2232 0.2867 0.2173 -0.0537 0.0506  0.0182  169 ASP A OD1 
1204 O OD2 . ASP A 169 ? 0.2547 0.3027 0.2533 -0.0690 0.0481  0.0327  169 ASP A OD2 
1205 N N   . GLN A 170 ? 0.1982 0.2121 0.2036 -0.0414 0.0285  -0.0001 170 GLN A N   
1206 C CA  . GLN A 170 ? 0.2547 0.2530 0.2591 -0.0380 0.0239  -0.0039 170 GLN A CA  
1207 C C   . GLN A 170 ? 0.2835 0.2786 0.2821 -0.0291 0.0229  -0.0076 170 GLN A C   
1208 O O   . GLN A 170 ? 0.3264 0.3085 0.3214 -0.0266 0.0205  -0.0071 170 GLN A O   
1209 C CB  . GLN A 170 ? 0.2788 0.2807 0.2902 -0.0400 0.0213  -0.0086 170 GLN A CB  
1210 C CG  . GLN A 170 ? 0.2919 0.2891 0.3076 -0.0506 0.0203  -0.0066 170 GLN A CG  
1211 C CD  . GLN A 170 ? 0.2675 0.2754 0.2902 -0.0545 0.0170  -0.0111 170 GLN A CD  
1212 O OE1 . GLN A 170 ? 0.2795 0.2981 0.3043 -0.0479 0.0153  -0.0146 170 GLN A OE1 
1213 N NE2 . GLN A 170 ? 0.2539 0.2589 0.2805 -0.0657 0.0155  -0.0106 170 GLN A NE2 
1214 N N   . MET A 171 ? 0.2701 0.2769 0.2688 -0.0243 0.0250  -0.0114 171 MET A N   
1215 C CA  . MET A 171 ? 0.2487 0.2510 0.2417 -0.0171 0.0244  -0.0156 171 MET A CA  
1216 C C   . MET A 171 ? 0.2477 0.2448 0.2312 -0.0181 0.0241  -0.0128 171 MET A C   
1217 O O   . MET A 171 ? 0.2595 0.2479 0.2395 -0.0153 0.0211  -0.0141 171 MET A O   
1218 C CB  . MET A 171 ? 0.2921 0.3059 0.2874 -0.0114 0.0279  -0.0204 171 MET A CB  
1219 C CG  . MET A 171 ? 0.2838 0.2893 0.2734 -0.0046 0.0273  -0.0257 171 MET A CG  
1220 S SD  . MET A 171 ? 0.3371 0.3326 0.3315 -0.0004 0.0227  -0.0273 171 MET A SD  
1221 C CE  . MET A 171 ? 0.3408 0.3212 0.3283 -0.0023 0.0192  -0.0261 171 MET A CE  
1222 N N   . VAL A 172 ? 0.2459 0.2502 0.2255 -0.0226 0.0270  -0.0081 172 VAL A N   
1223 C CA  . VAL A 172 ? 0.2662 0.2685 0.2352 -0.0242 0.0260  -0.0041 172 VAL A CA  
1224 C C   . VAL A 172 ? 0.2468 0.2368 0.2176 -0.0257 0.0211  0.0024  172 VAL A C   
1225 O O   . VAL A 172 ? 0.2609 0.2472 0.2266 -0.0243 0.0173  0.0041  172 VAL A O   
1226 C CB  . VAL A 172 ? 0.3026 0.3165 0.2661 -0.0292 0.0309  0.0011  172 VAL A CB  
1227 C CG1 . VAL A 172 ? 0.2913 0.3032 0.2424 -0.0317 0.0285  0.0076  172 VAL A CG1 
1228 C CG2 . VAL A 172 ? 0.3440 0.3712 0.3054 -0.0258 0.0372  -0.0060 172 VAL A CG2 
1229 N N   . THR A 173 ? 0.2157 0.1999 0.1946 -0.0286 0.0212  0.0056  173 THR A N   
1230 C CA  . THR A 173 ? 0.2524 0.2229 0.2347 -0.0284 0.0181  0.0107  173 THR A CA  
1231 C C   . THR A 173 ? 0.2510 0.2152 0.2354 -0.0224 0.0151  0.0060  173 THR A C   
1232 O O   . THR A 173 ? 0.2665 0.2261 0.2514 -0.0202 0.0123  0.0104  173 THR A O   
1233 C CB  . THR A 173 ? 0.2945 0.2569 0.2840 -0.0328 0.0196  0.0119  173 THR A CB  
1234 O OG1 . THR A 173 ? 0.3405 0.3059 0.3292 -0.0397 0.0220  0.0194  173 THR A OG1 
1235 C CG2 . THR A 173 ? 0.3027 0.2485 0.2959 -0.0300 0.0178  0.0138  173 THR A CG2 
1236 N N   . ILE A 174 ? 0.1978 0.1635 0.1846 -0.0199 0.0158  -0.0018 174 ILE A N   
1237 C CA  . ILE A 174 ? 0.2018 0.1618 0.1906 -0.0151 0.0139  -0.0056 174 ILE A CA  
1238 C C   . ILE A 174 ? 0.2171 0.1799 0.2018 -0.0132 0.0114  -0.0057 174 ILE A C   
1239 O O   . ILE A 174 ? 0.2978 0.2565 0.2856 -0.0113 0.0090  -0.0037 174 ILE A O   
1240 C CB  . ILE A 174 ? 0.1622 0.1242 0.1528 -0.0130 0.0149  -0.0124 174 ILE A CB  
1241 C CG1 . ILE A 174 ? 0.1632 0.1186 0.1573 -0.0146 0.0152  -0.0132 174 ILE A CG1 
1242 C CG2 . ILE A 174 ? 0.1581 0.1178 0.1482 -0.0084 0.0135  -0.0157 174 ILE A CG2 
1243 C CD1 . ILE A 174 ? 0.1729 0.1359 0.1690 -0.0179 0.0157  -0.0158 174 ILE A CD1 
1244 N N   . VAL A 175 ? 0.1799 0.1502 0.1577 -0.0142 0.0123  -0.0083 175 VAL A N   
1245 C CA  . VAL A 175 ? 0.1761 0.1480 0.1474 -0.0140 0.0095  -0.0103 175 VAL A CA  
1246 C C   . VAL A 175 ? 0.2179 0.1915 0.1869 -0.0167 0.0053  -0.0024 175 VAL A C   
1247 O O   . VAL A 175 ? 0.2462 0.2194 0.2166 -0.0165 0.0009  -0.0017 175 VAL A O   
1248 C CB  . VAL A 175 ? 0.2059 0.1840 0.1682 -0.0142 0.0126  -0.0163 175 VAL A CB  
1249 C CG1 . VAL A 175 ? 0.2553 0.2330 0.2079 -0.0157 0.0094  -0.0198 175 VAL A CG1 
1250 C CG2 . VAL A 175 ? 0.2035 0.1806 0.1707 -0.0097 0.0161  -0.0228 175 VAL A CG2 
1251 N N   . ARG A 176 ? 0.2104 0.1869 0.1770 -0.0194 0.0064  0.0045  176 ARG A N   
1252 C CA  . ARG A 176 ? 0.2661 0.2445 0.2311 -0.0211 0.0021  0.0145  176 ARG A CA  
1253 C C   . ARG A 176 ? 0.2828 0.2542 0.2605 -0.0175 -0.0002 0.0196  176 ARG A C   
1254 O O   . ARG A 176 ? 0.2958 0.2707 0.2761 -0.0167 -0.0054 0.0258  176 ARG A O   
1255 C CB  . ARG A 176 ? 0.2926 0.2736 0.2531 -0.0248 0.0047  0.0225  176 ARG A CB  
1256 C CG  . ARG A 176 ? 0.3614 0.3524 0.3086 -0.0281 0.0080  0.0189  176 ARG A CG  
1257 C CD  . ARG A 176 ? 0.4137 0.4101 0.3527 -0.0327 0.0082  0.0303  176 ARG A CD  
1258 N NE  . ARG A 176 ? 0.4650 0.4727 0.3876 -0.0355 0.0109  0.0266  176 ARG A NE  
1259 C CZ  . ARG A 176 ? 0.5301 0.5451 0.4481 -0.0384 0.0182  0.0267  176 ARG A CZ  
1260 N NH1 . ARG A 176 ? 0.5708 0.5834 0.5003 -0.0401 0.0224  0.0309  176 ARG A NH1 
1261 N NH2 . ARG A 176 ? 0.5413 0.5667 0.4432 -0.0400 0.0217  0.0224  176 ARG A NH2 
1262 N N   . SER A 177 ? 0.2891 0.2518 0.2746 -0.0152 0.0037  0.0167  177 SER A N   
1263 C CA  . SER A 177 ? 0.3020 0.2569 0.2985 -0.0109 0.0037  0.0196  177 SER A CA  
1264 C C   . SER A 177 ? 0.2905 0.2489 0.2920 -0.0081 0.0012  0.0165  177 SER A C   
1265 O O   . SER A 177 ? 0.2597 0.2193 0.2702 -0.0049 -0.0008 0.0224  177 SER A O   
1266 C CB  . SER A 177 ? 0.3779 0.3226 0.3778 -0.0103 0.0086  0.0149  177 SER A CB  
1267 O OG  . SER A 177 ? 0.4415 0.3789 0.4494 -0.0054 0.0101  0.0142  177 SER A OG  
1268 N N   . VAL A 178 ? 0.3066 0.2667 0.3036 -0.0091 0.0018  0.0080  178 VAL A N   
1269 C CA  . VAL A 178 ? 0.2717 0.2340 0.2727 -0.0082 -0.0004 0.0052  178 VAL A CA  
1270 C C   . VAL A 178 ? 0.2468 0.2183 0.2471 -0.0110 -0.0068 0.0099  178 VAL A C   
1271 O O   . VAL A 178 ? 0.2482 0.2242 0.2583 -0.0102 -0.0097 0.0135  178 VAL A O   
1272 C CB  . VAL A 178 ? 0.1643 0.1246 0.1596 -0.0089 0.0013  -0.0038 178 VAL A CB  
1273 C CG1 . VAL A 178 ? 0.2482 0.2093 0.2472 -0.0098 -0.0013 -0.0057 178 VAL A CG1 
1274 C CG2 . VAL A 178 ? 0.1594 0.1135 0.1561 -0.0062 0.0061  -0.0073 178 VAL A CG2 
1275 N N   . GLN A 179 ? 0.1834 0.1594 0.1722 -0.0148 -0.0091 0.0100  179 GLN A N   
1276 C CA  . GLN A 179 ? 0.2060 0.1919 0.1906 -0.0187 -0.0163 0.0146  179 GLN A CA  
1277 C C   . GLN A 179 ? 0.2246 0.2155 0.2200 -0.0160 -0.0198 0.0273  179 GLN A C   
1278 O O   . GLN A 179 ? 0.1943 0.1948 0.1963 -0.0171 -0.0262 0.0322  179 GLN A O   
1279 C CB  . GLN A 179 ? 0.2210 0.2106 0.1881 -0.0230 -0.0166 0.0125  179 GLN A CB  
1280 C CG  . GLN A 179 ? 0.2505 0.2363 0.2072 -0.0246 -0.0134 -0.0003 179 GLN A CG  
1281 C CD  . GLN A 179 ? 0.2946 0.2844 0.2349 -0.0272 -0.0107 -0.0029 179 GLN A CD  
1282 O OE1 . GLN A 179 ? 0.3425 0.3377 0.2787 -0.0285 -0.0108 0.0057  179 GLN A OE1 
1283 N NE2 . GLN A 179 ? 0.2908 0.2774 0.2215 -0.0277 -0.0075 -0.0144 179 GLN A NE2 
1284 N N   . PHE A 180 ? 0.1926 0.1769 0.1908 -0.0127 -0.0156 0.0329  180 PHE A N   
1285 C CA  . PHE A 180 ? 0.2156 0.2009 0.2249 -0.0084 -0.0175 0.0455  180 PHE A CA  
1286 C C   . PHE A 180 ? 0.1987 0.1845 0.2258 -0.0026 -0.0167 0.0470  180 PHE A C   
1287 O O   . PHE A 180 ? 0.2008 0.1968 0.2385 -0.0002 -0.0219 0.0563  180 PHE A O   
1288 C CB  . PHE A 180 ? 0.2071 0.1803 0.2157 -0.0066 -0.0119 0.0496  180 PHE A CB  
1289 C CG  . PHE A 180 ? 0.2101 0.1785 0.2320 -0.0003 -0.0119 0.0613  180 PHE A CG  
1290 C CD1 . PHE A 180 ? 0.2537 0.2314 0.2774 0.0004  -0.0186 0.0749  180 PHE A CD1 
1291 C CD2 . PHE A 180 ? 0.2369 0.1912 0.2690 0.0053  -0.0052 0.0589  180 PHE A CD2 
1292 C CE1 . PHE A 180 ? 0.2732 0.2458 0.3111 0.0080  -0.0183 0.0868  180 PHE A CE1 
1293 C CE2 . PHE A 180 ? 0.2507 0.1981 0.2954 0.0124  -0.0040 0.0689  180 PHE A CE2 
1294 C CZ  . PHE A 180 ? 0.2636 0.2199 0.3124 0.0144  -0.0104 0.0834  180 PHE A CZ  
1295 N N   . LEU A 181 ? 0.2068 0.1834 0.2372 -0.0003 -0.0101 0.0384  181 LEU A N   
1296 C CA  . LEU A 181 ? 0.2337 0.2108 0.2793 0.0053  -0.0072 0.0390  181 LEU A CA  
1297 C C   . LEU A 181 ? 0.3496 0.3420 0.4026 0.0027  -0.0131 0.0404  181 LEU A C   
1298 O O   . LEU A 181 ? 0.3928 0.3943 0.4621 0.0071  -0.0141 0.0478  181 LEU A O   
1299 C CB  . LEU A 181 ? 0.1751 0.1410 0.2182 0.0066  0.0004  0.0289  181 LEU A CB  
1300 C CG  . LEU A 181 ? 0.1765 0.1272 0.2171 0.0096  0.0067  0.0271  181 LEU A CG  
1301 C CD1 . LEU A 181 ? 0.1721 0.1153 0.2099 0.0105  0.0127  0.0176  181 LEU A CD1 
1302 C CD2 . LEU A 181 ? 0.1857 0.1322 0.2383 0.0165  0.0087  0.0358  181 LEU A CD2 
1303 N N   . CYS A 182 ? 0.3731 0.3682 0.4151 -0.0044 -0.0166 0.0332  182 CYS A N   
1304 C CA  . CYS A 182 ? 0.3679 0.3749 0.4156 -0.0093 -0.0224 0.0326  182 CYS A CA  
1305 C C   . CYS A 182 ? 0.3963 0.4195 0.4472 -0.0125 -0.0324 0.0417  182 CYS A C   
1306 O O   . CYS A 182 ? 0.4364 0.4735 0.5010 -0.0143 -0.0373 0.0461  182 CYS A O   
1307 C CB  . CYS A 182 ? 0.3235 0.3244 0.3572 -0.0159 -0.0228 0.0213  182 CYS A CB  
1308 S SG  . CYS A 182 ? 0.2499 0.2358 0.2818 -0.0126 -0.0131 0.0124  182 CYS A SG  
1309 N N   . THR A 183 ? 0.3867 0.4098 0.4252 -0.0137 -0.0357 0.0454  183 THR A N   
1310 C CA  . THR A 183 ? 0.3096 0.3488 0.3470 -0.0176 -0.0463 0.0546  183 THR A CA  
1311 C C   . THR A 183 ? 0.2553 0.3031 0.3110 -0.0096 -0.0482 0.0701  183 THR A C   
1312 O O   . THR A 183 ? 0.2203 0.2868 0.2867 -0.0108 -0.0572 0.0791  183 THR A O   
1313 C CB  . THR A 183 ? 0.3145 0.3513 0.3286 -0.0226 -0.0486 0.0529  183 THR A CB  
1314 O OG1 . THR A 183 ? 0.3672 0.4005 0.3657 -0.0302 -0.0491 0.0392  183 THR A OG1 
1315 C CG2 . THR A 183 ? 0.3300 0.3830 0.3413 -0.0251 -0.0592 0.0655  183 THR A CG2 
1316 N N   . LYS A 184 ? 0.2748 0.3089 0.3353 -0.0012 -0.0398 0.0731  184 LYS A N   
1317 C CA  . LYS A 184 ? 0.3345 0.3719 0.4098 0.0075  -0.0406 0.0880  184 LYS A CA  
1318 C C   . LYS A 184 ? 0.3636 0.3948 0.4598 0.0180  -0.0318 0.0892  184 LYS A C   
1319 O O   . LYS A 184 ? 0.4206 0.4608 0.5357 0.0260  -0.0334 0.1014  184 LYS A O   
1320 C CB  . LYS A 184 ? 0.3898 0.4147 0.4520 0.0081  -0.0388 0.0933  184 LYS A CB  
1321 C CG  . LYS A 184 ? 0.4054 0.4376 0.4458 -0.0014 -0.0460 0.0935  184 LYS A CG  
1322 C CD  . LYS A 184 ? 0.5068 0.5480 0.5470 0.0003  -0.0535 0.1113  184 LYS A CD  
1323 C CE  . LYS A 184 ? 0.5613 0.5844 0.6036 0.0066  -0.0463 0.1193  184 LYS A CE  
1324 N NZ  . LYS A 184 ? 0.5714 0.5987 0.6006 0.0035  -0.0519 0.1332  184 LYS A NZ  
1325 N N   . VAL A 185 ? 0.3403 0.3572 0.4331 0.0186  -0.0224 0.0769  185 VAL A N   
1326 C CA  . VAL A 185 ? 0.3177 0.3255 0.4252 0.0286  -0.0124 0.0764  185 VAL A CA  
1327 C C   . VAL A 185 ? 0.3220 0.3406 0.4429 0.0295  -0.0093 0.0721  185 VAL A C   
1328 O O   . VAL A 185 ? 0.2770 0.3033 0.4182 0.0382  -0.0055 0.0786  185 VAL A O   
1329 C CB  . VAL A 185 ? 0.2721 0.2557 0.3666 0.0291  -0.0033 0.0665  185 VAL A CB  
1330 C CG1 . VAL A 185 ? 0.2427 0.2168 0.3477 0.0376  0.0074  0.0620  185 VAL A CG1 
1331 C CG2 . VAL A 185 ? 0.2443 0.2163 0.3317 0.0297  -0.0041 0.0732  185 VAL A CG2 
1332 N N   . LEU A 186 ? 0.3530 0.3722 0.4633 0.0210  -0.0101 0.0620  186 LEU A N   
1333 C CA  . LEU A 186 ? 0.3202 0.3467 0.4408 0.0206  -0.0060 0.0581  186 LEU A CA  
1334 C C   . LEU A 186 ? 0.3112 0.3627 0.4490 0.0172  -0.0141 0.0661  186 LEU A C   
1335 O O   . LEU A 186 ? 0.3290 0.3898 0.4602 0.0084  -0.0247 0.0672  186 LEU A O   
1336 C CB  . LEU A 186 ? 0.3142 0.3308 0.4180 0.0129  -0.0042 0.0458  186 LEU A CB  
1337 C CG  . LEU A 186 ? 0.2535 0.2496 0.3443 0.0161  0.0045  0.0375  186 LEU A CG  
1338 C CD1 . LEU A 186 ? 0.2024 0.1912 0.2772 0.0090  0.0040  0.0277  186 LEU A CD1 
1339 C CD2 . LEU A 186 ? 0.2525 0.2453 0.3536 0.0241  0.0148  0.0369  186 LEU A CD2 
1340 N N   . GLU A 187 ? 0.2752 0.3383 0.4351 0.0238  -0.0087 0.0713  187 GLU A N   
1341 C CA  . GLU A 187 ? 0.2820 0.3721 0.4626 0.0202  -0.0155 0.0794  187 GLU A CA  
1342 C C   . GLU A 187 ? 0.2584 0.3512 0.4328 0.0075  -0.0180 0.0714  187 GLU A C   
1343 O O   . GLU A 187 ? 0.2415 0.3162 0.4003 0.0053  -0.0115 0.0611  187 GLU A O   
1344 C CB  . GLU A 187 ? 0.2715 0.3737 0.4791 0.0321  -0.0066 0.0871  187 GLU A CB  
1345 C CG  . GLU A 187 ? 0.3390 0.4369 0.5553 0.0458  -0.0039 0.0958  187 GLU A CG  
1346 C CD  . GLU A 187 ? 0.4535 0.5627 0.6973 0.0593  0.0065  0.1025  187 GLU A CD  
1347 O OE1 . GLU A 187 ? 0.4574 0.5673 0.7055 0.0600  0.0170  0.0962  187 GLU A OE1 
1348 O OE2 . GLU A 187 ? 0.5349 0.6526 0.7962 0.0699  0.0048  0.1146  187 GLU A OE2 
1349 N N   . PRO A 188 ? 0.2307 0.3460 0.4175 -0.0014 -0.0281 0.0765  188 PRO A N   
1350 C CA  . PRO A 188 ? 0.2279 0.3420 0.4075 -0.0150 -0.0312 0.0685  188 PRO A CA  
1351 C C   . PRO A 188 ? 0.2729 0.3830 0.4602 -0.0136 -0.0191 0.0654  188 PRO A C   
1352 O O   . PRO A 188 ? 0.2742 0.3966 0.4822 -0.0051 -0.0112 0.0721  188 PRO A O   
1353 C CB  . PRO A 188 ? 0.2324 0.3740 0.4280 -0.0244 -0.0445 0.0763  188 PRO A CB  
1354 C CG  . PRO A 188 ? 0.2179 0.3797 0.4370 -0.0131 -0.0449 0.0902  188 PRO A CG  
1355 C CD  . PRO A 188 ? 0.2257 0.3677 0.4328 -0.0003 -0.0381 0.0899  188 PRO A CD  
1356 N N   . LEU A 189 ? 0.3446 0.4374 0.5147 -0.0211 -0.0172 0.0554  189 LEU A N   
1357 C CA  . LEU A 189 ? 0.3458 0.4332 0.5191 -0.0213 -0.0066 0.0530  189 LEU A CA  
1358 C C   . LEU A 189 ? 0.3089 0.4198 0.5068 -0.0283 -0.0077 0.0604  189 LEU A C   
1359 O O   . LEU A 189 ? 0.3336 0.4616 0.5416 -0.0370 -0.0193 0.0644  189 LEU A O   
1360 C CB  . LEU A 189 ? 0.3344 0.3985 0.4844 -0.0282 -0.0064 0.0425  189 LEU A CB  
1361 C CG  . LEU A 189 ? 0.2872 0.3294 0.4157 -0.0205 -0.0016 0.0353  189 LEU A CG  
1362 C CD1 . LEU A 189 ? 0.1951 0.2186 0.3038 -0.0274 -0.0040 0.0263  189 LEU A CD1 
1363 C CD2 . LEU A 189 ? 0.3065 0.3437 0.4368 -0.0106 0.0111  0.0359  189 LEU A CD2 
1364 N N   . PRO A 190 ? 0.2704 0.3837 0.4778 -0.0254 0.0043  0.0624  190 PRO A N   
1365 C CA  . PRO A 190 ? 0.2395 0.3773 0.4724 -0.0329 0.0045  0.0705  190 PRO A CA  
1366 C C   . PRO A 190 ? 0.2333 0.3662 0.4605 -0.0506 -0.0043 0.0666  190 PRO A C   
1367 O O   . PRO A 190 ? 0.2554 0.3629 0.4581 -0.0544 -0.0065 0.0573  190 PRO A O   
1368 C CB  . PRO A 190 ? 0.2506 0.3873 0.4883 -0.0252 0.0213  0.0721  190 PRO A CB  
1369 C CG  . PRO A 190 ? 0.2889 0.3951 0.4972 -0.0203 0.0265  0.0623  190 PRO A CG  
1370 C CD  . PRO A 190 ? 0.2787 0.3743 0.4735 -0.0163 0.0179  0.0579  190 PRO A CD  
1371 N N   . GLU A 191 ? 0.2346 0.3917 0.4852 -0.0613 -0.0093 0.0738  191 GLU A N   
1372 C CA  . GLU A 191 ? 0.2398 0.3917 0.4867 -0.0799 -0.0181 0.0699  191 GLU A CA  
1373 C C   . GLU A 191 ? 0.2879 0.4145 0.5202 -0.0835 -0.0089 0.0649  191 GLU A C   
1374 O O   . GLU A 191 ? 0.3374 0.4420 0.5521 -0.0935 -0.0146 0.0568  191 GLU A O   
1375 C CB  . GLU A 191 ? 0.2418 0.4274 0.5204 -0.0912 -0.0240 0.0798  191 GLU A CB  
1376 C CG  . GLU A 191 ? 0.2553 0.4680 0.5489 -0.0888 -0.0359 0.0862  191 GLU A CG  
1377 C CD  . GLU A 191 ? 0.2782 0.5304 0.6088 -0.0942 -0.0383 0.0988  191 GLU A CD  
1378 O OE1 . GLU A 191 ? 0.2841 0.5375 0.6212 -0.1028 -0.0324 0.0993  191 GLU A OE1 
1379 O OE2 . GLU A 191 ? 0.2531 0.5275 0.5960 -0.0867 -0.0447 0.1056  191 GLU A OE2 
1380 N N   . GLU A 192 ? 0.2922 0.4215 0.5309 -0.0749 0.0057  0.0699  192 GLU A N   
1381 C CA  . GLU A 192 ? 0.2593 0.3660 0.4831 -0.0768 0.0148  0.0674  192 GLU A CA  
1382 C C   . GLU A 192 ? 0.2502 0.3404 0.4549 -0.0609 0.0250  0.0633  192 GLU A C   
1383 O O   . GLU A 192 ? 0.2477 0.3502 0.4600 -0.0485 0.0323  0.0664  192 GLU A O   
1384 C CB  . GLU A 192 ? 0.2243 0.3481 0.4694 -0.0840 0.0232  0.0773  192 GLU A CB  
1385 C CG  . GLU A 192 ? 0.2523 0.3895 0.5155 -0.1032 0.0129  0.0809  192 GLU A CG  
1386 C CD  . GLU A 192 ? 0.2921 0.4427 0.5745 -0.1124 0.0222  0.0910  192 GLU A CD  
1387 O OE1 . GLU A 192 ? 0.2783 0.4437 0.5708 -0.1020 0.0362  0.0981  192 GLU A OE1 
1388 O OE2 . GLU A 192 ? 0.2255 0.3691 0.5085 -0.1288 0.0160  0.0901  192 GLU A OE2 
1389 N N   . PHE A 193 ? 0.2627 0.3248 0.4430 -0.0614 0.0253  0.0563  193 PHE A N   
1390 C CA  . PHE A 193 ? 0.2552 0.3018 0.4162 -0.0487 0.0335  0.0522  193 PHE A CA  
1391 C C   . PHE A 193 ? 0.3035 0.3240 0.4440 -0.0521 0.0341  0.0483  193 PHE A C   
1392 O O   . PHE A 193 ? 0.3213 0.3321 0.4611 -0.0632 0.0278  0.0471  193 PHE A O   
1393 C CB  . PHE A 193 ? 0.2115 0.2546 0.3634 -0.0392 0.0288  0.0461  193 PHE A CB  
1394 C CG  . PHE A 193 ? 0.2152 0.2453 0.3547 -0.0449 0.0168  0.0388  193 PHE A CG  
1395 C CD1 . PHE A 193 ? 0.2287 0.2350 0.3463 -0.0438 0.0163  0.0314  193 PHE A CD1 
1396 C CD2 . PHE A 193 ? 0.2293 0.2728 0.3787 -0.0506 0.0063  0.0394  193 PHE A CD2 
1397 C CE1 . PHE A 193 ? 0.2435 0.2386 0.3495 -0.0480 0.0072  0.0241  193 PHE A CE1 
1398 C CE2 . PHE A 193 ? 0.2459 0.2776 0.3809 -0.0558 -0.0037 0.0318  193 PHE A CE2 
1399 C CZ  . PHE A 193 ? 0.2722 0.2793 0.3856 -0.0542 -0.0024 0.0237  193 PHE A CZ  
1400 N N   . THR A 194 ? 0.2881 0.2972 0.4122 -0.0424 0.0414  0.0462  194 THR A N   
1401 C CA  . THR A 194 ? 0.2377 0.2239 0.3426 -0.0430 0.0416  0.0436  194 THR A CA  
1402 C C   . THR A 194 ? 0.2183 0.1931 0.3048 -0.0326 0.0406  0.0360  194 THR A C   
1403 O O   . THR A 194 ? 0.1881 0.1694 0.2720 -0.0240 0.0461  0.0352  194 THR A O   
1404 C CB  . THR A 194 ? 0.2871 0.2727 0.3902 -0.0437 0.0518  0.0517  194 THR A CB  
1405 O OG1 . THR A 194 ? 0.3549 0.3493 0.4755 -0.0556 0.0524  0.0593  194 THR A OG1 
1406 C CG2 . THR A 194 ? 0.2828 0.2457 0.3656 -0.0419 0.0514  0.0505  194 THR A CG2 
1407 N N   . ALA A 195 ? 0.2224 0.1802 0.2968 -0.0338 0.0339  0.0302  195 ALA A N   
1408 C CA  . ALA A 195 ? 0.2358 0.1850 0.2950 -0.0254 0.0322  0.0234  195 ALA A CA  
1409 C C   . ALA A 195 ? 0.2663 0.1986 0.3110 -0.0232 0.0328  0.0230  195 ALA A C   
1410 O O   . ALA A 195 ? 0.2841 0.2041 0.3282 -0.0283 0.0298  0.0234  195 ALA A O   
1411 C CB  . ALA A 195 ? 0.1932 0.1419 0.2523 -0.0267 0.0238  0.0167  195 ALA A CB  
1412 N N   . ASN A 196 ? 0.2304 0.1618 0.2637 -0.0155 0.0364  0.0223  196 ASN A N   
1413 C CA  . ASN A 196 ? 0.2709 0.1896 0.2912 -0.0120 0.0356  0.0227  196 ASN A CA  
1414 C C   . ASN A 196 ? 0.2946 0.2145 0.3039 -0.0047 0.0345  0.0173  196 ASN A C   
1415 O O   . ASN A 196 ? 0.2676 0.1955 0.2785 -0.0026 0.0352  0.0132  196 ASN A O   
1416 C CB  . ASN A 196 ? 0.2181 0.1353 0.2348 -0.0130 0.0417  0.0320  196 ASN A CB  
1417 C CG  . ASN A 196 ? 0.2331 0.1626 0.2459 -0.0096 0.0492  0.0338  196 ASN A CG  
1418 O OD1 . ASN A 196 ? 0.2098 0.1474 0.2244 -0.0064 0.0501  0.0282  196 ASN A OD1 
1419 N ND2 . ASN A 196 ? 0.2366 0.1662 0.2429 -0.0102 0.0551  0.0418  196 ASN A ND2 
1420 N N   . PHE A 197 ? 0.3208 0.2328 0.3204 -0.0010 0.0325  0.0179  197 PHE A N   
1421 C CA  . PHE A 197 ? 0.2684 0.1833 0.2586 0.0045  0.0306  0.0136  197 PHE A CA  
1422 C C   . PHE A 197 ? 0.2097 0.1276 0.1886 0.0069  0.0341  0.0181  197 PHE A C   
1423 O O   . PHE A 197 ? 0.2216 0.1349 0.1964 0.0069  0.0352  0.0258  197 PHE A O   
1424 C CB  . PHE A 197 ? 0.2527 0.1608 0.2413 0.0076  0.0253  0.0108  197 PHE A CB  
1425 C CG  . PHE A 197 ? 0.2709 0.1788 0.2654 0.0062  0.0221  0.0036  197 PHE A CG  
1426 C CD1 . PHE A 197 ? 0.1980 0.0982 0.1985 0.0021  0.0207  0.0026  197 PHE A CD1 
1427 C CD2 . PHE A 197 ? 0.2743 0.1893 0.2672 0.0080  0.0205  -0.0020 197 PHE A CD2 
1428 C CE1 . PHE A 197 ? 0.2588 0.1597 0.2616 0.0003  0.0177  -0.0043 197 PHE A CE1 
1429 C CE2 . PHE A 197 ? 0.2882 0.2040 0.2847 0.0064  0.0179  -0.0073 197 PHE A CE2 
1430 C CZ  . PHE A 197 ? 0.2807 0.1900 0.2811 0.0028  0.0165  -0.0086 197 PHE A CZ  
1431 N N   . ARG A 198 ? 0.2799 0.2045 0.2526 0.0085  0.0358  0.0133  198 ARG A N   
1432 C CA  . ARG A 198 ? 0.3113 0.2391 0.2698 0.0100  0.0388  0.0153  198 ARG A CA  
1433 C C   . ARG A 198 ? 0.3027 0.2331 0.2523 0.0119  0.0340  0.0089  198 ARG A C   
1434 O O   . ARG A 198 ? 0.2420 0.1733 0.1964 0.0116  0.0323  0.0018  198 ARG A O   
1435 C CB  . ARG A 198 ? 0.2584 0.1911 0.2167 0.0090  0.0475  0.0149  198 ARG A CB  
1436 C CG  . ARG A 198 ? 0.2690 0.2032 0.2409 0.0058  0.0521  0.0211  198 ARG A CG  
1437 C CD  . ARG A 198 ? 0.2252 0.1674 0.1985 0.0061  0.0621  0.0219  198 ARG A CD  
1438 N NE  . ARG A 198 ? 0.2216 0.1691 0.2128 0.0024  0.0654  0.0275  198 ARG A NE  
1439 C CZ  . ARG A 198 ? 0.3143 0.2720 0.3128 0.0025  0.0747  0.0303  198 ARG A CZ  
1440 N NH1 . ARG A 198 ? 0.2345 0.1956 0.2217 0.0069  0.0828  0.0270  198 ARG A NH1 
1441 N NH2 . ARG A 198 ? 0.3189 0.2840 0.3362 -0.0021 0.0762  0.0361  198 ARG A NH2 
1442 N N   . LEU A 199 ? 0.3217 0.2543 0.2588 0.0132  0.0312  0.0123  199 LEU A N   
1443 C CA  . LEU A 199 ? 0.3122 0.2496 0.2419 0.0136  0.0252  0.0069  199 LEU A CA  
1444 C C   . LEU A 199 ? 0.2766 0.2187 0.1875 0.0123  0.0257  0.0063  199 LEU A C   
1445 O O   . LEU A 199 ? 0.2953 0.2371 0.1967 0.0122  0.0306  0.0121  199 LEU A O   
1446 C CB  . LEU A 199 ? 0.2986 0.2376 0.2342 0.0168  0.0178  0.0108  199 LEU A CB  
1447 C CG  . LEU A 199 ? 0.3289 0.2669 0.2612 0.0203  0.0154  0.0218  199 LEU A CG  
1448 C CD1 . LEU A 199 ? 0.4292 0.3767 0.3463 0.0206  0.0107  0.0250  199 LEU A CD1 
1449 C CD2 . LEU A 199 ? 0.2311 0.1659 0.1763 0.0248  0.0113  0.0236  199 LEU A CD2 
1450 N N   . GLU A 200 ? 0.2453 0.1921 0.1499 0.0104  0.0206  -0.0006 200 GLU A N   
1451 C CA  . GLU A 200 ? 0.3099 0.2614 0.1943 0.0077  0.0190  -0.0029 200 GLU A CA  
1452 C C   . GLU A 200 ? 0.3281 0.2897 0.2108 0.0068  0.0079  -0.0022 200 GLU A C   
1453 O O   . GLU A 200 ? 0.3075 0.2717 0.2034 0.0066  0.0036  -0.0055 200 GLU A O   
1454 C CB  . GLU A 200 ? 0.3467 0.2930 0.2231 0.0043  0.0247  -0.0147 200 GLU A CB  
1455 C CG  . GLU A 200 ? 0.4356 0.3846 0.2879 0.0004  0.0238  -0.0196 200 GLU A CG  
1456 C CD  . GLU A 200 ? 0.5086 0.4483 0.3523 -0.0020 0.0313  -0.0325 200 GLU A CD  
1457 O OE1 . GLU A 200 ? 0.4667 0.3989 0.3253 -0.0008 0.0351  -0.0370 200 GLU A OE1 
1458 O OE2 . GLU A 200 ? 0.6290 0.5679 0.4502 -0.0049 0.0336  -0.0380 200 GLU A OE2 
1459 N N   . TYR A 201 ? 0.3629 0.3321 0.2298 0.0061  0.0034  0.0030  201 TYR A N   
1460 C CA  . TYR A 201 ? 0.3454 0.3284 0.2112 0.0051  -0.0081 0.0051  201 TYR A CA  
1461 C C   . TYR A 201 ? 0.3565 0.3436 0.2089 -0.0031 -0.0118 -0.0068 201 TYR A C   
1462 O O   . TYR A 201 ? 0.3412 0.3192 0.1796 -0.0069 -0.0050 -0.0156 201 TYR A O   
1463 C CB  . TYR A 201 ? 0.3494 0.3401 0.2051 0.0085  -0.0129 0.0185  201 TYR A CB  
1464 C CG  . TYR A 201 ? 0.3502 0.3344 0.2191 0.0161  -0.0101 0.0309  201 TYR A CG  
1465 C CD1 . TYR A 201 ? 0.3139 0.3023 0.2006 0.0222  -0.0160 0.0373  201 TYR A CD1 
1466 C CD2 . TYR A 201 ? 0.3758 0.3490 0.2399 0.0168  -0.0009 0.0359  201 TYR A CD2 
1467 C CE1 . TYR A 201 ? 0.3562 0.3349 0.2539 0.0289  -0.0130 0.0471  201 TYR A CE1 
1468 C CE2 . TYR A 201 ? 0.3904 0.3554 0.2665 0.0220  0.0014  0.0467  201 TYR A CE2 
1469 C CZ  . TYR A 201 ? 0.3902 0.3562 0.2822 0.0280  -0.0048 0.0517  201 TYR A CZ  
1470 O OH  . TYR A 201 ? 0.3607 0.3149 0.2636 0.0329  -0.0021 0.0611  201 TYR A OH  
1471 N N   . THR A 202 ? 0.3723 0.3731 0.2298 -0.0059 -0.0224 -0.0072 202 THR A N   
1472 C CA  . THR A 202 ? 0.3740 0.3801 0.2185 -0.0158 -0.0281 -0.0178 202 THR A CA  
1473 C C   . THR A 202 ? 0.5209 0.5352 0.3398 -0.0190 -0.0333 -0.0152 202 THR A C   
1474 O O   . THR A 202 ? 0.5433 0.5607 0.3568 -0.0130 -0.0330 -0.0031 202 THR A O   
1475 C CB  . THR A 202 ? 0.3085 0.3299 0.1699 -0.0191 -0.0381 -0.0184 202 THR A CB  
1476 O OG1 . THR A 202 ? 0.2975 0.3350 0.1705 -0.0117 -0.0451 -0.0047 202 THR A OG1 
1477 C CG2 . THR A 202 ? 0.2942 0.3068 0.1752 -0.0187 -0.0324 -0.0238 202 THR A CG2 
1478 N N   . ASN A 203 ? 0.6107 0.6278 0.4126 -0.0292 -0.0383 -0.0263 203 ASN A N   
1479 C CA  . ASN A 203 ? 0.6468 0.6737 0.4214 -0.0340 -0.0449 -0.0250 203 ASN A CA  
1480 C C   . ASN A 203 ? 0.6898 0.7413 0.4722 -0.0317 -0.0593 -0.0108 203 ASN A C   
1481 O O   . ASN A 203 ? 0.7755 0.8359 0.5424 -0.0291 -0.0635 0.0000  203 ASN A O   
1482 C CB  . ASN A 203 ? 0.6746 0.6972 0.4288 -0.0469 -0.0475 -0.0424 203 ASN A CB  
1483 C CG  . ASN A 203 ? 0.7239 0.7237 0.4838 -0.0490 -0.0362 -0.0569 203 ASN A CG  
1484 O OD1 . ASN A 203 ? 0.7875 0.7864 0.5684 -0.0514 -0.0382 -0.0602 203 ASN A OD1 
1485 N ND2 . ASN A 203 ? 0.7022 0.6845 0.4438 -0.0477 -0.0238 -0.0647 203 ASN A ND2 
1486 N N   . ASP A 204 ? 0.6673 0.7303 0.4744 -0.0322 -0.0663 -0.0100 204 ASP A N   
1487 C CA  . ASP A 204 ? 0.6578 0.7467 0.4781 -0.0292 -0.0798 0.0029  204 ASP A CA  
1488 C C   . ASP A 204 ? 0.6639 0.7541 0.4936 -0.0151 -0.0778 0.0209  204 ASP A C   
1489 O O   . ASP A 204 ? 0.7187 0.8278 0.5492 -0.0110 -0.0882 0.0343  204 ASP A O   
1490 C CB  . ASP A 204 ? 0.6352 0.7350 0.4838 -0.0312 -0.0840 -0.0001 204 ASP A CB  
1491 C CG  . ASP A 204 ? 0.6644 0.7645 0.5060 -0.0466 -0.0878 -0.0161 204 ASP A CG  
1492 O OD1 . ASP A 204 ? 0.6917 0.7895 0.5058 -0.0562 -0.0914 -0.0240 204 ASP A OD1 
1493 O OD2 . ASP A 204 ? 0.6480 0.7498 0.5106 -0.0498 -0.0870 -0.0208 204 ASP A OD2 
1494 N N   . ALA A 205 ? 0.6235 0.6932 0.4612 -0.0080 -0.0649 0.0212  205 ALA A N   
1495 C CA  . ALA A 205 ? 0.5822 0.6474 0.4299 0.0043  -0.0615 0.0366  205 ALA A CA  
1496 C C   . ALA A 205 ? 0.5967 0.6676 0.4229 0.0060  -0.0657 0.0492  205 ALA A C   
1497 O O   . ALA A 205 ? 0.5400 0.6040 0.3403 0.0001  -0.0614 0.0445  205 ALA A O   
1498 C CB  . ALA A 205 ? 0.5367 0.5783 0.3904 0.0077  -0.0472 0.0326  205 ALA A CB  
1499 N N   . PRO A 206 ? 0.6426 0.7265 0.4793 0.0148  -0.0738 0.0661  206 PRO A N   
1500 C CA  . PRO A 206 ? 0.6538 0.7422 0.4714 0.0178  -0.0778 0.0818  206 PRO A CA  
1501 C C   . PRO A 206 ? 0.6392 0.7046 0.4477 0.0210  -0.0643 0.0864  206 PRO A C   
1502 O O   . PRO A 206 ? 0.6220 0.6700 0.4470 0.0243  -0.0540 0.0818  206 PRO A O   
1503 C CB  . PRO A 206 ? 0.6438 0.7469 0.4837 0.0294  -0.0872 0.0992  206 PRO A CB  
1504 C CG  . PRO A 206 ? 0.6089 0.7240 0.4739 0.0289  -0.0913 0.0898  206 PRO A CG  
1505 C CD  . PRO A 206 ? 0.6167 0.7120 0.4838 0.0231  -0.0791 0.0722  206 PRO A CD  
1506 N N   . SER A 207 ? 0.6417 0.7083 0.4242 0.0192  -0.0644 0.0957  207 SER A N   
1507 C CA  . SER A 207 ? 0.6090 0.6567 0.3838 0.0214  -0.0515 0.1025  207 SER A CA  
1508 C C   . SER A 207 ? 0.5965 0.6342 0.3950 0.0327  -0.0499 0.1183  207 SER A C   
1509 O O   . SER A 207 ? 0.5990 0.6172 0.4052 0.0343  -0.0383 0.1188  207 SER A O   
1510 C CB  . SER A 207 ? 0.6258 0.6798 0.3666 0.0172  -0.0523 0.1112  207 SER A CB  
1511 O OG  . SER A 207 ? 0.5931 0.6510 0.3092 0.0066  -0.0507 0.0940  207 SER A OG  
1512 N N   . ASN A 208 ? 0.6016 0.6525 0.4122 0.0403  -0.0617 0.1309  208 ASN A N   
1513 C CA  . ASN A 208 ? 0.6103 0.6500 0.4427 0.0523  -0.0605 0.1462  208 ASN A CA  
1514 C C   . ASN A 208 ? 0.5897 0.6157 0.4500 0.0562  -0.0537 0.1350  208 ASN A C   
1515 O O   . ASN A 208 ? 0.6476 0.6533 0.5202 0.0619  -0.0464 0.1410  208 ASN A O   
1516 C CB  . ASN A 208 ? 0.6649 0.7243 0.5045 0.0611  -0.0749 0.1628  208 ASN A CB  
1517 C CG  . ASN A 208 ? 0.7033 0.7841 0.5607 0.0617  -0.0843 0.1531  208 ASN A CG  
1518 O OD1 . ASN A 208 ? 0.7123 0.7884 0.5968 0.0688  -0.0817 0.1490  208 ASN A OD1 
1519 N ND2 . ASN A 208 ? 0.7282 0.8329 0.5696 0.0534  -0.0952 0.1493  208 ASN A ND2 
1520 N N   . PHE A 209 ? 0.5341 0.5705 0.4031 0.0522  -0.0563 0.1189  209 PHE A N   
1521 C CA  . PHE A 209 ? 0.4910 0.5173 0.3844 0.0555  -0.0505 0.1084  209 PHE A CA  
1522 C C   . PHE A 209 ? 0.5513 0.5548 0.4424 0.0507  -0.0374 0.0996  209 PHE A C   
1523 O O   . PHE A 209 ? 0.6129 0.6144 0.4865 0.0418  -0.0327 0.0917  209 PHE A O   
1524 C CB  . PHE A 209 ? 0.4020 0.4455 0.3034 0.0507  -0.0558 0.0943  209 PHE A CB  
1525 C CG  . PHE A 209 ? 0.3152 0.3490 0.2378 0.0527  -0.0489 0.0830  209 PHE A CG  
1526 C CD1 . PHE A 209 ? 0.3059 0.3429 0.2520 0.0632  -0.0504 0.0875  209 PHE A CD1 
1527 C CD2 . PHE A 209 ? 0.3023 0.3240 0.2207 0.0446  -0.0406 0.0683  209 PHE A CD2 
1528 C CE1 . PHE A 209 ? 0.2873 0.3157 0.2497 0.0646  -0.0436 0.0768  209 PHE A CE1 
1529 C CE2 . PHE A 209 ? 0.2807 0.2947 0.2164 0.0460  -0.0350 0.0592  209 PHE A CE2 
1530 C CZ  . PHE A 209 ? 0.2742 0.2915 0.2305 0.0555  -0.0365 0.0630  209 PHE A CZ  
1531 N N   . ARG A 210 ? 0.5140 0.5009 0.4234 0.0568  -0.0317 0.1005  210 ARG A N   
1532 C CA  . ARG A 210 ? 0.4892 0.4559 0.4002 0.0524  -0.0206 0.0937  210 ARG A CA  
1533 C C   . ARG A 210 ? 0.4470 0.4032 0.3798 0.0571  -0.0175 0.0867  210 ARG A C   
1534 O O   . ARG A 210 ? 0.4647 0.4183 0.4110 0.0666  -0.0203 0.0936  210 ARG A O   
1535 C CB  . ARG A 210 ? 0.5278 0.4802 0.4303 0.0528  -0.0158 0.1077  210 ARG A CB  
1536 C CG  . ARG A 210 ? 0.5686 0.4999 0.4791 0.0496  -0.0056 0.1042  210 ARG A CG  
1537 C CD  . ARG A 210 ? 0.6466 0.5654 0.5495 0.0490  -0.0013 0.1202  210 ARG A CD  
1538 N NE  . ARG A 210 ? 0.7132 0.6439 0.5930 0.0440  -0.0010 0.1258  210 ARG A NE  
1539 C CZ  . ARG A 210 ? 0.7603 0.7013 0.6269 0.0475  -0.0080 0.1394  210 ARG A CZ  
1540 N NH1 . ARG A 210 ? 0.7887 0.7301 0.6658 0.0572  -0.0161 0.1498  210 ARG A NH1 
1541 N NH2 . ARG A 210 ? 0.7807 0.7324 0.6232 0.0419  -0.0070 0.1426  210 ARG A NH2 
1542 N N   . ILE A 211 ? 0.3996 0.3500 0.3352 0.0508  -0.0116 0.0730  211 ILE A N   
1543 C CA  . ILE A 211 ? 0.3881 0.3286 0.3407 0.0537  -0.0082 0.0653  211 ILE A CA  
1544 C C   . ILE A 211 ? 0.4566 0.3746 0.4140 0.0554  -0.0026 0.0713  211 ILE A C   
1545 O O   . ILE A 211 ? 0.5059 0.4150 0.4563 0.0488  0.0027  0.0726  211 ILE A O   
1546 C CB  . ILE A 211 ? 0.3186 0.2612 0.2717 0.0461  -0.0047 0.0503  211 ILE A CB  
1547 C CG1 . ILE A 211 ? 0.2726 0.2348 0.2215 0.0432  -0.0103 0.0444  211 ILE A CG1 
1548 C CG2 . ILE A 211 ? 0.2879 0.2208 0.2555 0.0482  -0.0014 0.0428  211 ILE A CG2 
1549 C CD1 . ILE A 211 ? 0.2649 0.2277 0.2095 0.0349  -0.0068 0.0322  211 ILE A CD1 
1550 N N   . ASP A 212 ? 0.4454 0.3544 0.4153 0.0643  -0.0034 0.0750  212 ASP A N   
1551 C CA  . ASP A 212 ? 0.4275 0.3118 0.4028 0.0659  0.0015  0.0794  212 ASP A CA  
1552 C C   . ASP A 212 ? 0.3942 0.2678 0.3709 0.0564  0.0075  0.0680  212 ASP A C   
1553 O O   . ASP A 212 ? 0.3439 0.2232 0.3252 0.0546  0.0079  0.0552  212 ASP A O   
1554 C CB  . ASP A 212 ? 0.4931 0.3689 0.4825 0.0777  0.0006  0.0805  212 ASP A CB  
1555 C CG  . ASP A 212 ? 0.6197 0.4714 0.6118 0.0828  0.0028  0.0930  212 ASP A CG  
1556 O OD1 . ASP A 212 ? 0.6670 0.5024 0.6539 0.0745  0.0071  0.0955  212 ASP A OD1 
1557 O OD2 . ASP A 212 ? 0.6656 0.5151 0.6664 0.0953  0.0003  0.1008  212 ASP A OD2 
1558 N N   . GLY A 213 ? 0.4044 0.2645 0.3772 0.0500  0.0117  0.0737  213 GLY A N   
1559 C CA  . GLY A 213 ? 0.4396 0.2920 0.4155 0.0405  0.0165  0.0649  213 GLY A CA  
1560 C C   . GLY A 213 ? 0.4533 0.3181 0.4210 0.0320  0.0194  0.0643  213 GLY A C   
1561 O O   . GLY A 213 ? 0.3885 0.2491 0.3598 0.0240  0.0235  0.0608  213 GLY A O   
1562 N N   . PHE A 214 ? 0.4747 0.3554 0.4316 0.0337  0.0172  0.0675  214 PHE A N   
1563 C CA  . PHE A 214 ? 0.4087 0.3003 0.3560 0.0271  0.0211  0.0657  214 PHE A CA  
1564 C C   . PHE A 214 ? 0.4536 0.3486 0.3867 0.0269  0.0224  0.0788  214 PHE A C   
1565 O O   . PHE A 214 ? 0.4741 0.3768 0.3983 0.0319  0.0170  0.0845  214 PHE A O   
1566 C CB  . PHE A 214 ? 0.3266 0.2335 0.2703 0.0273  0.0184  0.0544  214 PHE A CB  
1567 C CG  . PHE A 214 ? 0.2747 0.1802 0.2300 0.0261  0.0183  0.0423  214 PHE A CG  
1568 C CD1 . PHE A 214 ? 0.2916 0.1944 0.2555 0.0313  0.0142  0.0389  214 PHE A CD1 
1569 C CD2 . PHE A 214 ? 0.2635 0.1716 0.2209 0.0204  0.0225  0.0351  214 PHE A CD2 
1570 C CE1 . PHE A 214 ? 0.3417 0.2441 0.3136 0.0297  0.0145  0.0283  214 PHE A CE1 
1571 C CE2 . PHE A 214 ? 0.3091 0.2169 0.2757 0.0191  0.0217  0.0256  214 PHE A CE2 
1572 C CZ  . PHE A 214 ? 0.3253 0.2302 0.2979 0.0233  0.0177  0.0222  214 PHE A CZ  
1573 N N   . GLU A 215 ? 0.4583 0.3493 0.3893 0.0207  0.0296  0.0843  215 GLU A N   
1574 C CA  . GLU A 215 ? 0.4514 0.3466 0.3672 0.0193  0.0328  0.0969  215 GLU A CA  
1575 C C   . GLU A 215 ? 0.4081 0.3201 0.3075 0.0178  0.0344  0.0904  215 GLU A C   
1576 O O   . GLU A 215 ? 0.3796 0.2970 0.2826 0.0151  0.0377  0.0779  215 GLU A O   
1577 C CB  . GLU A 215 ? 0.5028 0.3895 0.4235 0.0122  0.0413  0.1050  215 GLU A CB  
1578 C CG  . GLU A 215 ? 0.6338 0.5050 0.5553 0.0131  0.0408  0.1218  215 GLU A CG  
1579 C CD  . GLU A 215 ? 0.7336 0.5863 0.6708 0.0167  0.0360  0.1197  215 GLU A CD  
1580 O OE1 . GLU A 215 ? 0.7193 0.5721 0.6667 0.0172  0.0338  0.1052  215 GLU A OE1 
1581 O OE2 . GLU A 215 ? 0.7952 0.6320 0.7338 0.0194  0.0348  0.1328  215 GLU A OE2 
1582 N N   . ASP A 216 ? 0.3958 0.3153 0.2768 0.0197  0.0318  0.0990  216 ASP A N   
1583 C CA  . ASP A 216 ? 0.4033 0.3369 0.2649 0.0176  0.0331  0.0921  216 ASP A CA  
1584 C C   . ASP A 216 ? 0.3980 0.3338 0.2552 0.0121  0.0454  0.0889  216 ASP A C   
1585 O O   . ASP A 216 ? 0.3885 0.3193 0.2497 0.0092  0.0526  0.0992  216 ASP A O   
1586 C CB  . ASP A 216 ? 0.4588 0.4004 0.2995 0.0197  0.0274  0.1036  216 ASP A CB  
1587 C CG  . ASP A 216 ? 0.4963 0.4461 0.3371 0.0244  0.0147  0.1005  216 ASP A CG  
1588 O OD1 . ASP A 216 ? 0.4780 0.4250 0.3370 0.0269  0.0111  0.0917  216 ASP A OD1 
1589 O OD2 . ASP A 216 ? 0.5261 0.4868 0.3489 0.0252  0.0083  0.1075  216 ASP A OD2 
1590 N N   . SER A 217 ? 0.3467 0.2899 0.1971 0.0108  0.0483  0.0748  217 SER A N   
1591 C CA  . SER A 217 ? 0.3712 0.3179 0.2183 0.0076  0.0609  0.0704  217 SER A CA  
1592 C C   . SER A 217 ? 0.4474 0.4013 0.2752 0.0074  0.0628  0.0574  217 SER A C   
1593 O O   . SER A 217 ? 0.5094 0.4641 0.3347 0.0083  0.0542  0.0479  217 SER A O   
1594 C CB  . SER A 217 ? 0.4097 0.3523 0.2821 0.0065  0.0651  0.0644  217 SER A CB  
1595 O OG  . SER A 217 ? 0.4424 0.3911 0.3145 0.0050  0.0771  0.0594  217 SER A OG  
1596 N N   . SER A 218 ? 0.4802 0.4389 0.2943 0.0058  0.0746  0.0567  218 SER A N   
1597 C CA  . SER A 218 ? 0.4637 0.4260 0.2578 0.0055  0.0784  0.0426  218 SER A CA  
1598 C C   . SER A 218 ? 0.4230 0.3827 0.2322 0.0071  0.0875  0.0300  218 SER A C   
1599 O O   . SER A 218 ? 0.4450 0.4043 0.2407 0.0077  0.0931  0.0171  218 SER A O   
1600 C CB  . SER A 218 ? 0.4934 0.4625 0.2591 0.0037  0.0868  0.0479  218 SER A CB  
1601 O OG  . SER A 218 ? 0.5163 0.4880 0.2904 0.0032  0.0998  0.0578  218 SER A OG  
1602 N N   . THR A 219 ? 0.4098 0.3673 0.2468 0.0078  0.0885  0.0338  219 THR A N   
1603 C CA  . THR A 219 ? 0.4485 0.4048 0.3034 0.0100  0.0942  0.0237  219 THR A CA  
1604 C C   . THR A 219 ? 0.4193 0.3700 0.2944 0.0103  0.0833  0.0205  219 THR A C   
1605 O O   . THR A 219 ? 0.3025 0.2505 0.1833 0.0092  0.0742  0.0278  219 THR A O   
1606 C CB  . THR A 219 ? 0.4918 0.4549 0.3630 0.0100  0.1068  0.0306  219 THR A CB  
1607 O OG1 . THR A 219 ? 0.4981 0.4611 0.3818 0.0064  0.1031  0.0447  219 THR A OG1 
1608 C CG2 . THR A 219 ? 0.3587 0.3287 0.2104 0.0108  0.1208  0.0307  219 THR A CG2 
1609 N N   . PHE A 220 ? 0.4417 0.3901 0.3269 0.0125  0.0851  0.0098  220 PHE A N   
1610 C CA  . PHE A 220 ? 0.4196 0.3633 0.3209 0.0127  0.0759  0.0058  220 PHE A CA  
1611 C C   . PHE A 220 ? 0.4122 0.3584 0.3373 0.0140  0.0808  0.0064  220 PHE A C   
1612 O O   . PHE A 220 ? 0.3866 0.3367 0.3256 0.0121  0.0819  0.0154  220 PHE A O   
1613 C CB  . PHE A 220 ? 0.4236 0.3622 0.3143 0.0130  0.0716  -0.0066 220 PHE A CB  
1614 C CG  . PHE A 220 ? 0.4450 0.3805 0.3470 0.0120  0.0607  -0.0089 220 PHE A CG  
1615 C CD1 . PHE A 220 ? 0.4390 0.3757 0.3526 0.0115  0.0539  -0.0010 220 PHE A CD1 
1616 C CD2 . PHE A 220 ? 0.4509 0.3814 0.3513 0.0115  0.0580  -0.0193 220 PHE A CD2 
1617 C CE1 . PHE A 220 ? 0.4172 0.3521 0.3399 0.0112  0.0455  -0.0037 220 PHE A CE1 
1618 C CE2 . PHE A 220 ? 0.4273 0.3567 0.3379 0.0102  0.0491  -0.0206 220 PHE A CE2 
1619 C CZ  . PHE A 220 ? 0.3836 0.3163 0.3051 0.0104  0.0432  -0.0129 220 PHE A CZ  
1620 N N   . TYR A 221 ? 0.3975 0.3410 0.3272 0.0170  0.0833  -0.0028 221 TYR A N   
1621 C CA  . TYR A 221 ? 0.3514 0.2996 0.3024 0.0197  0.0891  -0.0020 221 TYR A CA  
1622 C C   . TYR A 221 ? 0.3686 0.3128 0.3151 0.0250  0.0975  -0.0117 221 TYR A C   
1623 O O   . TYR A 221 ? 0.3913 0.3267 0.3191 0.0248  0.0962  -0.0206 221 TYR A O   
1624 C CB  . TYR A 221 ? 0.2314 0.1787 0.2006 0.0182  0.0795  -0.0006 221 TYR A CB  
1625 C CG  . TYR A 221 ? 0.2967 0.2355 0.2617 0.0189  0.0726  -0.0089 221 TYR A CG  
1626 C CD1 . TYR A 221 ? 0.2504 0.1855 0.2206 0.0228  0.0764  -0.0150 221 TYR A CD1 
1627 C CD2 . TYR A 221 ? 0.3132 0.2481 0.2709 0.0157  0.0627  -0.0097 221 TYR A CD2 
1628 C CE1 . TYR A 221 ? 0.2314 0.1579 0.1983 0.0221  0.0704  -0.0214 221 TYR A CE1 
1629 C CE2 . TYR A 221 ? 0.2845 0.2139 0.2401 0.0152  0.0570  -0.0164 221 TYR A CE2 
1630 C CZ  . TYR A 221 ? 0.2493 0.1740 0.2090 0.0177  0.0608  -0.0221 221 TYR A CZ  
1631 O OH  . TYR A 221 ? 0.2708 0.1891 0.2286 0.0160  0.0554  -0.0276 221 TYR A OH  
1632 N N   . THR A 222 ? 0.3513 0.3019 0.3158 0.0296  0.1058  -0.0101 222 THR A N   
1633 C CA  . THR A 222 ? 0.2711 0.2157 0.2357 0.0365  0.1140  -0.0189 222 THR A CA  
1634 C C   . THR A 222 ? 0.2828 0.2315 0.2743 0.0405  0.1125  -0.0155 222 THR A C   
1635 O O   . THR A 222 ? 0.2646 0.2248 0.2745 0.0378  0.1077  -0.0062 222 THR A O   
1636 C CB  . THR A 222 ? 0.2922 0.2416 0.2490 0.0414  0.1300  -0.0209 222 THR A CB  
1637 O OG1 . THR A 222 ? 0.2852 0.2520 0.2614 0.0417  0.1359  -0.0096 222 THR A OG1 
1638 C CG2 . THR A 222 ? 0.4465 0.3914 0.3725 0.0373  0.1311  -0.0249 222 THR A CG2 
1639 N N   . LEU A 223 ? 0.3070 0.2458 0.3002 0.0466  0.1162  -0.0228 223 LEU A N   
1640 C CA  . LEU A 223 ? 0.3006 0.2432 0.3186 0.0519  0.1151  -0.0185 223 LEU A CA  
1641 C C   . LEU A 223 ? 0.3207 0.2660 0.3486 0.0626  0.1302  -0.0202 223 LEU A C   
1642 O O   . LEU A 223 ? 0.3053 0.2400 0.3157 0.0662  0.1403  -0.0298 223 LEU A O   
1643 C CB  . LEU A 223 ? 0.2779 0.2053 0.2926 0.0506  0.1060  -0.0233 223 LEU A CB  
1644 C CG  . LEU A 223 ? 0.3061 0.2291 0.3076 0.0412  0.0933  -0.0244 223 LEU A CG  
1645 C CD1 . LEU A 223 ? 0.3287 0.2371 0.3261 0.0399  0.0870  -0.0298 223 LEU A CD1 
1646 C CD2 . LEU A 223 ? 0.2212 0.1577 0.2355 0.0365  0.0849  -0.0147 223 LEU A CD2 
1647 N N   . PRO A 224 ? 0.3656 0.3260 0.4219 0.0679  0.1318  -0.0111 224 PRO A N   
1648 C CA  . PRO A 224 ? 0.3867 0.3504 0.4562 0.0803  0.1465  -0.0121 224 PRO A CA  
1649 C C   . PRO A 224 ? 0.4411 0.3831 0.5025 0.0845  0.1439  -0.0205 224 PRO A C   
1650 O O   . PRO A 224 ? 0.3988 0.3282 0.4566 0.0808  0.1341  -0.0218 224 PRO A O   
1651 C CB  . PRO A 224 ? 0.3670 0.3545 0.4705 0.0828  0.1436  0.0016  224 PRO A CB  
1652 C CG  . PRO A 224 ? 0.3331 0.3306 0.4364 0.0699  0.1305  0.0085  224 PRO A CG  
1653 C CD  . PRO A 224 ? 0.2382 0.2148 0.3155 0.0629  0.1209  0.0005  224 PRO A CD  
1654 N N   . ASP A 225 ? 0.5135 0.4515 0.5729 0.0915  0.1526  -0.0256 225 ASP A N   
1655 C CA  . ASP A 225 ? 0.5754 0.4902 0.6230 0.0940  0.1515  -0.0354 225 ASP A CA  
1656 C C   . ASP A 225 ? 0.5392 0.4484 0.6049 0.0978  0.1439  -0.0291 225 ASP A C   
1657 O O   . ASP A 225 ? 0.5644 0.4527 0.6194 0.0961  0.1394  -0.0355 225 ASP A O   
1658 C CB  . ASP A 225 ? 0.6471 0.5600 0.6905 0.1018  0.1638  -0.0422 225 ASP A CB  
1659 C CG  . ASP A 225 ? 0.6704 0.6020 0.7111 0.1017  0.1735  -0.0405 225 ASP A CG  
1660 O OD1 . ASP A 225 ? 0.6593 0.5859 0.6743 0.0951  0.1749  -0.0479 225 ASP A OD1 
1661 O OD2 . ASP A 225 ? 0.7006 0.6533 0.7652 0.1077  0.1791  -0.0310 225 ASP A OD2 
1662 N N   . ASP A 226 ? 0.4735 0.4025 0.5667 0.1021  0.1421  -0.0160 226 ASP A N   
1663 C CA  . ASP A 226 ? 0.5025 0.4289 0.6127 0.1058  0.1343  -0.0081 226 ASP A CA  
1664 C C   . ASP A 226 ? 0.4787 0.4070 0.5903 0.0977  0.1219  -0.0024 226 ASP A C   
1665 O O   . ASP A 226 ? 0.5154 0.4520 0.6457 0.0999  0.1145  0.0084  226 ASP A O   
1666 C CB  . ASP A 226 ? 0.5439 0.4921 0.6840 0.1156  0.1377  0.0036  226 ASP A CB  
1667 C CG  . ASP A 226 ? 0.6289 0.6065 0.7869 0.1124  0.1362  0.0139  226 ASP A CG  
1668 O OD1 . ASP A 226 ? 0.6703 0.6584 0.8415 0.1086  0.1255  0.0233  226 ASP A OD1 
1669 O OD2 . ASP A 226 ? 0.6689 0.6601 0.8285 0.1133  0.1455  0.0130  226 ASP A OD2 
1670 N N   . ILE A 227 ? 0.3860 0.3067 0.4771 0.0887  0.1194  -0.0096 227 ILE A N   
1671 C CA  . ILE A 227 ? 0.4089 0.3320 0.4996 0.0806  0.1080  -0.0054 227 ILE A CA  
1672 C C   . ILE A 227 ? 0.4452 0.3515 0.5337 0.0794  0.1001  -0.0048 227 ILE A C   
1673 O O   . ILE A 227 ? 0.4706 0.3579 0.5465 0.0796  0.1017  -0.0123 227 ILE A O   
1674 C CB  . ILE A 227 ? 0.3620 0.2825 0.4285 0.0696  0.1047  -0.0127 227 ILE A CB  
1675 C CG1 . ILE A 227 ? 0.3644 0.2940 0.4308 0.0593  0.0903  -0.0069 227 ILE A CG1 
1676 C CG2 . ILE A 227 ? 0.4075 0.3039 0.4496 0.0675  0.1076  -0.0259 227 ILE A CG2 
1677 C CD1 . ILE A 227 ? 0.3360 0.2891 0.4197 0.0573  0.0874  0.0031  227 ILE A CD1 
1678 N N   . GLN A 228 ? 0.4477 0.3654 0.5452 0.0744  0.0878  0.0047  228 GLN A N   
1679 C CA  . GLN A 228 ? 0.4295 0.3346 0.5243 0.0718  0.0798  0.0073  228 GLN A CA  
1680 C C   . GLN A 228 ? 0.4442 0.3459 0.5198 0.0591  0.0708  0.0023  228 GLN A C   
1681 O O   . GLN A 228 ? 0.4557 0.3685 0.5251 0.0531  0.0684  0.0004  228 GLN A O   
1682 C CB  . GLN A 228 ? 0.3593 0.2802 0.4755 0.0751  0.0725  0.0218  228 GLN A CB  
1683 C CG  . GLN A 228 ? 0.4154 0.3435 0.5550 0.0891  0.0807  0.0288  228 GLN A CG  
1684 C CD  . GLN A 228 ? 0.4526 0.3588 0.5839 0.0942  0.0872  0.0225  228 GLN A CD  
1685 O OE1 . GLN A 228 ? 0.4081 0.3007 0.5372 0.0939  0.0824  0.0256  228 GLN A OE1 
1686 N NE2 . GLN A 228 ? 0.5211 0.4240 0.6469 0.0982  0.0979  0.0135  228 GLN A NE2 
1687 N N   . SER A 229 ? 0.4366 0.3230 0.5041 0.0552  0.0664  0.0009  229 SER A N   
1688 C CA  . SER A 229 ? 0.4154 0.3002 0.4669 0.0441  0.0589  -0.0036 229 SER A CA  
1689 C C   . SER A 229 ? 0.4124 0.2941 0.4650 0.0399  0.0511  0.0029  229 SER A C   
1690 O O   . SER A 229 ? 0.4705 0.3447 0.5326 0.0453  0.0521  0.0095  229 SER A O   
1691 C CB  . SER A 229 ? 0.4227 0.2912 0.4560 0.0404  0.0634  -0.0163 229 SER A CB  
1692 O OG  . SER A 229 ? 0.4922 0.3392 0.5233 0.0419  0.0669  -0.0196 229 SER A OG  
1693 N N   . ALA A 230 ? 0.3177 0.2054 0.3607 0.0310  0.0439  0.0016  230 ALA A N   
1694 C CA  . ALA A 230 ? 0.3007 0.1865 0.3415 0.0256  0.0377  0.0065  230 ALA A CA  
1695 C C   . ALA A 230 ? 0.3233 0.2105 0.3505 0.0165  0.0341  -0.0003 230 ALA A C   
1696 O O   . ALA A 230 ? 0.3528 0.2511 0.3762 0.0144  0.0320  -0.0033 230 ALA A O   
1697 C CB  . ALA A 230 ? 0.2688 0.1707 0.3190 0.0265  0.0312  0.0175  230 ALA A CB  
1698 N N   . THR A 231 ? 0.3608 0.2367 0.3821 0.0112  0.0337  -0.0021 231 THR A N   
1699 C CA  . THR A 231 ? 0.3579 0.2383 0.3695 0.0028  0.0302  -0.0072 231 THR A CA  
1700 C C   . THR A 231 ? 0.3333 0.2290 0.3456 -0.0001 0.0246  -0.0011 231 THR A C   
1701 O O   . THR A 231 ? 0.3518 0.2485 0.3680 -0.0001 0.0227  0.0073  231 THR A O   
1702 C CB  . THR A 231 ? 0.3897 0.2555 0.3966 -0.0037 0.0312  -0.0102 231 THR A CB  
1703 O OG1 . THR A 231 ? 0.4070 0.2574 0.4094 -0.0023 0.0363  -0.0189 231 THR A OG1 
1704 C CG2 . THR A 231 ? 0.3926 0.2685 0.3934 -0.0124 0.0271  -0.0134 231 THR A CG2 
1705 N N   . ILE A 232 ? 0.2942 0.2012 0.3020 -0.0021 0.0223  -0.0053 232 ILE A N   
1706 C CA  . ILE A 232 ? 0.3154 0.2352 0.3219 -0.0045 0.0182  -0.0021 232 ILE A CA  
1707 C C   . ILE A 232 ? 0.3267 0.2489 0.3285 -0.0109 0.0175  -0.0032 232 ILE A C   
1708 O O   . ILE A 232 ? 0.3456 0.2732 0.3465 -0.0136 0.0160  0.0021  232 ILE A O   
1709 C CB  . ILE A 232 ? 0.3046 0.2332 0.3095 -0.0028 0.0168  -0.0058 232 ILE A CB  
1710 C CG1 . ILE A 232 ? 0.3026 0.2317 0.3143 0.0021  0.0176  -0.0033 232 ILE A CG1 
1711 C CG2 . ILE A 232 ? 0.3149 0.2536 0.3164 -0.0053 0.0135  -0.0049 232 ILE A CG2 
1712 C CD1 . ILE A 232 ? 0.2643 0.2013 0.2759 0.0023  0.0156  -0.0049 232 ILE A CD1 
1713 N N   . GLY A 233 ? 0.2983 0.2183 0.2973 -0.0138 0.0185  -0.0096 233 GLY A N   
1714 C CA  . GLY A 233 ? 0.2961 0.2210 0.2937 -0.0206 0.0178  -0.0104 233 GLY A CA  
1715 C C   . GLY A 233 ? 0.2772 0.2063 0.2725 -0.0228 0.0169  -0.0176 233 GLY A C   
1716 O O   . GLY A 233 ? 0.3107 0.2398 0.3036 -0.0186 0.0166  -0.0214 233 GLY A O   
1717 N N   . HIS A 234 ? 0.1882 0.1225 0.1847 -0.0299 0.0161  -0.0183 234 HIS A N   
1718 C CA  . HIS A 234 ? 0.2375 0.1792 0.2331 -0.0329 0.0136  -0.0240 234 HIS A CA  
1719 C C   . HIS A 234 ? 0.2936 0.2551 0.2945 -0.0347 0.0125  -0.0224 234 HIS A C   
1720 O O   . HIS A 234 ? 0.3496 0.3170 0.3536 -0.0366 0.0144  -0.0177 234 HIS A O   
1721 C CB  . HIS A 234 ? 0.2595 0.1902 0.2530 -0.0411 0.0131  -0.0279 234 HIS A CB  
1722 C CG  . HIS A 234 ? 0.3369 0.2669 0.3354 -0.0498 0.0138  -0.0238 234 HIS A CG  
1723 N ND1 . HIS A 234 ? 0.3713 0.2846 0.3701 -0.0511 0.0167  -0.0194 234 HIS A ND1 
1724 C CD2 . HIS A 234 ? 0.3091 0.2539 0.3135 -0.0577 0.0123  -0.0223 234 HIS A CD2 
1725 C CE1 . HIS A 234 ? 0.3340 0.2501 0.3373 -0.0602 0.0170  -0.0150 234 HIS A CE1 
1726 N NE2 . HIS A 234 ? 0.2819 0.2180 0.2890 -0.0647 0.0146  -0.0170 234 HIS A NE2 
1727 N N   . LEU A 235 ? 0.2726 0.2451 0.2743 -0.0333 0.0096  -0.0257 235 LEU A N   
1728 C CA  . LEU A 235 ? 0.2448 0.2378 0.2540 -0.0331 0.0089  -0.0242 235 LEU A CA  
1729 C C   . LEU A 235 ? 0.2111 0.2151 0.2246 -0.0403 0.0046  -0.0263 235 LEU A C   
1730 O O   . LEU A 235 ? 0.2199 0.2188 0.2277 -0.0413 0.0008  -0.0302 235 LEU A O   
1731 C CB  . LEU A 235 ? 0.2362 0.2346 0.2451 -0.0229 0.0091  -0.0245 235 LEU A CB  
1732 C CG  . LEU A 235 ? 0.2547 0.2442 0.2595 -0.0170 0.0121  -0.0234 235 LEU A CG  
1733 C CD1 . LEU A 235 ? 0.1544 0.1429 0.1575 -0.0088 0.0114  -0.0247 235 LEU A CD1 
1734 C CD2 . LEU A 235 ? 0.3358 0.3336 0.3429 -0.0177 0.0157  -0.0210 235 LEU A CD2 
1735 N N   . ARG A 236 ? 0.2104 0.2311 0.2338 -0.0458 0.0050  -0.0236 236 ARG A N   
1736 C CA  . ARG A 236 ? 0.1848 0.2206 0.2151 -0.0539 -0.0001 -0.0248 236 ARG A CA  
1737 C C   . ARG A 236 ? 0.1918 0.2555 0.2367 -0.0518 0.0009  -0.0207 236 ARG A C   
1738 O O   . ARG A 236 ? 0.1757 0.2502 0.2293 -0.0591 0.0037  -0.0174 236 ARG A O   
1739 C CB  . ARG A 236 ? 0.1936 0.2194 0.2233 -0.0677 -0.0009 -0.0260 236 ARG A CB  
1740 C CG  . ARG A 236 ? 0.2543 0.2955 0.2910 -0.0793 -0.0074 -0.0280 236 ARG A CG  
1741 C CD  . ARG A 236 ? 0.2423 0.2859 0.2719 -0.0766 -0.0145 -0.0330 236 ARG A CD  
1742 N NE  . ARG A 236 ? 0.2315 0.2826 0.2623 -0.0905 -0.0220 -0.0370 236 ARG A NE  
1743 C CZ  . ARG A 236 ? 0.2468 0.3269 0.2895 -0.0940 -0.0286 -0.0346 236 ARG A CZ  
1744 N NH1 . ARG A 236 ? 0.2101 0.3133 0.2653 -0.0831 -0.0275 -0.0283 236 ARG A NH1 
1745 N NH2 . ARG A 236 ? 0.2325 0.3187 0.2752 -0.1085 -0.0365 -0.0389 236 ARG A NH2 
1746 N N   . PRO A 237 ? 0.2183 0.2935 0.2666 -0.0411 -0.0004 -0.0203 237 PRO A N   
1747 C CA  . PRO A 237 ? 0.1698 0.2737 0.2346 -0.0382 0.0003  -0.0167 237 PRO A CA  
1748 C C   . PRO A 237 ? 0.1677 0.2906 0.2419 -0.0472 -0.0078 -0.0161 237 PRO A C   
1749 O O   . PRO A 237 ? 0.1765 0.2879 0.2425 -0.0577 -0.0131 -0.0196 237 PRO A O   
1750 C CB  . PRO A 237 ? 0.2013 0.3056 0.2655 -0.0229 0.0014  -0.0164 237 PRO A CB  
1751 C CG  . PRO A 237 ? 0.2911 0.3735 0.3404 -0.0213 -0.0025 -0.0193 237 PRO A CG  
1752 C CD  . PRO A 237 ? 0.3084 0.3709 0.3473 -0.0304 -0.0011 -0.0220 237 PRO A CD  
1753 N N   . GLY A 238 ? 0.1643 0.3162 0.2557 -0.0431 -0.0086 -0.0119 238 GLY A N   
1754 C CA  . GLY A 238 ? 0.1733 0.3497 0.2775 -0.0526 -0.0169 -0.0100 238 GLY A CA  
1755 C C   . GLY A 238 ? 0.2252 0.3960 0.3189 -0.0565 -0.0278 -0.0130 238 GLY A C   
1756 O O   . GLY A 238 ? 0.2570 0.4334 0.3512 -0.0712 -0.0349 -0.0152 238 GLY A O   
1757 N N   . CYS A 239 ? 0.2255 0.3845 0.3084 -0.0445 -0.0290 -0.0133 239 CYS A N   
1758 C CA  . CYS A 239 ? 0.2564 0.4155 0.3294 -0.0465 -0.0391 -0.0144 239 CYS A CA  
1759 C C   . CYS A 239 ? 0.3097 0.4381 0.3602 -0.0416 -0.0374 -0.0185 239 CYS A C   
1760 O O   . CYS A 239 ? 0.3757 0.5036 0.4162 -0.0393 -0.0438 -0.0181 239 CYS A O   
1761 C CB  . CYS A 239 ? 0.2593 0.4462 0.3467 -0.0360 -0.0445 -0.0067 239 CYS A CB  
1762 S SG  . CYS A 239 ? 0.3215 0.5509 0.4398 -0.0400 -0.0463 -0.0005 239 CYS A SG  
1763 N N   . HIS A 240 ? 0.2651 0.3701 0.3082 -0.0401 -0.0288 -0.0217 240 HIS A N   
1764 C CA  . HIS A 240 ? 0.2560 0.3342 0.2809 -0.0357 -0.0262 -0.0251 240 HIS A CA  
1765 C C   . HIS A 240 ? 0.2942 0.3499 0.3119 -0.0419 -0.0201 -0.0297 240 HIS A C   
1766 O O   . HIS A 240 ? 0.3215 0.3810 0.3480 -0.0472 -0.0168 -0.0289 240 HIS A O   
1767 C CB  . HIS A 240 ? 0.1941 0.2686 0.2201 -0.0208 -0.0219 -0.0209 240 HIS A CB  
1768 C CG  . HIS A 240 ? 0.2027 0.2949 0.2352 -0.0126 -0.0274 -0.0149 240 HIS A CG  
1769 N ND1 . HIS A 240 ? 0.1822 0.2994 0.2336 -0.0082 -0.0284 -0.0099 240 HIS A ND1 
1770 C CD2 . HIS A 240 ? 0.2129 0.3021 0.2361 -0.0076 -0.0319 -0.0120 240 HIS A CD2 
1771 C CE1 . HIS A 240 ? 0.2332 0.3614 0.2877 0.0000  -0.0339 -0.0038 240 HIS A CE1 
1772 N NE2 . HIS A 240 ? 0.2482 0.3594 0.2848 0.0001  -0.0363 -0.0046 240 HIS A NE2 
1773 N N   . ALA A 241 ? 0.1916 0.2250 0.1939 -0.0406 -0.0183 -0.0337 241 ALA A N   
1774 C CA  . ALA A 241 ? 0.2188 0.2302 0.2154 -0.0436 -0.0124 -0.0369 241 ALA A CA  
1775 C C   . ALA A 241 ? 0.2767 0.2708 0.2629 -0.0350 -0.0083 -0.0375 241 ALA A C   
1776 O O   . ALA A 241 ? 0.3089 0.3030 0.2870 -0.0312 -0.0106 -0.0379 241 ALA A O   
1777 C CB  . ALA A 241 ? 0.2371 0.2387 0.2273 -0.0563 -0.0147 -0.0431 241 ALA A CB  
1778 N N   . ALA A 242 ? 0.2732 0.2542 0.2602 -0.0324 -0.0024 -0.0366 242 ALA A N   
1779 C CA  . ALA A 242 ? 0.2776 0.2449 0.2582 -0.0251 0.0015  -0.0364 242 ALA A CA  
1780 C C   . ALA A 242 ? 0.3205 0.2720 0.3010 -0.0259 0.0065  -0.0366 242 ALA A C   
1781 O O   . ALA A 242 ? 0.3333 0.2853 0.3197 -0.0301 0.0074  -0.0346 242 ALA A O   
1782 C CB  . ALA A 242 ? 0.3084 0.2830 0.2938 -0.0163 0.0023  -0.0318 242 ALA A CB  
1783 N N   . ASN A 243 ? 0.3784 0.3171 0.3530 -0.0216 0.0099  -0.0379 243 ASN A N   
1784 C CA  . ASN A 243 ? 0.3878 0.3133 0.3645 -0.0200 0.0144  -0.0364 243 ASN A CA  
1785 C C   . ASN A 243 ? 0.3613 0.2858 0.3398 -0.0122 0.0171  -0.0330 243 ASN A C   
1786 O O   . ASN A 243 ? 0.3293 0.2536 0.3029 -0.0087 0.0181  -0.0342 243 ASN A O   
1787 C CB  . ASN A 243 ? 0.3998 0.3091 0.3699 -0.0233 0.0171  -0.0421 243 ASN A CB  
1788 C CG  . ASN A 243 ? 0.4302 0.3259 0.4055 -0.0213 0.0215  -0.0392 243 ASN A CG  
1789 O OD1 . ASN A 243 ? 0.5240 0.4232 0.5067 -0.0219 0.0207  -0.0331 243 ASN A OD1 
1790 N ND2 . ASN A 243 ? 0.3904 0.2709 0.3614 -0.0184 0.0264  -0.0432 243 ASN A ND2 
1791 N N   . MET A 244 ? 0.3712 0.2961 0.3564 -0.0103 0.0180  -0.0282 244 MET A N   
1792 C CA  . MET A 244 ? 0.3621 0.2876 0.3505 -0.0047 0.0194  -0.0248 244 MET A CA  
1793 C C   . MET A 244 ? 0.3400 0.2565 0.3326 -0.0023 0.0228  -0.0223 244 MET A C   
1794 O O   . MET A 244 ? 0.1810 0.0935 0.1768 -0.0041 0.0227  -0.0194 244 MET A O   
1795 C CB  . MET A 244 ? 0.3430 0.2774 0.3350 -0.0043 0.0169  -0.0215 244 MET A CB  
1796 C CG  . MET A 244 ? 0.2855 0.2212 0.2803 -0.0006 0.0170  -0.0191 244 MET A CG  
1797 S SD  . MET A 244 ? 0.2282 0.1715 0.2230 -0.0009 0.0142  -0.0187 244 MET A SD  
1798 C CE  . MET A 244 ? 0.3237 0.2652 0.3214 0.0012  0.0140  -0.0171 244 MET A CE  
1799 N N   . GLU A 245 ? 0.2297 0.1439 0.2231 0.0022  0.0261  -0.0224 245 GLU A N   
1800 C CA  . GLU A 245 ? 0.3254 0.2331 0.3254 0.0064  0.0303  -0.0197 245 GLU A CA  
1801 C C   . GLU A 245 ? 0.3461 0.2618 0.3542 0.0106  0.0310  -0.0149 245 GLU A C   
1802 O O   . GLU A 245 ? 0.3054 0.2275 0.3116 0.0101  0.0301  -0.0153 245 GLU A O   
1803 C CB  . GLU A 245 ? 0.1991 0.0948 0.1931 0.0079  0.0360  -0.0259 245 GLU A CB  
1804 C CG  . GLU A 245 ? 0.3388 0.2233 0.3272 0.0027  0.0353  -0.0304 245 GLU A CG  
1805 C CD  . GLU A 245 ? 0.4106 0.2836 0.3879 0.0019  0.0397  -0.0396 245 GLU A CD  
1806 O OE1 . GLU A 245 ? 0.5023 0.3814 0.4705 0.0007  0.0389  -0.0435 245 GLU A OE1 
1807 O OE2 . GLU A 245 ? 0.3652 0.2221 0.3420 0.0023  0.0438  -0.0429 245 GLU A OE2 
1808 N N   . CYS A 246 ? 0.4025 0.3183 0.4210 0.0144  0.0325  -0.0095 246 CYS A N   
1809 C CA  . CYS A 246 ? 0.1744 0.1002 0.2036 0.0177  0.0330  -0.0042 246 CYS A CA  
1810 C C   . CYS A 246 ? 0.2549 0.1773 0.2912 0.0245  0.0410  -0.0039 246 CYS A C   
1811 O O   . CYS A 246 ? 0.2854 0.1991 0.3257 0.0286  0.0439  -0.0028 246 CYS A O   
1812 C CB  . CYS A 246 ? 0.2096 0.1437 0.2472 0.0167  0.0270  0.0032  246 CYS A CB  
1813 S SG  . CYS A 246 ? 0.2289 0.1786 0.2825 0.0189  0.0258  0.0105  246 CYS A SG  
1814 N N   . TRP A 247 ? 0.2699 0.1982 0.3075 0.0261  0.0453  -0.0047 247 TRP A N   
1815 C CA  . TRP A 247 ? 0.3020 0.2303 0.3470 0.0332  0.0546  -0.0044 247 TRP A CA  
1816 C C   . TRP A 247 ? 0.3119 0.2574 0.3746 0.0349  0.0542  0.0040  247 TRP A C   
1817 O O   . TRP A 247 ? 0.2945 0.2489 0.3570 0.0298  0.0510  0.0056  247 TRP A O   
1818 C CB  . TRP A 247 ? 0.2851 0.2080 0.3162 0.0331  0.0614  -0.0117 247 TRP A CB  
1819 C CG  . TRP A 247 ? 0.2905 0.1995 0.3039 0.0293  0.0598  -0.0201 247 TRP A CG  
1820 C CD1 . TRP A 247 ? 0.3095 0.2190 0.3123 0.0226  0.0527  -0.0223 247 TRP A CD1 
1821 C CD2 . TRP A 247 ? 0.3606 0.2537 0.3661 0.0316  0.0652  -0.0275 247 TRP A CD2 
1822 N NE1 . TRP A 247 ? 0.3149 0.2128 0.3049 0.0199  0.0526  -0.0299 247 TRP A NE1 
1823 C CE2 . TRP A 247 ? 0.3561 0.2425 0.3464 0.0244  0.0600  -0.0338 247 TRP A CE2 
1824 C CE3 . TRP A 247 ? 0.4265 0.3101 0.4370 0.0391  0.0742  -0.0298 247 TRP A CE3 
1825 C CZ2 . TRP A 247 ? 0.3736 0.2436 0.3525 0.0226  0.0626  -0.0427 247 TRP A CZ2 
1826 C CZ3 . TRP A 247 ? 0.4433 0.3075 0.4414 0.0384  0.0777  -0.0393 247 TRP A CZ3 
1827 C CH2 . TRP A 247 ? 0.4027 0.2603 0.3847 0.0292  0.0714  -0.0459 247 TRP A CH2 
1828 N N   . SER A 248 ? 0.3106 0.2610 0.3898 0.0420  0.0572  0.0098  248 SER A N   
1829 C CA  . SER A 248 ? 0.2873 0.2579 0.3860 0.0424  0.0548  0.0189  248 SER A CA  
1830 C C   . SER A 248 ? 0.2955 0.2744 0.4144 0.0529  0.0627  0.0247  248 SER A C   
1831 O O   . SER A 248 ? 0.2521 0.2189 0.3721 0.0610  0.0681  0.0233  248 SER A O   
1832 C CB  . SER A 248 ? 0.3235 0.3010 0.4257 0.0369  0.0425  0.0246  248 SER A CB  
1833 O OG  . SER A 248 ? 0.3615 0.3591 0.4795 0.0339  0.0380  0.0319  248 SER A OG  
1834 N N   . MET A 249 ? 0.1830 0.1826 0.3191 0.0526  0.0635  0.0314  249 MET A N   
1835 C CA  . MET A 249 ? 0.2042 0.2185 0.3647 0.0625  0.0699  0.0390  249 MET A CA  
1836 C C   . MET A 249 ? 0.2136 0.2447 0.3927 0.0618  0.0586  0.0504  249 MET A C   
1837 O O   . MET A 249 ? 0.1848 0.2328 0.3880 0.0697  0.0611  0.0593  249 MET A O   
1838 C CB  . MET A 249 ? 0.2414 0.2723 0.4120 0.0620  0.0785  0.0406  249 MET A CB  
1839 C CG  . MET A 249 ? 0.2666 0.2840 0.4190 0.0638  0.0909  0.0309  249 MET A CG  
1840 S SD  . MET A 249 ? 0.3485 0.3530 0.5012 0.0795  0.1073  0.0249  249 MET A SD  
1841 C CE  . MET A 249 ? 0.2781 0.3062 0.4685 0.0906  0.1092  0.0382  249 MET A CE  
1842 N N   . LEU A 250 ? 0.2800 0.3074 0.4473 0.0525  0.0462  0.0501  250 LEU A N   
1843 C CA  . LEU A 250 ? 0.2935 0.3385 0.4732 0.0485  0.0336  0.0599  250 LEU A CA  
1844 C C   . LEU A 250 ? 0.2661 0.2995 0.4363 0.0494  0.0264  0.0621  250 LEU A C   
1845 O O   . LEU A 250 ? 0.2663 0.3059 0.4308 0.0411  0.0147  0.0649  250 LEU A O   
1846 C CB  . LEU A 250 ? 0.2924 0.3463 0.4661 0.0346  0.0251  0.0578  250 LEU A CB  
1847 C CG  . LEU A 250 ? 0.2986 0.3638 0.4816 0.0315  0.0316  0.0572  250 LEU A CG  
1848 C CD1 . LEU A 250 ? 0.2761 0.3381 0.4457 0.0178  0.0250  0.0520  250 LEU A CD1 
1849 C CD2 . LEU A 250 ? 0.1588 0.2525 0.3724 0.0345  0.0312  0.0686  250 LEU A CD2 
1850 N N   . MET A 251 ? 0.2898 0.3056 0.4575 0.0589  0.0338  0.0608  251 MET A N   
1851 C CA  . MET A 251 ? 0.3281 0.3309 0.4869 0.0593  0.0282  0.0639  251 MET A CA  
1852 C C   . MET A 251 ? 0.4514 0.4651 0.6307 0.0682  0.0243  0.0786  251 MET A C   
1853 O O   . MET A 251 ? 0.4564 0.4860 0.6588 0.0767  0.0283  0.0854  251 MET A O   
1854 C CB  . MET A 251 ? 0.2857 0.2604 0.4290 0.0625  0.0371  0.0543  251 MET A CB  
1855 C CG  . MET A 251 ? 0.1940 0.1583 0.3152 0.0533  0.0382  0.0415  251 MET A CG  
1856 S SD  . MET A 251 ? 0.3713 0.3076 0.4719 0.0508  0.0402  0.0335  251 MET A SD  
1857 C CE  . MET A 251 ? 0.2351 0.1697 0.3156 0.0404  0.0390  0.0217  251 MET A CE  
1858 N N   . SER A 252 ? 0.5451 0.5516 0.7160 0.0661  0.0167  0.0843  252 SER A N   
1859 C CA  . SER A 252 ? 0.5460 0.5597 0.7328 0.0743  0.0117  0.1000  252 SER A CA  
1860 C C   . SER A 252 ? 0.5400 0.5866 0.7438 0.0719  0.0003  0.1119  252 SER A C   
1861 O O   . SER A 252 ? 0.5448 0.6088 0.7536 0.0656  -0.0015 0.1080  252 SER A O   
1862 C CB  . SER A 252 ? 0.5729 0.5750 0.7764 0.0903  0.0239  0.1027  252 SER A CB  
1863 O OG  . SER A 252 ? 0.6356 0.6537 0.8573 0.0961  0.0313  0.1009  252 SER A OG  
1864 N N   . ALA B 3   ? 0.5690 0.5217 0.3218 -0.0068 0.0432  -0.0275 487 ALA B N   
1865 C CA  . ALA B 3   ? 0.5815 0.5456 0.3143 -0.0084 0.0372  -0.0168 487 ALA B CA  
1866 C C   . ALA B 3   ? 0.5377 0.5067 0.2877 -0.0035 0.0347  0.0020  487 ALA B C   
1867 O O   . ALA B 3   ? 0.5972 0.5688 0.3382 -0.0019 0.0408  0.0132  487 ALA B O   
1868 C CB  . ALA B 3   ? 0.6042 0.5763 0.3243 -0.0147 0.0222  -0.0214 487 ALA B CB  
1869 N N   . ARG B 4   ? 0.4347 0.4040 0.2090 -0.0014 0.0263  0.0054  488 ARG B N   
1870 C CA  . ARG B 4   ? 0.4239 0.3943 0.2151 0.0035  0.0239  0.0214  488 ARG B CA  
1871 C C   . ARG B 4   ? 0.3468 0.3095 0.1672 0.0064  0.0261  0.0194  488 ARG B C   
1872 O O   . ARG B 4   ? 0.3400 0.3018 0.1711 0.0055  0.0217  0.0100  488 ARG B O   
1873 C CB  . ARG B 4   ? 0.5291 0.5103 0.3181 0.0044  0.0098  0.0308  488 ARG B CB  
1874 C CG  . ARG B 4   ? 0.5469 0.5264 0.3505 0.0104  0.0078  0.0478  488 ARG B CG  
1875 C CD  . ARG B 4   ? 0.5600 0.5512 0.3532 0.0123  -0.0036 0.0607  488 ARG B CD  
1876 N NE  . ARG B 4   ? 0.5821 0.5698 0.3954 0.0196  -0.0074 0.0745  488 ARG B NE  
1877 C CZ  . ARG B 4   ? 0.5802 0.5713 0.4134 0.0239  -0.0152 0.0735  488 ARG B CZ  
1878 N NH1 . ARG B 4   ? 0.5646 0.5643 0.4010 0.0206  -0.0205 0.0606  488 ARG B NH1 
1879 N NH2 . ARG B 4   ? 0.5995 0.5846 0.4494 0.0315  -0.0170 0.0854  488 ARG B NH2 
1880 N N   . TYR B 5   ? 0.3428 0.3004 0.1751 0.0090  0.0327  0.0287  489 TYR B N   
1881 C CA  . TYR B 5   ? 0.3716 0.3221 0.2289 0.0108  0.0348  0.0270  489 TYR B CA  
1882 C C   . TYR B 5   ? 0.3738 0.3202 0.2443 0.0135  0.0325  0.0400  489 TYR B C   
1883 O O   . TYR B 5   ? 0.3170 0.2642 0.1783 0.0143  0.0321  0.0522  489 TYR B O   
1884 C CB  . TYR B 5   ? 0.4307 0.3776 0.2927 0.0098  0.0469  0.0218  489 TYR B CB  
1885 C CG  . TYR B 5   ? 0.4758 0.4233 0.3231 0.0083  0.0520  0.0093  489 TYR B CG  
1886 C CD1 . TYR B 5   ? 0.5034 0.4476 0.3558 0.0075  0.0488  -0.0029 489 TYR B CD1 
1887 C CD2 . TYR B 5   ? 0.4916 0.4416 0.3193 0.0075  0.0609  0.0094  489 TYR B CD2 
1888 C CE1 . TYR B 5   ? 0.5115 0.4523 0.3505 0.0060  0.0539  -0.0150 489 TYR B CE1 
1889 C CE2 . TYR B 5   ? 0.5157 0.4635 0.3287 0.0065  0.0666  -0.0038 489 TYR B CE2 
1890 C CZ  . TYR B 5   ? 0.5355 0.4774 0.3546 0.0058  0.0629  -0.0162 489 TYR B CZ  
1891 O OH  . TYR B 5   ? 0.5811 0.5170 0.3854 0.0048  0.0690  -0.0300 489 TYR B OH  
1892 N N   . GLY B 6   ? 0.3619 0.3025 0.2529 0.0148  0.0311  0.0374  490 GLY B N   
1893 C CA  . GLY B 6   ? 0.3617 0.2943 0.2660 0.0167  0.0299  0.0468  490 GLY B CA  
1894 C C   . GLY B 6   ? 0.3451 0.2714 0.2659 0.0142  0.0354  0.0433  490 GLY B C   
1895 O O   . GLY B 6   ? 0.2864 0.2145 0.2141 0.0133  0.0360  0.0330  490 GLY B O   
1896 N N   . VAL B 7   ? 0.3912 0.3103 0.3185 0.0124  0.0390  0.0525  491 VAL B N   
1897 C CA  . VAL B 7   ? 0.3823 0.2969 0.3259 0.0085  0.0429  0.0503  491 VAL B CA  
1898 C C   . VAL B 7   ? 0.4005 0.3019 0.3552 0.0085  0.0389  0.0547  491 VAL B C   
1899 O O   . VAL B 7   ? 0.2822 0.1758 0.2333 0.0095  0.0383  0.0654  491 VAL B O   
1900 C CB  . VAL B 7   ? 0.3932 0.3122 0.3368 0.0039  0.0526  0.0561  491 VAL B CB  
1901 C CG1 . VAL B 7   ? 0.3999 0.3174 0.3629 -0.0011 0.0550  0.0547  491 VAL B CG1 
1902 C CG2 . VAL B 7   ? 0.4223 0.3523 0.3542 0.0050  0.0583  0.0500  491 VAL B CG2 
1903 N N   . SER B 8   ? 0.4318 0.3297 0.3987 0.0074  0.0362  0.0464  492 SER B N   
1904 C CA  . SER B 8   ? 0.4526 0.3360 0.4284 0.0071  0.0329  0.0473  492 SER B CA  
1905 C C   . SER B 8   ? 0.4807 0.3546 0.4625 0.0005  0.0369  0.0559  492 SER B C   
1906 O O   . SER B 8   ? 0.4693 0.3505 0.4567 -0.0059 0.0417  0.0565  492 SER B O   
1907 C CB  . SER B 8   ? 0.4082 0.2918 0.3931 0.0059  0.0299  0.0357  492 SER B CB  
1908 O OG  . SER B 8   ? 0.3905 0.2775 0.3843 -0.0014 0.0328  0.0340  492 SER B OG  
1909 N N   . ASN B 9   ? 0.5326 0.3903 0.5148 0.0019  0.0353  0.0630  493 ASN B N   
1910 C CA  . ASN B 9   ? 0.6107 0.4560 0.5997 -0.0060 0.0387  0.0711  493 ASN B CA  
1911 C C   . ASN B 9   ? 0.6054 0.4452 0.6072 -0.0135 0.0372  0.0619  493 ASN B C   
1912 O O   . ASN B 9   ? 0.6687 0.5083 0.6789 -0.0234 0.0403  0.0655  493 ASN B O   
1913 C CB  . ASN B 9   ? 0.7071 0.5331 0.6932 -0.0018 0.0373  0.0814  493 ASN B CB  
1914 C CG  . ASN B 9   ? 0.7741 0.5936 0.7591 0.0087  0.0316  0.0756  493 ASN B CG  
1915 O OD1 . ASN B 9   ? 0.7792 0.5977 0.7696 0.0094  0.0291  0.0629  493 ASN B OD1 
1916 N ND2 . ASN B 9   ? 0.7999 0.6167 0.7780 0.0171  0.0298  0.0857  493 ASN B ND2 
1917 N N   . THR B 10  ? 0.5375 0.3746 0.5403 -0.0094 0.0324  0.0503  494 THR B N   
1918 C CA  . THR B 10  ? 0.5451 0.3797 0.5564 -0.0162 0.0298  0.0401  494 THR B CA  
1919 C C   . THR B 10  ? 0.5274 0.3833 0.5438 -0.0208 0.0310  0.0369  494 THR B C   
1920 O O   . THR B 10  ? 0.5496 0.4201 0.5610 -0.0153 0.0324  0.0362  494 THR B O   
1921 C CB  . THR B 10  ? 0.5457 0.3740 0.5541 -0.0096 0.0254  0.0289  494 THR B CB  
1922 O OG1 . THR B 10  ? 0.5827 0.3902 0.5889 -0.0042 0.0251  0.0317  494 THR B OG1 
1923 C CG2 . THR B 10  ? 0.5680 0.3956 0.5815 -0.0170 0.0223  0.0181  494 THR B CG2 
1924 N N   . SER B 11  ? 0.4706 0.3281 0.4976 -0.0309 0.0302  0.0352  495 SER B N   
1925 C CA  . SER B 11  ? 0.4128 0.2911 0.4478 -0.0343 0.0305  0.0326  495 SER B CA  
1926 C C   . SER B 11  ? 0.4077 0.2855 0.4522 -0.0439 0.0250  0.0265  495 SER B C   
1927 O O   . SER B 11  ? 0.4275 0.2880 0.4727 -0.0503 0.0223  0.0247  495 SER B O   
1928 C CB  . SER B 11  ? 0.3523 0.2441 0.3930 -0.0372 0.0377  0.0428  495 SER B CB  
1929 O OG  . SER B 11  ? 0.4147 0.3013 0.4655 -0.0481 0.0390  0.0495  495 SER B OG  
1930 N N   . ILE B 12  ? 0.3553 0.2518 0.4067 -0.0449 0.0232  0.0233  496 ILE B N   
1931 C CA  . ILE B 12  ? 0.3754 0.2762 0.4352 -0.0541 0.0166  0.0181  496 ILE B CA  
1932 C C   . ILE B 12  ? 0.3864 0.3090 0.4637 -0.0610 0.0180  0.0250  496 ILE B C   
1933 O O   . ILE B 12  ? 0.4004 0.3401 0.4822 -0.0546 0.0225  0.0287  496 ILE B O   
1934 C CB  . ILE B 12  ? 0.3669 0.2718 0.4198 -0.0491 0.0114  0.0089  496 ILE B CB  
1935 C CG1 . ILE B 12  ? 0.3855 0.2723 0.4235 -0.0416 0.0112  0.0025  496 ILE B CG1 
1936 C CG2 . ILE B 12  ? 0.3401 0.2503 0.3988 -0.0592 0.0036  0.0039  496 ILE B CG2 
1937 C CD1 . ILE B 12  ? 0.3652 0.2578 0.3958 -0.0357 0.0083  -0.0050 496 ILE B CD1 
1938 N N   . ASN B 13  ? 0.4054 0.3275 0.4934 -0.0741 0.0143  0.0265  497 ASN B N   
1939 C CA  . ASN B 13  ? 0.4446 0.3897 0.5528 -0.0818 0.0157  0.0345  497 ASN B CA  
1940 C C   . ASN B 13  ? 0.4269 0.3852 0.5461 -0.0916 0.0057  0.0306  497 ASN B C   
1941 O O   . ASN B 13  ? 0.4351 0.3789 0.5488 -0.1009 -0.0018 0.0234  497 ASN B O   
1942 C CB  . ASN B 13  ? 0.5142 0.4526 0.6298 -0.0911 0.0208  0.0434  497 ASN B CB  
1943 C CG  . ASN B 13  ? 0.5789 0.5281 0.6969 -0.0842 0.0324  0.0538  497 ASN B CG  
1944 O OD1 . ASN B 13  ? 0.6265 0.5623 0.7292 -0.0756 0.0375  0.0550  497 ASN B OD1 
1945 N ND2 . ASN B 13  ? 0.6088 0.5838 0.7460 -0.0880 0.0366  0.0613  497 ASN B ND2 
1946 N N   . ARG B 14  ? 0.3990 0.3847 0.5332 -0.0892 0.0057  0.0354  498 ARG B N   
1947 C CA  . ARG B 14  ? 0.4287 0.4335 0.5773 -0.0991 -0.0042 0.0352  498 ARG B CA  
1948 C C   . ARG B 14  ? 0.3768 0.4070 0.5520 -0.1067 -0.0010 0.0465  498 ARG B C   
1949 O O   . ARG B 14  ? 0.3206 0.3656 0.5053 -0.0976 0.0090  0.0542  498 ARG B O   
1950 C CB  . ARG B 14  ? 0.4650 0.4832 0.6115 -0.0897 -0.0086 0.0326  498 ARG B CB  
1951 C CG  . ARG B 14  ? 0.5426 0.5433 0.6676 -0.0887 -0.0161 0.0212  498 ARG B CG  
1952 C CD  . ARG B 14  ? 0.5858 0.5784 0.7077 -0.1045 -0.0262 0.0145  498 ARG B CD  
1953 N NE  . ARG B 14  ? 0.5803 0.5418 0.6869 -0.1072 -0.0233 0.0075  498 ARG B NE  
1954 C CZ  . ARG B 14  ? 0.5725 0.5199 0.6775 -0.1215 -0.0286 0.0023  498 ARG B CZ  
1955 N NH1 . ARG B 14  ? 0.5376 0.5012 0.6550 -0.1360 -0.0379 0.0030  498 ARG B NH1 
1956 N NH2 . ARG B 14  ? 0.5756 0.4924 0.6673 -0.1215 -0.0249 -0.0034 498 ARG B NH2 
1957 N N   . LYS B 15  ? 0.3636 0.3991 0.5506 -0.1236 -0.0090 0.0471  499 LYS B N   
1958 C CA  . LYS B 15  ? 0.4015 0.4649 0.6172 -0.1330 -0.0072 0.0584  499 LYS B CA  
1959 C C   . LYS B 15  ? 0.4657 0.5481 0.6957 -0.1477 -0.0217 0.0572  499 LYS B C   
1960 O O   . LYS B 15  ? 0.5208 0.5876 0.7355 -0.1550 -0.0327 0.0466  499 LYS B O   
1961 C CB  . LYS B 15  ? 0.3841 0.4340 0.6027 -0.1428 0.0003  0.0639  499 LYS B CB  
1962 C CG  . LYS B 15  ? 0.4092 0.4514 0.6196 -0.1296 0.0155  0.0695  499 LYS B CG  
1963 C CD  . LYS B 15  ? 0.4749 0.5126 0.6930 -0.1401 0.0235  0.0791  499 LYS B CD  
1964 C CE  . LYS B 15  ? 0.4814 0.5423 0.7112 -0.1315 0.0381  0.0904  499 LYS B CE  
1965 N NZ  . LYS B 15  ? 0.4998 0.5578 0.7304 -0.1400 0.0454  0.0978  499 LYS B NZ  
1966 N N   . ALA C 16  ? 0.6314 0.6885 0.5035 0.0730  -0.1809 0.0472  16  ALA C N   
1967 C CA  . ALA C 16  ? 0.5790 0.6184 0.4636 0.0849  -0.1693 0.0443  16  ALA C CA  
1968 C C   . ALA C 16  ? 0.5755 0.6307 0.4814 0.0787  -0.1539 0.0309  16  ALA C C   
1969 O O   . ALA C 16  ? 0.5977 0.6352 0.5074 0.0817  -0.1412 0.0268  16  ALA C O   
1970 C CB  . ALA C 16  ? 0.5689 0.6130 0.4711 0.1097  -0.1801 0.0510  16  ALA C CB  
1971 N N   . ASP C 17  ? 0.5632 0.6506 0.4813 0.0688  -0.1556 0.0246  17  ASP C N   
1972 C CA  . ASP C 17  ? 0.5594 0.6639 0.4986 0.0631  -0.1429 0.0132  17  ASP C CA  
1973 C C   . ASP C 17  ? 0.5127 0.6080 0.4363 0.0415  -0.1320 0.0052  17  ASP C C   
1974 O O   . ASP C 17  ? 0.5103 0.5984 0.4403 0.0375  -0.1178 -0.0021 17  ASP C O   
1975 C CB  . ASP C 17  ? 0.5753 0.7249 0.5435 0.0674  -0.1513 0.0112  17  ASP C CB  
1976 C CG  . ASP C 17  ? 0.5649 0.7282 0.5620 0.0828  -0.1441 0.0071  17  ASP C CG  
1977 O OD1 . ASP C 17  ? 0.5653 0.7076 0.5607 0.0820  -0.1297 0.0019  17  ASP C OD1 
1978 O OD2 . ASP C 17  ? 0.5755 0.7721 0.5971 0.0958  -0.1528 0.0089  17  ASP C OD2 
1979 N N   . SER C 18  ? 0.4672 0.5613 0.3689 0.0282  -0.1389 0.0066  18  SER C N   
1980 C CA  . SER C 18  ? 0.4846 0.5678 0.3691 0.0088  -0.1287 -0.0020 18  SER C CA  
1981 C C   . SER C 18  ? 0.5341 0.5814 0.3955 0.0064  -0.1169 -0.0014 18  SER C C   
1982 O O   . SER C 18  ? 0.6217 0.6525 0.4650 0.0103  -0.1220 0.0071  18  SER C O   
1983 C CB  . SER C 18  ? 0.4904 0.5860 0.3580 -0.0058 -0.1400 -0.0024 18  SER C CB  
1984 O OG  . SER C 18  ? 0.5187 0.5901 0.3534 -0.0109 -0.1420 0.0024  18  SER C OG  
1985 N N   . ILE C 19  ? 0.4892 0.5257 0.3518 -0.0003 -0.1015 -0.0100 19  ILE C N   
1986 C CA  . ILE C 19  ? 0.4551 0.4636 0.2997 -0.0034 -0.0889 -0.0107 19  ILE C CA  
1987 C C   . ILE C 19  ? 0.4483 0.4483 0.2666 -0.0190 -0.0857 -0.0164 19  ILE C C   
1988 O O   . ILE C 19  ? 0.4721 0.4766 0.2915 -0.0287 -0.0812 -0.0257 19  ILE C O   
1989 C CB  . ILE C 19  ? 0.4060 0.4080 0.2666 -0.0004 -0.0745 -0.0163 19  ILE C CB  
1990 C CG1 . ILE C 19  ? 0.3545 0.3693 0.2412 0.0130  -0.0779 -0.0135 19  ILE C CG1 
1991 C CG2 . ILE C 19  ? 0.4148 0.3931 0.2620 -0.0005 -0.0632 -0.0147 19  ILE C CG2 
1992 C CD1 . ILE C 19  ? 0.3534 0.3650 0.2554 0.0149  -0.0657 -0.0187 19  ILE C CD1 
1993 N N   . ASP C 20  ? 0.4166 0.4032 0.2094 -0.0219 -0.0883 -0.0108 20  ASP C N   
1994 C CA  . ASP C 20  ? 0.4826 0.4605 0.2461 -0.0363 -0.0856 -0.0163 20  ASP C CA  
1995 C C   . ASP C 20  ? 0.4781 0.4348 0.2268 -0.0406 -0.0671 -0.0223 20  ASP C C   
1996 O O   . ASP C 20  ? 0.4700 0.4175 0.1933 -0.0515 -0.0623 -0.0285 20  ASP C O   
1997 C CB  . ASP C 20  ? 0.5967 0.5757 0.3371 -0.0395 -0.1001 -0.0073 20  ASP C CB  
1998 C CG  . ASP C 20  ? 0.7158 0.6901 0.4605 -0.0267 -0.1077 0.0064  20  ASP C CG  
1999 O OD1 . ASP C 20  ? 0.7380 0.7129 0.5071 -0.0147 -0.1044 0.0082  20  ASP C OD1 
2000 O OD2 . ASP C 20  ? 0.7732 0.7411 0.4946 -0.0292 -0.1173 0.0153  20  ASP C OD2 
2001 N N   . ASP C 21  ? 0.4580 0.4084 0.2231 -0.0319 -0.0568 -0.0210 21  ASP C N   
2002 C CA  . ASP C 21  ? 0.4547 0.3904 0.2118 -0.0340 -0.0393 -0.0263 21  ASP C CA  
2003 C C   . ASP C 21  ? 0.4885 0.4202 0.2402 -0.0415 -0.0310 -0.0394 21  ASP C C   
2004 O O   . ASP C 21  ? 0.3931 0.3309 0.1628 -0.0406 -0.0318 -0.0442 21  ASP C O   
2005 C CB  . ASP C 21  ? 0.4402 0.3744 0.2204 -0.0239 -0.0317 -0.0231 21  ASP C CB  
2006 C CG  . ASP C 21  ? 0.4749 0.3990 0.2503 -0.0248 -0.0148 -0.0269 21  ASP C CG  
2007 O OD1 . ASP C 21  ? 0.4528 0.3737 0.2312 -0.0260 -0.0049 -0.0365 21  ASP C OD1 
2008 O OD2 . ASP C 21  ? 0.5276 0.4474 0.2965 -0.0242 -0.0114 -0.0198 21  ASP C OD2 
2009 N N   . LYS C 22  ? 0.5121 0.4316 0.2370 -0.0493 -0.0228 -0.0454 22  LYS C N   
2010 C CA  . LYS C 22  ? 0.5294 0.4392 0.2418 -0.0573 -0.0156 -0.0588 22  LYS C CA  
2011 C C   . LYS C 22  ? 0.5018 0.4043 0.2330 -0.0510 -0.0028 -0.0654 22  LYS C C   
2012 O O   . LYS C 22  ? 0.5408 0.4366 0.2709 -0.0562 -0.0015 -0.0744 22  LYS C O   
2013 C CB  . LYS C 22  ? 0.6566 0.5529 0.3348 -0.0648 -0.0068 -0.0643 22  LYS C CB  
2014 C CG  . LYS C 22  ? 0.6819 0.5825 0.3345 -0.0743 -0.0203 -0.0591 22  LYS C CG  
2015 C CD  . LYS C 22  ? 0.7675 0.6561 0.3891 -0.0811 -0.0095 -0.0644 22  LYS C CD  
2016 C CE  . LYS C 22  ? 0.8373 0.7325 0.4407 -0.0889 -0.0235 -0.0571 22  LYS C CE  
2017 N NZ  . LYS C 22  ? 0.9391 0.8256 0.5190 -0.0940 -0.0123 -0.0613 22  LYS C NZ  
2018 N N   . LYS C 23  ? 0.4408 0.3437 0.1877 -0.0407 0.0060  -0.0605 23  LYS C N   
2019 C CA  . LYS C 23  ? 0.4561 0.3530 0.2207 -0.0337 0.0171  -0.0651 23  LYS C CA  
2020 C C   . LYS C 23  ? 0.4590 0.3663 0.2511 -0.0289 0.0097  -0.0606 23  LYS C C   
2021 O O   . LYS C 23  ? 0.3634 0.2650 0.1666 -0.0270 0.0147  -0.0652 23  LYS C O   
2022 C CB  . LYS C 23  ? 0.4659 0.3616 0.2349 -0.0259 0.0302  -0.0624 23  LYS C CB  
2023 C CG  . LYS C 23  ? 0.5452 0.4273 0.2955 -0.0266 0.0452  -0.0726 23  LYS C CG  
2024 C CD  . LYS C 23  ? 0.5895 0.4760 0.3272 -0.0268 0.0533  -0.0692 23  LYS C CD  
2025 C CE  . LYS C 23  ? 0.6622 0.5357 0.3726 -0.0304 0.0661  -0.0811 23  LYS C CE  
2026 N NZ  . LYS C 23  ? 0.7272 0.5879 0.4451 -0.0223 0.0779  -0.0915 23  LYS C NZ  
2027 N N   . TRP C 24  ? 0.4339 0.3550 0.2353 -0.0268 -0.0020 -0.0516 24  TRP C N   
2028 C CA  . TRP C 24  ? 0.3692 0.3024 0.1947 -0.0223 -0.0093 -0.0480 24  TRP C CA  
2029 C C   . TRP C 24  ? 0.3877 0.3239 0.2154 -0.0299 -0.0129 -0.0550 24  TRP C C   
2030 O O   . TRP C 24  ? 0.3221 0.2625 0.1678 -0.0277 -0.0117 -0.0557 24  TRP C O   
2031 C CB  . TRP C 24  ? 0.3512 0.2967 0.1813 -0.0184 -0.0221 -0.0386 24  TRP C CB  
2032 C CG  . TRP C 24  ? 0.3578 0.3182 0.2110 -0.0132 -0.0297 -0.0363 24  TRP C CG  
2033 C CD1 . TRP C 24  ? 0.3470 0.3235 0.2062 -0.0167 -0.0400 -0.0375 24  TRP C CD1 
2034 C CD2 . TRP C 24  ? 0.3225 0.2852 0.1957 -0.0041 -0.0270 -0.0327 24  TRP C CD2 
2035 N NE1 . TRP C 24  ? 0.3373 0.3270 0.2200 -0.0092 -0.0425 -0.0353 24  TRP C NE1 
2036 C CE2 . TRP C 24  ? 0.3096 0.2892 0.1994 -0.0016 -0.0347 -0.0326 24  TRP C CE2 
2037 C CE3 . TRP C 24  ? 0.3249 0.2786 0.2032 0.0014  -0.0189 -0.0298 24  TRP C CE3 
2038 C CZ2 . TRP C 24  ? 0.2824 0.2674 0.1912 0.0068  -0.0336 -0.0305 24  TRP C CZ2 
2039 C CZ3 . TRP C 24  ? 0.3092 0.2676 0.2057 0.0085  -0.0193 -0.0273 24  TRP C CZ3 
2040 C CH2 . TRP C 24  ? 0.2758 0.2483 0.1861 0.0113  -0.0262 -0.0281 24  TRP C CH2 
2041 N N   . SER C 25  ? 0.5236 0.4573 0.3311 -0.0405 -0.0173 -0.0602 25  SER C N   
2042 C CA  . SER C 25  ? 0.6164 0.5540 0.4229 -0.0514 -0.0226 -0.0666 25  SER C CA  
2043 C C   . SER C 25  ? 0.5960 0.5158 0.4029 -0.0542 -0.0117 -0.0745 25  SER C C   
2044 O O   . SER C 25  ? 0.5688 0.4925 0.3817 -0.0625 -0.0152 -0.0778 25  SER C O   
2045 C CB  . SER C 25  ? 0.7098 0.6453 0.4897 -0.0639 -0.0294 -0.0709 25  SER C CB  
2046 O OG  . SER C 25  ? 0.7459 0.6951 0.5223 -0.0611 -0.0402 -0.0624 25  SER C OG  
2047 N N   . LYS C 26  ? 0.6086 0.5094 0.4092 -0.0475 0.0013  -0.0770 26  LYS C N   
2048 C CA  . LYS C 26  ? 0.6037 0.4831 0.4018 -0.0478 0.0118  -0.0842 26  LYS C CA  
2049 C C   . LYS C 26  ? 0.5822 0.4671 0.4046 -0.0433 0.0120  -0.0798 26  LYS C C   
2050 O O   . LYS C 26  ? 0.6300 0.5043 0.4510 -0.0505 0.0128  -0.0842 26  LYS C O   
2051 C CB  . LYS C 26  ? 0.6035 0.4662 0.3923 -0.0386 0.0257  -0.0870 26  LYS C CB  
2052 C CG  . LYS C 26  ? 0.6315 0.4738 0.4243 -0.0326 0.0365  -0.0914 26  LYS C CG  
2053 C CD  . LYS C 26  ? 0.7103 0.5366 0.4901 -0.0244 0.0505  -0.0970 26  LYS C CD  
2054 C CE  . LYS C 26  ? 0.7687 0.5774 0.5571 -0.0140 0.0605  -0.0989 26  LYS C CE  
2055 N NZ  . LYS C 26  ? 0.8387 0.6270 0.6207 -0.0221 0.0575  -0.1038 26  LYS C NZ  
2056 N N   . LEU C 27  ? 0.5231 0.4228 0.3651 -0.0326 0.0110  -0.0712 27  LEU C N   
2057 C CA  . LEU C 27  ? 0.5180 0.4225 0.3809 -0.0276 0.0121  -0.0669 27  LEU C CA  
2058 C C   . LEU C 27  ? 0.4903 0.4192 0.3695 -0.0295 0.0019  -0.0622 27  LEU C C   
2059 O O   . LEU C 27  ? 0.4504 0.3846 0.3435 -0.0293 0.0022  -0.0603 27  LEU C O   
2060 C CB  . LEU C 27  ? 0.5078 0.4112 0.3813 -0.0148 0.0188  -0.0613 27  LEU C CB  
2061 C CG  . LEU C 27  ? 0.4804 0.3643 0.3489 -0.0089 0.0305  -0.0645 27  LEU C CG  
2062 C CD1 . LEU C 27  ? 0.4026 0.2941 0.2844 0.0023  0.0349  -0.0576 27  LEU C CD1 
2063 C CD2 . LEU C 27  ? 0.4898 0.3599 0.3609 -0.0112 0.0327  -0.0667 27  LEU C CD2 
2064 N N   . PHE C 28  ? 0.4992 0.4431 0.3761 -0.0305 -0.0069 -0.0600 28  PHE C N   
2065 C CA  . PHE C 28  ? 0.4503 0.4189 0.3448 -0.0280 -0.0162 -0.0551 28  PHE C CA  
2066 C C   . PHE C 28  ? 0.4896 0.4750 0.3808 -0.0379 -0.0268 -0.0572 28  PHE C C   
2067 O O   . PHE C 28  ? 0.5154 0.4926 0.3870 -0.0463 -0.0288 -0.0612 28  PHE C O   
2068 C CB  . PHE C 28  ? 0.4011 0.3748 0.3010 -0.0162 -0.0190 -0.0479 28  PHE C CB  
2069 C CG  . PHE C 28  ? 0.3466 0.3099 0.2532 -0.0077 -0.0106 -0.0448 28  PHE C CG  
2070 C CD1 . PHE C 28  ? 0.2419 0.2123 0.1656 -0.0027 -0.0097 -0.0425 28  PHE C CD1 
2071 C CD2 . PHE C 28  ? 0.2753 0.2239 0.1708 -0.0054 -0.0036 -0.0443 28  PHE C CD2 
2072 C CE1 . PHE C 28  ? 0.2523 0.2142 0.1810 0.0037  -0.0035 -0.0394 28  PHE C CE1 
2073 C CE2 . PHE C 28  ? 0.2549 0.1982 0.1585 0.0014  0.0030  -0.0409 28  PHE C CE2 
2074 C CZ  . PHE C 28  ? 0.2663 0.2157 0.1861 0.0056  0.0023  -0.0383 28  PHE C CZ  
2075 N N   . PRO C 29  ? 0.4406 0.4516 0.3512 -0.0370 -0.0336 -0.0547 29  PRO C N   
2076 C CA  . PRO C 29  ? 0.3868 0.4208 0.2984 -0.0440 -0.0456 -0.0548 29  PRO C CA  
2077 C C   . PRO C 29  ? 0.3439 0.3821 0.2496 -0.0354 -0.0541 -0.0490 29  PRO C C   
2078 O O   . PRO C 29  ? 0.3081 0.3397 0.2177 -0.0224 -0.0521 -0.0437 29  PRO C O   
2079 C CB  . PRO C 29  ? 0.3761 0.4388 0.3137 -0.0421 -0.0483 -0.0532 29  PRO C CB  
2080 C CG  . PRO C 29  ? 0.3818 0.4359 0.3299 -0.0294 -0.0400 -0.0504 29  PRO C CG  
2081 C CD  . PRO C 29  ? 0.4334 0.4550 0.3649 -0.0305 -0.0302 -0.0523 29  PRO C CD  
2082 N N   . ARG C 30  ? 0.3406 0.3877 0.2344 -0.0441 -0.0641 -0.0496 30  ARG C N   
2083 C CA  . ARG C 30  ? 0.3768 0.4245 0.2593 -0.0382 -0.0732 -0.0434 30  ARG C CA  
2084 C C   . ARG C 30  ? 0.3638 0.4345 0.2676 -0.0237 -0.0831 -0.0352 30  ARG C C   
2085 O O   . ARG C 30  ? 0.3434 0.4068 0.2407 -0.0135 -0.0877 -0.0280 30  ARG C O   
2086 C CB  . ARG C 30  ? 0.4352 0.4866 0.2972 -0.0533 -0.0821 -0.0466 30  ARG C CB  
2087 C CG  . ARG C 30  ? 0.4815 0.5418 0.3337 -0.0493 -0.0959 -0.0388 30  ARG C CG  
2088 C CD  . ARG C 30  ? 0.5300 0.5928 0.3590 -0.0669 -0.1042 -0.0431 30  ARG C CD  
2089 N NE  . ARG C 30  ? 0.5319 0.6137 0.3576 -0.0642 -0.1218 -0.0343 30  ARG C NE  
2090 C CZ  . ARG C 30  ? 0.5257 0.6425 0.3695 -0.0660 -0.1363 -0.0314 30  ARG C CZ  
2091 N NH1 . ARG C 30  ? 0.5358 0.6730 0.4017 -0.0724 -0.1343 -0.0369 30  ARG C NH1 
2092 N NH2 . ARG C 30  ? 0.5378 0.6705 0.3779 -0.0616 -0.1531 -0.0222 30  ARG C NH2 
2093 N N   . ILE C 31  ? 0.3912 0.4887 0.3195 -0.0226 -0.0856 -0.0364 31  ILE C N   
2094 C CA  . ILE C 31  ? 0.3611 0.4825 0.3124 -0.0067 -0.0933 -0.0303 31  ILE C CA  
2095 C C   . ILE C 31  ? 0.3500 0.4804 0.3240 -0.0011 -0.0838 -0.0333 31  ILE C C   
2096 O O   . ILE C 31  ? 0.3030 0.4399 0.2819 -0.0135 -0.0777 -0.0392 31  ILE C O   
2097 C CB  . ILE C 31  ? 0.3786 0.5355 0.3397 -0.0101 -0.1088 -0.0281 31  ILE C CB  
2098 C CG1 . ILE C 31  ? 0.4017 0.5499 0.3399 -0.0113 -0.1206 -0.0223 31  ILE C CG1 
2099 C CG2 . ILE C 31  ? 0.3657 0.5533 0.3573 0.0070  -0.1139 -0.0241 31  ILE C CG2 
2100 C CD1 . ILE C 31  ? 0.3357 0.5163 0.2774 -0.0204 -0.1363 -0.0210 31  ILE C CD1 
2101 N N   . VAL C 32  ? 0.4045 0.5328 0.3897 0.0164  -0.0826 -0.0294 32  VAL C N   
2102 C CA  . VAL C 32  ? 0.4127 0.5467 0.4156 0.0219  -0.0729 -0.0326 32  VAL C CA  
2103 C C   . VAL C 32  ? 0.4258 0.5881 0.4529 0.0379  -0.0777 -0.0308 32  VAL C C   
2104 O O   . VAL C 32  ? 0.4025 0.5648 0.4407 0.0464  -0.0698 -0.0329 32  VAL C O   
2105 C CB  . VAL C 32  ? 0.4443 0.5450 0.4366 0.0276  -0.0630 -0.0318 32  VAL C CB  
2106 C CG1 . VAL C 32  ? 0.4973 0.5735 0.4697 0.0143  -0.0563 -0.0343 32  VAL C CG1 
2107 C CG2 . VAL C 32  ? 0.4080 0.4943 0.3937 0.0423  -0.0691 -0.0252 32  VAL C CG2 
2108 N N   . SER C 33  ? 0.4207 0.6078 0.4558 0.0424  -0.0908 -0.0271 33  SER C N   
2109 C CA  . SER C 33  ? 0.3888 0.6024 0.4473 0.0616  -0.0962 -0.0248 33  SER C CA  
2110 C C   . SER C 33  ? 0.3433 0.5965 0.4288 0.0585  -0.0909 -0.0305 33  SER C C   
2111 O O   . SER C 33  ? 0.3255 0.5914 0.4287 0.0739  -0.0862 -0.0322 33  SER C O   
2112 C CB  . SER C 33  ? 0.4193 0.6481 0.4783 0.0688  -0.1134 -0.0176 33  SER C CB  
2113 O OG  . SER C 33  ? 0.4358 0.6889 0.4948 0.0508  -0.1204 -0.0188 33  SER C OG  
2114 N N   . ASP C 34  ? 0.3056 0.5772 0.3924 0.0378  -0.0911 -0.0337 34  ASP C N   
2115 C CA  . ASP C 34  ? 0.2743 0.5858 0.3853 0.0304  -0.0863 -0.0383 34  ASP C CA  
2116 C C   . ASP C 34  ? 0.2898 0.5839 0.3968 0.0223  -0.0700 -0.0436 34  ASP C C   
2117 O O   . ASP C 34  ? 0.3562 0.6102 0.4405 0.0163  -0.0642 -0.0441 34  ASP C O   
2118 C CB  . ASP C 34  ? 0.3128 0.6499 0.4248 0.0088  -0.0946 -0.0390 34  ASP C CB  
2119 C CG  . ASP C 34  ? 0.3824 0.6869 0.4682 -0.0143 -0.0886 -0.0428 34  ASP C CG  
2120 O OD1 . ASP C 34  ? 0.4288 0.7036 0.4900 -0.0176 -0.0934 -0.0411 34  ASP C OD1 
2121 O OD2 . ASP C 34  ? 0.4061 0.7136 0.4948 -0.0287 -0.0788 -0.0474 34  ASP C OD2 
2122 N N   . PRO C 35  ? 0.2652 0.5915 0.3943 0.0220  -0.0626 -0.0473 35  PRO C N   
2123 C CA  . PRO C 35  ? 0.2139 0.5250 0.3391 0.0167  -0.0476 -0.0512 35  PRO C CA  
2124 C C   . PRO C 35  ? 0.2340 0.5181 0.3382 -0.0065 -0.0425 -0.0526 35  PRO C C   
2125 O O   . PRO C 35  ? 0.2428 0.4923 0.3319 -0.0059 -0.0342 -0.0530 35  PRO C O   
2126 C CB  . PRO C 35  ? 0.1898 0.5498 0.3431 0.0168  -0.0425 -0.0544 35  PRO C CB  
2127 C CG  . PRO C 35  ? 0.1949 0.5970 0.3664 0.0150  -0.0551 -0.0523 35  PRO C CG  
2128 C CD  . PRO C 35  ? 0.3064 0.6873 0.4661 0.0278  -0.0678 -0.0474 35  PRO C CD  
2129 N N   . ASP C 36  ? 0.2496 0.5479 0.3523 -0.0263 -0.0477 -0.0534 36  ASP C N   
2130 C CA  . ASP C 36  ? 0.2669 0.5355 0.3477 -0.0476 -0.0431 -0.0553 36  ASP C CA  
2131 C C   . ASP C 36  ? 0.2571 0.4785 0.3118 -0.0435 -0.0437 -0.0542 36  ASP C C   
2132 O O   . ASP C 36  ? 0.2425 0.4308 0.2819 -0.0480 -0.0351 -0.0550 36  ASP C O   
2133 C CB  . ASP C 36  ? 0.3220 0.6129 0.4037 -0.0702 -0.0500 -0.0570 36  ASP C CB  
2134 C CG  . ASP C 36  ? 0.3686 0.6944 0.4682 -0.0845 -0.0442 -0.0588 36  ASP C CG  
2135 O OD1 . ASP C 36  ? 0.3846 0.7249 0.4994 -0.0736 -0.0356 -0.0588 36  ASP C OD1 
2136 O OD2 . ASP C 36  ? 0.3953 0.7336 0.4922 -0.1079 -0.0479 -0.0604 36  ASP C OD2 
2137 N N   . ARG C 37  ? 0.2674 0.4871 0.3173 -0.0349 -0.0538 -0.0517 37  ARG C N   
2138 C CA  . ARG C 37  ? 0.3092 0.4885 0.3351 -0.0312 -0.0537 -0.0504 37  ARG C CA  
2139 C C   . ARG C 37  ? 0.3157 0.4758 0.3416 -0.0123 -0.0484 -0.0475 37  ARG C C   
2140 O O   . ARG C 37  ? 0.3415 0.4685 0.3498 -0.0105 -0.0446 -0.0466 37  ARG C O   
2141 C CB  . ARG C 37  ? 0.3163 0.5000 0.3334 -0.0312 -0.0664 -0.0481 37  ARG C CB  
2142 C CG  . ARG C 37  ? 0.3351 0.5138 0.3354 -0.0531 -0.0700 -0.0521 37  ARG C CG  
2143 C CD  . ARG C 37  ? 0.3539 0.5372 0.3430 -0.0534 -0.0832 -0.0495 37  ARG C CD  
2144 N NE  . ARG C 37  ? 0.4191 0.6454 0.4314 -0.0458 -0.0953 -0.0452 37  ARG C NE  
2145 C CZ  . ARG C 37  ? 0.4825 0.7229 0.4901 -0.0459 -0.1098 -0.0414 37  ARG C CZ  
2146 N NH1 . ARG C 37  ? 0.4935 0.7074 0.4715 -0.0548 -0.1132 -0.0421 37  ARG C NH1 
2147 N NH2 . ARG C 37  ? 0.4882 0.7704 0.5205 -0.0366 -0.1208 -0.0368 37  ARG C NH2 
2148 N N   . SER C 38  ? 0.2955 0.4769 0.3409 0.0015  -0.0479 -0.0465 38  SER C N   
2149 C CA  . SER C 38  ? 0.2965 0.4580 0.3403 0.0171  -0.0424 -0.0449 38  SER C CA  
2150 C C   . SER C 38  ? 0.2485 0.3921 0.2865 0.0098  -0.0307 -0.0472 38  SER C C   
2151 O O   . SER C 38  ? 0.2543 0.3692 0.2805 0.0143  -0.0264 -0.0456 38  SER C O   
2152 C CB  . SER C 38  ? 0.3085 0.4947 0.3725 0.0345  -0.0443 -0.0447 38  SER C CB  
2153 O OG  . SER C 38  ? 0.2935 0.4593 0.3541 0.0456  -0.0371 -0.0451 38  SER C OG  
2154 N N   . SER C 39  ? 0.2684 0.4303 0.3147 -0.0024 -0.0260 -0.0502 39  SER C N   
2155 C CA  . SER C 39  ? 0.2802 0.4275 0.3212 -0.0097 -0.0157 -0.0512 39  SER C CA  
2156 C C   . SER C 39  ? 0.3192 0.4322 0.3398 -0.0200 -0.0131 -0.0506 39  SER C C   
2157 O O   . SER C 39  ? 0.2815 0.3712 0.2939 -0.0174 -0.0070 -0.0491 39  SER C O   
2158 C CB  . SER C 39  ? 0.2903 0.4667 0.3441 -0.0218 -0.0115 -0.0537 39  SER C CB  
2159 O OG  . SER C 39  ? 0.3182 0.4764 0.3625 -0.0311 -0.0026 -0.0534 39  SER C OG  
2160 N N   . ASN C 40  ? 0.4249 0.5351 0.4369 -0.0314 -0.0177 -0.0520 40  ASN C N   
2161 C CA  . ASN C 40  ? 0.4497 0.5263 0.4418 -0.0398 -0.0141 -0.0527 40  ASN C CA  
2162 C C   . ASN C 40  ? 0.4064 0.4596 0.3875 -0.0282 -0.0146 -0.0507 40  ASN C C   
2163 O O   . ASN C 40  ? 0.4117 0.4377 0.3797 -0.0296 -0.0093 -0.0507 40  ASN C O   
2164 C CB  . ASN C 40  ? 0.4803 0.5580 0.4632 -0.0572 -0.0180 -0.0564 40  ASN C CB  
2165 C CG  . ASN C 40  ? 0.5439 0.6285 0.5223 -0.0551 -0.0274 -0.0569 40  ASN C CG  
2166 O OD1 . ASN C 40  ? 0.5901 0.6887 0.5777 -0.0414 -0.0326 -0.0539 40  ASN C OD1 
2167 N ND2 . ASN C 40  ? 0.5764 0.6488 0.5380 -0.0692 -0.0299 -0.0607 40  ASN C ND2 
2168 N N   . PHE C 41  ? 0.3451 0.4094 0.3318 -0.0166 -0.0208 -0.0485 41  PHE C N   
2169 C CA  . PHE C 41  ? 0.3143 0.3583 0.2917 -0.0063 -0.0206 -0.0453 41  PHE C CA  
2170 C C   . PHE C 41  ? 0.2625 0.2945 0.2429 0.0005  -0.0135 -0.0433 41  PHE C C   
2171 O O   . PHE C 41  ? 0.2192 0.2303 0.1903 0.0029  -0.0097 -0.0414 41  PHE C O   
2172 C CB  . PHE C 41  ? 0.3487 0.4036 0.3298 0.0046  -0.0292 -0.0421 41  PHE C CB  
2173 C CG  . PHE C 41  ? 0.3775 0.4131 0.3520 0.0151  -0.0279 -0.0380 41  PHE C CG  
2174 C CD1 . PHE C 41  ? 0.4112 0.4268 0.3693 0.0127  -0.0266 -0.0365 41  PHE C CD1 
2175 C CD2 . PHE C 41  ? 0.3889 0.4259 0.3723 0.0261  -0.0271 -0.0361 41  PHE C CD2 
2176 C CE1 . PHE C 41  ? 0.4368 0.4372 0.3894 0.0198  -0.0251 -0.0322 41  PHE C CE1 
2177 C CE2 . PHE C 41  ? 0.4333 0.4511 0.4090 0.0329  -0.0263 -0.0323 41  PHE C CE2 
2178 C CZ  . PHE C 41  ? 0.4421 0.4429 0.4032 0.0290  -0.0255 -0.0298 41  PHE C CZ  
2179 N N   . MET C 42  ? 0.2462 0.2939 0.2396 0.0035  -0.0119 -0.0437 42  MET C N   
2180 C CA  . MET C 42  ? 0.1991 0.2370 0.1937 0.0087  -0.0061 -0.0420 42  MET C CA  
2181 C C   . MET C 42  ? 0.1919 0.2118 0.1781 0.0002  0.0001  -0.0415 42  MET C C   
2182 O O   . MET C 42  ? 0.2459 0.2498 0.2276 0.0044  0.0031  -0.0386 42  MET C O   
2183 C CB  . MET C 42  ? 0.2068 0.2656 0.2145 0.0121  -0.0043 -0.0438 42  MET C CB  
2184 C CG  . MET C 42  ? 0.2346 0.3064 0.2511 0.0258  -0.0092 -0.0442 42  MET C CG  
2185 S SD  . MET C 42  ? 0.3125 0.3589 0.3191 0.0382  -0.0116 -0.0407 42  MET C SD  
2186 C CE  . MET C 42  ? 0.3937 0.4207 0.3923 0.0325  -0.0039 -0.0393 42  MET C CE  
2187 N N   . THR C 43  ? 0.2314 0.2536 0.2153 -0.0117 0.0014  -0.0438 43  THR C N   
2188 C CA  . THR C 43  ? 0.2848 0.2865 0.2593 -0.0191 0.0068  -0.0430 43  THR C CA  
2189 C C   . THR C 43  ? 0.2414 0.2195 0.2046 -0.0153 0.0081  -0.0422 43  THR C C   
2190 O O   . THR C 43  ? 0.2629 0.2247 0.2226 -0.0122 0.0123  -0.0393 43  THR C O   
2191 C CB  . THR C 43  ? 0.3881 0.3930 0.3593 -0.0346 0.0073  -0.0459 43  THR C CB  
2192 O OG1 . THR C 43  ? 0.4007 0.4351 0.3851 -0.0384 0.0061  -0.0470 43  THR C OG1 
2193 C CG2 . THR C 43  ? 0.3970 0.3783 0.3581 -0.0411 0.0128  -0.0437 43  THR C CG2 
2194 N N   . ARG C 44  ? 0.2932 0.2711 0.2507 -0.0154 0.0046  -0.0447 44  ARG C N   
2195 C CA  . ARG C 44  ? 0.2988 0.2576 0.2455 -0.0115 0.0073  -0.0447 44  ARG C CA  
2196 C C   . ARG C 44  ? 0.2220 0.1804 0.1736 -0.0003 0.0079  -0.0399 44  ARG C C   
2197 O O   . ARG C 44  ? 0.2175 0.1628 0.1657 0.0037  0.0125  -0.0380 44  ARG C O   
2198 C CB  . ARG C 44  ? 0.3820 0.3417 0.3187 -0.0153 0.0033  -0.0484 44  ARG C CB  
2199 C CG  . ARG C 44  ? 0.4890 0.4486 0.4181 -0.0290 0.0014  -0.0538 44  ARG C CG  
2200 C CD  . ARG C 44  ? 0.5446 0.4835 0.4667 -0.0359 0.0077  -0.0557 44  ARG C CD  
2201 N NE  . ARG C 44  ? 0.6315 0.5433 0.5399 -0.0318 0.0142  -0.0578 44  ARG C NE  
2202 C CZ  . ARG C 44  ? 0.6790 0.5744 0.5697 -0.0379 0.0156  -0.0642 44  ARG C CZ  
2203 N NH1 . ARG C 44  ? 0.7030 0.6063 0.5865 -0.0502 0.0095  -0.0686 44  ARG C NH1 
2204 N NH2 . ARG C 44  ? 0.6879 0.5598 0.5680 -0.0315 0.0231  -0.0665 44  ARG C NH2 
2205 N N   . ALA C 45  ? 0.2139 0.1870 0.1737 0.0046  0.0032  -0.0380 45  ALA C N   
2206 C CA  . ALA C 45  ? 0.2592 0.2299 0.2216 0.0130  0.0028  -0.0338 45  ALA C CA  
2207 C C   . ALA C 45  ? 0.2854 0.2503 0.2518 0.0143  0.0072  -0.0310 45  ALA C C   
2208 O O   . ALA C 45  ? 0.2844 0.2422 0.2500 0.0180  0.0088  -0.0274 45  ALA C O   
2209 C CB  . ALA C 45  ? 0.2683 0.2515 0.2368 0.0184  -0.0031 -0.0332 45  ALA C CB  
2210 N N   . ILE C 46  ? 0.1908 0.1603 0.1611 0.0102  0.0086  -0.0321 46  ILE C N   
2211 C CA  . ILE C 46  ? 0.1896 0.1527 0.1609 0.0099  0.0119  -0.0288 46  ILE C CA  
2212 C C   . ILE C 46  ? 0.1976 0.1449 0.1639 0.0098  0.0156  -0.0268 46  ILE C C   
2213 O O   . ILE C 46  ? 0.1959 0.1382 0.1640 0.0141  0.0168  -0.0223 46  ILE C O   
2214 C CB  . ILE C 46  ? 0.2935 0.2642 0.2670 0.0034  0.0133  -0.0301 46  ILE C CB  
2215 C CG1 . ILE C 46  ? 0.3153 0.3038 0.2958 0.0064  0.0113  -0.0323 46  ILE C CG1 
2216 C CG2 . ILE C 46  ? 0.3028 0.2633 0.2734 0.0016  0.0161  -0.0255 46  ILE C CG2 
2217 C CD1 . ILE C 46  ? 0.3573 0.3608 0.3419 -0.0011 0.0133  -0.0351 46  ILE C CD1 
2218 N N   . TYR C 47  ? 0.2968 0.2366 0.2566 0.0053  0.0172  -0.0305 47  TYR C N   
2219 C CA  . TYR C 47  ? 0.3253 0.2473 0.2786 0.0069  0.0217  -0.0304 47  TYR C CA  
2220 C C   . TYR C 47  ? 0.3423 0.2638 0.2970 0.0150  0.0236  -0.0286 47  TYR C C   
2221 O O   . TYR C 47  ? 0.3900 0.3053 0.3476 0.0207  0.0269  -0.0251 47  TYR C O   
2222 C CB  . TYR C 47  ? 0.2650 0.1771 0.2075 -0.0006 0.0229  -0.0366 47  TYR C CB  
2223 C CG  . TYR C 47  ? 0.2965 0.1881 0.2296 0.0029  0.0284  -0.0389 47  TYR C CG  
2224 C CD1 . TYR C 47  ? 0.3234 0.1969 0.2541 0.0059  0.0322  -0.0365 47  TYR C CD1 
2225 C CD2 . TYR C 47  ? 0.3008 0.1903 0.2261 0.0040  0.0300  -0.0437 47  TYR C CD2 
2226 C CE1 . TYR C 47  ? 0.2884 0.1423 0.2110 0.0117  0.0380  -0.0394 47  TYR C CE1 
2227 C CE2 . TYR C 47  ? 0.3013 0.1723 0.2171 0.0082  0.0367  -0.0473 47  TYR C CE2 
2228 C CZ  . TYR C 47  ? 0.3288 0.1820 0.2441 0.0130  0.0410  -0.0455 47  TYR C CZ  
2229 O OH  . TYR C 47  ? 0.3721 0.2060 0.2785 0.0198  0.0484  -0.0498 47  TYR C OH  
2230 N N   . VAL C 48  ? 0.2829 0.2124 0.2360 0.0153  0.0213  -0.0304 48  VAL C N   
2231 C CA  . VAL C 48  ? 0.2589 0.1889 0.2113 0.0203  0.0237  -0.0286 48  VAL C CA  
2232 C C   . VAL C 48  ? 0.2862 0.2238 0.2480 0.0244  0.0223  -0.0222 48  VAL C C   
2233 O O   . VAL C 48  ? 0.2893 0.2274 0.2550 0.0285  0.0261  -0.0191 48  VAL C O   
2234 C CB  . VAL C 48  ? 0.2168 0.1513 0.1616 0.0180  0.0205  -0.0309 48  VAL C CB  
2235 C CG1 . VAL C 48  ? 0.2183 0.1541 0.1610 0.0211  0.0233  -0.0279 48  VAL C CG1 
2236 C CG2 . VAL C 48  ? 0.2315 0.1591 0.1649 0.0124  0.0212  -0.0374 48  VAL C CG2 
2237 N N   . ALA C 49  ? 0.2680 0.2122 0.2332 0.0232  0.0170  -0.0208 49  ALA C N   
2238 C CA  . ALA C 49  ? 0.2363 0.1850 0.2068 0.0250  0.0146  -0.0158 49  ALA C CA  
2239 C C   . ALA C 49  ? 0.2073 0.1558 0.1842 0.0266  0.0165  -0.0115 49  ALA C C   
2240 O O   . ALA C 49  ? 0.1893 0.1423 0.1710 0.0282  0.0168  -0.0069 49  ALA C O   
2241 C CB  . ALA C 49  ? 0.1820 0.1344 0.1526 0.0243  0.0095  -0.0169 49  ALA C CB  
2242 N N   . PHE C 50  ? 0.1879 0.1321 0.1646 0.0255  0.0172  -0.0121 50  PHE C N   
2243 C CA  . PHE C 50  ? 0.2282 0.1706 0.2093 0.0274  0.0176  -0.0068 50  PHE C CA  
2244 C C   . PHE C 50  ? 0.2437 0.1809 0.2276 0.0333  0.0225  -0.0055 50  PHE C C   
2245 O O   . PHE C 50  ? 0.2487 0.1887 0.2397 0.0378  0.0223  0.0003  50  PHE C O   
2246 C CB  . PHE C 50  ? 0.2279 0.1650 0.2052 0.0233  0.0168  -0.0069 50  PHE C CB  
2247 C CG  . PHE C 50  ? 0.2190 0.1637 0.1953 0.0195  0.0132  -0.0072 50  PHE C CG  
2248 C CD1 . PHE C 50  ? 0.1859 0.1348 0.1638 0.0198  0.0099  -0.0025 50  PHE C CD1 
2249 C CD2 . PHE C 50  ? 0.2377 0.1863 0.2112 0.0156  0.0134  -0.0125 50  PHE C CD2 
2250 C CE1 . PHE C 50  ? 0.1846 0.1375 0.1585 0.0166  0.0076  -0.0043 50  PHE C CE1 
2251 C CE2 . PHE C 50  ? 0.2098 0.1658 0.1825 0.0141  0.0116  -0.0139 50  PHE C CE2 
2252 C CZ  . PHE C 50  ? 0.2180 0.1741 0.1894 0.0147  0.0091  -0.0103 50  PHE C CZ  
2253 N N   . SER C 51  ? 0.2551 0.1855 0.2331 0.0337  0.0267  -0.0111 51  SER C N   
2254 C CA  . SER C 51  ? 0.2763 0.2016 0.2554 0.0406  0.0330  -0.0118 51  SER C CA  
2255 C C   . SER C 51  ? 0.2380 0.1789 0.2265 0.0444  0.0344  -0.0078 51  SER C C   
2256 O O   . SER C 51  ? 0.2666 0.2126 0.2645 0.0518  0.0376  -0.0041 51  SER C O   
2257 C CB  . SER C 51  ? 0.3222 0.2366 0.2894 0.0385  0.0373  -0.0199 51  SER C CB  
2258 O OG  . SER C 51  ? 0.4152 0.3117 0.3743 0.0363  0.0383  -0.0230 51  SER C OG  
2259 N N   . ALA C 52  ? 0.2091 0.1580 0.1952 0.0391  0.0316  -0.0082 52  ALA C N   
2260 C CA  . ALA C 52  ? 0.2121 0.1749 0.2046 0.0391  0.0324  -0.0041 52  ALA C CA  
2261 C C   . ALA C 52  ? 0.1938 0.1679 0.1984 0.0396  0.0283  0.0033  52  ALA C C   
2262 O O   . ALA C 52  ? 0.1902 0.1782 0.2056 0.0425  0.0309  0.0077  52  ALA C O   
2263 C CB  . ALA C 52  ? 0.2243 0.1877 0.2084 0.0324  0.0287  -0.0052 52  ALA C CB  
2264 N N   . VAL C 53  ? 0.2279 0.1978 0.2304 0.0362  0.0219  0.0046  53  VAL C N   
2265 C CA  . VAL C 53  ? 0.2143 0.1931 0.2243 0.0347  0.0165  0.0112  53  VAL C CA  
2266 C C   . VAL C 53  ? 0.2663 0.2492 0.2866 0.0423  0.0180  0.0162  53  VAL C C   
2267 O O   . VAL C 53  ? 0.3011 0.2999 0.3332 0.0438  0.0161  0.0226  53  VAL C O   
2268 C CB  . VAL C 53  ? 0.2505 0.2221 0.2526 0.0295  0.0107  0.0102  53  VAL C CB  
2269 C CG1 . VAL C 53  ? 0.2517 0.2310 0.2582 0.0270  0.0049  0.0168  53  VAL C CG1 
2270 C CG2 . VAL C 53  ? 0.2514 0.2192 0.2450 0.0247  0.0087  0.0058  53  VAL C CG2 
2271 N N   . LEU C 54  ? 0.3003 0.2687 0.3159 0.0469  0.0208  0.0136  54  LEU C N   
2272 C CA  . LEU C 54  ? 0.3360 0.3024 0.3590 0.0560  0.0217  0.0186  54  LEU C CA  
2273 C C   . LEU C 54  ? 0.3248 0.3044 0.3610 0.0654  0.0277  0.0200  54  LEU C C   
2274 O O   . LEU C 54  ? 0.3560 0.3477 0.4059 0.0728  0.0259  0.0272  54  LEU C O   
2275 C CB  . LEU C 54  ? 0.3502 0.2930 0.3621 0.0579  0.0245  0.0147  54  LEU C CB  
2276 C CG  . LEU C 54  ? 0.3398 0.2726 0.3415 0.0498  0.0192  0.0157  54  LEU C CG  
2277 C CD1 . LEU C 54  ? 0.3548 0.2649 0.3441 0.0482  0.0228  0.0109  54  LEU C CD1 
2278 C CD2 . LEU C 54  ? 0.2957 0.2332 0.3021 0.0513  0.0127  0.0255  54  LEU C CD2 
2279 N N   . ARG C 55  ? 0.2839 0.2630 0.3161 0.0652  0.0348  0.0133  55  ARG C N   
2280 C CA  . ARG C 55  ? 0.2790 0.2709 0.3218 0.0740  0.0431  0.0128  55  ARG C CA  
2281 C C   . ARG C 55  ? 0.2817 0.3023 0.3383 0.0699  0.0417  0.0186  55  ARG C C   
2282 O O   . ARG C 55  ? 0.3302 0.3709 0.4046 0.0776  0.0434  0.0241  55  ARG C O   
2283 C CB  . ARG C 55  ? 0.2778 0.2575 0.3074 0.0738  0.0518  0.0031  55  ARG C CB  
2284 C CG  . ARG C 55  ? 0.3158 0.3094 0.3540 0.0824  0.0624  0.0012  55  ARG C CG  
2285 C CD  . ARG C 55  ? 0.4136 0.4072 0.4645 0.0987  0.0663  0.0036  55  ARG C CD  
2286 N NE  . ARG C 55  ? 0.4921 0.5140 0.5618 0.1073  0.0739  0.0060  55  ARG C NE  
2287 C CZ  . ARG C 55  ? 0.4658 0.5097 0.5580 0.1164  0.0713  0.0147  55  ARG C CZ  
2288 N NH1 . ARG C 55  ? 0.4316 0.4691 0.5274 0.1178  0.0608  0.0220  55  ARG C NH1 
2289 N NH2 . ARG C 55  ? 0.4611 0.5354 0.5723 0.1237  0.0791  0.0165  55  ARG C NH2 
2290 N N   . ASN C 56  ? 0.2675 0.2899 0.3159 0.0576  0.0384  0.0175  56  ASN C N   
2291 C CA  . ASN C 56  ? 0.3315 0.3767 0.3887 0.0501  0.0369  0.0227  56  ASN C CA  
2292 C C   . ASN C 56  ? 0.3840 0.4453 0.4540 0.0473  0.0281  0.0314  56  ASN C C   
2293 O O   . ASN C 56  ? 0.4430 0.5294 0.5267 0.0438  0.0277  0.0371  56  ASN C O   
2294 C CB  . ASN C 56  ? 0.3009 0.3368 0.3422 0.0377  0.0341  0.0199  56  ASN C CB  
2295 C CG  . ASN C 56  ? 0.3567 0.3893 0.3889 0.0375  0.0427  0.0146  56  ASN C CG  
2296 O OD1 . ASN C 56  ? 0.4323 0.4809 0.4684 0.0333  0.0472  0.0171  56  ASN C OD1 
2297 N ND2 . ASN C 56  ? 0.3262 0.3389 0.3450 0.0406  0.0448  0.0074  56  ASN C ND2 
2298 N N   . ARG C 57  ? 0.3692 0.4175 0.4340 0.0475  0.0207  0.0328  57  ARG C N   
2299 C CA  . ARG C 57  ? 0.4061 0.4680 0.4799 0.0444  0.0114  0.0411  57  ARG C CA  
2300 C C   . ARG C 57  ? 0.4330 0.5061 0.5235 0.0583  0.0124  0.0468  57  ARG C C   
2301 O O   . ARG C 57  ? 0.4251 0.5126 0.5256 0.0582  0.0042  0.0552  57  ARG C O   
2302 C CB  . ARG C 57  ? 0.4076 0.4509 0.4658 0.0375  0.0035  0.0400  57  ARG C CB  
2303 C CG  . ARG C 57  ? 0.3922 0.4472 0.4523 0.0284  -0.0068 0.0467  57  ARG C CG  
2304 C CD  . ARG C 57  ? 0.3528 0.4203 0.4139 0.0167  -0.0085 0.0474  57  ARG C CD  
2305 N NE  . ARG C 57  ? 0.3442 0.4139 0.3989 0.0045  -0.0187 0.0508  57  ARG C NE  
2306 C CZ  . ARG C 57  ? 0.4010 0.4944 0.4681 -0.0008 -0.0254 0.0589  57  ARG C CZ  
2307 N NH1 . ARG C 57  ? 0.4046 0.5248 0.4944 0.0066  -0.0224 0.0647  57  ARG C NH1 
2308 N NH2 . ARG C 57  ? 0.4366 0.5282 0.4934 -0.0137 -0.0351 0.0607  57  ARG C NH2 
2309 N N   . ASN C 58  ? 0.4744 0.5393 0.5665 0.0705  0.0220  0.0421  58  ASN C N   
2310 C CA  . ASN C 58  ? 0.4810 0.5503 0.5870 0.0873  0.0247  0.0460  58  ASN C CA  
2311 C C   . ASN C 58  ? 0.4744 0.5295 0.5763 0.0907  0.0157  0.0522  58  ASN C C   
2312 O O   . ASN C 58  ? 0.5044 0.5734 0.6216 0.1005  0.0113  0.0610  58  ASN C O   
2313 C CB  . ASN C 58  ? 0.5074 0.6147 0.6391 0.0923  0.0258  0.0528  58  ASN C CB  
2314 C CG  . ASN C 58  ? 0.6018 0.7149 0.7466 0.1114  0.0373  0.0504  58  ASN C CG  
2315 O OD1 . ASN C 58  ? 0.6487 0.7511 0.7979 0.1266  0.0366  0.0531  58  ASN C OD1 
2316 N ND2 . ASN C 58  ? 0.6170 0.7451 0.7665 0.1109  0.0482  0.0451  58  ASN C ND2 
2317 N N   . ILE C 59  ? 0.4206 0.4495 0.5019 0.0825  0.0130  0.0481  59  ILE C N   
2318 C CA  . ILE C 59  ? 0.3561 0.3671 0.4287 0.0841  0.0063  0.0530  59  ILE C CA  
2319 C C   . ILE C 59  ? 0.3812 0.3696 0.4509 0.0981  0.0129  0.0508  59  ILE C C   
2320 O O   . ILE C 59  ? 0.4695 0.4468 0.5389 0.1059  0.0084  0.0580  59  ILE C O   
2321 C CB  . ILE C 59  ? 0.3006 0.2949 0.3530 0.0697  0.0027  0.0488  59  ILE C CB  
2322 C CG1 . ILE C 59  ? 0.2079 0.2199 0.2610 0.0575  -0.0050 0.0517  59  ILE C CG1 
2323 C CG2 . ILE C 59  ? 0.3261 0.2987 0.3661 0.0701  -0.0014 0.0527  59  ILE C CG2 
2324 C CD1 . ILE C 59  ? 0.2019 0.2012 0.2374 0.0453  -0.0058 0.0448  59  ILE C CD1 
2325 N N   . LEU C 60  ? 0.3143 0.2938 0.3797 0.1008  0.0233  0.0409  60  LEU C N   
2326 C CA  . LEU C 60  ? 0.3330 0.2897 0.3941 0.1141  0.0311  0.0367  60  LEU C CA  
2327 C C   . LEU C 60  ? 0.3402 0.3118 0.4135 0.1247  0.0419  0.0314  60  LEU C C   
2328 O O   . LEU C 60  ? 0.2943 0.2856 0.3712 0.1169  0.0451  0.0279  60  LEU C O   
2329 C CB  . LEU C 60  ? 0.3179 0.2425 0.3554 0.1054  0.0339  0.0279  60  LEU C CB  
2330 C CG  . LEU C 60  ? 0.2824 0.1877 0.3059 0.0967  0.0262  0.0323  60  LEU C CG  
2331 C CD1 . LEU C 60  ? 0.2887 0.1697 0.2921 0.0864  0.0300  0.0228  60  LEU C CD1 
2332 C CD2 . LEU C 60  ? 0.3065 0.1967 0.3314 0.1086  0.0226  0.0413  60  LEU C CD2 
2333 N N   . GLY C 61  ? 0.3853 0.3462 0.4634 0.1424  0.0481  0.0308  61  GLY C N   
2334 C CA  . GLY C 61  ? 0.4275 0.4018 0.5162 0.1544  0.0604  0.0246  61  GLY C CA  
2335 C C   . GLY C 61  ? 0.4956 0.4493 0.5638 0.1484  0.0704  0.0108  61  GLY C C   
2336 O O   . GLY C 61  ? 0.5724 0.4966 0.6188 0.1385  0.0680  0.0059  61  GLY C O   
2337 N N   . GLN C 62  ? 0.4875 0.4589 0.5627 0.1538  0.0816  0.0049  62  GLN C N   
2338 C CA  . GLN C 62  ? 0.4805 0.4365 0.5358 0.1480  0.0914  -0.0079 62  GLN C CA  
2339 C C   . GLN C 62  ? 0.4751 0.3886 0.5081 0.1517  0.0944  -0.0170 62  GLN C C   
2340 O O   . GLN C 62  ? 0.4905 0.3833 0.5010 0.1412  0.0972  -0.0262 62  GLN C O   
2341 C CB  . GLN C 62  ? 0.4838 0.4685 0.5519 0.1555  0.1040  -0.0115 62  GLN C CB  
2342 C CG  . GLN C 62  ? 0.5571 0.5231 0.6068 0.1572  0.1147  -0.0255 62  GLN C CG  
2343 C CD  . GLN C 62  ? 0.6213 0.6191 0.6859 0.1640  0.1257  -0.0282 62  GLN C CD  
2344 O OE1 . GLN C 62  ? 0.6400 0.6660 0.7307 0.1742  0.1250  -0.0213 62  GLN C OE1 
2345 N NE2 . GLN C 62  ? 0.6303 0.6253 0.6779 0.1574  0.1354  -0.0382 62  GLN C NE2 
2346 N N   . GLU C 63  ? 0.4544 0.3563 0.4930 0.1631  0.0911  -0.0138 63  GLU C N   
2347 C CA  . GLU C 63  ? 0.5275 0.3894 0.5454 0.1639  0.0916  -0.0213 63  GLU C CA  
2348 C C   . GLU C 63  ? 0.5476 0.3796 0.5436 0.1489  0.0849  -0.0216 63  GLU C C   
2349 O O   . GLU C 63  ? 0.6167 0.4158 0.5923 0.1446  0.0854  -0.0286 63  GLU C O   
2350 C CB  . GLU C 63  ? 0.5536 0.4088 0.5831 0.1797  0.0879  -0.0157 63  GLU C CB  
2351 C CG  . GLU C 63  ? 0.5203 0.3739 0.5566 0.1793  0.0755  -0.0017 63  GLU C CG  
2352 C CD  . GLU C 63  ? 0.5876 0.4814 0.6538 0.1892  0.0712  0.0097  63  GLU C CD  
2353 O OE1 . GLU C 63  ? 0.6006 0.5292 0.6818 0.1890  0.0767  0.0088  63  GLU C OE1 
2354 O OE2 . GLU C 63  ? 0.6298 0.5211 0.7040 0.1961  0.0618  0.0202  63  GLU C OE2 
2355 N N   . TYR C 64  ? 0.5151 0.3598 0.5157 0.1406  0.0787  -0.0141 64  TYR C N   
2356 C CA  . TYR C 64  ? 0.4880 0.3104 0.4707 0.1255  0.0719  -0.0138 64  TYR C CA  
2357 C C   . TYR C 64  ? 0.4512 0.2801 0.4224 0.1083  0.0723  -0.0218 64  TYR C C   
2358 O O   . TYR C 64  ? 0.4437 0.2665 0.4051 0.0934  0.0654  -0.0214 64  TYR C O   
2359 C CB  . TYR C 64  ? 0.4288 0.2663 0.4232 0.1211  0.0602  -0.0007 64  TYR C CB  
2360 C CG  . TYR C 64  ? 0.4021 0.2260 0.4020 0.1349  0.0566  0.0087  64  TYR C CG  
2361 C CD1 . TYR C 64  ? 0.4837 0.2695 0.4651 0.1332  0.0549  0.0078  64  TYR C CD1 
2362 C CD2 . TYR C 64  ? 0.3620 0.2139 0.3857 0.1471  0.0530  0.0190  64  TYR C CD2 
2363 C CE1 . TYR C 64  ? 0.5224 0.2979 0.5081 0.1428  0.0488  0.0168  64  TYR C CE1 
2364 C CE2 . TYR C 64  ? 0.4394 0.2825 0.4684 0.1579  0.0468  0.0281  64  TYR C CE2 
2365 C CZ  . TYR C 64  ? 0.5043 0.3084 0.5138 0.1557  0.0445  0.0269  64  TYR C CZ  
2366 O OH  . TYR C 64  ? 0.5423 0.3364 0.5559 0.1653  0.0371  0.0364  64  TYR C OH  
2367 N N   . PHE C 65  ? 0.4144 0.2571 0.3868 0.1108  0.0805  -0.0286 65  PHE C N   
2368 C CA  . PHE C 65  ? 0.4314 0.2821 0.3932 0.0959  0.0799  -0.0345 65  PHE C CA  
2369 C C   . PHE C 65  ? 0.4913 0.3282 0.4361 0.0972  0.0903  -0.0469 65  PHE C C   
2370 O O   . PHE C 65  ? 0.5460 0.3768 0.4922 0.1102  0.0987  -0.0507 65  PHE C O   
2371 C CB  . PHE C 65  ? 0.3703 0.2571 0.3487 0.0925  0.0768  -0.0281 65  PHE C CB  
2372 C CG  . PHE C 65  ? 0.3897 0.2894 0.3810 0.0888  0.0663  -0.0174 65  PHE C CG  
2373 C CD1 . PHE C 65  ? 0.4027 0.3135 0.4117 0.0996  0.0645  -0.0086 65  PHE C CD1 
2374 C CD2 . PHE C 65  ? 0.3700 0.2717 0.3553 0.0749  0.0580  -0.0164 65  PHE C CD2 
2375 C CE1 . PHE C 65  ? 0.3583 0.2800 0.3758 0.0948  0.0544  0.0007  65  PHE C CE1 
2376 C CE2 . PHE C 65  ? 0.3228 0.2347 0.3171 0.0714  0.0494  -0.0080 65  PHE C CE2 
2377 C CZ  . PHE C 65  ? 0.2793 0.2004 0.2883 0.0804  0.0475  0.0005  65  PHE C CZ  
2378 N N   . THR C 66  ? 0.4941 0.3291 0.4232 0.0826  0.0879  -0.0527 66  THR C N   
2379 C CA  . THR C 66  ? 0.5330 0.3588 0.4435 0.0806  0.0964  -0.0640 66  THR C CA  
2380 C C   . THR C 66  ? 0.5540 0.4050 0.4644 0.0711  0.0945  -0.0629 66  THR C C   
2381 O O   . THR C 66  ? 0.5222 0.3859 0.4378 0.0614  0.0843  -0.0568 66  THR C O   
2382 C CB  . THR C 66  ? 0.5617 0.3551 0.4467 0.0702  0.0945  -0.0731 66  THR C CB  
2383 O OG1 . THR C 66  ? 0.5827 0.3790 0.4681 0.0563  0.0827  -0.0684 66  THR C OG1 
2384 C CG2 . THR C 66  ? 0.5961 0.3662 0.4794 0.0777  0.0957  -0.0743 66  THR C CG2 
2385 N N   . LYS C 67  ? 0.5809 0.4374 0.4840 0.0745  0.1047  -0.0688 67  LYS C N   
2386 C CA  . LYS C 67  ? 0.5840 0.4603 0.4825 0.0651  0.1036  -0.0675 67  LYS C CA  
2387 C C   . LYS C 67  ? 0.6295 0.4948 0.5083 0.0498  0.0945  -0.0710 67  LYS C C   
2388 O O   . LYS C 67  ? 0.6791 0.5200 0.5405 0.0459  0.0944  -0.0793 67  LYS C O   
2389 C CB  . LYS C 67  ? 0.5696 0.4513 0.4601 0.0708  0.1180  -0.0741 67  LYS C CB  
2390 C CG  . LYS C 67  ? 0.6061 0.4609 0.4699 0.0691  0.1240  -0.0874 67  LYS C CG  
2391 C CD  . LYS C 67  ? 0.6199 0.4854 0.4822 0.0761  0.1363  -0.0928 67  LYS C CD  
2392 C CE  . LYS C 67  ? 0.6127 0.4820 0.4966 0.0937  0.1421  -0.0921 67  LYS C CE  
2393 N NZ  . LYS C 67  ? 0.6334 0.5110 0.5143 0.1010  0.1544  -0.0999 67  LYS C NZ  
2394 N N   . ASN C 68  ? 0.5860 0.4689 0.4674 0.0411  0.0863  -0.0646 68  ASN C N   
2395 C CA  . ASN C 68  ? 0.5255 0.4037 0.3920 0.0283  0.0763  -0.0663 68  ASN C CA  
2396 C C   . ASN C 68  ? 0.4769 0.3731 0.3428 0.0222  0.0705  -0.0596 68  ASN C C   
2397 O O   . ASN C 68  ? 0.5056 0.4175 0.3878 0.0253  0.0694  -0.0511 68  ASN C O   
2398 C CB  . ASN C 68  ? 0.5254 0.3988 0.4001 0.0248  0.0663  -0.0637 68  ASN C CB  
2399 C CG  . ASN C 68  ? 0.6225 0.4717 0.4821 0.0204  0.0671  -0.0726 68  ASN C CG  
2400 O OD1 . ASN C 68  ? 0.6757 0.5203 0.5206 0.0091  0.0610  -0.0769 68  ASN C OD1 
2401 N ND2 . ASN C 68  ? 0.6562 0.4891 0.5188 0.0289  0.0739  -0.0747 68  ASN C ND2 
2402 N N   . TYR C 69  ? 0.4320 0.3243 0.2778 0.0129  0.0661  -0.0630 69  TYR C N   
2403 C CA  . TYR C 69  ? 0.4071 0.3118 0.2494 0.0070  0.0583  -0.0557 69  TYR C CA  
2404 C C   . TYR C 69  ? 0.4681 0.3776 0.3203 0.0042  0.0443  -0.0506 69  TYR C C   
2405 O O   . TYR C 69  ? 0.5750 0.4783 0.4237 0.0002  0.0389  -0.0552 69  TYR C O   
2406 C CB  . TYR C 69  ? 0.4107 0.3099 0.2255 -0.0014 0.0586  -0.0604 69  TYR C CB  
2407 C CG  . TYR C 69  ? 0.4201 0.3164 0.2214 0.0006  0.0736  -0.0661 69  TYR C CG  
2408 C CD1 . TYR C 69  ? 0.4056 0.2857 0.1950 0.0032  0.0835  -0.0780 69  TYR C CD1 
2409 C CD2 . TYR C 69  ? 0.4405 0.3494 0.2393 -0.0007 0.0784  -0.0600 69  TYR C CD2 
2410 C CE1 . TYR C 69  ? 0.4695 0.3477 0.2463 0.0066  0.0987  -0.0846 69  TYR C CE1 
2411 C CE2 . TYR C 69  ? 0.4833 0.3934 0.2703 0.0008  0.0936  -0.0655 69  TYR C CE2 
2412 C CZ  . TYR C 69  ? 0.4949 0.3903 0.2715 0.0055  0.1041  -0.0783 69  TYR C CZ  
2413 O OH  . TYR C 69  ? 0.5124 0.4096 0.2773 0.0087  0.1207  -0.0851 69  TYR C OH  
2414 N N   . ILE C 70  ? 0.4176 0.3379 0.2817 0.0059  0.0390  -0.0415 70  ILE C N   
2415 C CA  . ILE C 70  ? 0.4476 0.3727 0.3178 0.0043  0.0263  -0.0371 70  ILE C CA  
2416 C C   . ILE C 70  ? 0.4656 0.3908 0.3177 -0.0017 0.0187  -0.0357 70  ILE C C   
2417 O O   . ILE C 70  ? 0.4713 0.3987 0.3204 -0.0048 0.0095  -0.0373 70  ILE C O   
2418 C CB  . ILE C 70  ? 0.5100 0.4422 0.3962 0.0087  0.0232  -0.0289 70  ILE C CB  
2419 C CG1 . ILE C 70  ? 0.6679 0.6013 0.5713 0.0140  0.0285  -0.0295 70  ILE C CG1 
2420 C CG2 . ILE C 70  ? 0.4230 0.3586 0.3124 0.0088  0.0110  -0.0251 70  ILE C CG2 
2421 C CD1 . ILE C 70  ? 0.7723 0.7124 0.6890 0.0166  0.0269  -0.0221 70  ILE C CD1 
2422 N N   . THR C 71  ? 0.4770 0.4016 0.3171 -0.0038 0.0226  -0.0320 71  THR C N   
2423 C CA  . THR C 71  ? 0.4219 0.3444 0.2403 -0.0102 0.0162  -0.0296 71  THR C CA  
2424 C C   . THR C 71  ? 0.4182 0.3370 0.2177 -0.0147 0.0278  -0.0325 71  THR C C   
2425 O O   . THR C 71  ? 0.4479 0.3658 0.2517 -0.0115 0.0407  -0.0386 71  THR C O   
2426 C CB  . THR C 71  ? 0.4444 0.3685 0.2642 -0.0093 0.0062  -0.0185 71  THR C CB  
2427 O OG1 . THR C 71  ? 0.4496 0.3739 0.2717 -0.0095 0.0137  -0.0130 71  THR C OG1 
2428 C CG2 . THR C 71  ? 0.4553 0.3837 0.2949 -0.0028 -0.0028 -0.0166 71  THR C CG2 
2429 N N   . GLU C 72  ? 0.4462 0.3631 0.2244 -0.0213 0.0233  -0.0277 72  GLU C N   
2430 C CA  . GLU C 72  ? 0.4677 0.3828 0.2255 -0.0268 0.0347  -0.0293 72  GLU C CA  
2431 C C   . GLU C 72  ? 0.4871 0.4095 0.2557 -0.0254 0.0431  -0.0222 72  GLU C C   
2432 O O   . GLU C 72  ? 0.5766 0.5034 0.3371 -0.0279 0.0567  -0.0245 72  GLU C O   
2433 C CB  . GLU C 72  ? 0.5228 0.4332 0.2516 -0.0360 0.0261  -0.0251 72  GLU C CB  
2434 C CG  . GLU C 72  ? 0.6490 0.5548 0.3628 -0.0405 0.0182  -0.0325 72  GLU C CG  
2435 C CD  . GLU C 72  ? 0.8663 0.7691 0.5517 -0.0494 0.0073  -0.0264 72  GLU C CD  
2436 O OE1 . GLU C 72  ? 1.0141 0.9160 0.6926 -0.0511 0.0041  -0.0149 72  GLU C OE1 
2437 O OE2 . GLU C 72  ? 0.8745 0.7749 0.5431 -0.0556 0.0012  -0.0326 72  GLU C OE2 
2438 N N   . LYS C 73  ? 0.4207 0.3455 0.2072 -0.0221 0.0351  -0.0140 73  LYS C N   
2439 C CA  . LYS C 73  ? 0.4386 0.3694 0.2334 -0.0239 0.0397  -0.0057 73  LYS C CA  
2440 C C   . LYS C 73  ? 0.4360 0.3765 0.2586 -0.0166 0.0465  -0.0079 73  LYS C C   
2441 O O   . LYS C 73  ? 0.4918 0.4419 0.3235 -0.0187 0.0525  -0.0026 73  LYS C O   
2442 C CB  . LYS C 73  ? 0.4771 0.3996 0.2680 -0.0265 0.0257  0.0055  73  LYS C CB  
2443 C CG  . LYS C 73  ? 0.5492 0.4613 0.3129 -0.0326 0.0162  0.0102  73  LYS C CG  
2444 C CD  . LYS C 73  ? 0.6465 0.5588 0.3874 -0.0434 0.0249  0.0144  73  LYS C CD  
2445 C CE  . LYS C 73  ? 0.7330 0.6327 0.4447 -0.0500 0.0132  0.0218  73  LYS C CE  
2446 N NZ  . LYS C 73  ? 0.7521 0.6511 0.4529 -0.0485 0.0074  0.0142  73  LYS C NZ  
2447 N N   . LEU C 74  ? 0.3721 0.3110 0.2076 -0.0092 0.0448  -0.0148 74  LEU C N   
2448 C CA  . LEU C 74  ? 0.3108 0.2570 0.1713 -0.0021 0.0486  -0.0154 74  LEU C CA  
2449 C C   . LEU C 74  ? 0.3269 0.2708 0.1935 0.0048  0.0554  -0.0252 74  LEU C C   
2450 O O   . LEU C 74  ? 0.3251 0.2593 0.1838 0.0045  0.0505  -0.0310 74  LEU C O   
2451 C CB  . LEU C 74  ? 0.3377 0.2810 0.2102 -0.0001 0.0363  -0.0103 74  LEU C CB  
2452 C CG  . LEU C 74  ? 0.3964 0.3471 0.2921 0.0052  0.0381  -0.0091 74  LEU C CG  
2453 C CD1 . LEU C 74  ? 0.4433 0.4049 0.3455 0.0014  0.0432  -0.0023 74  LEU C CD1 
2454 C CD2 . LEU C 74  ? 0.3357 0.2812 0.2391 0.0077  0.0270  -0.0073 74  LEU C CD2 
2455 N N   . LYS C 75  ? 0.4236 0.3763 0.3042 0.0108  0.0662  -0.0267 75  LYS C N   
2456 C CA  . LYS C 75  ? 0.4711 0.4181 0.3599 0.0192  0.0715  -0.0342 75  LYS C CA  
2457 C C   . LYS C 75  ? 0.4953 0.4470 0.4067 0.0245  0.0663  -0.0294 75  LYS C C   
2458 O O   . LYS C 75  ? 0.5378 0.4993 0.4592 0.0219  0.0612  -0.0213 75  LYS C O   
2459 C CB  . LYS C 75  ? 0.4275 0.3797 0.3164 0.0254  0.0871  -0.0396 75  LYS C CB  
2460 C CG  . LYS C 75  ? 0.4640 0.4022 0.3281 0.0235  0.0940  -0.0501 75  LYS C CG  
2461 C CD  . LYS C 75  ? 0.4653 0.4093 0.3309 0.0320  0.1113  -0.0563 75  LYS C CD  
2462 C CE  . LYS C 75  ? 0.5209 0.4441 0.3805 0.0407  0.1173  -0.0677 75  LYS C CE  
2463 N NZ  . LYS C 75  ? 0.5431 0.4722 0.4072 0.0528  0.1348  -0.0738 75  LYS C NZ  
2464 N N   . CYS C 76  ? 0.4524 0.3950 0.3694 0.0308  0.0675  -0.0343 76  CYS C N   
2465 C CA  . CYS C 76  ? 0.4098 0.3556 0.3455 0.0354  0.0629  -0.0297 76  CYS C CA  
2466 C C   . CYS C 76  ? 0.4488 0.3830 0.3880 0.0436  0.0681  -0.0347 76  CYS C C   
2467 O O   . CYS C 76  ? 0.4427 0.3611 0.3673 0.0437  0.0724  -0.0430 76  CYS C O   
2468 C CB  . CYS C 76  ? 0.3469 0.2890 0.2820 0.0298  0.0507  -0.0271 76  CYS C CB  
2469 S SG  . CYS C 76  ? 0.3706 0.3152 0.3238 0.0336  0.0452  -0.0221 76  CYS C SG  
2470 N N   . MET C 77  ? 0.4930 0.4334 0.4499 0.0501  0.0671  -0.0293 77  MET C N   
2471 C CA  . MET C 77  ? 0.5362 0.4632 0.4965 0.0586  0.0703  -0.0318 77  MET C CA  
2472 C C   . MET C 77  ? 0.5325 0.4468 0.4899 0.0534  0.0613  -0.0311 77  MET C C   
2473 O O   . MET C 77  ? 0.5282 0.4520 0.4952 0.0506  0.0539  -0.0244 77  MET C O   
2474 C CB  . MET C 77  ? 0.4937 0.4355 0.4748 0.0692  0.0733  -0.0251 77  MET C CB  
2475 C CG  . MET C 77  ? 0.4114 0.3725 0.3997 0.0743  0.0832  -0.0251 77  MET C CG  
2476 S SD  . MET C 77  ? 0.5338 0.4796 0.5104 0.0852  0.0981  -0.0365 77  MET C SD  
2477 C CE  . MET C 77  ? 0.5852 0.5642 0.5746 0.0889  0.1094  -0.0343 77  MET C CE  
2478 N N   . THR C 78  ? 0.4936 0.3869 0.4364 0.0508  0.0624  -0.0383 78  THR C N   
2479 C CA  . THR C 78  ? 0.4463 0.3293 0.3862 0.0442  0.0552  -0.0377 78  THR C CA  
2480 C C   . THR C 78  ? 0.4037 0.2664 0.3425 0.0503  0.0582  -0.0378 78  THR C C   
2481 O O   . THR C 78  ? 0.4062 0.2550 0.3394 0.0584  0.0663  -0.0426 78  THR C O   
2482 C CB  . THR C 78  ? 0.4661 0.3420 0.3899 0.0329  0.0519  -0.0446 78  THR C CB  
2483 O OG1 . THR C 78  ? 0.5545 0.4137 0.4620 0.0333  0.0590  -0.0533 78  THR C OG1 
2484 C CG2 . THR C 78  ? 0.3919 0.2862 0.3171 0.0279  0.0465  -0.0424 78  THR C CG2 
2485 N N   . LEU C 79  ? 0.3523 0.2122 0.2953 0.0469  0.0520  -0.0325 79  LEU C N   
2486 C CA  . LEU C 79  ? 0.3071 0.1462 0.2481 0.0518  0.0530  -0.0300 79  LEU C CA  
2487 C C   . LEU C 79  ? 0.3390 0.1478 0.2609 0.0502  0.0583  -0.0389 79  LEU C C   
2488 O O   . LEU C 79  ? 0.3823 0.1844 0.2907 0.0377  0.0565  -0.0453 79  LEU C O   
2489 C CB  . LEU C 79  ? 0.3469 0.1870 0.2896 0.0436  0.0454  -0.0239 79  LEU C CB  
2490 C CG  . LEU C 79  ? 0.3384 0.1993 0.2969 0.0471  0.0404  -0.0143 79  LEU C CG  
2491 C CD1 . LEU C 79  ? 0.2689 0.1333 0.2252 0.0363  0.0342  -0.0112 79  LEU C CD1 
2492 C CD2 . LEU C 79  ? 0.2885 0.1437 0.2549 0.0600  0.0417  -0.0073 79  LEU C CD2 
2493 N N   . CYS C 80  ? 0.3693 0.1598 0.2901 0.0632  0.0644  -0.0392 80  CYS C N   
2494 C CA  . CYS C 80  ? 0.4212 0.1781 0.3216 0.0640  0.0708  -0.0489 80  CYS C CA  
2495 C C   . CYS C 80  ? 0.4197 0.1479 0.3040 0.0519  0.0662  -0.0492 80  CYS C C   
2496 O O   . CYS C 80  ? 0.4239 0.1433 0.3121 0.0542  0.0623  -0.0406 80  CYS C O   
2497 C CB  . CYS C 80  ? 0.4185 0.1672 0.3252 0.0833  0.0779  -0.0485 80  CYS C CB  
2498 S SG  . CYS C 80  ? 0.5513 0.2698 0.4376 0.0830  0.0829  -0.0598 80  CYS C SG  
2499 N N   . PHE C 81  ? 0.4350 0.1494 0.3001 0.0378  0.0663  -0.0586 81  PHE C N   
2500 C CA  . PHE C 81  ? 0.5374 0.2259 0.3856 0.0225  0.0623  -0.0598 81  PHE C CA  
2501 C C   . PHE C 81  ? 0.5327 0.1900 0.3703 0.0281  0.0645  -0.0606 81  PHE C C   
2502 O O   . PHE C 81  ? 0.5587 0.1938 0.3837 0.0166  0.0608  -0.0589 81  PHE C O   
2503 C CB  . PHE C 81  ? 0.5679 0.2608 0.4026 0.0037  0.0595  -0.0687 81  PHE C CB  
2504 C CG  . PHE C 81  ? 0.5712 0.3047 0.4218 -0.0043 0.0526  -0.0646 81  PHE C CG  
2505 C CD1 . PHE C 81  ? 0.5529 0.2995 0.4125 -0.0134 0.0463  -0.0572 81  PHE C CD1 
2506 C CD2 . PHE C 81  ? 0.5653 0.3221 0.4202 -0.0025 0.0527  -0.0682 81  PHE C CD2 
2507 C CE1 . PHE C 81  ? 0.4726 0.2547 0.3465 -0.0185 0.0408  -0.0545 81  PHE C CE1 
2508 C CE2 . PHE C 81  ? 0.5085 0.2984 0.3768 -0.0081 0.0460  -0.0642 81  PHE C CE2 
2509 C CZ  . PHE C 81  ? 0.4300 0.2325 0.3084 -0.0151 0.0402  -0.0579 81  PHE C CZ  
2510 N N   . ARG C 82  ? 0.5068 0.1644 0.3501 0.0452  0.0705  -0.0629 82  ARG C N   
2511 C CA  . ARG C 82  ? 0.5472 0.1759 0.3809 0.0524  0.0730  -0.0652 82  ARG C CA  
2512 C C   . ARG C 82  ? 0.6481 0.2748 0.4974 0.0710  0.0726  -0.0553 82  ARG C C   
2513 O O   . ARG C 82  ? 0.6820 0.2859 0.5264 0.0806  0.0746  -0.0566 82  ARG C O   
2514 C CB  . ARG C 82  ? 0.6500 0.2769 0.4759 0.0577  0.0804  -0.0767 82  ARG C CB  
2515 C CG  . ARG C 82  ? 0.6514 0.2670 0.4545 0.0382  0.0793  -0.0866 82  ARG C CG  
2516 C CD  . ARG C 82  ? 0.6811 0.3061 0.4784 0.0414  0.0859  -0.0968 82  ARG C CD  
2517 N NE  . ARG C 82  ? 0.7231 0.3454 0.5011 0.0211  0.0824  -0.1042 82  ARG C NE  
2518 C CZ  . ARG C 82  ? 0.7850 0.4146 0.5527 0.0184  0.0860  -0.1129 82  ARG C CZ  
2519 N NH1 . ARG C 82  ? 0.7667 0.4066 0.5411 0.0343  0.0944  -0.1158 82  ARG C NH1 
2520 N NH2 . ARG C 82  ? 0.8551 0.4836 0.6058 -0.0009 0.0808  -0.1184 82  ARG C NH2 
2521 N N   . ASN C 83  ? 0.5644 0.2151 0.4324 0.0761  0.0694  -0.0455 83  ASN C N   
2522 C CA  . ASN C 83  ? 0.5806 0.2314 0.4628 0.0902  0.0660  -0.0338 83  ASN C CA  
2523 C C   . ASN C 83  ? 0.5998 0.2402 0.4756 0.0774  0.0581  -0.0244 83  ASN C C   
2524 O O   . ASN C 83  ? 0.6024 0.2557 0.4769 0.0643  0.0559  -0.0240 83  ASN C O   
2525 C CB  . ASN C 83  ? 0.5529 0.2402 0.4609 0.1051  0.0676  -0.0286 83  ASN C CB  
2526 C CG  . ASN C 83  ? 0.5974 0.2890 0.5215 0.1194  0.0625  -0.0158 83  ASN C CG  
2527 O OD1 . ASN C 83  ? 0.6637 0.3523 0.5874 0.1138  0.0550  -0.0055 83  ASN C OD1 
2528 N ND2 . ASN C 83  ? 0.5866 0.2870 0.5250 0.1377  0.0663  -0.0163 83  ASN C ND2 
2529 N N   . LEU C 84  ? 0.6100 0.2271 0.4811 0.0810  0.0539  -0.0167 84  LEU C N   
2530 C CA  . LEU C 84  ? 0.6359 0.2402 0.4971 0.0668  0.0468  -0.0073 84  LEU C CA  
2531 C C   . LEU C 84  ? 0.5893 0.2207 0.4628 0.0643  0.0427  0.0016  84  LEU C C   
2532 O O   . LEU C 84  ? 0.5557 0.1880 0.4198 0.0462  0.0406  0.0021  84  LEU C O   
2533 C CB  . LEU C 84  ? 0.6764 0.2553 0.5340 0.0751  0.0424  0.0020  84  LEU C CB  
2534 C CG  . LEU C 84  ? 0.6911 0.2621 0.5414 0.0634  0.0346  0.0151  84  LEU C CG  
2535 C CD1 . LEU C 84  ? 0.7420 0.2889 0.5678 0.0390  0.0341  0.0116  84  LEU C CD1 
2536 C CD2 . LEU C 84  ? 0.6721 0.2311 0.5281 0.0781  0.0289  0.0276  84  LEU C CD2 
2537 N N   . ARG C 85  ? 0.4954 0.1501 0.3899 0.0817  0.0417  0.0083  85  ARG C N   
2538 C CA  . ARG C 85  ? 0.4960 0.1758 0.4017 0.0799  0.0365  0.0181  85  ARG C CA  
2539 C C   . ARG C 85  ? 0.4554 0.1705 0.3697 0.0679  0.0376  0.0107  85  ARG C C   
2540 O O   . ARG C 85  ? 0.4437 0.1741 0.3572 0.0531  0.0329  0.0134  85  ARG C O   
2541 C CB  . ARG C 85  ? 0.5110 0.2113 0.4387 0.1003  0.0339  0.0275  85  ARG C CB  
2542 C CG  . ARG C 85  ? 0.6304 0.3597 0.5690 0.0944  0.0248  0.0388  85  ARG C CG  
2543 C CD  . ARG C 85  ? 0.6780 0.4439 0.6426 0.1086  0.0234  0.0432  85  ARG C CD  
2544 N NE  . ARG C 85  ? 0.7096 0.4850 0.6815 0.1132  0.0134  0.0581  85  ARG C NE  
2545 C CZ  . ARG C 85  ? 0.7288 0.5296 0.7227 0.1284  0.0102  0.0654  85  ARG C CZ  
2546 N NH1 . ARG C 85  ? 0.6825 0.5020 0.6935 0.1405  0.0176  0.0589  85  ARG C NH1 
2547 N NH2 . ARG C 85  ? 0.7880 0.5970 0.7862 0.1307  -0.0005 0.0795  85  ARG C NH2 
2548 N N   . SER C 86  ? 0.4445 0.1720 0.3661 0.0752  0.0440  0.0017  86  SER C N   
2549 C CA  . SER C 86  ? 0.3825 0.1399 0.3106 0.0654  0.0445  -0.0047 86  SER C CA  
2550 C C   . SER C 86  ? 0.3860 0.1339 0.2978 0.0459  0.0438  -0.0116 86  SER C C   
2551 O O   . SER C 86  ? 0.4685 0.2408 0.3854 0.0352  0.0406  -0.0126 86  SER C O   
2552 C CB  . SER C 86  ? 0.3780 0.1461 0.3131 0.0762  0.0521  -0.0125 86  SER C CB  
2553 O OG  . SER C 86  ? 0.4129 0.1487 0.3332 0.0825  0.0593  -0.0204 86  SER C OG  
2554 N N   . ASN C 87  ? 0.4208 0.1331 0.3132 0.0415  0.0466  -0.0165 87  ASN C N   
2555 C CA  . ASN C 87  ? 0.5211 0.2241 0.3977 0.0209  0.0451  -0.0223 87  ASN C CA  
2556 C C   . ASN C 87  ? 0.5047 0.2180 0.3825 0.0078  0.0390  -0.0139 87  ASN C C   
2557 O O   . ASN C 87  ? 0.4918 0.2231 0.3696 -0.0075 0.0369  -0.0172 87  ASN C O   
2558 C CB  . ASN C 87  ? 0.5625 0.2202 0.4153 0.0176  0.0487  -0.0282 87  ASN C CB  
2559 C CG  . ASN C 87  ? 0.5982 0.2474 0.4346 -0.0063 0.0465  -0.0337 87  ASN C CG  
2560 O OD1 . ASN C 87  ? 0.6376 0.2767 0.4664 -0.0193 0.0428  -0.0275 87  ASN C OD1 
2561 N ND2 . ASN C 87  ? 0.6221 0.2770 0.4527 -0.0134 0.0485  -0.0449 87  ASN C ND2 
2562 N N   . GLN C 88  ? 0.5053 0.2083 0.3841 0.0144  0.0361  -0.0030 88  GLN C N   
2563 C CA  . GLN C 88  ? 0.5375 0.2486 0.4149 0.0025  0.0311  0.0056  88  GLN C CA  
2564 C C   . GLN C 88  ? 0.4876 0.2412 0.3825 0.0013  0.0286  0.0064  88  GLN C C   
2565 O O   . GLN C 88  ? 0.4907 0.2594 0.3845 -0.0127 0.0269  0.0068  88  GLN C O   
2566 C CB  . GLN C 88  ? 0.5688 0.2587 0.4419 0.0115  0.0276  0.0181  88  GLN C CB  
2567 C CG  . GLN C 88  ? 0.6369 0.3116 0.4939 -0.0051 0.0242  0.0260  88  GLN C CG  
2568 C CD  . GLN C 88  ? 0.8034 0.4547 0.6540 0.0046  0.0194  0.0397  88  GLN C CD  
2569 O OE1 . GLN C 88  ? 0.9089 0.5546 0.7685 0.0251  0.0188  0.0429  88  GLN C OE1 
2570 N NE2 . GLN C 88  ? 0.8208 0.4602 0.6562 -0.0102 0.0160  0.0485  88  GLN C NE2 
2571 N N   . ILE C 89  ? 0.3874 0.1595 0.2980 0.0158  0.0289  0.0062  89  ILE C N   
2572 C CA  . ILE C 89  ? 0.3710 0.1781 0.2960 0.0153  0.0265  0.0065  89  ILE C CA  
2573 C C   . ILE C 89  ? 0.4309 0.2532 0.3566 0.0063  0.0282  -0.0035 89  ILE C C   
2574 O O   . ILE C 89  ? 0.4373 0.2816 0.3680 -0.0007 0.0261  -0.0041 89  ILE C O   
2575 C CB  . ILE C 89  ? 0.3463 0.1681 0.2868 0.0311  0.0261  0.0094  89  ILE C CB  
2576 C CG1 . ILE C 89  ? 0.3271 0.1399 0.2700 0.0407  0.0225  0.0206  89  ILE C CG1 
2577 C CG2 . ILE C 89  ? 0.2823 0.1351 0.2342 0.0287  0.0235  0.0087  89  ILE C CG2 
2578 C CD1 . ILE C 89  ? 0.3119 0.1462 0.2729 0.0540  0.0209  0.0250  89  ILE C CD1 
2579 N N   . ALA C 90  ? 0.4505 0.2606 0.3702 0.0070  0.0320  -0.0113 90  ALA C N   
2580 C CA  . ALA C 90  ? 0.3893 0.2123 0.3078 -0.0019 0.0323  -0.0201 90  ALA C CA  
2581 C C   . ALA C 90  ? 0.3658 0.1907 0.2775 -0.0190 0.0304  -0.0212 90  ALA C C   
2582 O O   . ALA C 90  ? 0.3022 0.1508 0.2200 -0.0257 0.0286  -0.0248 90  ALA C O   
2583 C CB  . ALA C 90  ? 0.3305 0.1365 0.2397 0.0008  0.0366  -0.0282 90  ALA C CB  
2584 N N   . GLN C 91  ? 0.3453 0.1456 0.2445 -0.0258 0.0310  -0.0175 91  GLN C N   
2585 C CA  . GLN C 91  ? 0.4184 0.2207 0.3103 -0.0443 0.0300  -0.0175 91  GLN C CA  
2586 C C   . GLN C 91  ? 0.3864 0.2166 0.2889 -0.0470 0.0282  -0.0124 91  GLN C C   
2587 O O   . GLN C 91  ? 0.4306 0.2825 0.3368 -0.0586 0.0281  -0.0154 91  GLN C O   
2588 C CB  . GLN C 91  ? 0.5296 0.2942 0.4027 -0.0516 0.0309  -0.0134 91  GLN C CB  
2589 C CG  . GLN C 91  ? 0.5469 0.3113 0.4100 -0.0743 0.0306  -0.0138 91  GLN C CG  
2590 C CD  . GLN C 91  ? 0.5713 0.3402 0.4305 -0.0864 0.0307  -0.0241 91  GLN C CD  
2591 O OE1 . GLN C 91  ? 0.5543 0.3550 0.4227 -0.0976 0.0294  -0.0272 91  GLN C OE1 
2592 N NE2 . GLN C 91  ? 0.6051 0.3429 0.4505 -0.0838 0.0320  -0.0298 91  GLN C NE2 
2593 N N   . LEU C 92  ? 0.3593 0.1896 0.2665 -0.0359 0.0270  -0.0050 92  LEU C N   
2594 C CA  . LEU C 92  ? 0.3895 0.2437 0.3042 -0.0367 0.0255  -0.0011 92  LEU C CA  
2595 C C   . LEU C 92  ? 0.3307 0.2154 0.2588 -0.0346 0.0253  -0.0082 92  LEU C C   
2596 O O   . LEU C 92  ? 0.2942 0.1997 0.2258 -0.0423 0.0261  -0.0102 92  LEU C O   
2597 C CB  . LEU C 92  ? 0.4607 0.3104 0.3784 -0.0243 0.0228  0.0071  92  LEU C CB  
2598 C CG  . LEU C 92  ? 0.5397 0.3818 0.4480 -0.0297 0.0208  0.0169  92  LEU C CG  
2599 C CD1 . LEU C 92  ? 0.6223 0.4369 0.5138 -0.0411 0.0221  0.0200  92  LEU C CD1 
2600 C CD2 . LEU C 92  ? 0.5012 0.3385 0.4134 -0.0163 0.0165  0.0253  92  LEU C CD2 
2601 N N   . LEU C 93  ? 0.3200 0.2068 0.2549 -0.0237 0.0246  -0.0116 93  LEU C N   
2602 C CA  . LEU C 93  ? 0.3198 0.2303 0.2653 -0.0200 0.0234  -0.0169 93  LEU C CA  
2603 C C   . LEU C 93  ? 0.3067 0.2292 0.2528 -0.0295 0.0235  -0.0237 93  LEU C C   
2604 O O   . LEU C 93  ? 0.2438 0.1899 0.1989 -0.0291 0.0222  -0.0267 93  LEU C O   
2605 C CB  . LEU C 93  ? 0.3031 0.2102 0.2528 -0.0082 0.0230  -0.0178 93  LEU C CB  
2606 C CG  . LEU C 93  ? 0.2855 0.1892 0.2390 0.0013  0.0220  -0.0109 93  LEU C CG  
2607 C CD1 . LEU C 93  ? 0.2873 0.1905 0.2457 0.0112  0.0229  -0.0119 93  LEU C CD1 
2608 C CD2 . LEU C 93  ? 0.2292 0.1492 0.1874 0.0010  0.0194  -0.0084 93  LEU C CD2 
2609 N N   . ARG C 94  ? 0.3771 0.2834 0.3136 -0.0377 0.0245  -0.0263 94  ARG C N   
2610 C CA  . ARG C 94  ? 0.3916 0.3106 0.3283 -0.0487 0.0232  -0.0325 94  ARG C CA  
2611 C C   . ARG C 94  ? 0.3604 0.2992 0.3013 -0.0608 0.0240  -0.0317 94  ARG C C   
2612 O O   . ARG C 94  ? 0.3341 0.3005 0.2851 -0.0645 0.0224  -0.0358 94  ARG C O   
2613 C CB  . ARG C 94  ? 0.4316 0.3248 0.3535 -0.0567 0.0240  -0.0361 94  ARG C CB  
2614 C CG  . ARG C 94  ? 0.5077 0.4140 0.4295 -0.0644 0.0209  -0.0433 94  ARG C CG  
2615 C CD  . ARG C 94  ? 0.5839 0.4628 0.4871 -0.0767 0.0216  -0.0478 94  ARG C CD  
2616 N NE  . ARG C 94  ? 0.6239 0.5004 0.5214 -0.0948 0.0220  -0.0463 94  ARG C NE  
2617 C CZ  . ARG C 94  ? 0.7153 0.5564 0.5943 -0.1039 0.0243  -0.0455 94  ARG C CZ  
2618 N NH1 . ARG C 94  ? 0.7277 0.5680 0.6008 -0.1228 0.0244  -0.0433 94  ARG C NH1 
2619 N NH2 . ARG C 94  ? 0.7700 0.5761 0.6359 -0.0941 0.0268  -0.0468 94  ARG C NH2 
2620 N N   . ASN C 95  ? 0.2809 0.2073 0.2143 -0.0667 0.0266  -0.0260 95  ASN C N   
2621 C CA  . ASN C 95  ? 0.3077 0.2533 0.2435 -0.0790 0.0290  -0.0247 95  ASN C CA  
2622 C C   . ASN C 95  ? 0.3330 0.3091 0.2833 -0.0698 0.0296  -0.0260 95  ASN C C   
2623 O O   . ASN C 95  ? 0.3956 0.4007 0.3554 -0.0758 0.0313  -0.0294 95  ASN C O   
2624 C CB  . ASN C 95  ? 0.3041 0.2265 0.2253 -0.0866 0.0313  -0.0168 95  ASN C CB  
2625 C CG  . ASN C 95  ? 0.4291 0.3156 0.3334 -0.0950 0.0308  -0.0155 95  ASN C CG  
2626 O OD1 . ASN C 95  ? 0.4765 0.3590 0.3787 -0.1003 0.0296  -0.0217 95  ASN C OD1 
2627 N ND2 . ASN C 95  ? 0.4182 0.2765 0.3085 -0.0963 0.0313  -0.0074 95  ASN C ND2 
2628 N N   . ALA C 96  ? 0.2480 0.2173 0.1998 -0.0553 0.0283  -0.0237 96  ALA C N   
2629 C CA  . ALA C 96  ? 0.2365 0.2270 0.1983 -0.0456 0.0284  -0.0256 96  ALA C CA  
2630 C C   . ALA C 96  ? 0.2715 0.2843 0.2463 -0.0404 0.0261  -0.0322 96  ALA C C   
2631 O O   . ALA C 96  ? 0.3146 0.3521 0.2992 -0.0375 0.0275  -0.0357 96  ALA C O   
2632 C CB  . ALA C 96  ? 0.2250 0.2010 0.1844 -0.0334 0.0262  -0.0218 96  ALA C CB  
2633 N N   . GLY C 97  ? 0.2509 0.2543 0.2247 -0.0385 0.0226  -0.0339 97  GLY C N   
2634 C CA  . GLY C 97  ? 0.2514 0.2729 0.2347 -0.0343 0.0187  -0.0387 97  GLY C CA  
2635 C C   . GLY C 97  ? 0.2130 0.2599 0.2040 -0.0455 0.0187  -0.0422 97  GLY C C   
2636 O O   . GLY C 97  ? 0.2039 0.2775 0.2082 -0.0399 0.0163  -0.0454 97  GLY C O   
2637 N N   . ASP C 98  ? 0.2583 0.2972 0.2412 -0.0615 0.0210  -0.0413 98  ASP C N   
2638 C CA  . ASP C 98  ? 0.3135 0.3784 0.3035 -0.0762 0.0212  -0.0440 98  ASP C CA  
2639 C C   . ASP C 98  ? 0.3114 0.4101 0.3163 -0.0732 0.0253  -0.0450 98  ASP C C   
2640 O O   . ASP C 98  ? 0.2894 0.4225 0.3093 -0.0768 0.0244  -0.0483 98  ASP C O   
2641 C CB  . ASP C 98  ? 0.3997 0.4448 0.3747 -0.0956 0.0239  -0.0417 98  ASP C CB  
2642 C CG  . ASP C 98  ? 0.5146 0.5314 0.4755 -0.1010 0.0202  -0.0435 98  ASP C CG  
2643 O OD1 . ASP C 98  ? 0.5514 0.5726 0.5158 -0.0933 0.0153  -0.0471 98  ASP C OD1 
2644 O OD2 . ASP C 98  ? 0.5573 0.5457 0.5016 -0.1132 0.0222  -0.0414 98  ASP C OD2 
2645 N N   . ALA C 99  ? 0.3623 0.4523 0.3631 -0.0663 0.0298  -0.0423 99  ALA C N   
2646 C CA  . ALA C 99  ? 0.3514 0.4691 0.3622 -0.0630 0.0355  -0.0443 99  ALA C CA  
2647 C C   . ALA C 99  ? 0.3970 0.5381 0.4244 -0.0456 0.0329  -0.0493 99  ALA C C   
2648 O O   . ALA C 99  ? 0.4577 0.6290 0.4976 -0.0420 0.0375  -0.0530 99  ALA C O   
2649 C CB  . ALA C 99  ? 0.3084 0.4067 0.3065 -0.0605 0.0398  -0.0405 99  ALA C CB  
2650 N N   . THR C 100 ? 0.3576 0.4844 0.3843 -0.0343 0.0260  -0.0493 100 THR C N   
2651 C CA  . THR C 100 ? 0.3238 0.4668 0.3632 -0.0173 0.0222  -0.0526 100 THR C CA  
2652 C C   . THR C 100 ? 0.3656 0.5449 0.4226 -0.0198 0.0191  -0.0556 100 THR C C   
2653 O O   . THR C 100 ? 0.4558 0.6577 0.5274 -0.0058 0.0174  -0.0585 100 THR C O   
2654 C CB  . THR C 100 ? 0.2727 0.3905 0.3047 -0.0068 0.0153  -0.0506 100 THR C CB  
2655 O OG1 . THR C 100 ? 0.2378 0.3555 0.2690 -0.0136 0.0093  -0.0502 100 THR C OG1 
2656 C CG2 . THR C 100 ? 0.3069 0.3918 0.3232 -0.0074 0.0174  -0.0467 100 THR C CG2 
2657 N N   . LYS C 101 ? 0.3130 0.4973 0.3684 -0.0376 0.0178  -0.0548 101 LYS C N   
2658 C CA  . LYS C 101 ? 0.3214 0.5421 0.3933 -0.0435 0.0132  -0.0570 101 LYS C CA  
2659 C C   . LYS C 101 ? 0.3088 0.5727 0.4012 -0.0411 0.0193  -0.0601 101 LYS C C   
2660 O O   . LYS C 101 ? 0.3109 0.6081 0.4232 -0.0308 0.0151  -0.0623 101 LYS C O   
2661 C CB  . LYS C 101 ? 0.3368 0.5510 0.3992 -0.0669 0.0114  -0.0559 101 LYS C CB  
2662 C CG  . LYS C 101 ? 0.3636 0.6155 0.4417 -0.0754 0.0047  -0.0579 101 LYS C CG  
2663 C CD  . LYS C 101 ? 0.4518 0.7081 0.5241 -0.1029 0.0065  -0.0578 101 LYS C CD  
2664 C CE  . LYS C 101 ? 0.5630 0.8630 0.6532 -0.1129 -0.0010 -0.0596 101 LYS C CE  
2665 N NZ  . LYS C 101 ? 0.6297 0.9360 0.7140 -0.1427 0.0005  -0.0596 101 LYS C NZ  
2666 N N   . ASP C 102 ? 0.3255 0.5896 0.4130 -0.0501 0.0294  -0.0600 102 ASP C N   
2667 C CA  . ASP C 102 ? 0.3560 0.6610 0.4611 -0.0480 0.0378  -0.0636 102 ASP C CA  
2668 C C   . ASP C 102 ? 0.3612 0.6583 0.4643 -0.0283 0.0439  -0.0666 102 ASP C C   
2669 O O   . ASP C 102 ? 0.3871 0.7115 0.4995 -0.0257 0.0534  -0.0706 102 ASP C O   
2670 C CB  . ASP C 102 ? 0.3818 0.6959 0.4813 -0.0726 0.0460  -0.0618 102 ASP C CB  
2671 C CG  . ASP C 102 ? 0.4099 0.7542 0.5213 -0.0919 0.0421  -0.0615 102 ASP C CG  
2672 O OD1 . ASP C 102 ? 0.4404 0.8351 0.5771 -0.0897 0.0439  -0.0647 102 ASP C OD1 
2673 O OD2 . ASP C 102 ? 0.4326 0.7510 0.5283 -0.1091 0.0371  -0.0583 102 ASP C OD2 
2674 N N   . GLY C 103 ? 0.3368 0.5967 0.4264 -0.0154 0.0389  -0.0651 103 GLY C N   
2675 C CA  . GLY C 103 ? 0.2978 0.5455 0.3828 0.0024  0.0428  -0.0683 103 GLY C CA  
2676 C C   . GLY C 103 ? 0.2666 0.5027 0.3366 -0.0053 0.0527  -0.0683 103 GLY C C   
2677 O O   . GLY C 103 ? 0.2388 0.4847 0.3103 0.0048  0.0600  -0.0736 103 GLY C O   
2678 N N   . PHE C 104 ? 0.1993 0.4128 0.2533 -0.0226 0.0527  -0.0625 104 PHE C N   
2679 C CA  . PHE C 104 ? 0.2882 0.4897 0.3257 -0.0321 0.0606  -0.0605 104 PHE C CA  
2680 C C   . PHE C 104 ? 0.2797 0.4398 0.2975 -0.0271 0.0568  -0.0564 104 PHE C C   
2681 O O   . PHE C 104 ? 0.2693 0.4163 0.2714 -0.0339 0.0612  -0.0537 104 PHE C O   
2682 C CB  . PHE C 104 ? 0.2856 0.4904 0.3174 -0.0558 0.0634  -0.0555 104 PHE C CB  
2683 C CG  . PHE C 104 ? 0.2652 0.5151 0.3155 -0.0652 0.0688  -0.0590 104 PHE C CG  
2684 C CD1 . PHE C 104 ? 0.2840 0.5715 0.3538 -0.0516 0.0741  -0.0664 104 PHE C CD1 
2685 C CD2 . PHE C 104 ? 0.2503 0.5052 0.2986 -0.0879 0.0686  -0.0548 104 PHE C CD2 
2686 C CE1 . PHE C 104 ? 0.3082 0.6431 0.3983 -0.0601 0.0794  -0.0693 104 PHE C CE1 
2687 C CE2 . PHE C 104 ? 0.2834 0.5833 0.3498 -0.0991 0.0733  -0.0575 104 PHE C CE2 
2688 C CZ  . PHE C 104 ? 0.3109 0.6537 0.3998 -0.0850 0.0788  -0.0646 104 PHE C CZ  
2689 N N   . LEU C 105 ? 0.2586 0.4001 0.2771 -0.0162 0.0483  -0.0554 105 LEU C N   
2690 C CA  . LEU C 105 ? 0.2936 0.4004 0.2965 -0.0125 0.0442  -0.0511 105 LEU C CA  
2691 C C   . LEU C 105 ? 0.2670 0.3670 0.2691 0.0042  0.0426  -0.0553 105 LEU C C   
2692 O O   . LEU C 105 ? 0.2757 0.3783 0.2870 0.0157  0.0377  -0.0577 105 LEU C O   
2693 C CB  . LEU C 105 ? 0.3375 0.4246 0.3383 -0.0150 0.0368  -0.0461 105 LEU C CB  
2694 C CG  . LEU C 105 ? 0.3943 0.4520 0.3845 -0.0084 0.0321  -0.0420 105 LEU C CG  
2695 C CD1 . LEU C 105 ? 0.3897 0.4318 0.3657 -0.0159 0.0344  -0.0367 105 LEU C CD1 
2696 C CD2 . LEU C 105 ? 0.4364 0.4802 0.4270 -0.0081 0.0263  -0.0391 105 LEU C CD2 
2697 N N   . LYS C 106 ? 0.2851 0.3741 0.2741 0.0045  0.0461  -0.0559 106 LYS C N   
2698 C CA  . LYS C 106 ? 0.3477 0.4245 0.3315 0.0179  0.0445  -0.0603 106 LYS C CA  
2699 C C   . LYS C 106 ? 0.3144 0.3625 0.2894 0.0191  0.0362  -0.0543 106 LYS C C   
2700 O O   . LYS C 106 ? 0.3483 0.3867 0.3250 0.0295  0.0312  -0.0558 106 LYS C O   
2701 C CB  . LYS C 106 ? 0.3984 0.4760 0.3693 0.0165  0.0519  -0.0648 106 LYS C CB  
2702 C CG  . LYS C 106 ? 0.4319 0.4975 0.3963 0.0305  0.0516  -0.0719 106 LYS C CG  
2703 C CD  . LYS C 106 ? 0.4545 0.5414 0.4222 0.0379  0.0618  -0.0823 106 LYS C CD  
2704 C CE  . LYS C 106 ? 0.4862 0.5672 0.4334 0.0298  0.0688  -0.0849 106 LYS C CE  
2705 N NZ  . LYS C 106 ? 0.5295 0.5775 0.4567 0.0315  0.0628  -0.0847 106 LYS C NZ  
2706 N N   . GLU C 107 ? 0.3081 0.3434 0.2739 0.0085  0.0348  -0.0471 107 GLU C N   
2707 C CA  . GLU C 107 ? 0.3161 0.3292 0.2756 0.0092  0.0280  -0.0411 107 GLU C CA  
2708 C C   . GLU C 107 ? 0.3206 0.3256 0.2774 -0.0002 0.0264  -0.0327 107 GLU C C   
2709 O O   . GLU C 107 ? 0.2144 0.2225 0.1655 -0.0093 0.0301  -0.0302 107 GLU C O   
2710 C CB  . GLU C 107 ? 0.3304 0.3310 0.2763 0.0107  0.0269  -0.0422 107 GLU C CB  
2711 C CG  . GLU C 107 ? 0.3457 0.3285 0.2861 0.0088  0.0199  -0.0349 107 GLU C CG  
2712 C CD  . GLU C 107 ? 0.3527 0.3244 0.2788 0.0077  0.0177  -0.0362 107 GLU C CD  
2713 O OE1 . GLU C 107 ? 0.3846 0.3579 0.3038 0.0110  0.0218  -0.0443 107 GLU C OE1 
2714 O OE2 . GLU C 107 ? 0.2309 0.1929 0.1526 0.0036  0.0119  -0.0294 107 GLU C OE2 
2715 N N   . VAL C 108 ? 0.2818 0.2754 0.2418 0.0024  0.0214  -0.0285 108 VAL C N   
2716 C CA  . VAL C 108 ? 0.3077 0.2893 0.2645 -0.0027 0.0195  -0.0207 108 VAL C CA  
2717 C C   . VAL C 108 ? 0.3587 0.3292 0.3143 0.0022  0.0143  -0.0164 108 VAL C C   
2718 O O   . VAL C 108 ? 0.3517 0.3216 0.3117 0.0082  0.0120  -0.0188 108 VAL C O   
2719 C CB  . VAL C 108 ? 0.3379 0.3189 0.3006 -0.0048 0.0201  -0.0205 108 VAL C CB  
2720 C CG1 . VAL C 108 ? 0.3309 0.3124 0.3008 0.0027  0.0173  -0.0235 108 VAL C CG1 
2721 C CG2 . VAL C 108 ? 0.3874 0.3524 0.3449 -0.0086 0.0192  -0.0132 108 VAL C CG2 
2722 N N   . SER C 109 ? 0.3509 0.3138 0.3007 -0.0011 0.0119  -0.0093 109 SER C N   
2723 C CA  . SER C 109 ? 0.3070 0.2650 0.2574 0.0020  0.0066  -0.0048 109 SER C CA  
2724 C C   . SER C 109 ? 0.3143 0.2664 0.2657 0.0015  0.0037  0.0046  109 SER C C   
2725 O O   . SER C 109 ? 0.2767 0.2250 0.2213 -0.0031 0.0038  0.0093  109 SER C O   
2726 C CB  . SER C 109 ? 0.3349 0.2934 0.2759 -0.0003 0.0045  -0.0068 109 SER C CB  
2727 O OG  . SER C 109 ? 0.3713 0.3329 0.3114 0.0031  0.0073  -0.0158 109 SER C OG  
2728 N N   . LEU C 110 ? 0.3559 0.3077 0.3157 0.0066  0.0012  0.0078  110 LEU C N   
2729 C CA  . LEU C 110 ? 0.3569 0.3069 0.3208 0.0090  -0.0022 0.0168  110 LEU C CA  
2730 C C   . LEU C 110 ? 0.3039 0.2594 0.2639 0.0053  -0.0087 0.0217  110 LEU C C   
2731 O O   . LEU C 110 ? 0.2209 0.1814 0.1820 0.0042  -0.0111 0.0194  110 LEU C O   
2732 C CB  . LEU C 110 ? 0.3583 0.3104 0.3342 0.0161  -0.0010 0.0176  110 LEU C CB  
2733 C CG  . LEU C 110 ? 0.4308 0.3857 0.4151 0.0216  -0.0039 0.0266  110 LEU C CG  
2734 C CD1 . LEU C 110 ? 0.4702 0.4124 0.4505 0.0239  -0.0029 0.0310  110 LEU C CD1 
2735 C CD2 . LEU C 110 ? 0.4329 0.3941 0.4292 0.0282  -0.0009 0.0257  110 LEU C CD2 
2736 N N   . VAL C 111 ? 0.3543 0.3071 0.3074 0.0022  -0.0120 0.0287  111 VAL C N   
2737 C CA  . VAL C 111 ? 0.3123 0.2700 0.2576 -0.0035 -0.0190 0.0331  111 VAL C CA  
2738 C C   . VAL C 111 ? 0.2875 0.2509 0.2407 -0.0002 -0.0264 0.0449  111 VAL C C   
2739 O O   . VAL C 111 ? 0.3386 0.2956 0.2914 0.0031  -0.0274 0.0522  111 VAL C O   
2740 C CB  . VAL C 111 ? 0.2818 0.2342 0.2090 -0.0115 -0.0179 0.0319  111 VAL C CB  
2741 C CG1 . VAL C 111 ? 0.2588 0.2147 0.1743 -0.0186 -0.0255 0.0359  111 VAL C CG1 
2742 C CG2 . VAL C 111 ? 0.2415 0.1932 0.1640 -0.0132 -0.0101 0.0200  111 VAL C CG2 
2743 N N   . ILE C 112 ? 0.2345 0.2100 0.1950 -0.0013 -0.0321 0.0472  112 ILE C N   
2744 C CA  . ILE C 112 ? 0.2519 0.2397 0.2240 0.0024  -0.0398 0.0587  112 ILE C CA  
2745 C C   . ILE C 112 ? 0.2917 0.2849 0.2519 -0.0071 -0.0499 0.0648  112 ILE C C   
2746 O O   . ILE C 112 ? 0.2686 0.2633 0.2188 -0.0166 -0.0524 0.0595  112 ILE C O   
2747 C CB  . ILE C 112 ? 0.2957 0.2994 0.2864 0.0059  -0.0400 0.0589  112 ILE C CB  
2748 C CG1 . ILE C 112 ? 0.4250 0.4244 0.4267 0.0158  -0.0305 0.0542  112 ILE C CG1 
2749 C CG2 . ILE C 112 ? 0.2844 0.3074 0.2888 0.0084  -0.0491 0.0709  112 ILE C CG2 
2750 C CD1 . ILE C 112 ? 0.5659 0.5795 0.5816 0.0169  -0.0285 0.0525  112 ILE C CD1 
2751 N N   . THR C 113 ? 0.2664 0.2600 0.2254 -0.0045 -0.0563 0.0761  113 THR C N   
2752 C CA  . THR C 113 ? 0.3185 0.3183 0.2650 -0.0138 -0.0675 0.0836  113 THR C CA  
2753 C C   . THR C 113 ? 0.3848 0.4021 0.3485 -0.0068 -0.0780 0.0981  113 THR C C   
2754 O O   . THR C 113 ? 0.2819 0.3032 0.2655 0.0069  -0.0750 0.1019  113 THR C O   
2755 C CB  . THR C 113 ? 0.3264 0.3093 0.2484 -0.0201 -0.0667 0.0847  113 THR C CB  
2756 O OG1 . THR C 113 ? 0.3091 0.2821 0.2347 -0.0110 -0.0659 0.0932  113 THR C OG1 
2757 C CG2 . THR C 113 ? 0.3827 0.3535 0.2914 -0.0253 -0.0556 0.0704  113 THR C CG2 
2758 N N   . ASN C 114 ? 0.4264 0.4549 0.3821 -0.0158 -0.0903 0.1057  114 ASN C N   
2759 C CA  . ASN C 114 ? 0.4602 0.5080 0.4315 -0.0092 -0.1025 0.1212  114 ASN C CA  
2760 C C   . ASN C 114 ? 0.4438 0.4761 0.4106 0.0012  -0.1037 0.1313  114 ASN C C   
2761 O O   . ASN C 114 ? 0.4211 0.4586 0.4084 0.0173  -0.1044 0.1393  114 ASN C O   
2762 C CB  . ASN C 114 ? 0.5548 0.6176 0.5148 -0.0238 -0.1170 0.1272  114 ASN C CB  
2763 C CG  . ASN C 114 ? 0.6208 0.7042 0.5919 -0.0328 -0.1195 0.1220  114 ASN C CG  
2764 O OD1 . ASN C 114 ? 0.6280 0.7352 0.6274 -0.0252 -0.1210 0.1267  114 ASN C OD1 
2765 N ND2 . ASN C 114 ? 0.6459 0.7194 0.5937 -0.0493 -0.1197 0.1122  114 ASN C ND2 
2766 N N   . ASN C 115 ? 0.4673 0.4794 0.4057 -0.0083 -0.1036 0.1308  115 ASN C N   
2767 C CA  . ASN C 115 ? 0.4710 0.4638 0.3980 -0.0029 -0.1055 0.1411  115 ASN C CA  
2768 C C   . ASN C 115 ? 0.4518 0.4184 0.3624 -0.0064 -0.0918 0.1312  115 ASN C C   
2769 O O   . ASN C 115 ? 0.5158 0.4807 0.4171 -0.0160 -0.0835 0.1176  115 ASN C O   
2770 C CB  . ASN C 115 ? 0.4891 0.4839 0.3947 -0.0135 -0.1195 0.1530  115 ASN C CB  
2771 C CG  . ASN C 115 ? 0.5364 0.5584 0.4605 -0.0080 -0.1354 0.1667  115 ASN C CG  
2772 O OD1 . ASN C 115 ? 0.5808 0.6087 0.5278 0.0094  -0.1380 0.1757  115 ASN C OD1 
2773 N ND2 . ASN C 115 ? 0.5534 0.5921 0.4686 -0.0226 -0.1443 0.1658  115 ASN C ND2 
2774 N N   . GLU C 116 ? 0.4247 0.3709 0.3320 0.0015  -0.0899 0.1384  116 GLU C N   
2775 C CA  . GLU C 116 ? 0.4665 0.3888 0.3577 -0.0038 -0.0781 0.1309  116 GLU C CA  
2776 C C   . GLU C 116 ? 0.5017 0.4199 0.3640 -0.0220 -0.0773 0.1280  116 GLU C C   
2777 O O   . GLU C 116 ? 0.6011 0.5204 0.4472 -0.0288 -0.0878 0.1388  116 GLU C O   
2778 C CB  . GLU C 116 ? 0.5797 0.4772 0.4679 0.0054  -0.0785 0.1413  116 GLU C CB  
2779 C CG  . GLU C 116 ? 0.6882 0.5610 0.5579 -0.0036 -0.0675 0.1352  116 GLU C CG  
2780 C CD  . GLU C 116 ? 0.7749 0.6183 0.6409 0.0050  -0.0674 0.1441  116 GLU C CD  
2781 O OE1 . GLU C 116 ? 0.8279 0.6650 0.6956 0.0154  -0.0782 0.1591  116 GLU C OE1 
2782 O OE2 . GLU C 116 ? 0.7759 0.6017 0.6370 0.0016  -0.0569 0.1362  116 GLU C OE2 
2783 N N   . GLY C 117 ? 0.3850 0.3004 0.2412 -0.0295 -0.0649 0.1134  117 GLY C N   
2784 C CA  . GLY C 117 ? 0.3982 0.3101 0.2278 -0.0452 -0.0608 0.1089  117 GLY C CA  
2785 C C   . GLY C 117 ? 0.4795 0.4066 0.3010 -0.0537 -0.0630 0.1009  117 GLY C C   
2786 O O   . GLY C 117 ? 0.5546 0.4796 0.3531 -0.0659 -0.0584 0.0954  117 GLY C O   
2787 N N   . ASP C 118 ? 0.3931 0.3347 0.2320 -0.0480 -0.0692 0.0997  118 ASP C N   
2788 C CA  . ASP C 118 ? 0.3837 0.3357 0.2135 -0.0570 -0.0718 0.0914  118 ASP C CA  
2789 C C   . ASP C 118 ? 0.3877 0.3369 0.2146 -0.0593 -0.0583 0.0735  118 ASP C C   
2790 O O   . ASP C 118 ? 0.3441 0.2921 0.1883 -0.0508 -0.0499 0.0671  118 ASP C O   
2791 C CB  . ASP C 118 ? 0.3653 0.3339 0.2157 -0.0520 -0.0815 0.0949  118 ASP C CB  
2792 C CG  . ASP C 118 ? 0.4719 0.4492 0.3256 -0.0501 -0.0968 0.1127  118 ASP C CG  
2793 O OD1 . ASP C 118 ? 0.5143 0.4821 0.3488 -0.0546 -0.1013 0.1223  118 ASP C OD1 
2794 O OD2 . ASP C 118 ? 0.4339 0.4290 0.3097 -0.0442 -0.1044 0.1176  118 ASP C OD2 
2795 N N   . LEU C 119 ? 0.3781 0.3261 0.1822 -0.0701 -0.0565 0.0652  119 LEU C N   
2796 C CA  . LEU C 119 ? 0.3699 0.3156 0.1706 -0.0704 -0.0441 0.0481  119 LEU C CA  
2797 C C   . LEU C 119 ? 0.3524 0.3020 0.1687 -0.0651 -0.0454 0.0403  119 LEU C C   
2798 O O   . LEU C 119 ? 0.3345 0.2832 0.1641 -0.0576 -0.0368 0.0313  119 LEU C O   
2799 C CB  . LEU C 119 ? 0.4655 0.4072 0.2354 -0.0824 -0.0408 0.0408  119 LEU C CB  
2800 C CG  . LEU C 119 ? 0.5910 0.5289 0.3412 -0.0900 -0.0355 0.0453  119 LEU C CG  
2801 C CD1 . LEU C 119 ? 0.6561 0.5922 0.3776 -0.1000 -0.0280 0.0335  119 LEU C CD1 
2802 C CD2 . LEU C 119 ? 0.5967 0.5342 0.3623 -0.0838 -0.0249 0.0444  119 LEU C CD2 
2803 N N   . GLU C 120 ? 0.3844 0.3387 0.1980 -0.0703 -0.0569 0.0447  120 GLU C N   
2804 C CA  . GLU C 120 ? 0.4052 0.3617 0.2291 -0.0692 -0.0591 0.0383  120 GLU C CA  
2805 C C   . GLU C 120 ? 0.3917 0.3591 0.2460 -0.0594 -0.0621 0.0459  120 GLU C C   
2806 O O   . GLU C 120 ? 0.3272 0.3058 0.1920 -0.0581 -0.0714 0.0590  120 GLU C O   
2807 C CB  . GLU C 120 ? 0.5102 0.4676 0.3165 -0.0821 -0.0701 0.0390  120 GLU C CB  
2808 C CG  . GLU C 120 ? 0.5461 0.5030 0.3592 -0.0843 -0.0730 0.0328  120 GLU C CG  
2809 C CD  . GLU C 120 ? 0.6019 0.5605 0.3979 -0.0995 -0.0857 0.0351  120 GLU C CD  
2810 O OE1 . GLU C 120 ? 0.5864 0.5632 0.3969 -0.1024 -0.0976 0.0478  120 GLU C OE1 
2811 O OE2 . GLU C 120 ? 0.6644 0.6072 0.4325 -0.1086 -0.0839 0.0239  120 GLU C OE2 
2812 N N   . ALA C 121 ? 0.3825 0.3472 0.2503 -0.0520 -0.0542 0.0376  121 ALA C N   
2813 C CA  . ALA C 121 ? 0.3673 0.3413 0.2617 -0.0425 -0.0543 0.0429  121 ALA C CA  
2814 C C   . ALA C 121 ? 0.3791 0.3639 0.2835 -0.0465 -0.0619 0.0455  121 ALA C C   
2815 O O   . ALA C 121 ? 0.3446 0.3239 0.2350 -0.0561 -0.0651 0.0394  121 ALA C O   
2816 C CB  . ALA C 121 ? 0.3100 0.2770 0.2127 -0.0339 -0.0429 0.0338  121 ALA C CB  
2817 N N   . ILE C 122 ? 0.3856 0.3854 0.3135 -0.0393 -0.0645 0.0544  122 ILE C N   
2818 C CA  . ILE C 122 ? 0.3660 0.3809 0.3092 -0.0420 -0.0693 0.0573  122 ILE C CA  
2819 C C   . ILE C 122 ? 0.2991 0.3059 0.2472 -0.0387 -0.0604 0.0478  122 ILE C C   
2820 O O   . ILE C 122 ? 0.3180 0.3234 0.2625 -0.0468 -0.0625 0.0441  122 ILE C O   
2821 C CB  . ILE C 122 ? 0.4650 0.5023 0.4339 -0.0331 -0.0734 0.0700  122 ILE C CB  
2822 C CG1 . ILE C 122 ? 0.4854 0.5356 0.4513 -0.0382 -0.0864 0.0817  122 ILE C CG1 
2823 C CG2 . ILE C 122 ? 0.5036 0.5578 0.4926 -0.0330 -0.0726 0.0706  122 ILE C CG2 
2824 C CD1 . ILE C 122 ? 0.4987 0.5689 0.4895 -0.0254 -0.0904 0.0949  122 ILE C CD1 
2825 N N   . GLU C 123 ? 0.2660 0.2658 0.2203 -0.0276 -0.0511 0.0444  123 GLU C N   
2826 C CA  . GLU C 123 ? 0.2555 0.2500 0.2164 -0.0227 -0.0434 0.0376  123 GLU C CA  
2827 C C   . GLU C 123 ? 0.2251 0.2069 0.1819 -0.0150 -0.0346 0.0311  123 GLU C C   
2828 O O   . GLU C 123 ? 0.2309 0.2127 0.1900 -0.0102 -0.0331 0.0351  123 GLU C O   
2829 C CB  . GLU C 123 ? 0.2767 0.2883 0.2602 -0.0171 -0.0426 0.0440  123 GLU C CB  
2830 C CG  . GLU C 123 ? 0.2938 0.3005 0.2819 -0.0135 -0.0351 0.0379  123 GLU C CG  
2831 C CD  . GLU C 123 ? 0.3209 0.3468 0.3290 -0.0103 -0.0338 0.0437  123 GLU C CD  
2832 O OE1 . GLU C 123 ? 0.3858 0.4226 0.3969 -0.0196 -0.0381 0.0465  123 GLU C OE1 
2833 O OE2 . GLU C 123 ? 0.3099 0.3400 0.3299 0.0007  -0.0279 0.0451  123 GLU C OE2 
2834 N N   . VAL C 124 ? 0.2223 0.1932 0.1728 -0.0145 -0.0296 0.0218  124 VAL C N   
2835 C CA  . VAL C 124 ? 0.2178 0.1804 0.1653 -0.0086 -0.0221 0.0150  124 VAL C CA  
2836 C C   . VAL C 124 ? 0.3113 0.2708 0.2654 -0.0032 -0.0175 0.0100  124 VAL C C   
2837 O O   . VAL C 124 ? 0.3209 0.2764 0.2722 -0.0058 -0.0194 0.0078  124 VAL C O   
2838 C CB  . VAL C 124 ? 0.2680 0.2213 0.1976 -0.0126 -0.0208 0.0075  124 VAL C CB  
2839 C CG1 . VAL C 124 ? 0.3266 0.2759 0.2564 -0.0065 -0.0130 -0.0009 124 VAL C CG1 
2840 C CG2 . VAL C 124 ? 0.2402 0.1958 0.1610 -0.0175 -0.0234 0.0124  124 VAL C CG2 
2841 N N   . PHE C 125 ? 0.2612 0.2213 0.2222 0.0031  -0.0120 0.0088  125 PHE C N   
2842 C CA  . PHE C 125 ? 0.2570 0.2138 0.2209 0.0077  -0.0080 0.0033  125 PHE C CA  
2843 C C   . PHE C 125 ? 0.2004 0.1542 0.1594 0.0097  -0.0038 -0.0036 125 PHE C C   
2844 O O   . PHE C 125 ? 0.1923 0.1480 0.1537 0.0102  -0.0007 -0.0029 125 PHE C O   
2845 C CB  . PHE C 125 ? 0.2703 0.2318 0.2457 0.0122  -0.0051 0.0067  125 PHE C CB  
2846 C CG  . PHE C 125 ? 0.2180 0.1876 0.2011 0.0110  -0.0075 0.0127  125 PHE C CG  
2847 C CD1 . PHE C 125 ? 0.2149 0.1937 0.2046 0.0102  -0.0109 0.0201  125 PHE C CD1 
2848 C CD2 . PHE C 125 ? 0.2326 0.2023 0.2167 0.0102  -0.0067 0.0116  125 PHE C CD2 
2849 C CE1 . PHE C 125 ? 0.2079 0.2000 0.2080 0.0088  -0.0130 0.0259  125 PHE C CE1 
2850 C CE2 . PHE C 125 ? 0.2057 0.1863 0.1977 0.0073  -0.0080 0.0173  125 PHE C CE2 
2851 C CZ  . PHE C 125 ? 0.1972 0.1910 0.1986 0.0067  -0.0109 0.0242  125 PHE C CZ  
2852 N N   . SER C 126 ? 0.1988 0.1478 0.1511 0.0107  -0.0038 -0.0101 126 SER C N   
2853 C CA  . SER C 126 ? 0.3100 0.2612 0.2594 0.0131  0.0002  -0.0169 126 SER C CA  
2854 C C   . SER C 126 ? 0.3142 0.2673 0.2690 0.0194  0.0019  -0.0217 126 SER C C   
2855 O O   . SER C 126 ? 0.2726 0.2190 0.2262 0.0226  -0.0009 -0.0223 126 SER C O   
2856 C CB  . SER C 126 ? 0.3158 0.2618 0.2530 0.0114  -0.0002 -0.0217 126 SER C CB  
2857 O OG  . SER C 126 ? 0.3372 0.2726 0.2695 0.0148  -0.0029 -0.0254 126 SER C OG  
2858 N N   . MET C 127 ? 0.3051 0.2675 0.2649 0.0202  0.0058  -0.0245 127 MET C N   
2859 C CA  . MET C 127 ? 0.2641 0.2327 0.2295 0.0258  0.0065  -0.0294 127 MET C CA  
2860 C C   . MET C 127 ? 0.2813 0.2605 0.2470 0.0279  0.0103  -0.0358 127 MET C C   
2861 O O   . MET C 127 ? 0.2543 0.2422 0.2204 0.0222  0.0145  -0.0359 127 MET C O   
2862 C CB  . MET C 127 ? 0.2675 0.2413 0.2396 0.0238  0.0074  -0.0277 127 MET C CB  
2863 C CG  . MET C 127 ? 0.2756 0.2410 0.2476 0.0236  0.0054  -0.0228 127 MET C CG  
2864 S SD  . MET C 127 ? 0.3632 0.3312 0.3387 0.0223  0.0067  -0.0237 127 MET C SD  
2865 C CE  . MET C 127 ? 0.1779 0.1556 0.1562 0.0272  0.0036  -0.0287 127 MET C CE  
2866 N N   . LYS C 128 ? 0.3593 0.3373 0.3242 0.0363  0.0094  -0.0410 128 LYS C N   
2867 C CA  . LYS C 128 ? 0.3548 0.3448 0.3213 0.0408  0.0142  -0.0482 128 LYS C CA  
2868 C C   . LYS C 128 ? 0.3494 0.3544 0.3283 0.0497  0.0137  -0.0518 128 LYS C C   
2869 O O   . LYS C 128 ? 0.3946 0.3915 0.3744 0.0567  0.0082  -0.0506 128 LYS C O   
2870 C CB  . LYS C 128 ? 0.3183 0.2937 0.2722 0.0451  0.0144  -0.0527 128 LYS C CB  
2871 C CG  . LYS C 128 ? 0.2573 0.2208 0.1984 0.0352  0.0136  -0.0490 128 LYS C CG  
2872 C CD  . LYS C 128 ? 0.2973 0.2448 0.2228 0.0376  0.0135  -0.0547 128 LYS C CD  
2873 C CE  . LYS C 128 ? 0.3359 0.2730 0.2484 0.0262  0.0105  -0.0500 128 LYS C CE  
2874 N NZ  . LYS C 128 ? 0.3996 0.3196 0.2935 0.0262  0.0102  -0.0566 128 LYS C NZ  
2875 N N   . PHE C 129 ? 0.2493 0.2776 0.2377 0.0485  0.0190  -0.0555 129 PHE C N   
2876 C CA  . PHE C 129 ? 0.2341 0.2835 0.2375 0.0538  0.0175  -0.0574 129 PHE C CA  
2877 C C   . PHE C 129 ? 0.2668 0.3352 0.2791 0.0654  0.0217  -0.0650 129 PHE C C   
2878 O O   . PHE C 129 ? 0.3278 0.4021 0.3365 0.0644  0.0293  -0.0697 129 PHE C O   
2879 C CB  . PHE C 129 ? 0.2566 0.3219 0.2668 0.0410  0.0193  -0.0547 129 PHE C CB  
2880 C CG  . PHE C 129 ? 0.2764 0.3230 0.2787 0.0320  0.0161  -0.0483 129 PHE C CG  
2881 C CD1 . PHE C 129 ? 0.2928 0.3234 0.2842 0.0252  0.0181  -0.0446 129 PHE C CD1 
2882 C CD2 . PHE C 129 ? 0.3109 0.3570 0.3165 0.0310  0.0110  -0.0460 129 PHE C CD2 
2883 C CE1 . PHE C 129 ? 0.3414 0.3569 0.3279 0.0196  0.0157  -0.0389 129 PHE C CE1 
2884 C CE2 . PHE C 129 ? 0.3463 0.3756 0.3445 0.0244  0.0097  -0.0413 129 PHE C CE2 
2885 C CZ  . PHE C 129 ? 0.3576 0.3722 0.3475 0.0197  0.0123  -0.0379 129 PHE C CZ  
2886 N N   . ILE C 130 ? 0.2544 0.3330 0.2779 0.0771  0.0168  -0.0660 130 ILE C N   
2887 C CA  . ILE C 130 ? 0.2385 0.3404 0.2752 0.0909  0.0203  -0.0729 130 ILE C CA  
2888 C C   . ILE C 130 ? 0.2217 0.3565 0.2785 0.0901  0.0168  -0.0713 130 ILE C C   
2889 O O   . ILE C 130 ? 0.1993 0.3292 0.2554 0.0834  0.0094  -0.0654 130 ILE C O   
2890 C CB  . ILE C 130 ? 0.3197 0.4002 0.3502 0.1096  0.0163  -0.0756 130 ILE C CB  
2891 C CG1 . ILE C 130 ? 0.3798 0.4630 0.4079 0.1198  0.0254  -0.0851 130 ILE C CG1 
2892 C CG2 . ILE C 130 ? 0.3410 0.4330 0.3850 0.1225  0.0077  -0.0732 130 ILE C CG2 
2893 C CD1 . ILE C 130 ? 0.3392 0.4059 0.3489 0.1074  0.0320  -0.0869 130 ILE C CD1 
2894 N N   . TYR C 131 ? 0.2389 0.4089 0.3133 0.0959  0.0224  -0.0768 131 TYR C N   
2895 C CA  . TYR C 131 ? 0.2720 0.4788 0.3672 0.0926  0.0189  -0.0753 131 TYR C CA  
2896 C C   . TYR C 131 ? 0.3343 0.5667 0.4490 0.1140  0.0163  -0.0789 131 TYR C C   
2897 O O   . TYR C 131 ? 0.3897 0.6141 0.5026 0.1312  0.0205  -0.0845 131 TYR C O   
2898 C CB  . TYR C 131 ? 0.2608 0.4947 0.3625 0.0745  0.0278  -0.0767 131 TYR C CB  
2899 C CG  . TYR C 131 ? 0.2717 0.4785 0.3541 0.0551  0.0292  -0.0721 131 TYR C CG  
2900 C CD1 . TYR C 131 ? 0.2679 0.4647 0.3459 0.0429  0.0220  -0.0663 131 TYR C CD1 
2901 C CD2 . TYR C 131 ? 0.2723 0.4626 0.3397 0.0500  0.0373  -0.0735 131 TYR C CD2 
2902 C CE1 . TYR C 131 ? 0.2684 0.4396 0.3298 0.0282  0.0235  -0.0622 131 TYR C CE1 
2903 C CE2 . TYR C 131 ? 0.2807 0.4470 0.3318 0.0344  0.0374  -0.0682 131 TYR C CE2 
2904 C CZ  . TYR C 131 ? 0.2817 0.4384 0.3309 0.0246  0.0307  -0.0626 131 TYR C CZ  
2905 O OH  . TYR C 131 ? 0.2761 0.4084 0.3101 0.0119  0.0312  -0.0575 131 TYR C OH  
2906 N N   . PHE C 132 ? 0.3414 0.6039 0.4742 0.1132  0.0087  -0.0758 132 PHE C N   
2907 C CA  . PHE C 132 ? 0.3822 0.6695 0.5350 0.1350  0.0030  -0.0770 132 PHE C CA  
2908 C C   . PHE C 132 ? 0.3993 0.7449 0.5814 0.1310  0.0045  -0.0786 132 PHE C C   
2909 O O   . PHE C 132 ? 0.4393 0.8014 0.6236 0.1082  0.0055  -0.0765 132 PHE C O   
2910 C CB  . PHE C 132 ? 0.3900 0.6554 0.5355 0.1417  -0.0122 -0.0694 132 PHE C CB  
2911 C CG  . PHE C 132 ? 0.3806 0.5932 0.5005 0.1487  -0.0143 -0.0676 132 PHE C CG  
2912 C CD1 . PHE C 132 ? 0.3330 0.5125 0.4309 0.1316  -0.0127 -0.0648 132 PHE C CD1 
2913 C CD2 . PHE C 132 ? 0.4073 0.6035 0.5255 0.1723  -0.0181 -0.0686 132 PHE C CD2 
2914 C CE1 . PHE C 132 ? 0.3188 0.4543 0.3950 0.1361  -0.0148 -0.0628 132 PHE C CE1 
2915 C CE2 . PHE C 132 ? 0.3998 0.5465 0.4930 0.1760  -0.0204 -0.0667 132 PHE C CE2 
2916 C CZ  . PHE C 132 ? 0.3541 0.4726 0.4271 0.1569  -0.0187 -0.0637 132 PHE C CZ  
2917 N N   . GLU C 133 ? 0.3969 0.7608 0.5943 0.1481  0.0044  -0.0796 133 GLU C N   
2918 C CA  . GLU C 133 ? 0.3848 0.7978 0.6076 0.1432  0.0038  -0.0783 133 GLU C CA  
2919 C C   . GLU C 133 ? 0.3955 0.8221 0.6264 0.1399  -0.0124 -0.0708 133 GLU C C   
2920 O O   . GLU C 133 ? 0.3997 0.7966 0.6162 0.1438  -0.0228 -0.0667 133 GLU C O   
2921 C CB  . GLU C 133 ? 0.3971 0.8219 0.6328 0.1631  0.0090  -0.0811 133 GLU C CB  
2922 C CG  . GLU C 133 ? 0.4419 0.8890 0.6839 0.1568  0.0257  -0.0880 133 GLU C CG  
2923 C CD  . GLU C 133 ? 0.5414 0.9530 0.7647 0.1681  0.0364  -0.0946 133 GLU C CD  
2924 O OE1 . GLU C 133 ? 0.5987 0.9727 0.8093 0.1849  0.0308  -0.0940 133 GLU C OE1 
2925 O OE2 . GLU C 133 ? 0.5656 0.9854 0.7851 0.1585  0.0500  -0.1000 133 GLU C OE2 
2926 N N   . ASN C 134 ? 0.3860 0.8569 0.6384 0.1314  -0.0148 -0.0689 134 ASN C N   
2927 C CA  . ASN C 134 ? 0.3908 0.8782 0.6507 0.1258  -0.0306 -0.0618 134 ASN C CA  
2928 C C   . ASN C 134 ? 0.4367 0.9001 0.6914 0.1479  -0.0435 -0.0560 134 ASN C C   
2929 O O   . ASN C 134 ? 0.4633 0.9222 0.7246 0.1695  -0.0414 -0.0565 134 ASN C O   
2930 C CB  . ASN C 134 ? 0.3983 0.9369 0.6837 0.1175  -0.0305 -0.0608 134 ASN C CB  
2931 C CG  . ASN C 134 ? 0.4216 0.9818 0.7084 0.0900  -0.0205 -0.0642 134 ASN C CG  
2932 O OD1 . ASN C 134 ? 0.4032 0.9431 0.6727 0.0726  -0.0184 -0.0654 134 ASN C OD1 
2933 N ND2 . ASN C 134 ? 0.4628 1.0635 0.7700 0.0853  -0.0144 -0.0654 134 ASN C ND2 
2934 N N   . GLY C 135 ? 0.4622 0.9087 0.7035 0.1414  -0.0566 -0.0503 135 GLY C N   
2935 C CA  . GLY C 135 ? 0.4806 0.8976 0.7108 0.1590  -0.0691 -0.0436 135 GLY C CA  
2936 C C   . GLY C 135 ? 0.4816 0.8477 0.6840 0.1623  -0.0682 -0.0441 135 GLY C C   
2937 O O   . GLY C 135 ? 0.5347 0.8719 0.7207 0.1682  -0.0797 -0.0375 135 GLY C O   
2938 N N   . GLY C 136 ? 0.4142 0.7690 0.6106 0.1576  -0.0544 -0.0516 136 GLY C N   
2939 C CA  . GLY C 136 ? 0.4065 0.7101 0.5746 0.1548  -0.0513 -0.0518 136 GLY C CA  
2940 C C   . GLY C 136 ? 0.4106 0.6768 0.5665 0.1777  -0.0528 -0.0512 136 GLY C C   
2941 O O   . GLY C 136 ? 0.4362 0.6564 0.5662 0.1737  -0.0527 -0.0490 136 GLY C O   
2942 N N   . VAL C 137 ? 0.3792 0.6537 0.5467 0.1937  -0.0518 -0.0511 137 VAL C N   
2943 C CA  . VAL C 137 ? 0.4125 0.6458 0.5652 0.2116  -0.0532 -0.0493 137 VAL C CA  
2944 C C   . VAL C 137 ? 0.4880 0.7066 0.6361 0.2174  -0.0383 -0.0583 137 VAL C C   
2945 O O   . VAL C 137 ? 0.5633 0.7368 0.6895 0.2232  -0.0368 -0.0590 137 VAL C O   
2946 C CB  . VAL C 137 ? 0.5333 0.7803 0.7001 0.2273  -0.0630 -0.0429 137 VAL C CB  
2947 C CG1 . VAL C 137 ? 0.5726 0.7849 0.7300 0.2468  -0.0605 -0.0437 137 VAL C CG1 
2948 C CG2 . VAL C 137 ? 0.5095 0.7521 0.6691 0.2228  -0.0796 -0.0323 137 VAL C CG2 
2949 N N   . VAL C 138 ? 0.4826 0.7385 0.6494 0.2136  -0.0272 -0.0651 138 VAL C N   
2950 C CA  . VAL C 138 ? 0.4587 0.7053 0.6214 0.2188  -0.0128 -0.0739 138 VAL C CA  
2951 C C   . VAL C 138 ? 0.4205 0.6673 0.5744 0.2012  -0.0017 -0.0798 138 VAL C C   
2952 O O   . VAL C 138 ? 0.4242 0.7073 0.5917 0.1865  0.0017  -0.0807 138 VAL C O   
2953 C CB  . VAL C 138 ? 0.4289 0.7156 0.6174 0.2290  -0.0064 -0.0775 138 VAL C CB  
2954 C CG1 . VAL C 138 ? 0.4259 0.7071 0.6093 0.2310  0.0100  -0.0874 138 VAL C CG1 
2955 C CG2 . VAL C 138 ? 0.4385 0.7193 0.6344 0.2498  -0.0159 -0.0723 138 VAL C CG2 
2956 N N   . ALA C 139 ? 0.3807 0.5863 0.5110 0.2017  0.0038  -0.0836 139 ALA C N   
2957 C CA  . ALA C 139 ? 0.3777 0.5776 0.4961 0.1860  0.0137  -0.0885 139 ALA C CA  
2958 C C   . ALA C 139 ? 0.3822 0.6107 0.5105 0.1826  0.0282  -0.0961 139 ALA C C   
2959 O O   . ALA C 139 ? 0.3038 0.5327 0.4358 0.1960  0.0339  -0.1004 139 ALA C O   
2960 C CB  . ALA C 139 ? 0.3893 0.5362 0.4785 0.1866  0.0136  -0.0895 139 ALA C CB  
2961 N N   . ARG C 140 ? 0.3862 0.6377 0.5179 0.1642  0.0347  -0.0974 140 ARG C N   
2962 C CA  . ARG C 140 ? 0.4119 0.6836 0.5459 0.1569  0.0493  -0.1037 140 ARG C CA  
2963 C C   . ARG C 140 ? 0.4235 0.6550 0.5299 0.1559  0.0562  -0.1086 140 ARG C C   
2964 O O   . ARG C 140 ? 0.2701 0.4682 0.3577 0.1511  0.0508  -0.1063 140 ARG C O   
2965 C CB  . ARG C 140 ? 0.4053 0.7112 0.5489 0.1346  0.0534  -0.1021 140 ARG C CB  
2966 C CG  . ARG C 140 ? 0.4056 0.7511 0.5745 0.1312  0.0455  -0.0972 140 ARG C CG  
2967 C CD  . ARG C 140 ? 0.4336 0.7941 0.6035 0.1069  0.0447  -0.0939 140 ARG C CD  
2968 N NE  . ARG C 140 ? 0.5082 0.8790 0.6719 0.0887  0.0579  -0.0966 140 ARG C NE  
2969 C CZ  . ARG C 140 ? 0.5305 0.8996 0.6864 0.0629  0.0581  -0.0914 140 ARG C CZ  
2970 N NH1 . ARG C 140 ? 0.4879 0.8451 0.6412 0.0528  0.0464  -0.0845 140 ARG C NH1 
2971 N NH2 . ARG C 140 ? 0.5656 0.9417 0.7137 0.0471  0.0699  -0.0930 140 ARG C NH2 
2972 N N   . LEU C 141 ? 0.3998 0.6347 0.5031 0.1599  0.0679  -0.1154 141 LEU C N   
2973 C CA  . LEU C 141 ? 0.4319 0.6295 0.5073 0.1580  0.0742  -0.1206 141 LEU C CA  
2974 C C   . LEU C 141 ? 0.4636 0.6580 0.5240 0.1366  0.0779  -0.1195 141 LEU C C   
2975 O O   . LEU C 141 ? 0.5000 0.7272 0.5701 0.1227  0.0843  -0.1186 141 LEU C O   
2976 C CB  . LEU C 141 ? 0.4573 0.6621 0.5326 0.1665  0.0871  -0.1289 141 LEU C CB  
2977 C CG  . LEU C 141 ? 0.3631 0.5688 0.4519 0.1893  0.0857  -0.1314 141 LEU C CG  
2978 C CD1 . LEU C 141 ? 0.3925 0.6024 0.4780 0.1963  0.1008  -0.1411 141 LEU C CD1 
2979 C CD2 . LEU C 141 ? 0.3756 0.5356 0.4497 0.2004  0.0743  -0.1289 141 LEU C CD2 
2980 N N   . SER C 142 ? 0.4914 0.6456 0.5276 0.1331  0.0732  -0.1188 142 SER C N   
2981 C CA  . SER C 142 ? 0.5033 0.6496 0.5220 0.1142  0.0762  -0.1177 142 SER C CA  
2982 C C   . SER C 142 ? 0.5620 0.6796 0.5539 0.1131  0.0824  -0.1239 142 SER C C   
2983 O O   . SER C 142 ? 0.6253 0.7072 0.6025 0.1220  0.0772  -0.1256 142 SER C O   
2984 C CB  . SER C 142 ? 0.4513 0.5711 0.4635 0.1040  0.0629  -0.1063 142 SER C CB  
2985 O OG  . SER C 142 ? 0.4484 0.5544 0.4438 0.0842  0.0636  -0.1010 142 SER C OG  
2986 N N   . THR C 143 ? 0.5371 0.6687 0.5204 0.1003  0.0931  -0.1264 143 THR C N   
2987 C CA  . THR C 143 ? 0.5562 0.6643 0.5135 0.0991  0.1000  -0.1330 143 THR C CA  
2988 C C   . THR C 143 ? 0.5982 0.7011 0.5325 0.0785  0.1034  -0.1314 143 THR C C   
2989 O O   . THR C 143 ? 0.6448 0.7647 0.5855 0.0625  0.1025  -0.1227 143 THR C O   
2990 C CB  . THR C 143 ? 0.5328 0.6607 0.4984 0.1084  0.1124  -0.1400 143 THR C CB  
2991 O OG1 . THR C 143 ? 0.5005 0.6734 0.4887 0.1011  0.1182  -0.1368 143 THR C OG1 
2992 C CG2 . THR C 143 ? 0.5260 0.6445 0.5039 0.1305  0.1094  -0.1437 143 THR C CG2 
2993 N N   . ASP C 144 ? 0.6138 0.6870 0.5202 0.0773  0.1051  -0.1366 144 ASP C N   
2994 C CA  . ASP C 144 ? 0.6461 0.7147 0.5271 0.0596  0.1102  -0.1363 144 ASP C CA  
2995 C C   . ASP C 144 ? 0.6988 0.8019 0.5889 0.0553  0.1235  -0.1371 144 ASP C C   
2996 O O   . ASP C 144 ? 0.7061 0.8298 0.6188 0.0691  0.1287  -0.1407 144 ASP C O   
2997 C CB  . ASP C 144 ? 0.6860 0.7162 0.5363 0.0624  0.1090  -0.1434 144 ASP C CB  
2998 C CG  . ASP C 144 ? 0.7528 0.7501 0.5906 0.0565  0.0942  -0.1375 144 ASP C CG  
2999 O OD1 . ASP C 144 ? 0.7799 0.7810 0.6258 0.0437  0.0857  -0.1237 144 ASP C OD1 
3000 O OD2 . ASP C 144 ? 0.8023 0.7676 0.6228 0.0634  0.0904  -0.1442 144 ASP C OD2 
3001 N N   . LYS C 145 ? 0.6988 0.8098 0.5732 0.0372  0.1291  -0.1334 145 LYS C N   
3002 C CA  . LYS C 145 ? 0.6635 0.7511 0.5042 0.0211  0.1268  -0.1306 145 LYS C CA  
3003 C C   . LYS C 145 ? 0.7081 0.7789 0.5263 0.0291  0.1335  -0.1407 145 LYS C C   
3004 O O   . LYS C 145 ? 0.7234 0.8010 0.5255 0.0196  0.1410  -0.1410 145 LYS C O   
3005 C CB  . LYS C 145 ? 0.5898 0.6485 0.4205 0.0160  0.1127  -0.1253 145 LYS C CB  
3006 C CG  . LYS C 145 ? 0.5455 0.6114 0.3954 0.0070  0.1032  -0.1099 145 LYS C CG  
3007 C CD  . LYS C 145 ? 0.5929 0.6280 0.4373 0.0046  0.0873  -0.1006 145 LYS C CD  
3008 C CE  . LYS C 145 ? 0.6113 0.6519 0.4731 -0.0028 0.0793  -0.0866 145 LYS C CE  
3009 N NZ  . LYS C 145 ? 0.6407 0.6557 0.4997 -0.0040 0.0653  -0.0781 145 LYS C NZ  
3010 N N   . ASN C 146 ? 0.6772 0.7242 0.4929 0.0462  0.1306  -0.1488 146 ASN C N   
3011 C CA  . ASN C 146 ? 0.6857 0.7142 0.4821 0.0579  0.1381  -0.1599 146 ASN C CA  
3012 C C   . ASN C 146 ? 0.6769 0.7145 0.4980 0.0790  0.1460  -0.1667 146 ASN C C   
3013 O O   . ASN C 146 ? 0.6436 0.6638 0.4529 0.0907  0.1543  -0.1768 146 ASN C O   
3014 C CB  . ASN C 146 ? 0.6875 0.6731 0.4545 0.0579  0.1272  -0.1637 146 ASN C CB  
3015 C CG  . ASN C 146 ? 0.7261 0.7049 0.4683 0.0360  0.1204  -0.1584 146 ASN C CG  
3016 O OD1 . ASN C 146 ? 0.7446 0.7437 0.4833 0.0230  0.1265  -0.1533 146 ASN C OD1 
3017 N ND2 . ASN C 146 ? 0.7465 0.6955 0.4720 0.0299  0.1075  -0.1583 146 ASN C ND2 
3018 N N   . GLY C 147 ? 0.6898 0.7546 0.5456 0.0832  0.1427  -0.1611 147 GLY C N   
3019 C CA  . GLY C 147 ? 0.6537 0.7316 0.5376 0.1030  0.1460  -0.1654 147 GLY C CA  
3020 C C   . GLY C 147 ? 0.5868 0.6326 0.4724 0.1146  0.1346  -0.1666 147 GLY C C   
3021 O O   . GLY C 147 ? 0.6124 0.6633 0.5193 0.1320  0.1341  -0.1689 147 GLY C O   
3022 N N   . GLN C 148 ? 0.5333 0.5472 0.3964 0.1043  0.1245  -0.1641 148 GLN C N   
3023 C CA  . GLN C 148 ? 0.5136 0.4947 0.3748 0.1116  0.1125  -0.1643 148 GLN C CA  
3024 C C   . GLN C 148 ? 0.5000 0.4924 0.3845 0.1147  0.1004  -0.1538 148 GLN C C   
3025 O O   . GLN C 148 ? 0.4112 0.4243 0.3024 0.1037  0.0978  -0.1465 148 GLN C O   
3026 C CB  . GLN C 148 ? 0.5213 0.4662 0.3493 0.0973  0.1059  -0.1666 148 GLN C CB  
3027 C CG  . GLN C 148 ? 0.6027 0.5125 0.4262 0.1025  0.0926  -0.1660 148 GLN C CG  
3028 C CD  . GLN C 148 ? 0.7068 0.5851 0.4986 0.0889  0.0860  -0.1697 148 GLN C CD  
3029 O OE1 . GLN C 148 ? 0.7456 0.6307 0.5196 0.0752  0.0887  -0.1717 148 GLN C OE1 
3030 N NE2 . GLN C 148 ? 0.7595 0.6040 0.5435 0.0922  0.0759  -0.1690 148 GLN C NE2 
3031 N N   . GLU C 149 ? 0.4436 0.4216 0.3392 0.1292  0.0932  -0.1530 149 GLU C N   
3032 C CA  . GLU C 149 ? 0.4462 0.4296 0.3602 0.1330  0.0812  -0.1432 149 GLU C CA  
3033 C C   . GLU C 149 ? 0.4333 0.3979 0.3318 0.1183  0.0711  -0.1362 149 GLU C C   
3034 O O   . GLU C 149 ? 0.4265 0.3579 0.2995 0.1109  0.0674  -0.1380 149 GLU C O   
3035 C CB  . GLU C 149 ? 0.4326 0.3953 0.3528 0.1497  0.0746  -0.1430 149 GLU C CB  
3036 C CG  . GLU C 149 ? 0.4103 0.3733 0.3449 0.1536  0.0616  -0.1326 149 GLU C CG  
3037 C CD  . GLU C 149 ? 0.5025 0.4370 0.4351 0.1674  0.0541  -0.1315 149 GLU C CD  
3038 O OE1 . GLU C 149 ? 0.4890 0.3883 0.4039 0.1617  0.0448  -0.1272 149 GLU C OE1 
3039 O OE2 . GLU C 149 ? 0.4482 0.3954 0.3962 0.1835  0.0575  -0.1344 149 GLU C OE2 
3040 N N   . ASP C 150 ? 0.4616 0.4483 0.3756 0.1135  0.0667  -0.1286 150 ASP C N   
3041 C CA  . ASP C 150 ? 0.4431 0.4145 0.3494 0.0967  0.0566  -0.1172 150 ASP C CA  
3042 C C   . ASP C 150 ? 0.4689 0.4044 0.3657 0.1013  0.0455  -0.1140 150 ASP C C   
3043 O O   . ASP C 150 ? 0.4190 0.3497 0.3247 0.1174  0.0426  -0.1158 150 ASP C O   
3044 C CB  . ASP C 150 ? 0.4132 0.4130 0.3422 0.0886  0.0539  -0.1069 150 ASP C CB  
3045 C CG  . ASP C 150 ? 0.4988 0.5290 0.4329 0.0780  0.0635  -0.1074 150 ASP C CG  
3046 O OD1 . ASP C 150 ? 0.6107 0.6366 0.5267 0.0711  0.0702  -0.1121 150 ASP C OD1 
3047 O OD2 . ASP C 150 ? 0.4746 0.5323 0.4292 0.0751  0.0639  -0.1027 150 ASP C OD2 
3048 N N   . PRO C 151 ? 0.5463 0.4579 0.4252 0.0865  0.0388  -0.1084 151 PRO C N   
3049 C CA  . PRO C 151 ? 0.5568 0.4342 0.4241 0.0868  0.0288  -0.1049 151 PRO C CA  
3050 C C   . PRO C 151 ? 0.4867 0.3695 0.3722 0.0906  0.0211  -0.0953 151 PRO C C   
3051 O O   . PRO C 151 ? 0.4617 0.3200 0.3412 0.0980  0.0149  -0.0946 151 PRO C O   
3052 C CB  . PRO C 151 ? 0.6224 0.4871 0.4730 0.0667  0.0240  -0.0992 151 PRO C CB  
3053 C CG  . PRO C 151 ? 0.6191 0.5133 0.4783 0.0570  0.0291  -0.0955 151 PRO C CG  
3054 C CD  . PRO C 151 ? 0.5962 0.5128 0.4643 0.0681  0.0402  -0.1046 151 PRO C CD  
3055 N N   . HIS C 152 ? 0.4341 0.3461 0.3390 0.0851  0.0216  -0.0884 152 HIS C N   
3056 C CA  . HIS C 152 ? 0.3810 0.2983 0.3005 0.0869  0.0147  -0.0798 152 HIS C CA  
3057 C C   . HIS C 152 ? 0.3796 0.3123 0.3154 0.1042  0.0155  -0.0832 152 HIS C C   
3058 O O   . HIS C 152 ? 0.3622 0.2947 0.3063 0.1082  0.0086  -0.0771 152 HIS C O   
3059 C CB  . HIS C 152 ? 0.3543 0.2922 0.2850 0.0734  0.0146  -0.0716 152 HIS C CB  
3060 C CG  . HIS C 152 ? 0.3508 0.3211 0.2971 0.0740  0.0216  -0.0741 152 HIS C CG  
3061 N ND1 . HIS C 152 ? 0.3500 0.3321 0.2921 0.0675  0.0295  -0.0779 152 HIS C ND1 
3062 C CD2 . HIS C 152 ? 0.3865 0.3804 0.3517 0.0783  0.0216  -0.0727 152 HIS C CD2 
3063 C CE1 . HIS C 152 ? 0.3700 0.3816 0.3281 0.0673  0.0346  -0.0787 152 HIS C CE1 
3064 N NE2 . HIS C 152 ? 0.4032 0.4230 0.3761 0.0736  0.0296  -0.0758 152 HIS C NE2 
3065 N N   . PHE C 153 ? 0.3680 0.3159 0.3084 0.1145  0.0239  -0.0928 153 PHE C N   
3066 C CA  . PHE C 153 ? 0.3674 0.3388 0.3278 0.1316  0.0253  -0.0962 153 PHE C CA  
3067 C C   . PHE C 153 ? 0.4678 0.4155 0.4252 0.1476  0.0174  -0.0952 153 PHE C C   
3068 O O   . PHE C 153 ? 0.5108 0.4726 0.4839 0.1554  0.0115  -0.0902 153 PHE C O   
3069 C CB  . PHE C 153 ? 0.3449 0.3373 0.3097 0.1399  0.0375  -0.1076 153 PHE C CB  
3070 C CG  . PHE C 153 ? 0.3476 0.3666 0.3360 0.1548  0.0389  -0.1085 153 PHE C CG  
3071 C CD1 . PHE C 153 ? 0.3594 0.3604 0.3455 0.1694  0.0375  -0.1107 153 PHE C CD1 
3072 C CD2 . PHE C 153 ? 0.3486 0.4114 0.3612 0.1533  0.0414  -0.1071 153 PHE C CD2 
3073 C CE1 . PHE C 153 ? 0.4555 0.4820 0.4637 0.1841  0.0380  -0.1110 153 PHE C CE1 
3074 C CE2 . PHE C 153 ? 0.3724 0.4624 0.4073 0.1661  0.0415  -0.1074 153 PHE C CE2 
3075 C CZ  . PHE C 153 ? 0.4222 0.4945 0.4554 0.1823  0.0397  -0.1091 153 PHE C CZ  
3076 N N   . ALA C 154 ? 0.5136 0.4258 0.4505 0.1481  0.0166  -0.0975 154 ALA C N   
3077 C CA  . ALA C 154 ? 0.5270 0.4158 0.4601 0.1599  0.0106  -0.0954 154 ALA C CA  
3078 C C   . ALA C 154 ? 0.5304 0.4083 0.4644 0.1602  -0.0013 -0.0847 154 ALA C C   
3079 O O   . ALA C 154 ? 0.5358 0.4216 0.4817 0.1727  -0.0059 -0.0812 154 ALA C O   
3080 C CB  . ALA C 154 ? 0.5701 0.4199 0.4777 0.1560  0.0115  -0.0998 154 ALA C CB  
3081 N N   . LYS C 155 ? 0.5952 0.4555 0.5162 0.1462  -0.0062 -0.0792 155 LYS C N   
3082 C CA  . LYS C 155 ? 0.6402 0.4887 0.5594 0.1447  -0.0164 -0.0690 155 LYS C CA  
3083 C C   . LYS C 155 ? 0.6188 0.5028 0.5609 0.1494  -0.0186 -0.0650 155 LYS C C   
3084 O O   . LYS C 155 ? 0.6802 0.5610 0.6252 0.1576  -0.0268 -0.0589 155 LYS C O   
3085 C CB  . LYS C 155 ? 0.6502 0.4820 0.5555 0.1246  -0.0192 -0.0627 155 LYS C CB  
3086 C CG  . LYS C 155 ? 0.6544 0.4804 0.5591 0.1191  -0.0276 -0.0513 155 LYS C CG  
3087 C CD  . LYS C 155 ? 0.6474 0.4602 0.5402 0.0990  -0.0290 -0.0450 155 LYS C CD  
3088 C CE  . LYS C 155 ? 0.6057 0.4463 0.5127 0.0882  -0.0279 -0.0387 155 LYS C CE  
3089 N NZ  . LYS C 155 ? 0.6375 0.4716 0.5371 0.0706  -0.0276 -0.0336 155 LYS C NZ  
3090 N N   . LEU C 156 ? 0.5216 0.4397 0.4789 0.1414  -0.0117 -0.0674 156 LEU C N   
3091 C CA  . LEU C 156 ? 0.4405 0.3931 0.4181 0.1393  -0.0135 -0.0631 156 LEU C CA  
3092 C C   . LEU C 156 ? 0.4474 0.4237 0.4430 0.1584  -0.0150 -0.0664 156 LEU C C   
3093 O O   . LEU C 156 ? 0.4422 0.4336 0.4485 0.1613  -0.0224 -0.0605 156 LEU C O   
3094 C CB  . LEU C 156 ? 0.3443 0.3221 0.3301 0.1242  -0.0057 -0.0647 156 LEU C CB  
3095 C CG  . LEU C 156 ? 0.3419 0.3025 0.3144 0.1063  -0.0055 -0.0597 156 LEU C CG  
3096 C CD1 . LEU C 156 ? 0.3475 0.3308 0.3276 0.0934  0.0012  -0.0603 156 LEU C CD1 
3097 C CD2 . LEU C 156 ? 0.2969 0.2451 0.2648 0.1010  -0.0136 -0.0507 156 LEU C CD2 
3098 N N   . ALA C 157 ? 0.4455 0.4269 0.4445 0.1709  -0.0078 -0.0755 157 ALA C N   
3099 C CA  . ALA C 157 ? 0.4667 0.4744 0.4853 0.1854  -0.0077 -0.0769 157 ALA C CA  
3100 C C   . ALA C 157 ? 0.5013 0.4872 0.5149 0.1968  -0.0187 -0.0697 157 ALA C C   
3101 O O   . ALA C 157 ? 0.4374 0.4474 0.4683 0.2061  -0.0244 -0.0660 157 ALA C O   
3102 C CB  . ALA C 157 ? 0.4819 0.4952 0.5021 0.1910  0.0039  -0.0862 157 ALA C CB  
3103 N N   . GLN C 158 ? 0.5697 0.5108 0.5592 0.1947  -0.0220 -0.0673 158 GLN C N   
3104 C CA  . GLN C 158 ? 0.6237 0.5389 0.6042 0.2039  -0.0319 -0.0603 158 GLN C CA  
3105 C C   . GLN C 158 ? 0.6085 0.5251 0.5887 0.1996  -0.0433 -0.0496 158 GLN C C   
3106 O O   . GLN C 158 ? 0.6508 0.5586 0.6294 0.2082  -0.0523 -0.0426 158 GLN C O   
3107 C CB  . GLN C 158 ? 0.6857 0.5524 0.6387 0.1996  -0.0318 -0.0608 158 GLN C CB  
3108 C CG  . GLN C 158 ? 0.7759 0.6274 0.7258 0.2139  -0.0282 -0.0666 158 GLN C CG  
3109 C CD  . GLN C 158 ? 0.8008 0.6394 0.7391 0.2086  -0.0177 -0.0770 158 GLN C CD  
3110 O OE1 . GLN C 158 ? 0.7865 0.6505 0.7337 0.2026  -0.0091 -0.0832 158 GLN C OE1 
3111 N NE2 . GLN C 158 ? 0.8283 0.6265 0.7452 0.2098  -0.0185 -0.0789 158 GLN C NE2 
3112 N N   . LEU C 159 ? 0.5187 0.4455 0.4993 0.1863  -0.0428 -0.0484 159 LEU C N   
3113 C CA  . LEU C 159 ? 0.4877 0.4167 0.4667 0.1812  -0.0528 -0.0391 159 LEU C CA  
3114 C C   . LEU C 159 ? 0.5579 0.5248 0.5590 0.1904  -0.0588 -0.0365 159 LEU C C   
3115 O O   . LEU C 159 ? 0.6209 0.6243 0.6439 0.1952  -0.0530 -0.0429 159 LEU C O   
3116 C CB  . LEU C 159 ? 0.4061 0.3436 0.3830 0.1577  -0.0473 -0.0380 159 LEU C CB  
3117 C CG  . LEU C 159 ? 0.4455 0.3489 0.4007 0.1440  -0.0445 -0.0364 159 LEU C CG  
3118 C CD1 . LEU C 159 ? 0.4080 0.3276 0.3672 0.1248  -0.0379 -0.0364 159 LEU C CD1 
3119 C CD2 . LEU C 159 ? 0.4763 0.3482 0.4125 0.1417  -0.0537 -0.0268 159 LEU C CD2 
3120 N N   . VAL C 160 ? 0.5467 0.5058 0.5411 0.1911  -0.0706 -0.0266 160 VAL C N   
3121 C CA  . VAL C 160 ? 0.5096 0.5048 0.5226 0.1968  -0.0786 -0.0227 160 VAL C CA  
3122 C C   . VAL C 160 ? 0.4703 0.4746 0.4779 0.1776  -0.0829 -0.0168 160 VAL C C   
3123 O O   . VAL C 160 ? 0.5165 0.4907 0.5021 0.1651  -0.0837 -0.0116 160 VAL C O   
3124 C CB  . VAL C 160 ? 0.5699 0.5517 0.5792 0.2094  -0.0879 -0.0151 160 VAL C CB  
3125 C CG1 . VAL C 160 ? 0.6163 0.5998 0.6364 0.2246  -0.0810 -0.0216 160 VAL C CG1 
3126 C CG2 . VAL C 160 ? 0.6001 0.5337 0.5793 0.2037  -0.0939 -0.0066 160 VAL C CG2 
3127 N N   . TYR C 161 ? 0.4066 0.4526 0.4336 0.1728  -0.0843 -0.0180 161 TYR C N   
3128 C CA  . TYR C 161 ? 0.4023 0.4567 0.4228 0.1537  -0.0878 -0.0136 161 TYR C CA  
3129 C C   . TYR C 161 ? 0.4114 0.4470 0.4149 0.1568  -0.1015 -0.0028 161 TYR C C   
3130 O O   . TYR C 161 ? 0.3954 0.4420 0.4069 0.1728  -0.1127 0.0018  161 TYR C O   
3131 C CB  . TYR C 161 ? 0.3982 0.5001 0.4418 0.1477  -0.0879 -0.0174 161 TYR C CB  
3132 C CG  . TYR C 161 ? 0.4505 0.5591 0.4850 0.1295  -0.0934 -0.0134 161 TYR C CG  
3133 C CD1 . TYR C 161 ? 0.4539 0.5464 0.4738 0.1102  -0.0853 -0.0154 161 TYR C CD1 
3134 C CD2 . TYR C 161 ? 0.4939 0.6246 0.5336 0.1321  -0.1069 -0.0079 161 TYR C CD2 
3135 C CE1 . TYR C 161 ? 0.4430 0.5385 0.4522 0.0944  -0.0891 -0.0133 161 TYR C CE1 
3136 C CE2 . TYR C 161 ? 0.5193 0.6538 0.5471 0.1143  -0.1118 -0.0054 161 TYR C CE2 
3137 C CZ  . TYR C 161 ? 0.4938 0.6093 0.5055 0.0957  -0.1021 -0.0087 161 TYR C CZ  
3138 O OH  . TYR C 161 ? 0.5139 0.6304 0.5116 0.0789  -0.1057 -0.0078 161 TYR C OH  
3139 N N   . GLU C 162 ? 0.3962 0.4047 0.3762 0.1417  -0.1006 0.0017  162 GLU C N   
3140 C CA  . GLU C 162 ? 0.4907 0.4741 0.4488 0.1428  -0.1118 0.0125  162 GLU C CA  
3141 C C   . GLU C 162 ? 0.5027 0.4968 0.4505 0.1272  -0.1172 0.0170  162 GLU C C   
3142 O O   . GLU C 162 ? 0.4490 0.4195 0.3732 0.1224  -0.1234 0.0256  162 GLU C O   
3143 C CB  . GLU C 162 ? 0.5407 0.4807 0.4758 0.1381  -0.1068 0.0153  162 GLU C CB  
3144 C CG  . GLU C 162 ? 0.6397 0.5520 0.5698 0.1566  -0.1108 0.0173  162 GLU C CG  
3145 C CD  . GLU C 162 ? 0.7156 0.5890 0.6259 0.1485  -0.1039 0.0175  162 GLU C CD  
3146 O OE1 . GLU C 162 ? 0.7526 0.6143 0.6468 0.1307  -0.1012 0.0217  162 GLU C OE1 
3147 O OE2 . GLU C 162 ? 0.7212 0.5771 0.6320 0.1596  -0.1009 0.0129  162 GLU C OE2 
3148 N N   . GLY C 163 ? 0.5161 0.5440 0.4790 0.1181  -0.1146 0.0110  163 GLY C N   
3149 C CA  . GLY C 163 ? 0.4735 0.5108 0.4250 0.1025  -0.1193 0.0133  163 GLY C CA  
3150 C C   . GLY C 163 ? 0.4772 0.5029 0.4168 0.0835  -0.1067 0.0081  163 GLY C C   
3151 O O   . GLY C 163 ? 0.4661 0.4751 0.4050 0.0823  -0.0956 0.0047  163 GLY C O   
3152 N N   . GLY C 164 ? 0.4852 0.5195 0.4145 0.0690  -0.1088 0.0074  164 GLY C N   
3153 C CA  . GLY C 164 ? 0.4495 0.4764 0.3697 0.0526  -0.0967 0.0010  164 GLY C CA  
3154 C C   . GLY C 164 ? 0.4446 0.4405 0.3463 0.0482  -0.0879 0.0032  164 GLY C C   
3155 O O   . GLY C 164 ? 0.4322 0.4221 0.3380 0.0434  -0.0757 -0.0022 164 GLY C O   
3156 N N   . ASP C 165 ? 0.3351 0.3127 0.2168 0.0493  -0.0943 0.0119  165 ASP C N   
3157 C CA  . ASP C 165 ? 0.3607 0.3127 0.2242 0.0425  -0.0859 0.0147  165 ASP C CA  
3158 C C   . ASP C 165 ? 0.3321 0.2696 0.2039 0.0493  -0.0796 0.0149  165 ASP C C   
3159 O O   . ASP C 165 ? 0.3268 0.2522 0.1928 0.0420  -0.0694 0.0140  165 ASP C O   
3160 C CB  . ASP C 165 ? 0.4860 0.4219 0.3240 0.0402  -0.0948 0.0250  165 ASP C CB  
3161 C CG  . ASP C 165 ? 0.5751 0.5181 0.3955 0.0275  -0.0962 0.0238  165 ASP C CG  
3162 O OD1 . ASP C 165 ? 0.6067 0.5621 0.4329 0.0196  -0.0884 0.0143  165 ASP C OD1 
3163 O OD2 . ASP C 165 ? 0.6079 0.5414 0.4061 0.0249  -0.1051 0.0324  165 ASP C OD2 
3164 N N   . SER C 166 ? 0.3325 0.2724 0.2177 0.0633  -0.0857 0.0158  166 SER C N   
3165 C CA  . SER C 166 ? 0.3645 0.2902 0.2561 0.0695  -0.0800 0.0144  166 SER C CA  
3166 C C   . SER C 166 ? 0.3724 0.3101 0.2782 0.0632  -0.0677 0.0054  166 SER C C   
3167 O O   . SER C 166 ? 0.4007 0.3256 0.3046 0.0593  -0.0598 0.0046  166 SER C O   
3168 C CB  . SER C 166 ? 0.4109 0.3384 0.3144 0.0873  -0.0878 0.0149  166 SER C CB  
3169 O OG  . SER C 166 ? 0.4174 0.3758 0.3439 0.0920  -0.0868 0.0075  166 SER C OG  
3170 N N   . VAL C 167 ? 0.3354 0.2979 0.2546 0.0613  -0.0670 -0.0005 167 VAL C N   
3171 C CA  . VAL C 167 ? 0.3132 0.2860 0.2439 0.0549  -0.0565 -0.0081 167 VAL C CA  
3172 C C   . VAL C 167 ? 0.3164 0.2784 0.2349 0.0427  -0.0481 -0.0086 167 VAL C C   
3173 O O   . VAL C 167 ? 0.2856 0.2432 0.2086 0.0398  -0.0392 -0.0112 167 VAL C O   
3174 C CB  . VAL C 167 ? 0.2964 0.2965 0.2411 0.0530  -0.0585 -0.0135 167 VAL C CB  
3175 C CG1 . VAL C 167 ? 0.2388 0.2448 0.1919 0.0451  -0.0479 -0.0202 167 VAL C CG1 
3176 C CG2 . VAL C 167 ? 0.2866 0.3032 0.2473 0.0666  -0.0656 -0.0134 167 VAL C CG2 
3177 N N   . ARG C 168 ? 0.3443 0.3032 0.2472 0.0364  -0.0511 -0.0059 168 ARG C N   
3178 C CA  . ARG C 168 ? 0.3688 0.3178 0.2588 0.0266  -0.0424 -0.0065 168 ARG C CA  
3179 C C   . ARG C 168 ? 0.3360 0.2692 0.2220 0.0270  -0.0376 -0.0017 168 ARG C C   
3180 O O   . ARG C 168 ? 0.3267 0.2585 0.2165 0.0230  -0.0278 -0.0041 168 ARG C O   
3181 C CB  . ARG C 168 ? 0.3886 0.3354 0.2586 0.0200  -0.0468 -0.0040 168 ARG C CB  
3182 C CG  . ARG C 168 ? 0.3991 0.3337 0.2532 0.0121  -0.0374 -0.0029 168 ARG C CG  
3183 C CD  . ARG C 168 ? 0.4623 0.3964 0.2954 0.0035  -0.0380 -0.0041 168 ARG C CD  
3184 N NE  . ARG C 168 ? 0.5197 0.4514 0.3382 0.0041  -0.0510 0.0036  168 ARG C NE  
3185 C CZ  . ARG C 168 ? 0.5521 0.4701 0.3576 0.0047  -0.0546 0.0132  168 ARG C CZ  
3186 N NH1 . ARG C 168 ? 0.5593 0.4670 0.3657 0.0036  -0.0462 0.0159  168 ARG C NH1 
3187 N NH2 . ARG C 168 ? 0.5984 0.5129 0.3894 0.0058  -0.0676 0.0208  168 ARG C NH2 
3188 N N   . ASP C 169 ? 0.3214 0.2425 0.1996 0.0316  -0.0452 0.0055  169 ASP C N   
3189 C CA  . ASP C 169 ? 0.3299 0.2341 0.2019 0.0297  -0.0423 0.0107  169 ASP C CA  
3190 C C   . ASP C 169 ? 0.2926 0.1979 0.1803 0.0330  -0.0373 0.0067  169 ASP C C   
3191 O O   . ASP C 169 ? 0.3193 0.2180 0.2059 0.0275  -0.0315 0.0085  169 ASP C O   
3192 C CB  . ASP C 169 ? 0.3640 0.2503 0.2223 0.0343  -0.0528 0.0191  169 ASP C CB  
3193 C CG  . ASP C 169 ? 0.4070 0.2888 0.2450 0.0288  -0.0579 0.0254  169 ASP C CG  
3194 O OD1 . ASP C 169 ? 0.3957 0.2872 0.2285 0.0202  -0.0516 0.0224  169 ASP C OD1 
3195 O OD2 . ASP C 169 ? 0.4318 0.2986 0.2572 0.0333  -0.0683 0.0333  169 ASP C OD2 
3196 N N   . GLN C 170 ? 0.2750 0.1905 0.1768 0.0410  -0.0396 0.0016  170 GLN C N   
3197 C CA  . GLN C 170 ? 0.3092 0.2266 0.2237 0.0434  -0.0348 -0.0026 170 GLN C CA  
3198 C C   . GLN C 170 ? 0.3043 0.2311 0.2258 0.0361  -0.0252 -0.0062 170 GLN C C   
3199 O O   . GLN C 170 ? 0.3399 0.2629 0.2644 0.0332  -0.0205 -0.0057 170 GLN C O   
3200 C CB  . GLN C 170 ? 0.3169 0.2460 0.2443 0.0533  -0.0383 -0.0074 170 GLN C CB  
3201 C CG  . GLN C 170 ? 0.3336 0.2506 0.2569 0.0645  -0.0465 -0.0047 170 GLN C CG  
3202 C CD  . GLN C 170 ? 0.3747 0.3103 0.3125 0.0758  -0.0504 -0.0090 170 GLN C CD  
3203 O OE1 . GLN C 170 ? 0.3936 0.3515 0.3444 0.0730  -0.0466 -0.0142 170 GLN C OE1 
3204 N NE2 . GLN C 170 ? 0.2869 0.2133 0.2225 0.0886  -0.0580 -0.0067 170 GLN C NE2 
3205 N N   . MET C 171 ? 0.2838 0.2217 0.2068 0.0330  -0.0231 -0.0097 171 MET C N   
3206 C CA  . MET C 171 ? 0.3014 0.2441 0.2289 0.0276  -0.0143 -0.0132 171 MET C CA  
3207 C C   . MET C 171 ? 0.2804 0.2164 0.2009 0.0227  -0.0085 -0.0095 171 MET C C   
3208 O O   . MET C 171 ? 0.2597 0.1979 0.1874 0.0214  -0.0020 -0.0100 171 MET C O   
3209 C CB  . MET C 171 ? 0.3554 0.3062 0.2812 0.0243  -0.0139 -0.0181 171 MET C CB  
3210 C CG  . MET C 171 ? 0.3398 0.2910 0.2690 0.0203  -0.0052 -0.0225 171 MET C CG  
3211 S SD  . MET C 171 ? 0.2548 0.2122 0.1993 0.0219  -0.0031 -0.0253 171 MET C SD  
3212 C CE  . MET C 171 ? 0.2017 0.1528 0.1506 0.0237  0.0020  -0.0209 171 MET C CE  
3213 N N   . VAL C 172 ? 0.2799 0.2095 0.1865 0.0200  -0.0110 -0.0052 172 VAL C N   
3214 C CA  . VAL C 172 ? 0.3481 0.2746 0.2477 0.0141  -0.0048 -0.0013 172 VAL C CA  
3215 C C   . VAL C 172 ? 0.3516 0.2738 0.2563 0.0128  -0.0048 0.0034  172 VAL C C   
3216 O O   . VAL C 172 ? 0.2692 0.1974 0.1796 0.0091  0.0022  0.0046  172 VAL C O   
3217 C CB  . VAL C 172 ? 0.4044 0.3242 0.2848 0.0097  -0.0081 0.0032  172 VAL C CB  
3218 C CG1 . VAL C 172 ? 0.4073 0.3250 0.2806 0.0023  -0.0018 0.0086  172 VAL C CG1 
3219 C CG2 . VAL C 172 ? 0.4099 0.3345 0.2824 0.0081  -0.0067 -0.0021 172 VAL C CG2 
3220 N N   . THR C 173 ? 0.3728 0.2849 0.2752 0.0161  -0.0128 0.0057  173 THR C N   
3221 C CA  . THR C 173 ? 0.3309 0.2345 0.2343 0.0137  -0.0142 0.0092  173 THR C CA  
3222 C C   . THR C 173 ? 0.2518 0.1659 0.1705 0.0139  -0.0093 0.0059  173 THR C C   
3223 O O   . THR C 173 ? 0.2401 0.1562 0.1616 0.0079  -0.0067 0.0092  173 THR C O   
3224 C CB  . THR C 173 ? 0.4108 0.2987 0.3084 0.0201  -0.0232 0.0097  173 THR C CB  
3225 O OG1 . THR C 173 ? 0.5098 0.3856 0.3919 0.0203  -0.0293 0.0149  173 THR C OG1 
3226 C CG2 . THR C 173 ? 0.3646 0.2401 0.2601 0.0164  -0.0245 0.0118  173 THR C CG2 
3227 N N   . ILE C 174 ? 0.2656 0.1871 0.1936 0.0199  -0.0086 0.0000  174 ILE C N   
3228 C CA  . ILE C 174 ? 0.2946 0.2241 0.2347 0.0204  -0.0050 -0.0024 174 ILE C CA  
3229 C C   . ILE C 174 ? 0.3002 0.2397 0.2469 0.0170  0.0022  -0.0007 174 ILE C C   
3230 O O   . ILE C 174 ? 0.2473 0.1916 0.2013 0.0147  0.0035  0.0018  174 ILE C O   
3231 C CB  . ILE C 174 ? 0.2611 0.1965 0.2077 0.0257  -0.0051 -0.0083 174 ILE C CB  
3232 C CG1 . ILE C 174 ? 0.2561 0.1862 0.2013 0.0308  -0.0108 -0.0103 174 ILE C CG1 
3233 C CG2 . ILE C 174 ? 0.2383 0.1810 0.1947 0.0248  -0.0004 -0.0096 174 ILE C CG2 
3234 C CD1 . ILE C 174 ? 0.2035 0.1439 0.1559 0.0353  -0.0108 -0.0158 174 ILE C CD1 
3235 N N   . VAL C 175 ? 0.3155 0.2584 0.2593 0.0171  0.0067  -0.0023 175 VAL C N   
3236 C CA  . VAL C 175 ? 0.2707 0.2225 0.2207 0.0166  0.0149  -0.0020 175 VAL C CA  
3237 C C   . VAL C 175 ? 0.2834 0.2411 0.2345 0.0110  0.0170  0.0042  175 VAL C C   
3238 O O   . VAL C 175 ? 0.2802 0.2493 0.2433 0.0112  0.0208  0.0065  175 VAL C O   
3239 C CB  . VAL C 175 ? 0.3696 0.3207 0.3121 0.0175  0.0200  -0.0064 175 VAL C CB  
3240 C CG1 . VAL C 175 ? 0.3882 0.3473 0.3366 0.0192  0.0298  -0.0069 175 VAL C CG1 
3241 C CG2 . VAL C 175 ? 0.3943 0.3414 0.3364 0.0203  0.0177  -0.0124 175 VAL C CG2 
3242 N N   . ARG C 176 ? 0.2807 0.2311 0.2193 0.0056  0.0138  0.0077  176 ARG C N   
3243 C CA  . ARG C 176 ? 0.3240 0.2796 0.2615 -0.0028 0.0157  0.0142  176 ARG C CA  
3244 C C   . ARG C 176 ? 0.2896 0.2453 0.2339 -0.0068 0.0106  0.0178  176 ARG C C   
3245 O O   . ARG C 176 ? 0.2793 0.2481 0.2314 -0.0132 0.0133  0.0224  176 ARG C O   
3246 C CB  . ARG C 176 ? 0.3722 0.3154 0.2908 -0.0090 0.0126  0.0181  176 ARG C CB  
3247 C CG  . ARG C 176 ? 0.4068 0.3512 0.3154 -0.0077 0.0175  0.0153  176 ARG C CG  
3248 C CD  . ARG C 176 ? 0.4855 0.4259 0.3773 -0.0174 0.0187  0.0216  176 ARG C CD  
3249 N NE  . ARG C 176 ? 0.5567 0.5047 0.4408 -0.0179 0.0275  0.0184  176 ARG C NE  
3250 C CZ  . ARG C 176 ? 0.6036 0.5415 0.4688 -0.0187 0.0246  0.0177  176 ARG C CZ  
3251 N NH1 . ARG C 176 ? 0.6045 0.5259 0.4590 -0.0178 0.0127  0.0209  176 ARG C NH1 
3252 N NH2 . ARG C 176 ? 0.6227 0.5671 0.4791 -0.0200 0.0335  0.0136  176 ARG C NH2 
3253 N N   . SER C 177 ? 0.2492 0.1918 0.1904 -0.0033 0.0035  0.0152  177 SER C N   
3254 C CA  . SER C 177 ? 0.2509 0.1907 0.1950 -0.0072 -0.0014 0.0169  177 SER C CA  
3255 C C   . SER C 177 ? 0.2301 0.1879 0.1911 -0.0054 0.0018  0.0169  177 SER C C   
3256 O O   . SER C 177 ? 0.2908 0.2572 0.2574 -0.0123 0.0001  0.0213  177 SER C O   
3257 C CB  . SER C 177 ? 0.3007 0.2230 0.2370 -0.0020 -0.0079 0.0126  177 SER C CB  
3258 O OG  . SER C 177 ? 0.4098 0.3142 0.3309 -0.0022 -0.0122 0.0138  177 SER C OG  
3259 N N   . VAL C 178 ? 0.2147 0.1773 0.1826 0.0033  0.0054  0.0126  178 VAL C N   
3260 C CA  . VAL C 178 ? 0.2093 0.1858 0.1916 0.0070  0.0084  0.0135  178 VAL C CA  
3261 C C   . VAL C 178 ? 0.2373 0.2325 0.2306 0.0048  0.0138  0.0183  178 VAL C C   
3262 O O   . VAL C 178 ? 0.2809 0.2904 0.2862 0.0032  0.0124  0.0228  178 VAL C O   
3263 C CB  . VAL C 178 ? 0.2251 0.1989 0.2094 0.0156  0.0121  0.0082  178 VAL C CB  
3264 C CG1 . VAL C 178 ? 0.2673 0.2522 0.2650 0.0205  0.0157  0.0103  178 VAL C CG1 
3265 C CG2 . VAL C 178 ? 0.1857 0.1481 0.1636 0.0171  0.0074  0.0039  178 VAL C CG2 
3266 N N   . GLN C 179 ? 0.2149 0.2120 0.2040 0.0047  0.0199  0.0175  179 GLN C N   
3267 C CA  . GLN C 179 ? 0.2354 0.2526 0.2341 0.0024  0.0269  0.0215  179 GLN C CA  
3268 C C   . GLN C 179 ? 0.2416 0.2682 0.2429 -0.0098 0.0224  0.0285  179 GLN C C   
3269 O O   . GLN C 179 ? 0.2414 0.2911 0.2592 -0.0113 0.0242  0.0331  179 GLN C O   
3270 C CB  . GLN C 179 ? 0.2589 0.2734 0.2468 0.0020  0.0342  0.0188  179 GLN C CB  
3271 C CG  . GLN C 179 ? 0.3443 0.3514 0.3292 0.0123  0.0396  0.0114  179 GLN C CG  
3272 C CD  . GLN C 179 ? 0.3704 0.3729 0.3403 0.0102  0.0456  0.0083  179 GLN C CD  
3273 O OE1 . GLN C 179 ? 0.3699 0.3684 0.3275 0.0013  0.0433  0.0119  179 GLN C OE1 
3274 N NE2 . GLN C 179 ? 0.3529 0.3533 0.3210 0.0178  0.0532  0.0016  179 GLN C NE2 
3275 N N   . PHE C 180 ? 0.2456 0.2538 0.2304 -0.0185 0.0160  0.0295  180 PHE C N   
3276 C CA  . PHE C 180 ? 0.2890 0.2990 0.2707 -0.0328 0.0110  0.0358  180 PHE C CA  
3277 C C   . PHE C 180 ? 0.2517 0.2695 0.2434 -0.0355 0.0044  0.0378  180 PHE C C   
3278 O O   . PHE C 180 ? 0.2845 0.3236 0.2877 -0.0443 0.0038  0.0437  180 PHE C O   
3279 C CB  . PHE C 180 ? 0.2772 0.2577 0.2357 -0.0391 0.0046  0.0356  180 PHE C CB  
3280 C CG  . PHE C 180 ? 0.2711 0.2432 0.2217 -0.0537 -0.0027 0.0404  180 PHE C CG  
3281 C CD1 . PHE C 180 ? 0.3094 0.2943 0.2607 -0.0686 -0.0008 0.0475  180 PHE C CD1 
3282 C CD2 . PHE C 180 ? 0.3389 0.2897 0.2801 -0.0534 -0.0110 0.0373  180 PHE C CD2 
3283 C CE1 . PHE C 180 ? 0.3465 0.3213 0.2884 -0.0845 -0.0082 0.0518  180 PHE C CE1 
3284 C CE2 . PHE C 180 ? 0.3774 0.3161 0.3078 -0.0678 -0.0179 0.0405  180 PHE C CE2 
3285 C CZ  . PHE C 180 ? 0.3593 0.3090 0.2897 -0.0841 -0.0170 0.0480  180 PHE C CZ  
3286 N N   . LEU C 181 ? 0.2299 0.2324 0.2171 -0.0289 -0.0006 0.0332  181 LEU C N   
3287 C CA  . LEU C 181 ? 0.2313 0.2384 0.2237 -0.0316 -0.0072 0.0346  181 LEU C CA  
3288 C C   . LEU C 181 ? 0.2679 0.3046 0.2828 -0.0274 -0.0047 0.0390  181 LEU C C   
3289 O O   . LEU C 181 ? 0.2940 0.3460 0.3167 -0.0354 -0.0101 0.0443  181 LEU C O   
3290 C CB  . LEU C 181 ? 0.2425 0.2304 0.2260 -0.0238 -0.0105 0.0282  181 LEU C CB  
3291 C CG  . LEU C 181 ? 0.2732 0.2334 0.2364 -0.0275 -0.0159 0.0240  181 LEU C CG  
3292 C CD1 . LEU C 181 ? 0.2742 0.2241 0.2334 -0.0186 -0.0170 0.0175  181 LEU C CD1 
3293 C CD2 . LEU C 181 ? 0.2412 0.1964 0.1963 -0.0419 -0.0228 0.0273  181 LEU C CD2 
3294 N N   . CYS C 182 ? 0.2807 0.3248 0.3052 -0.0147 0.0030  0.0369  182 CYS C N   
3295 C CA  . CYS C 182 ? 0.2538 0.3221 0.2993 -0.0067 0.0056  0.0407  182 CYS C CA  
3296 C C   . CYS C 182 ? 0.2681 0.3669 0.3302 -0.0115 0.0096  0.0469  182 CYS C C   
3297 O O   . CYS C 182 ? 0.2983 0.4223 0.3799 -0.0084 0.0079  0.0524  182 CYS C O   
3298 C CB  . CYS C 182 ? 0.2243 0.2862 0.2722 0.0085  0.0131  0.0357  182 CYS C CB  
3299 S SG  . CYS C 182 ? 0.2240 0.2612 0.2605 0.0144  0.0085  0.0307  182 CYS C SG  
3300 N N   . THR C 183 ? 0.2593 0.3581 0.3145 -0.0191 0.0147  0.0466  183 THR C N   
3301 C CA  . THR C 183 ? 0.2466 0.3777 0.3182 -0.0238 0.0210  0.0519  183 THR C CA  
3302 C C   . THR C 183 ? 0.2630 0.4032 0.3320 -0.0444 0.0145  0.0585  183 THR C C   
3303 O O   . THR C 183 ? 0.2063 0.3810 0.2946 -0.0505 0.0161  0.0648  183 THR C O   
3304 C CB  . THR C 183 ? 0.2819 0.4120 0.3479 -0.0197 0.0334  0.0479  183 THR C CB  
3305 O OG1 . THR C 183 ? 0.4358 0.6027 0.5224 -0.0194 0.0424  0.0519  183 THR C OG1 
3306 C CG2 . THR C 183 ? 0.2323 0.3390 0.2736 -0.0331 0.0315  0.0474  183 THR C CG2 
3307 N N   . LYS C 184 ? 0.3016 0.4111 0.3473 -0.0551 0.0069  0.0568  184 LYS C N   
3308 C CA  . LYS C 184 ? 0.3530 0.4628 0.3907 -0.0763 0.0003  0.0623  184 LYS C CA  
3309 C C   . LYS C 184 ? 0.4055 0.5043 0.4370 -0.0836 -0.0123 0.0627  184 LYS C C   
3310 O O   . LYS C 184 ? 0.4491 0.5685 0.4892 -0.0975 -0.0182 0.0687  184 LYS C O   
3311 C CB  . LYS C 184 ? 0.3733 0.4526 0.3850 -0.0853 0.0011  0.0609  184 LYS C CB  
3312 C CG  . LYS C 184 ? 0.3521 0.4381 0.3634 -0.0806 0.0128  0.0603  184 LYS C CG  
3313 C CD  . LYS C 184 ? 0.3978 0.5264 0.4308 -0.0865 0.0212  0.0662  184 LYS C CD  
3314 C CE  . LYS C 184 ? 0.4678 0.5955 0.4886 -0.0937 0.0306  0.0676  184 LYS C CE  
3315 N NZ  . LYS C 184 ? 0.5227 0.6210 0.5168 -0.1130 0.0232  0.0718  184 LYS C NZ  
3316 N N   . VAL C 185 ? 0.4056 0.4738 0.4218 -0.0752 -0.0163 0.0562  185 VAL C N   
3317 C CA  . VAL C 185 ? 0.4398 0.4914 0.4435 -0.0829 -0.0271 0.0548  185 VAL C CA  
3318 C C   . VAL C 185 ? 0.4039 0.4761 0.4232 -0.0774 -0.0318 0.0570  185 VAL C C   
3319 O O   . VAL C 185 ? 0.4047 0.4844 0.4230 -0.0902 -0.0408 0.0605  185 VAL C O   
3320 C CB  . VAL C 185 ? 0.4360 0.4473 0.4161 -0.0759 -0.0285 0.0463  185 VAL C CB  
3321 C CG1 . VAL C 185 ? 0.4057 0.4009 0.3729 -0.0806 -0.0375 0.0431  185 VAL C CG1 
3322 C CG2 . VAL C 185 ? 0.4412 0.4276 0.4021 -0.0832 -0.0276 0.0457  185 VAL C CG2 
3323 N N   . LEU C 186 ? 0.3916 0.4714 0.4233 -0.0594 -0.0264 0.0553  186 LEU C N   
3324 C CA  . LEU C 186 ? 0.3489 0.4393 0.3900 -0.0523 -0.0314 0.0573  186 LEU C CA  
3325 C C   . LEU C 186 ? 0.3536 0.4847 0.4220 -0.0512 -0.0328 0.0664  186 LEU C C   
3326 O O   . LEU C 186 ? 0.3494 0.5022 0.4359 -0.0441 -0.0244 0.0688  186 LEU C O   
3327 C CB  . LEU C 186 ? 0.2801 0.3558 0.3195 -0.0345 -0.0258 0.0519  186 LEU C CB  
3328 C CG  . LEU C 186 ? 0.2223 0.2640 0.2382 -0.0340 -0.0271 0.0436  186 LEU C CG  
3329 C CD1 . LEU C 186 ? 0.2004 0.2322 0.2168 -0.0189 -0.0203 0.0387  186 LEU C CD1 
3330 C CD2 . LEU C 186 ? 0.2148 0.2495 0.2198 -0.0413 -0.0364 0.0437  186 LEU C CD2 
3331 N N   . GLU C 187 ? 0.3218 0.4637 0.3926 -0.0578 -0.0435 0.0713  187 GLU C N   
3332 C CA  . GLU C 187 ? 0.3155 0.4976 0.4132 -0.0551 -0.0475 0.0810  187 GLU C CA  
3333 C C   . GLU C 187 ? 0.2581 0.4419 0.3670 -0.0334 -0.0446 0.0821  187 GLU C C   
3334 O O   . GLU C 187 ? 0.2396 0.3932 0.3317 -0.0261 -0.0429 0.0760  187 GLU C O   
3335 C CB  . GLU C 187 ? 0.3820 0.5732 0.4746 -0.0723 -0.0620 0.0862  187 GLU C CB  
3336 C CG  . GLU C 187 ? 0.4563 0.6422 0.5353 -0.0959 -0.0658 0.0853  187 GLU C CG  
3337 C CD  . GLU C 187 ? 0.5884 0.7734 0.6543 -0.1142 -0.0805 0.0877  187 GLU C CD  
3338 O OE1 . GLU C 187 ? 0.6302 0.8523 0.7159 -0.1187 -0.0890 0.0970  187 GLU C OE1 
3339 O OE2 . GLU C 187 ? 0.6441 0.7916 0.6796 -0.1236 -0.0838 0.0802  187 GLU C OE2 
3340 N N   . PRO C 188 ? 0.2988 0.5178 0.4362 -0.0228 -0.0439 0.0900  188 PRO C N   
3341 C CA  . PRO C 188 ? 0.3351 0.5519 0.4824 -0.0008 -0.0404 0.0913  188 PRO C CA  
3342 C C   . PRO C 188 ? 0.3779 0.5756 0.5109 0.0011  -0.0502 0.0934  188 PRO C C   
3343 O O   . PRO C 188 ? 0.4271 0.6289 0.5522 -0.0126 -0.0622 0.0974  188 PRO C O   
3344 C CB  . PRO C 188 ? 0.3228 0.5852 0.5042 0.0080  -0.0404 0.1008  188 PRO C CB  
3345 C CG  . PRO C 188 ? 0.3087 0.5956 0.4986 -0.0074 -0.0372 0.1013  188 PRO C CG  
3346 C CD  . PRO C 188 ? 0.3100 0.5729 0.4725 -0.0301 -0.0451 0.0978  188 PRO C CD  
3347 N N   . LEU C 189 ? 0.3426 0.5185 0.4705 0.0168  -0.0449 0.0905  189 LEU C N   
3348 C CA  . LEU C 189 ? 0.3022 0.4600 0.4165 0.0194  -0.0527 0.0934  189 LEU C CA  
3349 C C   . LEU C 189 ? 0.3506 0.5360 0.4830 0.0247  -0.0637 0.1066  189 LEU C C   
3350 O O   . LEU C 189 ? 0.3760 0.5916 0.5356 0.0351  -0.0618 0.1125  189 LEU C O   
3351 C CB  . LEU C 189 ? 0.2800 0.4089 0.3856 0.0337  -0.0438 0.0880  189 LEU C CB  
3352 C CG  . LEU C 189 ? 0.2650 0.3634 0.3482 0.0278  -0.0365 0.0760  189 LEU C CG  
3353 C CD1 . LEU C 189 ? 0.2928 0.3688 0.3715 0.0411  -0.0279 0.0715  189 LEU C CD1 
3354 C CD2 . LEU C 189 ? 0.2397 0.3224 0.3001 0.0140  -0.0439 0.0738  189 LEU C CD2 
3355 N N   . PRO C 190 ? 0.3764 0.5532 0.4936 0.0180  -0.0754 0.1116  190 PRO C N   
3356 C CA  . PRO C 190 ? 0.3854 0.5865 0.5166 0.0226  -0.0883 0.1255  190 PRO C CA  
3357 C C   . PRO C 190 ? 0.3705 0.5742 0.5201 0.0472  -0.0845 0.1318  190 PRO C C   
3358 O O   . PRO C 190 ? 0.3332 0.5106 0.4764 0.0582  -0.0728 0.1246  190 PRO C O   
3359 C CB  . PRO C 190 ? 0.3824 0.5609 0.4845 0.0114  -0.0982 0.1266  190 PRO C CB  
3360 C CG  . PRO C 190 ? 0.3770 0.5322 0.4551 -0.0041 -0.0925 0.1135  190 PRO C CG  
3361 C CD  . PRO C 190 ? 0.3668 0.5123 0.4521 0.0050  -0.0773 0.1043  190 PRO C CD  
3362 N N   . GLU C 191 ? 0.3683 0.6028 0.5399 0.0556  -0.0949 0.1452  191 GLU C N   
3363 C CA  . GLU C 191 ? 0.3771 0.6143 0.5673 0.0812  -0.0926 0.1523  191 GLU C CA  
3364 C C   . GLU C 191 ? 0.4315 0.6245 0.5968 0.0886  -0.0923 0.1525  191 GLU C C   
3365 O O   . GLU C 191 ? 0.4394 0.6161 0.6102 0.1084  -0.0849 0.1526  191 GLU C O   
3366 C CB  . GLU C 191 ? 0.3772 0.6467 0.5866 0.0852  -0.1033 0.1620  191 GLU C CB  
3367 C CG  . GLU C 191 ? 0.4286 0.7299 0.6705 0.0994  -0.0945 0.1603  191 GLU C CG  
3368 C CD  . GLU C 191 ? 0.4679 0.7996 0.7280 0.1039  -0.1054 0.1691  191 GLU C CD  
3369 O OE1 . GLU C 191 ? 0.4530 0.8036 0.7097 0.0854  -0.1179 0.1744  191 GLU C OE1 
3370 O OE2 . GLU C 191 ? 0.4850 0.8201 0.7617 0.1260  -0.1017 0.1703  191 GLU C OE2 
3371 N N   . GLU C 192 ? 0.4872 0.6603 0.6241 0.0718  -0.1001 0.1524  192 GLU C N   
3372 C CA  . GLU C 192 ? 0.5266 0.6592 0.6373 0.0743  -0.0995 0.1526  192 GLU C CA  
3373 C C   . GLU C 192 ? 0.2852 0.3913 0.3664 0.0561  -0.0934 0.1398  192 GLU C C   
3374 O O   . GLU C 192 ? 0.2805 0.3954 0.3514 0.0382  -0.0987 0.1369  192 GLU C O   
3375 C CB  . GLU C 192 ? 0.4895 0.6250 0.5934 0.0747  -0.1163 0.1685  192 GLU C CB  
3376 C CG  . GLU C 192 ? 0.5725 0.7222 0.6986 0.0943  -0.1189 0.1749  192 GLU C CG  
3377 C CD  . GLU C 192 ? 0.6883 0.8368 0.8024 0.0920  -0.1337 0.1854  192 GLU C CD  
3378 O OE1 . GLU C 192 ? 0.7490 0.8910 0.8390 0.0730  -0.1416 0.1871  192 GLU C OE1 
3379 O OE2 . GLU C 192 ? 0.7140 0.8671 0.8415 0.1094  -0.1374 0.1915  192 GLU C OE2 
3380 N N   . PHE C 193 ? 0.2864 0.3599 0.3540 0.0607  -0.0823 0.1319  193 PHE C N   
3381 C CA  . PHE C 193 ? 0.3335 0.3833 0.3755 0.0461  -0.0759 0.1200  193 PHE C CA  
3382 C C   . PHE C 193 ? 0.3929 0.4083 0.4189 0.0511  -0.0683 0.1169  193 PHE C C   
3383 O O   . PHE C 193 ? 0.4634 0.4691 0.4977 0.0664  -0.0660 0.1217  193 PHE C O   
3384 C CB  . PHE C 193 ? 0.2731 0.3306 0.3206 0.0399  -0.0669 0.1072  193 PHE C CB  
3385 C CG  . PHE C 193 ? 0.2681 0.3186 0.3271 0.0524  -0.0541 0.1002  193 PHE C CG  
3386 C CD1 . PHE C 193 ? 0.3108 0.3321 0.3552 0.0542  -0.0453 0.0926  193 PHE C CD1 
3387 C CD2 . PHE C 193 ? 0.2454 0.3199 0.3290 0.0610  -0.0507 0.1010  193 PHE C CD2 
3388 C CE1 . PHE C 193 ? 0.3126 0.3263 0.3645 0.0642  -0.0343 0.0857  193 PHE C CE1 
3389 C CE2 . PHE C 193 ? 0.2368 0.3041 0.3279 0.0720  -0.0385 0.0938  193 PHE C CE2 
3390 C CZ  . PHE C 193 ? 0.2972 0.3328 0.3715 0.0734  -0.0306 0.0859  193 PHE C CZ  
3391 N N   . THR C 194 ? 0.3319 0.3293 0.3348 0.0380  -0.0644 0.1090  194 THR C N   
3392 C CA  . THR C 194 ? 0.3099 0.2782 0.2980 0.0386  -0.0558 0.1039  194 THR C CA  
3393 C C   . THR C 194 ? 0.2806 0.2442 0.2626 0.0304  -0.0455 0.0886  194 THR C C   
3394 O O   . THR C 194 ? 0.2723 0.2442 0.2472 0.0195  -0.0467 0.0833  194 THR C O   
3395 C CB  . THR C 194 ? 0.4181 0.3689 0.3818 0.0299  -0.0612 0.1109  194 THR C CB  
3396 O OG1 . THR C 194 ? 0.5254 0.4781 0.4926 0.0380  -0.0723 0.1266  194 THR C OG1 
3397 C CG2 . THR C 194 ? 0.3820 0.3047 0.3318 0.0285  -0.0519 0.1058  194 THR C CG2 
3398 N N   . ALA C 195 ? 0.2953 0.2445 0.2792 0.0363  -0.0359 0.0818  195 ALA C N   
3399 C CA  . ALA C 195 ? 0.3052 0.2512 0.2845 0.0299  -0.0273 0.0685  195 ALA C CA  
3400 C C   . ALA C 195 ? 0.3656 0.2893 0.3304 0.0259  -0.0210 0.0642  195 ALA C C   
3401 O O   . ALA C 195 ? 0.3258 0.2331 0.2905 0.0328  -0.0186 0.0670  195 ALA C O   
3402 C CB  . ALA C 195 ? 0.2959 0.2515 0.2922 0.0379  -0.0217 0.0627  195 ALA C CB  
3403 N N   . ASN C 196 ? 0.4036 0.3271 0.3563 0.0146  -0.0181 0.0570  196 ASN C N   
3404 C CA  . ASN C 196 ? 0.3648 0.2735 0.3054 0.0081  -0.0118 0.0523  196 ASN C CA  
3405 C C   . ASN C 196 ? 0.3064 0.2239 0.2466 0.0022  -0.0059 0.0401  196 ASN C C   
3406 O O   . ASN C 196 ? 0.3337 0.2645 0.2790 0.0026  -0.0071 0.0358  196 ASN C O   
3407 C CB  . ASN C 196 ? 0.4199 0.3194 0.3427 -0.0008 -0.0152 0.0600  196 ASN C CB  
3408 C CG  . ASN C 196 ? 0.4663 0.3789 0.3794 -0.0104 -0.0171 0.0576  196 ASN C CG  
3409 O OD1 . ASN C 196 ? 0.5111 0.4379 0.4312 -0.0090 -0.0188 0.0529  196 ASN C OD1 
3410 N ND2 . ASN C 196 ? 0.4818 0.3881 0.3767 -0.0209 -0.0165 0.0606  196 ASN C ND2 
3411 N N   . PHE C 197 ? 0.3060 0.2158 0.2400 -0.0034 0.0001  0.0349  197 PHE C N   
3412 C CA  . PHE C 197 ? 0.2883 0.2088 0.2236 -0.0077 0.0052  0.0240  197 PHE C CA  
3413 C C   . PHE C 197 ? 0.3609 0.2866 0.2840 -0.0182 0.0075  0.0223  197 PHE C C   
3414 O O   . PHE C 197 ? 0.3581 0.2748 0.2705 -0.0260 0.0089  0.0269  197 PHE C O   
3415 C CB  . PHE C 197 ? 0.2547 0.1691 0.1940 -0.0072 0.0102  0.0182  197 PHE C CB  
3416 C CG  . PHE C 197 ? 0.2754 0.1907 0.2261 0.0025  0.0102  0.0154  197 PHE C CG  
3417 C CD1 . PHE C 197 ? 0.3088 0.2373 0.2665 0.0050  0.0106  0.0088  197 PHE C CD1 
3418 C CD2 . PHE C 197 ? 0.2468 0.1486 0.2000 0.0096  0.0103  0.0194  197 PHE C CD2 
3419 C CE1 . PHE C 197 ? 0.3119 0.2414 0.2778 0.0122  0.0111  0.0069  197 PHE C CE1 
3420 C CE2 . PHE C 197 ? 0.2801 0.1848 0.2429 0.0180  0.0119  0.0163  197 PHE C CE2 
3421 C CZ  . PHE C 197 ? 0.3144 0.2336 0.2831 0.0183  0.0123  0.0104  197 PHE C CZ  
3422 N N   . ARG C 198 ? 0.3748 0.3140 0.2984 -0.0186 0.0083  0.0157  198 ARG C N   
3423 C CA  . ARG C 198 ? 0.3733 0.3201 0.2857 -0.0268 0.0121  0.0122  198 ARG C CA  
3424 C C   . ARG C 198 ? 0.3716 0.3324 0.2912 -0.0250 0.0179  0.0006  198 ARG C C   
3425 O O   . ARG C 198 ? 0.3230 0.2869 0.2519 -0.0170 0.0163  -0.0042 198 ARG C O   
3426 C CB  . ARG C 198 ? 0.3959 0.3437 0.2980 -0.0284 0.0073  0.0152  198 ARG C CB  
3427 C CG  . ARG C 198 ? 0.4348 0.3730 0.3341 -0.0274 -0.0009 0.0276  198 ARG C CG  
3428 C CD  . ARG C 198 ? 0.4612 0.4019 0.3476 -0.0320 -0.0066 0.0309  198 ARG C CD  
3429 N NE  . ARG C 198 ? 0.4778 0.4148 0.3667 -0.0290 -0.0163 0.0429  198 ARG C NE  
3430 C CZ  . ARG C 198 ? 0.5365 0.4752 0.4135 -0.0341 -0.0240 0.0492  198 ARG C CZ  
3431 N NH1 . ARG C 198 ? 0.5845 0.5256 0.4437 -0.0430 -0.0220 0.0437  198 ARG C NH1 
3432 N NH2 . ARG C 198 ? 0.5488 0.4881 0.4318 -0.0300 -0.0336 0.0609  198 ARG C NH2 
3433 N N   . LEU C 199 ? 0.3874 0.3575 0.3028 -0.0324 0.0244  -0.0032 199 LEU C N   
3434 C CA  . LEU C 199 ? 0.3451 0.3324 0.2703 -0.0295 0.0297  -0.0136 199 LEU C CA  
3435 C C   . LEU C 199 ? 0.3609 0.3627 0.2788 -0.0336 0.0364  -0.0195 199 LEU C C   
3436 O O   . LEU C 199 ? 0.2650 0.2638 0.1681 -0.0423 0.0381  -0.0152 199 LEU C O   
3437 C CB  . LEU C 199 ? 0.3105 0.3021 0.2445 -0.0335 0.0321  -0.0145 199 LEU C CB  
3438 C CG  . LEU C 199 ? 0.3115 0.3017 0.2378 -0.0474 0.0360  -0.0102 199 LEU C CG  
3439 C CD1 . LEU C 199 ? 0.3033 0.3173 0.2298 -0.0549 0.0440  -0.0160 199 LEU C CD1 
3440 C CD2 . LEU C 199 ? 0.2796 0.2622 0.2119 -0.0500 0.0347  -0.0095 199 LEU C CD2 
3441 N N   . GLU C 200 ? 0.3633 0.3812 0.2912 -0.0265 0.0404  -0.0292 200 GLU C N   
3442 C CA  . GLU C 200 ? 0.3638 0.3995 0.2881 -0.0281 0.0489  -0.0368 200 GLU C CA  
3443 C C   . GLU C 200 ? 0.3110 0.3718 0.2523 -0.0272 0.0546  -0.0428 200 GLU C C   
3444 O O   . GLU C 200 ? 0.2306 0.2947 0.1864 -0.0191 0.0508  -0.0450 200 GLU C O   
3445 C CB  . GLU C 200 ? 0.3312 0.3626 0.2498 -0.0178 0.0486  -0.0440 200 GLU C CB  
3446 C CG  . GLU C 200 ? 0.3307 0.3786 0.2436 -0.0173 0.0587  -0.0533 200 GLU C CG  
3447 C CD  . GLU C 200 ? 0.3822 0.4178 0.2827 -0.0089 0.0582  -0.0606 200 GLU C CD  
3448 O OE1 . GLU C 200 ? 0.4367 0.4558 0.3391 -0.0012 0.0503  -0.0600 200 GLU C OE1 
3449 O OE2 . GLU C 200 ? 0.4104 0.4517 0.2975 -0.0112 0.0661  -0.0670 200 GLU C OE2 
3450 N N   . TYR C 201 ? 0.2539 0.3340 0.1931 -0.0366 0.0634  -0.0449 201 TYR C N   
3451 C CA  . TYR C 201 ? 0.3514 0.4619 0.3085 -0.0375 0.0691  -0.0504 201 TYR C CA  
3452 C C   . TYR C 201 ? 0.3448 0.4760 0.3117 -0.0229 0.0747  -0.0617 201 TYR C C   
3453 O O   . TYR C 201 ? 0.3084 0.4310 0.2627 -0.0169 0.0776  -0.0661 201 TYR C O   
3454 C CB  . TYR C 201 ? 0.3852 0.5099 0.3365 -0.0562 0.0767  -0.0469 201 TYR C CB  
3455 C CG  . TYR C 201 ? 0.3589 0.4631 0.3018 -0.0707 0.0716  -0.0362 201 TYR C CG  
3456 C CD1 . TYR C 201 ? 0.3988 0.4753 0.3206 -0.0774 0.0684  -0.0272 201 TYR C CD1 
3457 C CD2 . TYR C 201 ? 0.2622 0.3741 0.2171 -0.0776 0.0697  -0.0351 201 TYR C CD2 
3458 C CE1 . TYR C 201 ? 0.3878 0.4426 0.3013 -0.0884 0.0638  -0.0174 201 TYR C CE1 
3459 C CE2 . TYR C 201 ? 0.2725 0.3609 0.2169 -0.0904 0.0656  -0.0264 201 TYR C CE2 
3460 C CZ  . TYR C 201 ? 0.3237 0.3827 0.2477 -0.0947 0.0629  -0.0176 201 TYR C CZ  
3461 O OH  . TYR C 201 ? 0.3010 0.3335 0.2141 -0.1050 0.0588  -0.0089 201 TYR C OH  
3462 N N   . THR C 202 ? 0.3419 0.4994 0.3305 -0.0168 0.0759  -0.0665 202 THR C N   
3463 C CA  . THR C 202 ? 0.3290 0.5097 0.3298 -0.0011 0.0818  -0.0770 202 THR C CA  
3464 C C   . THR C 202 ? 0.3661 0.5762 0.3666 -0.0090 0.0954  -0.0818 202 THR C C   
3465 O O   . THR C 202 ? 0.3575 0.5727 0.3509 -0.0283 0.0991  -0.0759 202 THR C O   
3466 C CB  . THR C 202 ? 0.3165 0.5188 0.3425 0.0091  0.0771  -0.0793 202 THR C CB  
3467 O OG1 . THR C 202 ? 0.3128 0.5419 0.3512 -0.0061 0.0790  -0.0761 202 THR C OG1 
3468 C CG2 . THR C 202 ? 0.3212 0.4950 0.3455 0.0159  0.0645  -0.0746 202 THR C CG2 
3469 N N   . ASN C 203 ? 0.4292 0.6575 0.4361 0.0061  0.1033  -0.0925 203 ASN C N   
3470 C CA  . ASN C 203 ? 0.4589 0.7218 0.4689 0.0008  0.1182  -0.0987 203 ASN C CA  
3471 C C   . ASN C 203 ? 0.4768 0.7808 0.5109 -0.0100 0.1209  -0.0962 203 ASN C C   
3472 O O   . ASN C 203 ? 0.4809 0.8040 0.5137 -0.0248 0.1287  -0.0941 203 ASN C O   
3473 C CB  . ASN C 203 ? 0.4915 0.7607 0.5061 0.0227  0.1241  -0.1098 203 ASN C CB  
3474 C CG  . ASN C 203 ? 0.5516 0.7812 0.5404 0.0316  0.1223  -0.1141 203 ASN C CG  
3475 O OD1 . ASN C 203 ? 0.5596 0.7603 0.5265 0.0196  0.1172  -0.1080 203 ASN C OD1 
3476 N ND2 . ASN C 203 ? 0.5854 0.8080 0.5761 0.0517  0.1242  -0.1221 203 ASN C ND2 
3477 N N   . ASP C 204 ? 0.4757 0.7854 0.5296 -0.0035 0.1106  -0.0938 204 ASP C N   
3478 C CA  . ASP C 204 ? 0.4221 0.7714 0.4999 -0.0135 0.1108  -0.0918 204 ASP C CA  
3479 C C   . ASP C 204 ? 0.3805 0.7232 0.4467 -0.0421 0.1103  -0.0824 204 ASP C C   
3480 O O   . ASP C 204 ? 0.4283 0.8048 0.5076 -0.0570 0.1146  -0.0812 204 ASP C O   
3481 C CB  . ASP C 204 ? 0.4296 0.7800 0.5260 -0.0010 0.0978  -0.0907 204 ASP C CB  
3482 C CG  . ASP C 204 ? 0.5108 0.8753 0.6233 0.0271  0.0980  -0.0991 204 ASP C CG  
3483 O OD1 . ASP C 204 ? 0.5500 0.9318 0.6684 0.0339  0.1058  -0.1033 204 ASP C OD1 
3484 O OD2 . ASP C 204 ? 0.5442 0.8873 0.6582 0.0412  0.0866  -0.0977 204 ASP C OD2 
3485 N N   . ALA C 205 ? 0.3564 0.6534 0.3977 -0.0494 0.1041  -0.0752 205 ALA C N   
3486 C CA  . ALA C 205 ? 0.3670 0.6482 0.3946 -0.0738 0.1019  -0.0654 205 ALA C CA  
3487 C C   . ALA C 205 ? 0.3614 0.6634 0.3808 -0.0937 0.1143  -0.0641 205 ALA C C   
3488 O O   . ALA C 205 ? 0.3830 0.6823 0.3876 -0.0921 0.1227  -0.0665 205 ALA C O   
3489 C CB  . ALA C 205 ? 0.3736 0.6038 0.3771 -0.0737 0.0937  -0.0583 205 ALA C CB  
3490 N N   . PRO C 206 ? 0.3432 0.6658 0.3705 -0.1141 0.1155  -0.0601 206 PRO C N   
3491 C CA  . PRO C 206 ? 0.3845 0.7149 0.4001 -0.1352 0.1227  -0.0556 206 PRO C CA  
3492 C C   . PRO C 206 ? 0.4345 0.7212 0.4167 -0.1501 0.1218  -0.0457 206 PRO C C   
3493 O O   . PRO C 206 ? 0.4347 0.6853 0.4073 -0.1503 0.1120  -0.0398 206 PRO C O   
3494 C CB  . PRO C 206 ? 0.3690 0.7208 0.4000 -0.1513 0.1185  -0.0530 206 PRO C CB  
3495 C CG  . PRO C 206 ? 0.3081 0.6800 0.3656 -0.1347 0.1121  -0.0590 206 PRO C CG  
3496 C CD  . PRO C 206 ? 0.3022 0.6384 0.3496 -0.1166 0.1068  -0.0597 206 PRO C CD  
3497 N N   . SER C 207 ? 0.4775 0.7608 0.4421 -0.1585 0.1280  -0.0431 207 SER C N   
3498 C CA  . SER C 207 ? 0.5620 0.8042 0.4939 -0.1707 0.1258  -0.0327 207 SER C CA  
3499 C C   . SER C 207 ? 0.5532 0.7677 0.4741 -0.1902 0.1183  -0.0217 207 SER C C   
3500 O O   . SER C 207 ? 0.6062 0.7795 0.5050 -0.1935 0.1126  -0.0127 207 SER C O   
3501 C CB  . SER C 207 ? 0.7171 0.9660 0.6341 -0.1790 0.1333  -0.0317 207 SER C CB  
3502 O OG  . SER C 207 ? 0.8231 1.0867 0.7435 -0.1608 0.1399  -0.0415 207 SER C OG  
3503 N N   . ASN C 208 ? 0.5294 0.7648 0.4649 -0.2022 0.1177  -0.0225 208 ASN C N   
3504 C CA  . ASN C 208 ? 0.5686 0.7755 0.4928 -0.2205 0.1103  -0.0139 208 ASN C CA  
3505 C C   . ASN C 208 ? 0.5093 0.6950 0.4387 -0.2133 0.1025  -0.0137 208 ASN C C   
3506 O O   . ASN C 208 ? 0.4863 0.6345 0.4003 -0.2245 0.0957  -0.0063 208 ASN C O   
3507 C CB  . ASN C 208 ? 0.6096 0.8461 0.5461 -0.2363 0.1114  -0.0157 208 ASN C CB  
3508 C CG  . ASN C 208 ? 0.6238 0.9145 0.5936 -0.2236 0.1159  -0.0269 208 ASN C CG  
3509 O OD1 . ASN C 208 ? 0.6133 0.9208 0.5936 -0.2036 0.1208  -0.0337 208 ASN C OD1 
3510 N ND2 . ASN C 208 ? 0.6533 0.9698 0.6387 -0.2343 0.1136  -0.0287 208 ASN C ND2 
3511 N N   . PHE C 209 ? 0.4590 0.6622 0.4091 -0.1904 0.1010  -0.0225 209 PHE C N   
3512 C CA  . PHE C 209 ? 0.4242 0.6016 0.3797 -0.1758 0.0891  -0.0234 209 PHE C CA  
3513 C C   . PHE C 209 ? 0.4035 0.5365 0.3405 -0.1624 0.0831  -0.0182 209 PHE C C   
3514 O O   . PHE C 209 ? 0.3986 0.5347 0.3355 -0.1468 0.0849  -0.0212 209 PHE C O   
3515 C CB  . PHE C 209 ? 0.3932 0.6041 0.3772 -0.1558 0.0876  -0.0338 209 PHE C CB  
3516 C CG  . PHE C 209 ? 0.3821 0.5669 0.3692 -0.1401 0.0763  -0.0346 209 PHE C CG  
3517 C CD1 . PHE C 209 ? 0.3677 0.5459 0.3582 -0.1489 0.0694  -0.0340 209 PHE C CD1 
3518 C CD2 . PHE C 209 ? 0.3738 0.5407 0.3587 -0.1183 0.0728  -0.0361 209 PHE C CD2 
3519 C CE1 . PHE C 209 ? 0.3707 0.5258 0.3620 -0.1353 0.0602  -0.0351 209 PHE C CE1 
3520 C CE2 . PHE C 209 ? 0.3605 0.5057 0.3479 -0.1055 0.0634  -0.0365 209 PHE C CE2 
3521 C CZ  . PHE C 209 ? 0.3761 0.5158 0.3665 -0.1135 0.0576  -0.0360 209 PHE C CZ  
3522 N N   . ARG C 210 ? 0.4024 0.4944 0.3239 -0.1684 0.0758  -0.0106 210 ARG C N   
3523 C CA  . ARG C 210 ? 0.4295 0.4824 0.3377 -0.1546 0.0689  -0.0052 210 ARG C CA  
3524 C C   . ARG C 210 ? 0.4289 0.4600 0.3428 -0.1451 0.0603  -0.0066 210 ARG C C   
3525 O O   . ARG C 210 ? 0.4756 0.5044 0.3912 -0.1565 0.0588  -0.0078 210 ARG C O   
3526 C CB  . ARG C 210 ? 0.4726 0.4928 0.3535 -0.1682 0.0687  0.0068  210 ARG C CB  
3527 C CG  . ARG C 210 ? 0.5439 0.5308 0.4128 -0.1533 0.0616  0.0134  210 ARG C CG  
3528 C CD  . ARG C 210 ? 0.6640 0.6165 0.5062 -0.1663 0.0594  0.0267  210 ARG C CD  
3529 N NE  . ARG C 210 ? 0.7424 0.6702 0.5767 -0.1797 0.0573  0.0306  210 ARG C NE  
3530 C CZ  . ARG C 210 ? 0.7589 0.6502 0.5884 -0.1714 0.0500  0.0341  210 ARG C CZ  
3531 N NH1 . ARG C 210 ? 0.6987 0.5781 0.5330 -0.1501 0.0441  0.0351  210 ARG C NH1 
3532 N NH2 . ARG C 210 ? 0.8156 0.6823 0.6349 -0.1849 0.0489  0.0361  210 ARG C NH2 
3533 N N   . ILE C 211 ? 0.4167 0.4327 0.3325 -0.1255 0.0551  -0.0069 211 ILE C N   
3534 C CA  . ILE C 211 ? 0.3870 0.3821 0.3065 -0.1154 0.0482  -0.0080 211 ILE C CA  
3535 C C   . ILE C 211 ? 0.4695 0.4216 0.3699 -0.1183 0.0442  0.0011  211 ILE C C   
3536 O O   . ILE C 211 ? 0.5060 0.4422 0.3966 -0.1123 0.0425  0.0081  211 ILE C O   
3537 C CB  . ILE C 211 ? 0.2908 0.2923 0.2223 -0.0938 0.0449  -0.0124 211 ILE C CB  
3538 C CG1 . ILE C 211 ? 0.2736 0.3131 0.2242 -0.0886 0.0476  -0.0217 211 ILE C CG1 
3539 C CG2 . ILE C 211 ? 0.2801 0.2574 0.2119 -0.0841 0.0387  -0.0121 211 ILE C CG2 
3540 C CD1 . ILE C 211 ? 0.2940 0.3394 0.2520 -0.0698 0.0459  -0.0254 211 ILE C CD1 
3541 N N   . ASP C 212 ? 0.4869 0.4199 0.3814 -0.1275 0.0425  0.0010  212 ASP C N   
3542 C CA  . ASP C 212 ? 0.5173 0.4061 0.3923 -0.1305 0.0395  0.0089  212 ASP C CA  
3543 C C   . ASP C 212 ? 0.4301 0.2983 0.3049 -0.1098 0.0349  0.0130  212 ASP C C   
3544 O O   . ASP C 212 ? 0.3575 0.2332 0.2455 -0.0949 0.0329  0.0073  212 ASP C O   
3545 C CB  . ASP C 212 ? 0.6359 0.5067 0.5057 -0.1399 0.0382  0.0047  212 ASP C CB  
3546 C CG  . ASP C 212 ? 0.7384 0.6206 0.6026 -0.1655 0.0417  0.0040  212 ASP C CG  
3547 O OD1 . ASP C 212 ? 0.7515 0.6717 0.6261 -0.1725 0.0461  0.0025  212 ASP C OD1 
3548 O OD2 . ASP C 212 ? 0.7955 0.6487 0.6445 -0.1789 0.0404  0.0046  212 ASP C OD2 
3549 N N   . GLY C 213 ? 0.4475 0.2911 0.3071 -0.1097 0.0329  0.0237  213 GLY C N   
3550 C CA  . GLY C 213 ? 0.4829 0.3101 0.3434 -0.0912 0.0278  0.0292  213 GLY C CA  
3551 C C   . GLY C 213 ? 0.4924 0.3397 0.3572 -0.0844 0.0264  0.0326  213 GLY C C   
3552 O O   . GLY C 213 ? 0.5198 0.3570 0.3847 -0.0717 0.0213  0.0390  213 GLY C O   
3553 N N   . PHE C 214 ? 0.4486 0.3254 0.3171 -0.0929 0.0310  0.0278  214 PHE C N   
3554 C CA  . PHE C 214 ? 0.4540 0.3487 0.3237 -0.0878 0.0306  0.0287  214 PHE C CA  
3555 C C   . PHE C 214 ? 0.5430 0.4420 0.3960 -0.1033 0.0343  0.0342  214 PHE C C   
3556 O O   . PHE C 214 ? 0.6034 0.5187 0.4557 -0.1173 0.0412  0.0300  214 PHE C O   
3557 C CB  . PHE C 214 ? 0.4096 0.3352 0.2975 -0.0801 0.0335  0.0170  214 PHE C CB  
3558 C CG  . PHE C 214 ? 0.4012 0.3237 0.3027 -0.0642 0.0292  0.0132  214 PHE C CG  
3559 C CD1 . PHE C 214 ? 0.4067 0.3282 0.3112 -0.0520 0.0246  0.0156  214 PHE C CD1 
3560 C CD2 . PHE C 214 ? 0.3984 0.3198 0.3085 -0.0631 0.0299  0.0073  214 PHE C CD2 
3561 C CE1 . PHE C 214 ? 0.4402 0.3607 0.3568 -0.0393 0.0215  0.0126  214 PHE C CE1 
3562 C CE2 . PHE C 214 ? 0.3947 0.3137 0.3152 -0.0496 0.0268  0.0040  214 PHE C CE2 
3563 C CZ  . PHE C 214 ? 0.3875 0.3065 0.3117 -0.0378 0.0231  0.0069  214 PHE C CZ  
3564 N N   . GLU C 215 ? 0.5510 0.4374 0.3907 -0.1013 0.0295  0.0440  215 GLU C N   
3565 C CA  . GLU C 215 ? 0.6024 0.4922 0.4228 -0.1155 0.0324  0.0500  215 GLU C CA  
3566 C C   . GLU C 215 ? 0.5757 0.4987 0.4015 -0.1156 0.0389  0.0400  215 GLU C C   
3567 O O   . GLU C 215 ? 0.5527 0.4868 0.3910 -0.1016 0.0367  0.0333  215 GLU C O   
3568 C CB  . GLU C 215 ? 0.6676 0.5345 0.4717 -0.1120 0.0235  0.0638  215 GLU C CB  
3569 C CG  . GLU C 215 ? 0.7335 0.5637 0.5276 -0.1122 0.0176  0.0754  215 GLU C CG  
3570 C CD  . GLU C 215 ? 0.8145 0.6297 0.5871 -0.1333 0.0218  0.0822  215 GLU C CD  
3571 O OE1 . GLU C 215 ? 0.8933 0.7124 0.6472 -0.1453 0.0231  0.0887  215 GLU C OE1 
3572 O OE2 . GLU C 215 ? 0.8235 0.6221 0.5960 -0.1391 0.0239  0.0808  215 GLU C OE2 
3573 N N   . ASP C 216 ? 0.5608 0.4990 0.3764 -0.1314 0.0474  0.0387  216 ASP C N   
3574 C CA  . ASP C 216 ? 0.5104 0.4770 0.3265 -0.1308 0.0545  0.0298  216 ASP C CA  
3575 C C   . ASP C 216 ? 0.4422 0.3980 0.2421 -0.1262 0.0482  0.0356  216 ASP C C   
3576 O O   . ASP C 216 ? 0.5018 0.4358 0.2817 -0.1335 0.0425  0.0489  216 ASP C O   
3577 C CB  . ASP C 216 ? 0.5593 0.5459 0.3666 -0.1496 0.0660  0.0280  216 ASP C CB  
3578 C CG  . ASP C 216 ? 0.5698 0.5815 0.3987 -0.1525 0.0731  0.0184  216 ASP C CG  
3579 O OD1 . ASP C 216 ? 0.5829 0.5878 0.4282 -0.1436 0.0678  0.0159  216 ASP C OD1 
3580 O OD2 . ASP C 216 ? 0.5388 0.5790 0.3684 -0.1641 0.0840  0.0134  216 ASP C OD2 
3581 N N   . SER C 217 ? 0.4015 0.3709 0.2091 -0.1142 0.0482  0.0262  217 SER C N   
3582 C CA  . SER C 217 ? 0.4625 0.4253 0.2539 -0.1120 0.0426  0.0296  217 SER C CA  
3583 C C   . SER C 217 ? 0.4726 0.4572 0.2631 -0.1091 0.0509  0.0155  217 SER C C   
3584 O O   . SER C 217 ? 0.5374 0.5394 0.3469 -0.1012 0.0573  0.0035  217 SER C O   
3585 C CB  . SER C 217 ? 0.5243 0.4718 0.3251 -0.0981 0.0300  0.0345  217 SER C CB  
3586 O OG  . SER C 217 ? 0.5503 0.4944 0.3363 -0.0975 0.0234  0.0374  217 SER C OG  
3587 N N   . SER C 218 ? 0.4434 0.4258 0.2104 -0.1151 0.0506  0.0169  218 SER C N   
3588 C CA  . SER C 218 ? 0.4553 0.4528 0.2171 -0.1113 0.0584  0.0027  218 SER C CA  
3589 C C   . SER C 218 ? 0.4406 0.4271 0.2034 -0.0999 0.0484  0.0000  218 SER C C   
3590 O O   . SER C 218 ? 0.5104 0.5016 0.2653 -0.0960 0.0524  -0.0115 218 SER C O   
3591 C CB  . SER C 218 ? 0.4778 0.4800 0.2099 -0.1263 0.0658  0.0036  218 SER C CB  
3592 O OG  . SER C 218 ? 0.4782 0.4598 0.1875 -0.1351 0.0546  0.0187  218 SER C OG  
3593 N N   . THR C 219 ? 0.4119 0.3835 0.1840 -0.0948 0.0358  0.0104  219 THR C N   
3594 C CA  . THR C 219 ? 0.4145 0.3781 0.1907 -0.0857 0.0256  0.0096  219 THR C CA  
3595 C C   . THR C 219 ? 0.3553 0.3176 0.1595 -0.0730 0.0217  0.0090  219 THR C C   
3596 O O   . THR C 219 ? 0.3604 0.3219 0.1773 -0.0723 0.0229  0.0137  219 THR C O   
3597 C CB  . THR C 219 ? 0.5148 0.4652 0.2742 -0.0918 0.0126  0.0237  219 THR C CB  
3598 O OG1 . THR C 219 ? 0.5108 0.4521 0.2735 -0.0944 0.0081  0.0381  219 THR C OG1 
3599 C CG2 . THR C 219 ? 0.4320 0.3828 0.1600 -0.1043 0.0153  0.0226  219 THR C CG2 
3600 N N   . PHE C 220 ? 0.4097 0.3704 0.2210 -0.0644 0.0170  0.0032  220 PHE C N   
3601 C CA  . PHE C 220 ? 0.4112 0.3722 0.2466 -0.0528 0.0149  0.0006  220 PHE C CA  
3602 C C   . PHE C 220 ? 0.4287 0.3817 0.2685 -0.0494 0.0028  0.0083  220 PHE C C   
3603 O O   . PHE C 220 ? 0.3726 0.3206 0.2133 -0.0511 -0.0043 0.0208  220 PHE C O   
3604 C CB  . PHE C 220 ? 0.4261 0.3942 0.2674 -0.0452 0.0220  -0.0144 220 PHE C CB  
3605 C CG  . PHE C 220 ? 0.4205 0.3925 0.2851 -0.0350 0.0229  -0.0176 220 PHE C CG  
3606 C CD1 . PHE C 220 ? 0.4102 0.3805 0.2879 -0.0344 0.0202  -0.0096 220 PHE C CD1 
3607 C CD2 . PHE C 220 ? 0.4355 0.4106 0.3067 -0.0259 0.0263  -0.0288 220 PHE C CD2 
3608 C CE1 . PHE C 220 ? 0.3196 0.2931 0.2155 -0.0262 0.0209  -0.0130 220 PHE C CE1 
3609 C CE2 . PHE C 220 ? 0.3813 0.3599 0.2718 -0.0171 0.0261  -0.0309 220 PHE C CE2 
3610 C CZ  . PHE C 220 ? 0.3030 0.2818 0.2054 -0.0181 0.0235  -0.0232 220 PHE C CZ  
3611 N N   . TYR C 221 ? 0.4695 0.4215 0.3124 -0.0444 0.0007  0.0009  221 TYR C N   
3612 C CA  . TYR C 221 ? 0.4404 0.3883 0.2851 -0.0443 -0.0103 0.0068  221 TYR C CA  
3613 C C   . TYR C 221 ? 0.4118 0.3546 0.2430 -0.0464 -0.0108 -0.0034 221 TYR C C   
3614 O O   . TYR C 221 ? 0.4259 0.3674 0.2540 -0.0424 -0.0023 -0.0156 221 TYR C O   
3615 C CB  . TYR C 221 ? 0.4243 0.3740 0.2928 -0.0353 -0.0130 0.0101  221 TYR C CB  
3616 C CG  . TYR C 221 ? 0.4263 0.3756 0.3043 -0.0279 -0.0079 -0.0007 221 TYR C CG  
3617 C CD1 . TYR C 221 ? 0.4086 0.3530 0.2850 -0.0273 -0.0123 -0.0047 221 TYR C CD1 
3618 C CD2 . TYR C 221 ? 0.4021 0.3554 0.2897 -0.0225 0.0002  -0.0062 221 TYR C CD2 
3619 C CE1 . TYR C 221 ? 0.3729 0.3137 0.2557 -0.0203 -0.0086 -0.0132 221 TYR C CE1 
3620 C CE2 . TYR C 221 ? 0.3525 0.3059 0.2484 -0.0150 0.0033  -0.0147 221 TYR C CE2 
3621 C CZ  . TYR C 221 ? 0.3163 0.2621 0.2092 -0.0133 -0.0011 -0.0179 221 TYR C CZ  
3622 O OH  . TYR C 221 ? 0.2705 0.2132 0.1695 -0.0054 0.0011  -0.0251 221 TYR C OH  
3623 N N   . THR C 222 ? 0.3602 0.2997 0.1831 -0.0526 -0.0210 0.0016  222 THR C N   
3624 C CA  . THR C 222 ? 0.3476 0.2777 0.1564 -0.0560 -0.0230 -0.0079 222 THR C CA  
3625 C C   . THR C 222 ? 0.3687 0.2990 0.1892 -0.0568 -0.0330 -0.0024 222 THR C C   
3626 O O   . THR C 222 ? 0.3390 0.2797 0.1761 -0.0554 -0.0392 0.0095  222 THR C O   
3627 C CB  . THR C 222 ? 0.4251 0.3498 0.2039 -0.0680 -0.0254 -0.0098 222 THR C CB  
3628 O OG1 . THR C 222 ? 0.4684 0.3992 0.2450 -0.0762 -0.0377 0.0045  222 THR C OG1 
3629 C CG2 . THR C 222 ? 0.3919 0.3191 0.1584 -0.0687 -0.0140 -0.0150 222 THR C CG2 
3630 N N   . LEU C 223 ? 0.4126 0.3311 0.2242 -0.0588 -0.0342 -0.0111 223 LEU C N   
3631 C CA  . LEU C 223 ? 0.4054 0.3242 0.2258 -0.0625 -0.0432 -0.0063 223 LEU C CA  
3632 C C   . LEU C 223 ? 0.3714 0.2821 0.1687 -0.0771 -0.0523 -0.0076 223 LEU C C   
3633 O O   . LEU C 223 ? 0.3956 0.2919 0.1676 -0.0813 -0.0488 -0.0178 223 LEU C O   
3634 C CB  . LEU C 223 ? 0.4089 0.3176 0.2380 -0.0545 -0.0384 -0.0139 223 LEU C CB  
3635 C CG  . LEU C 223 ? 0.3926 0.3102 0.2453 -0.0418 -0.0317 -0.0119 223 LEU C CG  
3636 C CD1 . LEU C 223 ? 0.3867 0.2924 0.2430 -0.0351 -0.0284 -0.0191 223 LEU C CD1 
3637 C CD2 . LEU C 223 ? 0.3433 0.2780 0.2168 -0.0415 -0.0367 0.0013  223 LEU C CD2 
3638 N N   . PRO C 224 ? 0.4519 0.3731 0.2576 -0.0854 -0.0638 0.0024  224 PRO C N   
3639 C CA  . PRO C 224 ? 0.5015 0.4151 0.2852 -0.1017 -0.0737 0.0008  224 PRO C CA  
3640 C C   . PRO C 224 ? 0.5392 0.4263 0.3064 -0.1041 -0.0704 -0.0128 224 PRO C C   
3641 O O   . PRO C 224 ? 0.4140 0.2940 0.1934 -0.0933 -0.0632 -0.0172 224 PRO C O   
3642 C CB  . PRO C 224 ? 0.4838 0.4203 0.2888 -0.1077 -0.0855 0.0150  224 PRO C CB  
3643 C CG  . PRO C 224 ? 0.4285 0.3842 0.2613 -0.0938 -0.0818 0.0249  224 PRO C CG  
3644 C CD  . PRO C 224 ? 0.4044 0.3470 0.2398 -0.0806 -0.0680 0.0153  224 PRO C CD  
3645 N N   . ASP C 225 ? 0.6265 0.4970 0.3644 -0.1183 -0.0760 -0.0193 225 ASP C N   
3646 C CA  . ASP C 225 ? 0.6555 0.4943 0.3727 -0.1203 -0.0727 -0.0332 225 ASP C CA  
3647 C C   . ASP C 225 ? 0.6022 0.4378 0.3328 -0.1244 -0.0780 -0.0290 225 ASP C C   
3648 O O   . ASP C 225 ? 0.6013 0.4109 0.3235 -0.1201 -0.0734 -0.0380 225 ASP C O   
3649 C CB  . ASP C 225 ? 0.7359 0.5563 0.4175 -0.1353 -0.0773 -0.0410 225 ASP C CB  
3650 C CG  . ASP C 225 ? 0.7895 0.6168 0.4586 -0.1331 -0.0719 -0.0431 225 ASP C CG  
3651 O OD1 . ASP C 225 ? 0.8288 0.6616 0.5044 -0.1199 -0.0620 -0.0457 225 ASP C OD1 
3652 O OD2 . ASP C 225 ? 0.7978 0.6264 0.4524 -0.1447 -0.0768 -0.0413 225 ASP C OD2 
3653 N N   . ASP C 226 ? 0.5615 0.4242 0.3130 -0.1323 -0.0874 -0.0148 226 ASP C N   
3654 C CA  . ASP C 226 ? 0.6054 0.4705 0.3704 -0.1388 -0.0921 -0.0095 226 ASP C CA  
3655 C C   . ASP C 226 ? 0.5647 0.4488 0.3635 -0.1234 -0.0855 -0.0023 226 ASP C C   
3656 O O   . ASP C 226 ? 0.6274 0.5257 0.4439 -0.1285 -0.0891 0.0058  226 ASP C O   
3657 C CB  . ASP C 226 ? 0.6433 0.5296 0.4109 -0.1590 -0.1065 0.0010  226 ASP C CB  
3658 C CG  . ASP C 226 ? 0.6731 0.5921 0.4548 -0.1571 -0.1119 0.0122  226 ASP C CG  
3659 O OD1 . ASP C 226 ? 0.6367 0.5576 0.4214 -0.1425 -0.1042 0.0111  226 ASP C OD1 
3660 O OD2 . ASP C 226 ? 0.7338 0.6771 0.5234 -0.1707 -0.1243 0.0228  226 ASP C OD2 
3661 N N   . ILE C 227 ? 0.5026 0.3874 0.3090 -0.1058 -0.0754 -0.0057 227 ILE C N   
3662 C CA  . ILE C 227 ? 0.5186 0.4184 0.3532 -0.0916 -0.0688 -0.0004 227 ILE C CA  
3663 C C   . ILE C 227 ? 0.5284 0.4093 0.3622 -0.0888 -0.0652 -0.0051 227 ILE C C   
3664 O O   . ILE C 227 ? 0.5559 0.4069 0.3670 -0.0903 -0.0639 -0.0153 227 ILE C O   
3665 C CB  . ILE C 227 ? 0.4933 0.3966 0.3333 -0.0760 -0.0594 -0.0035 227 ILE C CB  
3666 C CG1 . ILE C 227 ? 0.4521 0.3751 0.3210 -0.0644 -0.0550 0.0041  227 ILE C CG1 
3667 C CG2 . ILE C 227 ? 0.5222 0.4001 0.3453 -0.0679 -0.0510 -0.0174 227 ILE C CG2 
3668 C CD1 . ILE C 227 ? 0.4722 0.4209 0.3574 -0.0649 -0.0598 0.0162  227 ILE C CD1 
3669 N N   . GLN C 228 ? 0.4965 0.3938 0.3537 -0.0847 -0.0636 0.0026  228 GLN C N   
3670 C CA  . GLN C 228 ? 0.4218 0.3030 0.2784 -0.0825 -0.0606 0.0003  228 GLN C CA  
3671 C C   . GLN C 228 ? 0.4231 0.3068 0.2932 -0.0643 -0.0513 -0.0017 228 GLN C C   
3672 O O   . GLN C 228 ? 0.4733 0.3770 0.3592 -0.0558 -0.0478 0.0015  228 GLN C O   
3673 C CB  . GLN C 228 ? 0.3460 0.2437 0.2157 -0.0945 -0.0655 0.0103  228 GLN C CB  
3674 C CG  . GLN C 228 ? 0.3870 0.2836 0.2437 -0.1157 -0.0759 0.0128  228 GLN C CG  
3675 C CD  . GLN C 228 ? 0.5159 0.3736 0.3442 -0.1259 -0.0784 0.0053  228 GLN C CD  
3676 O OE1 . GLN C 228 ? 0.6043 0.4575 0.4319 -0.1373 -0.0810 0.0097  228 GLN C OE1 
3677 N NE2 . GLN C 228 ? 0.5543 0.3825 0.3578 -0.1221 -0.0771 -0.0061 228 GLN C NE2 
3678 N N   . SER C 229 ? 0.3807 0.2430 0.2435 -0.0588 -0.0483 -0.0066 229 SER C N   
3679 C CA  . SER C 229 ? 0.3922 0.2569 0.2661 -0.0427 -0.0409 -0.0088 229 SER C CA  
3680 C C   . SER C 229 ? 0.4295 0.2889 0.3079 -0.0419 -0.0404 -0.0049 229 SER C C   
3681 O O   . SER C 229 ? 0.3305 0.1763 0.1984 -0.0532 -0.0450 -0.0023 229 SER C O   
3682 C CB  . SER C 229 ? 0.4171 0.2624 0.2773 -0.0320 -0.0369 -0.0199 229 SER C CB  
3683 O OG  . SER C 229 ? 0.5009 0.3149 0.3413 -0.0335 -0.0394 -0.0252 229 SER C OG  
3684 N N   . ALA C 230 ? 0.3919 0.2614 0.2838 -0.0299 -0.0349 -0.0043 230 ALA C N   
3685 C CA  . ALA C 230 ? 0.3483 0.2127 0.2423 -0.0278 -0.0339 -0.0010 230 ALA C CA  
3686 C C   . ALA C 230 ? 0.2775 0.1458 0.1793 -0.0127 -0.0287 -0.0046 230 ALA C C   
3687 O O   . ALA C 230 ? 0.2793 0.1676 0.1954 -0.0076 -0.0246 -0.0041 230 ALA C O   
3688 C CB  . ALA C 230 ? 0.2803 0.1660 0.1879 -0.0366 -0.0337 0.0082  230 ALA C CB  
3689 N N   . THR C 231 ? 0.2917 0.1401 0.1834 -0.0059 -0.0296 -0.0078 231 THR C N   
3690 C CA  . THR C 231 ? 0.3801 0.2343 0.2793 0.0075  -0.0264 -0.0107 231 THR C CA  
3691 C C   . THR C 231 ? 0.4041 0.2747 0.3149 0.0064  -0.0239 -0.0046 231 THR C C   
3692 O O   . THR C 231 ? 0.4836 0.3485 0.3895 -0.0002 -0.0256 0.0012  231 THR C O   
3693 C CB  . THR C 231 ? 0.4098 0.2395 0.2961 0.0163  -0.0294 -0.0142 231 THR C CB  
3694 O OG1 . THR C 231 ? 0.5249 0.3404 0.4012 0.0207  -0.0296 -0.0222 231 THR C OG1 
3695 C CG2 . THR C 231 ? 0.3742 0.2149 0.2704 0.0286  -0.0277 -0.0153 231 THR C CG2 
3696 N N   . ILE C 232 ? 0.3741 0.2638 0.2984 0.0120  -0.0194 -0.0061 232 ILE C N   
3697 C CA  . ILE C 232 ? 0.3850 0.2879 0.3180 0.0119  -0.0162 -0.0022 232 ILE C CA  
3698 C C   . ILE C 232 ? 0.4233 0.3198 0.3518 0.0188  -0.0175 -0.0034 232 ILE C C   
3699 O O   . ILE C 232 ? 0.4398 0.3350 0.3646 0.0158  -0.0175 0.0010  232 ILE C O   
3700 C CB  . ILE C 232 ? 0.3587 0.2799 0.3050 0.0143  -0.0113 -0.0034 232 ILE C CB  
3701 C CG1 . ILE C 232 ? 0.3551 0.2831 0.3056 0.0083  -0.0117 -0.0006 232 ILE C CG1 
3702 C CG2 . ILE C 232 ? 0.3233 0.2542 0.2758 0.0148  -0.0072 -0.0010 232 ILE C CG2 
3703 C CD1 . ILE C 232 ? 0.3343 0.2779 0.2972 0.0100  -0.0075 0.0013  232 ILE C CD1 
3704 N N   . GLY C 233 ? 0.3709 0.2652 0.2996 0.0278  -0.0187 -0.0090 233 GLY C N   
3705 C CA  . GLY C 233 ? 0.3476 0.2386 0.2737 0.0356  -0.0216 -0.0098 233 GLY C CA  
3706 C C   . GLY C 233 ? 0.4284 0.3315 0.3635 0.0447  -0.0205 -0.0162 233 GLY C C   
3707 O O   . GLY C 233 ? 0.4480 0.3624 0.3907 0.0435  -0.0163 -0.0197 233 GLY C O   
3708 N N   . HIS C 234 ? 0.4292 0.3316 0.3637 0.0533  -0.0247 -0.0171 234 HIS C N   
3709 C CA  . HIS C 234 ? 0.4101 0.3288 0.3556 0.0619  -0.0239 -0.0229 234 HIS C CA  
3710 C C   . HIS C 234 ? 0.4032 0.3375 0.3550 0.0631  -0.0262 -0.0219 234 HIS C C   
3711 O O   . HIS C 234 ? 0.4046 0.3328 0.3489 0.0598  -0.0294 -0.0169 234 HIS C O   
3712 C CB  . HIS C 234 ? 0.3994 0.3072 0.3414 0.0740  -0.0271 -0.0264 234 HIS C CB  
3713 C CG  . HIS C 234 ? 0.4227 0.3151 0.3560 0.0811  -0.0350 -0.0218 234 HIS C CG  
3714 N ND1 . HIS C 234 ? 0.4357 0.2986 0.3520 0.0794  -0.0389 -0.0177 234 HIS C ND1 
3715 C CD2 . HIS C 234 ? 0.4729 0.3747 0.4108 0.0893  -0.0406 -0.0200 234 HIS C CD2 
3716 C CE1 . HIS C 234 ? 0.5124 0.3646 0.4220 0.0867  -0.0463 -0.0130 234 HIS C CE1 
3717 N NE2 . HIS C 234 ? 0.5320 0.4085 0.4549 0.0934  -0.0479 -0.0141 234 HIS C NE2 
3718 N N   . LEU C 235 ? 0.3302 0.2854 0.2946 0.0664  -0.0243 -0.0268 235 LEU C N   
3719 C CA  . LEU C 235 ? 0.2395 0.2124 0.2104 0.0657  -0.0271 -0.0268 235 LEU C CA  
3720 C C   . LEU C 235 ? 0.2240 0.2133 0.2059 0.0774  -0.0312 -0.0299 235 LEU C C   
3721 O O   . LEU C 235 ? 0.2568 0.2557 0.2474 0.0825  -0.0271 -0.0350 235 LEU C O   
3722 C CB  . LEU C 235 ? 0.2042 0.1903 0.1812 0.0553  -0.0209 -0.0293 235 LEU C CB  
3723 C CG  . LEU C 235 ? 0.2686 0.2417 0.2377 0.0463  -0.0166 -0.0264 235 LEU C CG  
3724 C CD1 . LEU C 235 ? 0.1902 0.1713 0.1646 0.0388  -0.0103 -0.0289 235 LEU C CD1 
3725 C CD2 . LEU C 235 ? 0.3229 0.2896 0.2826 0.0432  -0.0196 -0.0227 235 LEU C CD2 
3726 N N   . ARG C 236 ? 0.2326 0.2267 0.2141 0.0819  -0.0393 -0.0265 236 ARG C N   
3727 C CA  . ARG C 236 ? 0.2382 0.2524 0.2330 0.0945  -0.0445 -0.0284 236 ARG C CA  
3728 C C   . ARG C 236 ? 0.2357 0.2730 0.2370 0.0901  -0.0507 -0.0268 236 ARG C C   
3729 O O   . ARG C 236 ? 0.2492 0.2837 0.2453 0.0954  -0.0603 -0.0215 236 ARG C O   
3730 C CB  . ARG C 236 ? 0.2602 0.2543 0.2474 0.1094  -0.0513 -0.0250 236 ARG C CB  
3731 C CG  . ARG C 236 ? 0.3155 0.3296 0.3185 0.1270  -0.0561 -0.0273 236 ARG C CG  
3732 C CD  . ARG C 236 ? 0.3252 0.3660 0.3464 0.1284  -0.0469 -0.0359 236 ARG C CD  
3733 N NE  . ARG C 236 ? 0.3417 0.3962 0.3767 0.1484  -0.0482 -0.0397 236 ARG C NE  
3734 C CZ  . ARG C 236 ? 0.2979 0.3922 0.3556 0.1546  -0.0497 -0.0420 236 ARG C CZ  
3735 N NH1 . ARG C 236 ? 0.2705 0.3923 0.3374 0.1401  -0.0506 -0.0410 236 ARG C NH1 
3736 N NH2 . ARG C 236 ? 0.2757 0.3826 0.3469 0.1753  -0.0500 -0.0457 236 ARG C NH2 
3737 N N   . PRO C 237 ? 0.2637 0.3224 0.2745 0.0790  -0.0458 -0.0309 237 PRO C N   
3738 C CA  . PRO C 237 ? 0.2214 0.3062 0.2402 0.0740  -0.0521 -0.0308 237 PRO C CA  
3739 C C   . PRO C 237 ? 0.2736 0.3883 0.3127 0.0873  -0.0571 -0.0321 237 PRO C C   
3740 O O   . PRO C 237 ? 0.3024 0.4134 0.3471 0.1023  -0.0553 -0.0335 237 PRO C O   
3741 C CB  . PRO C 237 ? 0.2321 0.3262 0.2536 0.0576  -0.0441 -0.0354 237 PRO C CB  
3742 C CG  . PRO C 237 ? 0.2427 0.3130 0.2557 0.0551  -0.0346 -0.0363 237 PRO C CG  
3743 C CD  . PRO C 237 ? 0.2328 0.2909 0.2453 0.0694  -0.0351 -0.0353 237 PRO C CD  
3744 N N   . GLY C 238 ? 0.2581 0.4030 0.3082 0.0820  -0.0632 -0.0322 238 GLY C N   
3745 C CA  . GLY C 238 ? 0.2677 0.4476 0.3403 0.0950  -0.0692 -0.0326 238 GLY C CA  
3746 C C   . GLY C 238 ? 0.2952 0.4953 0.3869 0.1026  -0.0594 -0.0390 238 GLY C C   
3747 O O   . GLY C 238 ? 0.3327 0.5449 0.4378 0.1222  -0.0616 -0.0396 238 GLY C O   
3748 N N   . CYS C 239 ? 0.2612 0.4638 0.3529 0.0879  -0.0483 -0.0438 239 CYS C N   
3749 C CA  . CYS C 239 ? 0.2701 0.4981 0.3795 0.0913  -0.0386 -0.0499 239 CYS C CA  
3750 C C   . CYS C 239 ? 0.2881 0.4920 0.3854 0.0855  -0.0262 -0.0534 239 CYS C C   
3751 O O   . CYS C 239 ? 0.3196 0.5429 0.4267 0.0814  -0.0167 -0.0582 239 CYS C O   
3752 C CB  . CYS C 239 ? 0.2563 0.5262 0.3829 0.0765  -0.0383 -0.0518 239 CYS C CB  
3753 S SG  . CYS C 239 ? 0.2045 0.5106 0.3475 0.0810  -0.0545 -0.0474 239 CYS C SG  
3754 N N   . HIS C 240 ? 0.2517 0.4154 0.3278 0.0843  -0.0265 -0.0505 240 HIS C N   
3755 C CA  . HIS C 240 ? 0.2211 0.3619 0.2855 0.0796  -0.0168 -0.0527 240 HIS C CA  
3756 C C   . HIS C 240 ? 0.2179 0.3216 0.2655 0.0884  -0.0194 -0.0499 240 HIS C C   
3757 O O   . HIS C 240 ? 0.2278 0.3199 0.2697 0.0944  -0.0282 -0.0454 240 HIS C O   
3758 C CB  . HIS C 240 ? 0.1870 0.3208 0.2429 0.0593  -0.0126 -0.0516 240 HIS C CB  
3759 C CG  . HIS C 240 ? 0.2025 0.3676 0.2709 0.0469  -0.0113 -0.0534 240 HIS C CG  
3760 N ND1 . HIS C 240 ? 0.2546 0.4337 0.3268 0.0405  -0.0194 -0.0516 240 HIS C ND1 
3761 C CD2 . HIS C 240 ? 0.1786 0.3639 0.2552 0.0378  -0.0032 -0.0567 240 HIS C CD2 
3762 C CE1 . HIS C 240 ? 0.2575 0.4640 0.3404 0.0274  -0.0166 -0.0539 240 HIS C CE1 
3763 N NE2 . HIS C 240 ? 0.1786 0.3894 0.2644 0.0254  -0.0065 -0.0567 240 HIS C NE2 
3764 N N   . ALA C 241 ? 0.2047 0.2903 0.2432 0.0877  -0.0122 -0.0523 241 ALA C N   
3765 C CA  . ALA C 241 ? 0.2129 0.2634 0.2343 0.0919  -0.0142 -0.0497 241 ALA C CA  
3766 C C   . ALA C 241 ? 0.2069 0.2423 0.2178 0.0803  -0.0074 -0.0499 241 ALA C C   
3767 O O   . ALA C 241 ? 0.2023 0.2504 0.2173 0.0754  -0.0001 -0.0538 241 ALA C O   
3768 C CB  . ALA C 241 ? 0.3023 0.3448 0.3234 0.1098  -0.0152 -0.0532 241 ALA C CB  
3769 N N   . ALA C 242 ? 0.2325 0.2425 0.2297 0.0755  -0.0100 -0.0450 242 ALA C N   
3770 C CA  . ALA C 242 ? 0.2813 0.2790 0.2701 0.0651  -0.0053 -0.0437 242 ALA C CA  
3771 C C   . ALA C 242 ? 0.3175 0.2879 0.2924 0.0655  -0.0085 -0.0402 242 ALA C C   
3772 O O   . ALA C 242 ? 0.3428 0.3024 0.3129 0.0682  -0.0142 -0.0362 242 ALA C O   
3773 C CB  . ALA C 242 ? 0.2865 0.2900 0.2772 0.0532  -0.0039 -0.0405 242 ALA C CB  
3774 N N   . ASN C 243 ? 0.3271 0.2873 0.2945 0.0615  -0.0053 -0.0413 243 ASN C N   
3775 C CA  . ASN C 243 ? 0.3553 0.2921 0.3098 0.0582  -0.0084 -0.0376 243 ASN C CA  
3776 C C   . ASN C 243 ? 0.3360 0.2731 0.2891 0.0466  -0.0061 -0.0336 243 ASN C C   
3777 O O   . ASN C 243 ? 0.3574 0.3027 0.3122 0.0428  -0.0020 -0.0355 243 ASN C O   
3778 C CB  . ASN C 243 ? 0.4012 0.3221 0.3453 0.0643  -0.0085 -0.0428 243 ASN C CB  
3779 C CG  . ASN C 243 ? 0.4638 0.3583 0.3930 0.0597  -0.0133 -0.0389 243 ASN C CG  
3780 O OD1 . ASN C 243 ? 0.4325 0.3193 0.3594 0.0579  -0.0177 -0.0329 243 ASN C OD1 
3781 N ND2 . ASN C 243 ? 0.5403 0.4212 0.4577 0.0561  -0.0124 -0.0422 243 ASN C ND2 
3782 N N   . MET C 244 ? 0.3165 0.2458 0.2666 0.0413  -0.0087 -0.0274 244 MET C N   
3783 C CA  . MET C 244 ? 0.3306 0.2629 0.2823 0.0327  -0.0069 -0.0229 244 MET C CA  
3784 C C   . MET C 244 ? 0.3615 0.2808 0.3043 0.0270  -0.0101 -0.0196 244 MET C C   
3785 O O   . MET C 244 ? 0.3700 0.2777 0.3066 0.0262  -0.0135 -0.0171 244 MET C O   
3786 C CB  . MET C 244 ? 0.3206 0.2594 0.2784 0.0305  -0.0057 -0.0189 244 MET C CB  
3787 C CG  . MET C 244 ? 0.3567 0.3002 0.3188 0.0249  -0.0032 -0.0146 244 MET C CG  
3788 S SD  . MET C 244 ? 0.3342 0.2836 0.3022 0.0247  0.0005  -0.0127 244 MET C SD  
3789 C CE  . MET C 244 ? 0.2051 0.1578 0.1784 0.0215  0.0023  -0.0066 244 MET C CE  
3790 N N   . GLU C 245 ? 0.3701 0.2914 0.3111 0.0217  -0.0096 -0.0192 245 GLU C N   
3791 C CA  . GLU C 245 ? 0.3788 0.2899 0.3107 0.0143  -0.0136 -0.0165 245 GLU C CA  
3792 C C   . GLU C 245 ? 0.3938 0.3166 0.3320 0.0071  -0.0141 -0.0102 245 GLU C C   
3793 O O   . GLU C 245 ? 0.4606 0.3943 0.4056 0.0085  -0.0111 -0.0094 245 GLU C O   
3794 C CB  . GLU C 245 ? 0.3975 0.2958 0.3161 0.0152  -0.0144 -0.0233 245 GLU C CB  
3795 C CG  . GLU C 245 ? 0.4611 0.3465 0.3739 0.0251  -0.0143 -0.0296 245 GLU C CG  
3796 C CD  . GLU C 245 ? 0.5005 0.3762 0.4018 0.0289  -0.0123 -0.0383 245 GLU C CD  
3797 O OE1 . GLU C 245 ? 0.5527 0.4428 0.4591 0.0325  -0.0071 -0.0426 245 GLU C OE1 
3798 O OE2 . GLU C 245 ? 0.4670 0.3199 0.3526 0.0278  -0.0156 -0.0412 245 GLU C OE2 
3799 N N   . CYS C 246 ? 0.3438 0.2645 0.2795 -0.0009 -0.0182 -0.0053 246 CYS C N   
3800 C CA  . CYS C 246 ? 0.3165 0.2507 0.2591 -0.0072 -0.0203 0.0014  246 CYS C CA  
3801 C C   . CYS C 246 ? 0.2863 0.2139 0.2165 -0.0165 -0.0261 0.0011  246 CYS C C   
3802 O O   . CYS C 246 ? 0.2978 0.2123 0.2173 -0.0230 -0.0298 0.0000  246 CYS C O   
3803 C CB  . CYS C 246 ? 0.2166 0.1618 0.1705 -0.0100 -0.0203 0.0083  246 CYS C CB  
3804 S SG  . CYS C 246 ? 0.2888 0.2532 0.2525 -0.0184 -0.0251 0.0174  246 CYS C SG  
3805 N N   . TRP C 247 ? 0.3007 0.2354 0.2300 -0.0182 -0.0271 0.0023  247 TRP C N   
3806 C CA  . TRP C 247 ? 0.2877 0.2186 0.2041 -0.0286 -0.0335 0.0028  247 TRP C CA  
3807 C C   . TRP C 247 ? 0.3165 0.2679 0.2454 -0.0339 -0.0386 0.0133  247 TRP C C   
3808 O O   . TRP C 247 ? 0.3349 0.2987 0.2758 -0.0275 -0.0364 0.0179  247 TRP C O   
3809 C CB  . TRP C 247 ? 0.3510 0.2744 0.2532 -0.0274 -0.0314 -0.0038 247 TRP C CB  
3810 C CG  . TRP C 247 ? 0.3708 0.2835 0.2686 -0.0178 -0.0244 -0.0133 247 TRP C CG  
3811 C CD1 . TRP C 247 ? 0.4033 0.3241 0.3124 -0.0086 -0.0181 -0.0145 247 TRP C CD1 
3812 C CD2 . TRP C 247 ? 0.3847 0.2775 0.2659 -0.0161 -0.0233 -0.0231 247 TRP C CD2 
3813 N NE1 . TRP C 247 ? 0.4118 0.3236 0.3152 -0.0013 -0.0136 -0.0237 247 TRP C NE1 
3814 C CE2 . TRP C 247 ? 0.3960 0.2901 0.2827 -0.0042 -0.0163 -0.0291 247 TRP C CE2 
3815 C CE3 . TRP C 247 ? 0.4257 0.2989 0.2876 -0.0233 -0.0276 -0.0275 247 TRP C CE3 
3816 C CZ2 . TRP C 247 ? 0.3699 0.2485 0.2457 0.0031  -0.0134 -0.0391 247 TRP C CZ2 
3817 C CZ3 . TRP C 247 ? 0.4511 0.3037 0.2991 -0.0163 -0.0242 -0.0381 247 TRP C CZ3 
3818 C CH2 . TRP C 247 ? 0.3937 0.2502 0.2499 -0.0020 -0.0171 -0.0436 247 TRP C CH2 
3819 N N   . SER C 248 ? 0.3376 0.2926 0.2638 -0.0455 -0.0458 0.0173  248 SER C N   
3820 C CA  . SER C 248 ? 0.3160 0.2955 0.2574 -0.0498 -0.0516 0.0281  248 SER C CA  
3821 C C   . SER C 248 ? 0.2850 0.2675 0.2166 -0.0660 -0.0617 0.0310  248 SER C C   
3822 O O   . SER C 248 ? 0.2891 0.2537 0.2044 -0.0755 -0.0639 0.0256  248 SER C O   
3823 C CB  . SER C 248 ? 0.3368 0.3331 0.3001 -0.0449 -0.0479 0.0336  248 SER C CB  
3824 O OG  . SER C 248 ? 0.3333 0.3566 0.3143 -0.0466 -0.0529 0.0439  248 SER C OG  
3825 N N   . MET C 249 ? 0.2772 0.2812 0.2180 -0.0690 -0.0687 0.0400  249 MET C N   
3826 C CA  . MET C 249 ? 0.2903 0.3058 0.2273 -0.0854 -0.0800 0.0453  249 MET C CA  
3827 C C   . MET C 249 ? 0.3435 0.3863 0.3049 -0.0888 -0.0819 0.0540  249 MET C C   
3828 O O   . MET C 249 ? 0.3962 0.4542 0.3591 -0.1040 -0.0912 0.0593  249 MET C O   
3829 C CB  . MET C 249 ? 0.2930 0.3208 0.2275 -0.0871 -0.0882 0.0519  249 MET C CB  
3830 C CG  . MET C 249 ? 0.3076 0.3114 0.2151 -0.0876 -0.0867 0.0439  249 MET C CG  
3831 S SD  . MET C 249 ? 0.5577 0.5331 0.4308 -0.1048 -0.0904 0.0322  249 MET C SD  
3832 C CE  . MET C 249 ? 0.3609 0.3599 0.2384 -0.1248 -0.1062 0.0425  249 MET C CE  
3833 N N   . LEU C 250 ? 0.3296 0.3798 0.3096 -0.0756 -0.0726 0.0549  250 LEU C N   
3834 C CA  . LEU C 250 ? 0.3192 0.3999 0.3254 -0.0754 -0.0716 0.0630  250 LEU C CA  
3835 C C   . LEU C 250 ? 0.3795 0.4526 0.3842 -0.0808 -0.0655 0.0595  250 LEU C C   
3836 O O   . LEU C 250 ? 0.4409 0.5339 0.4655 -0.0753 -0.0592 0.0634  250 LEU C O   
3837 C CB  . LEU C 250 ? 0.2691 0.3657 0.2974 -0.0560 -0.0652 0.0674  250 LEU C CB  
3838 C CG  . LEU C 250 ? 0.2940 0.4119 0.3344 -0.0514 -0.0732 0.0769  250 LEU C CG  
3839 C CD1 . LEU C 250 ? 0.2196 0.3324 0.2679 -0.0317 -0.0665 0.0775  250 LEU C CD1 
3840 C CD2 . LEU C 250 ? 0.3262 0.4839 0.3924 -0.0559 -0.0785 0.0872  250 LEU C CD2 
3841 N N   . MET C 251 ? 0.3626 0.4059 0.3421 -0.0914 -0.0672 0.0523  251 MET C N   
3842 C CA  . MET C 251 ? 0.3851 0.4163 0.3590 -0.0976 -0.0628 0.0501  251 MET C CA  
3843 C C   . MET C 251 ? 0.4768 0.5228 0.4525 -0.1188 -0.0697 0.0563  251 MET C C   
3844 O O   . MET C 251 ? 0.4958 0.5423 0.4617 -0.1331 -0.0798 0.0576  251 MET C O   
3845 C CB  . MET C 251 ? 0.3136 0.3025 0.2595 -0.0964 -0.0611 0.0396  251 MET C CB  
3846 C CG  . MET C 251 ? 0.2766 0.2543 0.2226 -0.0770 -0.0535 0.0334  251 MET C CG  
3847 S SD  . MET C 251 ? 0.3751 0.3113 0.2963 -0.0725 -0.0499 0.0226  251 MET C SD  
3848 C CE  . MET C 251 ? 0.4845 0.4210 0.4126 -0.0521 -0.0421 0.0173  251 MET C CE  
3849 N N   . SER C 252 ? 0.5069 0.5655 0.4939 -0.1220 -0.0640 0.0603  252 SER C N   
3850 C CA  . SER C 252 ? 0.5724 0.6482 0.5632 -0.1435 -0.0685 0.0670  252 SER C CA  
3851 C C   . SER C 252 ? 0.6378 0.7624 0.6567 -0.1478 -0.0738 0.0767  252 SER C C   
3852 O O   . SER C 252 ? 0.6632 0.8236 0.7082 -0.1453 -0.0680 0.0832  252 SER C O   
3853 C CB  . SER C 252 ? 0.5887 0.6297 0.5478 -0.1635 -0.0772 0.0628  252 SER C CB  
3854 O OG  . SER C 252 ? 0.6083 0.6046 0.5428 -0.1567 -0.0727 0.0542  252 SER C OG  
3855 N N   . ALA D 3   ? 0.3809 0.4954 0.2122 -0.0569 0.1176  -0.0792 487 ALA D N   
3856 C CA  . ALA D 3   ? 0.4658 0.5594 0.3090 -0.0517 0.1024  -0.0707 487 ALA D CA  
3857 C C   . ALA D 3   ? 0.5253 0.6114 0.3669 -0.0673 0.0958  -0.0551 487 ALA D C   
3858 O O   . ALA D 3   ? 0.6293 0.7040 0.4479 -0.0812 0.0945  -0.0467 487 ALA D O   
3859 C CB  . ALA D 3   ? 0.4374 0.5012 0.2644 -0.0456 0.0928  -0.0715 487 ALA D CB  
3860 N N   . ARG D 4   ? 0.4703 0.5607 0.3345 -0.0646 0.0912  -0.0512 488 ARG D N   
3861 C CA  . ARG D 4   ? 0.4474 0.5286 0.3110 -0.0779 0.0858  -0.0380 488 ARG D CA  
3862 C C   . ARG D 4   ? 0.4113 0.4708 0.2851 -0.0700 0.0729  -0.0318 488 ARG D C   
3863 O O   . ARG D 4   ? 0.2949 0.3602 0.1880 -0.0576 0.0707  -0.0376 488 ARG D O   
3864 C CB  . ARG D 4   ? 0.4674 0.5759 0.3462 -0.0866 0.0942  -0.0393 488 ARG D CB  
3865 C CG  . ARG D 4   ? 0.5032 0.5987 0.3825 -0.0995 0.0883  -0.0275 488 ARG D CG  
3866 C CD  . ARG D 4   ? 0.5327 0.6569 0.4304 -0.1074 0.0950  -0.0307 488 ARG D CD  
3867 N NE  . ARG D 4   ? 0.5748 0.6829 0.4692 -0.1218 0.0900  -0.0205 488 ARG D NE  
3868 C CZ  . ARG D 4   ? 0.6138 0.7410 0.5209 -0.1329 0.0933  -0.0213 488 ARG D CZ  
3869 N NH1 . ARG D 4   ? 0.6209 0.7887 0.5481 -0.1303 0.1015  -0.0311 488 ARG D NH1 
3870 N NH2 . ARG D 4   ? 0.6418 0.7472 0.5414 -0.1466 0.0883  -0.0123 488 ARG D NH2 
3871 N N   . TYR D 5   ? 0.4239 0.4593 0.2844 -0.0767 0.0645  -0.0197 489 TYR D N   
3872 C CA  . TYR D 5   ? 0.3521 0.3682 0.2216 -0.0686 0.0535  -0.0138 489 TYR D CA  
3873 C C   . TYR D 5   ? 0.3216 0.3238 0.1905 -0.0772 0.0497  -0.0028 489 TYR D C   
3874 O O   . TYR D 5   ? 0.3912 0.3937 0.2486 -0.0915 0.0540  0.0025  489 TYR D O   
3875 C CB  . TYR D 5   ? 0.3716 0.3703 0.2290 -0.0640 0.0450  -0.0098 489 TYR D CB  
3876 C CG  . TYR D 5   ? 0.4199 0.4248 0.2699 -0.0586 0.0483  -0.0201 489 TYR D CG  
3877 C CD1 . TYR D 5   ? 0.4182 0.4257 0.2813 -0.0452 0.0476  -0.0295 489 TYR D CD1 
3878 C CD2 . TYR D 5   ? 0.4637 0.4686 0.2906 -0.0673 0.0519  -0.0205 489 TYR D CD2 
3879 C CE1 . TYR D 5   ? 0.4270 0.4347 0.2807 -0.0399 0.0506  -0.0394 489 TYR D CE1 
3880 C CE2 . TYR D 5   ? 0.4896 0.4964 0.3065 -0.0625 0.0554  -0.0314 489 TYR D CE2 
3881 C CZ  . TYR D 5   ? 0.4683 0.4751 0.2987 -0.0484 0.0547  -0.0410 489 TYR D CZ  
3882 O OH  . TYR D 5   ? 0.5169 0.5204 0.3349 -0.0432 0.0582  -0.0523 489 TYR D OH  
3883 N N   . GLY D 6   ? 0.3495 0.3379 0.2292 -0.0687 0.0421  0.0003  490 GLY D N   
3884 C CA  . GLY D 6   ? 0.4268 0.3962 0.3046 -0.0737 0.0380  0.0098  490 GLY D CA  
3885 C C   . GLY D 6   ? 0.4321 0.3812 0.3094 -0.0642 0.0282  0.0175  490 GLY D C   
3886 O O   . GLY D 6   ? 0.4218 0.3742 0.3098 -0.0527 0.0248  0.0133  490 GLY D O   
3887 N N   . VAL D 7   ? 0.4649 0.3936 0.3301 -0.0691 0.0238  0.0293  491 VAL D N   
3888 C CA  . VAL D 7   ? 0.4750 0.3872 0.3424 -0.0590 0.0146  0.0377  491 VAL D CA  
3889 C C   . VAL D 7   ? 0.4787 0.3691 0.3470 -0.0582 0.0132  0.0435  491 VAL D C   
3890 O O   . VAL D 7   ? 0.5109 0.3886 0.3661 -0.0696 0.0155  0.0484  491 VAL D O   
3891 C CB  . VAL D 7   ? 0.5101 0.4161 0.3611 -0.0621 0.0082  0.0480  491 VAL D CB  
3892 C CG1 . VAL D 7   ? 0.5456 0.4404 0.4034 -0.0504 -0.0018 0.0570  491 VAL D CG1 
3893 C CG2 . VAL D 7   ? 0.5049 0.4287 0.3509 -0.0641 0.0100  0.0409  491 VAL D CG2 
3894 N N   . SER D 8   ? 0.4826 0.3675 0.3648 -0.0452 0.0100  0.0425  492 SER D N   
3895 C CA  . SER D 8   ? 0.4904 0.3536 0.3736 -0.0423 0.0100  0.0449  492 SER D CA  
3896 C C   . SER D 8   ? 0.5456 0.3823 0.4152 -0.0421 0.0046  0.0585  492 SER D C   
3897 O O   . SER D 8   ? 0.5773 0.4146 0.4444 -0.0370 -0.0021 0.0673  492 SER D O   
3898 C CB  . SER D 8   ? 0.4837 0.3495 0.3841 -0.0276 0.0089  0.0401  492 SER D CB  
3899 O OG  . SER D 8   ? 0.4572 0.3220 0.3627 -0.0164 0.0023  0.0478  492 SER D OG  
3900 N N   . ASN D 9   ? 0.6047 0.4171 0.4645 -0.0480 0.0069  0.0605  493 ASN D N   
3901 C CA  . ASN D 9   ? 0.6675 0.4479 0.5147 -0.0445 0.0016  0.0731  493 ASN D CA  
3902 C C   . ASN D 9   ? 0.6938 0.4705 0.5556 -0.0235 -0.0034 0.0760  493 ASN D C   
3903 O O   . ASN D 9   ? 0.7469 0.5148 0.6059 -0.0153 -0.0109 0.0880  493 ASN D O   
3904 C CB  . ASN D 9   ? 0.7416 0.4922 0.5757 -0.0538 0.0055  0.0723  493 ASN D CB  
3905 C CG  . ASN D 9   ? 0.7998 0.5604 0.6241 -0.0758 0.0118  0.0676  493 ASN D CG  
3906 O OD1 . ASN D 9   ? 0.8226 0.6019 0.6414 -0.0855 0.0127  0.0700  493 ASN D OD1 
3907 N ND2 . ASN D 9   ? 0.8074 0.5570 0.6292 -0.0845 0.0164  0.0606  493 ASN D ND2 
3908 N N   . THR D 10  ? 0.6934 0.4791 0.5711 -0.0152 0.0007  0.0652  494 THR D N   
3909 C CA  . THR D 10  ? 0.6887 0.4737 0.5817 0.0039  -0.0012 0.0657  494 THR D CA  
3910 C C   . THR D 10  ? 0.6860 0.4988 0.5934 0.0120  -0.0067 0.0692  494 THR D C   
3911 O O   . THR D 10  ? 0.6460 0.4819 0.5557 0.0043  -0.0064 0.0646  494 THR D O   
3912 C CB  . THR D 10  ? 0.6419 0.4291 0.5441 0.0072  0.0058  0.0524  494 THR D CB  
3913 O OG1 . THR D 10  ? 0.7042 0.4598 0.5923 0.0023  0.0094  0.0502  494 THR D OG1 
3914 C CG2 . THR D 10  ? 0.6046 0.4014 0.5248 0.0254  0.0056  0.0511  494 THR D CG2 
3915 N N   . SER D 11  ? 0.6876 0.4981 0.6045 0.0273  -0.0119 0.0773  495 SER D N   
3916 C CA  . SER D 11  ? 0.6662 0.5047 0.5989 0.0344  -0.0175 0.0806  495 SER D CA  
3917 C C   . SER D 11  ? 0.6207 0.4639 0.5730 0.0531  -0.0172 0.0815  495 SER D C   
3918 O O   . SER D 11  ? 0.6881 0.5084 0.6389 0.0639  -0.0159 0.0848  495 SER D O   
3919 C CB  . SER D 11  ? 0.7295 0.5702 0.6531 0.0306  -0.0275 0.0939  495 SER D CB  
3920 O OG  . SER D 11  ? 0.7851 0.6305 0.6930 0.0134  -0.0266 0.0912  495 SER D OG  
3921 N N   . ILE D 12  ? 0.5160 0.3883 0.4856 0.0565  -0.0177 0.0781  496 ILE D N   
3922 C CA  . ILE D 12  ? 0.4957 0.3808 0.4863 0.0730  -0.0172 0.0798  496 ILE D CA  
3923 C C   . ILE D 12  ? 0.4864 0.3944 0.4883 0.0769  -0.0279 0.0918  496 ILE D C   
3924 O O   . ILE D 12  ? 0.4769 0.4049 0.4787 0.0661  -0.0326 0.0917  496 ILE D O   
3925 C CB  . ILE D 12  ? 0.4857 0.3883 0.4880 0.0728  -0.0096 0.0680  496 ILE D CB  
3926 C CG1 . ILE D 12  ? 0.4803 0.3644 0.4693 0.0651  -0.0012 0.0562  496 ILE D CG1 
3927 C CG2 . ILE D 12  ? 0.4920 0.4062 0.5143 0.0898  -0.0063 0.0688  496 ILE D CG2 
3928 C CD1 . ILE D 12  ? 0.4211 0.3198 0.4181 0.0642  0.0051  0.0456  496 ILE D CD1 
3929 N N   . ASN D 13  ? 0.5045 0.4091 0.5156 0.0925  -0.0324 0.1022  497 ASN D N   
3930 C CA  . ASN D 13  ? 0.5239 0.4501 0.5449 0.0960  -0.0448 0.1157  497 ASN D CA  
3931 C C   . ASN D 13  ? 0.5105 0.4650 0.5611 0.1130  -0.0454 0.1192  497 ASN D C   
3932 O O   . ASN D 13  ? 0.5035 0.4483 0.5638 0.1302  -0.0388 0.1177  497 ASN D O   
3933 C CB  . ASN D 13  ? 0.5636 0.4646 0.5691 0.0991  -0.0531 0.1290  497 ASN D CB  
3934 C CG  . ASN D 13  ? 0.5993 0.4766 0.5755 0.0804  -0.0524 0.1270  497 ASN D CG  
3935 O OD1 . ASN D 13  ? 0.6201 0.4862 0.5871 0.0712  -0.0426 0.1146  497 ASN D OD1 
3936 N ND2 . ASN D 13  ? 0.6161 0.4877 0.5774 0.0743  -0.0631 0.1397  497 ASN D ND2 
3937 N N   . ARG D 14  ? 0.5009 0.4909 0.5653 0.1075  -0.0529 0.1235  498 ARG D N   
3938 C CA  . ARG D 14  ? 0.5087 0.5328 0.6035 0.1215  -0.0548 0.1287  498 ARG D CA  
3939 C C   . ARG D 14  ? 0.5652 0.6082 0.6685 0.1254  -0.0708 0.1456  498 ARG D C   
3940 O O   . ARG D 14  ? 0.5893 0.6443 0.6835 0.1091  -0.0810 0.1498  498 ARG D O   
3941 C CB  . ARG D 14  ? 0.4722 0.5267 0.5795 0.1112  -0.0505 0.1204  498 ARG D CB  
3942 C CG  . ARG D 14  ? 0.5185 0.6151 0.6583 0.1217  -0.0531 0.1268  498 ARG D CG  
3943 C CD  . ARG D 14  ? 0.5327 0.6503 0.6835 0.1150  -0.0433 0.1165  498 ARG D CD  
3944 N NE  . ARG D 14  ? 0.5393 0.6360 0.6865 0.1239  -0.0279 0.1049  498 ARG D NE  
3945 C CZ  . ARG D 14  ? 0.5265 0.6297 0.6746 0.1173  -0.0177 0.0943  498 ARG D CZ  
3946 N NH1 . ARG D 14  ? 0.5070 0.6346 0.6594 0.1017  -0.0211 0.0939  498 ARG D NH1 
3947 N NH2 . ARG D 14  ? 0.5237 0.6067 0.6660 0.1253  -0.0048 0.0842  498 ARG D NH2 
3948 N N   . LYS D 15  ? 0.5797 0.6231 0.6967 0.1452  -0.0726 0.1514  499 LYS D N   
3949 C CA  . LYS D 15  ? 0.5975 0.6565 0.7197 0.1483  -0.0873 0.1627  499 LYS D CA  
3950 C C   . LYS D 15  ? 0.6109 0.7110 0.7666 0.1601  -0.0875 0.1627  499 LYS D C   
3951 O O   . LYS D 15  ? 0.6337 0.7385 0.8056 0.1724  -0.0752 0.1541  499 LYS D O   
3952 C CB  . LYS D 15  ? 0.6216 0.6416 0.7256 0.1589  -0.0915 0.1680  499 LYS D CB  
3953 C CG  . LYS D 15  ? 0.6333 0.6661 0.7406 0.1642  -0.1073 0.1803  499 LYS D CG  
3954 C CD  . LYS D 15  ? 0.6468 0.6436 0.7201 0.1568  -0.1158 0.1889  499 LYS D CD  
3955 C CE  . LYS D 15  ? 0.6756 0.6222 0.7280 0.1616  -0.1065 0.1841  499 LYS D CE  
3956 N NZ  . LYS D 15  ? 0.7405 0.6513 0.7623 0.1601  -0.1152 0.1943  499 LYS D NZ  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   ALA 2   2   ?   ?   ?   A . n 
A 1 3   PRO 3   3   ?   ?   ?   A . n 
A 1 4   LEU 4   4   ?   ?   ?   A . n 
A 1 5   GLU 5   5   ?   ?   ?   A . n 
A 1 6   THR 6   6   ?   ?   ?   A . n 
A 1 7   ILE 7   7   ?   ?   ?   A . n 
A 1 8   TYR 8   8   ?   ?   ?   A . n 
A 1 9   ASP 9   9   ?   ?   ?   A . n 
A 1 10  GLU 10  10  ?   ?   ?   A . n 
A 1 11  SER 11  11  ?   ?   ?   A . n 
A 1 12  LEU 12  12  ?   ?   ?   A . n 
A 1 13  ASN 13  13  ?   ?   ?   A . n 
A 1 14  LYS 14  14  ?   ?   ?   A . n 
A 1 15  SER 15  15  ?   ?   ?   A . n 
A 1 16  ALA 16  16  ?   ?   ?   A . n 
A 1 17  ASP 17  17  17  ASP ASP A . n 
A 1 18  SER 18  18  18  SER SER A . n 
A 1 19  ILE 19  19  19  ILE ILE A . n 
A 1 20  ASP 20  20  20  ASP ASP A . n 
A 1 21  ASP 21  21  21  ASP ASP A . n 
A 1 22  LYS 22  22  22  LYS LYS A . n 
A 1 23  LYS 23  23  23  LYS LYS A . n 
A 1 24  TRP 24  24  24  TRP TRP A . n 
A 1 25  SER 25  25  25  SER SER A . n 
A 1 26  LYS 26  26  26  LYS LYS A . n 
A 1 27  LEU 27  27  27  LEU LEU A . n 
A 1 28  PHE 28  28  28  PHE PHE A . n 
A 1 29  PRO 29  29  29  PRO PRO A . n 
A 1 30  ARG 30  30  30  ARG ARG A . n 
A 1 31  ILE 31  31  31  ILE ILE A . n 
A 1 32  VAL 32  32  32  VAL VAL A . n 
A 1 33  SER 33  33  33  SER SER A . n 
A 1 34  ASP 34  34  34  ASP ASP A . n 
A 1 35  PRO 35  35  35  PRO PRO A . n 
A 1 36  ASP 36  36  36  ASP ASP A . n 
A 1 37  ARG 37  37  37  ARG ARG A . n 
A 1 38  SER 38  38  38  SER SER A . n 
A 1 39  SER 39  39  39  SER SER A . n 
A 1 40  ASN 40  40  40  ASN ASN A . n 
A 1 41  PHE 41  41  41  PHE PHE A . n 
A 1 42  MET 42  42  42  MET MET A . n 
A 1 43  THR 43  43  43  THR THR A . n 
A 1 44  ARG 44  44  44  ARG ARG A . n 
A 1 45  ALA 45  45  45  ALA ALA A . n 
A 1 46  ILE 46  46  46  ILE ILE A . n 
A 1 47  TYR 47  47  47  TYR TYR A . n 
A 1 48  VAL 48  48  48  VAL VAL A . n 
A 1 49  ALA 49  49  49  ALA ALA A . n 
A 1 50  PHE 50  50  50  PHE PHE A . n 
A 1 51  SER 51  51  51  SER SER A . n 
A 1 52  ALA 52  52  52  ALA ALA A . n 
A 1 53  VAL 53  53  53  VAL VAL A . n 
A 1 54  LEU 54  54  54  LEU LEU A . n 
A 1 55  ARG 55  55  55  ARG ARG A . n 
A 1 56  ASN 56  56  56  ASN ASN A . n 
A 1 57  ARG 57  57  57  ARG ARG A . n 
A 1 58  ASN 58  58  58  ASN ASN A . n 
A 1 59  ILE 59  59  59  ILE ILE A . n 
A 1 60  LEU 60  60  60  LEU LEU A . n 
A 1 61  GLY 61  61  61  GLY GLY A . n 
A 1 62  GLN 62  62  62  GLN GLN A . n 
A 1 63  GLU 63  63  63  GLU GLU A . n 
A 1 64  TYR 64  64  64  TYR TYR A . n 
A 1 65  PHE 65  65  65  PHE PHE A . n 
A 1 66  THR 66  66  66  THR THR A . n 
A 1 67  LYS 67  67  67  LYS LYS A . n 
A 1 68  ASN 68  68  68  ASN ASN A . n 
A 1 69  TYR 69  69  69  TYR TYR A . n 
A 1 70  ILE 70  70  70  ILE ILE A . n 
A 1 71  THR 71  71  71  THR THR A . n 
A 1 72  GLU 72  72  72  GLU GLU A . n 
A 1 73  LYS 73  73  73  LYS LYS A . n 
A 1 74  LEU 74  74  74  LEU LEU A . n 
A 1 75  LYS 75  75  75  LYS LYS A . n 
A 1 76  CYS 76  76  76  CYS CYS A . n 
A 1 77  MET 77  77  77  MET MET A . n 
A 1 78  THR 78  78  78  THR THR A . n 
A 1 79  LEU 79  79  79  LEU LEU A . n 
A 1 80  CYS 80  80  80  CYS CYS A . n 
A 1 81  PHE 81  81  81  PHE PHE A . n 
A 1 82  ARG 82  82  82  ARG ARG A . n 
A 1 83  ASN 83  83  83  ASN ASN A . n 
A 1 84  LEU 84  84  84  LEU LEU A . n 
A 1 85  ARG 85  85  85  ARG ARG A . n 
A 1 86  SER 86  86  86  SER SER A . n 
A 1 87  ASN 87  87  87  ASN ASN A . n 
A 1 88  GLN 88  88  88  GLN GLN A . n 
A 1 89  ILE 89  89  89  ILE ILE A . n 
A 1 90  ALA 90  90  90  ALA ALA A . n 
A 1 91  GLN 91  91  91  GLN GLN A . n 
A 1 92  LEU 92  92  92  LEU LEU A . n 
A 1 93  LEU 93  93  93  LEU LEU A . n 
A 1 94  ARG 94  94  94  ARG ARG A . n 
A 1 95  ASN 95  95  95  ASN ASN A . n 
A 1 96  ALA 96  96  96  ALA ALA A . n 
A 1 97  GLY 97  97  97  GLY GLY A . n 
A 1 98  ASP 98  98  98  ASP ASP A . n 
A 1 99  ALA 99  99  99  ALA ALA A . n 
A 1 100 THR 100 100 100 THR THR A . n 
A 1 101 LYS 101 101 101 LYS LYS A . n 
A 1 102 ASP 102 102 102 ASP ASP A . n 
A 1 103 GLY 103 103 103 GLY GLY A . n 
A 1 104 PHE 104 104 104 PHE PHE A . n 
A 1 105 LEU 105 105 105 LEU LEU A . n 
A 1 106 LYS 106 106 106 LYS LYS A . n 
A 1 107 GLU 107 107 107 GLU GLU A . n 
A 1 108 VAL 108 108 108 VAL VAL A . n 
A 1 109 SER 109 109 109 SER SER A . n 
A 1 110 LEU 110 110 110 LEU LEU A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 ILE 112 112 112 ILE ILE A . n 
A 1 113 THR 113 113 113 THR THR A . n 
A 1 114 ASN 114 114 114 ASN ASN A . n 
A 1 115 ASN 115 115 115 ASN ASN A . n 
A 1 116 GLU 116 116 116 GLU GLU A . n 
A 1 117 GLY 117 117 117 GLY GLY A . n 
A 1 118 ASP 118 118 118 ASP ASP A . n 
A 1 119 LEU 119 119 119 LEU LEU A . n 
A 1 120 GLU 120 120 120 GLU GLU A . n 
A 1 121 ALA 121 121 121 ALA ALA A . n 
A 1 122 ILE 122 122 122 ILE ILE A . n 
A 1 123 GLU 123 123 123 GLU GLU A . n 
A 1 124 VAL 124 124 124 VAL VAL A . n 
A 1 125 PHE 125 125 125 PHE PHE A . n 
A 1 126 SER 126 126 126 SER SER A . n 
A 1 127 MET 127 127 127 MET MET A . n 
A 1 128 LYS 128 128 128 LYS LYS A . n 
A 1 129 PHE 129 129 129 PHE PHE A . n 
A 1 130 ILE 130 130 130 ILE ILE A . n 
A 1 131 TYR 131 131 131 TYR TYR A . n 
A 1 132 PHE 132 132 132 PHE PHE A . n 
A 1 133 GLU 133 133 133 GLU GLU A . n 
A 1 134 ASN 134 134 134 ASN ASN A . n 
A 1 135 GLY 135 135 135 GLY GLY A . n 
A 1 136 GLY 136 136 136 GLY GLY A . n 
A 1 137 VAL 137 137 137 VAL VAL A . n 
A 1 138 VAL 138 138 138 VAL VAL A . n 
A 1 139 ALA 139 139 139 ALA ALA A . n 
A 1 140 ARG 140 140 140 ARG ARG A . n 
A 1 141 LEU 141 141 141 LEU LEU A . n 
A 1 142 SER 142 142 142 SER SER A . n 
A 1 143 THR 143 143 143 THR THR A . n 
A 1 144 ASP 144 144 144 ASP ASP A . n 
A 1 145 LYS 145 145 ?   ?   ?   A . n 
A 1 146 ASN 146 146 ?   ?   ?   A . n 
A 1 147 GLY 147 147 ?   ?   ?   A . n 
A 1 148 GLN 148 148 148 GLN GLN A . n 
A 1 149 GLU 149 149 149 GLU GLU A . n 
A 1 150 ASP 150 150 150 ASP ASP A . n 
A 1 151 PRO 151 151 151 PRO PRO A . n 
A 1 152 HIS 152 152 152 HIS HIS A . n 
A 1 153 PHE 153 153 153 PHE PHE A . n 
A 1 154 ALA 154 154 154 ALA ALA A . n 
A 1 155 LYS 155 155 155 LYS LYS A . n 
A 1 156 LEU 156 156 156 LEU LEU A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 GLN 158 158 158 GLN GLN A . n 
A 1 159 LEU 159 159 159 LEU LEU A . n 
A 1 160 VAL 160 160 160 VAL VAL A . n 
A 1 161 TYR 161 161 161 TYR TYR A . n 
A 1 162 GLU 162 162 162 GLU GLU A . n 
A 1 163 GLY 163 163 163 GLY GLY A . n 
A 1 164 GLY 164 164 164 GLY GLY A . n 
A 1 165 ASP 165 165 165 ASP ASP A . n 
A 1 166 SER 166 166 166 SER SER A . n 
A 1 167 VAL 167 167 167 VAL VAL A . n 
A 1 168 ARG 168 168 168 ARG ARG A . n 
A 1 169 ASP 169 169 169 ASP ASP A . n 
A 1 170 GLN 170 170 170 GLN GLN A . n 
A 1 171 MET 171 171 171 MET MET A . n 
A 1 172 VAL 172 172 172 VAL VAL A . n 
A 1 173 THR 173 173 173 THR THR A . n 
A 1 174 ILE 174 174 174 ILE ILE A . n 
A 1 175 VAL 175 175 175 VAL VAL A . n 
A 1 176 ARG 176 176 176 ARG ARG A . n 
A 1 177 SER 177 177 177 SER SER A . n 
A 1 178 VAL 178 178 178 VAL VAL A . n 
A 1 179 GLN 179 179 179 GLN GLN A . n 
A 1 180 PHE 180 180 180 PHE PHE A . n 
A 1 181 LEU 181 181 181 LEU LEU A . n 
A 1 182 CYS 182 182 182 CYS CYS A . n 
A 1 183 THR 183 183 183 THR THR A . n 
A 1 184 LYS 184 184 184 LYS LYS A . n 
A 1 185 VAL 185 185 185 VAL VAL A . n 
A 1 186 LEU 186 186 186 LEU LEU A . n 
A 1 187 GLU 187 187 187 GLU GLU A . n 
A 1 188 PRO 188 188 188 PRO PRO A . n 
A 1 189 LEU 189 189 189 LEU LEU A . n 
A 1 190 PRO 190 190 190 PRO PRO A . n 
A 1 191 GLU 191 191 191 GLU GLU A . n 
A 1 192 GLU 192 192 192 GLU GLU A . n 
A 1 193 PHE 193 193 193 PHE PHE A . n 
A 1 194 THR 194 194 194 THR THR A . n 
A 1 195 ALA 195 195 195 ALA ALA A . n 
A 1 196 ASN 196 196 196 ASN ASN A . n 
A 1 197 PHE 197 197 197 PHE PHE A . n 
A 1 198 ARG 198 198 198 ARG ARG A . n 
A 1 199 LEU 199 199 199 LEU LEU A . n 
A 1 200 GLU 200 200 200 GLU GLU A . n 
A 1 201 TYR 201 201 201 TYR TYR A . n 
A 1 202 THR 202 202 202 THR THR A . n 
A 1 203 ASN 203 203 203 ASN ASN A . n 
A 1 204 ASP 204 204 204 ASP ASP A . n 
A 1 205 ALA 205 205 205 ALA ALA A . n 
A 1 206 PRO 206 206 206 PRO PRO A . n 
A 1 207 SER 207 207 207 SER SER A . n 
A 1 208 ASN 208 208 208 ASN ASN A . n 
A 1 209 PHE 209 209 209 PHE PHE A . n 
A 1 210 ARG 210 210 210 ARG ARG A . n 
A 1 211 ILE 211 211 211 ILE ILE A . n 
A 1 212 ASP 212 212 212 ASP ASP A . n 
A 1 213 GLY 213 213 213 GLY GLY A . n 
A 1 214 PHE 214 214 214 PHE PHE A . n 
A 1 215 GLU 215 215 215 GLU GLU A . n 
A 1 216 ASP 216 216 216 ASP ASP A . n 
A 1 217 SER 217 217 217 SER SER A . n 
A 1 218 SER 218 218 218 SER SER A . n 
A 1 219 THR 219 219 219 THR THR A . n 
A 1 220 PHE 220 220 220 PHE PHE A . n 
A 1 221 TYR 221 221 221 TYR TYR A . n 
A 1 222 THR 222 222 222 THR THR A . n 
A 1 223 LEU 223 223 223 LEU LEU A . n 
A 1 224 PRO 224 224 224 PRO PRO A . n 
A 1 225 ASP 225 225 225 ASP ASP A . n 
A 1 226 ASP 226 226 226 ASP ASP A . n 
A 1 227 ILE 227 227 227 ILE ILE A . n 
A 1 228 GLN 228 228 228 GLN GLN A . n 
A 1 229 SER 229 229 229 SER SER A . n 
A 1 230 ALA 230 230 230 ALA ALA A . n 
A 1 231 THR 231 231 231 THR THR A . n 
A 1 232 ILE 232 232 232 ILE ILE A . n 
A 1 233 GLY 233 233 233 GLY GLY A . n 
A 1 234 HIS 234 234 234 HIS HIS A . n 
A 1 235 LEU 235 235 235 LEU LEU A . n 
A 1 236 ARG 236 236 236 ARG ARG A . n 
A 1 237 PRO 237 237 237 PRO PRO A . n 
A 1 238 GLY 238 238 238 GLY GLY A . n 
A 1 239 CYS 239 239 239 CYS CYS A . n 
A 1 240 HIS 240 240 240 HIS HIS A . n 
A 1 241 ALA 241 241 241 ALA ALA A . n 
A 1 242 ALA 242 242 242 ALA ALA A . n 
A 1 243 ASN 243 243 243 ASN ASN A . n 
A 1 244 MET 244 244 244 MET MET A . n 
A 1 245 GLU 245 245 245 GLU GLU A . n 
A 1 246 CYS 246 246 246 CYS CYS A . n 
A 1 247 TRP 247 247 247 TRP TRP A . n 
A 1 248 SER 248 248 248 SER SER A . n 
A 1 249 MET 249 249 249 MET MET A . n 
A 1 250 LEU 250 250 250 LEU LEU A . n 
A 1 251 MET 251 251 251 MET MET A . n 
A 1 252 SER 252 252 252 SER SER A . n 
A 1 253 ASP 253 253 ?   ?   ?   A . n 
B 2 1   SER 1   485 ?   ?   ?   B . n 
B 2 2   THR 2   486 ?   ?   ?   B . n 
B 2 3   ALA 3   487 487 ALA ALA B . n 
B 2 4   ARG 4   488 488 ARG ARG B . n 
B 2 5   TYR 5   489 489 TYR TYR B . n 
B 2 6   GLY 6   490 490 GLY GLY B . n 
B 2 7   VAL 7   491 491 VAL VAL B . n 
B 2 8   SER 8   492 492 SER SER B . n 
B 2 9   ASN 9   493 493 ASN ASN B . n 
B 2 10  THR 10  494 494 THR THR B . n 
B 2 11  SER 11  495 495 SER SER B . n 
B 2 12  ILE 12  496 496 ILE ILE B . n 
B 2 13  ASN 13  497 497 ASN ASN B . n 
B 2 14  ARG 14  498 498 ARG ARG B . n 
B 2 15  LYS 15  499 499 LYS LYS B . n 
B 2 16  LYS 16  500 ?   ?   ?   B . n 
B 2 17  PRO 17  501 ?   ?   ?   B . n 
C 1 1   MET 1   1   ?   ?   ?   C . n 
C 1 2   ALA 2   2   ?   ?   ?   C . n 
C 1 3   PRO 3   3   ?   ?   ?   C . n 
C 1 4   LEU 4   4   ?   ?   ?   C . n 
C 1 5   GLU 5   5   ?   ?   ?   C . n 
C 1 6   THR 6   6   ?   ?   ?   C . n 
C 1 7   ILE 7   7   ?   ?   ?   C . n 
C 1 8   TYR 8   8   ?   ?   ?   C . n 
C 1 9   ASP 9   9   ?   ?   ?   C . n 
C 1 10  GLU 10  10  ?   ?   ?   C . n 
C 1 11  SER 11  11  ?   ?   ?   C . n 
C 1 12  LEU 12  12  ?   ?   ?   C . n 
C 1 13  ASN 13  13  ?   ?   ?   C . n 
C 1 14  LYS 14  14  ?   ?   ?   C . n 
C 1 15  SER 15  15  ?   ?   ?   C . n 
C 1 16  ALA 16  16  16  ALA ALA C . n 
C 1 17  ASP 17  17  17  ASP ASP C . n 
C 1 18  SER 18  18  18  SER SER C . n 
C 1 19  ILE 19  19  19  ILE ILE C . n 
C 1 20  ASP 20  20  20  ASP ASP C . n 
C 1 21  ASP 21  21  21  ASP ASP C . n 
C 1 22  LYS 22  22  22  LYS LYS C . n 
C 1 23  LYS 23  23  23  LYS LYS C . n 
C 1 24  TRP 24  24  24  TRP TRP C . n 
C 1 25  SER 25  25  25  SER SER C . n 
C 1 26  LYS 26  26  26  LYS LYS C . n 
C 1 27  LEU 27  27  27  LEU LEU C . n 
C 1 28  PHE 28  28  28  PHE PHE C . n 
C 1 29  PRO 29  29  29  PRO PRO C . n 
C 1 30  ARG 30  30  30  ARG ARG C . n 
C 1 31  ILE 31  31  31  ILE ILE C . n 
C 1 32  VAL 32  32  32  VAL VAL C . n 
C 1 33  SER 33  33  33  SER SER C . n 
C 1 34  ASP 34  34  34  ASP ASP C . n 
C 1 35  PRO 35  35  35  PRO PRO C . n 
C 1 36  ASP 36  36  36  ASP ASP C . n 
C 1 37  ARG 37  37  37  ARG ARG C . n 
C 1 38  SER 38  38  38  SER SER C . n 
C 1 39  SER 39  39  39  SER SER C . n 
C 1 40  ASN 40  40  40  ASN ASN C . n 
C 1 41  PHE 41  41  41  PHE PHE C . n 
C 1 42  MET 42  42  42  MET MET C . n 
C 1 43  THR 43  43  43  THR THR C . n 
C 1 44  ARG 44  44  44  ARG ARG C . n 
C 1 45  ALA 45  45  45  ALA ALA C . n 
C 1 46  ILE 46  46  46  ILE ILE C . n 
C 1 47  TYR 47  47  47  TYR TYR C . n 
C 1 48  VAL 48  48  48  VAL VAL C . n 
C 1 49  ALA 49  49  49  ALA ALA C . n 
C 1 50  PHE 50  50  50  PHE PHE C . n 
C 1 51  SER 51  51  51  SER SER C . n 
C 1 52  ALA 52  52  52  ALA ALA C . n 
C 1 53  VAL 53  53  53  VAL VAL C . n 
C 1 54  LEU 54  54  54  LEU LEU C . n 
C 1 55  ARG 55  55  55  ARG ARG C . n 
C 1 56  ASN 56  56  56  ASN ASN C . n 
C 1 57  ARG 57  57  57  ARG ARG C . n 
C 1 58  ASN 58  58  58  ASN ASN C . n 
C 1 59  ILE 59  59  59  ILE ILE C . n 
C 1 60  LEU 60  60  60  LEU LEU C . n 
C 1 61  GLY 61  61  61  GLY GLY C . n 
C 1 62  GLN 62  62  62  GLN GLN C . n 
C 1 63  GLU 63  63  63  GLU GLU C . n 
C 1 64  TYR 64  64  64  TYR TYR C . n 
C 1 65  PHE 65  65  65  PHE PHE C . n 
C 1 66  THR 66  66  66  THR THR C . n 
C 1 67  LYS 67  67  67  LYS LYS C . n 
C 1 68  ASN 68  68  68  ASN ASN C . n 
C 1 69  TYR 69  69  69  TYR TYR C . n 
C 1 70  ILE 70  70  70  ILE ILE C . n 
C 1 71  THR 71  71  71  THR THR C . n 
C 1 72  GLU 72  72  72  GLU GLU C . n 
C 1 73  LYS 73  73  73  LYS LYS C . n 
C 1 74  LEU 74  74  74  LEU LEU C . n 
C 1 75  LYS 75  75  75  LYS LYS C . n 
C 1 76  CYS 76  76  76  CYS CYS C . n 
C 1 77  MET 77  77  77  MET MET C . n 
C 1 78  THR 78  78  78  THR THR C . n 
C 1 79  LEU 79  79  79  LEU LEU C . n 
C 1 80  CYS 80  80  80  CYS CYS C . n 
C 1 81  PHE 81  81  81  PHE PHE C . n 
C 1 82  ARG 82  82  82  ARG ARG C . n 
C 1 83  ASN 83  83  83  ASN ASN C . n 
C 1 84  LEU 84  84  84  LEU LEU C . n 
C 1 85  ARG 85  85  85  ARG ARG C . n 
C 1 86  SER 86  86  86  SER SER C . n 
C 1 87  ASN 87  87  87  ASN ASN C . n 
C 1 88  GLN 88  88  88  GLN GLN C . n 
C 1 89  ILE 89  89  89  ILE ILE C . n 
C 1 90  ALA 90  90  90  ALA ALA C . n 
C 1 91  GLN 91  91  91  GLN GLN C . n 
C 1 92  LEU 92  92  92  LEU LEU C . n 
C 1 93  LEU 93  93  93  LEU LEU C . n 
C 1 94  ARG 94  94  94  ARG ARG C . n 
C 1 95  ASN 95  95  95  ASN ASN C . n 
C 1 96  ALA 96  96  96  ALA ALA C . n 
C 1 97  GLY 97  97  97  GLY GLY C . n 
C 1 98  ASP 98  98  98  ASP ASP C . n 
C 1 99  ALA 99  99  99  ALA ALA C . n 
C 1 100 THR 100 100 100 THR THR C . n 
C 1 101 LYS 101 101 101 LYS LYS C . n 
C 1 102 ASP 102 102 102 ASP ASP C . n 
C 1 103 GLY 103 103 103 GLY GLY C . n 
C 1 104 PHE 104 104 104 PHE PHE C . n 
C 1 105 LEU 105 105 105 LEU LEU C . n 
C 1 106 LYS 106 106 106 LYS LYS C . n 
C 1 107 GLU 107 107 107 GLU GLU C . n 
C 1 108 VAL 108 108 108 VAL VAL C . n 
C 1 109 SER 109 109 109 SER SER C . n 
C 1 110 LEU 110 110 110 LEU LEU C . n 
C 1 111 VAL 111 111 111 VAL VAL C . n 
C 1 112 ILE 112 112 112 ILE ILE C . n 
C 1 113 THR 113 113 113 THR THR C . n 
C 1 114 ASN 114 114 114 ASN ASN C . n 
C 1 115 ASN 115 115 115 ASN ASN C . n 
C 1 116 GLU 116 116 116 GLU GLU C . n 
C 1 117 GLY 117 117 117 GLY GLY C . n 
C 1 118 ASP 118 118 118 ASP ASP C . n 
C 1 119 LEU 119 119 119 LEU LEU C . n 
C 1 120 GLU 120 120 120 GLU GLU C . n 
C 1 121 ALA 121 121 121 ALA ALA C . n 
C 1 122 ILE 122 122 122 ILE ILE C . n 
C 1 123 GLU 123 123 123 GLU GLU C . n 
C 1 124 VAL 124 124 124 VAL VAL C . n 
C 1 125 PHE 125 125 125 PHE PHE C . n 
C 1 126 SER 126 126 126 SER SER C . n 
C 1 127 MET 127 127 127 MET MET C . n 
C 1 128 LYS 128 128 128 LYS LYS C . n 
C 1 129 PHE 129 129 129 PHE PHE C . n 
C 1 130 ILE 130 130 130 ILE ILE C . n 
C 1 131 TYR 131 131 131 TYR TYR C . n 
C 1 132 PHE 132 132 132 PHE PHE C . n 
C 1 133 GLU 133 133 133 GLU GLU C . n 
C 1 134 ASN 134 134 134 ASN ASN C . n 
C 1 135 GLY 135 135 135 GLY GLY C . n 
C 1 136 GLY 136 136 136 GLY GLY C . n 
C 1 137 VAL 137 137 137 VAL VAL C . n 
C 1 138 VAL 138 138 138 VAL VAL C . n 
C 1 139 ALA 139 139 139 ALA ALA C . n 
C 1 140 ARG 140 140 140 ARG ARG C . n 
C 1 141 LEU 141 141 141 LEU LEU C . n 
C 1 142 SER 142 142 142 SER SER C . n 
C 1 143 THR 143 143 143 THR THR C . n 
C 1 144 ASP 144 144 144 ASP ASP C . n 
C 1 145 LYS 145 145 145 LYS LYS C . n 
C 1 146 ASN 146 146 146 ASN ASN C . n 
C 1 147 GLY 147 147 147 GLY GLY C . n 
C 1 148 GLN 148 148 148 GLN GLN C . n 
C 1 149 GLU 149 149 149 GLU GLU C . n 
C 1 150 ASP 150 150 150 ASP ASP C . n 
C 1 151 PRO 151 151 151 PRO PRO C . n 
C 1 152 HIS 152 152 152 HIS HIS C . n 
C 1 153 PHE 153 153 153 PHE PHE C . n 
C 1 154 ALA 154 154 154 ALA ALA C . n 
C 1 155 LYS 155 155 155 LYS LYS C . n 
C 1 156 LEU 156 156 156 LEU LEU C . n 
C 1 157 ALA 157 157 157 ALA ALA C . n 
C 1 158 GLN 158 158 158 GLN GLN C . n 
C 1 159 LEU 159 159 159 LEU LEU C . n 
C 1 160 VAL 160 160 160 VAL VAL C . n 
C 1 161 TYR 161 161 161 TYR TYR C . n 
C 1 162 GLU 162 162 162 GLU GLU C . n 
C 1 163 GLY 163 163 163 GLY GLY C . n 
C 1 164 GLY 164 164 164 GLY GLY C . n 
C 1 165 ASP 165 165 165 ASP ASP C . n 
C 1 166 SER 166 166 166 SER SER C . n 
C 1 167 VAL 167 167 167 VAL VAL C . n 
C 1 168 ARG 168 168 168 ARG ARG C . n 
C 1 169 ASP 169 169 169 ASP ASP C . n 
C 1 170 GLN 170 170 170 GLN GLN C . n 
C 1 171 MET 171 171 171 MET MET C . n 
C 1 172 VAL 172 172 172 VAL VAL C . n 
C 1 173 THR 173 173 173 THR THR C . n 
C 1 174 ILE 174 174 174 ILE ILE C . n 
C 1 175 VAL 175 175 175 VAL VAL C . n 
C 1 176 ARG 176 176 176 ARG ARG C . n 
C 1 177 SER 177 177 177 SER SER C . n 
C 1 178 VAL 178 178 178 VAL VAL C . n 
C 1 179 GLN 179 179 179 GLN GLN C . n 
C 1 180 PHE 180 180 180 PHE PHE C . n 
C 1 181 LEU 181 181 181 LEU LEU C . n 
C 1 182 CYS 182 182 182 CYS CYS C . n 
C 1 183 THR 183 183 183 THR THR C . n 
C 1 184 LYS 184 184 184 LYS LYS C . n 
C 1 185 VAL 185 185 185 VAL VAL C . n 
C 1 186 LEU 186 186 186 LEU LEU C . n 
C 1 187 GLU 187 187 187 GLU GLU C . n 
C 1 188 PRO 188 188 188 PRO PRO C . n 
C 1 189 LEU 189 189 189 LEU LEU C . n 
C 1 190 PRO 190 190 190 PRO PRO C . n 
C 1 191 GLU 191 191 191 GLU GLU C . n 
C 1 192 GLU 192 192 192 GLU GLU C . n 
C 1 193 PHE 193 193 193 PHE PHE C . n 
C 1 194 THR 194 194 194 THR THR C . n 
C 1 195 ALA 195 195 195 ALA ALA C . n 
C 1 196 ASN 196 196 196 ASN ASN C . n 
C 1 197 PHE 197 197 197 PHE PHE C . n 
C 1 198 ARG 198 198 198 ARG ARG C . n 
C 1 199 LEU 199 199 199 LEU LEU C . n 
C 1 200 GLU 200 200 200 GLU GLU C . n 
C 1 201 TYR 201 201 201 TYR TYR C . n 
C 1 202 THR 202 202 202 THR THR C . n 
C 1 203 ASN 203 203 203 ASN ASN C . n 
C 1 204 ASP 204 204 204 ASP ASP C . n 
C 1 205 ALA 205 205 205 ALA ALA C . n 
C 1 206 PRO 206 206 206 PRO PRO C . n 
C 1 207 SER 207 207 207 SER SER C . n 
C 1 208 ASN 208 208 208 ASN ASN C . n 
C 1 209 PHE 209 209 209 PHE PHE C . n 
C 1 210 ARG 210 210 210 ARG ARG C . n 
C 1 211 ILE 211 211 211 ILE ILE C . n 
C 1 212 ASP 212 212 212 ASP ASP C . n 
C 1 213 GLY 213 213 213 GLY GLY C . n 
C 1 214 PHE 214 214 214 PHE PHE C . n 
C 1 215 GLU 215 215 215 GLU GLU C . n 
C 1 216 ASP 216 216 216 ASP ASP C . n 
C 1 217 SER 217 217 217 SER SER C . n 
C 1 218 SER 218 218 218 SER SER C . n 
C 1 219 THR 219 219 219 THR THR C . n 
C 1 220 PHE 220 220 220 PHE PHE C . n 
C 1 221 TYR 221 221 221 TYR TYR C . n 
C 1 222 THR 222 222 222 THR THR C . n 
C 1 223 LEU 223 223 223 LEU LEU C . n 
C 1 224 PRO 224 224 224 PRO PRO C . n 
C 1 225 ASP 225 225 225 ASP ASP C . n 
C 1 226 ASP 226 226 226 ASP ASP C . n 
C 1 227 ILE 227 227 227 ILE ILE C . n 
C 1 228 GLN 228 228 228 GLN GLN C . n 
C 1 229 SER 229 229 229 SER SER C . n 
C 1 230 ALA 230 230 230 ALA ALA C . n 
C 1 231 THR 231 231 231 THR THR C . n 
C 1 232 ILE 232 232 232 ILE ILE C . n 
C 1 233 GLY 233 233 233 GLY GLY C . n 
C 1 234 HIS 234 234 234 HIS HIS C . n 
C 1 235 LEU 235 235 235 LEU LEU C . n 
C 1 236 ARG 236 236 236 ARG ARG C . n 
C 1 237 PRO 237 237 237 PRO PRO C . n 
C 1 238 GLY 238 238 238 GLY GLY C . n 
C 1 239 CYS 239 239 239 CYS CYS C . n 
C 1 240 HIS 240 240 240 HIS HIS C . n 
C 1 241 ALA 241 241 241 ALA ALA C . n 
C 1 242 ALA 242 242 242 ALA ALA C . n 
C 1 243 ASN 243 243 243 ASN ASN C . n 
C 1 244 MET 244 244 244 MET MET C . n 
C 1 245 GLU 245 245 245 GLU GLU C . n 
C 1 246 CYS 246 246 246 CYS CYS C . n 
C 1 247 TRP 247 247 247 TRP TRP C . n 
C 1 248 SER 248 248 248 SER SER C . n 
C 1 249 MET 249 249 249 MET MET C . n 
C 1 250 LEU 250 250 250 LEU LEU C . n 
C 1 251 MET 251 251 251 MET MET C . n 
C 1 252 SER 252 252 252 SER SER C . n 
C 1 253 ASP 253 253 ?   ?   ?   C . n 
D 2 1   SER 1   485 ?   ?   ?   D . n 
D 2 2   THR 2   486 ?   ?   ?   D . n 
D 2 3   ALA 3   487 487 ALA ALA D . n 
D 2 4   ARG 4   488 488 ARG ARG D . n 
D 2 5   TYR 5   489 489 TYR TYR D . n 
D 2 6   GLY 6   490 490 GLY GLY D . n 
D 2 7   VAL 7   491 491 VAL VAL D . n 
D 2 8   SER 8   492 492 SER SER D . n 
D 2 9   ASN 9   493 493 ASN ASN D . n 
D 2 10  THR 10  494 494 THR THR D . n 
D 2 11  SER 11  495 495 SER SER D . n 
D 2 12  ILE 12  496 496 ILE ILE D . n 
D 2 13  ASN 13  497 497 ASN ASN D . n 
D 2 14  ARG 14  498 498 ARG ARG D . n 
D 2 15  LYS 15  499 499 LYS LYS D . n 
D 2 16  LYS 16  500 ?   ?   ?   D . n 
D 2 17  PRO 17  501 ?   ?   ?   D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 HOH 1   301 160 HOH HOH A . 
E 3 HOH 2   302 133 HOH HOH A . 
E 3 HOH 3   303 33  HOH HOH A . 
E 3 HOH 4   304 125 HOH HOH A . 
E 3 HOH 5   305 54  HOH HOH A . 
E 3 HOH 6   306 207 HOH HOH A . 
E 3 HOH 7   307 99  HOH HOH A . 
E 3 HOH 8   308 104 HOH HOH A . 
E 3 HOH 9   309 19  HOH HOH A . 
E 3 HOH 10  310 31  HOH HOH A . 
E 3 HOH 11  311 177 HOH HOH A . 
E 3 HOH 12  312 75  HOH HOH A . 
E 3 HOH 13  313 115 HOH HOH A . 
E 3 HOH 14  314 147 HOH HOH A . 
E 3 HOH 15  315 156 HOH HOH A . 
E 3 HOH 16  316 131 HOH HOH A . 
E 3 HOH 17  317 62  HOH HOH A . 
E 3 HOH 18  318 151 HOH HOH A . 
E 3 HOH 19  319 132 HOH HOH A . 
E 3 HOH 20  320 170 HOH HOH A . 
E 3 HOH 21  321 91  HOH HOH A . 
E 3 HOH 22  322 184 HOH HOH A . 
E 3 HOH 23  323 37  HOH HOH A . 
E 3 HOH 24  324 173 HOH HOH A . 
E 3 HOH 25  325 16  HOH HOH A . 
E 3 HOH 26  326 182 HOH HOH A . 
E 3 HOH 27  327 205 HOH HOH A . 
E 3 HOH 28  328 208 HOH HOH A . 
E 3 HOH 29  329 2   HOH HOH A . 
E 3 HOH 30  330 3   HOH HOH A . 
E 3 HOH 31  331 6   HOH HOH A . 
E 3 HOH 32  332 14  HOH HOH A . 
E 3 HOH 33  333 15  HOH HOH A . 
E 3 HOH 34  334 17  HOH HOH A . 
E 3 HOH 35  335 23  HOH HOH A . 
E 3 HOH 36  336 28  HOH HOH A . 
E 3 HOH 37  337 30  HOH HOH A . 
E 3 HOH 38  338 32  HOH HOH A . 
E 3 HOH 39  339 34  HOH HOH A . 
E 3 HOH 40  340 39  HOH HOH A . 
E 3 HOH 41  341 40  HOH HOH A . 
E 3 HOH 42  342 47  HOH HOH A . 
E 3 HOH 43  343 48  HOH HOH A . 
E 3 HOH 44  344 51  HOH HOH A . 
E 3 HOH 45  345 52  HOH HOH A . 
E 3 HOH 46  346 55  HOH HOH A . 
E 3 HOH 47  347 56  HOH HOH A . 
E 3 HOH 48  348 61  HOH HOH A . 
E 3 HOH 49  349 70  HOH HOH A . 
E 3 HOH 50  350 73  HOH HOH A . 
E 3 HOH 51  351 74  HOH HOH A . 
E 3 HOH 52  352 76  HOH HOH A . 
E 3 HOH 53  353 77  HOH HOH A . 
E 3 HOH 54  354 81  HOH HOH A . 
E 3 HOH 55  355 85  HOH HOH A . 
E 3 HOH 56  356 89  HOH HOH A . 
E 3 HOH 57  357 90  HOH HOH A . 
E 3 HOH 58  358 94  HOH HOH A . 
E 3 HOH 59  359 97  HOH HOH A . 
E 3 HOH 60  360 100 HOH HOH A . 
E 3 HOH 61  361 101 HOH HOH A . 
E 3 HOH 62  362 102 HOH HOH A . 
E 3 HOH 63  363 105 HOH HOH A . 
E 3 HOH 64  364 107 HOH HOH A . 
E 3 HOH 65  365 108 HOH HOH A . 
E 3 HOH 66  366 110 HOH HOH A . 
E 3 HOH 67  367 112 HOH HOH A . 
E 3 HOH 68  368 114 HOH HOH A . 
E 3 HOH 69  369 116 HOH HOH A . 
E 3 HOH 70  370 117 HOH HOH A . 
E 3 HOH 71  371 118 HOH HOH A . 
E 3 HOH 72  372 119 HOH HOH A . 
E 3 HOH 73  373 121 HOH HOH A . 
E 3 HOH 74  374 122 HOH HOH A . 
E 3 HOH 75  375 126 HOH HOH A . 
E 3 HOH 76  376 128 HOH HOH A . 
E 3 HOH 77  377 130 HOH HOH A . 
E 3 HOH 78  378 134 HOH HOH A . 
E 3 HOH 79  379 135 HOH HOH A . 
E 3 HOH 80  380 137 HOH HOH A . 
E 3 HOH 81  381 138 HOH HOH A . 
E 3 HOH 82  382 139 HOH HOH A . 
E 3 HOH 83  383 150 HOH HOH A . 
E 3 HOH 84  384 153 HOH HOH A . 
E 3 HOH 85  385 161 HOH HOH A . 
E 3 HOH 86  386 162 HOH HOH A . 
E 3 HOH 87  387 163 HOH HOH A . 
E 3 HOH 88  388 165 HOH HOH A . 
E 3 HOH 89  389 168 HOH HOH A . 
E 3 HOH 90  390 169 HOH HOH A . 
E 3 HOH 91  391 171 HOH HOH A . 
E 3 HOH 92  392 172 HOH HOH A . 
E 3 HOH 93  393 175 HOH HOH A . 
E 3 HOH 94  394 176 HOH HOH A . 
E 3 HOH 95  395 178 HOH HOH A . 
E 3 HOH 96  396 179 HOH HOH A . 
E 3 HOH 97  397 180 HOH HOH A . 
E 3 HOH 98  398 183 HOH HOH A . 
E 3 HOH 99  399 185 HOH HOH A . 
E 3 HOH 100 400 194 HOH HOH A . 
E 3 HOH 101 401 200 HOH HOH A . 
E 3 HOH 102 402 201 HOH HOH A . 
E 3 HOH 103 403 202 HOH HOH A . 
E 3 HOH 104 404 203 HOH HOH A . 
E 3 HOH 105 405 209 HOH HOH A . 
E 3 HOH 106 406 210 HOH HOH A . 
E 3 HOH 107 407 211 HOH HOH A . 
E 3 HOH 108 408 212 HOH HOH A . 
F 3 HOH 1   601 13  HOH HOH B . 
F 3 HOH 2   602 38  HOH HOH B . 
F 3 HOH 3   603 42  HOH HOH B . 
F 3 HOH 4   604 86  HOH HOH B . 
F 3 HOH 5   605 195 HOH HOH B . 
F 3 HOH 6   606 196 HOH HOH B . 
F 3 HOH 7   607 197 HOH HOH B . 
F 3 HOH 8   608 198 HOH HOH B . 
F 3 HOH 9   609 199 HOH HOH B . 
G 3 HOH 1   301 63  HOH HOH C . 
G 3 HOH 2   302 66  HOH HOH C . 
G 3 HOH 3   303 68  HOH HOH C . 
G 3 HOH 4   304 84  HOH HOH C . 
G 3 HOH 5   305 127 HOH HOH C . 
G 3 HOH 6   306 106 HOH HOH C . 
G 3 HOH 7   307 27  HOH HOH C . 
G 3 HOH 8   308 8   HOH HOH C . 
G 3 HOH 9   309 124 HOH HOH C . 
G 3 HOH 10  310 174 HOH HOH C . 
G 3 HOH 11  311 58  HOH HOH C . 
G 3 HOH 12  312 21  HOH HOH C . 
G 3 HOH 13  313 10  HOH HOH C . 
G 3 HOH 14  314 167 HOH HOH C . 
G 3 HOH 15  315 144 HOH HOH C . 
G 3 HOH 16  316 204 HOH HOH C . 
G 3 HOH 17  317 59  HOH HOH C . 
G 3 HOH 18  318 141 HOH HOH C . 
G 3 HOH 19  319 188 HOH HOH C . 
G 3 HOH 20  320 4   HOH HOH C . 
G 3 HOH 21  321 7   HOH HOH C . 
G 3 HOH 22  322 9   HOH HOH C . 
G 3 HOH 23  323 11  HOH HOH C . 
G 3 HOH 24  324 18  HOH HOH C . 
G 3 HOH 25  325 22  HOH HOH C . 
G 3 HOH 26  326 35  HOH HOH C . 
G 3 HOH 27  327 36  HOH HOH C . 
G 3 HOH 28  328 43  HOH HOH C . 
G 3 HOH 29  329 45  HOH HOH C . 
G 3 HOH 30  330 49  HOH HOH C . 
G 3 HOH 31  331 50  HOH HOH C . 
G 3 HOH 32  332 53  HOH HOH C . 
G 3 HOH 33  333 64  HOH HOH C . 
G 3 HOH 34  334 67  HOH HOH C . 
G 3 HOH 35  335 69  HOH HOH C . 
G 3 HOH 36  336 71  HOH HOH C . 
G 3 HOH 37  337 72  HOH HOH C . 
G 3 HOH 38  338 79  HOH HOH C . 
G 3 HOH 39  339 80  HOH HOH C . 
G 3 HOH 40  340 83  HOH HOH C . 
G 3 HOH 41  341 87  HOH HOH C . 
G 3 HOH 42  342 92  HOH HOH C . 
G 3 HOH 43  343 93  HOH HOH C . 
G 3 HOH 44  344 96  HOH HOH C . 
G 3 HOH 45  345 98  HOH HOH C . 
G 3 HOH 46  346 103 HOH HOH C . 
G 3 HOH 47  347 111 HOH HOH C . 
G 3 HOH 48  348 120 HOH HOH C . 
G 3 HOH 49  349 123 HOH HOH C . 
G 3 HOH 50  350 136 HOH HOH C . 
G 3 HOH 51  351 140 HOH HOH C . 
G 3 HOH 52  352 143 HOH HOH C . 
G 3 HOH 53  353 148 HOH HOH C . 
G 3 HOH 54  354 149 HOH HOH C . 
G 3 HOH 55  355 152 HOH HOH C . 
G 3 HOH 56  356 154 HOH HOH C . 
G 3 HOH 57  357 155 HOH HOH C . 
G 3 HOH 58  358 157 HOH HOH C . 
G 3 HOH 59  359 164 HOH HOH C . 
G 3 HOH 60  360 181 HOH HOH C . 
G 3 HOH 61  361 186 HOH HOH C . 
G 3 HOH 62  362 187 HOH HOH C . 
G 3 HOH 63  363 189 HOH HOH C . 
G 3 HOH 64  364 190 HOH HOH C . 
G 3 HOH 65  365 191 HOH HOH C . 
G 3 HOH 66  366 192 HOH HOH C . 
G 3 HOH 67  367 193 HOH HOH C . 
G 3 HOH 68  368 206 HOH HOH C . 
G 3 HOH 69  369 213 HOH HOH C . 
G 3 HOH 70  370 214 HOH HOH C . 
G 3 HOH 71  371 215 HOH HOH C . 
G 3 HOH 72  372 216 HOH HOH C . 
G 3 HOH 73  373 217 HOH HOH C . 
G 3 HOH 74  374 218 HOH HOH C . 
G 3 HOH 75  375 219 HOH HOH C . 
H 3 HOH 1   601 41  HOH HOH D . 
H 3 HOH 2   602 46  HOH HOH D . 
H 3 HOH 3   603 146 HOH HOH D . 
H 3 HOH 4   604 158 HOH HOH D . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric 2 
2 author_and_software_defined_assembly PISA dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,E,F 
2 1 C,D,G,H 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1990  ? 
1 MORE         -4    ? 
1 'SSA (A^2)'  11470 ? 
2 'ABSA (A^2)' 2120  ? 
2 MORE         -5    ? 
2 'SSA (A^2)'  11770 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2014-11-19 
2 'Structure model' 1 1 2014-12-17 
3 'Structure model' 1 2 2017-09-20 
4 'Structure model' 1 3 2019-12-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'        
2 3 'Structure model' 'Author supporting evidence' 
3 3 'Structure model' 'Derived calculations'       
4 3 'Structure model' 'Source and taxonomy'        
5 3 'Structure model' 'Structure summary'          
6 4 'Structure model' 'Author supporting evidence' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' entity_src_gen        
2 3 'Structure model' pdbx_audit_support    
3 3 'Structure model' pdbx_struct_oper_list 
4 3 'Structure model' struct_keywords       
5 4 'Structure model' pdbx_audit_support    
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_entity_src_gen.pdbx_alt_source_flag'      
2 3 'Structure model' '_pdbx_audit_support.funding_organization'  
3 3 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 
4 3 'Structure model' '_struct_keywords.pdbx_keywords'            
5 4 'Structure model' '_pdbx_audit_support.funding_organization'  
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[1][1]_esd 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][2]_esd 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[1][3]_esd 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[2][2]_esd 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.T[2][3]_esd 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[3][3]_esd 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[1][1]_esd 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][2]_esd 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[1][3]_esd 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[2][2]_esd 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.L[2][3]_esd 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[3][3]_esd 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][1]_esd 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][2]_esd 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[1][3]_esd 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][1]_esd 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][2]_esd 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][3]_esd 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][1]_esd 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][2]_esd 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[3][3]_esd 
1 'X-RAY DIFFRACTION' ? refined -50.4304 70.2280  -130.3838 0.1575 ? 0.0082 ? 0.0133 ? 0.1013 ? -0.0209 ? 0.1461 ? 1.9769 ? 0.2513 
? -0.2129 ? 1.5731 ? -0.4562 ? 1.8999 ? 0.0082  ? 0.0520  ? 0.0567  ? -0.0722 ? -0.0331 ? -0.0078 ? -0.0402 ? -0.1330 ? 0.0367 ? 
2 'X-RAY DIFFRACTION' ? refined -43.1834 103.2945 -156.9461 0.1787 ? 0.0180 ? 0.0093 ? 0.1434 ? -0.0204 ? 0.1532 ? 1.4160 ? 0.5686 
? 0.1351  ? 1.6233 ? -0.1727 ? 2.8851 ? -0.0093 ? -0.0571 ? -0.0493 ? 0.0327  ? -0.1001 ? 0.0261  ? 0.0458  ? -0.1730 ? 0.0881 ? 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? ? ? ? ? 
;chain 'A' or chain 'B'
;
2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? ? ? ? ? 
;chain 'C' or chain 'D'
;
# 
_software.citation_id            ? 
_software.classification         refinement 
_software.compiler_name          ? 
_software.compiler_version       ? 
_software.contact_author         ? 
_software.contact_author_email   ? 
_software.date                   ? 
_software.description            ? 
_software.dependencies           ? 
_software.hardware               ? 
_software.language               ? 
_software.location               ? 
_software.mods                   ? 
_software.name                   PHENIX 
_software.os                     ? 
_software.os_version             ? 
_software.type                   ? 
_software.version                '(phenix.refine: 1.9_1692)' 
_software.pdbx_ordinal           1 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   OD1 
_pdbx_validate_close_contact.auth_asym_id_1   C 
_pdbx_validate_close_contact.auth_comp_id_1   ASP 
_pdbx_validate_close_contact.auth_seq_id_1    17 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   OH 
_pdbx_validate_close_contact.auth_asym_id_2   C 
_pdbx_validate_close_contact.auth_comp_id_2   TYR 
_pdbx_validate_close_contact.auth_seq_id_2    161 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.18 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 PHE A 220 ? ? -121.10 -106.61 
2 1 PRO A 237 ? ? -78.14  -169.38 
3 1 LYS C 145 ? ? 79.87   -60.56  
4 1 PHE C 220 ? ? -123.42 -112.02 
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1 1 O ? A HOH 359 ? 5.89 . 
2 1 O ? A HOH 408 ? 5.82 . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A ALA 2   ? A ALA 2   
3  1 Y 1 A PRO 3   ? A PRO 3   
4  1 Y 1 A LEU 4   ? A LEU 4   
5  1 Y 1 A GLU 5   ? A GLU 5   
6  1 Y 1 A THR 6   ? A THR 6   
7  1 Y 1 A ILE 7   ? A ILE 7   
8  1 Y 1 A TYR 8   ? A TYR 8   
9  1 Y 1 A ASP 9   ? A ASP 9   
10 1 Y 1 A GLU 10  ? A GLU 10  
11 1 Y 1 A SER 11  ? A SER 11  
12 1 Y 1 A LEU 12  ? A LEU 12  
13 1 Y 1 A ASN 13  ? A ASN 13  
14 1 Y 1 A LYS 14  ? A LYS 14  
15 1 Y 1 A SER 15  ? A SER 15  
16 1 Y 1 A ALA 16  ? A ALA 16  
17 1 Y 1 A LYS 145 ? A LYS 145 
18 1 Y 1 A ASN 146 ? A ASN 146 
19 1 Y 1 A GLY 147 ? A GLY 147 
20 1 Y 1 A ASP 253 ? A ASP 253 
21 1 Y 1 B SER 485 ? B SER 1   
22 1 Y 1 B THR 486 ? B THR 2   
23 1 Y 1 B LYS 500 ? B LYS 16  
24 1 Y 1 B PRO 501 ? B PRO 17  
25 1 Y 1 C MET 1   ? C MET 1   
26 1 Y 1 C ALA 2   ? C ALA 2   
27 1 Y 1 C PRO 3   ? C PRO 3   
28 1 Y 1 C LEU 4   ? C LEU 4   
29 1 Y 1 C GLU 5   ? C GLU 5   
30 1 Y 1 C THR 6   ? C THR 6   
31 1 Y 1 C ILE 7   ? C ILE 7   
32 1 Y 1 C TYR 8   ? C TYR 8   
33 1 Y 1 C ASP 9   ? C ASP 9   
34 1 Y 1 C GLU 10  ? C GLU 10  
35 1 Y 1 C SER 11  ? C SER 11  
36 1 Y 1 C LEU 12  ? C LEU 12  
37 1 Y 1 C ASN 13  ? C ASN 13  
38 1 Y 1 C LYS 14  ? C LYS 14  
39 1 Y 1 C SER 15  ? C SER 15  
40 1 Y 1 C ASP 253 ? C ASP 253 
41 1 Y 1 D SER 485 ? D SER 1   
42 1 Y 1 D THR 486 ? D THR 2   
43 1 Y 1 D LYS 500 ? D LYS 16  
44 1 Y 1 D PRO 501 ? D PRO 17  
# 
_pdbx_audit_support.funding_organization   
'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 
_pdbx_audit_support.country                'United States' 
_pdbx_audit_support.grant_number           R01GM104141 
_pdbx_audit_support.ordinal                1 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#