data_4U6Q
# 
_entry.id   4U6Q 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4U6Q         
WWPDB D_1000202834 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 4U6S PDB . 
unspecified 4LCE PDB . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4U6Q 
_pdbx_database_status.recvd_initial_deposition_date   2014-07-29 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Hilbert, B.J.'   1 
'Morris, B.L.'    2 
'Ellis, K.C.'     3 
'Paulsen, J.L.'   4 
'Schiffer, C.A.'  5 
'Grossman, S.R.'  6 
'Royer Jr., W.E.' 7 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Acs Chem.Biol.' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1554-8937 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            10 
_citation.language                  ? 
_citation.page_first                1118 
_citation.page_last                 1127 
_citation.title                     'Structure-Guided Design of a High Affinity Inhibitor to Human CtBP.' 
_citation.year                      2015 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1021/cb500820b 
_citation.pdbx_database_id_PubMed   25636004 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Hilbert, B.J.'  1 
primary 'Morris, B.L.'   2 
primary 'Ellis, K.C.'    3 
primary 'Paulsen, J.L.'  4 
primary 'Schiffer, C.A.' 5 
primary 'Grossman, S.R.' 6 
primary 'Royer, W.E.'    7 
# 
_cell.entry_id           4U6Q 
_cell.length_a           84.000 
_cell.length_b           84.000 
_cell.length_c           159.472 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4U6Q 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                181 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 64 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'C-terminal-binding protein 1'                 38139.469 1   1.1.1.- ? 'NAD nucleotide binding residues 28-353' 
? 
2 non-polymer syn '1,4-DIHYDRONICOTINAMIDE ADENINE DINUCLEOTIDE' 665.441   1   ?       ? ?                                        
? 
3 non-polymer syn '(2E)-2-(hydroxyimino)-3-phenylpropanoic acid' 179.173   1   ?       ? ?                                        
? 
4 non-polymer syn 'CALCIUM ION'                                  40.078    1   ?       ? ?                                        
? 
5 non-polymer syn 'FORMIC ACID'                                  46.025    1   ?       ? ?                                        
? 
6 water       nat water                                          18.015    175 ?       ? ?                                        
? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        CtBP1 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGSSHHHHHHSSGLVPRGSHMPLVALLDGRDCTVEMPILKDVATVAFCDAQSTQEIHEKVLNEAVGALMYHTITLTREDL
EKFKALRIIVRIGSGFDNIDIKSAGDLGIAVCNVPAASVEETADSTLCHILNLYRRATWLHQALREGTRVQSVEQIREVA
SGAARIRGETLGIIGLGRVGQAVALRAKAFGFNVLFYDPYLSDGVERALGLQRVSTLQDLLFHSDCVTLHCGLNEHNHHL
INDFTVKQMRQGAFLVNTARGGLVDEKALAQALKEGRIRGAALDVHESEPFSFSQGPLKDAPNLICTPHAAWYSEQASIE
MREEAAREIRRAITGRIPDSLKNCVNK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGSSHHHHHHSSGLVPRGSHMPLVALLDGRDCTVEMPILKDVATVAFCDAQSTQEIHEKVLNEAVGALMYHTITLTREDL
EKFKALRIIVRIGSGFDNIDIKSAGDLGIAVCNVPAASVEETADSTLCHILNLYRRATWLHQALREGTRVQSVEQIREVA
SGAARIRGETLGIIGLGRVGQAVALRAKAFGFNVLFYDPYLSDGVERALGLQRVSTLQDLLFHSDCVTLHCGLNEHNHHL
INDFTVKQMRQGAFLVNTARGGLVDEKALAQALKEGRIRGAALDVHESEPFSFSQGPLKDAPNLICTPHAAWYSEQASIE
MREEAAREIRRAITGRIPDSLKNCVNK
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   SER n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  SER n 
1 12  SER n 
1 13  GLY n 
1 14  LEU n 
1 15  VAL n 
1 16  PRO n 
1 17  ARG n 
1 18  GLY n 
1 19  SER n 
1 20  HIS n 
1 21  MET n 
1 22  PRO n 
1 23  LEU n 
1 24  VAL n 
1 25  ALA n 
1 26  LEU n 
1 27  LEU n 
1 28  ASP n 
1 29  GLY n 
1 30  ARG n 
1 31  ASP n 
1 32  CYS n 
1 33  THR n 
1 34  VAL n 
1 35  GLU n 
1 36  MET n 
1 37  PRO n 
1 38  ILE n 
1 39  LEU n 
1 40  LYS n 
1 41  ASP n 
1 42  VAL n 
1 43  ALA n 
1 44  THR n 
1 45  VAL n 
1 46  ALA n 
1 47  PHE n 
1 48  CYS n 
1 49  ASP n 
1 50  ALA n 
1 51  GLN n 
1 52  SER n 
1 53  THR n 
1 54  GLN n 
1 55  GLU n 
1 56  ILE n 
1 57  HIS n 
1 58  GLU n 
1 59  LYS n 
1 60  VAL n 
1 61  LEU n 
1 62  ASN n 
1 63  GLU n 
1 64  ALA n 
1 65  VAL n 
1 66  GLY n 
1 67  ALA n 
1 68  LEU n 
1 69  MET n 
1 70  TYR n 
1 71  HIS n 
1 72  THR n 
1 73  ILE n 
1 74  THR n 
1 75  LEU n 
1 76  THR n 
1 77  ARG n 
1 78  GLU n 
1 79  ASP n 
1 80  LEU n 
1 81  GLU n 
1 82  LYS n 
1 83  PHE n 
1 84  LYS n 
1 85  ALA n 
1 86  LEU n 
1 87  ARG n 
1 88  ILE n 
1 89  ILE n 
1 90  VAL n 
1 91  ARG n 
1 92  ILE n 
1 93  GLY n 
1 94  SER n 
1 95  GLY n 
1 96  PHE n 
1 97  ASP n 
1 98  ASN n 
1 99  ILE n 
1 100 ASP n 
1 101 ILE n 
1 102 LYS n 
1 103 SER n 
1 104 ALA n 
1 105 GLY n 
1 106 ASP n 
1 107 LEU n 
1 108 GLY n 
1 109 ILE n 
1 110 ALA n 
1 111 VAL n 
1 112 CYS n 
1 113 ASN n 
1 114 VAL n 
1 115 PRO n 
1 116 ALA n 
1 117 ALA n 
1 118 SER n 
1 119 VAL n 
1 120 GLU n 
1 121 GLU n 
1 122 THR n 
1 123 ALA n 
1 124 ASP n 
1 125 SER n 
1 126 THR n 
1 127 LEU n 
1 128 CYS n 
1 129 HIS n 
1 130 ILE n 
1 131 LEU n 
1 132 ASN n 
1 133 LEU n 
1 134 TYR n 
1 135 ARG n 
1 136 ARG n 
1 137 ALA n 
1 138 THR n 
1 139 TRP n 
1 140 LEU n 
1 141 HIS n 
1 142 GLN n 
1 143 ALA n 
1 144 LEU n 
1 145 ARG n 
1 146 GLU n 
1 147 GLY n 
1 148 THR n 
1 149 ARG n 
1 150 VAL n 
1 151 GLN n 
1 152 SER n 
1 153 VAL n 
1 154 GLU n 
1 155 GLN n 
1 156 ILE n 
1 157 ARG n 
1 158 GLU n 
1 159 VAL n 
1 160 ALA n 
1 161 SER n 
1 162 GLY n 
1 163 ALA n 
1 164 ALA n 
1 165 ARG n 
1 166 ILE n 
1 167 ARG n 
1 168 GLY n 
1 169 GLU n 
1 170 THR n 
1 171 LEU n 
1 172 GLY n 
1 173 ILE n 
1 174 ILE n 
1 175 GLY n 
1 176 LEU n 
1 177 GLY n 
1 178 ARG n 
1 179 VAL n 
1 180 GLY n 
1 181 GLN n 
1 182 ALA n 
1 183 VAL n 
1 184 ALA n 
1 185 LEU n 
1 186 ARG n 
1 187 ALA n 
1 188 LYS n 
1 189 ALA n 
1 190 PHE n 
1 191 GLY n 
1 192 PHE n 
1 193 ASN n 
1 194 VAL n 
1 195 LEU n 
1 196 PHE n 
1 197 TYR n 
1 198 ASP n 
1 199 PRO n 
1 200 TYR n 
1 201 LEU n 
1 202 SER n 
1 203 ASP n 
1 204 GLY n 
1 205 VAL n 
1 206 GLU n 
1 207 ARG n 
1 208 ALA n 
1 209 LEU n 
1 210 GLY n 
1 211 LEU n 
1 212 GLN n 
1 213 ARG n 
1 214 VAL n 
1 215 SER n 
1 216 THR n 
1 217 LEU n 
1 218 GLN n 
1 219 ASP n 
1 220 LEU n 
1 221 LEU n 
1 222 PHE n 
1 223 HIS n 
1 224 SER n 
1 225 ASP n 
1 226 CYS n 
1 227 VAL n 
1 228 THR n 
1 229 LEU n 
1 230 HIS n 
1 231 CYS n 
1 232 GLY n 
1 233 LEU n 
1 234 ASN n 
1 235 GLU n 
1 236 HIS n 
1 237 ASN n 
1 238 HIS n 
1 239 HIS n 
1 240 LEU n 
1 241 ILE n 
1 242 ASN n 
1 243 ASP n 
1 244 PHE n 
1 245 THR n 
1 246 VAL n 
1 247 LYS n 
1 248 GLN n 
1 249 MET n 
1 250 ARG n 
1 251 GLN n 
1 252 GLY n 
1 253 ALA n 
1 254 PHE n 
1 255 LEU n 
1 256 VAL n 
1 257 ASN n 
1 258 THR n 
1 259 ALA n 
1 260 ARG n 
1 261 GLY n 
1 262 GLY n 
1 263 LEU n 
1 264 VAL n 
1 265 ASP n 
1 266 GLU n 
1 267 LYS n 
1 268 ALA n 
1 269 LEU n 
1 270 ALA n 
1 271 GLN n 
1 272 ALA n 
1 273 LEU n 
1 274 LYS n 
1 275 GLU n 
1 276 GLY n 
1 277 ARG n 
1 278 ILE n 
1 279 ARG n 
1 280 GLY n 
1 281 ALA n 
1 282 ALA n 
1 283 LEU n 
1 284 ASP n 
1 285 VAL n 
1 286 HIS n 
1 287 GLU n 
1 288 SER n 
1 289 GLU n 
1 290 PRO n 
1 291 PHE n 
1 292 SER n 
1 293 PHE n 
1 294 SER n 
1 295 GLN n 
1 296 GLY n 
1 297 PRO n 
1 298 LEU n 
1 299 LYS n 
1 300 ASP n 
1 301 ALA n 
1 302 PRO n 
1 303 ASN n 
1 304 LEU n 
1 305 ILE n 
1 306 CYS n 
1 307 THR n 
1 308 PRO n 
1 309 HIS n 
1 310 ALA n 
1 311 ALA n 
1 312 TRP n 
1 313 TYR n 
1 314 SER n 
1 315 GLU n 
1 316 GLN n 
1 317 ALA n 
1 318 SER n 
1 319 ILE n 
1 320 GLU n 
1 321 MET n 
1 322 ARG n 
1 323 GLU n 
1 324 GLU n 
1 325 ALA n 
1 326 ALA n 
1 327 ARG n 
1 328 GLU n 
1 329 ILE n 
1 330 ARG n 
1 331 ARG n 
1 332 ALA n 
1 333 ILE n 
1 334 THR n 
1 335 GLY n 
1 336 ARG n 
1 337 ILE n 
1 338 PRO n 
1 339 ASP n 
1 340 SER n 
1 341 LEU n 
1 342 LYS n 
1 343 ASN n 
1 344 CYS n 
1 345 VAL n 
1 346 ASN n 
1 347 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   347 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'CTBP1, CTBP' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21-DE3 
_entity_src_gen.pdbx_host_org_variant              RIL+ 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pet28a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CTBP1_HUMAN 
_struct_ref.pdbx_db_accession          Q13363 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;PLVALLDGRDCTVEMPILKDVATVAFCDAQSTQEIHEKVLNEAVGALMYHTITLTREDLEKFKALRIIVRIGSGFDNIDI
KSAGDLGIAVCNVPAASVEETADSTLCHILNLYRRATWLHQALREGTRVQSVEQIREVASGAARIRGETLGIIGLGRVGQ
AVALRAKAFGFNVLFYDPYLSDGVERALGLQRVSTLQDLLFHSDCVTLHCGLNEHNHHLINDFTVKQMRQGAFLVNTARG
GLVDEKALAQALKEGRIRGAALDVHESEPFSFSQGPLKDAPNLICTPHAAWYSEQASIEMREEAAREIRRAITGRIPDSL
KNCVNK
;
_struct_ref.pdbx_align_begin           28 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              4U6Q 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 22 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 347 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q13363 
_struct_ref_seq.db_align_beg                  28 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  353 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       28 
_struct_ref_seq.pdbx_auth_seq_align_end       353 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4U6Q MET A 1  ? UNP Q13363 ? ? 'expression tag' 7  1  
1 4U6Q GLY A 2  ? UNP Q13363 ? ? 'expression tag' 8  2  
1 4U6Q SER A 3  ? UNP Q13363 ? ? 'expression tag' 9  3  
1 4U6Q SER A 4  ? UNP Q13363 ? ? 'expression tag' 10 4  
1 4U6Q HIS A 5  ? UNP Q13363 ? ? 'expression tag' 11 5  
1 4U6Q HIS A 6  ? UNP Q13363 ? ? 'expression tag' 12 6  
1 4U6Q HIS A 7  ? UNP Q13363 ? ? 'expression tag' 13 7  
1 4U6Q HIS A 8  ? UNP Q13363 ? ? 'expression tag' 14 8  
1 4U6Q HIS A 9  ? UNP Q13363 ? ? 'expression tag' 15 9  
1 4U6Q HIS A 10 ? UNP Q13363 ? ? 'expression tag' 16 10 
1 4U6Q SER A 11 ? UNP Q13363 ? ? 'expression tag' 17 11 
1 4U6Q SER A 12 ? UNP Q13363 ? ? 'expression tag' 18 12 
1 4U6Q GLY A 13 ? UNP Q13363 ? ? 'expression tag' 19 13 
1 4U6Q LEU A 14 ? UNP Q13363 ? ? 'expression tag' 20 14 
1 4U6Q VAL A 15 ? UNP Q13363 ? ? 'expression tag' 21 15 
1 4U6Q PRO A 16 ? UNP Q13363 ? ? 'expression tag' 22 16 
1 4U6Q ARG A 17 ? UNP Q13363 ? ? 'expression tag' 23 17 
1 4U6Q GLY A 18 ? UNP Q13363 ? ? 'expression tag' 24 18 
1 4U6Q SER A 19 ? UNP Q13363 ? ? 'expression tag' 25 19 
1 4U6Q HIS A 20 ? UNP Q13363 ? ? 'expression tag' 26 20 
1 4U6Q MET A 21 ? UNP Q13363 ? ? 'expression tag' 27 21 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
3CR non-polymer         . '(2E)-2-(hydroxyimino)-3-phenylpropanoic acid' ?    'C9 H9 N O3'        179.173 
ALA 'L-peptide linking' y ALANINE                                        ?    'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                       ?    'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                     ?    'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                ?    'C4 H7 N O4'        133.103 
CA  non-polymer         . 'CALCIUM ION'                                  ?    'Ca 2'              40.078  
CYS 'L-peptide linking' y CYSTEINE                                       ?    'C3 H7 N O2 S'      121.158 
FMT non-polymer         . 'FORMIC ACID'                                  ?    'C H2 O2'           46.025  
GLN 'L-peptide linking' y GLUTAMINE                                      ?    'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                ?    'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                        ?    'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                      ?    'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                          ?    'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                     ?    'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                        ?    'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                         ?    'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                     ?    'C5 H11 N O2 S'     149.211 
NAI non-polymer         . '1,4-DIHYDRONICOTINAMIDE ADENINE DINUCLEOTIDE' NADH 'C21 H29 N7 O14 P2' 665.441 
PHE 'L-peptide linking' y PHENYLALANINE                                  ?    'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                        ?    'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                         ?    'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                      ?    'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                     ?    'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                       ?    'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                         ?    'C5 H11 N O2'       117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4U6Q 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.3 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         42.23 
_exptl_crystal.description                 'bi-pyramidal crystal' 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '75 mM CaCl2, 100 mM Hepes pH 7.5, and 1 mM NADH' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'RIGAKU SATURN 944' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2013-10-21 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.99 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.target                      ? 
_diffrn_source.type                        'RIGAKU MICROMAX-007 HF' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.99 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_synchrotron_site       ? 
# 
_reflns.B_iso_Wilson_estimate            39.34 
_reflns.entry_id                         4U6Q 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.3 
_reflns.d_resolution_low                 30.0 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       15487 
_reflns.number_obs                       15450 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.66 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  18.1 
_reflns.pdbx_Rmerge_I_obs                0.059 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            31.3 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.3 
_reflns_shell.d_res_low                   2.34 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         5.48 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        99.3 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.491 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             12.4 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               42.80 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 4U6Q 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.3 
_refine.ls_d_res_low                             30.0 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     15450 
_refine.ls_number_reflns_R_free                  771 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.66 
_refine.ls_percent_reflns_R_free                 4.99 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2063 
_refine.ls_R_factor_R_free                       0.2486 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2042 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.33 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4LCE 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            'Random selection' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 24.72 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.22 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2444 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         61 
_refine_hist.number_atoms_solvent             175 
_refine_hist.number_atoms_total               2680 
_refine_hist.d_res_high                       2.3 
_refine_hist.d_res_low                        30.0 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.004  ? 2554 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.836  ? 3475 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 16.214 ? 917  ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.045  ? 411  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.003  ? 447  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
'X-RAY DIFFRACTION' 2.3    2.4429  . . 125 2382 100.00 . . . 0.2918 . 0.2476 . . . . . . . . 
'X-RAY DIFFRACTION' 2.4429 2.6314  . . 113 2401 100.00 . . . 0.2744 . 0.2424 . . . . . . . . 
'X-RAY DIFFRACTION' 2.6314 2.8960  . . 141 2385 100.00 . . . 0.2973 . 0.2356 . . . . . . . . 
'X-RAY DIFFRACTION' 2.8960 3.3146  . . 129 2412 100.00 . . . 0.3281 . 0.2178 . . . . . . . . 
'X-RAY DIFFRACTION' 3.3146 4.1743  . . 127 2464 100.00 . . . 0.2029 . 0.1834 . . . . . . . . 
'X-RAY DIFFRACTION' 4.1743 30.0209 . . 136 2635 100.00 . . . 0.2192 . 0.1895 . . . . . . . . 
# 
_struct.entry_id                     4U6Q 
_struct.title                        'CtBP1 bound to inhibitor 2-(hydroxyimino)-3-phenylpropanoic acid' 
_struct.pdbx_descriptor              'Human C-terminal binding protein 1 (E.C.1.1.1.-)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4U6Q 
_struct_keywords.text            'Rossman fold, transcription regulator, cancer, inhibitor, OXIDOREDUCTASE' 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLU A 35  ? LYS A 40  ? GLU A 41  LYS A 46  1 ? 6  
HELX_P HELX_P2  AA2 SER A 52  ? ILE A 56  ? SER A 58  ILE A 62  5 ? 5  
HELX_P HELX_P3  AA3 HIS A 57  ? GLU A 63  ? HIS A 63  GLU A 69  1 ? 7  
HELX_P HELX_P4  AA4 THR A 76  ? LYS A 82  ? THR A 82  LYS A 88  1 ? 7  
HELX_P HELX_P5  AA5 ASP A 100 ? LEU A 107 ? ASP A 106 LEU A 113 1 ? 8  
HELX_P HELX_P6  AA6 SER A 118 ? ARG A 136 ? SER A 124 ARG A 142 1 ? 19 
HELX_P HELX_P7  AA7 ARG A 136 ? GLY A 147 ? ARG A 142 GLY A 153 1 ? 12 
HELX_P HELX_P8  AA8 SER A 152 ? ALA A 160 ? SER A 158 ALA A 166 1 ? 9  
HELX_P HELX_P9  AA9 GLY A 177 ? ALA A 189 ? GLY A 183 ALA A 195 1 ? 13 
HELX_P HELX_P10 AB1 GLY A 204 ? LEU A 209 ? GLY A 210 LEU A 215 1 ? 6  
HELX_P HELX_P11 AB2 THR A 216 ? SER A 224 ? THR A 222 SER A 230 1 ? 9  
HELX_P HELX_P12 AB3 ASN A 242 ? GLN A 248 ? ASN A 248 GLN A 254 1 ? 7  
HELX_P HELX_P13 AB4 ARG A 260 ? VAL A 264 ? ARG A 266 VAL A 270 5 ? 5  
HELX_P HELX_P14 AB5 ASP A 265 ? GLU A 275 ? ASP A 271 GLU A 281 1 ? 11 
HELX_P HELX_P15 AB6 SER A 314 ? GLY A 335 ? SER A 320 GLY A 341 1 ? 22 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? D CA . CA ? ? ? 1_555 E FMT . O2 ? ? A CA 403 A FMT 404 1_555 ? ? ? ? ? ? ? 2.525 ? 
metalc2 metalc ? ? D CA . CA ? ? ? 1_555 F HOH . O  ? ? A CA 403 A HOH 590 1_555 ? ? ? ? ? ? ? 2.284 ? 
metalc3 metalc ? ? D CA . CA ? ? ? 1_555 E FMT . O1 ? ? A CA 403 A FMT 404 1_555 ? ? ? ? ? ? ? 2.780 ? 
metalc4 metalc ? ? D CA . CA ? ? ? 1_555 F HOH . O  ? ? A CA 403 A HOH 581 1_555 ? ? ? ? ? ? ? 2.729 ? 
metalc5 metalc ? ? D CA . CA ? ? ? 1_555 F HOH . O  ? ? A CA 403 A HOH 620 1_555 ? ? ? ? ? ? ? 2.747 ? 
metalc6 metalc ? ? D CA . CA ? ? ? 1_555 F HOH . O  ? ? A CA 403 A HOH 626 1_555 ? ? ? ? ? ? ? 2.620 ? 
metalc7 metalc ? ? D CA . CA ? ? ? 1_555 F HOH . O  ? ? A CA 403 A HOH 664 1_555 ? ? ? ? ? ? ? 2.303 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 289 A . ? GLU 295 A PRO 290 A ? PRO 296 A 1 4.44  
2 ILE 337 A . ? ILE 343 A PRO 338 A ? PRO 344 A 1 -4.12 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5 ? 
AA2 ? 7 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel 
AA1 2 3 ? parallel 
AA1 3 4 ? parallel 
AA1 4 5 ? parallel 
AA2 1 2 ? parallel 
AA2 2 3 ? parallel 
AA2 3 4 ? parallel 
AA2 4 5 ? parallel 
AA2 5 6 ? parallel 
AA2 6 7 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 THR A 44  ? PHE A 47  ? THR A 50  PHE A 53  
AA1 2 LEU A 23  ? LEU A 26  ? LEU A 29  LEU A 32  
AA1 3 ALA A 64  ? MET A 69  ? ALA A 70  MET A 75  
AA1 4 ILE A 88  ? ARG A 91  ? ILE A 94  ARG A 97  
AA1 5 ALA A 110 ? CYS A 112 ? ALA A 116 CYS A 118 
AA2 1 GLN A 212 ? ARG A 213 ? GLN A 218 ARG A 219 
AA2 2 ASN A 193 ? TYR A 197 ? ASN A 199 TYR A 203 
AA2 3 THR A 170 ? ILE A 174 ? THR A 176 ILE A 180 
AA2 4 CYS A 226 ? LEU A 229 ? CYS A 232 LEU A 235 
AA2 5 ALA A 253 ? ASN A 257 ? ALA A 259 ASN A 263 
AA2 6 ILE A 278 ? LEU A 283 ? ILE A 284 LEU A 289 
AA2 7 LEU A 304 ? CYS A 306 ? LEU A 310 CYS A 312 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O THR A 44  ? O THR A 50  N VAL A 24  ? N VAL A 30  
AA1 2 3 N ALA A 25  ? N ALA A 31  O LEU A 68  ? O LEU A 74  
AA1 3 4 N ALA A 67  ? N ALA A 73  O VAL A 90  ? O VAL A 96  
AA1 4 5 N ARG A 91  ? N ARG A 97  O CYS A 112 ? O CYS A 118 
AA2 1 2 O GLN A 212 ? O GLN A 218 N VAL A 194 ? N VAL A 200 
AA2 2 3 O LEU A 195 ? O LEU A 201 N LEU A 171 ? N LEU A 177 
AA2 3 4 N GLY A 172 ? N GLY A 178 O CYS A 226 ? O CYS A 232 
AA2 4 5 N VAL A 227 ? N VAL A 233 O VAL A 256 ? O VAL A 262 
AA2 5 6 N LEU A 255 ? N LEU A 261 O ALA A 282 ? O ALA A 288 
AA2 6 7 N ALA A 281 ? N ALA A 287 O ILE A 305 ? O ILE A 311 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A NAI 401 ? 29 'binding site for residue NAI A 401' 
AC2 Software A 3CR 402 ? 12 'binding site for residue 3CR A 402' 
AC3 Software A CA  403 ? 6  'binding site for residue CA A 403'  
AC4 Software A FMT 404 ? 4  'binding site for residue FMT A 404' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 29 SER A 94  ? SER A 100 . ? 1_555 ? 
2  AC1 29 GLY A 95  ? GLY A 101 . ? 1_555 ? 
3  AC1 29 THR A 122 ? THR A 128 . ? 1_555 ? 
4  AC1 29 GLY A 175 ? GLY A 181 . ? 1_555 ? 
5  AC1 29 GLY A 177 ? GLY A 183 . ? 1_555 ? 
6  AC1 29 ARG A 178 ? ARG A 184 . ? 1_555 ? 
7  AC1 29 VAL A 179 ? VAL A 185 . ? 1_555 ? 
8  AC1 29 TYR A 197 ? TYR A 203 . ? 1_555 ? 
9  AC1 29 ASP A 198 ? ASP A 204 . ? 1_555 ? 
10 AC1 29 PRO A 199 ? PRO A 205 . ? 1_555 ? 
11 AC1 29 TYR A 200 ? TYR A 206 . ? 1_555 ? 
12 AC1 29 HIS A 230 ? HIS A 236 . ? 1_555 ? 
13 AC1 29 CYS A 231 ? CYS A 237 . ? 1_555 ? 
14 AC1 29 GLY A 232 ? GLY A 238 . ? 1_555 ? 
15 AC1 29 ASN A 234 ? ASN A 240 . ? 1_555 ? 
16 AC1 29 ASN A 237 ? ASN A 243 . ? 1_555 ? 
17 AC1 29 THR A 258 ? THR A 264 . ? 1_555 ? 
18 AC1 29 ALA A 259 ? ALA A 265 . ? 1_555 ? 
19 AC1 29 ARG A 260 ? ARG A 266 . ? 1_555 ? 
20 AC1 29 ASP A 284 ? ASP A 290 . ? 1_555 ? 
21 AC1 29 HIS A 309 ? HIS A 315 . ? 1_555 ? 
22 AC1 29 TRP A 312 ? TRP A 318 . ? 1_555 ? 
23 AC1 29 3CR C .   ? 3CR A 402 . ? 1_555 ? 
24 AC1 29 HOH F .   ? HOH A 516 . ? 1_555 ? 
25 AC1 29 HOH F .   ? HOH A 575 . ? 1_555 ? 
26 AC1 29 HOH F .   ? HOH A 579 . ? 1_555 ? 
27 AC1 29 HOH F .   ? HOH A 588 . ? 1_555 ? 
28 AC1 29 HOH F .   ? HOH A 661 . ? 1_555 ? 
29 AC1 29 HOH F .   ? HOH A 675 . ? 1_555 ? 
30 AC2 12 TYR A 70  ? TYR A 76  . ? 1_555 ? 
31 AC2 12 ARG A 91  ? ARG A 97  . ? 1_555 ? 
32 AC2 12 ILE A 92  ? ILE A 98  . ? 1_555 ? 
33 AC2 12 GLY A 93  ? GLY A 99  . ? 1_555 ? 
34 AC2 12 SER A 94  ? SER A 100 . ? 1_555 ? 
35 AC2 12 GLY A 95  ? GLY A 101 . ? 1_555 ? 
36 AC2 12 ARG A 260 ? ARG A 266 . ? 1_555 ? 
37 AC2 12 HIS A 309 ? HIS A 315 . ? 1_555 ? 
38 AC2 12 TRP A 312 ? TRP A 318 . ? 1_555 ? 
39 AC2 12 MET A 321 ? MET A 327 . ? 1_555 ? 
40 AC2 12 NAI B .   ? NAI A 401 . ? 1_555 ? 
41 AC2 12 HOH F .   ? HOH A 674 . ? 1_555 ? 
42 AC3 6  FMT E .   ? FMT A 404 . ? 1_555 ? 
43 AC3 6  HOH F .   ? HOH A 581 . ? 1_555 ? 
44 AC3 6  HOH F .   ? HOH A 590 . ? 1_555 ? 
45 AC3 6  HOH F .   ? HOH A 620 . ? 1_555 ? 
46 AC3 6  HOH F .   ? HOH A 626 . ? 1_555 ? 
47 AC3 6  HOH F .   ? HOH A 664 . ? 1_555 ? 
48 AC4 4  GLU A 169 ? GLU A 175 . ? 1_555 ? 
49 AC4 4  GLY A 252 ? GLY A 258 . ? 1_555 ? 
50 AC4 4  ARG A 279 ? ARG A 285 . ? 1_555 ? 
51 AC4 4  CA  D .   ? CA  A 403 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4U6Q 
_atom_sites.fract_transf_matrix[1][1]   0.011905 
_atom_sites.fract_transf_matrix[1][2]   0.006873 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013746 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006271 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . HIS A 1 20  ? 13.088  9.958  5.842   1.00 59.17 ? 26  HIS A N   1 
ATOM   2    C  CA  . HIS A 1 20  ? 13.178  9.975  4.387   1.00 63.95 ? 26  HIS A CA  1 
ATOM   3    C  C   . HIS A 1 20  ? 12.560  11.246 3.816   1.00 64.56 ? 26  HIS A C   1 
ATOM   4    O  O   . HIS A 1 20  ? 11.341  11.347 3.671   1.00 65.94 ? 26  HIS A O   1 
ATOM   5    C  CB  . HIS A 1 20  ? 12.491  8.744  3.791   1.00 67.46 ? 26  HIS A CB  1 
ATOM   6    N  N   . MET A 1 21  ? 13.412  12.215 3.499   1.00 54.30 ? 27  MET A N   1 
ATOM   7    C  CA  . MET A 1 21  ? 12.971  13.481 2.930   1.00 55.12 ? 27  MET A CA  1 
ATOM   8    C  C   . MET A 1 21  ? 13.690  13.709 1.605   1.00 57.07 ? 27  MET A C   1 
ATOM   9    O  O   . MET A 1 21  ? 14.702  14.407 1.557   1.00 58.91 ? 27  MET A O   1 
ATOM   10   C  CB  . MET A 1 21  ? 13.272  14.631 3.894   1.00 56.89 ? 27  MET A CB  1 
ATOM   11   C  CG  . MET A 1 21  ? 12.441  14.607 5.172   1.00 58.46 ? 27  MET A CG  1 
ATOM   12   S  SD  . MET A 1 21  ? 10.749  15.198 4.944   1.00 55.42 ? 27  MET A SD  1 
ATOM   13   C  CE  . MET A 1 21  ? 11.007  16.941 4.617   1.00 50.07 ? 27  MET A CE  1 
ATOM   14   N  N   . PRO A 1 22  ? 13.166  13.117 0.521   1.00 53.33 ? 28  PRO A N   1 
ATOM   15   C  CA  . PRO A 1 22  ? 13.852  13.165 -0.775  1.00 52.73 ? 28  PRO A CA  1 
ATOM   16   C  C   . PRO A 1 22  ? 14.089  14.588 -1.276  1.00 49.79 ? 28  PRO A C   1 
ATOM   17   O  O   . PRO A 1 22  ? 13.343  15.503 -0.929  1.00 47.47 ? 28  PRO A O   1 
ATOM   18   C  CB  . PRO A 1 22  ? 12.897  12.411 -1.708  1.00 48.31 ? 28  PRO A CB  1 
ATOM   19   C  CG  . PRO A 1 22  ? 11.572  12.481 -1.045  1.00 52.62 ? 28  PRO A CG  1 
ATOM   20   C  CD  . PRO A 1 22  ? 11.853  12.459 0.424   1.00 48.54 ? 28  PRO A CD  1 
ATOM   21   N  N   . LEU A 1 23  ? 15.123  14.758 -2.094  1.00 44.97 ? 29  LEU A N   1 
ATOM   22   C  CA  . LEU A 1 23  ? 15.517  16.075 -2.583  1.00 51.23 ? 29  LEU A CA  1 
ATOM   23   C  C   . LEU A 1 23  ? 14.687  16.504 -3.792  1.00 43.35 ? 29  LEU A C   1 
ATOM   24   O  O   . LEU A 1 23  ? 14.590  15.779 -4.782  1.00 41.75 ? 29  LEU A O   1 
ATOM   25   C  CB  . LEU A 1 23  ? 17.004  16.064 -2.952  1.00 45.01 ? 29  LEU A CB  1 
ATOM   26   C  CG  . LEU A 1 23  ? 17.590  17.350 -3.538  1.00 46.20 ? 29  LEU A CG  1 
ATOM   27   C  CD1 . LEU A 1 23  ? 17.488  18.492 -2.543  1.00 44.59 ? 29  LEU A CD1 1 
ATOM   28   C  CD2 . LEU A 1 23  ? 19.036  17.135 -3.962  1.00 52.03 ? 29  LEU A CD2 1 
ATOM   29   N  N   . VAL A 1 24  ? 14.087  17.686 -3.700  1.00 46.96 ? 30  VAL A N   1 
ATOM   30   C  CA  . VAL A 1 24  ? 13.369  18.282 -4.822  1.00 42.38 ? 30  VAL A CA  1 
ATOM   31   C  C   . VAL A 1 24  ? 14.051  19.599 -5.175  1.00 40.94 ? 30  VAL A C   1 
ATOM   32   O  O   . VAL A 1 24  ? 14.224  20.464 -4.316  1.00 40.69 ? 30  VAL A O   1 
ATOM   33   C  CB  . VAL A 1 24  ? 11.885  18.537 -4.484  1.00 43.33 ? 30  VAL A CB  1 
ATOM   34   C  CG1 . VAL A 1 24  ? 11.183  19.249 -5.633  1.00 44.78 ? 30  VAL A CG1 1 
ATOM   35   C  CG2 . VAL A 1 24  ? 11.181  17.229 -4.164  1.00 33.04 ? 30  VAL A CG2 1 
ATOM   36   N  N   . ALA A 1 25  ? 14.441  19.747 -6.438  1.00 42.57 ? 31  ALA A N   1 
ATOM   37   C  CA  . ALA A 1 25  ? 15.268  20.876 -6.851  1.00 44.42 ? 31  ALA A CA  1 
ATOM   38   C  C   . ALA A 1 25  ? 14.588  21.769 -7.886  1.00 40.76 ? 31  ALA A C   1 
ATOM   39   O  O   . ALA A 1 25  ? 14.107  21.292 -8.914  1.00 38.85 ? 31  ALA A O   1 
ATOM   40   C  CB  . ALA A 1 25  ? 16.590  20.368 -7.401  1.00 43.62 ? 31  ALA A CB  1 
ATOM   41   N  N   . LEU A 1 26  ? 14.562  23.069 -7.606  1.00 43.00 ? 32  LEU A N   1 
ATOM   42   C  CA  . LEU A 1 26  ? 14.160  24.061 -8.596  1.00 41.65 ? 32  LEU A CA  1 
ATOM   43   C  C   . LEU A 1 26  ? 15.393  24.457 -9.399  1.00 45.87 ? 32  LEU A C   1 
ATOM   44   O  O   . LEU A 1 26  ? 16.307  25.094 -8.873  1.00 45.75 ? 32  LEU A O   1 
ATOM   45   C  CB  . LEU A 1 26  ? 13.552  25.290 -7.919  1.00 42.29 ? 32  LEU A CB  1 
ATOM   46   C  CG  . LEU A 1 26  ? 13.326  26.508 -8.820  1.00 44.35 ? 32  LEU A CG  1 
ATOM   47   C  CD1 . LEU A 1 26  ? 12.226  26.232 -9.831  1.00 40.29 ? 32  LEU A CD1 1 
ATOM   48   C  CD2 . LEU A 1 26  ? 13.006  27.741 -7.987  1.00 39.26 ? 32  LEU A CD2 1 
ATOM   49   N  N   . LEU A 1 27  ? 15.417  24.083 -10.672 1.00 44.47 ? 33  LEU A N   1 
ATOM   50   C  CA  . LEU A 1 27  ? 16.629  24.202 -11.473 1.00 45.00 ? 33  LEU A CA  1 
ATOM   51   C  C   . LEU A 1 27  ? 16.919  25.644 -11.876 1.00 50.24 ? 33  LEU A C   1 
ATOM   52   O  O   . LEU A 1 27  ? 17.943  26.209 -11.490 1.00 46.83 ? 33  LEU A O   1 
ATOM   53   C  CB  . LEU A 1 27  ? 16.521  23.318 -12.717 1.00 39.85 ? 33  LEU A CB  1 
ATOM   54   C  CG  . LEU A 1 27  ? 16.070  21.884 -12.431 1.00 40.07 ? 33  LEU A CG  1 
ATOM   55   C  CD1 . LEU A 1 27  ? 16.118  21.030 -13.685 1.00 38.29 ? 33  LEU A CD1 1 
ATOM   56   C  CD2 . LEU A 1 27  ? 16.915  21.274 -11.327 1.00 45.38 ? 33  LEU A CD2 1 
ATOM   57   N  N   . ASP A 1 28  ? 16.014  26.236 -12.647 1.00 43.40 ? 34  ASP A N   1 
ATOM   58   C  CA  . ASP A 1 28  ? 16.233  27.576 -13.177 1.00 47.39 ? 34  ASP A CA  1 
ATOM   59   C  C   . ASP A 1 28  ? 15.438  28.634 -12.422 1.00 47.99 ? 34  ASP A C   1 
ATOM   60   O  O   . ASP A 1 28  ? 14.698  29.415 -13.022 1.00 47.81 ? 34  ASP A O   1 
ATOM   61   C  CB  . ASP A 1 28  ? 15.871  27.618 -14.659 1.00 45.86 ? 34  ASP A CB  1 
ATOM   62   C  CG  . ASP A 1 28  ? 14.460  27.141 -14.926 1.00 48.90 ? 34  ASP A CG  1 
ATOM   63   O  OD1 . ASP A 1 28  ? 13.893  26.442 -14.058 1.00 48.13 ? 34  ASP A OD1 1 
ATOM   64   O  OD2 . ASP A 1 28  ? 13.917  27.458 -16.007 1.00 44.64 ? 34  ASP A OD2 1 
ATOM   65   N  N   . GLY A 1 29  ? 15.602  28.659 -11.103 1.00 44.83 ? 35  GLY A N   1 
ATOM   66   C  CA  . GLY A 1 29  ? 14.960  29.658 -10.271 1.00 45.13 ? 35  GLY A CA  1 
ATOM   67   C  C   . GLY A 1 29  ? 15.647  29.769 -8.925  1.00 45.35 ? 35  GLY A C   1 
ATOM   68   O  O   . GLY A 1 29  ? 16.459  28.917 -8.568  1.00 48.23 ? 35  GLY A O   1 
ATOM   69   N  N   . ARG A 1 30  ? 15.325  30.820 -8.177  1.00 51.71 ? 36  ARG A N   1 
ATOM   70   C  CA  . ARG A 1 30  ? 15.933  31.041 -6.869  1.00 49.90 ? 36  ARG A CA  1 
ATOM   71   C  C   . ARG A 1 30  ? 14.903  31.144 -5.742  1.00 54.71 ? 36  ARG A C   1 
ATOM   72   O  O   . ARG A 1 30  ? 15.268  31.174 -4.566  1.00 66.25 ? 36  ARG A O   1 
ATOM   73   C  CB  . ARG A 1 30  ? 16.788  32.311 -6.895  1.00 52.27 ? 36  ARG A CB  1 
ATOM   74   N  N   . ASP A 1 31  ? 13.624  31.195 -6.100  1.00 42.35 ? 37  ASP A N   1 
ATOM   75   C  CA  . ASP A 1 31  ? 12.558  31.345 -5.115  1.00 48.68 ? 37  ASP A CA  1 
ATOM   76   C  C   . ASP A 1 31  ? 11.693  30.088 -5.077  1.00 45.33 ? 37  ASP A C   1 
ATOM   77   O  O   . ASP A 1 31  ? 11.253  29.595 -6.116  1.00 40.27 ? 37  ASP A O   1 
ATOM   78   C  CB  . ASP A 1 31  ? 11.714  32.578 -5.450  1.00 41.88 ? 37  ASP A CB  1 
ATOM   79   C  CG  . ASP A 1 31  ? 10.618  32.838 -4.436  1.00 43.83 ? 37  ASP A CG  1 
ATOM   80   O  OD1 . ASP A 1 31  ? 9.933   31.877 -4.028  1.00 48.22 ? 37  ASP A OD1 1 
ATOM   81   O  OD2 . ASP A 1 31  ? 10.440  34.010 -4.047  1.00 47.92 ? 37  ASP A OD2 1 
ATOM   82   N  N   . CYS A 1 32  ? 11.461  29.570 -3.874  1.00 42.62 ? 38  CYS A N   1 
ATOM   83   C  CA  . CYS A 1 32  ? 10.657  28.366 -3.697  1.00 39.27 ? 38  CYS A CA  1 
ATOM   84   C  C   . CYS A 1 32  ? 9.589   28.585 -2.632  1.00 35.38 ? 38  CYS A C   1 
ATOM   85   O  O   . CYS A 1 32  ? 9.025   27.627 -2.107  1.00 38.35 ? 38  CYS A O   1 
ATOM   86   C  CB  . CYS A 1 32  ? 11.546  27.184 -3.300  1.00 48.04 ? 38  CYS A CB  1 
ATOM   87   S  SG  . CYS A 1 32  ? 12.807  26.751 -4.528  1.00 53.17 ? 38  CYS A SG  1 
ATOM   88   N  N   . THR A 1 33  ? 9.308   29.849 -2.329  1.00 36.42 ? 39  THR A N   1 
ATOM   89   C  CA  . THR A 1 33  ? 8.402   30.201 -1.239  1.00 42.13 ? 39  THR A CA  1 
ATOM   90   C  C   . THR A 1 33  ? 6.997   29.630 -1.417  1.00 41.03 ? 39  THR A C   1 
ATOM   91   O  O   . THR A 1 33  ? 6.408   29.117 -0.466  1.00 45.16 ? 39  THR A O   1 
ATOM   92   C  CB  . THR A 1 33  ? 8.283   31.730 -1.070  1.00 42.89 ? 39  THR A CB  1 
ATOM   93   O  OG1 . THR A 1 33  ? 7.721   32.311 -2.254  1.00 43.72 ? 39  THR A OG1 1 
ATOM   94   C  CG2 . THR A 1 33  ? 9.642   32.351 -0.787  1.00 41.22 ? 39  THR A CG2 1 
ATOM   95   N  N   . VAL A 1 34  ? 6.459   29.728 -2.630  1.00 40.03 ? 40  VAL A N   1 
ATOM   96   C  CA  . VAL A 1 34  ? 5.097   29.275 -2.896  1.00 38.68 ? 40  VAL A CA  1 
ATOM   97   C  C   . VAL A 1 34  ? 4.986   27.762 -2.772  1.00 35.05 ? 40  VAL A C   1 
ATOM   98   O  O   . VAL A 1 34  ? 3.947   27.238 -2.372  1.00 41.75 ? 40  VAL A O   1 
ATOM   99   C  CB  . VAL A 1 34  ? 4.627   29.687 -4.307  1.00 36.03 ? 40  VAL A CB  1 
ATOM   100  C  CG1 . VAL A 1 34  ? 3.221   29.165 -4.577  1.00 36.52 ? 40  VAL A CG1 1 
ATOM   101  C  CG2 . VAL A 1 34  ? 4.669   31.199 -4.463  1.00 33.52 ? 40  VAL A CG2 1 
ATOM   102  N  N   . GLU A 1 35  ? 6.063   27.064 -3.117  1.00 33.93 ? 41  GLU A N   1 
ATOM   103  C  CA  . GLU A 1 35  ? 6.059   25.607 -3.137  1.00 36.63 ? 41  GLU A CA  1 
ATOM   104  C  C   . GLU A 1 35  ? 6.205   24.998 -1.742  1.00 37.91 ? 41  GLU A C   1 
ATOM   105  O  O   . GLU A 1 35  ? 5.702   23.906 -1.479  1.00 34.97 ? 41  GLU A O   1 
ATOM   106  C  CB  . GLU A 1 35  ? 7.191   25.090 -4.030  1.00 35.32 ? 41  GLU A CB  1 
ATOM   107  C  CG  . GLU A 1 35  ? 7.044   25.432 -5.511  1.00 35.01 ? 41  GLU A CG  1 
ATOM   108  C  CD  . GLU A 1 35  ? 7.496   26.840 -5.847  1.00 36.69 ? 41  GLU A CD  1 
ATOM   109  O  OE1 . GLU A 1 35  ? 7.423   27.218 -7.037  1.00 34.85 ? 41  GLU A OE1 1 
ATOM   110  O  OE2 . GLU A 1 35  ? 7.925   27.571 -4.927  1.00 37.33 ? 41  GLU A OE2 1 
ATOM   111  N  N   . MET A 1 36  ? 6.894   25.707 -0.853  1.00 36.70 ? 42  MET A N   1 
ATOM   112  C  CA  . MET A 1 36  ? 7.309   25.137 0.428   1.00 36.51 ? 42  MET A CA  1 
ATOM   113  C  C   . MET A 1 36  ? 6.162   24.592 1.287   1.00 33.15 ? 42  MET A C   1 
ATOM   114  O  O   . MET A 1 36  ? 6.245   23.469 1.783   1.00 39.88 ? 42  MET A O   1 
ATOM   115  C  CB  . MET A 1 36  ? 8.124   26.160 1.225   1.00 44.33 ? 42  MET A CB  1 
ATOM   116  C  CG  . MET A 1 36  ? 9.563   26.304 0.750   1.00 41.22 ? 42  MET A CG  1 
ATOM   117  S  SD  . MET A 1 36  ? 10.479  24.749 0.718   1.00 65.23 ? 42  MET A SD  1 
ATOM   118  C  CE  . MET A 1 36  ? 10.118  24.091 2.344   1.00 39.55 ? 42  MET A CE  1 
ATOM   119  N  N   . PRO A 1 37  ? 5.090   25.378 1.468   1.00 35.09 ? 43  PRO A N   1 
ATOM   120  C  CA  . PRO A 1 37  ? 3.985   24.908 2.312   1.00 36.91 ? 43  PRO A CA  1 
ATOM   121  C  C   . PRO A 1 37  ? 3.311   23.645 1.779   1.00 37.14 ? 43  PRO A C   1 
ATOM   122  O  O   . PRO A 1 37  ? 2.542   23.020 2.504   1.00 37.33 ? 43  PRO A O   1 
ATOM   123  C  CB  . PRO A 1 37  ? 2.995   26.078 2.285   1.00 37.40 ? 43  PRO A CB  1 
ATOM   124  C  CG  . PRO A 1 37  ? 3.795   27.259 1.877   1.00 33.53 ? 43  PRO A CG  1 
ATOM   125  C  CD  . PRO A 1 37  ? 4.847   26.735 0.953   1.00 40.25 ? 43  PRO A CD  1 
ATOM   126  N  N   . ILE A 1 38  ? 3.590   23.278 0.533   1.00 33.72 ? 44  ILE A N   1 
ATOM   127  C  CA  . ILE A 1 38  ? 2.992   22.087 -0.059  1.00 29.87 ? 44  ILE A CA  1 
ATOM   128  C  C   . ILE A 1 38  ? 3.942   20.891 -0.003  1.00 32.42 ? 44  ILE A C   1 
ATOM   129  O  O   . ILE A 1 38  ? 3.514   19.745 -0.146  1.00 42.20 ? 44  ILE A O   1 
ATOM   130  C  CB  . ILE A 1 38  ? 2.565   22.356 -1.520  1.00 35.18 ? 44  ILE A CB  1 
ATOM   131  C  CG1 . ILE A 1 38  ? 1.390   23.338 -1.545  1.00 39.27 ? 44  ILE A CG1 1 
ATOM   132  C  CG2 . ILE A 1 38  ? 2.179   21.060 -2.228  1.00 29.21 ? 44  ILE A CG2 1 
ATOM   133  C  CD1 . ILE A 1 38  ? 1.126   23.959 -2.903  1.00 36.18 ? 44  ILE A CD1 1 
ATOM   134  N  N   . LEU A 1 39  ? 5.225   21.158 0.219   1.00 37.79 ? 45  LEU A N   1 
ATOM   135  C  CA  . LEU A 1 39  ? 6.240   20.110 0.206   1.00 36.67 ? 45  LEU A CA  1 
ATOM   136  C  C   . LEU A 1 39  ? 7.019   20.027 1.517   1.00 37.92 ? 45  LEU A C   1 
ATOM   137  O  O   . LEU A 1 39  ? 7.855   19.141 1.694   1.00 43.96 ? 45  LEU A O   1 
ATOM   138  C  CB  . LEU A 1 39  ? 7.217   20.376 -0.934  1.00 34.38 ? 45  LEU A CB  1 
ATOM   139  C  CG  . LEU A 1 39  ? 6.597   20.416 -2.329  1.00 35.35 ? 45  LEU A CG  1 
ATOM   140  C  CD1 . LEU A 1 39  ? 7.594   20.971 -3.329  1.00 36.90 ? 45  LEU A CD1 1 
ATOM   141  C  CD2 . LEU A 1 39  ? 6.127   19.032 -2.740  1.00 37.30 ? 45  LEU A CD2 1 
ATOM   142  N  N   . LYS A 1 40  ? 6.742   20.951 2.430   1.00 41.82 ? 46  LYS A N   1 
ATOM   143  C  CA  . LYS A 1 40  ? 7.516   21.084 3.659   1.00 46.99 ? 46  LYS A CA  1 
ATOM   144  C  C   . LYS A 1 40  ? 7.728   19.763 4.392   1.00 48.09 ? 46  LYS A C   1 
ATOM   145  O  O   . LYS A 1 40  ? 8.815   19.500 4.905   1.00 43.46 ? 46  LYS A O   1 
ATOM   146  C  CB  . LYS A 1 40  ? 6.830   22.078 4.598   1.00 41.92 ? 46  LYS A CB  1 
ATOM   147  C  CG  . LYS A 1 40  ? 7.480   22.182 5.964   1.00 47.22 ? 46  LYS A CG  1 
ATOM   148  C  CD  . LYS A 1 40  ? 6.935   23.363 6.743   1.00 53.95 ? 46  LYS A CD  1 
ATOM   149  C  CE  . LYS A 1 40  ? 7.464   23.384 8.166   1.00 50.82 ? 46  LYS A CE  1 
ATOM   150  N  NZ  . LYS A 1 40  ? 7.400   24.751 8.748   1.00 61.68 ? 46  LYS A NZ  1 
ATOM   151  N  N   . ASP A 1 41  ? 6.692   18.935 4.440   1.00 41.46 ? 47  ASP A N   1 
ATOM   152  C  CA  . ASP A 1 41  ? 6.732   17.727 5.257   1.00 46.97 ? 47  ASP A CA  1 
ATOM   153  C  C   . ASP A 1 41  ? 7.149   16.480 4.484   1.00 45.62 ? 47  ASP A C   1 
ATOM   154  O  O   . ASP A 1 41  ? 7.349   15.426 5.084   1.00 43.35 ? 47  ASP A O   1 
ATOM   155  C  CB  . ASP A 1 41  ? 5.367   17.481 5.908   1.00 43.24 ? 47  ASP A CB  1 
ATOM   156  C  CG  . ASP A 1 41  ? 4.237   17.437 4.896   1.00 45.28 ? 47  ASP A CG  1 
ATOM   157  O  OD1 . ASP A 1 41  ? 4.279   18.220 3.924   1.00 44.83 ? 47  ASP A OD1 1 
ATOM   158  O  OD2 . ASP A 1 41  ? 3.308   16.619 5.070   1.00 42.55 ? 47  ASP A OD2 1 
ATOM   159  N  N   . VAL A 1 42  ? 7.289   16.589 3.165   1.00 41.08 ? 48  VAL A N   1 
ATOM   160  C  CA  . VAL A 1 42  ? 7.555   15.407 2.344   1.00 44.18 ? 48  VAL A CA  1 
ATOM   161  C  C   . VAL A 1 42  ? 8.789   15.517 1.448   1.00 46.07 ? 48  VAL A C   1 
ATOM   162  O  O   . VAL A 1 42  ? 9.104   14.577 0.719   1.00 47.41 ? 48  VAL A O   1 
ATOM   163  C  CB  . VAL A 1 42  ? 6.353   15.069 1.438   1.00 45.05 ? 48  VAL A CB  1 
ATOM   164  C  CG1 . VAL A 1 42  ? 5.095   14.877 2.267   1.00 47.41 ? 48  VAL A CG1 1 
ATOM   165  C  CG2 . VAL A 1 42  ? 6.154   16.155 0.396   1.00 45.67 ? 48  VAL A CG2 1 
ATOM   166  N  N   . ALA A 1 43  ? 9.483   16.650 1.486   1.00 44.55 ? 49  ALA A N   1 
ATOM   167  C  CA  . ALA A 1 43  ? 10.648  16.832 0.625   1.00 45.26 ? 49  ALA A CA  1 
ATOM   168  C  C   . ALA A 1 43  ? 11.641  17.856 1.160   1.00 49.09 ? 49  ALA A C   1 
ATOM   169  O  O   . ALA A 1 43  ? 11.259  18.859 1.763   1.00 57.65 ? 49  ALA A O   1 
ATOM   170  C  CB  . ALA A 1 43  ? 10.205  17.240 -0.767  1.00 47.32 ? 49  ALA A CB  1 
ATOM   171  N  N   . THR A 1 44  ? 12.921  17.586 0.924   1.00 49.61 ? 50  THR A N   1 
ATOM   172  C  CA  . THR A 1 44  ? 13.976  18.570 1.125   1.00 49.61 ? 50  THR A CA  1 
ATOM   173  C  C   . THR A 1 44  ? 14.012  19.428 -0.134  1.00 46.55 ? 50  THR A C   1 
ATOM   174  O  O   . THR A 1 44  ? 14.222  18.909 -1.229  1.00 43.53 ? 50  THR A O   1 
ATOM   175  C  CB  . THR A 1 44  ? 15.346  17.885 1.331   1.00 53.59 ? 50  THR A CB  1 
ATOM   176  O  OG1 . THR A 1 44  ? 15.268  16.976 2.436   1.00 53.47 ? 50  THR A OG1 1 
ATOM   177  C  CG2 . THR A 1 44  ? 16.448  18.912 1.593   1.00 49.23 ? 50  THR A CG2 1 
ATOM   178  N  N   . VAL A 1 45  ? 13.792  20.731 0.015   1.00 50.67 ? 51  VAL A N   1 
ATOM   179  C  CA  . VAL A 1 45  ? 13.678  21.618 -1.140  1.00 52.35 ? 51  VAL A CA  1 
ATOM   180  C  C   . VAL A 1 45  ? 14.902  22.521 -1.285  1.00 48.58 ? 51  VAL A C   1 
ATOM   181  O  O   . VAL A 1 45  ? 15.300  23.201 -0.339  1.00 52.39 ? 51  VAL A O   1 
ATOM   182  C  CB  . VAL A 1 45  ? 12.409  22.493 -1.048  1.00 53.56 ? 51  VAL A CB  1 
ATOM   183  C  CG1 . VAL A 1 45  ? 12.309  23.422 -2.250  1.00 41.58 ? 51  VAL A CG1 1 
ATOM   184  C  CG2 . VAL A 1 45  ? 11.166  21.620 -0.946  1.00 43.18 ? 51  VAL A CG2 1 
ATOM   185  N  N   . ALA A 1 46  ? 15.490  22.520 -2.480  1.00 51.27 ? 52  ALA A N   1 
ATOM   186  C  CA  . ALA A 1 46  ? 16.645  23.360 -2.786  1.00 53.12 ? 52  ALA A CA  1 
ATOM   187  C  C   . ALA A 1 46  ? 16.454  24.039 -4.139  1.00 49.50 ? 52  ALA A C   1 
ATOM   188  O  O   . ALA A 1 46  ? 15.624  23.612 -4.942  1.00 49.30 ? 52  ALA A O   1 
ATOM   189  C  CB  . ALA A 1 46  ? 17.913  22.520 -2.802  1.00 49.43 ? 52  ALA A CB  1 
ATOM   190  N  N   . PHE A 1 47  ? 17.218  25.098 -4.391  1.00 52.36 ? 53  PHE A N   1 
ATOM   191  C  CA  . PHE A 1 47  ? 17.198  25.750 -5.696  1.00 51.68 ? 53  PHE A CA  1 
ATOM   192  C  C   . PHE A 1 47  ? 18.614  25.877 -6.248  1.00 52.86 ? 53  PHE A C   1 
ATOM   193  O  O   . PHE A 1 47  ? 19.586  25.814 -5.497  1.00 60.42 ? 53  PHE A O   1 
ATOM   194  C  CB  . PHE A 1 47  ? 16.511  27.118 -5.623  1.00 53.42 ? 53  PHE A CB  1 
ATOM   195  C  CG  . PHE A 1 47  ? 17.219  28.118 -4.754  1.00 54.39 ? 53  PHE A CG  1 
ATOM   196  C  CD1 . PHE A 1 47  ? 16.805  28.340 -3.452  1.00 57.97 ? 53  PHE A CD1 1 
ATOM   197  C  CD2 . PHE A 1 47  ? 18.286  28.846 -5.245  1.00 54.73 ? 53  PHE A CD2 1 
ATOM   198  C  CE1 . PHE A 1 47  ? 17.448  29.265 -2.653  1.00 64.06 ? 53  PHE A CE1 1 
ATOM   199  C  CE2 . PHE A 1 47  ? 18.934  29.774 -4.452  1.00 64.59 ? 53  PHE A CE2 1 
ATOM   200  C  CZ  . PHE A 1 47  ? 18.514  29.983 -3.154  1.00 63.34 ? 53  PHE A CZ  1 
ATOM   201  N  N   . CYS A 1 48  ? 18.725  26.048 -7.563  1.00 60.61 ? 54  CYS A N   1 
ATOM   202  C  CA  . CYS A 1 48  ? 20.025  26.054 -8.227  1.00 54.10 ? 54  CYS A CA  1 
ATOM   203  C  C   . CYS A 1 48  ? 20.297  27.340 -9.002  1.00 56.87 ? 54  CYS A C   1 
ATOM   204  O  O   . CYS A 1 48  ? 21.442  27.622 -9.355  1.00 59.61 ? 54  CYS A O   1 
ATOM   205  C  CB  . CYS A 1 48  ? 20.122  24.862 -9.182  1.00 50.45 ? 54  CYS A CB  1 
ATOM   206  S  SG  . CYS A 1 48  ? 19.693  23.272 -8.427  1.00 54.00 ? 54  CYS A SG  1 
ATOM   207  N  N   . ASP A 1 49  ? 19.250  28.117 -9.260  1.00 55.59 ? 55  ASP A N   1 
ATOM   208  C  CA  . ASP A 1 49  ? 19.374  29.336 -10.053 1.00 53.45 ? 55  ASP A CA  1 
ATOM   209  C  C   . ASP A 1 49  ? 20.334  29.118 -11.219 1.00 56.62 ? 55  ASP A C   1 
ATOM   210  O  O   . ASP A 1 49  ? 21.265  29.896 -11.428 1.00 59.24 ? 55  ASP A O   1 
ATOM   211  C  CB  . ASP A 1 49  ? 19.863  30.490 -9.175  1.00 53.37 ? 55  ASP A CB  1 
ATOM   212  C  CG  . ASP A 1 49  ? 19.551  31.847 -9.770  1.00 64.93 ? 55  ASP A CG  1 
ATOM   213  O  OD1 . ASP A 1 49  ? 18.652  31.927 -10.633 1.00 62.60 ? 55  ASP A OD1 1 
ATOM   214  O  OD2 . ASP A 1 49  ? 20.200  32.836 -9.369  1.00 71.05 ? 55  ASP A OD2 1 
ATOM   215  N  N   . ALA A 1 50  ? 20.094  28.052 -11.976 1.00 52.84 ? 56  ALA A N   1 
ATOM   216  C  CA  . ALA A 1 50  ? 20.998  27.642 -13.043 1.00 54.85 ? 56  ALA A CA  1 
ATOM   217  C  C   . ALA A 1 50  ? 20.389  27.856 -14.421 1.00 59.06 ? 56  ALA A C   1 
ATOM   218  O  O   . ALA A 1 50  ? 19.227  27.525 -14.660 1.00 50.95 ? 56  ALA A O   1 
ATOM   219  C  CB  . ALA A 1 50  ? 21.364  26.187 -12.872 1.00 49.42 ? 56  ALA A CB  1 
ATOM   220  N  N   . GLN A 1 51  ? 21.188  28.401 -15.331 1.00 54.68 ? 57  GLN A N   1 
ATOM   221  C  CA  . GLN A 1 51  ? 20.772  28.549 -16.717 1.00 57.59 ? 57  GLN A CA  1 
ATOM   222  C  C   . GLN A 1 51  ? 21.155  27.309 -17.521 1.00 51.13 ? 57  GLN A C   1 
ATOM   223  O  O   . GLN A 1 51  ? 20.851  27.215 -18.710 1.00 59.16 ? 57  GLN A O   1 
ATOM   224  C  CB  . GLN A 1 51  ? 21.416  29.792 -17.336 1.00 60.40 ? 57  GLN A CB  1 
ATOM   225  N  N   . SER A 1 52  ? 21.813  26.355 -16.867 1.00 54.71 ? 58  SER A N   1 
ATOM   226  C  CA  . SER A 1 52  ? 22.300  25.161 -17.549 1.00 58.72 ? 58  SER A CA  1 
ATOM   227  C  C   . SER A 1 52  ? 22.685  24.067 -16.557 1.00 59.26 ? 58  SER A C   1 
ATOM   228  O  O   . SER A 1 52  ? 22.728  24.299 -15.349 1.00 60.69 ? 58  SER A O   1 
ATOM   229  C  CB  . SER A 1 52  ? 23.517  25.516 -18.402 1.00 59.99 ? 58  SER A CB  1 
ATOM   230  O  OG  . SER A 1 52  ? 24.558  26.024 -17.584 1.00 60.46 ? 58  SER A OG  1 
ATOM   231  N  N   . THR A 1 53  ? 22.925  22.868 -17.035 1.00 58.95 ? 59  THR A N   1 
ATOM   232  C  CA  . THR A 1 53  ? 23.401  21.833 -16.136 1.00 66.46 ? 59  THR A CA  1 
ATOM   233  C  C   . THR A 1 53  ? 24.769  22.185 -15.527 1.00 65.82 ? 59  THR A C   1 
ATOM   234  O  O   . THR A 1 53  ? 25.001  22.064 -14.341 1.00 67.24 ? 59  THR A O   1 
ATOM   235  C  CB  . THR A 1 53  ? 23.404  20.472 -16.829 1.00 65.08 ? 59  THR A CB  1 
ATOM   236  O  OG1 . THR A 1 53  ? 22.062  20.021 -16.906 1.00 63.79 ? 59  THR A OG1 1 
ATOM   237  C  CG2 . THR A 1 53  ? 24.182  19.453 -16.066 1.00 64.55 ? 59  THR A CG2 1 
ATOM   238  N  N   . GLN A 1 54  ? 25.664  22.658 -16.347 1.00 63.16 ? 60  GLN A N   1 
ATOM   239  C  CA  . GLN A 1 54  ? 27.003  22.950 -15.850 1.00 71.84 ? 60  GLN A CA  1 
ATOM   240  C  C   . GLN A 1 54  ? 26.957  23.733 -14.540 1.00 70.80 ? 60  GLN A C   1 
ATOM   241  O  O   . GLN A 1 54  ? 27.888  23.668 -13.736 1.00 77.04 ? 60  GLN A O   1 
ATOM   242  C  CB  . GLN A 1 54  ? 27.793  23.739 -16.896 1.00 71.01 ? 60  GLN A CB  1 
ATOM   243  N  N   . GLU A 1 55  ? 25.871  24.471 -14.329 1.00 61.26 ? 61  GLU A N   1 
ATOM   244  C  CA  . GLU A 1 55  ? 25.731  25.315 -13.145 1.00 67.85 ? 61  GLU A CA  1 
ATOM   245  C  C   . GLU A 1 55  ? 25.163  24.562 -11.940 1.00 67.91 ? 61  GLU A C   1 
ATOM   246  O  O   . GLU A 1 55  ? 25.078  25.116 -10.844 1.00 70.62 ? 61  GLU A O   1 
ATOM   247  C  CB  . GLU A 1 55  ? 24.832  26.513 -13.462 1.00 64.89 ? 61  GLU A CB  1 
ATOM   248  C  CG  . GLU A 1 55  ? 25.527  27.862 -13.384 1.00 64.69 ? 61  GLU A CG  1 
ATOM   249  C  CD  . GLU A 1 55  ? 24.612  29.003 -13.782 1.00 62.58 ? 61  GLU A CD  1 
ATOM   250  O  OE1 . GLU A 1 55  ? 24.534  29.997 -13.030 1.00 66.15 ? 61  GLU A OE1 1 
ATOM   251  O  OE2 . GLU A 1 55  ? 23.970  28.904 -14.849 1.00 60.14 ? 61  GLU A OE2 1 
ATOM   252  N  N   . ILE A 1 56  ? 24.779  23.304 -12.140 1.00 61.91 ? 62  ILE A N   1 
ATOM   253  C  CA  . ILE A 1 56  ? 24.141  22.523 -11.083 1.00 65.80 ? 62  ILE A CA  1 
ATOM   254  C  C   . ILE A 1 56  ? 25.168  21.724 -10.284 1.00 66.60 ? 62  ILE A C   1 
ATOM   255  O  O   . ILE A 1 56  ? 26.085  21.131 -10.853 1.00 68.82 ? 62  ILE A O   1 
ATOM   256  C  CB  . ILE A 1 56  ? 23.084  21.563 -11.666 1.00 66.33 ? 62  ILE A CB  1 
ATOM   257  C  CG1 . ILE A 1 56  ? 22.008  22.358 -12.411 1.00 61.16 ? 62  ILE A CG1 1 
ATOM   258  C  CG2 . ILE A 1 56  ? 22.455  20.726 -10.564 1.00 61.37 ? 62  ILE A CG2 1 
ATOM   259  C  CD1 . ILE A 1 56  ? 20.998  21.498 -13.142 1.00 57.42 ? 62  ILE A CD1 1 
ATOM   260  N  N   . HIS A 1 57  ? 25.006  21.709 -8.963  1.00 66.81 ? 63  HIS A N   1 
ATOM   261  C  CA  . HIS A 1 57  ? 25.921  20.991 -8.083  1.00 57.80 ? 63  HIS A CA  1 
ATOM   262  C  C   . HIS A 1 57  ? 25.771  19.486 -8.269  1.00 59.44 ? 63  HIS A C   1 
ATOM   263  O  O   . HIS A 1 57  ? 24.683  18.996 -8.577  1.00 55.54 ? 63  HIS A O   1 
ATOM   264  C  CB  . HIS A 1 57  ? 25.661  21.364 -6.622  1.00 63.27 ? 63  HIS A CB  1 
ATOM   265  N  N   . GLU A 1 58  ? 26.867  18.757 -8.081  1.00 55.87 ? 64  GLU A N   1 
ATOM   266  C  CA  . GLU A 1 58  ? 26.860  17.309 -8.241  1.00 53.25 ? 64  GLU A CA  1 
ATOM   267  C  C   . GLU A 1 58  ? 25.868  16.668 -7.278  1.00 55.33 ? 64  GLU A C   1 
ATOM   268  O  O   . GLU A 1 58  ? 25.225  15.672 -7.607  1.00 56.74 ? 64  GLU A O   1 
ATOM   269  C  CB  . GLU A 1 58  ? 28.261  16.738 -8.005  1.00 53.45 ? 64  GLU A CB  1 
ATOM   270  N  N   . LYS A 1 59  ? 25.748  17.251 -6.089  1.00 50.60 ? 65  LYS A N   1 
ATOM   271  C  CA  . LYS A 1 59  ? 24.852  16.736 -5.060  1.00 60.30 ? 65  LYS A CA  1 
ATOM   272  C  C   . LYS A 1 59  ? 23.407  16.666 -5.550  1.00 61.70 ? 65  LYS A C   1 
ATOM   273  O  O   . LYS A 1 59  ? 22.710  15.679 -5.311  1.00 62.11 ? 65  LYS A O   1 
ATOM   274  C  CB  . LYS A 1 59  ? 24.946  17.610 -3.806  1.00 57.68 ? 65  LYS A CB  1 
ATOM   275  C  CG  . LYS A 1 59  ? 24.065  17.161 -2.653  1.00 64.86 ? 65  LYS A CG  1 
ATOM   276  C  CD  . LYS A 1 59  ? 24.523  17.780 -1.340  1.00 61.66 ? 65  LYS A CD  1 
ATOM   277  C  CE  . LYS A 1 59  ? 23.613  17.383 -0.189  1.00 65.14 ? 65  LYS A CE  1 
ATOM   278  N  NZ  . LYS A 1 59  ? 22.292  18.072 -0.230  1.00 66.19 ? 65  LYS A NZ  1 
ATOM   279  N  N   . VAL A 1 60  ? 22.962  17.716 -6.234  1.00 59.63 ? 66  VAL A N   1 
ATOM   280  C  CA  . VAL A 1 60  ? 21.602  17.771 -6.756  1.00 56.17 ? 66  VAL A CA  1 
ATOM   281  C  C   . VAL A 1 60  ? 21.431  16.771 -7.892  1.00 52.87 ? 66  VAL A C   1 
ATOM   282  O  O   . VAL A 1 60  ? 20.442  16.043 -7.951  1.00 47.04 ? 66  VAL A O   1 
ATOM   283  C  CB  . VAL A 1 60  ? 21.265  19.182 -7.273  1.00 56.82 ? 66  VAL A CB  1 
ATOM   284  C  CG1 . VAL A 1 60  ? 19.871  19.212 -7.879  1.00 55.85 ? 66  VAL A CG1 1 
ATOM   285  C  CG2 . VAL A 1 60  ? 21.387  20.199 -6.148  1.00 57.32 ? 66  VAL A CG2 1 
ATOM   286  N  N   . LEU A 1 61  ? 22.403  16.742 -8.796  1.00 55.60 ? 67  LEU A N   1 
ATOM   287  C  CA  . LEU A 1 61  ? 22.370  15.816 -9.917  1.00 58.33 ? 67  LEU A CA  1 
ATOM   288  C  C   . LEU A 1 61  ? 22.372  14.379 -9.405  1.00 57.78 ? 67  LEU A C   1 
ATOM   289  O  O   . LEU A 1 61  ? 21.732  13.499 -9.981  1.00 54.33 ? 67  LEU A O   1 
ATOM   290  C  CB  . LEU A 1 61  ? 23.575  16.055 -10.829 1.00 62.62 ? 67  LEU A CB  1 
ATOM   291  C  CG  . LEU A 1 61  ? 23.707  17.473 -11.393 1.00 65.61 ? 67  LEU A CG  1 
ATOM   292  C  CD1 . LEU A 1 61  ? 25.059  17.661 -12.062 1.00 63.03 ? 67  LEU A CD1 1 
ATOM   293  C  CD2 . LEU A 1 61  ? 22.580  17.777 -12.366 1.00 51.71 ? 67  LEU A CD2 1 
ATOM   294  N  N   . ASN A 1 62  ? 23.088  14.153 -8.308  1.00 58.20 ? 68  ASN A N   1 
ATOM   295  C  CA  . ASN A 1 62  ? 23.224  12.820 -7.738  1.00 59.62 ? 68  ASN A CA  1 
ATOM   296  C  C   . ASN A 1 62  ? 22.008  12.391 -6.923  1.00 58.70 ? 68  ASN A C   1 
ATOM   297  O  O   . ASN A 1 62  ? 21.564  11.245 -7.013  1.00 60.81 ? 68  ASN A O   1 
ATOM   298  C  CB  . ASN A 1 62  ? 24.468  12.760 -6.847  1.00 60.26 ? 68  ASN A CB  1 
ATOM   299  C  CG  . ASN A 1 62  ? 25.758  12.909 -7.631  1.00 63.73 ? 68  ASN A CG  1 
ATOM   300  O  OD1 . ASN A 1 62  ? 25.836  12.533 -8.801  1.00 66.69 ? 68  ASN A OD1 1 
ATOM   301  N  ND2 . ASN A 1 62  ? 26.779  13.460 -6.986  1.00 68.73 ? 68  ASN A ND2 1 
ATOM   302  N  N   . GLU A 1 63  ? 21.469  13.315 -6.134  1.00 55.15 ? 69  GLU A N   1 
ATOM   303  C  CA  . GLU A 1 63  ? 20.481  12.969 -5.117  1.00 58.02 ? 69  GLU A CA  1 
ATOM   304  C  C   . GLU A 1 63  ? 19.049  13.385 -5.462  1.00 55.52 ? 69  GLU A C   1 
ATOM   305  O  O   . GLU A 1 63  ? 18.095  12.773 -4.982  1.00 55.94 ? 69  GLU A O   1 
ATOM   306  C  CB  . GLU A 1 63  ? 20.889  13.586 -3.777  1.00 55.58 ? 69  GLU A CB  1 
ATOM   307  C  CG  . GLU A 1 63  ? 22.283  13.177 -3.311  1.00 58.51 ? 69  GLU A CG  1 
ATOM   308  C  CD  . GLU A 1 63  ? 22.645  13.759 -1.958  1.00 66.55 ? 69  GLU A CD  1 
ATOM   309  O  OE1 . GLU A 1 63  ? 21.727  14.175 -1.221  1.00 64.56 ? 69  GLU A OE1 1 
ATOM   310  O  OE2 . GLU A 1 63  ? 23.850  13.801 -1.633  1.00 71.77 ? 69  GLU A OE2 1 
ATOM   311  N  N   . ALA A 1 64  ? 18.898  14.418 -6.285  1.00 55.20 ? 70  ALA A N   1 
ATOM   312  C  CA  . ALA A 1 64  ? 17.572  14.942 -6.618  1.00 53.43 ? 70  ALA A CA  1 
ATOM   313  C  C   . ALA A 1 64  ? 16.636  13.846 -7.128  1.00 49.30 ? 70  ALA A C   1 
ATOM   314  O  O   . ALA A 1 64  ? 16.952  13.142 -8.087  1.00 51.73 ? 70  ALA A O   1 
ATOM   315  C  CB  . ALA A 1 64  ? 17.686  16.057 -7.644  1.00 51.59 ? 70  ALA A CB  1 
ATOM   316  N  N   . VAL A 1 65  ? 15.482  13.713 -6.477  1.00 49.04 ? 71  VAL A N   1 
ATOM   317  C  CA  . VAL A 1 65  ? 14.481  12.719 -6.853  1.00 46.75 ? 71  VAL A CA  1 
ATOM   318  C  C   . VAL A 1 65  ? 13.395  13.354 -7.717  1.00 48.58 ? 71  VAL A C   1 
ATOM   319  O  O   . VAL A 1 65  ? 12.729  12.675 -8.499  1.00 46.49 ? 71  VAL A O   1 
ATOM   320  C  CB  . VAL A 1 65  ? 13.826  12.090 -5.603  1.00 48.44 ? 71  VAL A CB  1 
ATOM   321  C  CG1 . VAL A 1 65  ? 12.677  11.172 -5.996  1.00 46.62 ? 71  VAL A CG1 1 
ATOM   322  C  CG2 . VAL A 1 65  ? 14.860  11.330 -4.787  1.00 50.52 ? 71  VAL A CG2 1 
ATOM   323  N  N   . GLY A 1 66  ? 13.219  14.661 -7.559  1.00 46.92 ? 72  GLY A N   1 
ATOM   324  C  CA  . GLY A 1 66  ? 12.245  15.408 -8.331  1.00 42.29 ? 72  GLY A CA  1 
ATOM   325  C  C   . GLY A 1 66  ? 12.817  16.752 -8.731  1.00 42.01 ? 72  GLY A C   1 
ATOM   326  O  O   . GLY A 1 66  ? 13.667  17.305 -8.030  1.00 42.02 ? 72  GLY A O   1 
ATOM   327  N  N   . ALA A 1 67  ? 12.359  17.283 -9.860  1.00 43.61 ? 73  ALA A N   1 
ATOM   328  C  CA  . ALA A 1 67  ? 12.856  18.563 -10.342 1.00 44.71 ? 73  ALA A CA  1 
ATOM   329  C  C   . ALA A 1 67  ? 11.721  19.469 -10.802 1.00 41.19 ? 73  ALA A C   1 
ATOM   330  O  O   . ALA A 1 67  ? 10.782  19.025 -11.461 1.00 38.74 ? 73  ALA A O   1 
ATOM   331  C  CB  . ALA A 1 67  ? 13.848  18.349 -11.473 1.00 42.34 ? 73  ALA A CB  1 
ATOM   332  N  N   . LEU A 1 68  ? 11.822  20.741 -10.438 1.00 41.04 ? 74  LEU A N   1 
ATOM   333  C  CA  . LEU A 1 68  ? 10.899  21.759 -10.906 1.00 43.81 ? 74  LEU A CA  1 
ATOM   334  C  C   . LEU A 1 68  ? 11.676  22.703 -11.806 1.00 47.16 ? 74  LEU A C   1 
ATOM   335  O  O   . LEU A 1 68  ? 12.763  23.152 -11.444 1.00 43.84 ? 74  LEU A O   1 
ATOM   336  C  CB  . LEU A 1 68  ? 10.316  22.535 -9.726  1.00 35.63 ? 74  LEU A CB  1 
ATOM   337  C  CG  . LEU A 1 68  ? 9.361   21.781 -8.800  1.00 41.17 ? 74  LEU A CG  1 
ATOM   338  C  CD1 . LEU A 1 68  ? 9.303   22.450 -7.437  1.00 33.82 ? 74  LEU A CD1 1 
ATOM   339  C  CD2 . LEU A 1 68  ? 7.979   21.719 -9.422  1.00 34.87 ? 74  LEU A CD2 1 
ATOM   340  N  N   . MET A 1 69  ? 11.130  23.009 -12.976 1.00 40.85 ? 75  MET A N   1 
ATOM   341  C  CA  . MET A 1 69  ? 11.809  23.906 -13.897 1.00 42.93 ? 75  MET A CA  1 
ATOM   342  C  C   . MET A 1 69  ? 10.868  24.735 -14.725 1.00 44.33 ? 75  MET A C   1 
ATOM   343  O  O   . MET A 1 69  ? 9.754   24.308 -15.039 1.00 39.73 ? 75  MET A O   1 
ATOM   344  C  CB  . MET A 1 69  ? 12.693  23.108 -14.819 1.00 42.38 ? 75  MET A CB  1 
ATOM   345  C  CG  . MET A 1 69  ? 11.970  21.957 -15.458 1.00 43.25 ? 75  MET A CG  1 
ATOM   346  S  SD  . MET A 1 69  ? 13.168  21.166 -16.507 1.00 45.57 ? 75  MET A SD  1 
ATOM   347  C  CE  . MET A 1 69  ? 13.270  22.338 -17.858 1.00 47.06 ? 75  MET A CE  1 
ATOM   348  N  N   . TYR A 1 70  ? 11.336  25.925 -15.083 1.00 38.64 ? 76  TYR A N   1 
ATOM   349  C  CA  . TYR A 1 70  ? 10.608  26.796 -15.984 1.00 40.10 ? 76  TYR A CA  1 
ATOM   350  C  C   . TYR A 1 70  ? 11.056  26.508 -17.417 1.00 42.58 ? 76  TYR A C   1 
ATOM   351  O  O   . TYR A 1 70  ? 11.273  25.350 -17.773 1.00 39.09 ? 76  TYR A O   1 
ATOM   352  C  CB  . TYR A 1 70  ? 10.818  28.260 -15.589 1.00 36.84 ? 76  TYR A CB  1 
ATOM   353  C  CG  . TYR A 1 70  ? 10.245  28.595 -14.228 1.00 44.85 ? 76  TYR A CG  1 
ATOM   354  C  CD1 . TYR A 1 70  ? 8.915   28.956 -14.091 1.00 40.44 ? 76  TYR A CD1 1 
ATOM   355  C  CD2 . TYR A 1 70  ? 11.027  28.541 -13.084 1.00 44.52 ? 76  TYR A CD2 1 
ATOM   356  C  CE1 . TYR A 1 70  ? 8.379   29.260 -12.858 1.00 45.57 ? 76  TYR A CE1 1 
ATOM   357  C  CE2 . TYR A 1 70  ? 10.499  28.842 -11.845 1.00 41.34 ? 76  TYR A CE2 1 
ATOM   358  C  CZ  . TYR A 1 70  ? 9.176   29.199 -11.735 1.00 44.75 ? 76  TYR A CZ  1 
ATOM   359  O  OH  . TYR A 1 70  ? 8.665   29.500 -10.488 1.00 38.12 ? 76  TYR A OH  1 
ATOM   360  N  N   . HIS A 1 71  ? 11.203  27.547 -18.233 1.00 41.59 ? 77  HIS A N   1 
ATOM   361  C  CA  . HIS A 1 71  ? 11.486  27.367 -19.653 1.00 45.24 ? 77  HIS A CA  1 
ATOM   362  C  C   . HIS A 1 71  ? 12.892  27.839 -20.011 1.00 41.91 ? 77  HIS A C   1 
ATOM   363  O  O   . HIS A 1 71  ? 13.329  27.696 -21.153 1.00 45.53 ? 77  HIS A O   1 
ATOM   364  C  CB  . HIS A 1 71  ? 10.473  28.156 -20.479 1.00 42.47 ? 77  HIS A CB  1 
ATOM   365  C  CG  . HIS A 1 71  ? 10.629  29.642 -20.351 1.00 38.71 ? 77  HIS A CG  1 
ATOM   366  N  ND1 . HIS A 1 71  ? 10.136  30.347 -19.279 1.00 43.39 ? 77  HIS A ND1 1 
ATOM   367  C  CD2 . HIS A 1 71  ? 11.237  30.542 -21.154 1.00 39.28 ? 77  HIS A CD2 1 
ATOM   368  C  CE1 . HIS A 1 71  ? 10.428  31.631 -19.429 1.00 42.77 ? 77  HIS A CE1 1 
ATOM   369  N  NE2 . HIS A 1 71  ? 11.096  31.773 -20.559 1.00 41.17 ? 77  HIS A NE2 1 
ATOM   370  N  N   . THR A 1 72  ? 13.598  28.404 -19.037 1.00 47.15 ? 78  THR A N   1 
ATOM   371  C  CA  . THR A 1 72  ? 14.888  29.030 -19.302 1.00 41.19 ? 78  THR A CA  1 
ATOM   372  C  C   . THR A 1 72  ? 16.028  28.013 -19.393 1.00 45.82 ? 78  THR A C   1 
ATOM   373  O  O   . THR A 1 72  ? 17.125  28.348 -19.842 1.00 57.40 ? 78  THR A O   1 
ATOM   374  C  CB  . THR A 1 72  ? 15.244  30.079 -18.227 1.00 46.95 ? 78  THR A CB  1 
ATOM   375  O  OG1 . THR A 1 72  ? 15.494  29.425 -16.978 1.00 47.95 ? 78  THR A OG1 1 
ATOM   376  C  CG2 . THR A 1 72  ? 14.117  31.090 -18.049 1.00 44.09 ? 78  THR A CG2 1 
ATOM   377  N  N   . ILE A 1 73  ? 15.772  26.778 -18.972 1.00 46.14 ? 79  ILE A N   1 
ATOM   378  C  CA  . ILE A 1 73  ? 16.777  25.720 -19.066 1.00 43.50 ? 79  ILE A CA  1 
ATOM   379  C  C   . ILE A 1 73  ? 16.277  24.592 -19.967 1.00 47.29 ? 79  ILE A C   1 
ATOM   380  O  O   . ILE A 1 73  ? 15.080  24.316 -20.025 1.00 54.29 ? 79  ILE A O   1 
ATOM   381  C  CB  . ILE A 1 73  ? 17.151  25.151 -17.677 1.00 51.32 ? 79  ILE A CB  1 
ATOM   382  C  CG1 . ILE A 1 73  ? 18.217  24.062 -17.823 1.00 53.66 ? 79  ILE A CG1 1 
ATOM   383  C  CG2 . ILE A 1 73  ? 15.928  24.586 -16.992 1.00 50.15 ? 79  ILE A CG2 1 
ATOM   384  C  CD1 . ILE A 1 73  ? 18.823  23.589 -16.514 1.00 56.10 ? 79  ILE A CD1 1 
ATOM   385  N  N   . THR A 1 74  ? 17.204  23.946 -20.668 1.00 49.01 ? 80  THR A N   1 
ATOM   386  C  CA  . THR A 1 74  ? 16.868  22.872 -21.597 1.00 47.96 ? 80  THR A CA  1 
ATOM   387  C  C   . THR A 1 74  ? 17.484  21.559 -21.123 1.00 44.93 ? 80  THR A C   1 
ATOM   388  O  O   . THR A 1 74  ? 18.614  21.539 -20.638 1.00 54.44 ? 80  THR A O   1 
ATOM   389  C  CB  . THR A 1 74  ? 17.389  23.190 -23.015 1.00 49.55 ? 80  THR A CB  1 
ATOM   390  O  OG1 . THR A 1 74  ? 16.957  24.499 -23.406 1.00 55.88 ? 80  THR A OG1 1 
ATOM   391  C  CG2 . THR A 1 74  ? 16.883  22.170 -24.021 1.00 47.92 ? 80  THR A CG2 1 
ATOM   392  N  N   . LEU A 1 75  ? 16.739  20.465 -21.261 1.00 46.47 ? 81  LEU A N   1 
ATOM   393  C  CA  . LEU A 1 75  ? 17.220  19.153 -20.836 1.00 48.50 ? 81  LEU A CA  1 
ATOM   394  C  C   . LEU A 1 75  ? 17.239  18.154 -21.990 1.00 50.67 ? 81  LEU A C   1 
ATOM   395  O  O   . LEU A 1 75  ? 16.214  17.554 -22.318 1.00 47.36 ? 81  LEU A O   1 
ATOM   396  C  CB  . LEU A 1 75  ? 16.347  18.600 -19.705 1.00 49.61 ? 81  LEU A CB  1 
ATOM   397  C  CG  . LEU A 1 75  ? 16.357  19.345 -18.368 1.00 46.03 ? 81  LEU A CG  1 
ATOM   398  C  CD1 . LEU A 1 75  ? 15.457  18.628 -17.371 1.00 37.42 ? 81  LEU A CD1 1 
ATOM   399  C  CD2 . LEU A 1 75  ? 17.769  19.477 -17.818 1.00 46.96 ? 81  LEU A CD2 1 
ATOM   400  N  N   . THR A 1 76  ? 18.407  17.981 -22.603 1.00 58.17 ? 82  THR A N   1 
ATOM   401  C  CA  . THR A 1 76  ? 18.597  16.943 -23.614 1.00 58.86 ? 82  THR A CA  1 
ATOM   402  C  C   . THR A 1 76  ? 18.774  15.600 -22.912 1.00 60.82 ? 82  THR A C   1 
ATOM   403  O  O   . THR A 1 76  ? 18.815  15.543 -21.683 1.00 63.33 ? 82  THR A O   1 
ATOM   404  C  CB  . THR A 1 76  ? 19.838  17.212 -24.493 1.00 60.65 ? 82  THR A CB  1 
ATOM   405  O  OG1 . THR A 1 76  ? 21.027  17.138 -23.696 1.00 62.63 ? 82  THR A OG1 1 
ATOM   406  C  CG2 . THR A 1 76  ? 19.752  18.581 -25.158 1.00 57.99 ? 82  THR A CG2 1 
ATOM   407  N  N   . ARG A 1 77  ? 18.879  14.520 -23.682 1.00 56.29 ? 83  ARG A N   1 
ATOM   408  C  CA  . ARG A 1 77  ? 19.131  13.204 -23.101 1.00 60.68 ? 83  ARG A CA  1 
ATOM   409  C  C   . ARG A 1 77  ? 20.463  13.203 -22.360 1.00 64.65 ? 83  ARG A C   1 
ATOM   410  O  O   . ARG A 1 77  ? 20.600  12.569 -21.314 1.00 66.18 ? 83  ARG A O   1 
ATOM   411  C  CB  . ARG A 1 77  ? 19.134  12.115 -24.177 1.00 57.50 ? 83  ARG A CB  1 
ATOM   412  C  CG  . ARG A 1 77  ? 19.438  10.719 -23.641 1.00 55.18 ? 83  ARG A CG  1 
ATOM   413  C  CD  . ARG A 1 77  ? 19.492  9.690  -24.759 1.00 56.55 ? 83  ARG A CD  1 
ATOM   414  N  NE  . ARG A 1 77  ? 18.200  9.041  -24.974 1.00 57.64 ? 83  ARG A NE  1 
ATOM   415  C  CZ  . ARG A 1 77  ? 17.815  7.898  -24.407 1.00 59.94 ? 83  ARG A CZ  1 
ATOM   416  N  NH1 . ARG A 1 77  ? 18.614  7.241  -23.575 1.00 62.59 ? 83  ARG A NH1 1 
ATOM   417  N  NH2 . ARG A 1 77  ? 16.615  7.404  -24.678 1.00 60.50 ? 83  ARG A NH2 1 
ATOM   418  N  N   . GLU A 1 78  ? 21.442  13.916 -22.907 1.00 61.37 ? 84  GLU A N   1 
ATOM   419  C  CA  . GLU A 1 78  ? 22.747  14.034 -22.269 1.00 67.52 ? 84  GLU A CA  1 
ATOM   420  C  C   . GLU A 1 78  ? 22.613  14.703 -20.903 1.00 68.06 ? 84  GLU A C   1 
ATOM   421  O  O   . GLU A 1 78  ? 23.161  14.224 -19.911 1.00 67.59 ? 84  GLU A O   1 
ATOM   422  C  CB  . GLU A 1 78  ? 23.706  14.834 -23.155 1.00 58.19 ? 84  GLU A CB  1 
ATOM   423  N  N   . ASP A 1 79  ? 21.875  15.808 -20.859 1.00 64.05 ? 85  ASP A N   1 
ATOM   424  C  CA  . ASP A 1 79  ? 21.643  16.525 -19.611 1.00 65.04 ? 85  ASP A CA  1 
ATOM   425  C  C   . ASP A 1 79  ? 20.835  15.686 -18.626 1.00 63.14 ? 85  ASP A C   1 
ATOM   426  O  O   . ASP A 1 79  ? 21.055  15.753 -17.416 1.00 60.92 ? 85  ASP A O   1 
ATOM   427  C  CB  . ASP A 1 79  ? 20.921  17.846 -19.884 1.00 65.59 ? 85  ASP A CB  1 
ATOM   428  C  CG  . ASP A 1 79  ? 21.791  18.844 -20.620 1.00 63.87 ? 85  ASP A CG  1 
ATOM   429  O  OD1 . ASP A 1 79  ? 23.012  18.879 -20.358 1.00 65.64 ? 85  ASP A OD1 1 
ATOM   430  O  OD2 . ASP A 1 79  ? 21.253  19.592 -21.464 1.00 67.87 ? 85  ASP A OD2 1 
ATOM   431  N  N   . LEU A 1 80  ? 19.899  14.900 -19.146 1.00 59.35 ? 86  LEU A N   1 
ATOM   432  C  CA  . LEU A 1 80  ? 19.067  14.045 -18.307 1.00 55.72 ? 86  LEU A CA  1 
ATOM   433  C  C   . LEU A 1 80  ? 19.886  12.922 -17.680 1.00 61.84 ? 86  LEU A C   1 
ATOM   434  O  O   . LEU A 1 80  ? 19.626  12.507 -16.550 1.00 66.35 ? 86  LEU A O   1 
ATOM   435  C  CB  . LEU A 1 80  ? 17.923  13.444 -19.125 1.00 58.20 ? 86  LEU A CB  1 
ATOM   436  C  CG  . LEU A 1 80  ? 16.819  14.398 -19.588 1.00 60.12 ? 86  LEU A CG  1 
ATOM   437  C  CD1 . LEU A 1 80  ? 15.986  13.740 -20.677 1.00 55.21 ? 86  LEU A CD1 1 
ATOM   438  C  CD2 . LEU A 1 80  ? 15.940  14.809 -18.421 1.00 59.55 ? 86  LEU A CD2 1 
ATOM   439  N  N   . GLU A 1 81  ? 20.873  12.430 -18.420 1.00 63.06 ? 87  GLU A N   1 
ATOM   440  C  CA  . GLU A 1 81  ? 21.701  11.323 -17.954 1.00 63.99 ? 87  GLU A CA  1 
ATOM   441  C  C   . GLU A 1 81  ? 22.546  11.704 -16.739 1.00 59.76 ? 87  GLU A C   1 
ATOM   442  O  O   . GLU A 1 81  ? 23.044  10.832 -16.026 1.00 58.28 ? 87  GLU A O   1 
ATOM   443  C  CB  . GLU A 1 81  ? 22.597  10.822 -19.088 1.00 63.39 ? 87  GLU A CB  1 
ATOM   444  C  CG  . GLU A 1 81  ? 21.870  9.960  -20.109 1.00 65.75 ? 87  GLU A CG  1 
ATOM   445  C  CD  . GLU A 1 81  ? 22.673  9.755  -21.380 1.00 70.81 ? 87  GLU A CD  1 
ATOM   446  O  OE1 . GLU A 1 81  ? 23.664  10.488 -21.584 1.00 67.45 ? 87  GLU A OE1 1 
ATOM   447  O  OE2 . GLU A 1 81  ? 22.313  8.859  -22.174 1.00 72.61 ? 87  GLU A OE2 1 
ATOM   448  N  N   . LYS A 1 82  ? 22.711  12.990 -16.523 1.00 58.70 ? 88  LYS A N   1 
ATOM   449  C  CA  . LYS A 1 82  ? 23.441  13.473 -15.382 1.00 63.46 ? 88  LYS A CA  1 
ATOM   450  C  C   . LYS A 1 82  ? 22.652  13.369 -14.073 1.00 67.33 ? 88  LYS A C   1 
ATOM   451  O  O   . LYS A 1 82  ? 23.170  13.697 -13.025 1.00 63.03 ? 88  LYS A O   1 
ATOM   452  C  CB  . LYS A 1 82  ? 23.886  14.913 -15.608 1.00 63.56 ? 88  LYS A CB  1 
ATOM   453  C  CG  . LYS A 1 82  ? 24.986  15.067 -16.624 1.00 64.65 ? 88  LYS A CG  1 
ATOM   454  C  CD  . LYS A 1 82  ? 25.090  16.473 -17.163 1.00 63.80 ? 88  LYS A CD  1 
ATOM   455  C  CE  . LYS A 1 82  ? 25.458  16.451 -18.621 1.00 68.51 ? 88  LYS A CE  1 
ATOM   456  N  NZ  . LYS A 1 82  ? 25.683  17.806 -19.192 1.00 75.38 ? 88  LYS A NZ  1 
ATOM   457  N  N   . PHE A 1 83  ? 21.406  12.908 -14.148 1.00 67.08 ? 89  PHE A N   1 
ATOM   458  C  CA  . PHE A 1 83  ? 20.550  12.738 -12.977 1.00 61.83 ? 89  PHE A CA  1 
ATOM   459  C  C   . PHE A 1 83  ? 20.442  11.267 -12.578 1.00 60.51 ? 89  PHE A C   1 
ATOM   460  O  O   . PHE A 1 83  ? 19.845  10.462 -13.293 1.00 60.86 ? 89  PHE A O   1 
ATOM   461  C  CB  . PHE A 1 83  ? 19.159  13.309 -13.251 1.00 62.79 ? 89  PHE A CB  1 
ATOM   462  C  CG  . PHE A 1 83  ? 19.129  14.809 -13.357 1.00 56.51 ? 89  PHE A CG  1 
ATOM   463  C  CD1 . PHE A 1 83  ? 19.270  15.434 -14.582 1.00 54.06 ? 89  PHE A CD1 1 
ATOM   464  C  CD2 . PHE A 1 83  ? 18.962  15.590 -12.229 1.00 56.03 ? 89  PHE A CD2 1 
ATOM   465  C  CE1 . PHE A 1 83  ? 19.243  16.810 -14.680 1.00 56.57 ? 89  PHE A CE1 1 
ATOM   466  C  CE2 . PHE A 1 83  ? 18.934  16.967 -12.321 1.00 53.47 ? 89  PHE A CE2 1 
ATOM   467  C  CZ  . PHE A 1 83  ? 19.075  17.578 -13.548 1.00 54.81 ? 89  PHE A CZ  1 
ATOM   468  N  N   . LYS A 1 84  ? 21.014  10.930 -11.425 1.00 60.85 ? 90  LYS A N   1 
ATOM   469  C  CA  . LYS A 1 84  ? 21.102  9.543  -10.976 1.00 64.70 ? 90  LYS A CA  1 
ATOM   470  C  C   . LYS A 1 84  ? 19.862  9.062  -10.221 1.00 59.52 ? 90  LYS A C   1 
ATOM   471  O  O   . LYS A 1 84  ? 19.560  7.869  -10.219 1.00 64.28 ? 90  LYS A O   1 
ATOM   472  C  CB  . LYS A 1 84  ? 22.334  9.365  -10.086 1.00 50.56 ? 90  LYS A CB  1 
ATOM   473  N  N   . ALA A 1 85  ? 19.151  9.983  -9.580  1.00 63.07 ? 91  ALA A N   1 
ATOM   474  C  CA  . ALA A 1 85  ? 18.017  9.616  -8.737  1.00 59.15 ? 91  ALA A CA  1 
ATOM   475  C  C   . ALA A 1 85  ? 16.706  10.275 -9.170  1.00 56.35 ? 91  ALA A C   1 
ATOM   476  O  O   . ALA A 1 85  ? 15.658  10.031 -8.572  1.00 56.77 ? 91  ALA A O   1 
ATOM   477  C  CB  . ALA A 1 85  ? 18.321  9.964  -7.292  1.00 56.37 ? 91  ALA A CB  1 
ATOM   478  N  N   . LEU A 1 86  ? 16.761  11.100 -10.211 1.00 58.79 ? 92  LEU A N   1 
ATOM   479  C  CA  . LEU A 1 86  ? 15.586  11.840 -10.661 1.00 54.28 ? 92  LEU A CA  1 
ATOM   480  C  C   . LEU A 1 86  ? 14.492  10.893 -11.152 1.00 48.19 ? 92  LEU A C   1 
ATOM   481  O  O   . LEU A 1 86  ? 14.756  9.973  -11.927 1.00 55.60 ? 92  LEU A O   1 
ATOM   482  C  CB  . LEU A 1 86  ? 15.979  12.823 -11.767 1.00 57.77 ? 92  LEU A CB  1 
ATOM   483  C  CG  . LEU A 1 86  ? 14.942  13.856 -12.213 1.00 50.99 ? 92  LEU A CG  1 
ATOM   484  C  CD1 . LEU A 1 86  ? 14.515  14.736 -11.050 1.00 43.38 ? 92  LEU A CD1 1 
ATOM   485  C  CD2 . LEU A 1 86  ? 15.503  14.704 -13.344 1.00 45.70 ? 92  LEU A CD2 1 
ATOM   486  N  N   . ARG A 1 87  ? 13.266  11.125 -10.690 1.00 47.98 ? 93  ARG A N   1 
ATOM   487  C  CA  . ARG A 1 87  ? 12.131  10.271 -11.038 1.00 49.07 ? 93  ARG A CA  1 
ATOM   488  C  C   . ARG A 1 87  ? 10.973  11.034 -11.687 1.00 47.33 ? 93  ARG A C   1 
ATOM   489  O  O   . ARG A 1 87  ? 10.121  10.432 -12.340 1.00 46.14 ? 93  ARG A O   1 
ATOM   490  C  CB  . ARG A 1 87  ? 11.619  9.542  -9.793  1.00 53.54 ? 93  ARG A CB  1 
ATOM   491  C  CG  . ARG A 1 87  ? 12.491  8.376  -9.343  1.00 55.73 ? 93  ARG A CG  1 
ATOM   492  C  CD  . ARG A 1 87  ? 11.802  7.050  -9.631  1.00 59.92 ? 93  ARG A CD  1 
ATOM   493  N  NE  . ARG A 1 87  ? 10.588  6.894  -8.832  1.00 69.97 ? 93  ARG A NE  1 
ATOM   494  C  CZ  . ARG A 1 87  ? 9.567   6.100  -9.146  1.00 69.73 ? 93  ARG A CZ  1 
ATOM   495  N  NH1 . ARG A 1 87  ? 9.584   5.374  -10.257 1.00 57.49 ? 93  ARG A NH1 1 
ATOM   496  N  NH2 . ARG A 1 87  ? 8.514   6.039  -8.343  1.00 66.00 ? 93  ARG A NH2 1 
ATOM   497  N  N   . ILE A 1 88  ? 10.932  12.349 -11.502 1.00 47.88 ? 94  ILE A N   1 
ATOM   498  C  CA  . ILE A 1 88  ? 9.888   13.164 -12.115 1.00 43.66 ? 94  ILE A CA  1 
ATOM   499  C  C   . ILE A 1 88  ? 10.359  14.593 -12.355 1.00 44.67 ? 94  ILE A C   1 
ATOM   500  O  O   . ILE A 1 88  ? 11.100  15.159 -11.551 1.00 43.73 ? 94  ILE A O   1 
ATOM   501  C  CB  . ILE A 1 88  ? 8.612   13.209 -11.249 1.00 50.35 ? 94  ILE A CB  1 
ATOM   502  C  CG1 . ILE A 1 88  ? 7.558   14.102 -11.910 1.00 45.16 ? 94  ILE A CG1 1 
ATOM   503  C  CG2 . ILE A 1 88  ? 8.937   13.723 -9.857  1.00 41.51 ? 94  ILE A CG2 1 
ATOM   504  C  CD1 . ILE A 1 88  ? 6.149   13.871 -11.414 1.00 45.11 ? 94  ILE A CD1 1 
ATOM   505  N  N   . ILE A 1 89  ? 9.930   15.158 -13.479 1.00 45.98 ? 95  ILE A N   1 
ATOM   506  C  CA  . ILE A 1 89  ? 10.154  16.562 -13.787 1.00 43.53 ? 95  ILE A CA  1 
ATOM   507  C  C   . ILE A 1 89  ? 8.792   17.226 -13.912 1.00 41.30 ? 95  ILE A C   1 
ATOM   508  O  O   . ILE A 1 89  ? 7.895   16.689 -14.560 1.00 40.03 ? 95  ILE A O   1 
ATOM   509  C  CB  . ILE A 1 89  ? 10.901  16.740 -15.123 1.00 44.35 ? 95  ILE A CB  1 
ATOM   510  C  CG1 . ILE A 1 89  ? 12.258  16.031 -15.077 1.00 51.56 ? 95  ILE A CG1 1 
ATOM   511  C  CG2 . ILE A 1 89  ? 11.062  18.223 -15.450 1.00 43.27 ? 95  ILE A CG2 1 
ATOM   512  C  CD1 . ILE A 1 89  ? 12.979  15.992 -16.412 1.00 54.01 ? 95  ILE A CD1 1 
ATOM   513  N  N   . VAL A 1 90  ? 8.626   18.386 -13.289 1.00 40.92 ? 96  VAL A N   1 
ATOM   514  C  CA  . VAL A 1 90  ? 7.398   19.148 -13.461 1.00 42.21 ? 96  VAL A CA  1 
ATOM   515  C  C   . VAL A 1 90  ? 7.707   20.518 -14.039 1.00 36.29 ? 96  VAL A C   1 
ATOM   516  O  O   . VAL A 1 90  ? 8.371   21.338 -13.404 1.00 39.48 ? 96  VAL A O   1 
ATOM   517  C  CB  . VAL A 1 90  ? 6.630   19.313 -12.137 1.00 40.69 ? 96  VAL A CB  1 
ATOM   518  C  CG1 . VAL A 1 90  ? 5.389   20.172 -12.347 1.00 38.50 ? 96  VAL A CG1 1 
ATOM   519  C  CG2 . VAL A 1 90  ? 6.249   17.957 -11.578 1.00 35.02 ? 96  VAL A CG2 1 
ATOM   520  N  N   . ARG A 1 91  ? 7.236   20.753 -15.259 1.00 34.23 ? 97  ARG A N   1 
ATOM   521  C  CA  . ARG A 1 91  ? 7.333   22.071 -15.868 1.00 40.15 ? 97  ARG A CA  1 
ATOM   522  C  C   . ARG A 1 91  ? 6.356   23.021 -15.193 1.00 37.70 ? 97  ARG A C   1 
ATOM   523  O  O   . ARG A 1 91  ? 5.146   22.795 -15.217 1.00 41.77 ? 97  ARG A O   1 
ATOM   524  C  CB  . ARG A 1 91  ? 7.019   21.999 -17.363 1.00 39.06 ? 97  ARG A CB  1 
ATOM   525  C  CG  . ARG A 1 91  ? 8.224   21.729 -18.249 1.00 40.66 ? 97  ARG A CG  1 
ATOM   526  C  CD  . ARG A 1 91  ? 9.111   22.956 -18.397 1.00 40.69 ? 97  ARG A CD  1 
ATOM   527  N  NE  . ARG A 1 91  ? 8.430   24.042 -19.104 1.00 40.25 ? 97  ARG A NE  1 
ATOM   528  C  CZ  . ARG A 1 91  ? 7.958   25.155 -18.541 1.00 42.99 ? 97  ARG A CZ  1 
ATOM   529  N  NH1 . ARG A 1 91  ? 8.086   25.379 -17.240 1.00 41.00 ? 97  ARG A NH1 1 
ATOM   530  N  NH2 . ARG A 1 91  ? 7.357   26.063 -19.294 1.00 38.52 ? 97  ARG A NH2 1 
ATOM   531  N  N   . ILE A 1 92  ? 6.881   24.078 -14.583 1.00 37.98 ? 98  ILE A N   1 
ATOM   532  C  CA  . ILE A 1 92  ? 6.032   25.130 -14.045 1.00 33.31 ? 98  ILE A CA  1 
ATOM   533  C  C   . ILE A 1 92  ? 5.595   25.987 -15.226 1.00 37.86 ? 98  ILE A C   1 
ATOM   534  O  O   . ILE A 1 92  ? 6.139   27.063 -15.472 1.00 34.33 ? 98  ILE A O   1 
ATOM   535  C  CB  . ILE A 1 92  ? 6.756   25.975 -12.981 1.00 38.34 ? 98  ILE A CB  1 
ATOM   536  C  CG1 . ILE A 1 92  ? 7.237   25.076 -11.836 1.00 37.31 ? 98  ILE A CG1 1 
ATOM   537  C  CG2 . ILE A 1 92  ? 5.827   27.057 -12.444 1.00 36.74 ? 98  ILE A CG2 1 
ATOM   538  C  CD1 . ILE A 1 92  ? 8.225   25.735 -10.894 1.00 37.22 ? 98  ILE A CD1 1 
ATOM   539  N  N   . GLY A 1 93  ? 4.614   25.475 -15.963 1.00 36.71 ? 99  GLY A N   1 
ATOM   540  C  CA  . GLY A 1 93  ? 4.165   26.073 -17.205 1.00 37.63 ? 99  GLY A CA  1 
ATOM   541  C  C   . GLY A 1 93  ? 3.534   24.984 -18.049 1.00 34.76 ? 99  GLY A C   1 
ATOM   542  O  O   . GLY A 1 93  ? 3.457   23.841 -17.610 1.00 32.41 ? 99  GLY A O   1 
ATOM   543  N  N   . SER A 1 94  ? 3.086   25.325 -19.254 1.00 36.06 ? 100 SER A N   1 
ATOM   544  C  CA  . SER A 1 94  ? 2.413   24.354 -20.111 1.00 41.39 ? 100 SER A CA  1 
ATOM   545  C  C   . SER A 1 94  ? 3.353   23.763 -21.161 1.00 32.46 ? 100 SER A C   1 
ATOM   546  O  O   . SER A 1 94  ? 3.276   22.575 -21.470 1.00 40.62 ? 100 SER A O   1 
ATOM   547  C  CB  . SER A 1 94  ? 1.203   24.993 -20.796 1.00 38.17 ? 100 SER A CB  1 
ATOM   548  O  OG  . SER A 1 94  ? 1.580   26.135 -21.538 1.00 37.33 ? 100 SER A OG  1 
ATOM   549  N  N   . GLY A 1 95  ? 4.232   24.594 -21.709 1.00 37.04 ? 101 GLY A N   1 
ATOM   550  C  CA  . GLY A 1 95  ? 5.138   24.150 -22.751 1.00 35.39 ? 101 GLY A CA  1 
ATOM   551  C  C   . GLY A 1 95  ? 6.290   23.323 -22.217 1.00 41.37 ? 101 GLY A C   1 
ATOM   552  O  O   . GLY A 1 95  ? 6.913   23.676 -21.216 1.00 44.19 ? 101 GLY A O   1 
ATOM   553  N  N   . PHE A 1 96  ? 6.575   22.218 -22.897 1.00 41.25 ? 102 PHE A N   1 
ATOM   554  C  CA  . PHE A 1 96  ? 7.641   21.315 -22.482 1.00 42.90 ? 102 PHE A CA  1 
ATOM   555  C  C   . PHE A 1 96  ? 8.529   20.929 -23.661 1.00 48.44 ? 102 PHE A C   1 
ATOM   556  O  O   . PHE A 1 96  ? 9.100   19.838 -23.693 1.00 46.73 ? 102 PHE A O   1 
ATOM   557  C  CB  . PHE A 1 96  ? 7.042   20.065 -21.842 1.00 38.14 ? 102 PHE A CB  1 
ATOM   558  C  CG  . PHE A 1 96  ? 5.930   19.453 -22.643 1.00 48.18 ? 102 PHE A CG  1 
ATOM   559  C  CD1 . PHE A 1 96  ? 6.205   18.592 -23.688 1.00 45.70 ? 102 PHE A CD1 1 
ATOM   560  C  CD2 . PHE A 1 96  ? 4.611   19.743 -22.351 1.00 42.48 ? 102 PHE A CD2 1 
ATOM   561  C  CE1 . PHE A 1 96  ? 5.188   18.032 -24.427 1.00 38.74 ? 102 PHE A CE1 1 
ATOM   562  C  CE2 . PHE A 1 96  ? 3.585   19.186 -23.086 1.00 43.28 ? 102 PHE A CE2 1 
ATOM   563  C  CZ  . PHE A 1 96  ? 3.873   18.328 -24.126 1.00 44.64 ? 102 PHE A CZ  1 
ATOM   564  N  N   . ASP A 1 97  ? 8.638   21.833 -24.628 1.00 48.55 ? 103 ASP A N   1 
ATOM   565  C  CA  . ASP A 1 97  ? 9.510   21.627 -25.777 1.00 46.30 ? 103 ASP A CA  1 
ATOM   566  C  C   . ASP A 1 97  ? 10.975  21.694 -25.364 1.00 47.33 ? 103 ASP A C   1 
ATOM   567  O  O   . ASP A 1 97  ? 11.857  21.274 -26.111 1.00 52.20 ? 103 ASP A O   1 
ATOM   568  C  CB  . ASP A 1 97  ? 9.232   22.685 -26.840 1.00 42.57 ? 103 ASP A CB  1 
ATOM   569  C  CG  . ASP A 1 97  ? 9.305   24.088 -26.286 1.00 42.81 ? 103 ASP A CG  1 
ATOM   570  O  OD1 . ASP A 1 97  ? 8.343   24.491 -25.600 1.00 44.92 ? 103 ASP A OD1 1 
ATOM   571  O  OD2 . ASP A 1 97  ? 10.315  24.785 -26.526 1.00 41.84 ? 103 ASP A OD2 1 
ATOM   572  N  N   . ASN A 1 98  ? 11.233  22.233 -24.177 1.00 47.57 ? 104 ASN A N   1 
ATOM   573  C  CA  . ASN A 1 98  ? 12.598  22.350 -23.677 1.00 41.49 ? 104 ASN A CA  1 
ATOM   574  C  C   . ASN A 1 98  ? 13.080  21.080 -22.970 1.00 44.74 ? 104 ASN A C   1 
ATOM   575  O  O   . ASN A 1 98  ? 14.128  21.083 -22.326 1.00 48.69 ? 104 ASN A O   1 
ATOM   576  C  CB  . ASN A 1 98  ? 12.712  23.546 -22.732 1.00 38.53 ? 104 ASN A CB  1 
ATOM   577  C  CG  . ASN A 1 98  ? 11.729  23.475 -21.580 1.00 41.41 ? 104 ASN A CG  1 
ATOM   578  O  OD1 . ASN A 1 98  ? 10.625  22.946 -21.718 1.00 40.54 ? 104 ASN A OD1 1 
ATOM   579  N  ND2 . ASN A 1 98  ? 12.125  24.011 -20.435 1.00 41.24 ? 104 ASN A ND2 1 
ATOM   580  N  N   . ILE A 1 99  ? 12.314  19.999 -23.098 1.00 45.21 ? 105 ILE A N   1 
ATOM   581  C  CA  . ILE A 1 99  ? 12.673  18.720 -22.494 1.00 42.66 ? 105 ILE A CA  1 
ATOM   582  C  C   . ILE A 1 99  ? 12.487  17.585 -23.491 1.00 43.20 ? 105 ILE A C   1 
ATOM   583  O  O   . ILE A 1 99  ? 11.434  17.469 -24.116 1.00 46.07 ? 105 ILE A O   1 
ATOM   584  C  CB  . ILE A 1 99  ? 11.788  18.412 -21.272 1.00 46.69 ? 105 ILE A CB  1 
ATOM   585  C  CG1 . ILE A 1 99  ? 11.938  19.500 -20.206 1.00 38.77 ? 105 ILE A CG1 1 
ATOM   586  C  CG2 . ILE A 1 99  ? 12.140  17.047 -20.691 1.00 49.13 ? 105 ILE A CG2 1 
ATOM   587  C  CD1 . ILE A 1 99  ? 10.809  19.521 -19.189 1.00 48.39 ? 105 ILE A CD1 1 
ATOM   588  N  N   . ASP A 1 100 ? 13.510  16.751 -23.640 1.00 49.83 ? 106 ASP A N   1 
ATOM   589  C  CA  . ASP A 1 100 ? 13.375  15.525 -24.413 1.00 52.88 ? 106 ASP A CA  1 
ATOM   590  C  C   . ASP A 1 100 ? 12.570  14.533 -23.580 1.00 49.28 ? 106 ASP A C   1 
ATOM   591  O  O   . ASP A 1 100 ? 13.131  13.674 -22.900 1.00 54.01 ? 106 ASP A O   1 
ATOM   592  C  CB  . ASP A 1 100 ? 14.752  14.957 -24.763 1.00 51.29 ? 106 ASP A CB  1 
ATOM   593  C  CG  . ASP A 1 100 ? 14.669  13.717 -25.630 1.00 56.28 ? 106 ASP A CG  1 
ATOM   594  O  OD1 . ASP A 1 100 ? 13.570  13.131 -25.736 1.00 58.18 ? 106 ASP A OD1 1 
ATOM   595  O  OD2 . ASP A 1 100 ? 15.707  13.325 -26.205 1.00 59.59 ? 106 ASP A OD2 1 
ATOM   596  N  N   . ILE A 1 101 ? 11.248  14.666 -23.637 1.00 52.04 ? 107 ILE A N   1 
ATOM   597  C  CA  . ILE A 1 101 ? 10.356  13.891 -22.779 1.00 51.95 ? 107 ILE A CA  1 
ATOM   598  C  C   . ILE A 1 101 ? 10.349  12.406 -23.128 1.00 54.59 ? 107 ILE A C   1 
ATOM   599  O  O   . ILE A 1 101 ? 10.109  11.562 -22.264 1.00 56.86 ? 107 ILE A O   1 
ATOM   600  C  CB  . ILE A 1 101 ? 8.908   14.423 -22.845 1.00 51.65 ? 107 ILE A CB  1 
ATOM   601  C  CG1 . ILE A 1 101 ? 8.357   14.290 -24.269 1.00 50.04 ? 107 ILE A CG1 1 
ATOM   602  C  CG2 . ILE A 1 101 ? 8.858   15.867 -22.373 1.00 49.71 ? 107 ILE A CG2 1 
ATOM   603  C  CD1 . ILE A 1 101 ? 6.871   14.517 -24.386 1.00 50.67 ? 107 ILE A CD1 1 
ATOM   604  N  N   . LYS A 1 102 ? 10.605  12.088 -24.393 1.00 55.87 ? 108 LYS A N   1 
ATOM   605  C  CA  . LYS A 1 102 ? 10.606  10.700 -24.837 1.00 53.42 ? 108 LYS A CA  1 
ATOM   606  C  C   . LYS A 1 102 ? 11.765  9.947  -24.195 1.00 55.01 ? 108 LYS A C   1 
ATOM   607  O  O   . LYS A 1 102 ? 11.590  8.846  -23.670 1.00 55.66 ? 108 LYS A O   1 
ATOM   608  C  CB  . LYS A 1 102 ? 10.703  10.628 -26.362 1.00 57.64 ? 108 LYS A CB  1 
ATOM   609  N  N   . SER A 1 103 ? 12.948  10.548 -24.244 1.00 51.67 ? 109 SER A N   1 
ATOM   610  C  CA  . SER A 1 103 ? 14.121  9.986  -23.592 1.00 59.56 ? 109 SER A CA  1 
ATOM   611  C  C   . SER A 1 103 ? 13.930  9.983  -22.081 1.00 64.55 ? 109 SER A C   1 
ATOM   612  O  O   . SER A 1 103 ? 14.226  8.992  -21.414 1.00 64.87 ? 109 SER A O   1 
ATOM   613  C  CB  . SER A 1 103 ? 15.366  10.792 -23.962 1.00 55.61 ? 109 SER A CB  1 
ATOM   614  O  OG  . SER A 1 103 ? 15.641  10.686 -25.349 1.00 61.23 ? 109 SER A OG  1 
ATOM   615  N  N   . ALA A 1 104 ? 13.438  11.096 -21.546 1.00 61.29 ? 110 ALA A N   1 
ATOM   616  C  CA  . ALA A 1 104 ? 13.149  11.191 -20.123 1.00 56.87 ? 110 ALA A CA  1 
ATOM   617  C  C   . ALA A 1 104 ? 12.342  9.978  -19.673 1.00 55.50 ? 110 ALA A C   1 
ATOM   618  O  O   . ALA A 1 104 ? 12.647  9.368  -18.649 1.00 58.83 ? 110 ALA A O   1 
ATOM   619  C  CB  . ALA A 1 104 ? 12.393  12.469 -19.822 1.00 57.89 ? 110 ALA A CB  1 
ATOM   620  N  N   . GLY A 1 105 ? 11.318  9.629  -20.447 1.00 53.54 ? 111 GLY A N   1 
ATOM   621  C  CA  . GLY A 1 105 ? 10.490  8.475  -20.146 1.00 56.96 ? 111 GLY A CA  1 
ATOM   622  C  C   . GLY A 1 105 ? 11.244  7.166  -20.284 1.00 64.91 ? 111 GLY A C   1 
ATOM   623  O  O   . GLY A 1 105 ? 11.033  6.237  -19.503 1.00 60.97 ? 111 GLY A O   1 
ATOM   624  N  N   . ASP A 1 106 ? 12.116  7.082  -21.285 1.00 62.45 ? 112 ASP A N   1 
ATOM   625  C  CA  . ASP A 1 106 ? 12.964  5.907  -21.455 1.00 63.14 ? 112 ASP A CA  1 
ATOM   626  C  C   . ASP A 1 106 ? 13.863  5.718  -20.238 1.00 60.69 ? 112 ASP A C   1 
ATOM   627  O  O   . ASP A 1 106 ? 14.176  4.591  -19.855 1.00 59.16 ? 112 ASP A O   1 
ATOM   628  C  CB  . ASP A 1 106 ? 13.816  6.032  -22.720 1.00 60.87 ? 112 ASP A CB  1 
ATOM   629  C  CG  . ASP A 1 106 ? 12.996  5.925  -23.993 1.00 56.22 ? 112 ASP A CG  1 
ATOM   630  O  OD1 . ASP A 1 106 ? 11.890  5.342  -23.950 1.00 58.50 ? 112 ASP A OD1 1 
ATOM   631  O  OD2 . ASP A 1 106 ? 13.463  6.419  -25.041 1.00 59.77 ? 112 ASP A OD2 1 
ATOM   632  N  N   . LEU A 1 107 ? 14.269  6.827  -19.629 1.00 62.05 ? 113 LEU A N   1 
ATOM   633  C  CA  . LEU A 1 107 ? 15.115  6.785  -18.442 1.00 56.82 ? 113 LEU A CA  1 
ATOM   634  C  C   . LEU A 1 107 ? 14.286  6.607  -17.171 1.00 59.44 ? 113 LEU A C   1 
ATOM   635  O  O   . LEU A 1 107 ? 14.822  6.642  -16.063 1.00 61.23 ? 113 LEU A O   1 
ATOM   636  C  CB  . LEU A 1 107 ? 15.950  8.063  -18.345 1.00 52.63 ? 113 LEU A CB  1 
ATOM   637  C  CG  . LEU A 1 107 ? 17.017  8.234  -19.429 1.00 60.23 ? 113 LEU A CG  1 
ATOM   638  C  CD1 . LEU A 1 107 ? 17.599  9.639  -19.405 1.00 55.72 ? 113 LEU A CD1 1 
ATOM   639  C  CD2 . LEU A 1 107 ? 18.122  7.198  -19.271 1.00 65.09 ? 113 LEU A CD2 1 
ATOM   640  N  N   . GLY A 1 108 ? 12.981  6.416  -17.337 1.00 62.01 ? 114 GLY A N   1 
ATOM   641  C  CA  . GLY A 1 108 ? 12.086  6.198  -16.213 1.00 62.48 ? 114 GLY A CA  1 
ATOM   642  C  C   . GLY A 1 108 ? 11.686  7.480  -15.505 1.00 60.73 ? 114 GLY A C   1 
ATOM   643  O  O   . GLY A 1 108 ? 11.260  7.452  -14.350 1.00 56.26 ? 114 GLY A O   1 
ATOM   644  N  N   . ILE A 1 109 ? 11.807  8.604  -16.203 1.00 59.82 ? 115 ILE A N   1 
ATOM   645  C  CA  . ILE A 1 109 ? 11.518  9.906  -15.617 1.00 52.97 ? 115 ILE A CA  1 
ATOM   646  C  C   . ILE A 1 109 ? 10.214  10.470 -16.170 1.00 52.06 ? 115 ILE A C   1 
ATOM   647  O  O   . ILE A 1 109 ? 10.137  10.842 -17.340 1.00 52.97 ? 115 ILE A O   1 
ATOM   648  C  CB  . ILE A 1 109 ? 12.653  10.913 -15.900 1.00 54.59 ? 115 ILE A CB  1 
ATOM   649  C  CG1 . ILE A 1 109 ? 14.002  10.336 -15.453 1.00 53.29 ? 115 ILE A CG1 1 
ATOM   650  C  CG2 . ILE A 1 109 ? 12.365  12.236 -15.208 1.00 51.31 ? 115 ILE A CG2 1 
ATOM   651  C  CD1 . ILE A 1 109 ? 15.185  11.286 -15.626 1.00 54.29 ? 115 ILE A CD1 1 
ATOM   652  N  N   . ALA A 1 110 ? 9.189   10.529 -15.325 1.00 49.72 ? 116 ALA A N   1 
ATOM   653  C  CA  . ALA A 1 110 ? 7.916   11.123 -15.713 1.00 48.54 ? 116 ALA A CA  1 
ATOM   654  C  C   . ALA A 1 110 ? 8.089   12.630 -15.887 1.00 45.98 ? 116 ALA A C   1 
ATOM   655  O  O   . ALA A 1 110 ? 8.808   13.271 -15.123 1.00 47.24 ? 116 ALA A O   1 
ATOM   656  C  CB  . ALA A 1 110 ? 6.853   10.830 -14.667 1.00 42.71 ? 116 ALA A CB  1 
ATOM   657  N  N   . VAL A 1 111 ? 7.434   13.189 -16.899 1.00 46.47 ? 117 VAL A N   1 
ATOM   658  C  CA  . VAL A 1 111 ? 7.449   14.631 -17.120 1.00 48.65 ? 117 VAL A CA  1 
ATOM   659  C  C   . VAL A 1 111 ? 6.009   15.144 -17.123 1.00 47.55 ? 117 VAL A C   1 
ATOM   660  O  O   . VAL A 1 111 ? 5.135   14.553 -17.757 1.00 43.11 ? 117 VAL A O   1 
ATOM   661  C  CB  . VAL A 1 111 ? 8.150   15.002 -18.446 1.00 49.98 ? 117 VAL A CB  1 
ATOM   662  C  CG1 . VAL A 1 111 ? 8.137   16.509 -18.656 1.00 46.47 ? 117 VAL A CG1 1 
ATOM   663  C  CG2 . VAL A 1 111 ? 9.581   14.479 -18.458 1.00 47.73 ? 117 VAL A CG2 1 
ATOM   664  N  N   . CYS A 1 112 ? 5.764   16.232 -16.398 1.00 45.15 ? 118 CYS A N   1 
ATOM   665  C  CA  . CYS A 1 112 ? 4.423   16.793 -16.277 1.00 41.62 ? 118 CYS A CA  1 
ATOM   666  C  C   . CYS A 1 112 ? 4.470   18.298 -16.504 1.00 38.21 ? 118 CYS A C   1 
ATOM   667  O  O   . CYS A 1 112 ? 5.541   18.903 -16.471 1.00 37.56 ? 118 CYS A O   1 
ATOM   668  C  CB  . CYS A 1 112 ? 3.840   16.499 -14.891 1.00 44.23 ? 118 CYS A CB  1 
ATOM   669  S  SG  . CYS A 1 112 ? 3.981   14.774 -14.361 1.00 44.20 ? 118 CYS A SG  1 
ATOM   670  N  N   . ASN A 1 113 ? 3.308   18.899 -16.732 1.00 38.51 ? 119 ASN A N   1 
ATOM   671  C  CA  . ASN A 1 113 ? 3.223   20.339 -16.934 1.00 37.90 ? 119 ASN A CA  1 
ATOM   672  C  C   . ASN A 1 113 ? 2.062   20.942 -16.148 1.00 33.78 ? 119 ASN A C   1 
ATOM   673  O  O   . ASN A 1 113 ? 1.396   20.249 -15.376 1.00 30.96 ? 119 ASN A O   1 
ATOM   674  C  CB  . ASN A 1 113 ? 3.083   20.658 -18.426 1.00 34.68 ? 119 ASN A CB  1 
ATOM   675  C  CG  . ASN A 1 113 ? 1.760   20.198 -19.000 1.00 35.08 ? 119 ASN A CG  1 
ATOM   676  O  OD1 . ASN A 1 113 ? 1.105   19.312 -18.452 1.00 36.09 ? 119 ASN A OD1 1 
ATOM   677  N  ND2 . ASN A 1 113 ? 1.363   20.796 -20.116 1.00 34.72 ? 119 ASN A ND2 1 
ATOM   678  N  N   . VAL A 1 114 ? 1.831   22.236 -16.352 1.00 34.43 ? 120 VAL A N   1 
ATOM   679  C  CA  . VAL A 1 114 ? 0.747   22.960 -15.697 1.00 37.51 ? 120 VAL A CA  1 
ATOM   680  C  C   . VAL A 1 114 ? 0.013   23.787 -16.751 1.00 32.21 ? 120 VAL A C   1 
ATOM   681  O  O   . VAL A 1 114 ? 0.361   24.943 -16.992 1.00 38.38 ? 120 VAL A O   1 
ATOM   682  C  CB  . VAL A 1 114 ? 1.287   23.887 -14.600 1.00 34.54 ? 120 VAL A CB  1 
ATOM   683  C  CG1 . VAL A 1 114 ? 0.155   24.658 -13.952 1.00 31.62 ? 120 VAL A CG1 1 
ATOM   684  C  CG2 . VAL A 1 114 ? 2.042   23.077 -13.564 1.00 32.95 ? 120 VAL A CG2 1 
ATOM   685  N  N   . PRO A 1 115 ? -1.002  23.184 -17.390 1.00 32.65 ? 121 PRO A N   1 
ATOM   686  C  CA  . PRO A 1 115 ? -1.693  23.692 -18.585 1.00 33.78 ? 121 PRO A CA  1 
ATOM   687  C  C   . PRO A 1 115 ? -2.807  24.723 -18.363 1.00 35.27 ? 121 PRO A C   1 
ATOM   688  O  O   . PRO A 1 115 ? -3.245  25.321 -19.346 1.00 42.06 ? 121 PRO A O   1 
ATOM   689  C  CB  . PRO A 1 115 ? -2.311  22.422 -19.177 1.00 38.89 ? 121 PRO A CB  1 
ATOM   690  C  CG  . PRO A 1 115 ? -2.570  21.568 -17.999 1.00 35.81 ? 121 PRO A CG  1 
ATOM   691  C  CD  . PRO A 1 115 ? -1.438  21.818 -17.050 1.00 32.92 ? 121 PRO A CD  1 
ATOM   692  N  N   . ALA A 1 116 ? -3.258  24.931 -17.129 1.00 33.04 ? 122 ALA A N   1 
ATOM   693  C  CA  . ALA A 1 116 ? -4.480  25.705 -16.899 1.00 38.47 ? 122 ALA A CA  1 
ATOM   694  C  C   . ALA A 1 116 ? -4.268  27.125 -16.362 1.00 32.88 ? 122 ALA A C   1 
ATOM   695  O  O   . ALA A 1 116 ? -5.099  28.004 -16.587 1.00 36.70 ? 122 ALA A O   1 
ATOM   696  C  CB  . ALA A 1 116 ? -5.401  24.936 -15.962 1.00 39.26 ? 122 ALA A CB  1 
ATOM   697  N  N   . ALA A 1 117 ? -3.165  27.348 -15.657 1.00 36.61 ? 123 ALA A N   1 
ATOM   698  C  CA  . ALA A 1 117 ? -3.000  28.556 -14.848 1.00 40.27 ? 123 ALA A CA  1 
ATOM   699  C  C   . ALA A 1 117 ? -3.095  29.877 -15.621 1.00 38.24 ? 123 ALA A C   1 
ATOM   700  O  O   . ALA A 1 117 ? -3.742  30.819 -15.157 1.00 41.77 ? 123 ALA A O   1 
ATOM   701  C  CB  . ALA A 1 117 ? -1.686  28.492 -14.094 1.00 37.99 ? 123 ALA A CB  1 
ATOM   702  N  N   . SER A 1 118 ? -2.455  29.953 -16.784 1.00 32.86 ? 124 SER A N   1 
ATOM   703  C  CA  . SER A 1 118 ? -2.335  31.228 -17.490 1.00 31.47 ? 124 SER A CA  1 
ATOM   704  C  C   . SER A 1 118 ? -3.001  31.223 -18.863 1.00 31.41 ? 124 SER A C   1 
ATOM   705  O  O   . SER A 1 118 ? -2.546  31.906 -19.780 1.00 34.73 ? 124 SER A O   1 
ATOM   706  C  CB  . SER A 1 118 ? -0.858  31.601 -17.642 1.00 27.35 ? 124 SER A CB  1 
ATOM   707  O  OG  . SER A 1 118 ? -0.245  31.772 -16.378 1.00 35.60 ? 124 SER A OG  1 
ATOM   708  N  N   . VAL A 1 119 ? -4.081  30.463 -19.004 1.00 31.27 ? 125 VAL A N   1 
ATOM   709  C  CA  . VAL A 1 119 ? -4.764  30.358 -20.287 1.00 29.67 ? 125 VAL A CA  1 
ATOM   710  C  C   . VAL A 1 119 ? -5.345  31.699 -20.704 1.00 26.23 ? 125 VAL A C   1 
ATOM   711  O  O   . VAL A 1 119 ? -5.127  32.158 -21.825 1.00 29.39 ? 125 VAL A O   1 
ATOM   712  C  CB  . VAL A 1 119 ? -5.902  29.323 -20.239 1.00 32.88 ? 125 VAL A CB  1 
ATOM   713  C  CG1 . VAL A 1 119 ? -6.659  29.299 -21.559 1.00 34.48 ? 125 VAL A CG1 1 
ATOM   714  C  CG2 . VAL A 1 119 ? -5.352  27.947 -19.918 1.00 27.87 ? 125 VAL A CG2 1 
ATOM   715  N  N   . GLU A 1 120 ? -6.091  32.325 -19.801 1.00 27.39 ? 126 GLU A N   1 
ATOM   716  C  CA  . GLU A 1 120 ? -6.794  33.557 -20.128 1.00 28.74 ? 126 GLU A CA  1 
ATOM   717  C  C   . GLU A 1 120 ? -5.865  34.767 -20.126 1.00 27.02 ? 126 GLU A C   1 
ATOM   718  O  O   . GLU A 1 120 ? -6.057  35.696 -20.911 1.00 27.58 ? 126 GLU A O   1 
ATOM   719  C  CB  . GLU A 1 120 ? -7.972  33.765 -19.175 1.00 27.31 ? 126 GLU A CB  1 
ATOM   720  C  CG  . GLU A 1 120 ? -9.024  32.676 -19.296 1.00 26.08 ? 126 GLU A CG  1 
ATOM   721  C  CD  . GLU A 1 120 ? -10.344 33.057 -18.660 1.00 32.05 ? 126 GLU A CD  1 
ATOM   722  O  OE1 . GLU A 1 120 ? -11.333 33.238 -19.404 1.00 30.15 ? 126 GLU A OE1 1 
ATOM   723  O  OE2 . GLU A 1 120 ? -10.395 33.174 -17.419 1.00 32.57 ? 126 GLU A OE2 1 
ATOM   724  N  N   . GLU A 1 121 ? -4.863  34.757 -19.249 1.00 27.98 ? 127 GLU A N   1 
ATOM   725  C  CA  . GLU A 1 121 ? -3.824  35.782 -19.281 1.00 32.44 ? 127 GLU A CA  1 
ATOM   726  C  C   . GLU A 1 121 ? -3.168  35.796 -20.654 1.00 28.59 ? 127 GLU A C   1 
ATOM   727  O  O   . GLU A 1 121 ? -2.973  36.852 -21.257 1.00 31.58 ? 127 GLU A O   1 
ATOM   728  C  CB  . GLU A 1 121 ? -2.755  35.518 -18.217 1.00 29.80 ? 127 GLU A CB  1 
ATOM   729  C  CG  . GLU A 1 121 ? -3.100  36.013 -16.819 1.00 29.50 ? 127 GLU A CG  1 
ATOM   730  C  CD  . GLU A 1 121 ? -3.970  35.049 -16.042 1.00 31.22 ? 127 GLU A CD  1 
ATOM   731  O  OE1 . GLU A 1 121 ? -4.413  34.034 -16.623 1.00 32.55 ? 127 GLU A OE1 1 
ATOM   732  O  OE2 . GLU A 1 121 ? -4.208  35.311 -14.841 1.00 24.90 ? 127 GLU A OE2 1 
ATOM   733  N  N   . THR A 1 122 ? -2.833  34.609 -21.145 1.00 29.59 ? 128 THR A N   1 
ATOM   734  C  CA  . THR A 1 122 ? -2.149  34.477 -22.422 1.00 28.60 ? 128 THR A CA  1 
ATOM   735  C  C   . THR A 1 122 ? -3.072  34.879 -23.563 1.00 28.75 ? 128 THR A C   1 
ATOM   736  O  O   . THR A 1 122 ? -2.632  35.481 -24.544 1.00 24.60 ? 128 THR A O   1 
ATOM   737  C  CB  . THR A 1 122 ? -1.658  33.038 -22.648 1.00 25.46 ? 128 THR A CB  1 
ATOM   738  O  OG1 . THR A 1 122 ? -0.732  32.676 -21.615 1.00 29.21 ? 128 THR A OG1 1 
ATOM   739  C  CG2 . THR A 1 122 ? -0.972  32.912 -23.996 1.00 27.13 ? 128 THR A CG2 1 
ATOM   740  N  N   . ALA A 1 123 ? -4.353  34.549 -23.429 1.00 22.69 ? 129 ALA A N   1 
ATOM   741  C  CA  . ALA A 1 123 ? -5.339  34.912 -24.438 1.00 23.06 ? 129 ALA A CA  1 
ATOM   742  C  C   . ALA A 1 123 ? -5.577  36.419 -24.443 1.00 26.33 ? 129 ALA A C   1 
ATOM   743  O  O   . ALA A 1 123 ? -5.796  37.019 -25.495 1.00 26.67 ? 129 ALA A O   1 
ATOM   744  C  CB  . ALA A 1 123 ? -6.641  34.174 -24.192 1.00 24.39 ? 129 ALA A CB  1 
ATOM   745  N  N   . ASP A 1 124 ? -5.539  37.028 -23.262 1.00 24.12 ? 130 ASP A N   1 
ATOM   746  C  CA  . ASP A 1 124 ? -5.728  38.470 -23.142 1.00 29.27 ? 130 ASP A CA  1 
ATOM   747  C  C   . ASP A 1 124 ? -4.543  39.222 -23.745 1.00 29.51 ? 130 ASP A C   1 
ATOM   748  O  O   . ASP A 1 124 ? -4.713  40.250 -24.397 1.00 26.43 ? 130 ASP A O   1 
ATOM   749  C  CB  . ASP A 1 124 ? -5.911  38.863 -21.674 1.00 30.71 ? 130 ASP A CB  1 
ATOM   750  C  CG  . ASP A 1 124 ? -7.170  38.269 -21.062 1.00 30.17 ? 130 ASP A CG  1 
ATOM   751  O  OD1 . ASP A 1 124 ? -8.032  37.781 -21.823 1.00 29.13 ? 130 ASP A OD1 1 
ATOM   752  O  OD2 . ASP A 1 124 ? -7.301  38.296 -19.820 1.00 31.18 ? 130 ASP A OD2 1 
ATOM   753  N  N   . SER A 1 125 ? -3.340  38.703 -23.521 1.00 30.31 ? 131 SER A N   1 
ATOM   754  C  CA  . SER A 1 125 ? -2.139  39.296 -24.098 1.00 29.58 ? 131 SER A CA  1 
ATOM   755  C  C   . SER A 1 125 ? -2.168  39.195 -25.607 1.00 29.34 ? 131 SER A C   1 
ATOM   756  O  O   . SER A 1 125 ? -1.807  40.131 -26.316 1.00 32.15 ? 131 SER A O   1 
ATOM   757  C  CB  . SER A 1 125 ? -0.900  38.602 -23.548 1.00 29.82 ? 131 SER A CB  1 
ATOM   758  O  OG  . SER A 1 125 ? -0.849  38.828 -22.155 1.00 29.05 ? 131 SER A OG  1 
ATOM   759  N  N   . THR A 1 126 ? -2.610  38.043 -26.089 1.00 25.20 ? 132 THR A N   1 
ATOM   760  C  CA  . THR A 1 126 ? -2.719  37.811 -27.514 1.00 28.60 ? 132 THR A CA  1 
ATOM   761  C  C   . THR A 1 126 ? -3.654  38.835 -28.146 1.00 28.87 ? 132 THR A C   1 
ATOM   762  O  O   . THR A 1 126 ? -3.356  39.381 -29.207 1.00 31.77 ? 132 THR A O   1 
ATOM   763  C  CB  . THR A 1 126 ? -3.236  36.396 -27.800 1.00 25.22 ? 132 THR A CB  1 
ATOM   764  O  OG1 . THR A 1 126 ? -2.304  35.433 -27.289 1.00 24.54 ? 132 THR A OG1 1 
ATOM   765  C  CG2 . THR A 1 126 ? -3.404  36.182 -29.292 1.00 23.91 ? 132 THR A CG2 1 
ATOM   766  N  N   . LEU A 1 127 ? -4.773  39.111 -27.484 1.00 25.29 ? 133 LEU A N   1 
ATOM   767  C  CA  . LEU A 1 127 ? -5.731  40.088 -27.993 1.00 29.60 ? 133 LEU A CA  1 
ATOM   768  C  C   . LEU A 1 127 ? -5.155  41.496 -27.939 1.00 23.48 ? 133 LEU A C   1 
ATOM   769  O  O   . LEU A 1 127 ? -5.352  42.295 -28.854 1.00 30.13 ? 133 LEU A O   1 
ATOM   770  C  CB  . LEU A 1 127 ? -7.039  40.031 -27.197 1.00 25.48 ? 133 LEU A CB  1 
ATOM   771  C  CG  . LEU A 1 127 ? -8.175  39.229 -27.837 1.00 32.24 ? 133 LEU A CG  1 
ATOM   772  C  CD1 . LEU A 1 127 ? -8.603  39.862 -29.150 1.00 26.57 ? 133 LEU A CD1 1 
ATOM   773  C  CD2 . LEU A 1 127 ? -7.752  37.792 -28.047 1.00 27.93 ? 133 LEU A CD2 1 
ATOM   774  N  N   . CYS A 1 128 ? -4.447  41.798 -26.858 1.00 26.75 ? 134 CYS A N   1 
ATOM   775  C  CA  . CYS A 1 128 ? -3.783  43.086 -26.715 1.00 29.98 ? 134 CYS A CA  1 
ATOM   776  C  C   . CYS A 1 128 ? -2.846  43.334 -27.896 1.00 28.06 ? 134 CYS A C   1 
ATOM   777  O  O   . CYS A 1 128 ? -2.864  44.403 -28.506 1.00 30.30 ? 134 CYS A O   1 
ATOM   778  C  CB  . CYS A 1 128 ? -2.996  43.124 -25.407 1.00 28.13 ? 134 CYS A CB  1 
ATOM   779  S  SG  . CYS A 1 128 ? -2.308  44.745 -25.007 1.00 34.27 ? 134 CYS A SG  1 
ATOM   780  N  N   . HIS A 1 129 ? -2.029  42.333 -28.212 1.00 23.88 ? 135 HIS A N   1 
ATOM   781  C  CA  . HIS A 1 129 ? -1.114  42.407 -29.347 1.00 29.06 ? 135 HIS A CA  1 
ATOM   782  C  C   . HIS A 1 129 ? -1.858  42.575 -30.670 1.00 31.20 ? 135 HIS A C   1 
ATOM   783  O  O   . HIS A 1 129 ? -1.481  43.403 -31.498 1.00 32.91 ? 135 HIS A O   1 
ATOM   784  C  CB  . HIS A 1 129 ? -0.250  41.148 -29.405 1.00 28.59 ? 135 HIS A CB  1 
ATOM   785  C  CG  . HIS A 1 129 ? 0.925   41.181 -28.478 1.00 36.24 ? 135 HIS A CG  1 
ATOM   786  N  ND1 . HIS A 1 129 ? 1.233   40.131 -27.633 1.00 42.13 ? 135 HIS A ND1 1 
ATOM   787  C  CD2 . HIS A 1 129 ? 1.876   42.115 -28.269 1.00 41.81 ? 135 HIS A CD2 1 
ATOM   788  C  CE1 . HIS A 1 129 ? 2.315   40.426 -26.943 1.00 37.27 ? 135 HIS A CE1 1 
ATOM   789  N  NE2 . HIS A 1 129 ? 2.731   41.633 -27.310 1.00 43.43 ? 135 HIS A NE2 1 
ATOM   790  N  N   . ILE A 1 130 ? -2.906  41.782 -30.870 1.00 28.50 ? 136 ILE A N   1 
ATOM   791  C  CA  . ILE A 1 130 ? -3.717  41.882 -32.077 1.00 33.02 ? 136 ILE A CA  1 
ATOM   792  C  C   . ILE A 1 130 ? -4.296  43.282 -32.204 1.00 28.01 ? 136 ILE A C   1 
ATOM   793  O  O   . ILE A 1 130 ? -4.275  43.875 -33.281 1.00 29.50 ? 136 ILE A O   1 
ATOM   794  C  CB  . ILE A 1 130 ? -4.867  40.855 -32.071 1.00 28.59 ? 136 ILE A CB  1 
ATOM   795  C  CG1 . ILE A 1 130 ? -4.310  39.436 -32.211 1.00 28.40 ? 136 ILE A CG1 1 
ATOM   796  C  CG2 . ILE A 1 130 ? -5.846  41.139 -33.205 1.00 24.38 ? 136 ILE A CG2 1 
ATOM   797  C  CD1 . ILE A 1 130 ? -5.326  38.348 -31.927 1.00 25.11 ? 136 ILE A CD1 1 
ATOM   798  N  N   . LEU A 1 131 ? -4.802  43.809 -31.094 1.00 32.42 ? 137 LEU A N   1 
ATOM   799  C  CA  . LEU A 1 131 ? -5.400  45.138 -31.076 1.00 29.62 ? 137 LEU A CA  1 
ATOM   800  C  C   . LEU A 1 131 ? -4.346  46.230 -31.231 1.00 30.65 ? 137 LEU A C   1 
ATOM   801  O  O   . LEU A 1 131 ? -4.618  47.291 -31.795 1.00 31.63 ? 137 LEU A O   1 
ATOM   802  C  CB  . LEU A 1 131 ? -6.185  45.350 -29.779 1.00 29.18 ? 137 LEU A CB  1 
ATOM   803  C  CG  . LEU A 1 131 ? -7.481  44.545 -29.638 1.00 28.02 ? 137 LEU A CG  1 
ATOM   804  C  CD1 . LEU A 1 131 ? -8.083  44.744 -28.257 1.00 22.42 ? 137 LEU A CD1 1 
ATOM   805  C  CD2 . LEU A 1 131 ? -8.481  44.929 -30.714 1.00 26.15 ? 137 LEU A CD2 1 
ATOM   806  N  N   . ASN A 1 132 ? -3.142  45.972 -30.732 1.00 30.36 ? 138 ASN A N   1 
ATOM   807  C  CA  . ASN A 1 132 ? -2.052  46.929 -30.881 1.00 34.73 ? 138 ASN A CA  1 
ATOM   808  C  C   . ASN A 1 132 ? -1.599  47.038 -32.334 1.00 32.09 ? 138 ASN A C   1 
ATOM   809  O  O   . ASN A 1 132 ? -1.177  48.102 -32.781 1.00 32.53 ? 138 ASN A O   1 
ATOM   810  C  CB  . ASN A 1 132 ? -0.875  46.553 -29.980 1.00 31.90 ? 138 ASN A CB  1 
ATOM   811  C  CG  . ASN A 1 132 ? -1.020  47.108 -28.573 1.00 35.61 ? 138 ASN A CG  1 
ATOM   812  O  OD1 . ASN A 1 132 ? -1.377  48.271 -28.385 1.00 33.94 ? 138 ASN A OD1 1 
ATOM   813  N  ND2 . ASN A 1 132 ? -0.751  46.274 -27.578 1.00 33.07 ? 138 ASN A ND2 1 
ATOM   814  N  N   . LEU A 1 133 ? -1.700  45.937 -33.072 1.00 29.12 ? 139 LEU A N   1 
ATOM   815  C  CA  . LEU A 1 133 ? -1.390  45.950 -34.496 1.00 32.79 ? 139 LEU A CA  1 
ATOM   816  C  C   . LEU A 1 133 ? -2.491  46.652 -35.285 1.00 35.85 ? 139 LEU A C   1 
ATOM   817  O  O   . LEU A 1 133 ? -2.213  47.471 -36.163 1.00 33.24 ? 139 LEU A O   1 
ATOM   818  C  CB  . LEU A 1 133 ? -1.223  44.525 -35.024 1.00 33.43 ? 139 LEU A CB  1 
ATOM   819  C  CG  . LEU A 1 133 ? -0.004  43.721 -34.567 1.00 32.48 ? 139 LEU A CG  1 
ATOM   820  C  CD1 . LEU A 1 133 ? -0.074  42.313 -35.135 1.00 28.14 ? 139 LEU A CD1 1 
ATOM   821  C  CD2 . LEU A 1 133 ? 1.287   44.398 -34.990 1.00 31.17 ? 139 LEU A CD2 1 
ATOM   822  N  N   . TYR A 1 134 ? -3.741  46.327 -34.971 1.00 30.88 ? 140 TYR A N   1 
ATOM   823  C  CA  . TYR A 1 134 ? -4.879  46.871 -35.704 1.00 30.15 ? 140 TYR A CA  1 
ATOM   824  C  C   . TYR A 1 134 ? -5.150  48.335 -35.376 1.00 33.44 ? 140 TYR A C   1 
ATOM   825  O  O   . TYR A 1 134 ? -5.625  49.086 -36.229 1.00 35.03 ? 140 TYR A O   1 
ATOM   826  C  CB  . TYR A 1 134 ? -6.139  46.047 -35.424 1.00 26.06 ? 140 TYR A CB  1 
ATOM   827  C  CG  . TYR A 1 134 ? -6.338  44.899 -36.388 1.00 25.17 ? 140 TYR A CG  1 
ATOM   828  C  CD1 . TYR A 1 134 ? -6.911  45.107 -37.632 1.00 29.01 ? 140 TYR A CD1 1 
ATOM   829  C  CD2 . TYR A 1 134 ? -5.953  43.612 -36.056 1.00 26.19 ? 140 TYR A CD2 1 
ATOM   830  C  CE1 . TYR A 1 134 ? -7.094  44.066 -38.517 1.00 31.70 ? 140 TYR A CE1 1 
ATOM   831  C  CE2 . TYR A 1 134 ? -6.131  42.566 -36.934 1.00 24.38 ? 140 TYR A CE2 1 
ATOM   832  C  CZ  . TYR A 1 134 ? -6.701  42.798 -38.165 1.00 27.11 ? 140 TYR A CZ  1 
ATOM   833  O  OH  . TYR A 1 134 ? -6.890  41.756 -39.049 1.00 35.54 ? 140 TYR A OH  1 
ATOM   834  N  N   . ARG A 1 135 ? -4.853  48.738 -34.145 1.00 31.96 ? 141 ARG A N   1 
ATOM   835  C  CA  . ARG A 1 135 ? -5.150  50.094 -33.694 1.00 32.09 ? 141 ARG A CA  1 
ATOM   836  C  C   . ARG A 1 135 ? -3.884  50.937 -33.534 1.00 33.38 ? 141 ARG A C   1 
ATOM   837  O  O   . ARG A 1 135 ? -3.959  52.157 -33.378 1.00 34.04 ? 141 ARG A O   1 
ATOM   838  C  CB  . ARG A 1 135 ? -5.924  50.051 -32.375 1.00 28.37 ? 141 ARG A CB  1 
ATOM   839  C  CG  . ARG A 1 135 ? -7.169  49.166 -32.415 1.00 29.26 ? 141 ARG A CG  1 
ATOM   840  C  CD  . ARG A 1 135 ? -8.069  49.523 -33.588 1.00 30.89 ? 141 ARG A CD  1 
ATOM   841  N  NE  . ARG A 1 135 ? -8.357  50.954 -33.624 1.00 33.57 ? 141 ARG A NE  1 
ATOM   842  C  CZ  . ARG A 1 135 ? -8.626  51.653 -34.724 1.00 34.32 ? 141 ARG A CZ  1 
ATOM   843  N  NH1 . ARG A 1 135 ? -8.869  52.950 -34.617 1.00 36.65 ? 141 ARG A NH1 1 
ATOM   844  N  NH2 . ARG A 1 135 ? -8.648  51.074 -35.921 1.00 28.89 ? 141 ARG A NH2 1 
ATOM   845  N  N   . ARG A 1 136 ? -2.729  50.277 -33.565 1.00 37.56 ? 142 ARG A N   1 
ATOM   846  C  CA  . ARG A 1 136 ? -1.437  50.958 -33.539 1.00 38.39 ? 142 ARG A CA  1 
ATOM   847  C  C   . ARG A 1 136 ? -1.235  51.771 -32.258 1.00 41.67 ? 142 ARG A C   1 
ATOM   848  O  O   . ARG A 1 136 ? -0.517  52.768 -32.256 1.00 44.61 ? 142 ARG A O   1 
ATOM   849  C  CB  . ARG A 1 136 ? -1.279  51.858 -34.774 1.00 36.19 ? 142 ARG A CB  1 
ATOM   850  C  CG  . ARG A 1 136 ? -1.239  51.101 -36.104 1.00 39.48 ? 142 ARG A CG  1 
ATOM   851  C  CD  . ARG A 1 136 ? -0.808  52.005 -37.256 1.00 43.55 ? 142 ARG A CD  1 
ATOM   852  N  NE  . ARG A 1 136 ? 0.645   52.181 -37.305 1.00 48.51 ? 142 ARG A NE  1 
ATOM   853  C  CZ  . ARG A 1 136 ? 1.479   51.452 -38.046 1.00 47.96 ? 142 ARG A CZ  1 
ATOM   854  N  NH1 . ARG A 1 136 ? 1.032   50.477 -38.828 1.00 47.11 ? 142 ARG A NH1 1 
ATOM   855  N  NH2 . ARG A 1 136 ? 2.779   51.702 -38.008 1.00 52.78 ? 142 ARG A NH2 1 
ATOM   856  N  N   . ALA A 1 137 ? -1.856  51.330 -31.169 1.00 39.99 ? 143 ALA A N   1 
ATOM   857  C  CA  . ALA A 1 137 ? -1.809  52.066 -29.910 1.00 38.37 ? 143 ALA A CA  1 
ATOM   858  C  C   . ALA A 1 137 ? -0.397  52.163 -29.327 1.00 40.94 ? 143 ALA A C   1 
ATOM   859  O  O   . ALA A 1 137 ? 0.013   53.223 -28.854 1.00 41.68 ? 143 ALA A O   1 
ATOM   860  C  CB  . ALA A 1 137 ? -2.749  51.434 -28.901 1.00 29.64 ? 143 ALA A CB  1 
ATOM   861  N  N   . THR A 1 138 ? 0.341   51.059 -29.355 1.00 39.53 ? 144 THR A N   1 
ATOM   862  C  CA  . THR A 1 138 ? 1.688   51.024 -28.794 1.00 42.76 ? 144 THR A CA  1 
ATOM   863  C  C   . THR A 1 138 ? 2.665   51.871 -29.609 1.00 41.37 ? 144 THR A C   1 
ATOM   864  O  O   . THR A 1 138 ? 3.535   52.537 -29.048 1.00 44.94 ? 144 THR A O   1 
ATOM   865  C  CB  . THR A 1 138 ? 2.205   49.576 -28.701 1.00 45.20 ? 144 THR A CB  1 
ATOM   866  O  OG1 . THR A 1 138 ? 1.456   48.868 -27.704 1.00 45.12 ? 144 THR A OG1 1 
ATOM   867  C  CG2 . THR A 1 138 ? 3.684   49.540 -28.333 1.00 43.25 ? 144 THR A CG2 1 
ATOM   868  N  N   . TRP A 1 139 ? 2.514   51.849 -30.929 1.00 38.10 ? 145 TRP A N   1 
ATOM   869  C  CA  . TRP A 1 139 ? 3.372   52.634 -31.811 1.00 43.76 ? 145 TRP A CA  1 
ATOM   870  C  C   . TRP A 1 139 ? 3.038   54.123 -31.729 1.00 38.27 ? 145 TRP A C   1 
ATOM   871  O  O   . TRP A 1 139 ? 3.925   54.970 -31.825 1.00 44.40 ? 145 TRP A O   1 
ATOM   872  C  CB  . TRP A 1 139 ? 3.242   52.137 -33.252 1.00 40.66 ? 145 TRP A CB  1 
ATOM   873  C  CG  . TRP A 1 139 ? 3.809   50.762 -33.459 1.00 43.98 ? 145 TRP A CG  1 
ATOM   874  C  CD1 . TRP A 1 139 ? 4.859   50.201 -32.794 1.00 43.90 ? 145 TRP A CD1 1 
ATOM   875  C  CD2 . TRP A 1 139 ? 3.350   49.773 -34.385 1.00 45.37 ? 145 TRP A CD2 1 
ATOM   876  N  NE1 . TRP A 1 139 ? 5.086   48.927 -33.252 1.00 46.94 ? 145 TRP A NE1 1 
ATOM   877  C  CE2 . TRP A 1 139 ? 4.167   48.639 -34.234 1.00 43.55 ? 145 TRP A CE2 1 
ATOM   878  C  CE3 . TRP A 1 139 ? 2.322   49.736 -35.335 1.00 48.53 ? 145 TRP A CE3 1 
ATOM   879  C  CZ2 . TRP A 1 139 ? 3.997   47.483 -34.986 1.00 42.48 ? 145 TRP A CZ2 1 
ATOM   880  C  CZ3 . TRP A 1 139 ? 2.154   48.588 -36.083 1.00 46.78 ? 145 TRP A CZ3 1 
ATOM   881  C  CH2 . TRP A 1 139 ? 2.986   47.480 -35.906 1.00 40.86 ? 145 TRP A CH2 1 
ATOM   882  N  N   . LEU A 1 140 ? 1.759   54.436 -31.547 1.00 38.00 ? 146 LEU A N   1 
ATOM   883  C  CA  . LEU A 1 140 ? 1.322   55.820 -31.396 1.00 43.22 ? 146 LEU A CA  1 
ATOM   884  C  C   . LEU A 1 140 ? 1.853   56.419 -30.098 1.00 46.56 ? 146 LEU A C   1 
ATOM   885  O  O   . LEU A 1 140 ? 2.189   57.602 -30.035 1.00 41.47 ? 146 LEU A O   1 
ATOM   886  C  CB  . LEU A 1 140 ? -0.204  55.896 -31.409 1.00 32.66 ? 146 LEU A CB  1 
ATOM   887  C  CG  . LEU A 1 140 ? -0.873  55.634 -32.760 1.00 40.70 ? 146 LEU A CG  1 
ATOM   888  C  CD1 . LEU A 1 140 ? -2.336  55.262 -32.566 1.00 35.34 ? 146 LEU A CD1 1 
ATOM   889  C  CD2 . LEU A 1 140 ? -0.747  56.847 -33.662 1.00 35.96 ? 146 LEU A CD2 1 
ATOM   890  N  N   . HIS A 1 141 ? 1.914   55.594 -29.059 1.00 45.14 ? 147 HIS A N   1 
ATOM   891  C  CA  . HIS A 1 141 ? 2.441   56.018 -27.767 1.00 46.86 ? 147 HIS A CA  1 
ATOM   892  C  C   . HIS A 1 141 ? 3.954   56.188 -27.835 1.00 43.05 ? 147 HIS A C   1 
ATOM   893  O  O   . HIS A 1 141 ? 4.508   57.121 -27.255 1.00 51.05 ? 147 HIS A O   1 
ATOM   894  C  CB  . HIS A 1 141 ? 2.065   54.995 -26.694 1.00 43.72 ? 147 HIS A CB  1 
ATOM   895  C  CG  . HIS A 1 141 ? 2.861   55.112 -25.432 1.00 45.29 ? 147 HIS A CG  1 
ATOM   896  N  ND1 . HIS A 1 141 ? 2.623   56.089 -24.486 1.00 45.58 ? 147 HIS A ND1 1 
ATOM   897  C  CD2 . HIS A 1 141 ? 3.889   54.374 -24.953 1.00 47.29 ? 147 HIS A CD2 1 
ATOM   898  C  CE1 . HIS A 1 141 ? 3.467   55.946 -23.484 1.00 50.20 ? 147 HIS A CE1 1 
ATOM   899  N  NE2 . HIS A 1 141 ? 4.250   54.907 -23.742 1.00 48.64 ? 147 HIS A NE2 1 
ATOM   900  N  N   . GLN A 1 142 ? 4.617   55.285 -28.550 1.00 45.25 ? 148 GLN A N   1 
ATOM   901  C  CA  . GLN A 1 142 ? 6.057   55.371 -28.745 1.00 49.51 ? 148 GLN A CA  1 
ATOM   902  C  C   . GLN A 1 142 ? 6.410   56.656 -29.485 1.00 48.86 ? 148 GLN A C   1 
ATOM   903  O  O   . GLN A 1 142 ? 7.410   57.303 -29.182 1.00 54.58 ? 148 GLN A O   1 
ATOM   904  C  CB  . GLN A 1 142 ? 6.556   54.159 -29.535 1.00 52.72 ? 148 GLN A CB  1 
ATOM   905  C  CG  . GLN A 1 142 ? 8.067   54.103 -29.716 1.00 60.49 ? 148 GLN A CG  1 
ATOM   906  C  CD  . GLN A 1 142 ? 8.515   52.909 -30.543 1.00 67.50 ? 148 GLN A CD  1 
ATOM   907  O  OE1 . GLN A 1 142 ? 7.789   51.924 -30.680 1.00 58.50 ? 148 GLN A OE1 1 
ATOM   908  N  NE2 . GLN A 1 142 ? 9.716   52.996 -31.103 1.00 76.80 ? 148 GLN A NE2 1 
ATOM   909  N  N   . ALA A 1 143 ? 5.578   57.024 -30.453 1.00 48.03 ? 149 ALA A N   1 
ATOM   910  C  CA  . ALA A 1 143 ? 5.819   58.220 -31.250 1.00 45.72 ? 149 ALA A CA  1 
ATOM   911  C  C   . ALA A 1 143 ? 5.711   59.486 -30.407 1.00 49.69 ? 149 ALA A C   1 
ATOM   912  O  O   . ALA A 1 143 ? 6.525   60.399 -30.543 1.00 49.21 ? 149 ALA A O   1 
ATOM   913  C  CB  . ALA A 1 143 ? 4.851   58.278 -32.413 1.00 43.22 ? 149 ALA A CB  1 
ATOM   914  N  N   . LEU A 1 144 ? 4.704   59.545 -29.542 1.00 46.18 ? 150 LEU A N   1 
ATOM   915  C  CA  . LEU A 1 144 ? 4.540   60.687 -28.653 1.00 51.78 ? 150 LEU A CA  1 
ATOM   916  C  C   . LEU A 1 144 ? 5.733   60.813 -27.709 1.00 47.58 ? 150 LEU A C   1 
ATOM   917  O  O   . LEU A 1 144 ? 6.193   61.918 -27.424 1.00 53.85 ? 150 LEU A O   1 
ATOM   918  C  CB  . LEU A 1 144 ? 3.240   60.557 -27.859 1.00 50.26 ? 150 LEU A CB  1 
ATOM   919  C  CG  . LEU A 1 144 ? 1.949   60.730 -28.663 1.00 47.17 ? 150 LEU A CG  1 
ATOM   920  C  CD1 . LEU A 1 144 ? 0.747   60.427 -27.790 1.00 40.95 ? 150 LEU A CD1 1 
ATOM   921  C  CD2 . LEU A 1 144 ? 1.846   62.127 -29.247 1.00 41.71 ? 150 LEU A CD2 1 
ATOM   922  N  N   . ARG A 1 145 ? 6.228   59.678 -27.223 1.00 43.66 ? 151 ARG A N   1 
ATOM   923  C  CA  . ARG A 1 145 ? 7.426   59.667 -26.394 1.00 53.45 ? 151 ARG A CA  1 
ATOM   924  C  C   . ARG A 1 145 ? 8.606   60.254 -27.162 1.00 50.72 ? 151 ARG A C   1 
ATOM   925  O  O   . ARG A 1 145 ? 9.454   60.936 -26.587 1.00 59.17 ? 151 ARG A O   1 
ATOM   926  C  CB  . ARG A 1 145 ? 7.757   58.241 -25.947 1.00 52.54 ? 151 ARG A CB  1 
ATOM   927  C  CG  . ARG A 1 145 ? 6.777   57.653 -24.945 1.00 55.05 ? 151 ARG A CG  1 
ATOM   928  C  CD  . ARG A 1 145 ? 6.794   58.411 -23.626 1.00 58.83 ? 151 ARG A CD  1 
ATOM   929  N  NE  . ARG A 1 145 ? 6.070   57.700 -22.573 1.00 64.68 ? 151 ARG A NE  1 
ATOM   930  C  CZ  . ARG A 1 145 ? 5.826   58.193 -21.362 1.00 68.27 ? 151 ARG A CZ  1 
ATOM   931  N  NH1 . ARG A 1 145 ? 6.242   59.411 -21.035 1.00 68.84 ? 151 ARG A NH1 1 
ATOM   932  N  NH2 . ARG A 1 145 ? 5.162   57.468 -20.472 1.00 60.35 ? 151 ARG A NH2 1 
ATOM   933  N  N   . GLU A 1 146 ? 8.646   59.993 -28.466 1.00 51.33 ? 152 GLU A N   1 
ATOM   934  C  CA  . GLU A 1 146 ? 9.739   60.458 -29.315 1.00 50.20 ? 152 GLU A CA  1 
ATOM   935  C  C   . GLU A 1 146 ? 9.613   61.940 -29.668 1.00 51.73 ? 152 GLU A C   1 
ATOM   936  O  O   . GLU A 1 146 ? 10.545  62.534 -30.213 1.00 56.97 ? 152 GLU A O   1 
ATOM   937  C  CB  . GLU A 1 146 ? 9.805   59.617 -30.590 1.00 53.06 ? 152 GLU A CB  1 
ATOM   938  C  CG  . GLU A 1 146 ? 10.260  58.187 -30.347 1.00 54.66 ? 152 GLU A CG  1 
ATOM   939  C  CD  . GLU A 1 146 ? 10.183  57.326 -31.592 1.00 66.80 ? 152 GLU A CD  1 
ATOM   940  O  OE1 . GLU A 1 146 ? 9.827   57.861 -32.663 1.00 59.34 ? 152 GLU A OE1 1 
ATOM   941  O  OE2 . GLU A 1 146 ? 10.476  56.115 -31.496 1.00 70.45 ? 152 GLU A OE2 1 
ATOM   942  N  N   . GLY A 1 147 ? 8.463   62.532 -29.361 1.00 47.76 ? 153 GLY A N   1 
ATOM   943  C  CA  . GLY A 1 147 ? 8.274   63.962 -29.544 1.00 50.07 ? 153 GLY A CA  1 
ATOM   944  C  C   . GLY A 1 147 ? 7.250   64.363 -30.588 1.00 49.06 ? 153 GLY A C   1 
ATOM   945  O  O   . GLY A 1 147 ? 6.926   65.545 -30.711 1.00 50.79 ? 153 GLY A O   1 
ATOM   946  N  N   . THR A 1 148 ? 6.734   63.399 -31.341 1.00 51.93 ? 154 THR A N   1 
ATOM   947  C  CA  . THR A 1 148 ? 5.790   63.708 -32.409 1.00 48.83 ? 154 THR A CA  1 
ATOM   948  C  C   . THR A 1 148 ? 4.625   64.552 -31.899 1.00 48.34 ? 154 THR A C   1 
ATOM   949  O  O   . THR A 1 148 ? 4.041   64.262 -30.854 1.00 50.21 ? 154 THR A O   1 
ATOM   950  C  CB  . THR A 1 148 ? 5.228   62.431 -33.062 1.00 54.42 ? 154 THR A CB  1 
ATOM   951  O  OG1 . THR A 1 148 ? 6.278   61.722 -33.733 1.00 55.32 ? 154 THR A OG1 1 
ATOM   952  C  CG2 . THR A 1 148 ? 4.144   62.779 -34.070 1.00 43.92 ? 154 THR A CG2 1 
ATOM   953  N  N   . ARG A 1 149 ? 4.303   65.604 -32.646 1.00 51.87 ? 155 ARG A N   1 
ATOM   954  C  CA  . ARG A 1 149 ? 3.156   66.450 -32.341 1.00 59.14 ? 155 ARG A CA  1 
ATOM   955  C  C   . ARG A 1 149 ? 2.096   66.256 -33.419 1.00 55.05 ? 155 ARG A C   1 
ATOM   956  O  O   . ARG A 1 149 ? 2.380   66.398 -34.608 1.00 55.03 ? 155 ARG A O   1 
ATOM   957  C  CB  . ARG A 1 149 ? 3.576   67.918 -32.276 1.00 59.59 ? 155 ARG A CB  1 
ATOM   958  N  N   . VAL A 1 150 ? 0.877   65.931 -32.999 1.00 56.06 ? 156 VAL A N   1 
ATOM   959  C  CA  . VAL A 1 150 ? -0.204  65.625 -33.934 1.00 48.35 ? 156 VAL A CA  1 
ATOM   960  C  C   . VAL A 1 150 ? -1.350  66.628 -33.795 1.00 48.07 ? 156 VAL A C   1 
ATOM   961  O  O   . VAL A 1 150 ? -2.290  66.406 -33.033 1.00 46.61 ? 156 VAL A O   1 
ATOM   962  C  CB  . VAL A 1 150 ? -0.738  64.198 -33.708 1.00 42.17 ? 156 VAL A CB  1 
ATOM   963  C  CG1 . VAL A 1 150 ? -1.718  63.820 -34.801 1.00 43.40 ? 156 VAL A CG1 1 
ATOM   964  C  CG2 . VAL A 1 150 ? 0.414   63.207 -33.662 1.00 42.23 ? 156 VAL A CG2 1 
ATOM   965  N  N   . GLN A 1 151 ? -1.268  67.719 -34.554 1.00 50.76 ? 157 GLN A N   1 
ATOM   966  C  CA  . GLN A 1 151 ? -2.189  68.845 -34.415 1.00 52.28 ? 157 GLN A CA  1 
ATOM   967  C  C   . GLN A 1 151 ? -3.440  68.708 -35.283 1.00 52.73 ? 157 GLN A C   1 
ATOM   968  O  O   . GLN A 1 151 ? -4.558  68.917 -34.810 1.00 48.19 ? 157 GLN A O   1 
ATOM   969  C  CB  . GLN A 1 151 ? -1.460  70.147 -34.768 1.00 52.67 ? 157 GLN A CB  1 
ATOM   970  C  CG  . GLN A 1 151 ? -2.283  71.418 -34.581 1.00 53.73 ? 157 GLN A CG  1 
ATOM   971  C  CD  . GLN A 1 151 ? -3.283  71.640 -35.699 1.00 60.69 ? 157 GLN A CD  1 
ATOM   972  O  OE1 . GLN A 1 151 ? -2.973  71.432 -36.873 1.00 61.63 ? 157 GLN A OE1 1 
ATOM   973  N  NE2 . GLN A 1 151 ? -4.490  72.064 -35.341 1.00 60.50 ? 157 GLN A NE2 1 
ATOM   974  N  N   . SER A 1 152 ? -3.247  68.367 -36.554 1.00 48.36 ? 158 SER A N   1 
ATOM   975  C  CA  . SER A 1 152 ? -4.344  68.337 -37.515 1.00 45.43 ? 158 SER A CA  1 
ATOM   976  C  C   . SER A 1 152 ? -4.871  66.920 -37.722 1.00 41.81 ? 158 SER A C   1 
ATOM   977  O  O   . SER A 1 152 ? -4.253  65.946 -37.293 1.00 46.51 ? 158 SER A O   1 
ATOM   978  C  CB  . SER A 1 152 ? -3.881  68.912 -38.854 1.00 36.13 ? 158 SER A CB  1 
ATOM   979  O  OG  . SER A 1 152 ? -2.868  68.101 -39.426 1.00 47.81 ? 158 SER A OG  1 
ATOM   980  N  N   . VAL A 1 153 ? -6.016  66.814 -38.391 1.00 43.20 ? 159 VAL A N   1 
ATOM   981  C  CA  . VAL A 1 153 ? -6.594  65.518 -38.724 1.00 38.03 ? 159 VAL A CA  1 
ATOM   982  C  C   . VAL A 1 153 ? -5.725  64.803 -39.750 1.00 41.81 ? 159 VAL A C   1 
ATOM   983  O  O   . VAL A 1 153 ? -5.549  63.586 -39.686 1.00 48.40 ? 159 VAL A O   1 
ATOM   984  C  CB  . VAL A 1 153 ? -8.023  65.672 -39.271 1.00 46.24 ? 159 VAL A CB  1 
ATOM   985  C  CG1 . VAL A 1 153 ? -8.520  64.363 -39.869 1.00 47.52 ? 159 VAL A CG1 1 
ATOM   986  C  CG2 . VAL A 1 153 ? -8.951  66.142 -38.168 1.00 41.18 ? 159 VAL A CG2 1 
ATOM   987  N  N   . GLU A 1 154 ? -5.181  65.562 -40.666 1.00 41.96 ? 160 GLU A N   1 
ATOM   988  C  CA  . GLU A 1 154 ? -4.285  65.036 -41.665 1.00 41.11 ? 160 GLU A CA  1 
ATOM   989  C  C   . GLU A 1 154 ? -3.121  64.287 -41.025 1.00 41.73 ? 160 GLU A C   1 
ATOM   990  O  O   . GLU A 1 154 ? -2.713  63.210 -41.467 1.00 45.87 ? 160 GLU A O   1 
ATOM   991  C  CB  . GLU A 1 154 ? -3.759  66.162 -42.557 1.00 36.29 ? 160 GLU A CB  1 
ATOM   992  N  N   . GLN A 1 155 ? -2.589  64.882 -39.962 1.00 39.08 ? 161 GLN A N   1 
ATOM   993  C  CA  . GLN A 1 155 ? -1.484  64.289 -39.218 1.00 44.48 ? 161 GLN A CA  1 
ATOM   994  C  C   . GLN A 1 155 ? -1.911  63.020 -38.483 1.00 41.60 ? 161 GLN A C   1 
ATOM   995  O  O   . GLN A 1 155 ? -1.155  62.051 -38.408 1.00 39.78 ? 161 GLN A O   1 
ATOM   996  C  CB  . GLN A 1 155 ? -0.919  65.302 -38.220 1.00 48.99 ? 161 GLN A CB  1 
ATOM   997  C  CG  . GLN A 1 155 ? -0.170  66.462 -38.862 1.00 53.81 ? 161 GLN A CG  1 
ATOM   998  C  CD  . GLN A 1 155 ? 0.216   67.533 -37.859 1.00 53.96 ? 161 GLN A CD  1 
ATOM   999  O  OE1 . GLN A 1 155 ? -0.627  68.311 -37.412 1.00 54.70 ? 161 GLN A OE1 1 
ATOM   1000 N  NE2 . GLN A 1 155 ? 1.493   67.575 -37.497 1.00 49.61 ? 161 GLN A NE2 1 
ATOM   1001 N  N   . ILE A 1 156 ? -3.121  63.029 -37.937 1.00 38.82 ? 162 ILE A N   1 
ATOM   1002 C  CA  . ILE A 1 156 ? -3.642  61.862 -37.235 1.00 36.13 ? 162 ILE A CA  1 
ATOM   1003 C  C   . ILE A 1 156 ? -3.713  60.666 -38.178 1.00 36.32 ? 162 ILE A C   1 
ATOM   1004 O  O   . ILE A 1 156 ? -3.287  59.565 -37.829 1.00 38.54 ? 162 ILE A O   1 
ATOM   1005 C  CB  . ILE A 1 156 ? -5.038  62.143 -36.646 1.00 44.26 ? 162 ILE A CB  1 
ATOM   1006 C  CG1 . ILE A 1 156 ? -4.937  63.195 -35.536 1.00 41.98 ? 162 ILE A CG1 1 
ATOM   1007 C  CG2 . ILE A 1 156 ? -5.654  60.863 -36.106 1.00 41.10 ? 162 ILE A CG2 1 
ATOM   1008 C  CD1 . ILE A 1 156 ? -6.269  63.722 -35.052 1.00 36.69 ? 162 ILE A CD1 1 
ATOM   1009 N  N   . ARG A 1 157 ? -4.243  60.890 -39.376 1.00 35.95 ? 163 ARG A N   1 
ATOM   1010 C  CA  . ARG A 1 157 ? -4.362  59.833 -40.374 1.00 39.09 ? 163 ARG A CA  1 
ATOM   1011 C  C   . ARG A 1 157 ? -2.993  59.340 -40.815 1.00 43.23 ? 163 ARG A C   1 
ATOM   1012 O  O   . ARG A 1 157 ? -2.793  58.143 -41.033 1.00 44.64 ? 163 ARG A O   1 
ATOM   1013 C  CB  . ARG A 1 157 ? -5.137  60.335 -41.591 1.00 42.08 ? 163 ARG A CB  1 
ATOM   1014 C  CG  . ARG A 1 157 ? -6.559  60.754 -41.283 1.00 42.77 ? 163 ARG A CG  1 
ATOM   1015 C  CD  . ARG A 1 157 ? -7.238  61.352 -42.500 1.00 42.89 ? 163 ARG A CD  1 
ATOM   1016 N  NE  . ARG A 1 157 ? -8.596  61.775 -42.175 1.00 38.48 ? 163 ARG A NE  1 
ATOM   1017 C  CZ  . ARG A 1 157 ? -9.194  62.869 -42.640 1.00 37.65 ? 163 ARG A CZ  1 
ATOM   1018 N  NH1 . ARG A 1 157 ? -8.571  63.693 -43.473 1.00 37.93 ? 163 ARG A NH1 1 
ATOM   1019 N  NH2 . ARG A 1 157 ? -10.432 63.140 -42.258 1.00 37.05 ? 163 ARG A NH2 1 
ATOM   1020 N  N   . GLU A 1 158 ? -2.052  60.268 -40.951 1.00 43.41 ? 164 GLU A N   1 
ATOM   1021 C  CA  . GLU A 1 158 ? -0.709  59.929 -41.404 1.00 40.98 ? 164 GLU A CA  1 
ATOM   1022 C  C   . GLU A 1 158 ? 0.033   59.102 -40.363 1.00 37.01 ? 164 GLU A C   1 
ATOM   1023 O  O   . GLU A 1 158 ? 0.644   58.082 -40.687 1.00 47.63 ? 164 GLU A O   1 
ATOM   1024 C  CB  . GLU A 1 158 ? 0.083   61.200 -41.724 1.00 42.76 ? 164 GLU A CB  1 
ATOM   1025 N  N   . VAL A 1 159 ? -0.024  59.538 -39.110 1.00 33.42 ? 165 VAL A N   1 
ATOM   1026 C  CA  . VAL A 1 159 ? 0.698   58.856 -38.045 1.00 43.46 ? 165 VAL A CA  1 
ATOM   1027 C  C   . VAL A 1 159 ? 0.008   57.550 -37.660 1.00 41.89 ? 165 VAL A C   1 
ATOM   1028 O  O   . VAL A 1 159 ? 0.665   56.581 -37.277 1.00 39.42 ? 165 VAL A O   1 
ATOM   1029 C  CB  . VAL A 1 159 ? 0.836   59.755 -36.803 1.00 37.51 ? 165 VAL A CB  1 
ATOM   1030 C  CG1 . VAL A 1 159 ? -0.477  59.829 -36.046 1.00 40.03 ? 165 VAL A CG1 1 
ATOM   1031 C  CG2 . VAL A 1 159 ? 1.941   59.243 -35.902 1.00 40.34 ? 165 VAL A CG2 1 
ATOM   1032 N  N   . ALA A 1 160 ? -1.317  57.525 -37.765 1.00 43.68 ? 166 ALA A N   1 
ATOM   1033 C  CA  . ALA A 1 160 ? -2.078  56.322 -37.451 1.00 43.89 ? 166 ALA A CA  1 
ATOM   1034 C  C   . ALA A 1 160 ? -2.297  55.466 -38.695 1.00 41.20 ? 166 ALA A C   1 
ATOM   1035 O  O   . ALA A 1 160 ? -3.069  54.505 -38.667 1.00 40.12 ? 166 ALA A O   1 
ATOM   1036 C  CB  . ALA A 1 160 ? -3.408  56.690 -36.827 1.00 30.40 ? 166 ALA A CB  1 
ATOM   1037 N  N   . SER A 1 161 ? -1.615  55.816 -39.782 1.00 43.27 ? 167 SER A N   1 
ATOM   1038 C  CA  . SER A 1 161 ? -1.730  55.072 -41.029 1.00 42.36 ? 167 SER A CA  1 
ATOM   1039 C  C   . SER A 1 161 ? -1.449  53.598 -40.780 1.00 41.24 ? 167 SER A C   1 
ATOM   1040 O  O   . SER A 1 161 ? -0.485  53.248 -40.098 1.00 45.98 ? 167 SER A O   1 
ATOM   1041 C  CB  . SER A 1 161 ? -0.748  55.619 -42.065 1.00 40.90 ? 167 SER A CB  1 
ATOM   1042 O  OG  . SER A 1 161 ? -0.987  55.053 -43.341 1.00 46.15 ? 167 SER A OG  1 
ATOM   1043 N  N   . GLY A 1 162 ? -2.295  52.737 -41.335 1.00 42.57 ? 168 GLY A N   1 
ATOM   1044 C  CA  . GLY A 1 162 ? -2.169  51.306 -41.128 1.00 44.16 ? 168 GLY A CA  1 
ATOM   1045 C  C   . GLY A 1 162 ? -3.213  50.775 -40.166 1.00 42.72 ? 168 GLY A C   1 
ATOM   1046 O  O   . GLY A 1 162 ? -3.554  49.595 -40.201 1.00 50.15 ? 168 GLY A O   1 
ATOM   1047 N  N   . ALA A 1 163 ? -3.715  51.642 -39.293 1.00 41.62 ? 169 ALA A N   1 
ATOM   1048 C  CA  . ALA A 1 163 ? -4.817  51.268 -38.419 1.00 38.07 ? 169 ALA A CA  1 
ATOM   1049 C  C   . ALA A 1 163 ? -5.992  50.851 -39.296 1.00 38.19 ? 169 ALA A C   1 
ATOM   1050 O  O   . ALA A 1 163 ? -6.321  51.539 -40.262 1.00 41.39 ? 169 ALA A O   1 
ATOM   1051 C  CB  . ALA A 1 163 ? -5.203  52.426 -37.537 1.00 35.67 ? 169 ALA A CB  1 
ATOM   1052 N  N   . ALA A 1 164 ? -6.621  49.728 -38.962 1.00 37.97 ? 170 ALA A N   1 
ATOM   1053 C  CA  . ALA A 1 164 ? -7.651  49.153 -39.821 1.00 32.69 ? 170 ALA A CA  1 
ATOM   1054 C  C   . ALA A 1 164 ? -8.891  48.732 -39.036 1.00 32.72 ? 170 ALA A C   1 
ATOM   1055 O  O   . ALA A 1 164 ? -8.797  48.318 -37.879 1.00 34.05 ? 170 ALA A O   1 
ATOM   1056 C  CB  . ALA A 1 164 ? -7.088  47.967 -40.575 1.00 33.03 ? 170 ALA A CB  1 
ATOM   1057 N  N   . ARG A 1 165 ? -10.050 48.843 -39.677 1.00 33.00 ? 171 ARG A N   1 
ATOM   1058 C  CA  . ARG A 1 165 ? -11.301 48.388 -39.089 1.00 33.39 ? 171 ARG A CA  1 
ATOM   1059 C  C   . ARG A 1 165 ? -11.244 46.878 -38.913 1.00 32.42 ? 171 ARG A C   1 
ATOM   1060 O  O   . ARG A 1 165 ? -10.821 46.156 -39.817 1.00 35.17 ? 171 ARG A O   1 
ATOM   1061 C  CB  . ARG A 1 165 ? -12.480 48.778 -39.983 1.00 33.13 ? 171 ARG A CB  1 
ATOM   1062 C  CG  . ARG A 1 165 ? -13.821 48.210 -39.550 1.00 34.25 ? 171 ARG A CG  1 
ATOM   1063 C  CD  . ARG A 1 165 ? -14.941 48.757 -40.422 1.00 33.72 ? 171 ARG A CD  1 
ATOM   1064 N  NE  . ARG A 1 165 ? -15.259 50.142 -40.087 1.00 37.26 ? 171 ARG A NE  1 
ATOM   1065 C  CZ  . ARG A 1 165 ? -16.127 50.897 -40.753 1.00 33.14 ? 171 ARG A CZ  1 
ATOM   1066 N  NH1 . ARG A 1 165 ? -16.773 50.410 -41.804 1.00 34.30 ? 171 ARG A NH1 1 
ATOM   1067 N  NH2 . ARG A 1 165 ? -16.346 52.146 -40.366 1.00 39.10 ? 171 ARG A NH2 1 
ATOM   1068 N  N   . ILE A 1 166 ? -11.676 46.401 -37.752 1.00 32.38 ? 172 ILE A N   1 
ATOM   1069 C  CA  . ILE A 1 166 ? -11.546 44.988 -37.417 1.00 27.41 ? 172 ILE A CA  1 
ATOM   1070 C  C   . ILE A 1 166 ? -12.709 44.135 -37.925 1.00 31.18 ? 172 ILE A C   1 
ATOM   1071 O  O   . ILE A 1 166 ? -12.502 42.995 -38.333 1.00 27.63 ? 172 ILE A O   1 
ATOM   1072 C  CB  . ILE A 1 166 ? -11.387 44.796 -35.895 1.00 27.98 ? 172 ILE A CB  1 
ATOM   1073 C  CG1 . ILE A 1 166 ? -9.992  45.263 -35.457 1.00 25.44 ? 172 ILE A CG1 1 
ATOM   1074 C  CG2 . ILE A 1 166 ? -11.624 43.338 -35.516 1.00 31.54 ? 172 ILE A CG2 1 
ATOM   1075 C  CD1 . ILE A 1 166 ? -9.785  45.303 -33.956 1.00 29.46 ? 172 ILE A CD1 1 
ATOM   1076 N  N   . ARG A 1 167 ? -13.923 44.679 -37.913 1.00 31.77 ? 173 ARG A N   1 
ATOM   1077 C  CA  . ARG A 1 167 ? -15.094 43.905 -38.322 1.00 31.95 ? 173 ARG A CA  1 
ATOM   1078 C  C   . ARG A 1 167 ? -14.986 43.460 -39.776 1.00 34.51 ? 173 ARG A C   1 
ATOM   1079 O  O   . ARG A 1 167 ? -14.704 44.266 -40.662 1.00 37.87 ? 173 ARG A O   1 
ATOM   1080 C  CB  . ARG A 1 167 ? -16.382 44.708 -38.131 1.00 27.64 ? 173 ARG A CB  1 
ATOM   1081 C  CG  . ARG A 1 167 ? -17.628 43.967 -38.611 1.00 27.68 ? 173 ARG A CG  1 
ATOM   1082 C  CD  . ARG A 1 167 ? -18.907 44.618 -38.113 1.00 34.00 ? 173 ARG A CD  1 
ATOM   1083 N  NE  . ARG A 1 167 ? -19.009 44.564 -36.658 1.00 29.74 ? 173 ARG A NE  1 
ATOM   1084 C  CZ  . ARG A 1 167 ? -19.356 43.485 -35.964 1.00 32.18 ? 173 ARG A CZ  1 
ATOM   1085 N  NH1 . ARG A 1 167 ? -19.418 43.543 -34.641 1.00 27.25 ? 173 ARG A NH1 1 
ATOM   1086 N  NH2 . ARG A 1 167 ? -19.637 42.345 -36.582 1.00 38.56 ? 173 ARG A NH2 1 
ATOM   1087 N  N   . GLY A 1 168 ? -15.224 42.174 -40.015 1.00 33.93 ? 174 GLY A N   1 
ATOM   1088 C  CA  . GLY A 1 168 ? -15.146 41.622 -41.355 1.00 29.75 ? 174 GLY A CA  1 
ATOM   1089 C  C   . GLY A 1 168 ? -13.772 41.058 -41.665 1.00 32.00 ? 174 GLY A C   1 
ATOM   1090 O  O   . GLY A 1 168 ? -13.595 40.338 -42.649 1.00 37.45 ? 174 GLY A O   1 
ATOM   1091 N  N   . GLU A 1 169 ? -12.793 41.399 -40.833 1.00 27.32 ? 175 GLU A N   1 
ATOM   1092 C  CA  . GLU A 1 169 ? -11.449 40.859 -40.974 1.00 28.81 ? 175 GLU A CA  1 
ATOM   1093 C  C   . GLU A 1 169 ? -11.447 39.397 -40.551 1.00 30.42 ? 175 GLU A C   1 
ATOM   1094 O  O   . GLU A 1 169 ? -12.267 38.978 -39.734 1.00 31.80 ? 175 GLU A O   1 
ATOM   1095 C  CB  . GLU A 1 169 ? -10.462 41.655 -40.121 1.00 27.97 ? 175 GLU A CB  1 
ATOM   1096 C  CG  . GLU A 1 169 ? -10.120 43.027 -40.684 1.00 32.83 ? 175 GLU A CG  1 
ATOM   1097 C  CD  . GLU A 1 169 ? -8.933  42.983 -41.624 1.00 35.43 ? 175 GLU A CD  1 
ATOM   1098 O  OE1 . GLU A 1 169 ? -7.903  42.379 -41.251 1.00 33.96 ? 175 GLU A OE1 1 
ATOM   1099 O  OE2 . GLU A 1 169 ? -9.033  43.541 -42.737 1.00 38.59 ? 175 GLU A OE2 1 
ATOM   1100 N  N   . THR A 1 170 ? -10.524 38.622 -41.109 1.00 27.39 ? 176 THR A N   1 
ATOM   1101 C  CA  . THR A 1 170 ? -10.435 37.203 -40.791 1.00 30.19 ? 176 THR A CA  1 
ATOM   1102 C  C   . THR A 1 170 ? -9.213  36.910 -39.925 1.00 35.36 ? 176 THR A C   1 
ATOM   1103 O  O   . THR A 1 170 ? -8.074  37.157 -40.329 1.00 31.58 ? 176 THR A O   1 
ATOM   1104 C  CB  . THR A 1 170 ? -10.374 36.341 -42.068 1.00 32.26 ? 176 THR A CB  1 
ATOM   1105 O  OG1 . THR A 1 170 ? -11.616 36.445 -42.775 1.00 36.53 ? 176 THR A OG1 1 
ATOM   1106 C  CG2 . THR A 1 170 ? -10.115 34.885 -41.715 1.00 30.90 ? 176 THR A CG2 1 
ATOM   1107 N  N   . LEU A 1 171 ? -9.457  36.385 -38.727 1.00 30.17 ? 177 LEU A N   1 
ATOM   1108 C  CA  . LEU A 1 171 ? -8.381  35.960 -37.843 1.00 27.62 ? 177 LEU A CA  1 
ATOM   1109 C  C   . LEU A 1 171 ? -8.155  34.465 -38.003 1.00 31.57 ? 177 LEU A C   1 
ATOM   1110 O  O   . LEU A 1 171 ? -9.082  33.668 -37.855 1.00 31.65 ? 177 LEU A O   1 
ATOM   1111 C  CB  . LEU A 1 171 ? -8.718  36.275 -36.385 1.00 22.87 ? 177 LEU A CB  1 
ATOM   1112 C  CG  . LEU A 1 171 ? -7.653  35.871 -35.358 1.00 30.44 ? 177 LEU A CG  1 
ATOM   1113 C  CD1 . LEU A 1 171 ? -6.406  36.726 -35.519 1.00 28.77 ? 177 LEU A CD1 1 
ATOM   1114 C  CD2 . LEU A 1 171 ? -8.190  35.970 -33.937 1.00 27.97 ? 177 LEU A CD2 1 
ATOM   1115 N  N   . GLY A 1 172 ? -6.918  34.094 -38.313 1.00 32.68 ? 178 GLY A N   1 
ATOM   1116 C  CA  . GLY A 1 172 ? -6.546  32.701 -38.471 1.00 23.71 ? 178 GLY A CA  1 
ATOM   1117 C  C   . GLY A 1 172 ? -5.805  32.175 -37.261 1.00 31.40 ? 178 GLY A C   1 
ATOM   1118 O  O   . GLY A 1 172 ? -4.757  32.705 -36.885 1.00 33.38 ? 178 GLY A O   1 
ATOM   1119 N  N   . ILE A 1 173 ? -6.346  31.127 -36.652 1.00 25.22 ? 179 ILE A N   1 
ATOM   1120 C  CA  . ILE A 1 173 ? -5.752  30.545 -35.459 1.00 27.01 ? 179 ILE A CA  1 
ATOM   1121 C  C   . ILE A 1 173 ? -5.059  29.230 -35.792 1.00 33.74 ? 179 ILE A C   1 
ATOM   1122 O  O   . ILE A 1 173 ? -5.682  28.302 -36.310 1.00 32.38 ? 179 ILE A O   1 
ATOM   1123 C  CB  . ILE A 1 173 ? -6.816  30.296 -34.372 1.00 28.63 ? 179 ILE A CB  1 
ATOM   1124 C  CG1 . ILE A 1 173 ? -7.338  31.631 -33.828 1.00 30.34 ? 179 ILE A CG1 1 
ATOM   1125 C  CG2 . ILE A 1 173 ? -6.243  29.444 -33.250 1.00 24.58 ? 179 ILE A CG2 1 
ATOM   1126 C  CD1 . ILE A 1 173 ? -8.460  31.493 -32.806 1.00 26.17 ? 179 ILE A CD1 1 
ATOM   1127 N  N   . ILE A 1 174 ? -3.767  29.154 -35.489 1.00 30.74 ? 180 ILE A N   1 
ATOM   1128 C  CA  . ILE A 1 174 ? -3.003  27.932 -35.697 1.00 27.33 ? 180 ILE A CA  1 
ATOM   1129 C  C   . ILE A 1 174 ? -2.810  27.250 -34.352 1.00 32.33 ? 180 ILE A C   1 
ATOM   1130 O  O   . ILE A 1 174 ? -2.013  27.697 -33.524 1.00 28.64 ? 180 ILE A O   1 
ATOM   1131 C  CB  . ILE A 1 174 ? -1.644  28.224 -36.354 1.00 27.07 ? 180 ILE A CB  1 
ATOM   1132 C  CG1 . ILE A 1 174 ? -1.869  28.921 -37.702 1.00 30.08 ? 180 ILE A CG1 1 
ATOM   1133 C  CG2 . ILE A 1 174 ? -0.854  26.931 -36.529 1.00 28.40 ? 180 ILE A CG2 1 
ATOM   1134 C  CD1 . ILE A 1 174 ? -0.616  29.419 -38.383 1.00 33.48 ? 180 ILE A CD1 1 
ATOM   1135 N  N   . GLY A 1 175 ? -3.554  26.169 -34.140 1.00 27.45 ? 181 GLY A N   1 
ATOM   1136 C  CA  . GLY A 1 175 ? -3.593  25.506 -32.850 1.00 28.17 ? 181 GLY A CA  1 
ATOM   1137 C  C   . GLY A 1 175 ? -4.784  25.980 -32.040 1.00 27.57 ? 181 GLY A C   1 
ATOM   1138 O  O   . GLY A 1 175 ? -4.728  27.034 -31.406 1.00 31.46 ? 181 GLY A O   1 
ATOM   1139 N  N   . LEU A 1 176 ? -5.867  25.208 -32.058 1.00 27.73 ? 182 LEU A N   1 
ATOM   1140 C  CA  . LEU A 1 176 ? -7.084  25.599 -31.354 1.00 29.42 ? 182 LEU A CA  1 
ATOM   1141 C  C   . LEU A 1 176 ? -7.231  24.814 -30.055 1.00 33.94 ? 182 LEU A C   1 
ATOM   1142 O  O   . LEU A 1 176 ? -8.179  24.045 -29.882 1.00 33.86 ? 182 LEU A O   1 
ATOM   1143 C  CB  . LEU A 1 176 ? -8.316  25.388 -32.237 1.00 30.12 ? 182 LEU A CB  1 
ATOM   1144 C  CG  . LEU A 1 176 ? -9.583  26.112 -31.769 1.00 31.73 ? 182 LEU A CG  1 
ATOM   1145 C  CD1 . LEU A 1 176 ? -9.560  27.579 -32.180 1.00 24.62 ? 182 LEU A CD1 1 
ATOM   1146 C  CD2 . LEU A 1 176 ? -10.837 25.429 -32.296 1.00 28.18 ? 182 LEU A CD2 1 
ATOM   1147 N  N   . GLY A 1 177 ? -6.282  25.009 -29.147 1.00 31.45 ? 183 GLY A N   1 
ATOM   1148 C  CA  . GLY A 1 177 ? -6.341  24.388 -27.838 1.00 31.07 ? 183 GLY A CA  1 
ATOM   1149 C  C   . GLY A 1 177 ? -6.926  25.336 -26.811 1.00 26.81 ? 183 GLY A C   1 
ATOM   1150 O  O   . GLY A 1 177 ? -7.846  26.098 -27.112 1.00 30.24 ? 183 GLY A O   1 
ATOM   1151 N  N   . ARG A 1 178 ? -6.389  25.292 -25.596 1.00 26.53 ? 184 ARG A N   1 
ATOM   1152 C  CA  . ARG A 1 178 ? -6.894  26.117 -24.505 1.00 30.49 ? 184 ARG A CA  1 
ATOM   1153 C  C   . ARG A 1 178 ? -6.817  27.600 -24.841 1.00 32.08 ? 184 ARG A C   1 
ATOM   1154 O  O   . ARG A 1 178 ? -7.818  28.314 -24.760 1.00 28.40 ? 184 ARG A O   1 
ATOM   1155 C  CB  . ARG A 1 178 ? -6.109  25.840 -23.223 1.00 31.97 ? 184 ARG A CB  1 
ATOM   1156 C  CG  . ARG A 1 178 ? -6.189  24.402 -22.742 1.00 33.22 ? 184 ARG A CG  1 
ATOM   1157 C  CD  . ARG A 1 178 ? -5.218  24.148 -21.604 1.00 30.42 ? 184 ARG A CD  1 
ATOM   1158 N  NE  . ARG A 1 178 ? -5.269  22.763 -21.144 1.00 44.00 ? 184 ARG A NE  1 
ATOM   1159 C  CZ  . ARG A 1 178 ? -4.503  21.776 -21.605 1.00 40.34 ? 184 ARG A CZ  1 
ATOM   1160 N  NH1 . ARG A 1 178 ? -3.598  21.995 -22.550 1.00 37.11 ? 184 ARG A NH1 1 
ATOM   1161 N  NH2 . ARG A 1 178 ? -4.642  20.557 -21.108 1.00 41.25 ? 184 ARG A NH2 1 
ATOM   1162 N  N   . VAL A 1 179 ? -5.628  28.063 -25.217 1.00 29.88 ? 185 VAL A N   1 
ATOM   1163 C  CA  . VAL A 1 179 ? -5.424  29.476 -25.515 1.00 27.14 ? 185 VAL A CA  1 
ATOM   1164 C  C   . VAL A 1 179 ? -6.105  29.859 -26.825 1.00 26.66 ? 185 VAL A C   1 
ATOM   1165 O  O   . VAL A 1 179 ? -6.738  30.909 -26.918 1.00 25.81 ? 185 VAL A O   1 
ATOM   1166 C  CB  . VAL A 1 179 ? -3.930  29.822 -25.604 1.00 26.53 ? 185 VAL A CB  1 
ATOM   1167 C  CG1 . VAL A 1 179 ? -3.744  31.296 -25.898 1.00 23.94 ? 185 VAL A CG1 1 
ATOM   1168 C  CG2 . VAL A 1 179 ? -3.221  29.449 -24.309 1.00 28.14 ? 185 VAL A CG2 1 
ATOM   1169 N  N   . GLY A 1 180 ? -5.978  29.003 -27.834 1.00 22.73 ? 186 GLY A N   1 
ATOM   1170 C  CA  . GLY A 1 180 ? -6.602  29.253 -29.121 1.00 28.95 ? 186 GLY A CA  1 
ATOM   1171 C  C   . GLY A 1 180 ? -8.103  29.442 -29.007 1.00 27.09 ? 186 GLY A C   1 
ATOM   1172 O  O   . GLY A 1 180 ? -8.661  30.381 -29.573 1.00 31.14 ? 186 GLY A O   1 
ATOM   1173 N  N   . GLN A 1 181 ? -8.759  28.556 -28.266 1.00 25.49 ? 187 GLN A N   1 
ATOM   1174 C  CA  . GLN A 1 181 ? -10.200 28.655 -28.065 1.00 27.66 ? 187 GLN A CA  1 
ATOM   1175 C  C   . GLN A 1 181 ? -10.556 29.933 -27.314 1.00 25.92 ? 187 GLN A C   1 
ATOM   1176 O  O   . GLN A 1 181 ? -11.521 30.616 -27.656 1.00 29.41 ? 187 GLN A O   1 
ATOM   1177 C  CB  . GLN A 1 181 ? -10.719 27.437 -27.302 1.00 22.34 ? 187 GLN A CB  1 
ATOM   1178 C  CG  . GLN A 1 181 ? -10.705 26.147 -28.102 1.00 25.12 ? 187 GLN A CG  1 
ATOM   1179 C  CD  . GLN A 1 181 ? -11.108 24.952 -27.265 1.00 33.07 ? 187 GLN A CD  1 
ATOM   1180 O  OE1 . GLN A 1 181 ? -11.881 25.080 -26.316 1.00 39.27 ? 187 GLN A OE1 1 
ATOM   1181 N  NE2 . GLN A 1 181 ? -10.579 23.785 -27.603 1.00 37.45 ? 187 GLN A NE2 1 
ATOM   1182 N  N   . ALA A 1 182 ? -9.774  30.256 -26.290 1.00 25.26 ? 188 ALA A N   1 
ATOM   1183 C  CA  . ALA A 1 182 ? -9.994  31.476 -25.525 1.00 28.12 ? 188 ALA A CA  1 
ATOM   1184 C  C   . ALA A 1 182 ? -9.842  32.706 -26.413 1.00 25.07 ? 188 ALA A C   1 
ATOM   1185 O  O   . ALA A 1 182 ? -10.580 33.680 -26.270 1.00 27.44 ? 188 ALA A O   1 
ATOM   1186 C  CB  . ALA A 1 182 ? -9.032  31.548 -24.371 1.00 19.46 ? 188 ALA A CB  1 
ATOM   1187 N  N   . VAL A 1 183 ? -8.878  32.656 -27.328 1.00 29.51 ? 189 VAL A N   1 
ATOM   1188 C  CA  . VAL A 1 183 ? -8.645  33.755 -28.256 1.00 26.08 ? 189 VAL A CA  1 
ATOM   1189 C  C   . VAL A 1 183 ? -9.807  33.886 -29.236 1.00 28.29 ? 189 VAL A C   1 
ATOM   1190 O  O   . VAL A 1 183 ? -10.268 34.992 -29.520 1.00 27.72 ? 189 VAL A O   1 
ATOM   1191 C  CB  . VAL A 1 183 ? -7.334  33.550 -29.041 1.00 23.67 ? 189 VAL A CB  1 
ATOM   1192 C  CG1 . VAL A 1 183 ? -7.227  34.543 -30.188 1.00 23.91 ? 189 VAL A CG1 1 
ATOM   1193 C  CG2 . VAL A 1 183 ? -6.132  33.678 -28.117 1.00 24.36 ? 189 VAL A CG2 1 
ATOM   1194 N  N   . ALA A 1 184 ? -10.277 32.754 -29.749 1.00 29.14 ? 190 ALA A N   1 
ATOM   1195 C  CA  . ALA A 1 184 ? -11.380 32.743 -30.705 1.00 30.15 ? 190 ALA A CA  1 
ATOM   1196 C  C   . ALA A 1 184 ? -12.630 33.417 -30.142 1.00 26.85 ? 190 ALA A C   1 
ATOM   1197 O  O   . ALA A 1 184 ? -13.253 34.241 -30.811 1.00 27.65 ? 190 ALA A O   1 
ATOM   1198 C  CB  . ALA A 1 184 ? -11.700 31.320 -31.118 1.00 24.49 ? 190 ALA A CB  1 
ATOM   1199 N  N   . LEU A 1 185 ? -12.997 33.061 -28.916 1.00 28.59 ? 191 LEU A N   1 
ATOM   1200 C  CA  . LEU A 1 185 ? -14.215 33.581 -28.305 1.00 33.04 ? 191 LEU A CA  1 
ATOM   1201 C  C   . LEU A 1 185 ? -14.136 35.090 -28.104 1.00 27.56 ? 191 LEU A C   1 
ATOM   1202 O  O   . LEU A 1 185 ? -15.106 35.809 -28.348 1.00 31.34 ? 191 LEU A O   1 
ATOM   1203 C  CB  . LEU A 1 185 ? -14.475 32.889 -26.968 1.00 29.85 ? 191 LEU A CB  1 
ATOM   1204 C  CG  . LEU A 1 185 ? -14.736 31.383 -27.038 1.00 38.05 ? 191 LEU A CG  1 
ATOM   1205 C  CD1 . LEU A 1 185 ? -14.889 30.813 -25.638 1.00 36.31 ? 191 LEU A CD1 1 
ATOM   1206 C  CD2 . LEU A 1 185 ? -15.970 31.088 -27.877 1.00 37.83 ? 191 LEU A CD2 1 
ATOM   1207 N  N   . ARG A 1 186 ? -12.982 35.568 -27.654 1.00 29.63 ? 192 ARG A N   1 
ATOM   1208 C  CA  . ARG A 1 186 ? -12.774 36.999 -27.485 1.00 28.96 ? 192 ARG A CA  1 
ATOM   1209 C  C   . ARG A 1 186 ? -12.797 37.689 -28.843 1.00 31.27 ? 192 ARG A C   1 
ATOM   1210 O  O   . ARG A 1 186 ? -13.434 38.727 -29.009 1.00 31.27 ? 192 ARG A O   1 
ATOM   1211 C  CB  . ARG A 1 186 ? -11.444 37.267 -26.779 1.00 25.41 ? 192 ARG A CB  1 
ATOM   1212 C  CG  . ARG A 1 186 ? -11.475 37.006 -25.285 1.00 27.51 ? 192 ARG A CG  1 
ATOM   1213 C  CD  . ARG A 1 186 ? -10.100 36.649 -24.745 1.00 27.24 ? 192 ARG A CD  1 
ATOM   1214 N  NE  . ARG A 1 186 ? -10.125 36.460 -23.297 1.00 30.40 ? 192 ARG A NE  1 
ATOM   1215 C  CZ  . ARG A 1 186 ? -10.598 35.378 -22.687 1.00 27.98 ? 192 ARG A CZ  1 
ATOM   1216 N  NH1 . ARG A 1 186 ? -11.093 34.368 -23.390 1.00 26.43 ? 192 ARG A NH1 1 
ATOM   1217 N  NH2 . ARG A 1 186 ? -10.580 35.306 -21.364 1.00 23.67 ? 192 ARG A NH2 1 
ATOM   1218 N  N   . ALA A 1 187 ? -12.116 37.090 -29.815 1.00 25.72 ? 193 ALA A N   1 
ATOM   1219 C  CA  . ALA A 1 187 ? -11.983 37.682 -31.139 1.00 33.08 ? 193 ALA A CA  1 
ATOM   1220 C  C   . ALA A 1 187 ? -13.340 37.897 -31.799 1.00 28.40 ? 193 ALA A C   1 
ATOM   1221 O  O   . ALA A 1 187 ? -13.541 38.885 -32.506 1.00 30.39 ? 193 ALA A O   1 
ATOM   1222 C  CB  . ALA A 1 187 ? -11.109 36.806 -32.015 1.00 23.36 ? 193 ALA A CB  1 
ATOM   1223 N  N   . LYS A 1 188 ? -14.266 36.969 -31.577 1.00 27.94 ? 194 LYS A N   1 
ATOM   1224 C  CA  . LYS A 1 188 ? -15.605 37.087 -32.143 1.00 32.16 ? 194 LYS A CA  1 
ATOM   1225 C  C   . LYS A 1 188 ? -16.295 38.357 -31.661 1.00 27.98 ? 194 LYS A C   1 
ATOM   1226 O  O   . LYS A 1 188 ? -17.085 38.955 -32.388 1.00 30.40 ? 194 LYS A O   1 
ATOM   1227 C  CB  . LYS A 1 188 ? -16.462 35.875 -31.773 1.00 34.60 ? 194 LYS A CB  1 
ATOM   1228 C  CG  . LYS A 1 188 ? -16.089 34.588 -32.492 1.00 39.37 ? 194 LYS A CG  1 
ATOM   1229 C  CD  . LYS A 1 188 ? -16.952 33.425 -32.012 1.00 37.22 ? 194 LYS A CD  1 
ATOM   1230 C  CE  . LYS A 1 188 ? -17.910 32.949 -33.094 1.00 48.15 ? 194 LYS A CE  1 
ATOM   1231 N  NZ  . LYS A 1 188 ? -18.945 32.021 -32.556 1.00 51.42 ? 194 LYS A NZ  1 
ATOM   1232 N  N   . ALA A 1 189 ? -15.995 38.767 -30.433 1.00 26.24 ? 195 ALA A N   1 
ATOM   1233 C  CA  . ALA A 1 189 ? -16.655 39.922 -29.840 1.00 31.11 ? 195 ALA A CA  1 
ATOM   1234 C  C   . ALA A 1 189 ? -16.228 41.226 -30.509 1.00 25.95 ? 195 ALA A C   1 
ATOM   1235 O  O   . ALA A 1 189 ? -16.824 42.275 -30.271 1.00 32.72 ? 195 ALA A O   1 
ATOM   1236 C  CB  . ALA A 1 189 ? -16.375 39.980 -28.354 1.00 30.06 ? 195 ALA A CB  1 
ATOM   1237 N  N   . PHE A 1 190 ? -15.196 41.159 -31.344 1.00 27.21 ? 196 PHE A N   1 
ATOM   1238 C  CA  . PHE A 1 190 ? -14.721 42.336 -32.061 1.00 25.86 ? 196 PHE A CA  1 
ATOM   1239 C  C   . PHE A 1 190 ? -15.184 42.333 -33.513 1.00 26.91 ? 196 PHE A C   1 
ATOM   1240 O  O   . PHE A 1 190 ? -14.898 43.267 -34.264 1.00 24.93 ? 196 PHE A O   1 
ATOM   1241 C  CB  . PHE A 1 190 ? -13.195 42.403 -32.012 1.00 25.84 ? 196 PHE A CB  1 
ATOM   1242 C  CG  . PHE A 1 190 ? -12.643 42.675 -30.641 1.00 25.87 ? 196 PHE A CG  1 
ATOM   1243 C  CD1 . PHE A 1 190 ? -12.453 41.647 -29.739 1.00 28.35 ? 196 PHE A CD1 1 
ATOM   1244 C  CD2 . PHE A 1 190 ? -12.304 43.961 -30.261 1.00 28.15 ? 196 PHE A CD2 1 
ATOM   1245 C  CE1 . PHE A 1 190 ? -11.942 41.894 -28.482 1.00 29.93 ? 196 PHE A CE1 1 
ATOM   1246 C  CE2 . PHE A 1 190 ? -11.793 44.216 -29.008 1.00 21.55 ? 196 PHE A CE2 1 
ATOM   1247 C  CZ  . PHE A 1 190 ? -11.610 43.183 -28.117 1.00 21.95 ? 196 PHE A CZ  1 
ATOM   1248 N  N   . GLY A 1 191 ? -15.888 41.277 -33.909 1.00 29.74 ? 197 GLY A N   1 
ATOM   1249 C  CA  . GLY A 1 191 ? -16.386 41.167 -35.267 1.00 24.23 ? 197 GLY A CA  1 
ATOM   1250 C  C   . GLY A 1 191 ? -15.444 40.415 -36.187 1.00 27.21 ? 197 GLY A C   1 
ATOM   1251 O  O   . GLY A 1 191 ? -15.634 40.415 -37.404 1.00 31.01 ? 197 GLY A O   1 
ATOM   1252 N  N   . PHE A 1 192 ? -14.425 39.779 -35.615 1.00 25.69 ? 198 PHE A N   1 
ATOM   1253 C  CA  . PHE A 1 192 ? -13.514 38.949 -36.397 1.00 26.65 ? 198 PHE A CA  1 
ATOM   1254 C  C   . PHE A 1 192 ? -14.236 37.720 -36.925 1.00 29.30 ? 198 PHE A C   1 
ATOM   1255 O  O   . PHE A 1 192 ? -14.962 37.053 -36.188 1.00 32.55 ? 198 PHE A O   1 
ATOM   1256 C  CB  . PHE A 1 192 ? -12.341 38.462 -35.540 1.00 27.37 ? 198 PHE A CB  1 
ATOM   1257 C  CG  . PHE A 1 192 ? -11.180 39.415 -35.478 1.00 26.66 ? 198 PHE A CG  1 
ATOM   1258 C  CD1 . PHE A 1 192 ? -10.399 39.643 -36.593 1.00 21.84 ? 198 PHE A CD1 1 
ATOM   1259 C  CD2 . PHE A 1 192 ? -10.849 40.054 -34.295 1.00 23.92 ? 198 PHE A CD2 1 
ATOM   1260 C  CE1 . PHE A 1 192 ? -9.324  40.506 -36.540 1.00 28.30 ? 198 PHE A CE1 1 
ATOM   1261 C  CE2 . PHE A 1 192 ? -9.773  40.918 -34.236 1.00 27.97 ? 198 PHE A CE2 1 
ATOM   1262 C  CZ  . PHE A 1 192 ? -9.009  41.142 -35.360 1.00 28.75 ? 198 PHE A CZ  1 
ATOM   1263 N  N   . ASN A 1 193 ? -14.036 37.424 -38.204 1.00 27.98 ? 199 ASN A N   1 
ATOM   1264 C  CA  . ASN A 1 193 ? -14.375 36.116 -38.739 1.00 29.66 ? 199 ASN A CA  1 
ATOM   1265 C  C   . ASN A 1 193 ? -13.230 35.178 -38.371 1.00 32.56 ? 199 ASN A C   1 
ATOM   1266 O  O   . ASN A 1 193 ? -12.097 35.380 -38.804 1.00 30.56 ? 199 ASN A O   1 
ATOM   1267 C  CB  . ASN A 1 193 ? -14.550 36.184 -40.257 1.00 34.23 ? 199 ASN A CB  1 
ATOM   1268 C  CG  . ASN A 1 193 ? -14.755 34.816 -40.884 1.00 41.55 ? 199 ASN A CG  1 
ATOM   1269 O  OD1 . ASN A 1 193 ? -15.434 33.958 -40.321 1.00 48.73 ? 199 ASN A OD1 1 
ATOM   1270 N  ND2 . ASN A 1 193 ? -14.155 34.604 -42.052 1.00 47.31 ? 199 ASN A ND2 1 
ATOM   1271 N  N   . VAL A 1 194 ? -13.515 34.162 -37.563 1.00 33.10 ? 200 VAL A N   1 
ATOM   1272 C  CA  . VAL A 1 194 ? -12.452 33.331 -37.004 1.00 31.43 ? 200 VAL A CA  1 
ATOM   1273 C  C   . VAL A 1 194 ? -12.306 31.983 -37.711 1.00 33.28 ? 200 VAL A C   1 
ATOM   1274 O  O   . VAL A 1 194 ? -13.250 31.195 -37.775 1.00 31.97 ? 200 VAL A O   1 
ATOM   1275 C  CB  . VAL A 1 194 ? -12.666 33.101 -35.493 1.00 28.21 ? 200 VAL A CB  1 
ATOM   1276 C  CG1 . VAL A 1 194 ? -11.620 32.146 -34.946 1.00 31.19 ? 200 VAL A CG1 1 
ATOM   1277 C  CG2 . VAL A 1 194 ? -12.618 34.428 -34.748 1.00 25.53 ? 200 VAL A CG2 1 
ATOM   1278 N  N   . LEU A 1 195 ? -11.106 31.736 -38.234 1.00 34.44 ? 201 LEU A N   1 
ATOM   1279 C  CA  . LEU A 1 195 ? -10.743 30.449 -38.823 1.00 31.66 ? 201 LEU A CA  1 
ATOM   1280 C  C   . LEU A 1 195 ? -9.701  29.779 -37.943 1.00 33.80 ? 201 LEU A C   1 
ATOM   1281 O  O   . LEU A 1 195 ? -9.033  30.445 -37.153 1.00 31.88 ? 201 LEU A O   1 
ATOM   1282 C  CB  . LEU A 1 195 ? -10.138 30.636 -40.217 1.00 36.32 ? 201 LEU A CB  1 
ATOM   1283 C  CG  . LEU A 1 195 ? -11.056 30.602 -41.438 1.00 39.32 ? 201 LEU A CG  1 
ATOM   1284 C  CD1 . LEU A 1 195 ? -11.980 31.798 -41.446 1.00 44.17 ? 201 LEU A CD1 1 
ATOM   1285 C  CD2 . LEU A 1 195 ? -10.224 30.553 -42.716 1.00 38.07 ? 201 LEU A CD2 1 
ATOM   1286 N  N   . PHE A 1 196 ? -9.545  28.466 -38.082 1.00 29.72 ? 202 PHE A N   1 
ATOM   1287 C  CA  . PHE A 1 196 ? -8.475  27.772 -37.379 1.00 33.22 ? 202 PHE A CA  1 
ATOM   1288 C  C   . PHE A 1 196 ? -7.979  26.546 -38.141 1.00 35.58 ? 202 PHE A C   1 
ATOM   1289 O  O   . PHE A 1 196 ? -8.719  25.921 -38.905 1.00 33.78 ? 202 PHE A O   1 
ATOM   1290 C  CB  . PHE A 1 196 ? -8.904  27.382 -35.957 1.00 24.60 ? 202 PHE A CB  1 
ATOM   1291 C  CG  . PHE A 1 196 ? -9.804  26.182 -35.896 1.00 31.80 ? 202 PHE A CG  1 
ATOM   1292 C  CD1 . PHE A 1 196 ? -11.170 26.322 -36.026 1.00 34.42 ? 202 PHE A CD1 1 
ATOM   1293 C  CD2 . PHE A 1 196 ? -9.283  24.918 -35.689 1.00 30.98 ? 202 PHE A CD2 1 
ATOM   1294 C  CE1 . PHE A 1 196 ? -12.000 25.226 -35.963 1.00 35.95 ? 202 PHE A CE1 1 
ATOM   1295 C  CE2 . PHE A 1 196 ? -10.108 23.816 -35.624 1.00 35.64 ? 202 PHE A CE2 1 
ATOM   1296 C  CZ  . PHE A 1 196 ? -11.471 23.970 -35.761 1.00 34.40 ? 202 PHE A CZ  1 
ATOM   1297 N  N   . TYR A 1 197 ? -6.706  26.229 -37.933 1.00 33.79 ? 203 TYR A N   1 
ATOM   1298 C  CA  . TYR A 1 197 ? -6.095  25.031 -38.487 1.00 34.59 ? 203 TYR A CA  1 
ATOM   1299 C  C   . TYR A 1 197 ? -5.451  24.249 -37.356 1.00 33.53 ? 203 TYR A C   1 
ATOM   1300 O  O   . TYR A 1 197 ? -4.527  24.731 -36.699 1.00 34.66 ? 203 TYR A O   1 
ATOM   1301 C  CB  . TYR A 1 197 ? -5.048  25.395 -39.540 1.00 31.28 ? 203 TYR A CB  1 
ATOM   1302 C  CG  . TYR A 1 197 ? -4.091  24.270 -39.878 1.00 36.86 ? 203 TYR A CG  1 
ATOM   1303 C  CD1 . TYR A 1 197 ? -4.521  23.158 -40.585 1.00 37.41 ? 203 TYR A CD1 1 
ATOM   1304 C  CD2 . TYR A 1 197 ? -2.757  24.329 -39.502 1.00 39.32 ? 203 TYR A CD2 1 
ATOM   1305 C  CE1 . TYR A 1 197 ? -3.653  22.132 -40.899 1.00 36.92 ? 203 TYR A CE1 1 
ATOM   1306 C  CE2 . TYR A 1 197 ? -1.880  23.308 -39.815 1.00 37.27 ? 203 TYR A CE2 1 
ATOM   1307 C  CZ  . TYR A 1 197 ? -2.335  22.210 -40.512 1.00 41.96 ? 203 TYR A CZ  1 
ATOM   1308 O  OH  . TYR A 1 197 ? -1.472  21.184 -40.835 1.00 44.99 ? 203 TYR A OH  1 
ATOM   1309 N  N   . ASP A 1 198 ? -5.961  23.048 -37.119 1.00 29.88 ? 204 ASP A N   1 
ATOM   1310 C  CA  . ASP A 1 198 ? -5.432  22.191 -36.077 1.00 36.69 ? 204 ASP A CA  1 
ATOM   1311 C  C   . ASP A 1 198 ? -5.650  20.740 -36.485 1.00 37.57 ? 204 ASP A C   1 
ATOM   1312 O  O   . ASP A 1 198 ? -6.715  20.175 -36.242 1.00 37.06 ? 204 ASP A O   1 
ATOM   1313 C  CB  . ASP A 1 198 ? -6.116  22.494 -34.746 1.00 33.87 ? 204 ASP A CB  1 
ATOM   1314 C  CG  . ASP A 1 198 ? -5.408  21.849 -33.575 1.00 36.63 ? 204 ASP A CG  1 
ATOM   1315 O  OD1 . ASP A 1 198 ? -4.687  20.853 -33.797 1.00 31.37 ? 204 ASP A OD1 1 
ATOM   1316 O  OD2 . ASP A 1 198 ? -5.568  22.335 -32.434 1.00 39.01 ? 204 ASP A OD2 1 
ATOM   1317 N  N   . PRO A 1 199 ? -4.631  20.132 -37.111 1.00 37.93 ? 205 PRO A N   1 
ATOM   1318 C  CA  . PRO A 1 199 ? -4.754  18.820 -37.755 1.00 41.36 ? 205 PRO A CA  1 
ATOM   1319 C  C   . PRO A 1 199 ? -4.854  17.654 -36.779 1.00 38.40 ? 205 PRO A C   1 
ATOM   1320 O  O   . PRO A 1 199 ? -5.134  16.536 -37.209 1.00 42.40 ? 205 PRO A O   1 
ATOM   1321 C  CB  . PRO A 1 199 ? -3.458  18.714 -38.560 1.00 34.33 ? 205 PRO A CB  1 
ATOM   1322 C  CG  . PRO A 1 199 ? -2.480  19.496 -37.766 1.00 38.88 ? 205 PRO A CG  1 
ATOM   1323 C  CD  . PRO A 1 199 ? -3.252  20.646 -37.179 1.00 35.15 ? 205 PRO A CD  1 
ATOM   1324 N  N   . TYR A 1 200 ? -4.627  17.906 -35.494 1.00 38.46 ? 206 TYR A N   1 
ATOM   1325 C  CA  . TYR A 1 200 ? -4.654  16.837 -34.502 1.00 36.65 ? 206 TYR A CA  1 
ATOM   1326 C  C   . TYR A 1 200 ? -5.987  16.762 -33.762 1.00 42.25 ? 206 TYR A C   1 
ATOM   1327 O  O   . TYR A 1 200 ? -6.229  15.818 -33.009 1.00 41.36 ? 206 TYR A O   1 
ATOM   1328 C  CB  . TYR A 1 200 ? -3.512  17.019 -33.502 1.00 38.27 ? 206 TYR A CB  1 
ATOM   1329 C  CG  . TYR A 1 200 ? -2.150  17.133 -34.155 1.00 46.02 ? 206 TYR A CG  1 
ATOM   1330 C  CD1 . TYR A 1 200 ? -1.597  16.063 -34.844 1.00 43.51 ? 206 TYR A CD1 1 
ATOM   1331 C  CD2 . TYR A 1 200 ? -1.417  18.309 -34.079 1.00 41.33 ? 206 TYR A CD2 1 
ATOM   1332 C  CE1 . TYR A 1 200 ? -0.356  16.162 -35.443 1.00 45.03 ? 206 TYR A CE1 1 
ATOM   1333 C  CE2 . TYR A 1 200 ? -0.174  18.416 -34.675 1.00 41.42 ? 206 TYR A CE2 1 
ATOM   1334 C  CZ  . TYR A 1 200 ? 0.352   17.340 -35.354 1.00 44.49 ? 206 TYR A CZ  1 
ATOM   1335 O  OH  . TYR A 1 200 ? 1.589   17.444 -35.951 1.00 44.50 ? 206 TYR A OH  1 
ATOM   1336 N  N   . LEU A 1 201 ? -6.848  17.753 -33.971 1.00 40.84 ? 207 LEU A N   1 
ATOM   1337 C  CA  . LEU A 1 201 ? -8.149  17.773 -33.312 1.00 37.21 ? 207 LEU A CA  1 
ATOM   1338 C  C   . LEU A 1 201 ? -9.156  16.897 -34.044 1.00 36.54 ? 207 LEU A C   1 
ATOM   1339 O  O   . LEU A 1 201 ? -9.055  16.687 -35.254 1.00 38.63 ? 207 LEU A O   1 
ATOM   1340 C  CB  . LEU A 1 201 ? -8.686  19.203 -33.210 1.00 38.48 ? 207 LEU A CB  1 
ATOM   1341 C  CG  . LEU A 1 201 ? -8.046  20.111 -32.157 1.00 44.56 ? 207 LEU A CG  1 
ATOM   1342 C  CD1 . LEU A 1 201 ? -8.900  21.351 -31.940 1.00 37.10 ? 207 LEU A CD1 1 
ATOM   1343 C  CD2 . LEU A 1 201 ? -7.829  19.378 -30.846 1.00 40.99 ? 207 LEU A CD2 1 
ATOM   1344 N  N   . SER A 1 202 ? -10.133 16.394 -33.299 1.00 37.41 ? 208 SER A N   1 
ATOM   1345 C  CA  . SER A 1 202 ? -11.135 15.503 -33.862 1.00 41.62 ? 208 SER A CA  1 
ATOM   1346 C  C   . SER A 1 202 ? -12.251 16.284 -34.548 1.00 45.70 ? 208 SER A C   1 
ATOM   1347 O  O   . SER A 1 202 ? -12.445 17.476 -34.298 1.00 43.20 ? 208 SER A O   1 
ATOM   1348 C  CB  . SER A 1 202 ? -11.711 14.596 -32.772 1.00 47.00 ? 208 SER A CB  1 
ATOM   1349 O  OG  . SER A 1 202 ? -12.277 15.354 -31.717 1.00 53.79 ? 208 SER A OG  1 
ATOM   1350 N  N   . ASP A 1 203 ? -12.969 15.592 -35.424 1.00 38.66 ? 209 ASP A N   1 
ATOM   1351 C  CA  . ASP A 1 203 ? -14.075 16.167 -36.174 1.00 40.57 ? 209 ASP A CA  1 
ATOM   1352 C  C   . ASP A 1 203 ? -15.128 16.774 -35.251 1.00 42.10 ? 209 ASP A C   1 
ATOM   1353 O  O   . ASP A 1 203 ? -15.615 16.104 -34.340 1.00 43.31 ? 209 ASP A O   1 
ATOM   1354 C  CB  . ASP A 1 203 ? -14.730 15.062 -37.007 1.00 44.54 ? 209 ASP A CB  1 
ATOM   1355 C  CG  . ASP A 1 203 ? -15.268 15.562 -38.329 1.00 50.98 ? 209 ASP A CG  1 
ATOM   1356 O  OD1 . ASP A 1 203 ? -15.396 16.793 -38.501 1.00 50.87 ? 209 ASP A OD1 1 
ATOM   1357 O  OD2 . ASP A 1 203 ? -15.568 14.714 -39.197 1.00 53.74 ? 209 ASP A OD2 1 
ATOM   1358 N  N   . GLY A 1 204 ? -15.476 18.038 -35.482 1.00 42.99 ? 210 GLY A N   1 
ATOM   1359 C  CA  . GLY A 1 204 ? -16.665 18.617 -34.876 1.00 38.50 ? 210 GLY A CA  1 
ATOM   1360 C  C   . GLY A 1 204 ? -16.472 19.728 -33.860 1.00 38.60 ? 210 GLY A C   1 
ATOM   1361 O  O   . GLY A 1 204 ? -17.446 20.371 -33.466 1.00 35.58 ? 210 GLY A O   1 
ATOM   1362 N  N   . VAL A 1 205 ? -15.238 19.964 -33.426 1.00 42.44 ? 211 VAL A N   1 
ATOM   1363 C  CA  . VAL A 1 205 ? -14.986 20.995 -32.421 1.00 40.14 ? 211 VAL A CA  1 
ATOM   1364 C  C   . VAL A 1 205 ? -15.357 22.374 -32.951 1.00 33.32 ? 211 VAL A C   1 
ATOM   1365 O  O   . VAL A 1 205 ? -15.721 23.267 -32.187 1.00 37.85 ? 211 VAL A O   1 
ATOM   1366 C  CB  . VAL A 1 205 ? -13.511 21.024 -31.984 1.00 47.89 ? 211 VAL A CB  1 
ATOM   1367 C  CG1 . VAL A 1 205 ? -13.098 19.677 -31.413 1.00 38.20 ? 211 VAL A CG1 1 
ATOM   1368 C  CG2 . VAL A 1 205 ? -12.617 21.420 -33.152 1.00 48.06 ? 211 VAL A CG2 1 
ATOM   1369 N  N   . GLU A 1 206 ? -15.249 22.539 -34.266 1.00 35.28 ? 212 GLU A N   1 
ATOM   1370 C  CA  . GLU A 1 206 ? -15.551 23.808 -34.917 1.00 38.90 ? 212 GLU A CA  1 
ATOM   1371 C  C   . GLU A 1 206 ? -17.025 24.176 -34.768 1.00 39.47 ? 212 GLU A C   1 
ATOM   1372 O  O   . GLU A 1 206 ? -17.377 25.354 -34.717 1.00 37.87 ? 212 GLU A O   1 
ATOM   1373 C  CB  . GLU A 1 206 ? -15.166 23.757 -36.402 1.00 38.01 ? 212 GLU A CB  1 
ATOM   1374 C  CG  . GLU A 1 206 ? -15.778 22.607 -37.198 1.00 37.38 ? 212 GLU A CG  1 
ATOM   1375 C  CD  . GLU A 1 206 ? -14.911 21.359 -37.198 1.00 43.13 ? 212 GLU A CD  1 
ATOM   1376 O  OE1 . GLU A 1 206 ? -15.037 20.546 -38.139 1.00 53.23 ? 212 GLU A OE1 1 
ATOM   1377 O  OE2 . GLU A 1 206 ? -14.105 21.188 -36.259 1.00 41.27 ? 212 GLU A OE2 1 
ATOM   1378 N  N   . ARG A 1 207 ? -17.882 23.164 -34.692 1.00 37.08 ? 213 ARG A N   1 
ATOM   1379 C  CA  . ARG A 1 207 ? -19.319 23.384 -34.592 1.00 37.84 ? 213 ARG A CA  1 
ATOM   1380 C  C   . ARG A 1 207 ? -19.699 23.840 -33.190 1.00 37.38 ? 213 ARG A C   1 
ATOM   1381 O  O   . ARG A 1 207 ? -20.566 24.696 -33.017 1.00 42.58 ? 213 ARG A O   1 
ATOM   1382 C  CB  . ARG A 1 207 ? -20.076 22.100 -34.941 1.00 36.46 ? 213 ARG A CB  1 
ATOM   1383 C  CG  . ARG A 1 207 ? -19.612 21.430 -36.227 1.00 42.91 ? 213 ARG A CG  1 
ATOM   1384 C  CD  . ARG A 1 207 ? -19.812 22.325 -37.442 1.00 45.08 ? 213 ARG A CD  1 
ATOM   1385 N  NE  . ARG A 1 207 ? -21.114 22.118 -38.070 1.00 47.83 ? 213 ARG A NE  1 
ATOM   1386 C  CZ  . ARG A 1 207 ? -21.381 21.168 -38.962 1.00 45.61 ? 213 ARG A CZ  1 
ATOM   1387 N  NH1 . ARG A 1 207 ? -20.440 20.317 -39.347 1.00 45.65 ? 213 ARG A NH1 1 
ATOM   1388 N  NH2 . ARG A 1 207 ? -22.599 21.067 -39.472 1.00 48.14 ? 213 ARG A NH2 1 
ATOM   1389 N  N   . ALA A 1 208 ? -19.041 23.266 -32.190 1.00 38.30 ? 214 ALA A N   1 
ATOM   1390 C  CA  . ALA A 1 208 ? -19.353 23.568 -30.802 1.00 39.65 ? 214 ALA A CA  1 
ATOM   1391 C  C   . ALA A 1 208 ? -19.103 25.035 -30.486 1.00 37.31 ? 214 ALA A C   1 
ATOM   1392 O  O   . ALA A 1 208 ? -19.844 25.649 -29.720 1.00 41.29 ? 214 ALA A O   1 
ATOM   1393 C  CB  . ALA A 1 208 ? -18.527 22.697 -29.884 1.00 36.44 ? 214 ALA A CB  1 
ATOM   1394 N  N   . LEU A 1 209 ? -18.057 25.593 -31.085 1.00 41.88 ? 215 LEU A N   1 
ATOM   1395 C  CA  . LEU A 1 209 ? -17.612 26.937 -30.748 1.00 32.92 ? 215 LEU A CA  1 
ATOM   1396 C  C   . LEU A 1 209 ? -17.968 27.954 -31.832 1.00 39.28 ? 215 LEU A C   1 
ATOM   1397 O  O   . LEU A 1 209 ? -17.645 29.137 -31.713 1.00 41.07 ? 215 LEU A O   1 
ATOM   1398 C  CB  . LEU A 1 209 ? -16.104 26.919 -30.501 1.00 39.09 ? 215 LEU A CB  1 
ATOM   1399 C  CG  . LEU A 1 209 ? -15.696 25.806 -29.529 1.00 45.63 ? 215 LEU A CG  1 
ATOM   1400 C  CD1 . LEU A 1 209 ? -14.195 25.560 -29.529 1.00 41.76 ? 215 LEU A CD1 1 
ATOM   1401 C  CD2 . LEU A 1 209 ? -16.183 26.125 -28.124 1.00 36.79 ? 215 LEU A CD2 1 
ATOM   1402 N  N   . GLY A 1 210 ? -18.643 27.496 -32.881 1.00 33.88 ? 216 GLY A N   1 
ATOM   1403 C  CA  . GLY A 1 210 ? -19.091 28.382 -33.939 1.00 32.32 ? 216 GLY A CA  1 
ATOM   1404 C  C   . GLY A 1 210 ? -17.944 28.972 -34.735 1.00 35.33 ? 216 GLY A C   1 
ATOM   1405 O  O   . GLY A 1 210 ? -17.910 30.176 -34.994 1.00 37.78 ? 216 GLY A O   1 
ATOM   1406 N  N   . LEU A 1 211 ? -17.008 28.120 -35.137 1.00 30.49 ? 217 LEU A N   1 
ATOM   1407 C  CA  . LEU A 1 211 ? -15.836 28.564 -35.874 1.00 33.05 ? 217 LEU A CA  1 
ATOM   1408 C  C   . LEU A 1 211 ? -15.760 27.868 -37.227 1.00 31.84 ? 217 LEU A C   1 
ATOM   1409 O  O   . LEU A 1 211 ? -16.440 26.867 -37.460 1.00 38.66 ? 217 LEU A O   1 
ATOM   1410 C  CB  . LEU A 1 211 ? -14.571 28.262 -35.071 1.00 25.80 ? 217 LEU A CB  1 
ATOM   1411 C  CG  . LEU A 1 211 ? -14.552 28.744 -33.620 1.00 35.82 ? 217 LEU A CG  1 
ATOM   1412 C  CD1 . LEU A 1 211 ? -13.257 28.323 -32.948 1.00 30.30 ? 217 LEU A CD1 1 
ATOM   1413 C  CD2 . LEU A 1 211 ? -14.731 30.247 -33.555 1.00 33.59 ? 217 LEU A CD2 1 
ATOM   1414 N  N   . GLN A 1 212 ? -14.927 28.401 -38.115 1.00 39.61 ? 218 GLN A N   1 
ATOM   1415 C  CA  . GLN A 1 212 ? -14.679 27.773 -39.407 1.00 38.95 ? 218 GLN A CA  1 
ATOM   1416 C  C   . GLN A 1 212 ? -13.341 27.052 -39.346 1.00 34.63 ? 218 GLN A C   1 
ATOM   1417 O  O   . GLN A 1 212 ? -12.376 27.569 -38.782 1.00 35.89 ? 218 GLN A O   1 
ATOM   1418 C  CB  . GLN A 1 212 ? -14.659 28.817 -40.526 1.00 40.27 ? 218 GLN A CB  1 
ATOM   1419 C  CG  . GLN A 1 212 ? -15.273 28.334 -41.838 1.00 49.66 ? 218 GLN A CG  1 
ATOM   1420 C  CD  . GLN A 1 212 ? -14.880 29.189 -43.029 1.00 56.06 ? 218 GLN A CD  1 
ATOM   1421 O  OE1 . GLN A 1 212 ? -14.240 28.710 -43.966 1.00 51.11 ? 218 GLN A OE1 1 
ATOM   1422 N  NE2 . GLN A 1 212 ? -15.269 30.459 -43.002 1.00 51.78 ? 218 GLN A NE2 1 
ATOM   1423 N  N   . ARG A 1 213 ? -13.288 25.855 -39.921 1.00 37.38 ? 219 ARG A N   1 
ATOM   1424 C  CA  . ARG A 1 213 ? -12.073 25.050 -39.902 1.00 37.86 ? 219 ARG A CA  1 
ATOM   1425 C  C   . ARG A 1 213 ? -11.542 24.820 -41.311 1.00 38.52 ? 219 ARG A C   1 
ATOM   1426 O  O   . ARG A 1 213 ? -12.315 24.651 -42.256 1.00 36.49 ? 219 ARG A O   1 
ATOM   1427 C  CB  . ARG A 1 213 ? -12.344 23.703 -39.229 1.00 33.85 ? 219 ARG A CB  1 
ATOM   1428 C  CG  . ARG A 1 213 ? -11.135 22.778 -39.169 1.00 33.23 ? 219 ARG A CG  1 
ATOM   1429 C  CD  . ARG A 1 213 ? -11.450 21.510 -38.391 1.00 34.38 ? 219 ARG A CD  1 
ATOM   1430 N  NE  . ARG A 1 213 ? -10.243 20.770 -38.037 1.00 38.40 ? 219 ARG A NE  1 
ATOM   1431 C  CZ  . ARG A 1 213 ? -10.214 19.725 -37.216 1.00 39.39 ? 219 ARG A CZ  1 
ATOM   1432 N  NH1 . ARG A 1 213 ? -11.330 19.281 -36.651 1.00 36.44 ? 219 ARG A NH1 1 
ATOM   1433 N  NH2 . ARG A 1 213 ? -9.063  19.121 -36.955 1.00 38.79 ? 219 ARG A NH2 1 
ATOM   1434 N  N   . VAL A 1 214 ? -10.219 24.814 -41.442 1.00 34.41 ? 220 VAL A N   1 
ATOM   1435 C  CA  . VAL A 1 214 ? -9.575  24.492 -42.709 1.00 34.47 ? 220 VAL A CA  1 
ATOM   1436 C  C   . VAL A 1 214 ? -8.641  23.303 -42.517 1.00 40.14 ? 220 VAL A C   1 
ATOM   1437 O  O   . VAL A 1 214 ? -8.171  23.047 -41.407 1.00 37.93 ? 220 VAL A O   1 
ATOM   1438 C  CB  . VAL A 1 214 ? -8.796  25.692 -43.285 1.00 36.33 ? 220 VAL A CB  1 
ATOM   1439 C  CG1 . VAL A 1 214 ? -9.751  26.822 -43.621 1.00 34.64 ? 220 VAL A CG1 1 
ATOM   1440 C  CG2 . VAL A 1 214 ? -7.722  26.162 -42.316 1.00 42.09 ? 220 VAL A CG2 1 
ATOM   1441 N  N   . SER A 1 215 ? -8.377  22.580 -43.600 1.00 34.89 ? 221 SER A N   1 
ATOM   1442 C  CA  . SER A 1 215 ? -7.637  21.326 -43.521 1.00 40.13 ? 221 SER A CA  1 
ATOM   1443 C  C   . SER A 1 215 ? -6.128  21.504 -43.668 1.00 36.23 ? 221 SER A C   1 
ATOM   1444 O  O   . SER A 1 215 ? -5.360  20.630 -43.265 1.00 43.19 ? 221 SER A O   1 
ATOM   1445 C  CB  . SER A 1 215 ? -8.139  20.349 -44.588 1.00 47.52 ? 221 SER A CB  1 
ATOM   1446 O  OG  . SER A 1 215 ? -9.486  19.980 -44.355 1.00 49.82 ? 221 SER A OG  1 
ATOM   1447 N  N   . THR A 1 216 ? -5.701  22.626 -44.240 1.00 43.00 ? 222 THR A N   1 
ATOM   1448 C  CA  . THR A 1 216 ? -4.280  22.860 -44.476 1.00 42.66 ? 222 THR A CA  1 
ATOM   1449 C  C   . THR A 1 216 ? -3.827  24.218 -43.954 1.00 41.01 ? 222 THR A C   1 
ATOM   1450 O  O   . THR A 1 216 ? -4.618  25.155 -43.851 1.00 40.10 ? 222 THR A O   1 
ATOM   1451 C  CB  . THR A 1 216 ? -3.936  22.788 -45.979 1.00 40.77 ? 222 THR A CB  1 
ATOM   1452 O  OG1 . THR A 1 216 ? -4.544  23.889 -46.665 1.00 50.35 ? 222 THR A OG1 1 
ATOM   1453 C  CG2 . THR A 1 216 ? -4.426  21.483 -46.584 1.00 40.86 ? 222 THR A CG2 1 
ATOM   1454 N  N   . LEU A 1 217 ? -2.542  24.309 -43.631 1.00 36.77 ? 223 LEU A N   1 
ATOM   1455 C  CA  . LEU A 1 217 ? -1.932  25.563 -43.208 1.00 41.05 ? 223 LEU A CA  1 
ATOM   1456 C  C   . LEU A 1 217 ? -2.030  26.609 -44.311 1.00 40.66 ? 223 LEU A C   1 
ATOM   1457 O  O   . LEU A 1 217 ? -2.280  27.785 -44.046 1.00 34.60 ? 223 LEU A O   1 
ATOM   1458 C  CB  . LEU A 1 217 ? -0.464  25.324 -42.854 1.00 37.77 ? 223 LEU A CB  1 
ATOM   1459 C  CG  . LEU A 1 217 ? 0.402   26.553 -42.577 1.00 42.10 ? 223 LEU A CG  1 
ATOM   1460 C  CD1 . LEU A 1 217 ? -0.124  27.343 -41.391 1.00 39.65 ? 223 LEU A CD1 1 
ATOM   1461 C  CD2 . LEU A 1 217 ? 1.840   26.118 -42.346 1.00 38.82 ? 223 LEU A CD2 1 
ATOM   1462 N  N   . GLN A 1 218 ? -1.830  26.172 -45.549 1.00 40.10 ? 224 GLN A N   1 
ATOM   1463 C  CA  . GLN A 1 218 ? -1.888  27.066 -46.698 1.00 41.84 ? 224 GLN A CA  1 
ATOM   1464 C  C   . GLN A 1 218 ? -3.253  27.741 -46.807 1.00 32.36 ? 224 GLN A C   1 
ATOM   1465 O  O   . GLN A 1 218 ? -3.336  28.939 -47.076 1.00 32.06 ? 224 GLN A O   1 
ATOM   1466 C  CB  . GLN A 1 218 ? -1.571  26.290 -47.977 1.00 42.40 ? 224 GLN A CB  1 
ATOM   1467 C  CG  . GLN A 1 218 ? -1.799  27.069 -49.255 1.00 45.01 ? 224 GLN A CG  1 
ATOM   1468 C  CD  . GLN A 1 218 ? -1.400  26.285 -50.486 1.00 56.16 ? 224 GLN A CD  1 
ATOM   1469 O  OE1 . GLN A 1 218 ? -1.035  25.112 -50.404 1.00 61.71 ? 224 GLN A OE1 1 
ATOM   1470 N  NE2 . GLN A 1 218 ? -1.464  26.933 -51.637 1.00 54.37 ? 224 GLN A NE2 1 
ATOM   1471 N  N   . ASP A 1 219 ? -4.320  26.974 -46.597 1.00 37.59 ? 225 ASP A N   1 
ATOM   1472 C  CA  . ASP A 1 219 ? -5.670  27.531 -46.610 1.00 40.75 ? 225 ASP A CA  1 
ATOM   1473 C  C   . ASP A 1 219 ? -5.796  28.600 -45.536 1.00 38.52 ? 225 ASP A C   1 
ATOM   1474 O  O   . ASP A 1 219 ? -6.308  29.691 -45.784 1.00 37.98 ? 225 ASP A O   1 
ATOM   1475 C  CB  . ASP A 1 219 ? -6.715  26.439 -46.368 1.00 49.91 ? 225 ASP A CB  1 
ATOM   1476 C  CG  . ASP A 1 219 ? -7.035  25.648 -47.620 1.00 55.25 ? 225 ASP A CG  1 
ATOM   1477 O  OD1 . ASP A 1 219 ? -7.252  26.271 -48.682 1.00 63.32 ? 225 ASP A OD1 1 
ATOM   1478 O  OD2 . ASP A 1 219 ? -7.072  24.401 -47.541 1.00 58.70 ? 225 ASP A OD2 1 
ATOM   1479 N  N   . LEU A 1 220 ? -5.320  28.274 -44.338 1.00 38.24 ? 226 LEU A N   1 
ATOM   1480 C  CA  . LEU A 1 220 ? -5.363  29.194 -43.209 1.00 37.77 ? 226 LEU A CA  1 
ATOM   1481 C  C   . LEU A 1 220 ? -4.674  30.506 -43.567 1.00 34.98 ? 226 LEU A C   1 
ATOM   1482 O  O   . LEU A 1 220 ? -5.269  31.581 -43.474 1.00 37.35 ? 226 LEU A O   1 
ATOM   1483 C  CB  . LEU A 1 220 ? -4.682  28.549 -41.996 1.00 37.47 ? 226 LEU A CB  1 
ATOM   1484 C  CG  . LEU A 1 220 ? -4.854  29.177 -40.611 1.00 35.20 ? 226 LEU A CG  1 
ATOM   1485 C  CD1 . LEU A 1 220 ? -4.033  30.449 -40.473 1.00 35.65 ? 226 LEU A CD1 1 
ATOM   1486 C  CD2 . LEU A 1 220 ? -6.320  29.445 -40.322 1.00 29.78 ? 226 LEU A CD2 1 
ATOM   1487 N  N   . LEU A 1 221 ? -3.421  30.407 -43.995 1.00 35.01 ? 227 LEU A N   1 
ATOM   1488 C  CA  . LEU A 1 221 ? -2.621  31.583 -44.309 1.00 39.83 ? 227 LEU A CA  1 
ATOM   1489 C  C   . LEU A 1 221 ? -3.206  32.371 -45.478 1.00 38.02 ? 227 LEU A C   1 
ATOM   1490 O  O   . LEU A 1 221 ? -3.048  33.589 -45.559 1.00 32.09 ? 227 LEU A O   1 
ATOM   1491 C  CB  . LEU A 1 221 ? -1.191  31.155 -44.639 1.00 38.57 ? 227 LEU A CB  1 
ATOM   1492 C  CG  . LEU A 1 221 ? -0.461  30.399 -43.525 1.00 37.69 ? 227 LEU A CG  1 
ATOM   1493 C  CD1 . LEU A 1 221 ? 0.857   29.838 -44.034 1.00 40.36 ? 227 LEU A CD1 1 
ATOM   1494 C  CD2 . LEU A 1 221 ? -0.236  31.293 -42.316 1.00 29.96 ? 227 LEU A CD2 1 
ATOM   1495 N  N   . PHE A 1 222 ? -3.893  31.669 -46.373 1.00 34.26 ? 228 PHE A N   1 
ATOM   1496 C  CA  . PHE A 1 222 ? -4.407  32.268 -47.599 1.00 38.49 ? 228 PHE A CA  1 
ATOM   1497 C  C   . PHE A 1 222 ? -5.643  33.131 -47.353 1.00 40.24 ? 228 PHE A C   1 
ATOM   1498 O  O   . PHE A 1 222 ? -5.861  34.125 -48.047 1.00 38.99 ? 228 PHE A O   1 
ATOM   1499 C  CB  . PHE A 1 222 ? -4.723  31.160 -48.608 1.00 41.02 ? 228 PHE A CB  1 
ATOM   1500 C  CG  . PHE A 1 222 ? -5.351  31.649 -49.882 1.00 48.32 ? 228 PHE A CG  1 
ATOM   1501 C  CD1 . PHE A 1 222 ? -4.629  32.412 -50.782 1.00 52.51 ? 228 PHE A CD1 1 
ATOM   1502 C  CD2 . PHE A 1 222 ? -6.660  31.325 -50.188 1.00 47.18 ? 228 PHE A CD2 1 
ATOM   1503 C  CE1 . PHE A 1 222 ? -5.207  32.855 -51.957 1.00 59.05 ? 228 PHE A CE1 1 
ATOM   1504 C  CE2 . PHE A 1 222 ? -7.243  31.761 -51.360 1.00 53.73 ? 228 PHE A CE2 1 
ATOM   1505 C  CZ  . PHE A 1 222 ? -6.516  32.527 -52.246 1.00 53.77 ? 228 PHE A CZ  1 
ATOM   1506 N  N   . HIS A 1 223 ? -6.444  32.757 -46.361 1.00 39.79 ? 229 HIS A N   1 
ATOM   1507 C  CA  . HIS A 1 223 ? -7.698  33.454 -46.086 1.00 42.21 ? 229 HIS A CA  1 
ATOM   1508 C  C   . HIS A 1 223 ? -7.608  34.400 -44.888 1.00 37.77 ? 229 HIS A C   1 
ATOM   1509 O  O   . HIS A 1 223 ? -8.579  35.085 -44.563 1.00 40.74 ? 229 HIS A O   1 
ATOM   1510 C  CB  . HIS A 1 223 ? -8.817  32.442 -45.830 1.00 38.83 ? 229 HIS A CB  1 
ATOM   1511 C  CG  . HIS A 1 223 ? -9.227  31.666 -47.044 1.00 47.38 ? 229 HIS A CG  1 
ATOM   1512 N  ND1 . HIS A 1 223 ? -8.827  30.366 -47.265 1.00 45.68 ? 229 HIS A ND1 1 
ATOM   1513 C  CD2 . HIS A 1 223 ? -10.007 32.005 -48.097 1.00 48.18 ? 229 HIS A CD2 1 
ATOM   1514 C  CE1 . HIS A 1 223 ? -9.343  29.937 -48.404 1.00 50.82 ? 229 HIS A CE1 1 
ATOM   1515 N  NE2 . HIS A 1 223 ? -10.060 30.913 -48.929 1.00 56.01 ? 229 HIS A NE2 1 
ATOM   1516 N  N   . SER A 1 224 ? -6.453  34.440 -44.232 1.00 36.56 ? 230 SER A N   1 
ATOM   1517 C  CA  . SER A 1 224 ? -6.327  35.151 -42.963 1.00 35.54 ? 230 SER A CA  1 
ATOM   1518 C  C   . SER A 1 224 ? -5.613  36.498 -43.094 1.00 32.75 ? 230 SER A C   1 
ATOM   1519 O  O   . SER A 1 224 ? -4.504  36.580 -43.622 1.00 38.46 ? 230 SER A O   1 
ATOM   1520 C  CB  . SER A 1 224 ? -5.598  34.271 -41.946 1.00 35.80 ? 230 SER A CB  1 
ATOM   1521 O  OG  . SER A 1 224 ? -6.320  33.072 -41.712 1.00 32.56 ? 230 SER A OG  1 
ATOM   1522 N  N   . ASP A 1 225 ? -6.260  37.549 -42.597 1.00 32.58 ? 231 ASP A N   1 
ATOM   1523 C  CA  . ASP A 1 225 ? -5.673  38.883 -42.575 1.00 33.04 ? 231 ASP A CA  1 
ATOM   1524 C  C   . ASP A 1 225 ? -4.700  38.999 -41.412 1.00 31.10 ? 231 ASP A C   1 
ATOM   1525 O  O   . ASP A 1 225 ? -3.710  39.730 -41.483 1.00 32.96 ? 231 ASP A O   1 
ATOM   1526 C  CB  . ASP A 1 225 ? -6.769  39.938 -42.425 1.00 30.65 ? 231 ASP A CB  1 
ATOM   1527 C  CG  . ASP A 1 225 ? -7.766  39.910 -43.564 1.00 35.03 ? 231 ASP A CG  1 
ATOM   1528 O  OD1 . ASP A 1 225 ? -7.340  40.039 -44.731 1.00 36.48 ? 231 ASP A OD1 1 
ATOM   1529 O  OD2 . ASP A 1 225 ? -8.974  39.752 -43.291 1.00 32.70 ? 231 ASP A OD2 1 
ATOM   1530 N  N   . CYS A 1 226 ? -5.003  38.284 -40.334 1.00 32.02 ? 232 CYS A N   1 
ATOM   1531 C  CA  . CYS A 1 226 ? -4.146  38.250 -39.158 1.00 31.20 ? 232 CYS A CA  1 
ATOM   1532 C  C   . CYS A 1 226 ? -3.957  36.805 -38.698 1.00 30.11 ? 232 CYS A C   1 
ATOM   1533 O  O   . CYS A 1 226 ? -4.930  36.085 -38.472 1.00 31.83 ? 232 CYS A O   1 
ATOM   1534 C  CB  . CYS A 1 226 ? -4.763  39.089 -38.039 1.00 32.68 ? 232 CYS A CB  1 
ATOM   1535 S  SG  . CYS A 1 226 ? -3.762  39.177 -36.535 1.00 29.49 ? 232 CYS A SG  1 
ATOM   1536 N  N   . VAL A 1 227 ? -2.704  36.381 -38.568 1.00 29.18 ? 233 VAL A N   1 
ATOM   1537 C  CA  . VAL A 1 227 ? -2.395  35.016 -38.159 1.00 29.32 ? 233 VAL A CA  1 
ATOM   1538 C  C   . VAL A 1 227 ? -1.842  35.022 -36.738 1.00 34.04 ? 233 VAL A C   1 
ATOM   1539 O  O   . VAL A 1 227 ? -0.940  35.797 -36.422 1.00 33.32 ? 233 VAL A O   1 
ATOM   1540 C  CB  . VAL A 1 227 ? -1.364  34.366 -39.107 1.00 35.21 ? 233 VAL A CB  1 
ATOM   1541 C  CG1 . VAL A 1 227 ? -0.977  32.977 -38.616 1.00 29.56 ? 233 VAL A CG1 1 
ATOM   1542 C  CG2 . VAL A 1 227 ? -1.913  34.297 -40.526 1.00 30.16 ? 233 VAL A CG2 1 
ATOM   1543 N  N   . THR A 1 228 ? -2.390  34.165 -35.880 1.00 32.04 ? 234 THR A N   1 
ATOM   1544 C  CA  . THR A 1 228 ? -1.930  34.074 -34.499 1.00 30.22 ? 234 THR A CA  1 
ATOM   1545 C  C   . THR A 1 228 ? -1.636  32.618 -34.132 1.00 30.89 ? 234 THR A C   1 
ATOM   1546 O  O   . THR A 1 228 ? -2.432  31.719 -34.414 1.00 28.50 ? 234 THR A O   1 
ATOM   1547 C  CB  . THR A 1 228 ? -2.952  34.705 -33.518 1.00 29.04 ? 234 THR A CB  1 
ATOM   1548 O  OG1 . THR A 1 228 ? -2.460  34.616 -32.175 1.00 28.59 ? 234 THR A OG1 1 
ATOM   1549 C  CG2 . THR A 1 228 ? -4.302  34.015 -33.616 1.00 31.96 ? 234 THR A CG2 1 
ATOM   1550 N  N   . LEU A 1 229 ? -0.484  32.397 -33.505 1.00 31.46 ? 235 LEU A N   1 
ATOM   1551 C  CA  . LEU A 1 229 ? 0.004   31.049 -33.234 1.00 31.54 ? 235 LEU A CA  1 
ATOM   1552 C  C   . LEU A 1 229 ? -0.297  30.617 -31.804 1.00 30.38 ? 235 LEU A C   1 
ATOM   1553 O  O   . LEU A 1 229 ? -0.052  31.362 -30.853 1.00 28.84 ? 235 LEU A O   1 
ATOM   1554 C  CB  . LEU A 1 229 ? 1.513   30.984 -33.492 1.00 34.46 ? 235 LEU A CB  1 
ATOM   1555 C  CG  . LEU A 1 229 ? 1.924   31.414 -34.903 1.00 38.31 ? 235 LEU A CG  1 
ATOM   1556 C  CD1 . LEU A 1 229 ? 3.411   31.720 -34.995 1.00 33.29 ? 235 LEU A CD1 1 
ATOM   1557 C  CD2 . LEU A 1 229 ? 1.540   30.341 -35.901 1.00 40.62 ? 235 LEU A CD2 1 
ATOM   1558 N  N   . HIS A 1 230 ? -0.824  29.405 -31.660 1.00 25.90 ? 236 HIS A N   1 
ATOM   1559 C  CA  . HIS A 1 230 ? -1.170  28.872 -30.350 1.00 28.42 ? 236 HIS A CA  1 
ATOM   1560 C  C   . HIS A 1 230 ? -0.967  27.362 -30.300 1.00 32.65 ? 236 HIS A C   1 
ATOM   1561 O  O   . HIS A 1 230 ? -1.676  26.654 -29.582 1.00 32.40 ? 236 HIS A O   1 
ATOM   1562 C  CB  . HIS A 1 230 ? -2.617  29.218 -30.009 1.00 26.19 ? 236 HIS A CB  1 
ATOM   1563 C  CG  . HIS A 1 230 ? -2.897  30.690 -30.007 1.00 24.68 ? 236 HIS A CG  1 
ATOM   1564 N  ND1 . HIS A 1 230 ? -2.454  31.526 -29.007 1.00 23.60 ? 236 HIS A ND1 1 
ATOM   1565 C  CD2 . HIS A 1 230 ? -3.565  31.467 -30.885 1.00 26.51 ? 236 HIS A CD2 1 
ATOM   1566 C  CE1 . HIS A 1 230 ? -2.844  32.764 -29.268 1.00 27.41 ? 236 HIS A CE1 1 
ATOM   1567 N  NE2 . HIS A 1 230 ? -3.520  32.754 -30.407 1.00 26.45 ? 236 HIS A NE2 1 
ATOM   1568 N  N   . CYS A 1 231 ? 0.004   26.878 -31.069 1.00 33.17 ? 237 CYS A N   1 
ATOM   1569 C  CA  . CYS A 1 231 ? 0.336   25.460 -31.091 1.00 33.25 ? 237 CYS A CA  1 
ATOM   1570 C  C   . CYS A 1 231 ? 1.587   25.202 -30.263 1.00 33.66 ? 237 CYS A C   1 
ATOM   1571 O  O   . CYS A 1 231 ? 2.446   26.076 -30.127 1.00 35.44 ? 237 CYS A O   1 
ATOM   1572 C  CB  . CYS A 1 231 ? 0.574   24.996 -32.525 1.00 30.69 ? 237 CYS A CB  1 
ATOM   1573 S  SG  . CYS A 1 231 ? 1.886   25.915 -33.361 1.00 31.99 ? 237 CYS A SG  1 
ATOM   1574 N  N   . GLY A 1 232 ? 1.682   24.002 -29.703 1.00 32.81 ? 238 GLY A N   1 
ATOM   1575 C  CA  . GLY A 1 232 ? 2.887   23.589 -29.014 1.00 38.53 ? 238 GLY A CA  1 
ATOM   1576 C  C   . GLY A 1 232 ? 4.001   23.346 -30.009 1.00 38.56 ? 238 GLY A C   1 
ATOM   1577 O  O   . GLY A 1 232 ? 3.743   23.018 -31.168 1.00 34.07 ? 238 GLY A O   1 
ATOM   1578 N  N   . LEU A 1 233 ? 5.242   23.513 -29.565 1.00 41.85 ? 239 LEU A N   1 
ATOM   1579 C  CA  . LEU A 1 233 ? 6.385   23.233 -30.424 1.00 40.72 ? 239 LEU A CA  1 
ATOM   1580 C  C   . LEU A 1 233 ? 6.720   21.750 -30.363 1.00 42.68 ? 239 LEU A C   1 
ATOM   1581 O  O   . LEU A 1 233 ? 7.062   21.223 -29.304 1.00 41.98 ? 239 LEU A O   1 
ATOM   1582 C  CB  . LEU A 1 233 ? 7.604   24.068 -30.021 1.00 35.23 ? 239 LEU A CB  1 
ATOM   1583 C  CG  . LEU A 1 233 ? 8.848   23.860 -30.895 1.00 37.99 ? 239 LEU A CG  1 
ATOM   1584 C  CD1 . LEU A 1 233 ? 8.561   24.227 -32.343 1.00 34.93 ? 239 LEU A CD1 1 
ATOM   1585 C  CD2 . LEU A 1 233 ? 10.032  24.657 -30.366 1.00 39.30 ? 239 LEU A CD2 1 
ATOM   1586 N  N   . ASN A 1 234 ? 6.607   21.082 -31.505 1.00 43.89 ? 240 ASN A N   1 
ATOM   1587 C  CA  . ASN A 1 234 ? 6.872   19.654 -31.583 1.00 38.40 ? 240 ASN A CA  1 
ATOM   1588 C  C   . ASN A 1 234 ? 7.833   19.336 -32.727 1.00 46.28 ? 240 ASN A C   1 
ATOM   1589 O  O   . ASN A 1 234 ? 8.374   20.239 -33.367 1.00 42.85 ? 240 ASN A O   1 
ATOM   1590 C  CB  . ASN A 1 234 ? 5.561   18.871 -31.731 1.00 48.30 ? 240 ASN A CB  1 
ATOM   1591 C  CG  . ASN A 1 234 ? 4.707   19.364 -32.882 1.00 44.96 ? 240 ASN A CG  1 
ATOM   1592 O  OD1 . ASN A 1 234 ? 5.094   19.261 -34.045 1.00 43.18 ? 240 ASN A OD1 1 
ATOM   1593 N  ND2 . ASN A 1 234 ? 3.528   19.890 -32.563 1.00 40.69 ? 240 ASN A ND2 1 
ATOM   1594 N  N   . GLU A 1 235 ? 8.042   18.049 -32.976 1.00 51.21 ? 241 GLU A N   1 
ATOM   1595 C  CA  . GLU A 1 235 ? 9.002   17.599 -33.979 1.00 53.58 ? 241 GLU A CA  1 
ATOM   1596 C  C   . GLU A 1 235 ? 8.667   18.060 -35.397 1.00 50.32 ? 241 GLU A C   1 
ATOM   1597 O  O   . GLU A 1 235 ? 9.555   18.158 -36.242 1.00 52.76 ? 241 GLU A O   1 
ATOM   1598 C  CB  . GLU A 1 235 ? 9.096   16.071 -33.955 1.00 51.92 ? 241 GLU A CB  1 
ATOM   1599 N  N   . HIS A 1 236 ? 7.397   18.350 -35.659 1.00 52.28 ? 242 HIS A N   1 
ATOM   1600 C  CA  . HIS A 1 236 ? 6.951   18.560 -37.033 1.00 49.90 ? 242 HIS A CA  1 
ATOM   1601 C  C   . HIS A 1 236 ? 6.511   19.988 -37.372 1.00 44.55 ? 242 HIS A C   1 
ATOM   1602 O  O   . HIS A 1 236 ? 5.912   20.205 -38.425 1.00 50.37 ? 242 HIS A O   1 
ATOM   1603 C  CB  . HIS A 1 236 ? 5.809   17.591 -37.361 1.00 53.15 ? 242 HIS A CB  1 
ATOM   1604 C  CG  . HIS A 1 236 ? 6.207   16.145 -37.307 1.00 58.40 ? 242 HIS A CG  1 
ATOM   1605 N  ND1 . HIS A 1 236 ? 5.739   15.284 -36.340 1.00 58.71 ? 242 HIS A ND1 1 
ATOM   1606 C  CD2 . HIS A 1 236 ? 7.024   15.417 -38.100 1.00 57.88 ? 242 HIS A CD2 1 
ATOM   1607 C  CE1 . HIS A 1 236 ? 6.252   14.080 -36.541 1.00 58.63 ? 242 HIS A CE1 1 
ATOM   1608 N  NE2 . HIS A 1 236 ? 7.037   14.136 -37.604 1.00 58.37 ? 242 HIS A NE2 1 
ATOM   1609 N  N   . ASN A 1 237 ? 6.802   20.961 -36.511 1.00 47.30 ? 243 ASN A N   1 
ATOM   1610 C  CA  . ASN A 1 237 ? 6.411   22.340 -36.811 1.00 42.95 ? 243 ASN A CA  1 
ATOM   1611 C  C   . ASN A 1 237 ? 7.460   23.410 -36.490 1.00 43.11 ? 243 ASN A C   1 
ATOM   1612 O  O   . ASN A 1 237 ? 7.120   24.576 -36.285 1.00 43.94 ? 243 ASN A O   1 
ATOM   1613 C  CB  . ASN A 1 237 ? 5.075   22.687 -36.140 1.00 42.63 ? 243 ASN A CB  1 
ATOM   1614 C  CG  . ASN A 1 237 ? 5.128   22.576 -34.631 1.00 46.86 ? 243 ASN A CG  1 
ATOM   1615 O  OD1 . ASN A 1 237 ? 6.190   22.373 -34.044 1.00 41.70 ? 243 ASN A OD1 1 
ATOM   1616 N  ND2 . ASN A 1 237 ? 3.972   22.719 -33.992 1.00 34.76 ? 243 ASN A ND2 1 
ATOM   1617 N  N   . HIS A 1 238 ? 8.731   23.024 -36.447 1.00 43.19 ? 244 HIS A N   1 
ATOM   1618 C  CA  A HIS A 1 238 ? 9.810   23.997 -36.317 0.50 41.16 ? 244 HIS A CA  1 
ATOM   1619 C  CA  B HIS A 1 238 ? 9.805   23.999 -36.310 0.50 40.93 ? 244 HIS A CA  1 
ATOM   1620 C  C   . HIS A 1 238 ? 9.862   24.846 -37.577 1.00 41.56 ? 244 HIS A C   1 
ATOM   1621 O  O   . HIS A 1 238 ? 9.815   24.320 -38.689 1.00 39.67 ? 244 HIS A O   1 
ATOM   1622 C  CB  A HIS A 1 238 ? 11.149  23.289 -36.112 0.50 40.74 ? 244 HIS A CB  1 
ATOM   1623 C  CB  B HIS A 1 238 ? 11.152  23.310 -36.076 0.50 40.85 ? 244 HIS A CB  1 
ATOM   1624 C  CG  A HIS A 1 238 ? 12.292  24.221 -35.829 0.50 40.52 ? 244 HIS A CG  1 
ATOM   1625 C  CG  B HIS A 1 238 ? 11.366  22.855 -34.662 0.50 39.53 ? 244 HIS A CG  1 
ATOM   1626 N  ND1 A HIS A 1 238 ? 12.510  24.765 -34.585 0.50 42.65 ? 244 HIS A ND1 1 
ATOM   1627 N  ND1 B HIS A 1 238 ? 12.138  23.564 -33.768 0.50 37.96 ? 244 HIS A ND1 1 
ATOM   1628 C  CD2 A HIS A 1 238 ? 13.272  24.697 -36.630 0.50 39.50 ? 244 HIS A CD2 1 
ATOM   1629 C  CD2 B HIS A 1 238 ? 10.921  21.767 -33.996 0.50 39.92 ? 244 HIS A CD2 1 
ATOM   1630 C  CE1 A HIS A 1 238 ? 13.582  25.541 -34.627 0.50 39.27 ? 244 HIS A CE1 1 
ATOM   1631 C  CE1 B HIS A 1 238 ? 12.157  22.932 -32.607 0.50 36.56 ? 244 HIS A CE1 1 
ATOM   1632 N  NE2 A HIS A 1 238 ? 14.062  25.515 -35.860 0.50 39.61 ? 244 HIS A NE2 1 
ATOM   1633 N  NE2 B HIS A 1 238 ? 11.425  21.835 -32.720 0.50 33.90 ? 244 HIS A NE2 1 
ATOM   1634 N  N   . HIS A 1 239 ? 9.955   26.158 -37.401 1.00 40.31 ? 245 HIS A N   1 
ATOM   1635 C  CA  . HIS A 1 239 ? 9.940   27.078 -38.528 1.00 38.36 ? 245 HIS A CA  1 
ATOM   1636 C  C   . HIS A 1 239 ? 8.726   26.801 -39.414 1.00 43.51 ? 245 HIS A C   1 
ATOM   1637 O  O   . HIS A 1 239 ? 8.812   26.845 -40.643 1.00 43.28 ? 245 HIS A O   1 
ATOM   1638 C  CB  . HIS A 1 239 ? 11.244  26.981 -39.325 1.00 38.52 ? 245 HIS A CB  1 
ATOM   1639 C  CG  . HIS A 1 239 ? 12.423  27.600 -38.636 1.00 40.83 ? 245 HIS A CG  1 
ATOM   1640 N  ND1 . HIS A 1 239 ? 13.630  27.793 -39.259 1.00 46.33 ? 245 HIS A ND1 1 
ATOM   1641 C  CD2 . HIS A 1 239 ? 12.565  28.074 -37.369 1.00 40.45 ? 245 HIS A CD2 1 
ATOM   1642 C  CE1 . HIS A 1 239 ? 14.480  28.362 -38.406 1.00 39.01 ? 245 HIS A CE1 1 
ATOM   1643 N  NE2 . HIS A 1 239 ? 13.853  28.536 -37.265 1.00 45.79 ? 245 HIS A NE2 1 
ATOM   1644 N  N   . LEU A 1 240 ? 7.597   26.503 -38.774 1.00 42.06 ? 246 LEU A N   1 
ATOM   1645 C  CA  . LEU A 1 240 ? 6.321   26.355 -39.469 1.00 41.94 ? 246 LEU A CA  1 
ATOM   1646 C  C   . LEU A 1 240 ? 6.071   27.583 -40.338 1.00 39.81 ? 246 LEU A C   1 
ATOM   1647 O  O   . LEU A 1 240 ? 5.566   27.477 -41.457 1.00 44.45 ? 246 LEU A O   1 
ATOM   1648 C  CB  . LEU A 1 240 ? 5.185   26.169 -38.456 1.00 41.61 ? 246 LEU A CB  1 
ATOM   1649 C  CG  . LEU A 1 240 ? 3.770   25.939 -38.999 1.00 42.80 ? 246 LEU A CG  1 
ATOM   1650 C  CD1 . LEU A 1 240 ? 2.938   25.166 -37.990 1.00 48.82 ? 246 LEU A CD1 1 
ATOM   1651 C  CD2 . LEU A 1 240 ? 3.083   27.251 -39.339 1.00 44.69 ? 246 LEU A CD2 1 
ATOM   1652 N  N   . ILE A 1 241 ? 6.432   28.748 -39.811 1.00 35.56 ? 247 ILE A N   1 
ATOM   1653 C  CA  . ILE A 1 241 ? 6.400   29.986 -40.575 1.00 38.77 ? 247 ILE A CA  1 
ATOM   1654 C  C   . ILE A 1 241 ? 7.788   30.233 -41.156 1.00 44.06 ? 247 ILE A C   1 
ATOM   1655 O  O   . ILE A 1 241 ? 8.736   30.505 -40.420 1.00 36.79 ? 247 ILE A O   1 
ATOM   1656 C  CB  . ILE A 1 241 ? 5.986   31.172 -39.690 1.00 40.18 ? 247 ILE A CB  1 
ATOM   1657 C  CG1 . ILE A 1 241 ? 4.570   30.958 -39.143 1.00 42.36 ? 247 ILE A CG1 1 
ATOM   1658 C  CG2 . ILE A 1 241 ? 6.071   32.477 -40.468 1.00 39.00 ? 247 ILE A CG2 1 
ATOM   1659 C  CD1 . ILE A 1 241 ? 3.512   30.795 -40.208 1.00 38.96 ? 247 ILE A CD1 1 
ATOM   1660 N  N   . ASN A 1 242 ? 7.899   30.133 -42.479 1.00 44.77 ? 248 ASN A N   1 
ATOM   1661 C  CA  . ASN A 1 242 ? 9.185   30.212 -43.160 1.00 41.78 ? 248 ASN A CA  1 
ATOM   1662 C  C   . ASN A 1 242 ? 9.053   30.963 -44.482 1.00 43.40 ? 248 ASN A C   1 
ATOM   1663 O  O   . ASN A 1 242 ? 7.964   31.409 -44.839 1.00 47.38 ? 248 ASN A O   1 
ATOM   1664 C  CB  . ASN A 1 242 ? 9.728   28.806 -43.414 1.00 39.20 ? 248 ASN A CB  1 
ATOM   1665 C  CG  . ASN A 1 242 ? 8.750   27.936 -44.182 1.00 46.18 ? 248 ASN A CG  1 
ATOM   1666 O  OD1 . ASN A 1 242 ? 8.404   28.237 -45.322 1.00 50.26 ? 248 ASN A OD1 1 
ATOM   1667 N  ND2 . ASN A 1 242 ? 8.303   26.853 -43.561 1.00 41.97 ? 248 ASN A ND2 1 
ATOM   1668 N  N   . ASP A 1 243 ? 10.160  31.103 -45.206 1.00 50.57 ? 249 ASP A N   1 
ATOM   1669 C  CA  . ASP A 1 243 ? 10.150  31.806 -46.489 1.00 50.02 ? 249 ASP A CA  1 
ATOM   1670 C  C   . ASP A 1 243 ? 9.057   31.274 -47.414 1.00 46.59 ? 249 ASP A C   1 
ATOM   1671 O  O   . ASP A 1 243 ? 8.408   32.041 -48.124 1.00 48.98 ? 249 ASP A O   1 
ATOM   1672 C  CB  . ASP A 1 243 ? 11.515  31.688 -47.173 1.00 53.53 ? 249 ASP A CB  1 
ATOM   1673 C  CG  . ASP A 1 243 ? 12.538  32.656 -46.607 1.00 60.83 ? 249 ASP A CG  1 
ATOM   1674 O  OD1 . ASP A 1 243 ? 12.256  33.874 -46.572 1.00 59.32 ? 249 ASP A OD1 1 
ATOM   1675 O  OD2 . ASP A 1 243 ? 13.625  32.199 -46.195 1.00 69.33 ? 249 ASP A OD2 1 
ATOM   1676 N  N   . PHE A 1 244 ? 8.854   29.961 -47.397 1.00 44.48 ? 250 PHE A N   1 
ATOM   1677 C  CA  . PHE A 1 244 ? 7.842   29.330 -48.236 1.00 51.83 ? 250 PHE A CA  1 
ATOM   1678 C  C   . PHE A 1 244 ? 6.431   29.712 -47.794 1.00 48.54 ? 250 PHE A C   1 
ATOM   1679 O  O   . PHE A 1 244 ? 5.643   30.226 -48.588 1.00 53.09 ? 250 PHE A O   1 
ATOM   1680 C  CB  . PHE A 1 244 ? 8.006   27.807 -48.204 1.00 48.58 ? 250 PHE A CB  1 
ATOM   1681 C  CG  . PHE A 1 244 ? 7.141   27.079 -49.192 1.00 60.40 ? 250 PHE A CG  1 
ATOM   1682 C  CD1 . PHE A 1 244 ? 7.338   27.229 -50.555 1.00 64.39 ? 250 PHE A CD1 1 
ATOM   1683 C  CD2 . PHE A 1 244 ? 6.139   26.229 -48.756 1.00 60.84 ? 250 PHE A CD2 1 
ATOM   1684 C  CE1 . PHE A 1 244 ? 6.543   26.552 -51.463 1.00 65.44 ? 250 PHE A CE1 1 
ATOM   1685 C  CE2 . PHE A 1 244 ? 5.343   25.551 -49.657 1.00 56.77 ? 250 PHE A CE2 1 
ATOM   1686 C  CZ  . PHE A 1 244 ? 5.545   25.711 -51.012 1.00 60.05 ? 250 PHE A CZ  1 
ATOM   1687 N  N   . THR A 1 245 ? 6.115   29.462 -46.527 1.00 48.63 ? 251 THR A N   1 
ATOM   1688 C  CA  . THR A 1 245 ? 4.764   29.691 -46.021 1.00 42.60 ? 251 THR A CA  1 
ATOM   1689 C  C   . THR A 1 245 ? 4.434   31.177 -45.868 1.00 42.40 ? 251 THR A C   1 
ATOM   1690 O  O   . THR A 1 245 ? 3.267   31.561 -45.914 1.00 48.34 ? 251 THR A O   1 
ATOM   1691 C  CB  . THR A 1 245 ? 4.523   28.971 -44.676 1.00 42.23 ? 251 THR A CB  1 
ATOM   1692 O  OG1 . THR A 1 245 ? 5.558   29.308 -43.746 1.00 40.89 ? 251 THR A OG1 1 
ATOM   1693 C  CG2 . THR A 1 245 ? 4.498   27.460 -44.865 1.00 39.03 ? 251 THR A CG2 1 
ATOM   1694 N  N   . VAL A 1 246 ? 5.453   32.012 -45.688 1.00 43.07 ? 252 VAL A N   1 
ATOM   1695 C  CA  . VAL A 1 246 ? 5.243   33.456 -45.644 1.00 44.93 ? 252 VAL A CA  1 
ATOM   1696 C  C   . VAL A 1 246 ? 4.695   33.937 -46.982 1.00 46.70 ? 252 VAL A C   1 
ATOM   1697 O  O   . VAL A 1 246 ? 3.839   34.820 -47.032 1.00 45.81 ? 252 VAL A O   1 
ATOM   1698 C  CB  . VAL A 1 246 ? 6.547   34.220 -45.324 1.00 52.29 ? 252 VAL A CB  1 
ATOM   1699 C  CG1 . VAL A 1 246 ? 6.442   35.679 -45.758 1.00 45.82 ? 252 VAL A CG1 1 
ATOM   1700 C  CG2 . VAL A 1 246 ? 6.865   34.132 -43.842 1.00 39.80 ? 252 VAL A CG2 1 
ATOM   1701 N  N   . LYS A 1 247 ? 5.198   33.352 -48.065 1.00 44.71 ? 253 LYS A N   1 
ATOM   1702 C  CA  . LYS A 1 247 ? 4.718   33.675 -49.402 1.00 48.95 ? 253 LYS A CA  1 
ATOM   1703 C  C   . LYS A 1 247 ? 3.255   33.266 -49.567 1.00 38.28 ? 253 LYS A C   1 
ATOM   1704 O  O   . LYS A 1 247 ? 2.550   33.782 -50.433 1.00 46.55 ? 253 LYS A O   1 
ATOM   1705 C  CB  . LYS A 1 247 ? 5.581   32.979 -50.456 1.00 46.93 ? 253 LYS A CB  1 
ATOM   1706 N  N   . GLN A 1 248 ? 2.806   32.334 -48.733 1.00 41.56 ? 254 GLN A N   1 
ATOM   1707 C  CA  . GLN A 1 248 ? 1.415   31.893 -48.753 1.00 42.41 ? 254 GLN A CA  1 
ATOM   1708 C  C   . GLN A 1 248 ? 0.510   32.845 -47.969 1.00 40.93 ? 254 GLN A C   1 
ATOM   1709 O  O   . GLN A 1 248 ? -0.714  32.776 -48.075 1.00 38.34 ? 254 GLN A O   1 
ATOM   1710 C  CB  . GLN A 1 248 ? 1.294   30.484 -48.168 1.00 42.82 ? 254 GLN A CB  1 
ATOM   1711 C  CG  . GLN A 1 248 ? 1.881   29.377 -49.029 1.00 44.15 ? 254 GLN A CG  1 
ATOM   1712 C  CD  . GLN A 1 248 ? 1.827   28.028 -48.337 1.00 49.05 ? 254 GLN A CD  1 
ATOM   1713 O  OE1 . GLN A 1 248 ? 1.707   27.952 -47.114 1.00 50.81 ? 254 GLN A OE1 1 
ATOM   1714 N  NE2 . GLN A 1 248 ? 1.905   26.956 -49.115 1.00 49.25 ? 254 GLN A NE2 1 
ATOM   1715 N  N   . MET A 1 249 ? 1.116   33.732 -47.184 1.00 43.28 ? 255 MET A N   1 
ATOM   1716 C  CA  . MET A 1 249 ? 0.356   34.655 -46.348 1.00 40.39 ? 255 MET A CA  1 
ATOM   1717 C  C   . MET A 1 249 ? -0.162  35.835 -47.161 1.00 44.41 ? 255 MET A C   1 
ATOM   1718 O  O   . MET A 1 249 ? 0.481   36.274 -48.114 1.00 51.44 ? 255 MET A O   1 
ATOM   1719 C  CB  . MET A 1 249 ? 1.218   35.161 -45.186 1.00 34.33 ? 255 MET A CB  1 
ATOM   1720 C  CG  . MET A 1 249 ? 1.609   34.075 -44.201 1.00 40.92 ? 255 MET A CG  1 
ATOM   1721 S  SD  . MET A 1 249 ? 2.603   34.660 -42.814 1.00 44.26 ? 255 MET A SD  1 
ATOM   1722 C  CE  . MET A 1 249 ? 1.457   35.716 -41.942 1.00 31.94 ? 255 MET A CE  1 
ATOM   1723 N  N   . ARG A 1 250 ? -1.330  36.341 -46.777 1.00 39.76 ? 256 ARG A N   1 
ATOM   1724 C  CA  . ARG A 1 250 ? -1.937  37.475 -47.460 1.00 41.66 ? 256 ARG A CA  1 
ATOM   1725 C  C   . ARG A 1 250 ? -1.023  38.695 -47.432 1.00 44.76 ? 256 ARG A C   1 
ATOM   1726 O  O   . ARG A 1 250 ? -0.222  38.867 -46.512 1.00 44.11 ? 256 ARG A O   1 
ATOM   1727 C  CB  . ARG A 1 250 ? -3.283  37.823 -46.824 1.00 40.14 ? 256 ARG A CB  1 
ATOM   1728 C  CG  . ARG A 1 250 ? -4.415  36.897 -47.224 1.00 41.46 ? 256 ARG A CG  1 
ATOM   1729 C  CD  . ARG A 1 250 ? -5.762  37.512 -46.886 1.00 36.87 ? 256 ARG A CD  1 
ATOM   1730 N  NE  . ARG A 1 250 ? -6.876  36.716 -47.394 1.00 45.73 ? 256 ARG A NE  1 
ATOM   1731 C  CZ  . ARG A 1 250 ? -8.155  37.056 -47.273 1.00 45.65 ? 256 ARG A CZ  1 
ATOM   1732 N  NH1 . ARG A 1 250 ? -8.493  38.182 -46.658 1.00 40.25 ? 256 ARG A NH1 1 
ATOM   1733 N  NH2 . ARG A 1 250 ? -9.101  36.269 -47.767 1.00 41.18 ? 256 ARG A NH2 1 
ATOM   1734 N  N   . GLN A 1 251 ? -1.158  39.541 -48.447 1.00 39.85 ? 257 GLN A N   1 
ATOM   1735 C  CA  . GLN A 1 251 ? -0.365  40.757 -48.551 1.00 43.75 ? 257 GLN A CA  1 
ATOM   1736 C  C   . GLN A 1 251 ? -0.799  41.748 -47.479 1.00 41.56 ? 257 GLN A C   1 
ATOM   1737 O  O   . GLN A 1 251 ? -1.984  42.060 -47.352 1.00 39.44 ? 257 GLN A O   1 
ATOM   1738 C  CB  . GLN A 1 251 ? -0.535  41.376 -49.940 1.00 45.05 ? 257 GLN A CB  1 
ATOM   1739 C  CG  . GLN A 1 251 ? 0.741   41.959 -50.524 1.00 46.98 ? 257 GLN A CG  1 
ATOM   1740 C  CD  . GLN A 1 251 ? 1.110   43.293 -49.914 1.00 54.14 ? 257 GLN A CD  1 
ATOM   1741 O  OE1 . GLN A 1 251 ? 0.247   44.135 -49.663 1.00 65.41 ? 257 GLN A OE1 1 
ATOM   1742 N  NE2 . GLN A 1 251 ? 2.400   43.495 -49.672 1.00 53.31 ? 257 GLN A NE2 1 
ATOM   1743 N  N   . GLY A 1 252 ? 0.165   42.238 -46.705 1.00 40.35 ? 258 GLY A N   1 
ATOM   1744 C  CA  . GLY A 1 252 ? -0.122  43.173 -45.634 1.00 41.86 ? 258 GLY A CA  1 
ATOM   1745 C  C   . GLY A 1 252 ? -0.733  42.501 -44.420 1.00 38.61 ? 258 GLY A C   1 
ATOM   1746 O  O   . GLY A 1 252 ? -1.394  43.150 -43.609 1.00 42.08 ? 258 GLY A O   1 
ATOM   1747 N  N   . ALA A 1 253 ? -0.511  41.198 -44.291 1.00 39.92 ? 259 ALA A N   1 
ATOM   1748 C  CA  . ALA A 1 253 ? -1.088  40.431 -43.195 1.00 37.79 ? 259 ALA A CA  1 
ATOM   1749 C  C   . ALA A 1 253 ? -0.390  40.741 -41.874 1.00 36.44 ? 259 ALA A C   1 
ATOM   1750 O  O   . ALA A 1 253 ? 0.728   41.253 -41.856 1.00 38.61 ? 259 ALA A O   1 
ATOM   1751 C  CB  . ALA A 1 253 ? -0.995  38.954 -43.496 1.00 32.12 ? 259 ALA A CB  1 
ATOM   1752 N  N   . PHE A 1 254 ? -1.064  40.425 -40.773 1.00 34.53 ? 260 PHE A N   1 
ATOM   1753 C  CA  . PHE A 1 254 ? -0.479  40.558 -39.446 1.00 29.01 ? 260 PHE A CA  1 
ATOM   1754 C  C   . PHE A 1 254 ? -0.027  39.190 -38.957 1.00 29.95 ? 260 PHE A C   1 
ATOM   1755 O  O   . PHE A 1 254 ? -0.558  38.164 -39.383 1.00 31.75 ? 260 PHE A O   1 
ATOM   1756 C  CB  . PHE A 1 254 ? -1.499  41.134 -38.458 1.00 34.42 ? 260 PHE A CB  1 
ATOM   1757 C  CG  . PHE A 1 254 ? -1.730  42.617 -38.598 1.00 32.50 ? 260 PHE A CG  1 
ATOM   1758 C  CD1 . PHE A 1 254 ? -0.678  43.487 -38.823 1.00 38.23 ? 260 PHE A CD1 1 
ATOM   1759 C  CD2 . PHE A 1 254 ? -3.004  43.138 -38.488 1.00 29.74 ? 260 PHE A CD2 1 
ATOM   1760 C  CE1 . PHE A 1 254 ? -0.898  44.846 -38.941 1.00 36.95 ? 260 PHE A CE1 1 
ATOM   1761 C  CE2 . PHE A 1 254 ? -3.229  44.494 -38.607 1.00 30.76 ? 260 PHE A CE2 1 
ATOM   1762 C  CZ  . PHE A 1 254 ? -2.176  45.348 -38.834 1.00 33.37 ? 260 PHE A CZ  1 
ATOM   1763 N  N   . LEU A 1 255 ? 0.953   39.180 -38.060 1.00 33.10 ? 261 LEU A N   1 
ATOM   1764 C  CA  . LEU A 1 255 ? 1.392   37.942 -37.431 1.00 33.07 ? 261 LEU A CA  1 
ATOM   1765 C  C   . LEU A 1 255 ? 1.554   38.156 -35.934 1.00 30.29 ? 261 LEU A C   1 
ATOM   1766 O  O   . LEU A 1 255 ? 2.163   39.133 -35.502 1.00 34.06 ? 261 LEU A O   1 
ATOM   1767 C  CB  . LEU A 1 255 ? 2.712   37.455 -38.032 1.00 31.41 ? 261 LEU A CB  1 
ATOM   1768 C  CG  . LEU A 1 255 ? 3.208   36.115 -37.480 1.00 34.75 ? 261 LEU A CG  1 
ATOM   1769 C  CD1 . LEU A 1 255 ? 2.257   34.993 -37.870 1.00 33.36 ? 261 LEU A CD1 1 
ATOM   1770 C  CD2 . LEU A 1 255 ? 4.621   35.814 -37.954 1.00 33.84 ? 261 LEU A CD2 1 
ATOM   1771 N  N   . VAL A 1 256 ? 1.001   37.237 -35.149 1.00 30.75 ? 262 VAL A N   1 
ATOM   1772 C  CA  . VAL A 1 256 ? 1.108   37.299 -33.697 1.00 29.04 ? 262 VAL A CA  1 
ATOM   1773 C  C   . VAL A 1 256 ? 1.591   35.952 -33.173 1.00 28.59 ? 262 VAL A C   1 
ATOM   1774 O  O   . VAL A 1 256 ? 1.125   34.905 -33.619 1.00 31.90 ? 262 VAL A O   1 
ATOM   1775 C  CB  . VAL A 1 256 ? -0.248  37.640 -33.041 1.00 29.76 ? 262 VAL A CB  1 
ATOM   1776 C  CG1 . VAL A 1 256 ? -0.121  37.656 -31.525 1.00 23.80 ? 262 VAL A CG1 1 
ATOM   1777 C  CG2 . VAL A 1 256 ? -0.770  38.974 -33.550 1.00 26.66 ? 262 VAL A CG2 1 
ATOM   1778 N  N   . ASN A 1 257 ? 2.527   35.977 -32.229 1.00 27.60 ? 263 ASN A N   1 
ATOM   1779 C  CA  . ASN A 1 257 ? 3.034   34.742 -31.645 1.00 31.44 ? 263 ASN A CA  1 
ATOM   1780 C  C   . ASN A 1 257 ? 3.218   34.856 -30.139 1.00 31.74 ? 263 ASN A C   1 
ATOM   1781 O  O   . ASN A 1 257 ? 4.064   35.612 -29.659 1.00 32.98 ? 263 ASN A O   1 
ATOM   1782 C  CB  . ASN A 1 257 ? 4.350   34.333 -32.310 1.00 30.02 ? 263 ASN A CB  1 
ATOM   1783 C  CG  . ASN A 1 257 ? 4.795   32.936 -31.911 1.00 35.47 ? 263 ASN A CG  1 
ATOM   1784 O  OD1 . ASN A 1 257 ? 4.046   32.192 -31.279 1.00 33.78 ? 263 ASN A OD1 1 
ATOM   1785 N  ND2 . ASN A 1 257 ? 6.015   32.571 -32.287 1.00 33.48 ? 263 ASN A ND2 1 
ATOM   1786 N  N   . THR A 1 258 ? 2.408   34.103 -29.402 1.00 28.81 ? 264 THR A N   1 
ATOM   1787 C  CA  . THR A 1 258 ? 2.528   34.016 -27.952 1.00 27.88 ? 264 THR A CA  1 
ATOM   1788 C  C   . THR A 1 258 ? 2.714   32.555 -27.565 1.00 29.84 ? 264 THR A C   1 
ATOM   1789 O  O   . THR A 1 258 ? 2.489   32.176 -26.417 1.00 31.26 ? 264 THR A O   1 
ATOM   1790 C  CB  . THR A 1 258 ? 1.276   34.570 -27.228 1.00 30.21 ? 264 THR A CB  1 
ATOM   1791 O  OG1 . THR A 1 258 ? 0.109   33.870 -27.677 1.00 26.68 ? 264 THR A OG1 1 
ATOM   1792 C  CG2 . THR A 1 258 ? 1.108   36.061 -27.486 1.00 24.76 ? 264 THR A CG2 1 
ATOM   1793 N  N   . ALA A 1 259 ? 3.118   31.732 -28.530 1.00 31.36 ? 265 ALA A N   1 
ATOM   1794 C  CA  . ALA A 1 259 ? 3.309   30.307 -28.283 1.00 36.52 ? 265 ALA A CA  1 
ATOM   1795 C  C   . ALA A 1 259 ? 4.785   29.976 -28.063 1.00 36.11 ? 265 ALA A C   1 
ATOM   1796 O  O   . ALA A 1 259 ? 5.266   29.996 -26.930 1.00 35.97 ? 265 ALA A O   1 
ATOM   1797 C  CB  . ALA A 1 259 ? 2.737   29.485 -29.429 1.00 26.11 ? 265 ALA A CB  1 
ATOM   1798 N  N   . ARG A 1 260 ? 5.496   29.677 -29.147 1.00 33.11 ? 266 ARG A N   1 
ATOM   1799 C  CA  . ARG A 1 260 ? 6.910   29.323 -29.070 1.00 34.91 ? 266 ARG A CA  1 
ATOM   1800 C  C   . ARG A 1 260 ? 7.696   29.988 -30.194 1.00 36.04 ? 266 ARG A C   1 
ATOM   1801 O  O   . ARG A 1 260 ? 7.258   30.008 -31.345 1.00 35.19 ? 266 ARG A O   1 
ATOM   1802 C  CB  . ARG A 1 260 ? 7.084   27.804 -29.138 1.00 39.36 ? 266 ARG A CB  1 
ATOM   1803 C  CG  . ARG A 1 260 ? 6.834   27.090 -27.818 1.00 34.42 ? 266 ARG A CG  1 
ATOM   1804 C  CD  . ARG A 1 260 ? 7.870   27.505 -26.780 1.00 38.13 ? 266 ARG A CD  1 
ATOM   1805 N  NE  . ARG A 1 260 ? 7.654   26.899 -25.467 1.00 36.32 ? 266 ARG A NE  1 
ATOM   1806 C  CZ  . ARG A 1 260 ? 7.017   27.468 -24.447 1.00 39.86 ? 266 ARG A CZ  1 
ATOM   1807 N  NH1 . ARG A 1 260 ? 6.490   28.684 -24.550 1.00 34.23 ? 266 ARG A NH1 1 
ATOM   1808 N  NH2 . ARG A 1 260 ? 6.906   26.803 -23.307 1.00 37.26 ? 266 ARG A NH2 1 
ATOM   1809 N  N   . GLY A 1 261 ? 8.863   30.524 -29.853 1.00 33.17 ? 267 GLY A N   1 
ATOM   1810 C  CA  . GLY A 1 261 ? 9.681   31.245 -30.809 1.00 35.32 ? 267 GLY A CA  1 
ATOM   1811 C  C   . GLY A 1 261 ? 10.136  30.382 -31.967 1.00 37.34 ? 267 GLY A C   1 
ATOM   1812 O  O   . GLY A 1 261 ? 10.169  30.836 -33.109 1.00 33.66 ? 267 GLY A O   1 
ATOM   1813 N  N   . GLY A 1 262 ? 10.468  29.128 -31.675 1.00 33.73 ? 268 GLY A N   1 
ATOM   1814 C  CA  . GLY A 1 262 ? 10.971  28.221 -32.689 1.00 38.82 ? 268 GLY A CA  1 
ATOM   1815 C  C   . GLY A 1 262 ? 9.990   27.941 -33.814 1.00 40.46 ? 268 GLY A C   1 
ATOM   1816 O  O   . GLY A 1 262 ? 10.335  27.267 -34.783 1.00 39.29 ? 268 GLY A O   1 
ATOM   1817 N  N   . LEU A 1 263 ? 8.765   28.443 -33.691 1.00 36.62 ? 269 LEU A N   1 
ATOM   1818 C  CA  . LEU A 1 263 ? 7.763   28.258 -34.736 1.00 35.36 ? 269 LEU A CA  1 
ATOM   1819 C  C   . LEU A 1 263 ? 7.987   29.183 -35.933 1.00 35.85 ? 269 LEU A C   1 
ATOM   1820 O  O   . LEU A 1 263 ? 7.401   28.982 -36.998 1.00 36.32 ? 269 LEU A O   1 
ATOM   1821 C  CB  . LEU A 1 263 ? 6.367   28.506 -34.172 1.00 35.34 ? 269 LEU A CB  1 
ATOM   1822 C  CG  . LEU A 1 263 ? 5.916   27.587 -33.037 1.00 33.50 ? 269 LEU A CG  1 
ATOM   1823 C  CD1 . LEU A 1 263 ? 4.656   28.140 -32.402 1.00 36.64 ? 269 LEU A CD1 1 
ATOM   1824 C  CD2 . LEU A 1 263 ? 5.685   26.178 -33.548 1.00 32.25 ? 269 LEU A CD2 1 
ATOM   1825 N  N   . VAL A 1 264 ? 8.834   30.193 -35.757 1.00 34.03 ? 270 VAL A N   1 
ATOM   1826 C  CA  . VAL A 1 264 ? 9.018   31.219 -36.776 1.00 38.08 ? 270 VAL A CA  1 
ATOM   1827 C  C   . VAL A 1 264 ? 10.483  31.413 -37.143 1.00 42.42 ? 270 VAL A C   1 
ATOM   1828 O  O   . VAL A 1 264 ? 11.336  31.584 -36.269 1.00 38.06 ? 270 VAL A O   1 
ATOM   1829 C  CB  . VAL A 1 264 ? 8.465   32.573 -36.290 1.00 41.56 ? 270 VAL A CB  1 
ATOM   1830 C  CG1 . VAL A 1 264 ? 8.689   33.653 -37.335 1.00 37.93 ? 270 VAL A CG1 1 
ATOM   1831 C  CG2 . VAL A 1 264 ? 6.988   32.450 -35.951 1.00 39.44 ? 270 VAL A CG2 1 
ATOM   1832 N  N   . ASP A 1 265 ? 10.766  31.385 -38.441 1.00 46.28 ? 271 ASP A N   1 
ATOM   1833 C  CA  . ASP A 1 265 ? 12.079  31.748 -38.951 1.00 41.88 ? 271 ASP A CA  1 
ATOM   1834 C  C   . ASP A 1 265 ? 12.167  33.268 -38.986 1.00 39.78 ? 271 ASP A C   1 
ATOM   1835 O  O   . ASP A 1 265 ? 11.604  33.912 -39.873 1.00 43.64 ? 271 ASP A O   1 
ATOM   1836 C  CB  . ASP A 1 265 ? 12.278  31.171 -40.352 1.00 45.68 ? 271 ASP A CB  1 
ATOM   1837 C  CG  . ASP A 1 265 ? 13.671  31.418 -40.896 1.00 41.01 ? 271 ASP A CG  1 
ATOM   1838 O  OD1 . ASP A 1 265 ? 14.420  32.218 -40.295 1.00 40.83 ? 271 ASP A OD1 1 
ATOM   1839 O  OD2 . ASP A 1 265 ? 14.012  30.813 -41.936 1.00 41.25 ? 271 ASP A OD2 1 
ATOM   1840 N  N   . GLU A 1 266 ? 12.872  33.841 -38.018 1.00 38.13 ? 272 GLU A N   1 
ATOM   1841 C  CA  . GLU A 1 266 ? 12.911  35.290 -37.865 1.00 42.70 ? 272 GLU A CA  1 
ATOM   1842 C  C   . GLU A 1 266 ? 13.619  35.980 -39.030 1.00 40.78 ? 272 GLU A C   1 
ATOM   1843 O  O   . GLU A 1 266 ? 13.449  37.182 -39.238 1.00 46.85 ? 272 GLU A O   1 
ATOM   1844 C  CB  . GLU A 1 266 ? 13.563  35.666 -36.532 1.00 43.05 ? 272 GLU A CB  1 
ATOM   1845 C  CG  . GLU A 1 266 ? 12.712  35.303 -35.324 1.00 42.29 ? 272 GLU A CG  1 
ATOM   1846 C  CD  . GLU A 1 266 ? 13.415  35.560 -34.008 1.00 49.49 ? 272 GLU A CD  1 
ATOM   1847 O  OE1 . GLU A 1 266 ? 14.465  36.237 -34.012 1.00 54.65 ? 272 GLU A OE1 1 
ATOM   1848 O  OE2 . GLU A 1 266 ? 12.917  35.084 -32.967 1.00 49.75 ? 272 GLU A OE2 1 
ATOM   1849 N  N   . LYS A 1 267 ? 14.403  35.223 -39.792 1.00 41.38 ? 273 LYS A N   1 
ATOM   1850 C  CA  . LYS A 1 267 ? 15.029  35.760 -40.995 1.00 49.08 ? 273 LYS A CA  1 
ATOM   1851 C  C   . LYS A 1 267 ? 13.961  36.078 -42.031 1.00 39.21 ? 273 LYS A C   1 
ATOM   1852 O  O   . LYS A 1 267 ? 13.943  37.165 -42.609 1.00 42.40 ? 273 LYS A O   1 
ATOM   1853 C  CB  . LYS A 1 267 ? 16.026  34.763 -41.586 1.00 49.31 ? 273 LYS A CB  1 
ATOM   1854 C  CG  . LYS A 1 267 ? 17.271  34.538 -40.748 1.00 51.77 ? 273 LYS A CG  1 
ATOM   1855 C  CD  . LYS A 1 267 ? 18.175  33.488 -41.379 1.00 63.71 ? 273 LYS A CD  1 
ATOM   1856 C  CE  . LYS A 1 267 ? 18.542  33.846 -42.813 1.00 78.51 ? 273 LYS A CE  1 
ATOM   1857 N  NZ  . LYS A 1 267 ? 19.540  32.903 -43.388 1.00 86.09 ? 273 LYS A NZ  1 
ATOM   1858 N  N   . ALA A 1 268 ? 13.071  35.118 -42.263 1.00 37.95 ? 274 ALA A N   1 
ATOM   1859 C  CA  . ALA A 1 268 ? 11.997  35.288 -43.232 1.00 44.20 ? 274 ALA A CA  1 
ATOM   1860 C  C   . ALA A 1 268 ? 11.021  36.369 -42.782 1.00 44.24 ? 274 ALA A C   1 
ATOM   1861 O  O   . ALA A 1 268 ? 10.516  37.139 -43.599 1.00 48.08 ? 274 ALA A O   1 
ATOM   1862 C  CB  . ALA A 1 268 ? 11.269  33.975 -43.437 1.00 40.04 ? 274 ALA A CB  1 
ATOM   1863 N  N   . LEU A 1 269 ? 10.757  36.421 -41.480 1.00 40.38 ? 275 LEU A N   1 
ATOM   1864 C  CA  . LEU A 1 269 ? 9.843   37.412 -40.927 1.00 36.58 ? 275 LEU A CA  1 
ATOM   1865 C  C   . LEU A 1 269 ? 10.413  38.816 -41.083 1.00 36.57 ? 275 LEU A C   1 
ATOM   1866 O  O   . LEU A 1 269 ? 9.696   39.748 -41.446 1.00 42.89 ? 275 LEU A O   1 
ATOM   1867 C  CB  . LEU A 1 269 ? 9.570   37.114 -39.451 1.00 36.36 ? 275 LEU A CB  1 
ATOM   1868 C  CG  . LEU A 1 269 ? 8.676   38.100 -38.695 1.00 38.92 ? 275 LEU A CG  1 
ATOM   1869 C  CD1 . LEU A 1 269 ? 7.349   38.305 -39.412 1.00 34.69 ? 275 LEU A CD1 1 
ATOM   1870 C  CD2 . LEU A 1 269 ? 8.442   37.617 -37.272 1.00 33.45 ? 275 LEU A CD2 1 
ATOM   1871 N  N   . ALA A 1 270 ? 11.704  38.964 -40.809 1.00 43.73 ? 276 ALA A N   1 
ATOM   1872 C  CA  . ALA A 1 270 ? 12.366  40.257 -40.936 1.00 46.37 ? 276 ALA A CA  1 
ATOM   1873 C  C   . ALA A 1 270 ? 12.212  40.811 -42.349 1.00 42.40 ? 276 ALA A C   1 
ATOM   1874 O  O   . ALA A 1 270 ? 11.710  41.919 -42.537 1.00 48.04 ? 276 ALA A O   1 
ATOM   1875 C  CB  . ALA A 1 270 ? 13.832  40.131 -40.581 1.00 42.47 ? 276 ALA A CB  1 
ATOM   1876 N  N   . GLN A 1 271 ? 12.644  40.034 -43.338 1.00 43.58 ? 277 GLN A N   1 
ATOM   1877 C  CA  . GLN A 1 271 ? 12.585  40.464 -44.731 1.00 46.64 ? 277 GLN A CA  1 
ATOM   1878 C  C   . GLN A 1 271 ? 11.152  40.787 -45.143 1.00 42.84 ? 277 GLN A C   1 
ATOM   1879 O  O   . GLN A 1 271 ? 10.911  41.756 -45.861 1.00 45.89 ? 277 GLN A O   1 
ATOM   1880 C  CB  . GLN A 1 271 ? 13.166  39.387 -45.653 1.00 50.17 ? 277 GLN A CB  1 
ATOM   1881 C  CG  . GLN A 1 271 ? 14.228  39.896 -46.623 1.00 54.82 ? 277 GLN A CG  1 
ATOM   1882 N  N   . ALA A 1 272 ? 10.204  39.975 -44.690 1.00 45.81 ? 278 ALA A N   1 
ATOM   1883 C  CA  . ALA A 1 272 ? 8.800   40.207 -45.004 1.00 42.94 ? 278 ALA A CA  1 
ATOM   1884 C  C   . ALA A 1 272 ? 8.351   41.557 -44.460 1.00 43.15 ? 278 ALA A C   1 
ATOM   1885 O  O   . ALA A 1 272 ? 7.613   42.289 -45.121 1.00 46.70 ? 278 ALA A O   1 
ATOM   1886 C  CB  . ALA A 1 272 ? 7.944   39.097 -44.434 1.00 39.98 ? 278 ALA A CB  1 
ATOM   1887 N  N   . LEU A 1 273 ? 8.800   41.882 -43.253 1.00 40.20 ? 279 LEU A N   1 
ATOM   1888 C  CA  . LEU A 1 273 ? 8.454   43.150 -42.622 1.00 44.87 ? 279 LEU A CA  1 
ATOM   1889 C  C   . LEU A 1 273 ? 9.050   44.343 -43.375 1.00 44.06 ? 279 LEU A C   1 
ATOM   1890 O  O   . LEU A 1 273 ? 8.370   45.345 -43.598 1.00 47.14 ? 279 LEU A O   1 
ATOM   1891 C  CB  . LEU A 1 273 ? 8.919   43.155 -41.162 1.00 44.36 ? 279 LEU A CB  1 
ATOM   1892 C  CG  . LEU A 1 273 ? 8.041   42.377 -40.177 1.00 42.50 ? 279 LEU A CG  1 
ATOM   1893 C  CD1 . LEU A 1 273 ? 8.733   42.222 -38.830 1.00 35.80 ? 279 LEU A CD1 1 
ATOM   1894 C  CD2 . LEU A 1 273 ? 6.700   43.071 -40.006 1.00 42.00 ? 279 LEU A CD2 1 
ATOM   1895 N  N   . LYS A 1 274 ? 10.316  44.235 -43.764 1.00 50.68 ? 280 LYS A N   1 
ATOM   1896 C  CA  . LYS A 1 274 ? 10.978  45.307 -44.502 1.00 49.40 ? 280 LYS A CA  1 
ATOM   1897 C  C   . LYS A 1 274 ? 10.352  45.474 -45.883 1.00 44.46 ? 280 LYS A C   1 
ATOM   1898 O  O   . LYS A 1 274 ? 10.171  46.593 -46.363 1.00 49.32 ? 280 LYS A O   1 
ATOM   1899 C  CB  . LYS A 1 274 ? 12.472  45.017 -44.650 1.00 50.42 ? 280 LYS A CB  1 
ATOM   1900 C  CG  . LYS A 1 274 ? 13.216  44.871 -43.334 1.00 51.62 ? 280 LYS A CG  1 
ATOM   1901 C  CD  . LYS A 1 274 ? 14.676  44.518 -43.568 1.00 57.36 ? 280 LYS A CD  1 
ATOM   1902 C  CE  . LYS A 1 274 ? 15.286  43.825 -42.360 1.00 55.29 ? 280 LYS A CE  1 
ATOM   1903 N  NZ  . LYS A 1 274 ? 16.296  42.812 -42.769 1.00 57.21 ? 280 LYS A NZ  1 
ATOM   1904 N  N   . GLU A 1 275 ? 10.022  44.353 -46.514 1.00 44.24 ? 281 GLU A N   1 
ATOM   1905 C  CA  . GLU A 1 275 ? 9.434   44.365 -47.848 1.00 47.17 ? 281 GLU A CA  1 
ATOM   1906 C  C   . GLU A 1 275 ? 7.971   44.796 -47.816 1.00 48.53 ? 281 GLU A C   1 
ATOM   1907 O  O   . GLU A 1 275 ? 7.385   45.108 -48.853 1.00 50.87 ? 281 GLU A O   1 
ATOM   1908 C  CB  . GLU A 1 275 ? 9.550   42.980 -48.489 1.00 49.06 ? 281 GLU A CB  1 
ATOM   1909 C  CG  . GLU A 1 275 ? 10.971  42.586 -48.863 1.00 50.04 ? 281 GLU A CG  1 
ATOM   1910 C  CD  . GLU A 1 275 ? 11.051  41.198 -49.467 1.00 52.66 ? 281 GLU A CD  1 
ATOM   1911 O  OE1 . GLU A 1 275 ? 12.177  40.736 -49.752 1.00 61.33 ? 281 GLU A OE1 1 
ATOM   1912 O  OE2 . GLU A 1 275 ? 9.989   40.569 -49.657 1.00 59.64 ? 281 GLU A OE2 1 
ATOM   1913 N  N   . GLY A 1 276 ? 7.380   44.807 -46.625 1.00 48.84 ? 282 GLY A N   1 
ATOM   1914 C  CA  . GLY A 1 276 ? 5.985   45.174 -46.474 1.00 49.97 ? 282 GLY A CA  1 
ATOM   1915 C  C   . GLY A 1 276 ? 5.037   44.041 -46.830 1.00 46.92 ? 282 GLY A C   1 
ATOM   1916 O  O   . GLY A 1 276 ? 3.823   44.238 -46.884 1.00 44.62 ? 282 GLY A O   1 
ATOM   1917 N  N   . ARG A 1 277 ? 5.584   42.856 -47.087 1.00 46.54 ? 283 ARG A N   1 
ATOM   1918 C  CA  . ARG A 1 277 ? 4.756   41.682 -47.336 1.00 41.01 ? 283 ARG A CA  1 
ATOM   1919 C  C   . ARG A 1 277 ? 3.942   41.376 -46.084 1.00 43.61 ? 283 ARG A C   1 
ATOM   1920 O  O   . ARG A 1 277 ? 2.809   40.899 -46.164 1.00 47.84 ? 283 ARG A O   1 
ATOM   1921 C  CB  . ARG A 1 277 ? 5.617   40.478 -47.715 1.00 41.18 ? 283 ARG A CB  1 
ATOM   1922 N  N   . ILE A 1 278 ? 4.534   41.659 -44.928 1.00 44.58 ? 284 ILE A N   1 
ATOM   1923 C  CA  . ILE A 1 278 ? 3.826   41.592 -43.658 1.00 43.13 ? 284 ILE A CA  1 
ATOM   1924 C  C   . ILE A 1 278 ? 3.791   42.992 -43.052 1.00 41.69 ? 284 ILE A C   1 
ATOM   1925 O  O   . ILE A 1 278 ? 4.830   43.629 -42.882 1.00 45.77 ? 284 ILE A O   1 
ATOM   1926 C  CB  . ILE A 1 278 ? 4.491   40.586 -42.696 1.00 41.71 ? 284 ILE A CB  1 
ATOM   1927 C  CG1 . ILE A 1 278 ? 4.126   39.157 -43.113 1.00 34.11 ? 284 ILE A CG1 1 
ATOM   1928 C  CG2 . ILE A 1 278 ? 4.058   40.850 -41.260 1.00 39.20 ? 284 ILE A CG2 1 
ATOM   1929 C  CD1 . ILE A 1 278 ? 4.745   38.064 -42.259 1.00 32.89 ? 284 ILE A CD1 1 
ATOM   1930 N  N   . ARG A 1 279 ? 2.589   43.470 -42.744 1.00 39.56 ? 285 ARG A N   1 
ATOM   1931 C  CA  . ARG A 1 279 ? 2.399   44.843 -42.291 1.00 35.29 ? 285 ARG A CA  1 
ATOM   1932 C  C   . ARG A 1 279 ? 2.873   45.049 -40.856 1.00 40.20 ? 285 ARG A C   1 
ATOM   1933 O  O   . ARG A 1 279 ? 3.287   46.148 -40.483 1.00 37.65 ? 285 ARG A O   1 
ATOM   1934 C  CB  . ARG A 1 279 ? 0.922   45.235 -42.395 1.00 39.33 ? 285 ARG A CB  1 
ATOM   1935 C  CG  . ARG A 1 279 ? 0.678   46.735 -42.299 1.00 51.13 ? 285 ARG A CG  1 
ATOM   1936 C  CD  . ARG A 1 279 ? -0.783  47.060 -42.026 1.00 46.65 ? 285 ARG A CD  1 
ATOM   1937 N  NE  . ARG A 1 279 ? -1.633  46.787 -43.180 1.00 56.85 ? 285 ARG A NE  1 
ATOM   1938 C  CZ  . ARG A 1 279 ? -1.676  47.537 -44.277 1.00 65.41 ? 285 ARG A CZ  1 
ATOM   1939 N  NH1 . ARG A 1 279 ? -0.908  48.614 -44.388 1.00 67.31 ? 285 ARG A NH1 1 
ATOM   1940 N  NH2 . ARG A 1 279 ? -2.484  47.207 -45.273 1.00 65.58 ? 285 ARG A NH2 1 
ATOM   1941 N  N   . GLY A 1 280 ? 2.802   43.997 -40.049 1.00 38.64 ? 286 GLY A N   1 
ATOM   1942 C  CA  . GLY A 1 280 ? 3.167   44.097 -38.648 1.00 33.85 ? 286 GLY A CA  1 
ATOM   1943 C  C   . GLY A 1 280 ? 3.246   42.743 -37.971 1.00 36.22 ? 286 GLY A C   1 
ATOM   1944 O  O   . GLY A 1 280 ? 2.578   41.796 -38.383 1.00 31.83 ? 286 GLY A O   1 
ATOM   1945 N  N   . ALA A 1 281 ? 4.066   42.653 -36.928 1.00 37.55 ? 287 ALA A N   1 
ATOM   1946 C  CA  . ALA A 1 281 ? 4.196   41.423 -36.158 1.00 36.46 ? 287 ALA A CA  1 
ATOM   1947 C  C   . ALA A 1 281 ? 4.279   41.738 -34.668 1.00 35.48 ? 287 ALA A C   1 
ATOM   1948 O  O   . ALA A 1 281 ? 4.926   42.703 -34.266 1.00 37.81 ? 287 ALA A O   1 
ATOM   1949 C  CB  . ALA A 1 281 ? 5.425   40.651 -36.603 1.00 36.35 ? 287 ALA A CB  1 
ATOM   1950 N  N   . ALA A 1 282 ? 3.616   40.922 -33.855 1.00 35.36 ? 288 ALA A N   1 
ATOM   1951 C  CA  . ALA A 1 282 ? 3.659   41.078 -32.406 1.00 35.81 ? 288 ALA A CA  1 
ATOM   1952 C  C   . ALA A 1 282 ? 4.100   39.763 -31.782 1.00 31.69 ? 288 ALA A C   1 
ATOM   1953 O  O   . ALA A 1 282 ? 3.399   38.756 -31.885 1.00 32.44 ? 288 ALA A O   1 
ATOM   1954 C  CB  . ALA A 1 282 ? 2.298   41.488 -31.876 1.00 35.23 ? 288 ALA A CB  1 
ATOM   1955 N  N   . LEU A 1 283 ? 5.261   39.775 -31.134 1.00 34.15 ? 289 LEU A N   1 
ATOM   1956 C  CA  . LEU A 1 283 ? 5.872   38.546 -30.642 1.00 34.39 ? 289 LEU A CA  1 
ATOM   1957 C  C   . LEU A 1 283 ? 6.174   38.611 -29.151 1.00 37.40 ? 289 LEU A C   1 
ATOM   1958 O  O   . LEU A 1 283 ? 6.840   39.533 -28.684 1.00 37.63 ? 289 LEU A O   1 
ATOM   1959 C  CB  . LEU A 1 283 ? 7.175   38.277 -31.392 1.00 30.73 ? 289 LEU A CB  1 
ATOM   1960 C  CG  . LEU A 1 283 ? 7.167   38.530 -32.899 1.00 37.32 ? 289 LEU A CG  1 
ATOM   1961 C  CD1 . LEU A 1 283 ? 8.571   38.387 -33.463 1.00 34.00 ? 289 LEU A CD1 1 
ATOM   1962 C  CD2 . LEU A 1 283 ? 6.208   37.585 -33.599 1.00 31.71 ? 289 LEU A CD2 1 
ATOM   1963 N  N   . ASP A 1 284 ? 5.697   37.620 -28.408 1.00 35.84 ? 290 ASP A N   1 
ATOM   1964 C  CA  . ASP A 1 284 ? 6.004   37.522 -26.987 1.00 35.49 ? 290 ASP A CA  1 
ATOM   1965 C  C   . ASP A 1 284 ? 7.039   36.427 -26.751 1.00 40.35 ? 290 ASP A C   1 
ATOM   1966 O  O   . ASP A 1 284 ? 7.546   36.261 -25.640 1.00 38.50 ? 290 ASP A O   1 
ATOM   1967 C  CB  . ASP A 1 284 ? 4.732   37.246 -26.180 1.00 35.43 ? 290 ASP A CB  1 
ATOM   1968 C  CG  . ASP A 1 284 ? 4.980   37.240 -24.684 1.00 33.58 ? 290 ASP A CG  1 
ATOM   1969 O  OD1 . ASP A 1 284 ? 5.299   38.310 -24.125 1.00 33.45 ? 290 ASP A OD1 1 
ATOM   1970 O  OD2 . ASP A 1 284 ? 4.846   36.167 -24.065 1.00 28.44 ? 290 ASP A OD2 1 
ATOM   1971 N  N   . VAL A 1 285 ? 7.355   35.690 -27.811 1.00 36.01 ? 291 VAL A N   1 
ATOM   1972 C  CA  . VAL A 1 285 ? 8.322   34.606 -27.743 1.00 33.50 ? 291 VAL A CA  1 
ATOM   1973 C  C   . VAL A 1 285 ? 9.257   34.715 -28.944 1.00 43.45 ? 291 VAL A C   1 
ATOM   1974 O  O   . VAL A 1 285 ? 8.893   35.313 -29.958 1.00 41.54 ? 291 VAL A O   1 
ATOM   1975 C  CB  . VAL A 1 285 ? 7.616   33.239 -27.741 1.00 33.76 ? 291 VAL A CB  1 
ATOM   1976 C  CG1 . VAL A 1 285 ? 6.720   33.121 -26.522 1.00 37.18 ? 291 VAL A CG1 1 
ATOM   1977 C  CG2 . VAL A 1 285 ? 6.806   33.060 -29.011 1.00 33.91 ? 291 VAL A CG2 1 
ATOM   1978 N  N   . HIS A 1 286 ? 10.454  34.142 -28.831 1.00 39.51 ? 292 HIS A N   1 
ATOM   1979 C  CA  . HIS A 1 286 ? 11.476  34.306 -29.863 1.00 40.94 ? 292 HIS A CA  1 
ATOM   1980 C  C   . HIS A 1 286 ? 12.393  33.090 -29.970 1.00 38.15 ? 292 HIS A C   1 
ATOM   1981 O  O   . HIS A 1 286 ? 12.486  32.286 -29.041 1.00 40.68 ? 292 HIS A O   1 
ATOM   1982 C  CB  . HIS A 1 286 ? 12.318  35.545 -29.567 1.00 38.03 ? 292 HIS A CB  1 
ATOM   1983 C  CG  . HIS A 1 286 ? 11.510  36.791 -29.359 1.00 42.22 ? 292 HIS A CG  1 
ATOM   1984 N  ND1 . HIS A 1 286 ? 10.910  37.088 -28.157 1.00 40.18 ? 292 HIS A ND1 1 
ATOM   1985 C  CD2 . HIS A 1 286 ? 11.211  37.807 -30.195 1.00 38.48 ? 292 HIS A CD2 1 
ATOM   1986 C  CE1 . HIS A 1 286 ? 10.271  38.243 -28.259 1.00 38.12 ? 292 HIS A CE1 1 
ATOM   1987 N  NE2 . HIS A 1 286 ? 10.439  38.700 -29.493 1.00 39.35 ? 292 HIS A NE2 1 
ATOM   1988 N  N   . GLU A 1 287 ? 13.071  32.968 -31.108 1.00 39.65 ? 293 GLU A N   1 
ATOM   1989 C  CA  . GLU A 1 287 ? 13.972  31.848 -31.354 1.00 44.03 ? 293 GLU A CA  1 
ATOM   1990 C  C   . GLU A 1 287 ? 15.025  31.761 -30.254 1.00 40.91 ? 293 GLU A C   1 
ATOM   1991 O  O   . GLU A 1 287 ? 15.301  30.682 -29.728 1.00 43.67 ? 293 GLU A O   1 
ATOM   1992 C  CB  . GLU A 1 287 ? 14.646  31.988 -32.725 1.00 45.77 ? 293 GLU A CB  1 
ATOM   1993 C  CG  . GLU A 1 287 ? 13.674  31.941 -33.900 1.00 42.77 ? 293 GLU A CG  1 
ATOM   1994 C  CD  . GLU A 1 287 ? 14.349  31.615 -35.222 1.00 42.87 ? 293 GLU A CD  1 
ATOM   1995 O  OE1 . GLU A 1 287 ? 14.472  32.524 -36.068 1.00 45.23 ? 293 GLU A OE1 1 
ATOM   1996 O  OE2 . GLU A 1 287 ? 14.742  30.446 -35.421 1.00 44.31 ? 293 GLU A OE2 1 
ATOM   1997 N  N   . SER A 1 288 ? 15.612  32.904 -29.914 1.00 42.70 ? 294 SER A N   1 
ATOM   1998 C  CA  . SER A 1 288 ? 16.575  32.975 -28.824 1.00 51.09 ? 294 SER A CA  1 
ATOM   1999 C  C   . SER A 1 288 ? 16.107  33.970 -27.769 1.00 43.43 ? 294 SER A C   1 
ATOM   2000 O  O   . SER A 1 288 ? 16.046  35.173 -28.020 1.00 45.99 ? 294 SER A O   1 
ATOM   2001 C  CB  . SER A 1 288 ? 17.952  33.386 -29.350 1.00 56.30 ? 294 SER A CB  1 
ATOM   2002 O  OG  . SER A 1 288 ? 18.932  33.284 -28.330 1.00 66.62 ? 294 SER A OG  1 
ATOM   2003 N  N   . GLU A 1 289 ? 15.771  33.460 -26.591 1.00 46.58 ? 295 GLU A N   1 
ATOM   2004 C  CA  . GLU A 1 289 ? 15.362  34.310 -25.483 1.00 46.95 ? 295 GLU A CA  1 
ATOM   2005 C  C   . GLU A 1 289 ? 16.455  34.319 -24.420 1.00 42.24 ? 295 GLU A C   1 
ATOM   2006 O  O   . GLU A 1 289 ? 17.129  33.308 -24.217 1.00 39.70 ? 295 GLU A O   1 
ATOM   2007 C  CB  . GLU A 1 289 ? 14.035  33.819 -24.902 1.00 42.24 ? 295 GLU A CB  1 
ATOM   2008 C  CG  . GLU A 1 289 ? 12.859  33.987 -25.856 1.00 42.80 ? 295 GLU A CG  1 
ATOM   2009 C  CD  . GLU A 1 289 ? 11.581  33.349 -25.346 1.00 38.45 ? 295 GLU A CD  1 
ATOM   2010 O  OE1 . GLU A 1 289 ? 11.485  33.086 -24.129 1.00 35.97 ? 295 GLU A OE1 1 
ATOM   2011 O  OE2 . GLU A 1 289 ? 10.672  33.109 -26.169 1.00 37.41 ? 295 GLU A OE2 1 
ATOM   2012 N  N   . PRO A 1 290 ? 16.633  35.457 -23.729 1.00 42.60 ? 296 PRO A N   1 
ATOM   2013 C  CA  . PRO A 1 290 ? 15.816  36.673 -23.832 1.00 46.86 ? 296 PRO A CA  1 
ATOM   2014 C  C   . PRO A 1 290 ? 15.983  37.415 -25.156 1.00 44.76 ? 296 PRO A C   1 
ATOM   2015 O  O   . PRO A 1 290 ? 17.014  37.282 -25.814 1.00 51.03 ? 296 PRO A O   1 
ATOM   2016 C  CB  . PRO A 1 290 ? 16.333  37.533 -22.674 1.00 45.49 ? 296 PRO A CB  1 
ATOM   2017 C  CG  . PRO A 1 290 ? 17.728  37.083 -22.465 1.00 49.89 ? 296 PRO A CG  1 
ATOM   2018 C  CD  . PRO A 1 290 ? 17.718  35.610 -22.745 1.00 40.62 ? 296 PRO A CD  1 
ATOM   2019 N  N   . PHE A 1 291 ? 14.969  38.188 -25.535 1.00 47.27 ? 297 PHE A N   1 
ATOM   2020 C  CA  . PHE A 1 291 ? 15.008  38.949 -26.779 1.00 51.38 ? 297 PHE A CA  1 
ATOM   2021 C  C   . PHE A 1 291 ? 15.633  40.322 -26.570 1.00 39.31 ? 297 PHE A C   1 
ATOM   2022 O  O   . PHE A 1 291 ? 15.524  40.909 -25.493 1.00 44.77 ? 297 PHE A O   1 
ATOM   2023 C  CB  . PHE A 1 291 ? 13.595  39.113 -27.350 1.00 42.37 ? 297 PHE A CB  1 
ATOM   2024 C  CG  . PHE A 1 291 ? 13.531  39.993 -28.572 1.00 38.34 ? 297 PHE A CG  1 
ATOM   2025 C  CD1 . PHE A 1 291 ? 13.852  39.495 -29.823 1.00 43.04 ? 297 PHE A CD1 1 
ATOM   2026 C  CD2 . PHE A 1 291 ? 13.149  41.320 -28.466 1.00 44.52 ? 297 PHE A CD2 1 
ATOM   2027 C  CE1 . PHE A 1 291 ? 13.794  40.305 -30.946 1.00 49.77 ? 297 PHE A CE1 1 
ATOM   2028 C  CE2 . PHE A 1 291 ? 13.089  42.133 -29.584 1.00 44.28 ? 297 PHE A CE2 1 
ATOM   2029 C  CZ  . PHE A 1 291 ? 13.412  41.625 -30.824 1.00 40.53 ? 297 PHE A CZ  1 
ATOM   2030 N  N   . SER A 1 292 ? 16.297  40.821 -27.607 1.00 44.30 ? 298 SER A N   1 
ATOM   2031 C  CA  . SER A 1 292 ? 16.821  42.180 -27.604 1.00 47.96 ? 298 SER A CA  1 
ATOM   2032 C  C   . SER A 1 292 ? 16.614  42.824 -28.970 1.00 51.01 ? 298 SER A C   1 
ATOM   2033 O  O   . SER A 1 292 ? 16.746  42.168 -30.003 1.00 52.57 ? 298 SER A O   1 
ATOM   2034 C  CB  . SER A 1 292 ? 18.305  42.185 -27.237 1.00 49.57 ? 298 SER A CB  1 
ATOM   2035 O  OG  . SER A 1 292 ? 18.858  43.480 -27.401 1.00 54.98 ? 298 SER A OG  1 
ATOM   2036 N  N   . PHE A 1 293 ? 16.283  44.111 -28.971 1.00 50.74 ? 299 PHE A N   1 
ATOM   2037 C  CA  . PHE A 1 293 ? 16.067  44.838 -30.216 1.00 56.55 ? 299 PHE A CA  1 
ATOM   2038 C  C   . PHE A 1 293 ? 17.381  45.135 -30.939 1.00 60.81 ? 299 PHE A C   1 
ATOM   2039 O  O   . PHE A 1 293 ? 17.375  45.575 -32.089 1.00 60.14 ? 299 PHE A O   1 
ATOM   2040 C  CB  . PHE A 1 293 ? 15.321  46.149 -29.951 1.00 57.44 ? 299 PHE A CB  1 
ATOM   2041 C  CG  . PHE A 1 293 ? 13.824  46.008 -29.951 1.00 58.11 ? 299 PHE A CG  1 
ATOM   2042 C  CD1 . PHE A 1 293 ? 13.142  45.702 -31.116 1.00 53.83 ? 299 PHE A CD1 1 
ATOM   2043 C  CD2 . PHE A 1 293 ? 13.099  46.194 -28.789 1.00 54.55 ? 299 PHE A CD2 1 
ATOM   2044 C  CE1 . PHE A 1 293 ? 11.765  45.576 -31.119 1.00 49.50 ? 299 PHE A CE1 1 
ATOM   2045 C  CE2 . PHE A 1 293 ? 11.722  46.073 -28.785 1.00 56.29 ? 299 PHE A CE2 1 
ATOM   2046 C  CZ  . PHE A 1 293 ? 11.054  45.763 -29.951 1.00 51.64 ? 299 PHE A CZ  1 
ATOM   2047 N  N   . SER A 1 294 ? 18.502  44.891 -30.267 1.00 61.63 ? 300 SER A N   1 
ATOM   2048 C  CA  . SER A 1 294 ? 19.811  45.196 -30.830 1.00 60.83 ? 300 SER A CA  1 
ATOM   2049 C  C   . SER A 1 294 ? 20.528  43.936 -31.313 1.00 62.35 ? 300 SER A C   1 
ATOM   2050 O  O   . SER A 1 294 ? 21.566  44.017 -31.970 1.00 68.96 ? 300 SER A O   1 
ATOM   2051 C  CB  . SER A 1 294 ? 20.673  45.909 -29.789 1.00 59.96 ? 300 SER A CB  1 
ATOM   2052 O  OG  . SER A 1 294 ? 19.975  47.000 -29.213 1.00 70.96 ? 300 SER A OG  1 
ATOM   2053 N  N   . GLN A 1 295 ? 19.970  42.774 -30.986 1.00 62.26 ? 301 GLN A N   1 
ATOM   2054 C  CA  . GLN A 1 295 ? 20.583  41.500 -31.347 1.00 53.84 ? 301 GLN A CA  1 
ATOM   2055 C  C   . GLN A 1 295 ? 19.630  40.628 -32.160 1.00 59.19 ? 301 GLN A C   1 
ATOM   2056 O  O   . GLN A 1 295 ? 18.526  40.320 -31.709 1.00 63.75 ? 301 GLN A O   1 
ATOM   2057 C  CB  . GLN A 1 295 ? 21.010  40.749 -30.085 1.00 50.75 ? 301 GLN A CB  1 
ATOM   2058 N  N   . GLY A 1 296 ? 20.061  40.233 -33.355 1.00 54.06 ? 302 GLY A N   1 
ATOM   2059 C  CA  . GLY A 1 296 ? 19.309  39.296 -34.169 1.00 52.14 ? 302 GLY A CA  1 
ATOM   2060 C  C   . GLY A 1 296 ? 18.859  39.846 -35.509 1.00 52.20 ? 302 GLY A C   1 
ATOM   2061 O  O   . GLY A 1 296 ? 19.131  40.999 -35.839 1.00 59.27 ? 302 GLY A O   1 
ATOM   2062 N  N   . PRO A 1 297 ? 18.160  39.010 -36.293 1.00 52.58 ? 303 PRO A N   1 
ATOM   2063 C  CA  . PRO A 1 297 ? 17.613  39.343 -37.614 1.00 51.68 ? 303 PRO A CA  1 
ATOM   2064 C  C   . PRO A 1 297 ? 16.546  40.425 -37.536 1.00 49.16 ? 303 PRO A C   1 
ATOM   2065 O  O   . PRO A 1 297 ? 16.391  41.211 -38.473 1.00 48.15 ? 303 PRO A O   1 
ATOM   2066 C  CB  . PRO A 1 297 ? 16.979  38.025 -38.078 1.00 54.35 ? 303 PRO A CB  1 
ATOM   2067 C  CG  . PRO A 1 297 ? 17.575  36.968 -37.216 1.00 50.15 ? 303 PRO A CG  1 
ATOM   2068 C  CD  . PRO A 1 297 ? 17.855  37.622 -35.910 1.00 52.13 ? 303 PRO A CD  1 
ATOM   2069 N  N   . LEU A 1 298 ? 15.813  40.452 -36.427 1.00 48.10 ? 304 LEU A N   1 
ATOM   2070 C  CA  . LEU A 1 298 ? 14.771  41.448 -36.215 1.00 47.37 ? 304 LEU A CA  1 
ATOM   2071 C  C   . LEU A 1 298 ? 15.373  42.785 -35.780 1.00 49.26 ? 304 LEU A C   1 
ATOM   2072 O  O   . LEU A 1 298 ? 14.649  43.762 -35.584 1.00 45.69 ? 304 LEU A O   1 
ATOM   2073 C  CB  . LEU A 1 298 ? 13.778  40.947 -35.163 1.00 48.15 ? 304 LEU A CB  1 
ATOM   2074 C  CG  . LEU A 1 298 ? 13.111  39.609 -35.501 1.00 47.32 ? 304 LEU A CG  1 
ATOM   2075 C  CD1 . LEU A 1 298 ? 12.570  38.928 -34.253 1.00 55.55 ? 304 LEU A CD1 1 
ATOM   2076 C  CD2 . LEU A 1 298 ? 11.998  39.795 -36.522 1.00 44.63 ? 304 LEU A CD2 1 
ATOM   2077 N  N   . LYS A 1 299 ? 16.697  42.818 -35.634 1.00 46.31 ? 305 LYS A N   1 
ATOM   2078 C  CA  . LYS A 1 299 ? 17.418  44.036 -35.263 1.00 55.55 ? 305 LYS A CA  1 
ATOM   2079 C  C   . LYS A 1 299 ? 16.832  45.291 -35.909 1.00 56.86 ? 305 LYS A C   1 
ATOM   2080 O  O   . LYS A 1 299 ? 16.329  46.177 -35.217 1.00 57.91 ? 305 LYS A O   1 
ATOM   2081 C  CB  . LYS A 1 299 ? 18.899  43.909 -35.640 1.00 61.12 ? 305 LYS A CB  1 
ATOM   2082 C  CG  . LYS A 1 299 ? 19.827  43.676 -34.454 1.00 63.89 ? 305 LYS A CG  1 
ATOM   2083 C  CD  . LYS A 1 299 ? 21.214  43.205 -34.892 1.00 70.46 ? 305 LYS A CD  1 
ATOM   2084 C  CE  . LYS A 1 299 ? 21.976  44.274 -35.661 1.00 65.89 ? 305 LYS A CE  1 
ATOM   2085 N  NZ  . LYS A 1 299 ? 23.385  43.860 -35.930 1.00 69.43 ? 305 LYS A NZ  1 
ATOM   2086 N  N   . ASP A 1 300 ? 16.907  45.364 -37.235 1.00 50.93 ? 306 ASP A N   1 
ATOM   2087 C  CA  . ASP A 1 300 ? 16.467  46.552 -37.962 1.00 59.51 ? 306 ASP A CA  1 
ATOM   2088 C  C   . ASP A 1 300 ? 15.125  46.348 -38.660 1.00 61.03 ? 306 ASP A C   1 
ATOM   2089 O  O   . ASP A 1 300 ? 14.774  47.098 -39.571 1.00 62.83 ? 306 ASP A O   1 
ATOM   2090 C  CB  . ASP A 1 300 ? 17.521  46.956 -38.994 1.00 54.62 ? 306 ASP A CB  1 
ATOM   2091 N  N   . ALA A 1 301 ? 14.377  45.338 -38.232 1.00 53.89 ? 307 ALA A N   1 
ATOM   2092 C  CA  . ALA A 1 301 ? 13.077  45.054 -38.827 1.00 44.18 ? 307 ALA A CA  1 
ATOM   2093 C  C   . ALA A 1 301 ? 12.013  45.996 -38.263 1.00 44.77 ? 307 ALA A C   1 
ATOM   2094 O  O   . ALA A 1 301 ? 11.967  46.226 -37.055 1.00 44.82 ? 307 ALA A O   1 
ATOM   2095 C  CB  . ALA A 1 301 ? 12.700  43.613 -38.577 1.00 47.58 ? 307 ALA A CB  1 
ATOM   2096 N  N   . PRO A 1 302 ? 11.157  46.548 -39.140 1.00 42.61 ? 308 PRO A N   1 
ATOM   2097 C  CA  . PRO A 1 302 ? 10.152  47.545 -38.758 1.00 40.68 ? 308 PRO A CA  1 
ATOM   2098 C  C   . PRO A 1 302 ? 8.787   46.950 -38.414 1.00 40.74 ? 308 PRO A C   1 
ATOM   2099 O  O   . PRO A 1 302 ? 8.589   45.740 -38.522 1.00 40.49 ? 308 PRO A O   1 
ATOM   2100 C  CB  . PRO A 1 302 ? 10.027  48.385 -40.025 1.00 45.03 ? 308 PRO A CB  1 
ATOM   2101 C  CG  . PRO A 1 302 ? 10.209  47.386 -41.120 1.00 38.10 ? 308 PRO A CG  1 
ATOM   2102 C  CD  . PRO A 1 302 ? 11.194  46.357 -40.601 1.00 43.35 ? 308 PRO A CD  1 
ATOM   2103 N  N   . ASN A 1 303 ? 7.857   47.814 -38.015 1.00 39.50 ? 309 ASN A N   1 
ATOM   2104 C  CA  . ASN A 1 303 ? 6.494   47.403 -37.702 1.00 41.38 ? 309 ASN A CA  1 
ATOM   2105 C  C   . ASN A 1 303 ? 6.484   46.202 -36.771 1.00 40.91 ? 309 ASN A C   1 
ATOM   2106 O  O   . ASN A 1 303 ? 5.750   45.239 -36.990 1.00 38.14 ? 309 ASN A O   1 
ATOM   2107 C  CB  . ASN A 1 303 ? 5.728   47.069 -38.982 1.00 40.63 ? 309 ASN A CB  1 
ATOM   2108 C  CG  . ASN A 1 303 ? 5.733   48.210 -39.983 1.00 39.19 ? 309 ASN A CG  1 
ATOM   2109 O  OD1 . ASN A 1 303 ? 6.043   48.017 -41.160 1.00 45.37 ? 309 ASN A OD1 1 
ATOM   2110 N  ND2 . ASN A 1 303 ? 5.391   49.406 -39.521 1.00 34.98 ? 309 ASN A ND2 1 
ATOM   2111 N  N   . LEU A 1 304 ? 7.301   46.270 -35.727 1.00 37.35 ? 310 LEU A N   1 
ATOM   2112 C  CA  . LEU A 1 304 ? 7.482   45.141 -34.834 1.00 44.45 ? 310 LEU A CA  1 
ATOM   2113 C  C   . LEU A 1 304 ? 7.122   45.499 -33.397 1.00 46.02 ? 310 LEU A C   1 
ATOM   2114 O  O   . LEU A 1 304 ? 7.541   46.534 -32.876 1.00 47.47 ? 310 LEU A O   1 
ATOM   2115 C  CB  . LEU A 1 304 ? 8.936   44.666 -34.897 1.00 43.22 ? 310 LEU A CB  1 
ATOM   2116 C  CG  . LEU A 1 304 ? 9.260   43.309 -34.270 1.00 46.53 ? 310 LEU A CG  1 
ATOM   2117 C  CD1 . LEU A 1 304 ? 8.335   42.228 -34.798 1.00 47.82 ? 310 LEU A CD1 1 
ATOM   2118 C  CD2 . LEU A 1 304 ? 10.712  42.936 -34.532 1.00 47.55 ? 310 LEU A CD2 1 
ATOM   2119 N  N   . ILE A 1 305 ? 6.336   44.634 -32.767 1.00 41.60 ? 311 ILE A N   1 
ATOM   2120 C  CA  . ILE A 1 305 ? 6.089   44.707 -31.334 1.00 41.30 ? 311 ILE A CA  1 
ATOM   2121 C  C   . ILE A 1 305 ? 6.669   43.442 -30.719 1.00 37.57 ? 311 ILE A C   1 
ATOM   2122 O  O   . ILE A 1 305 ? 6.602   42.367 -31.312 1.00 38.84 ? 311 ILE A O   1 
ATOM   2123 C  CB  . ILE A 1 305 ? 4.587   44.789 -31.000 1.00 43.00 ? 311 ILE A CB  1 
ATOM   2124 C  CG1 . ILE A 1 305 ? 3.968   46.053 -31.599 1.00 45.49 ? 311 ILE A CG1 1 
ATOM   2125 C  CG2 . ILE A 1 305 ? 4.381   44.766 -29.488 1.00 40.88 ? 311 ILE A CG2 1 
ATOM   2126 C  CD1 . ILE A 1 305 ? 2.449   46.092 -31.532 1.00 45.58 ? 311 ILE A CD1 1 
ATOM   2127 N  N   . CYS A 1 306 ? 7.242   43.575 -29.531 1.00 40.53 ? 312 CYS A N   1 
ATOM   2128 C  CA  . CYS A 1 306 ? 7.903   42.457 -28.872 1.00 36.13 ? 312 CYS A CA  1 
ATOM   2129 C  C   . CYS A 1 306 ? 7.739   42.578 -27.368 1.00 41.56 ? 312 CYS A C   1 
ATOM   2130 O  O   . CYS A 1 306 ? 7.861   43.666 -26.810 1.00 42.96 ? 312 CYS A O   1 
ATOM   2131 C  CB  . CYS A 1 306 ? 9.388   42.407 -29.232 1.00 35.40 ? 312 CYS A CB  1 
ATOM   2132 S  SG  . CYS A 1 306 ? 9.712   41.921 -30.943 1.00 41.02 ? 312 CYS A SG  1 
ATOM   2133 N  N   . THR A 1 307 ? 7.443   41.459 -26.719 1.00 43.45 ? 313 THR A N   1 
ATOM   2134 C  CA  . THR A 1 307 ? 7.365   41.421 -25.265 1.00 37.91 ? 313 THR A CA  1 
ATOM   2135 C  C   . THR A 1 307 ? 8.149   40.210 -24.769 1.00 35.98 ? 313 THR A C   1 
ATOM   2136 O  O   . THR A 1 307 ? 8.296   39.225 -25.491 1.00 37.59 ? 313 THR A O   1 
ATOM   2137 C  CB  . THR A 1 307 ? 5.907   41.365 -24.772 1.00 38.99 ? 313 THR A CB  1 
ATOM   2138 O  OG1 . THR A 1 307 ? 5.196   40.357 -25.494 1.00 35.18 ? 313 THR A OG1 1 
ATOM   2139 C  CG2 . THR A 1 307 ? 5.222   42.705 -24.979 1.00 36.44 ? 313 THR A CG2 1 
ATOM   2140 N  N   . PRO A 1 308 ? 8.666   40.286 -23.535 1.00 38.36 ? 314 PRO A N   1 
ATOM   2141 C  CA  . PRO A 1 308 ? 9.624   39.310 -23.010 1.00 34.11 ? 314 PRO A CA  1 
ATOM   2142 C  C   . PRO A 1 308 ? 8.980   38.073 -22.387 1.00 36.67 ? 314 PRO A C   1 
ATOM   2143 O  O   . PRO A 1 308 ? 9.225   37.780 -21.216 1.00 36.59 ? 314 PRO A O   1 
ATOM   2144 C  CB  . PRO A 1 308 ? 10.362  40.116 -21.944 1.00 39.96 ? 314 PRO A CB  1 
ATOM   2145 C  CG  . PRO A 1 308 ? 9.310   41.018 -21.401 1.00 40.03 ? 314 PRO A CG  1 
ATOM   2146 C  CD  . PRO A 1 308 ? 8.402   41.361 -22.561 1.00 37.54 ? 314 PRO A CD  1 
ATOM   2147 N  N   . HIS A 1 309 ? 8.174   37.354 -23.161 1.00 39.57 ? 315 HIS A N   1 
ATOM   2148 C  CA  . HIS A 1 309 ? 7.551   36.130 -22.676 1.00 34.11 ? 315 HIS A CA  1 
ATOM   2149 C  C   . HIS A 1 309 ? 6.774   36.407 -21.393 1.00 31.87 ? 315 HIS A C   1 
ATOM   2150 O  O   . HIS A 1 309 ? 6.978   35.740 -20.379 1.00 34.64 ? 315 HIS A O   1 
ATOM   2151 C  CB  . HIS A 1 309 ? 8.621   35.063 -22.428 1.00 31.92 ? 315 HIS A CB  1 
ATOM   2152 C  CG  . HIS A 1 309 ? 8.094   33.659 -22.460 1.00 38.04 ? 315 HIS A CG  1 
ATOM   2153 N  ND1 . HIS A 1 309 ? 8.804   32.620 -23.024 1.00 36.53 ? 315 HIS A ND1 1 
ATOM   2154 C  CD2 . HIS A 1 309 ? 6.941   33.127 -22.003 1.00 36.21 ? 315 HIS A CD2 1 
ATOM   2155 C  CE1 . HIS A 1 309 ? 8.102   31.502 -22.911 1.00 40.21 ? 315 HIS A CE1 1 
ATOM   2156 N  NE2 . HIS A 1 309 ? 6.968   31.785 -22.294 1.00 35.95 ? 315 HIS A NE2 1 
ATOM   2157 N  N   . ALA A 1 310 ? 5.887   37.398 -21.440 1.00 35.58 ? 316 ALA A N   1 
ATOM   2158 C  CA  . ALA A 1 310 ? 5.121   37.796 -20.263 1.00 33.82 ? 316 ALA A CA  1 
ATOM   2159 C  C   . ALA A 1 310 ? 3.611   37.682 -20.476 1.00 31.73 ? 316 ALA A C   1 
ATOM   2160 O  O   . ALA A 1 310 ? 2.827   38.129 -19.639 1.00 30.26 ? 316 ALA A O   1 
ATOM   2161 C  CB  . ALA A 1 310 ? 5.481   39.210 -19.870 1.00 28.36 ? 316 ALA A CB  1 
ATOM   2162 N  N   . ALA A 1 311 ? 3.200   37.098 -21.595 1.00 30.11 ? 317 ALA A N   1 
ATOM   2163 C  CA  . ALA A 1 311 ? 1.778   36.933 -21.876 1.00 29.90 ? 317 ALA A CA  1 
ATOM   2164 C  C   . ALA A 1 311 ? 1.099   36.145 -20.762 1.00 29.74 ? 317 ALA A C   1 
ATOM   2165 O  O   . ALA A 1 311 ? -0.073  36.362 -20.453 1.00 33.59 ? 317 ALA A O   1 
ATOM   2166 C  CB  . ALA A 1 311 ? 1.586   36.231 -23.198 1.00 29.74 ? 317 ALA A CB  1 
ATOM   2167 N  N   . TRP A 1 312 ? 1.851   35.226 -20.167 1.00 31.32 ? 318 TRP A N   1 
ATOM   2168 C  CA  . TRP A 1 312 ? 1.344   34.354 -19.118 1.00 31.69 ? 318 TRP A CA  1 
ATOM   2169 C  C   . TRP A 1 312 ? 1.136   35.039 -17.777 1.00 33.74 ? 318 TRP A C   1 
ATOM   2170 O  O   . TRP A 1 312 ? 0.354   34.561 -16.956 1.00 30.61 ? 318 TRP A O   1 
ATOM   2171 C  CB  . TRP A 1 312 ? 2.329   33.212 -18.891 1.00 28.20 ? 318 TRP A CB  1 
ATOM   2172 C  CG  . TRP A 1 312 ? 3.633   33.667 -18.305 1.00 36.46 ? 318 TRP A CG  1 
ATOM   2173 C  CD1 . TRP A 1 312 ? 4.687   34.198 -18.980 1.00 31.99 ? 318 TRP A CD1 1 
ATOM   2174 C  CD2 . TRP A 1 312 ? 4.014   33.628 -16.927 1.00 37.82 ? 318 TRP A CD2 1 
ATOM   2175 N  NE1 . TRP A 1 312 ? 5.706   34.494 -18.110 1.00 33.97 ? 318 TRP A NE1 1 
ATOM   2176 C  CE2 . TRP A 1 312 ? 5.320   34.154 -16.841 1.00 38.14 ? 318 TRP A CE2 1 
ATOM   2177 C  CE3 . TRP A 1 312 ? 3.389   33.201 -15.753 1.00 33.94 ? 318 TRP A CE3 1 
ATOM   2178 C  CZ2 . TRP A 1 312 ? 6.003   34.264 -15.637 1.00 37.80 ? 318 TRP A CZ2 1 
ATOM   2179 C  CZ3 . TRP A 1 312 ? 4.069   33.310 -14.559 1.00 40.65 ? 318 TRP A CZ3 1 
ATOM   2180 C  CH2 . TRP A 1 312 ? 5.362   33.837 -14.511 1.00 34.16 ? 318 TRP A CH2 1 
ATOM   2181 N  N   . TYR A 1 313 ? 1.838   36.140 -17.538 1.00 29.84 ? 319 TYR A N   1 
ATOM   2182 C  CA  . TYR A 1 313 ? 2.001   36.601 -16.166 1.00 31.31 ? 319 TYR A CA  1 
ATOM   2183 C  C   . TYR A 1 313 ? 0.842   37.368 -15.544 1.00 31.77 ? 319 TYR A C   1 
ATOM   2184 O  O   . TYR A 1 313 ? 0.315   38.329 -16.108 1.00 27.56 ? 319 TYR A O   1 
ATOM   2185 C  CB  . TYR A 1 313 ? 3.255   37.453 -16.006 1.00 26.42 ? 319 TYR A CB  1 
ATOM   2186 C  CG  . TYR A 1 313 ? 3.374   37.974 -14.594 1.00 26.15 ? 319 TYR A CG  1 
ATOM   2187 C  CD1 . TYR A 1 313 ? 3.780   37.143 -13.563 1.00 30.95 ? 319 TYR A CD1 1 
ATOM   2188 C  CD2 . TYR A 1 313 ? 3.046   39.281 -14.287 1.00 34.25 ? 319 TYR A CD2 1 
ATOM   2189 C  CE1 . TYR A 1 313 ? 3.873   37.605 -12.271 1.00 34.44 ? 319 TYR A CE1 1 
ATOM   2190 C  CE2 . TYR A 1 313 ? 3.136   39.753 -12.997 1.00 36.36 ? 319 TYR A CE2 1 
ATOM   2191 C  CZ  . TYR A 1 313 ? 3.547   38.910 -11.991 1.00 34.11 ? 319 TYR A CZ  1 
ATOM   2192 O  OH  . TYR A 1 313 ? 3.645   39.380 -10.696 1.00 44.79 ? 319 TYR A OH  1 
ATOM   2193 N  N   . SER A 1 314 ? 0.473   36.912 -14.354 1.00 30.48 ? 320 SER A N   1 
ATOM   2194 C  CA  . SER A 1 314 ? -0.287  37.694 -13.396 1.00 31.69 ? 320 SER A CA  1 
ATOM   2195 C  C   . SER A 1 314 ? 0.124   37.120 -12.050 1.00 29.21 ? 320 SER A C   1 
ATOM   2196 O  O   . SER A 1 314 ? 0.605   35.987 -11.986 1.00 36.00 ? 320 SER A O   1 
ATOM   2197 C  CB  . SER A 1 314 ? -1.791  37.543 -13.612 1.00 29.28 ? 320 SER A CB  1 
ATOM   2198 O  OG  . SER A 1 314 ? -2.239  36.278 -13.162 1.00 32.39 ? 320 SER A OG  1 
ATOM   2199 N  N   . GLU A 1 315 ? -0.042  37.880 -10.976 1.00 26.70 ? 321 GLU A N   1 
ATOM   2200 C  CA  . GLU A 1 315 ? 0.353   37.378 -9.668  1.00 35.92 ? 321 GLU A CA  1 
ATOM   2201 C  C   . GLU A 1 315 ? -0.449  36.127 -9.331  1.00 34.22 ? 321 GLU A C   1 
ATOM   2202 O  O   . GLU A 1 315 ? 0.097   35.142 -8.833  1.00 36.35 ? 321 GLU A O   1 
ATOM   2203 C  CB  . GLU A 1 315 ? 0.166   38.436 -8.582  1.00 36.98 ? 321 GLU A CB  1 
ATOM   2204 C  CG  . GLU A 1 315 ? 0.560   37.943 -7.196  1.00 48.70 ? 321 GLU A CG  1 
ATOM   2205 C  CD  . GLU A 1 315 ? 0.602   39.049 -6.161  1.00 56.43 ? 321 GLU A CD  1 
ATOM   2206 O  OE1 . GLU A 1 315 ? 1.078   38.787 -5.036  1.00 59.20 ? 321 GLU A OE1 1 
ATOM   2207 O  OE2 . GLU A 1 315 ? 0.162   40.178 -6.470  1.00 59.11 ? 321 GLU A OE2 1 
ATOM   2208 N  N   . GLN A 1 316 ? -1.745  36.161 -9.624  1.00 31.23 ? 322 GLN A N   1 
ATOM   2209 C  CA  . GLN A 1 316 ? -2.621  35.037 -9.323  1.00 35.77 ? 322 GLN A CA  1 
ATOM   2210 C  C   . GLN A 1 316 ? -2.223  33.796 -10.114 1.00 31.75 ? 322 GLN A C   1 
ATOM   2211 O  O   . GLN A 1 316 ? -2.234  32.688 -9.583  1.00 36.63 ? 322 GLN A O   1 
ATOM   2212 C  CB  . GLN A 1 316 ? -4.080  35.403 -9.607  1.00 35.81 ? 322 GLN A CB  1 
ATOM   2213 C  CG  . GLN A 1 316 ? -4.644  36.456 -8.662  1.00 39.11 ? 322 GLN A CG  1 
ATOM   2214 C  CD  . GLN A 1 316 ? -6.014  36.956 -9.086  1.00 47.88 ? 322 GLN A CD  1 
ATOM   2215 O  OE1 . GLN A 1 316 ? -6.154  38.076 -9.575  1.00 49.69 ? 322 GLN A OE1 1 
ATOM   2216 N  NE2 . GLN A 1 316 ? -7.034  36.128 -8.894  1.00 40.01 ? 322 GLN A NE2 1 
ATOM   2217 N  N   . ALA A 1 317 ? -1.863  33.982 -11.380 1.00 30.46 ? 323 ALA A N   1 
ATOM   2218 C  CA  . ALA A 1 317 ? -1.483  32.861 -12.235 1.00 34.60 ? 323 ALA A CA  1 
ATOM   2219 C  C   . ALA A 1 317 ? -0.160  32.246 -11.790 1.00 31.37 ? 323 ALA A C   1 
ATOM   2220 O  O   . ALA A 1 317 ? -0.041  31.026 -11.670 1.00 35.22 ? 323 ALA A O   1 
ATOM   2221 C  CB  . ALA A 1 317 ? -1.387  33.311 -13.679 1.00 32.30 ? 323 ALA A CB  1 
ATOM   2222 N  N   . SER A 1 318 ? 0.833   33.095 -11.550 1.00 33.77 ? 324 SER A N   1 
ATOM   2223 C  CA  . SER A 1 318 ? 2.157   32.637 -11.141 1.00 40.67 ? 324 SER A CA  1 
ATOM   2224 C  C   . SER A 1 318 ? 2.082   31.765 -9.892  1.00 33.04 ? 324 SER A C   1 
ATOM   2225 O  O   . SER A 1 318 ? 2.652   30.676 -9.845  1.00 34.15 ? 324 SER A O   1 
ATOM   2226 C  CB  . SER A 1 318 ? 3.066   33.836 -10.875 1.00 34.50 ? 324 SER A CB  1 
ATOM   2227 O  OG  . SER A 1 318 ? 4.374   33.423 -10.524 1.00 38.71 ? 324 SER A OG  1 
ATOM   2228 N  N   . ILE A 1 319 ? 1.378   32.257 -8.879  1.00 33.70 ? 325 ILE A N   1 
ATOM   2229 C  CA  . ILE A 1 319 ? 1.175   31.504 -7.650  1.00 35.29 ? 325 ILE A CA  1 
ATOM   2230 C  C   . ILE A 1 319 ? 0.419   30.209 -7.930  1.00 32.33 ? 325 ILE A C   1 
ATOM   2231 O  O   . ILE A 1 319 ? 0.762   29.153 -7.400  1.00 38.01 ? 325 ILE A O   1 
ATOM   2232 C  CB  . ILE A 1 319 ? 0.387   32.338 -6.625  1.00 30.98 ? 325 ILE A CB  1 
ATOM   2233 C  CG1 . ILE A 1 319 ? 1.249   33.495 -6.115  1.00 35.97 ? 325 ILE A CG1 1 
ATOM   2234 C  CG2 . ILE A 1 319 ? -0.068  31.469 -5.460  1.00 30.45 ? 325 ILE A CG2 1 
ATOM   2235 C  CD1 . ILE A 1 319 ? 0.471   34.551 -5.358  1.00 34.59 ? 325 ILE A CD1 1 
ATOM   2236 N  N   . GLU A 1 320 ? -0.603  30.297 -8.776  1.00 32.25 ? 326 GLU A N   1 
ATOM   2237 C  CA  . GLU A 1 320 ? -1.437  29.141 -9.098  1.00 35.19 ? 326 GLU A CA  1 
ATOM   2238 C  C   . GLU A 1 320 ? -0.633  27.998 -9.706  1.00 36.21 ? 326 GLU A C   1 
ATOM   2239 O  O   . GLU A 1 320 ? -0.750  26.854 -9.266  1.00 35.54 ? 326 GLU A O   1 
ATOM   2240 C  CB  . GLU A 1 320 ? -2.558  29.536 -10.063 1.00 33.44 ? 326 GLU A CB  1 
ATOM   2241 C  CG  . GLU A 1 320 ? -3.952  29.163 -9.582  1.00 49.51 ? 326 GLU A CG  1 
ATOM   2242 C  CD  . GLU A 1 320 ? -5.049  29.876 -10.353 1.00 48.72 ? 326 GLU A CD  1 
ATOM   2243 O  OE1 . GLU A 1 320 ? -5.927  30.489 -9.710  1.00 50.17 ? 326 GLU A OE1 1 
ATOM   2244 O  OE2 . GLU A 1 320 ? -5.037  29.817 -11.600 1.00 39.17 ? 326 GLU A OE2 1 
ATOM   2245 N  N   . MET A 1 321 ? 0.157   28.296 -10.734 1.00 32.84 ? 327 MET A N   1 
ATOM   2246 C  CA  . MET A 1 321 ? 0.927   27.262 -11.415 1.00 33.47 ? 327 MET A CA  1 
ATOM   2247 C  C   . MET A 1 321 ? 2.000   26.642 -10.565 1.00 34.47 ? 327 MET A C   1 
ATOM   2248 O  O   . MET A 1 321 ? 2.333   25.466 -10.713 1.00 36.88 ? 327 MET A O   1 
ATOM   2249 C  CB  . MET A 1 321 ? 1.492   27.781 -12.736 1.00 34.19 ? 327 MET A CB  1 
ATOM   2250 C  CG  . MET A 1 321 ? 2.632   28.766 -12.614 1.00 37.19 ? 327 MET A CG  1 
ATOM   2251 S  SD  . MET A 1 321 ? 3.359   28.983 -14.250 1.00 46.81 ? 327 MET A SD  1 
ATOM   2252 C  CE  . MET A 1 321 ? 2.066   29.904 -15.081 1.00 39.01 ? 327 MET A CE  1 
ATOM   2253 N  N   . ARG A 1 322 ? 2.554   27.439 -9.657  1.00 30.86 ? 328 ARG A N   1 
ATOM   2254 C  CA  . ARG A 1 322 ? 3.583   26.956 -8.742  1.00 32.95 ? 328 ARG A CA  1 
ATOM   2255 C  C   . ARG A 1 322 ? 2.980   26.039 -7.685  1.00 33.47 ? 328 ARG A C   1 
ATOM   2256 O  O   . ARG A 1 322 ? 3.610   25.076 -7.252  1.00 37.64 ? 328 ARG A O   1 
ATOM   2257 C  CB  . ARG A 1 322 ? 4.291   28.130 -8.065  1.00 31.59 ? 328 ARG A CB  1 
ATOM   2258 C  CG  . ARG A 1 322 ? 5.152   28.954 -9.010  1.00 30.81 ? 328 ARG A CG  1 
ATOM   2259 C  CD  . ARG A 1 322 ? 5.672   30.222 -8.345  1.00 34.35 ? 328 ARG A CD  1 
ATOM   2260 N  NE  . ARG A 1 322 ? 6.604   29.926 -7.262  1.00 34.22 ? 328 ARG A NE  1 
ATOM   2261 C  CZ  . ARG A 1 322 ? 7.265   30.844 -6.565  1.00 39.82 ? 328 ARG A CZ  1 
ATOM   2262 N  NH1 . ARG A 1 322 ? 7.109   32.134 -6.829  1.00 34.30 ? 328 ARG A NH1 1 
ATOM   2263 N  NH2 . ARG A 1 322 ? 8.092   30.470 -5.599  1.00 38.18 ? 328 ARG A NH2 1 
ATOM   2264 N  N   . GLU A 1 323 ? 1.755   26.346 -7.270  1.00 35.55 ? 329 GLU A N   1 
ATOM   2265 C  CA  . GLU A 1 323 ? 1.054   25.519 -6.294  1.00 35.66 ? 329 GLU A CA  1 
ATOM   2266 C  C   . GLU A 1 323 ? 0.628   24.193 -6.915  1.00 29.45 ? 329 GLU A C   1 
ATOM   2267 O  O   . GLU A 1 323 ? 0.679   23.152 -6.263  1.00 38.20 ? 329 GLU A O   1 
ATOM   2268 C  CB  . GLU A 1 323 ? -0.159  26.266 -5.732  1.00 32.22 ? 329 GLU A CB  1 
ATOM   2269 C  CG  . GLU A 1 323 ? 0.199   27.289 -4.661  1.00 37.26 ? 329 GLU A CG  1 
ATOM   2270 C  CD  . GLU A 1 323 ? -0.961  28.190 -4.290  1.00 38.67 ? 329 GLU A CD  1 
ATOM   2271 O  OE1 . GLU A 1 323 ? -2.017  28.110 -4.952  1.00 45.45 ? 329 GLU A OE1 1 
ATOM   2272 O  OE2 . GLU A 1 323 ? -0.815  28.979 -3.332  1.00 39.44 ? 329 GLU A OE2 1 
ATOM   2273 N  N   . GLU A 1 324 ? 0.224   24.230 -8.180  1.00 32.00 ? 330 GLU A N   1 
ATOM   2274 C  CA  . GLU A 1 324 ? -0.166  23.015 -8.888  1.00 33.02 ? 330 GLU A CA  1 
ATOM   2275 C  C   . GLU A 1 324 ? 1.042   22.120 -9.131  1.00 34.95 ? 330 GLU A C   1 
ATOM   2276 O  O   . GLU A 1 324 ? 0.955   20.899 -9.017  1.00 37.62 ? 330 GLU A O   1 
ATOM   2277 C  CB  . GLU A 1 324 ? -0.830  23.364 -10.220 1.00 34.62 ? 330 GLU A CB  1 
ATOM   2278 C  CG  . GLU A 1 324 ? -1.105  22.160 -11.114 1.00 37.39 ? 330 GLU A CG  1 
ATOM   2279 C  CD  . GLU A 1 324 ? -2.207  21.272 -10.571 1.00 43.29 ? 330 GLU A CD  1 
ATOM   2280 O  OE1 . GLU A 1 324 ? -3.184  21.813 -10.008 1.00 41.79 ? 330 GLU A OE1 1 
ATOM   2281 O  OE2 . GLU A 1 324 ? -2.096  20.034 -10.703 1.00 48.37 ? 330 GLU A OE2 1 
ATOM   2282 N  N   . ALA A 1 325 ? 2.172   22.731 -9.470  1.00 33.67 ? 331 ALA A N   1 
ATOM   2283 C  CA  . ALA A 1 325 ? 3.383   21.971 -9.743  1.00 37.47 ? 331 ALA A CA  1 
ATOM   2284 C  C   . ALA A 1 325 ? 3.861   21.248 -8.489  1.00 35.16 ? 331 ALA A C   1 
ATOM   2285 O  O   . ALA A 1 325 ? 4.230   20.077 -8.542  1.00 34.39 ? 331 ALA A O   1 
ATOM   2286 C  CB  . ALA A 1 325 ? 4.467   22.882 -10.274 1.00 31.76 ? 331 ALA A CB  1 
ATOM   2287 N  N   . ALA A 1 326 ? 3.855   21.948 -7.360  1.00 37.20 ? 332 ALA A N   1 
ATOM   2288 C  CA  . ALA A 1 326 ? 4.270   21.346 -6.101  1.00 35.06 ? 332 ALA A CA  1 
ATOM   2289 C  C   . ALA A 1 326 ? 3.344   20.196 -5.723  1.00 36.08 ? 332 ALA A C   1 
ATOM   2290 O  O   . ALA A 1 326 ? 3.799   19.157 -5.244  1.00 39.65 ? 332 ALA A O   1 
ATOM   2291 C  CB  . ALA A 1 326 ? 4.296   22.384 -5.005  1.00 32.44 ? 332 ALA A CB  1 
ATOM   2292 N  N   . ARG A 1 327 ? 2.045   20.380 -5.939  1.00 36.63 ? 333 ARG A N   1 
ATOM   2293 C  CA  . ARG A 1 327 ? 1.081   19.328 -5.644  1.00 33.47 ? 333 ARG A CA  1 
ATOM   2294 C  C   . ARG A 1 327 ? 1.375   18.091 -6.490  1.00 37.29 ? 333 ARG A C   1 
ATOM   2295 O  O   . ARG A 1 327 ? 1.268   16.965 -6.009  1.00 37.46 ? 333 ARG A O   1 
ATOM   2296 C  CB  . ARG A 1 327 ? -0.353  19.811 -5.883  1.00 38.67 ? 333 ARG A CB  1 
ATOM   2297 C  CG  . ARG A 1 327 ? -0.899  20.728 -4.791  1.00 39.03 ? 333 ARG A CG  1 
ATOM   2298 C  CD  . ARG A 1 327 ? -2.411  20.898 -4.917  1.00 36.76 ? 333 ARG A CD  1 
ATOM   2299 N  NE  . ARG A 1 327 ? -2.799  21.593 -6.143  1.00 35.55 ? 333 ARG A NE  1 
ATOM   2300 C  CZ  . ARG A 1 327 ? -2.954  22.911 -6.259  1.00 37.98 ? 333 ARG A CZ  1 
ATOM   2301 N  NH1 . ARG A 1 327 ? -3.310  23.426 -7.426  1.00 33.40 ? 333 ARG A NH1 1 
ATOM   2302 N  NH2 . ARG A 1 327 ? -2.757  23.719 -5.226  1.00 33.77 ? 333 ARG A NH2 1 
ATOM   2303 N  N   . GLU A 1 328 ? 1.754   18.306 -7.748  1.00 36.73 ? 334 GLU A N   1 
ATOM   2304 C  CA  . GLU A 1 328 ? 2.112   17.202 -8.632  1.00 41.12 ? 334 GLU A CA  1 
ATOM   2305 C  C   . GLU A 1 328 ? 3.357   16.498 -8.097  1.00 40.82 ? 334 GLU A C   1 
ATOM   2306 O  O   . GLU A 1 328 ? 3.416   15.270 -8.047  1.00 43.89 ? 334 GLU A O   1 
ATOM   2307 C  CB  . GLU A 1 328 ? 2.363   17.712 -10.052 1.00 37.24 ? 334 GLU A CB  1 
ATOM   2308 C  CG  . GLU A 1 328 ? 2.584   16.617 -11.089 1.00 37.78 ? 334 GLU A CG  1 
ATOM   2309 C  CD  . GLU A 1 328 ? 1.288   16.055 -11.640 1.00 43.22 ? 334 GLU A CD  1 
ATOM   2310 O  OE1 . GLU A 1 328 ? 0.394   15.711 -10.837 1.00 40.60 ? 334 GLU A OE1 1 
ATOM   2311 O  OE2 . GLU A 1 328 ? 1.161   15.963 -12.880 1.00 42.66 ? 334 GLU A OE2 1 
ATOM   2312 N  N   . ILE A 1 329 ? 4.346   17.287 -7.689  1.00 38.07 ? 335 ILE A N   1 
ATOM   2313 C  CA  . ILE A 1 329 ? 5.547   16.750 -7.062  1.00 38.96 ? 335 ILE A CA  1 
ATOM   2314 C  C   . ILE A 1 329 ? 5.178   15.912 -5.839  1.00 43.14 ? 335 ILE A C   1 
ATOM   2315 O  O   . ILE A 1 329 ? 5.749   14.845 -5.613  1.00 43.71 ? 335 ILE A O   1 
ATOM   2316 C  CB  . ILE A 1 329 ? 6.501   17.882 -6.621  1.00 40.68 ? 335 ILE A CB  1 
ATOM   2317 C  CG1 . ILE A 1 329 ? 7.104   18.594 -7.838  1.00 34.42 ? 335 ILE A CG1 1 
ATOM   2318 C  CG2 . ILE A 1 329 ? 7.600   17.336 -5.720  1.00 35.64 ? 335 ILE A CG2 1 
ATOM   2319 C  CD1 . ILE A 1 329 ? 8.029   17.741 -8.674  1.00 38.54 ? 335 ILE A CD1 1 
ATOM   2320 N  N   . ARG A 1 330 ? 4.221   16.398 -5.054  1.00 45.10 ? 336 ARG A N   1 
ATOM   2321 C  CA  . ARG A 1 330 ? 3.816   15.705 -3.838  1.00 40.72 ? 336 ARG A CA  1 
ATOM   2322 C  C   . ARG A 1 330 ? 3.069   14.419 -4.165  1.00 40.36 ? 336 ARG A C   1 
ATOM   2323 O  O   . ARG A 1 330 ? 3.244   13.405 -3.491  1.00 46.04 ? 336 ARG A O   1 
ATOM   2324 C  CB  . ARG A 1 330 ? 2.942   16.603 -2.961  1.00 38.95 ? 336 ARG A CB  1 
ATOM   2325 C  CG  . ARG A 1 330 ? 2.459   15.914 -1.691  1.00 47.50 ? 336 ARG A CG  1 
ATOM   2326 C  CD  . ARG A 1 330 ? 1.741   16.867 -0.752  1.00 45.25 ? 336 ARG A CD  1 
ATOM   2327 N  NE  . ARG A 1 330 ? 1.557   16.268 0.573   1.00 53.74 ? 336 ARG A NE  1 
ATOM   2328 C  CZ  . ARG A 1 330 ? 1.927   16.822 1.729   1.00 54.04 ? 336 ARG A CZ  1 
ATOM   2329 N  NH1 . ARG A 1 330 ? 1.712   16.173 2.864   1.00 51.60 ? 336 ARG A NH1 1 
ATOM   2330 N  NH2 . ARG A 1 330 ? 2.506   18.016 1.770   1.00 49.07 ? 336 ARG A NH2 1 
ATOM   2331 N  N   . ARG A 1 331 ? 2.232   14.463 -5.195  1.00 38.67 ? 337 ARG A N   1 
ATOM   2332 C  CA  . ARG A 1 331 ? 1.502   13.277 -5.620  1.00 43.47 ? 337 ARG A CA  1 
ATOM   2333 C  C   . ARG A 1 331 ? 2.487   12.190 -6.037  1.00 45.12 ? 337 ARG A C   1 
ATOM   2334 O  O   . ARG A 1 331 ? 2.252   11.005 -5.806  1.00 46.04 ? 337 ARG A O   1 
ATOM   2335 C  CB  . ARG A 1 331 ? 0.548   13.604 -6.774  1.00 41.77 ? 337 ARG A CB  1 
ATOM   2336 C  CG  . ARG A 1 331 ? -0.684  14.413 -6.370  1.00 41.49 ? 337 ARG A CG  1 
ATOM   2337 C  CD  . ARG A 1 331 ? -1.677  14.541 -7.523  1.00 38.83 ? 337 ARG A CD  1 
ATOM   2338 N  NE  . ARG A 1 331 ? -1.264  15.522 -8.528  1.00 38.18 ? 337 ARG A NE  1 
ATOM   2339 C  CZ  . ARG A 1 331 ? -1.636  16.802 -8.545  1.00 39.39 ? 337 ARG A CZ  1 
ATOM   2340 N  NH1 . ARG A 1 331 ? -2.433  17.294 -7.607  1.00 37.81 ? 337 ARG A NH1 1 
ATOM   2341 N  NH2 . ARG A 1 331 ? -1.204  17.601 -9.509  1.00 34.81 ? 337 ARG A NH2 1 
ATOM   2342 N  N   . ALA A 1 332 ? 3.597   12.601 -6.643  1.00 42.28 ? 338 ALA A N   1 
ATOM   2343 C  CA  . ALA A 1 332 ? 4.616   11.661 -7.096  1.00 47.47 ? 338 ALA A CA  1 
ATOM   2344 C  C   . ALA A 1 332 ? 5.350   11.002 -5.928  1.00 49.11 ? 338 ALA A C   1 
ATOM   2345 O  O   . ALA A 1 332 ? 5.517   9.782  -5.902  1.00 52.84 ? 338 ALA A O   1 
ATOM   2346 C  CB  . ALA A 1 332 ? 5.606   12.363 -8.002  1.00 46.88 ? 338 ALA A CB  1 
ATOM   2347 N  N   . ILE A 1 333 ? 5.792   11.812 -4.971  1.00 46.11 ? 339 ILE A N   1 
ATOM   2348 C  CA  . ILE A 1 333 ? 6.534   11.306 -3.819  1.00 46.98 ? 339 ILE A CA  1 
ATOM   2349 C  C   . ILE A 1 333 ? 5.668   10.412 -2.939  1.00 52.40 ? 339 ILE A C   1 
ATOM   2350 O  O   . ILE A 1 333 ? 6.115   9.367  -2.466  1.00 59.63 ? 339 ILE A O   1 
ATOM   2351 C  CB  . ILE A 1 333 ? 7.071   12.458 -2.943  1.00 52.34 ? 339 ILE A CB  1 
ATOM   2352 C  CG1 . ILE A 1 333 ? 8.072   13.316 -3.725  1.00 50.97 ? 339 ILE A CG1 1 
ATOM   2353 C  CG2 . ILE A 1 333 ? 7.720   11.904 -1.681  1.00 56.53 ? 339 ILE A CG2 1 
ATOM   2354 C  CD1 . ILE A 1 333 ? 8.563   14.534 -2.962  1.00 54.10 ? 339 ILE A CD1 1 
ATOM   2355 N  N   . THR A 1 334 ? 4.428   10.834 -2.721  1.00 51.55 ? 340 THR A N   1 
ATOM   2356 C  CA  . THR A 1 334 ? 3.545   10.179 -1.766  1.00 56.89 ? 340 THR A CA  1 
ATOM   2357 C  C   . THR A 1 334 ? 2.763   9.020  -2.386  1.00 49.99 ? 340 THR A C   1 
ATOM   2358 O  O   . THR A 1 334 ? 2.284   8.137  -1.674  1.00 57.97 ? 340 THR A O   1 
ATOM   2359 C  CB  . THR A 1 334 ? 2.553   11.198 -1.174  1.00 52.16 ? 340 THR A CB  1 
ATOM   2360 O  OG1 . THR A 1 334 ? 3.270   12.181 -0.417  1.00 55.53 ? 340 THR A OG1 1 
ATOM   2361 C  CG2 . THR A 1 334 ? 1.558   10.521 -0.264  1.00 62.20 ? 340 THR A CG2 1 
ATOM   2362 N  N   . GLY A 1 335 ? 2.643   9.024  -3.711  1.00 50.36 ? 341 GLY A N   1 
ATOM   2363 C  CA  . GLY A 1 335 ? 1.867   8.014  -4.410  1.00 45.87 ? 341 GLY A CA  1 
ATOM   2364 C  C   . GLY A 1 335 ? 2.698   7.166  -5.357  1.00 53.99 ? 341 GLY A C   1 
ATOM   2365 O  O   . GLY A 1 335 ? 3.905   7.010  -5.170  1.00 56.39 ? 341 GLY A O   1 
ATOM   2366 N  N   . ARG A 1 336 ? 2.055   6.696  -6.422  1.00 63.16 ? 342 ARG A N   1 
ATOM   2367 C  CA  . ARG A 1 336 ? 2.728   5.930  -7.468  1.00 62.23 ? 342 ARG A CA  1 
ATOM   2368 C  C   . ARG A 1 336 ? 2.843   6.738  -8.750  1.00 61.20 ? 342 ARG A C   1 
ATOM   2369 O  O   . ARG A 1 336 ? 1.906   7.418  -9.161  1.00 60.20 ? 342 ARG A O   1 
ATOM   2370 C  CB  . ARG A 1 336 ? 1.964   4.628  -7.776  1.00 62.40 ? 342 ARG A CB  1 
ATOM   2371 N  N   . ILE A 1 337 ? 4.007   6.646  -9.381  1.00 58.66 ? 343 ILE A N   1 
ATOM   2372 C  CA  . ILE A 1 337 ? 4.200   7.164  -10.718 1.00 59.76 ? 343 ILE A CA  1 
ATOM   2373 C  C   . ILE A 1 337 ? 3.847   6.045  -11.710 1.00 65.50 ? 343 ILE A C   1 
ATOM   2374 O  O   . ILE A 1 337 ? 4.165   4.882  -11.465 1.00 64.08 ? 343 ILE A O   1 
ATOM   2375 C  CB  . ILE A 1 337 ? 5.644   7.658  -10.889 1.00 60.31 ? 343 ILE A CB  1 
ATOM   2376 C  CG1 . ILE A 1 337 ? 5.922   8.739  -9.835  1.00 55.88 ? 343 ILE A CG1 1 
ATOM   2377 C  CG2 . ILE A 1 337 ? 5.861   8.178  -12.293 1.00 57.66 ? 343 ILE A CG2 1 
ATOM   2378 C  CD1 . ILE A 1 337 ? 7.339   9.241  -9.779  1.00 52.32 ? 343 ILE A CD1 1 
ATOM   2379 N  N   . PRO A 1 338 ? 3.135   6.380  -12.802 1.00 64.21 ? 344 PRO A N   1 
ATOM   2380 C  CA  . PRO A 1 338 ? 2.570   7.693  -13.134 1.00 62.58 ? 344 PRO A CA  1 
ATOM   2381 C  C   . PRO A 1 338 ? 1.053   7.758  -12.912 1.00 62.35 ? 344 PRO A C   1 
ATOM   2382 O  O   . PRO A 1 338 ? 0.387   8.679  -13.403 1.00 56.38 ? 344 PRO A O   1 
ATOM   2383 C  CB  . PRO A 1 338 ? 2.894   7.820  -14.629 1.00 61.39 ? 344 PRO A CB  1 
ATOM   2384 C  CG  . PRO A 1 338 ? 2.791   6.383  -15.145 1.00 57.26 ? 344 PRO A CG  1 
ATOM   2385 C  CD  . PRO A 1 338 ? 3.109   5.474  -13.969 1.00 64.16 ? 344 PRO A CD  1 
ATOM   2386 N  N   . ASP A 1 339 ? 0.566   6.801  -12.244 1.00 61.78 ? 345 ASP A N   1 
ATOM   2387 C  CA  . ASP A 1 339 ? -0.890  6.654  -11.993 1.00 54.46 ? 345 ASP A CA  1 
ATOM   2388 C  C   . ASP A 1 339 ? -1.527  7.788  -11.169 1.00 51.78 ? 345 ASP A C   1 
ATOM   2389 O  O   . ASP A 1 339 ? -2.697  8.115  -11.325 1.00 48.92 ? 345 ASP A O   1 
ATOM   2390 C  CB  . ASP A 1 339 ? -1.194  5.336  -11.265 1.00 60.91 ? 345 ASP A CB  1 
ATOM   2391 C  CG  . ASP A 1 339 ? -0.327  4.184  -11.730 1.00 68.38 ? 345 ASP A CG  1 
ATOM   2392 O  OD1 . ASP A 1 339 ? 0.201   3.455  -10.862 1.00 72.82 ? 345 ASP A OD1 1 
ATOM   2393 O  OD2 . ASP A 1 339 ? -0.176  4.003  -12.955 1.00 73.33 ? 345 ASP A OD2 1 
ATOM   2394 N  N   . SER A 1 340 ? -0.725  8.374  -10.285 1.00 51.26 ? 346 SER A N   1 
ATOM   2395 C  CA  . SER A 1 340 ? -1.207  9.427  -9.389  1.00 52.88 ? 346 SER A CA  1 
ATOM   2396 C  C   . SER A 1 340 ? -1.100  10.807 -10.028 1.00 53.62 ? 346 SER A C   1 
ATOM   2397 O  O   . SER A 1 340 ? -1.667  11.779 -9.542  1.00 50.14 ? 346 SER A O   1 
ATOM   2398 C  CB  . SER A 1 340 ? -0.381  9.440  -8.108  1.00 49.65 ? 346 SER A CB  1 
ATOM   2399 O  OG  . SER A 1 340 ? -0.386  8.191  -7.445  1.00 61.05 ? 346 SER A OG  1 
ATOM   2400 N  N   . LEU A 1 341 ? -0.321  10.895 -11.098 1.00 49.72 ? 347 LEU A N   1 
ATOM   2401 C  CA  . LEU A 1 341 ? -0.047  12.172 -11.737 1.00 46.94 ? 347 LEU A CA  1 
ATOM   2402 C  C   . LEU A 1 341 ? -1.272  12.682 -12.493 1.00 46.28 ? 347 LEU A C   1 
ATOM   2403 O  O   . LEU A 1 341 ? -2.000  11.931 -13.151 1.00 46.70 ? 347 LEU A O   1 
ATOM   2404 C  CB  . LEU A 1 341 ? 1.166   12.055 -12.660 1.00 41.86 ? 347 LEU A CB  1 
ATOM   2405 C  CG  . LEU A 1 341 ? 2.380   11.412 -11.994 1.00 42.87 ? 347 LEU A CG  1 
ATOM   2406 C  CD1 . LEU A 1 341 ? 3.613   11.473 -12.897 1.00 38.50 ? 347 LEU A CD1 1 
ATOM   2407 C  CD2 . LEU A 1 341 ? 2.644   12.098 -10.683 1.00 43.73 ? 347 LEU A CD2 1 
ATOM   2408 N  N   . LYS A 1 342 ? -1.497  13.979 -12.371 1.00 47.10 ? 348 LYS A N   1 
ATOM   2409 C  CA  . LYS A 1 342 ? -2.640  14.635 -12.990 1.00 43.51 ? 348 LYS A CA  1 
ATOM   2410 C  C   . LYS A 1 342 ? -2.301  15.128 -14.392 1.00 41.88 ? 348 LYS A C   1 
ATOM   2411 O  O   . LYS A 1 342 ? -3.145  15.104 -15.289 1.00 35.74 ? 348 LYS A O   1 
ATOM   2412 C  CB  . LYS A 1 342 ? -3.106  15.810 -12.126 1.00 39.87 ? 348 LYS A CB  1 
ATOM   2413 C  CG  . LYS A 1 342 ? -4.365  16.491 -12.635 1.00 48.27 ? 348 LYS A CG  1 
ATOM   2414 N  N   . ASN A 1 343 ? -1.060  15.566 -14.580 1.00 36.40 ? 349 ASN A N   1 
ATOM   2415 C  CA  . ASN A 1 343 ? -0.651  16.194 -15.831 1.00 39.33 ? 349 ASN A CA  1 
ATOM   2416 C  C   . ASN A 1 343 ? 0.637   15.619 -16.414 1.00 39.47 ? 349 ASN A C   1 
ATOM   2417 O  O   . ASN A 1 343 ? 1.520   16.366 -16.837 1.00 37.97 ? 349 ASN A O   1 
ATOM   2418 C  CB  . ASN A 1 343 ? -0.486  17.700 -15.623 1.00 35.56 ? 349 ASN A CB  1 
ATOM   2419 C  CG  . ASN A 1 343 ? -1.813  18.419 -15.507 1.00 42.94 ? 349 ASN A CG  1 
ATOM   2420 O  OD1 . ASN A 1 343 ? -2.129  19.006 -14.472 1.00 47.79 ? 349 ASN A OD1 1 
ATOM   2421 N  ND2 . ASN A 1 343 ? -2.597  18.378 -16.575 1.00 38.87 ? 349 ASN A ND2 1 
ATOM   2422 N  N   . CYS A 1 344 ? 0.745   14.294 -16.437 1.00 40.75 ? 350 CYS A N   1 
ATOM   2423 C  CA  . CYS A 1 344 ? 1.894   13.646 -17.055 1.00 38.60 ? 350 CYS A CA  1 
ATOM   2424 C  C   . CYS A 1 344 ? 1.750   13.675 -18.573 1.00 38.52 ? 350 CYS A C   1 
ATOM   2425 O  O   . CYS A 1 344 ? 0.704   13.314 -19.113 1.00 37.46 ? 350 CYS A O   1 
ATOM   2426 C  CB  . CYS A 1 344 ? 2.027   12.205 -16.566 1.00 50.15 ? 350 CYS A CB  1 
ATOM   2427 S  SG  . CYS A 1 344 ? 3.456   11.332 -17.251 1.00 45.73 ? 350 CYS A SG  1 
ATOM   2428 N  N   . VAL A 1 345 ? 2.784   14.178 -19.229 1.00 39.45 ? 351 VAL A N   1 
ATOM   2429 C  CA  . VAL A 1 345 ? 2.731   14.337 -20.671 1.00 45.23 ? 351 VAL A CA  1 
ATOM   2430 C  C   . VAL A 1 345 ? 3.575   13.285 -21.412 1.00 47.76 ? 351 VAL A C   1 
ATOM   2431 O  O   . VAL A 1 345 ? 3.674   13.324 -22.629 1.00 47.25 ? 351 VAL A O   1 
ATOM   2432 C  CB  . VAL A 1 345 ? 3.191   15.753 -21.093 1.00 42.69 ? 351 VAL A CB  1 
ATOM   2433 C  CG1 . VAL A 1 345 ? 2.297   16.849 -20.451 1.00 41.42 ? 351 VAL A CG1 1 
ATOM   2434 C  CG2 . VAL A 1 345 ? 4.647   15.990 -20.707 1.00 49.43 ? 351 VAL A CG2 1 
ATOM   2435 N  N   . ASN A 1 346 ? 4.170   12.338 -20.696 1.00 44.61 ? 352 ASN A N   1 
ATOM   2436 C  CA  . ASN A 1 346 ? 5.092   11.391 -21.341 1.00 48.57 ? 352 ASN A CA  1 
ATOM   2437 C  C   . ASN A 1 346 ? 4.933   9.959  -20.840 1.00 52.64 ? 352 ASN A C   1 
ATOM   2438 O  O   . ASN A 1 346 ? 5.913   9.238  -20.666 1.00 61.13 ? 352 ASN A O   1 
ATOM   2439 C  CB  . ASN A 1 346 ? 6.540   11.841 -21.127 1.00 41.78 ? 352 ASN A CB  1 
ATOM   2440 C  CG  . ASN A 1 346 ? 7.048   11.537 -19.703 1.00 52.21 ? 352 ASN A CG  1 
ATOM   2441 O  OD1 . ASN A 1 346 ? 6.274   11.527 -18.727 1.00 48.37 ? 352 ASN A OD1 1 
ATOM   2442 N  ND2 . ASN A 1 346 ? 8.354   11.289 -19.584 1.00 44.70 ? 352 ASN A ND2 1 
ATOM   2443 N  N   . LYS A 1 347 ? 3.698   9.554  -20.592 1.00 52.04 ? 353 LYS A N   1 
ATOM   2444 C  CA  . LYS A 1 347 ? 3.406   8.194  -20.165 1.00 55.14 ? 353 LYS A CA  1 
ATOM   2445 C  C   . LYS A 1 347 ? 3.842   7.226  -21.247 1.00 57.84 ? 353 LYS A C   1 
ATOM   2446 O  O   . LYS A 1 347 ? 4.355   7.660  -22.275 1.00 62.89 ? 353 LYS A O   1 
ATOM   2447 C  CB  . LYS A 1 347 ? 1.912   8.030  -19.925 1.00 53.40 ? 353 LYS A CB  1 
ATOM   2448 C  CG  . LYS A 1 347 ? 1.408   8.580  -18.608 1.00 52.22 ? 353 LYS A CG  1 
ATOM   2449 C  CD  . LYS A 1 347 ? -0.139  8.588  -18.614 1.00 48.54 ? 353 LYS A CD  1 
ATOM   2450 C  CE  . LYS A 1 347 ? -0.702  8.329  -17.222 1.00 59.46 ? 353 LYS A CE  1 
ATOM   2451 N  NZ  . LYS A 1 347 ? 0.136   9.021  -16.207 1.00 58.52 ? 353 LYS A NZ  1 
HETATM 2452 P  PA  . NAI B 2 .   ? -2.734  23.118 -25.766 1.00 30.46 ? 401 NAI A PA  1 
HETATM 2453 O  O1A . NAI B 2 .   ? -2.042  21.777 -25.721 1.00 39.91 ? 401 NAI A O1A 1 
HETATM 2454 O  O2A . NAI B 2 .   ? -3.986  23.342 -24.954 1.00 32.80 ? 401 NAI A O2A 1 
HETATM 2455 O  O5B . NAI B 2 .   ? -3.054  23.482 -27.298 1.00 30.11 ? 401 NAI A O5B 1 
HETATM 2456 C  C5B . NAI B 2 .   ? -2.160  23.126 -28.345 1.00 31.08 ? 401 NAI A C5B 1 
HETATM 2457 C  C4B . NAI B 2 .   ? -2.955  22.932 -29.627 1.00 34.26 ? 401 NAI A C4B 1 
HETATM 2458 O  O4B . NAI B 2 .   ? -2.129  23.172 -30.770 1.00 37.53 ? 401 NAI A O4B 1 
HETATM 2459 C  C3B . NAI B 2 .   ? -3.497  21.515 -29.763 1.00 35.54 ? 401 NAI A C3B 1 
HETATM 2460 O  O3B . NAI B 2 .   ? -4.918  21.543 -29.921 1.00 33.87 ? 401 NAI A O3B 1 
HETATM 2461 C  C2B . NAI B 2 .   ? -2.832  20.943 -31.001 1.00 36.18 ? 401 NAI A C2B 1 
HETATM 2462 O  O2B . NAI B 2 .   ? -3.734  20.125 -31.753 1.00 36.41 ? 401 NAI A O2B 1 
HETATM 2463 C  C1B . NAI B 2 .   ? -2.407  22.186 -31.767 1.00 34.77 ? 401 NAI A C1B 1 
HETATM 2464 N  N9A . NAI B 2 .   ? -1.235  21.966 -32.649 1.00 37.53 ? 401 NAI A N9A 1 
HETATM 2465 C  C8A . NAI B 2 .   ? -0.089  21.333 -32.336 1.00 41.89 ? 401 NAI A C8A 1 
HETATM 2466 N  N7A . NAI B 2 .   ? 0.758   21.326 -33.402 1.00 37.50 ? 401 NAI A N7A 1 
HETATM 2467 C  C5A . NAI B 2 .   ? 0.146   21.965 -34.418 1.00 37.09 ? 401 NAI A C5A 1 
HETATM 2468 C  C6A . NAI B 2 .   ? 0.464   22.317 -35.821 1.00 39.80 ? 401 NAI A C6A 1 
HETATM 2469 N  N6A . NAI B 2 .   ? 1.647   21.980 -36.389 1.00 43.42 ? 401 NAI A N6A 1 
HETATM 2470 N  N1A . NAI B 2 .   ? -0.467  22.991 -36.526 1.00 34.23 ? 401 NAI A N1A 1 
HETATM 2471 C  C2A . NAI B 2 .   ? -1.652  23.344 -35.999 1.00 37.57 ? 401 NAI A C2A 1 
HETATM 2472 N  N3A . NAI B 2 .   ? -2.004  23.056 -34.736 1.00 35.19 ? 401 NAI A N3A 1 
HETATM 2473 C  C4A . NAI B 2 .   ? -1.169  22.380 -33.913 1.00 35.43 ? 401 NAI A C4A 1 
HETATM 2474 O  O3  . NAI B 2 .   ? -1.659  24.242 -25.366 1.00 31.11 ? 401 NAI A O3  1 
HETATM 2475 P  PN  . NAI B 2 .   ? -2.102  25.688 -24.830 1.00 34.97 ? 401 NAI A PN  1 
HETATM 2476 O  O1N . NAI B 2 .   ? -2.268  25.619 -23.332 1.00 33.59 ? 401 NAI A O1N 1 
HETATM 2477 O  O2N . NAI B 2 .   ? -3.223  26.185 -25.705 1.00 27.09 ? 401 NAI A O2N 1 
HETATM 2478 O  O5D . NAI B 2 .   ? -0.772  26.524 -25.169 1.00 31.73 ? 401 NAI A O5D 1 
HETATM 2479 C  C5D . NAI B 2 .   ? -0.467  26.822 -26.529 1.00 30.22 ? 401 NAI A C5D 1 
HETATM 2480 C  C4D . NAI B 2 .   ? 0.977   27.288 -26.649 1.00 34.29 ? 401 NAI A C4D 1 
HETATM 2481 O  O4D . NAI B 2 .   ? 1.154   28.548 -26.000 1.00 33.91 ? 401 NAI A O4D 1 
HETATM 2482 C  C3D . NAI B 2 .   ? 1.947   26.314 -26.000 1.00 34.82 ? 401 NAI A C3D 1 
HETATM 2483 O  O3D . NAI B 2 .   ? 2.863   25.836 -26.983 1.00 44.42 ? 401 NAI A O3D 1 
HETATM 2484 C  C2D . NAI B 2 .   ? 2.701   27.094 -24.943 1.00 33.19 ? 401 NAI A C2D 1 
HETATM 2485 O  O2D . NAI B 2 .   ? 4.110   26.864 -25.038 1.00 40.18 ? 401 NAI A O2D 1 
HETATM 2486 C  C1D . NAI B 2 .   ? 2.369   28.544 -25.246 1.00 32.41 ? 401 NAI A C1D 1 
HETATM 2487 N  N1N . NAI B 2 .   ? 2.192   29.350 -24.042 1.00 32.18 ? 401 NAI A N1N 1 
HETATM 2488 C  C2N . NAI B 2 .   ? 2.845   30.511 -23.934 1.00 30.30 ? 401 NAI A C2N 1 
HETATM 2489 C  C3N . NAI B 2 .   ? 2.710   31.314 -22.808 1.00 30.52 ? 401 NAI A C3N 1 
HETATM 2490 C  C7N . NAI B 2 .   ? 3.464   32.609 -22.734 1.00 34.72 ? 401 NAI A C7N 1 
HETATM 2491 O  O7N . NAI B 2 .   ? 3.642   33.135 -21.648 1.00 31.29 ? 401 NAI A O7N 1 
HETATM 2492 N  N7N . NAI B 2 .   ? 3.921   33.151 -23.861 1.00 28.45 ? 401 NAI A N7N 1 
HETATM 2493 C  C4N . NAI B 2 .   ? 1.819   30.908 -21.659 1.00 30.77 ? 401 NAI A C4N 1 
HETATM 2494 C  C5N . NAI B 2 .   ? 1.169   29.627 -21.904 1.00 30.36 ? 401 NAI A C5N 1 
HETATM 2495 C  C6N . NAI B 2 .   ? 1.380   28.907 -23.075 1.00 33.68 ? 401 NAI A C6N 1 
HETATM 2496 O  O01 . 3CR C 3 .   ? 5.057   27.334 -20.991 1.00 40.90 ? 402 3CR A O01 1 
HETATM 2497 C  C02 . 3CR C 3 .   ? 4.937   28.588 -20.983 1.00 39.12 ? 402 3CR A C02 1 
HETATM 2498 O  O03 . 3CR C 3 .   ? 5.509   29.279 -21.867 1.00 33.02 ? 402 3CR A O03 1 
HETATM 2499 C  C04 . 3CR C 3 .   ? 4.123   29.252 -19.925 1.00 36.45 ? 402 3CR A C04 1 
HETATM 2500 N  N05 . 3CR C 3 .   ? 3.082   28.634 -19.441 1.00 41.25 ? 402 3CR A N05 1 
HETATM 2501 O  O06 . 3CR C 3 .   ? 2.449   29.076 -18.395 1.00 42.88 ? 402 3CR A O06 1 
HETATM 2502 C  C07 . 3CR C 3 .   ? 4.492   30.626 -19.473 1.00 35.38 ? 402 3CR A C07 1 
HETATM 2503 C  C08 . 3CR C 3 .   ? 5.357   30.737 -18.265 1.00 40.24 ? 402 3CR A C08 1 
HETATM 2504 C  C09 . 3CR C 3 .   ? 6.467   31.566 -18.287 1.00 37.64 ? 402 3CR A C09 1 
HETATM 2505 C  C10 . 3CR C 3 .   ? 7.275   31.672 -17.165 1.00 42.54 ? 402 3CR A C10 1 
HETATM 2506 C  C11 . 3CR C 3 .   ? 6.972   30.946 -16.023 1.00 41.60 ? 402 3CR A C11 1 
HETATM 2507 C  C12 . 3CR C 3 .   ? 5.863   30.113 -16.001 1.00 39.59 ? 402 3CR A C12 1 
HETATM 2508 C  C13 . 3CR C 3 .   ? 5.055   30.011 -17.123 1.00 37.66 ? 402 3CR A C13 1 
HETATM 2509 CA CA  . CA  D 4 .   ? -5.578  44.104 -44.989 1.00 45.72 ? 403 CA  A CA  1 
HETATM 2510 C  C   . FMT E 5 .   ? -4.709  43.643 -42.132 1.00 44.17 ? 404 FMT A C   1 
HETATM 2511 O  O1  . FMT E 5 .   ? -3.791  44.018 -42.861 1.00 49.62 ? 404 FMT A O1  1 
HETATM 2512 O  O2  . FMT E 5 .   ? -5.864  43.538 -42.545 1.00 39.67 ? 404 FMT A O2  1 
HETATM 2513 O  O   . HOH F 6 .   ? 21.404  21.461 -22.708 1.00 50.32 ? 501 HOH A O   1 
HETATM 2514 O  O   . HOH F 6 .   ? 5.079   63.935 -27.322 1.00 47.50 ? 502 HOH A O   1 
HETATM 2515 O  O   . HOH F 6 .   ? -8.620  33.620 -15.875 1.00 30.72 ? 503 HOH A O   1 
HETATM 2516 O  O   . HOH F 6 .   ? -6.760  51.529 -42.677 1.00 48.11 ? 504 HOH A O   1 
HETATM 2517 O  O   . HOH F 6 .   ? -6.311  37.912 -17.555 1.00 34.81 ? 505 HOH A O   1 
HETATM 2518 O  O   . HOH F 6 .   ? -3.758  26.539 -5.830  1.00 34.56 ? 506 HOH A O   1 
HETATM 2519 O  O   . HOH F 6 .   ? -17.055 16.953 -40.370 1.00 52.12 ? 507 HOH A O   1 
HETATM 2520 O  O   . HOH F 6 .   ? 17.476  39.391 -29.627 1.00 51.30 ? 508 HOH A O   1 
HETATM 2521 O  O   . HOH F 6 .   ? -21.634 26.738 -31.169 1.00 36.16 ? 509 HOH A O   1 
HETATM 2522 O  O   . HOH F 6 .   ? 9.611   28.769 -8.226  1.00 36.98 ? 510 HOH A O   1 
HETATM 2523 O  O   . HOH F 6 .   ? 12.216  34.003 -21.789 1.00 40.46 ? 511 HOH A O   1 
HETATM 2524 O  O   . HOH F 6 .   ? -14.790 45.873 -33.978 1.00 25.26 ? 512 HOH A O   1 
HETATM 2525 O  O   . HOH F 6 .   ? -3.092  25.937 -8.444  1.00 40.41 ? 513 HOH A O   1 
HETATM 2526 O  O   . HOH F 6 .   ? 21.534  22.676 -19.328 1.00 61.20 ? 514 HOH A O   1 
HETATM 2527 O  O   . HOH F 6 .   ? -3.915  19.900 -8.254  1.00 34.83 ? 515 HOH A O   1 
HETATM 2528 O  O   . HOH F 6 .   ? -5.735  21.400 -25.637 1.00 39.63 ? 516 HOH A O   1 
HETATM 2529 O  O   . HOH F 6 .   ? 14.523  28.392 -33.672 1.00 46.09 ? 517 HOH A O   1 
HETATM 2530 O  O   . HOH F 6 .   ? 4.380   37.474 -8.891  1.00 39.82 ? 518 HOH A O   1 
HETATM 2531 O  O   . HOH F 6 .   ? -20.153 41.224 -39.023 1.00 45.09 ? 519 HOH A O   1 
HETATM 2532 O  O   . HOH F 6 .   ? 16.310  31.687 -37.944 1.00 48.59 ? 520 HOH A O   1 
HETATM 2533 O  O   . HOH F 6 .   ? -2.456  18.872 -21.116 1.00 38.68 ? 521 HOH A O   1 
HETATM 2534 O  O   . HOH F 6 .   ? -17.604 20.111 -39.118 1.00 42.25 ? 522 HOH A O   1 
HETATM 2535 O  O   . HOH F 6 .   ? -4.208  64.929 -31.655 1.00 39.55 ? 523 HOH A O   1 
HETATM 2536 O  O   . HOH F 6 .   ? 1.061   13.520 2.207   1.00 50.80 ? 524 HOH A O   1 
HETATM 2537 O  O   . HOH F 6 .   ? -20.030 41.914 -32.423 1.00 38.88 ? 525 HOH A O   1 
HETATM 2538 O  O   . HOH F 6 .   ? 1.054   6.532  0.367   1.00 58.24 ? 526 HOH A O   1 
HETATM 2539 O  O   . HOH F 6 .   ? -7.147  40.632 -10.442 1.00 42.63 ? 527 HOH A O   1 
HETATM 2540 O  O   . HOH F 6 .   ? 18.104  15.124 -26.392 1.00 52.39 ? 528 HOH A O   1 
HETATM 2541 O  O   . HOH F 6 .   ? -21.655 32.957 -32.232 1.00 43.33 ? 529 HOH A O   1 
HETATM 2542 O  O   . HOH F 6 .   ? 4.254   57.528 -17.716 1.00 53.95 ? 530 HOH A O   1 
HETATM 2543 O  O   . HOH F 6 .   ? 7.727   34.501 -5.027  1.00 42.92 ? 531 HOH A O   1 
HETATM 2544 O  O   . HOH F 6 .   ? -16.540 46.092 -42.026 1.00 43.77 ? 532 HOH A O   1 
HETATM 2545 O  O   . HOH F 6 .   ? 2.013   40.560 -21.052 1.00 32.60 ? 533 HOH A O   1 
HETATM 2546 O  O   . HOH F 6 .   ? 1.596   28.652 -1.330  1.00 46.43 ? 534 HOH A O   1 
HETATM 2547 O  O   . HOH F 6 .   ? -19.220 42.095 -28.574 1.00 29.82 ? 535 HOH A O   1 
HETATM 2548 O  O   . HOH F 6 .   ? -6.113  68.254 -41.478 1.00 41.36 ? 536 HOH A O   1 
HETATM 2549 O  O   . HOH F 6 .   ? 0.285   41.910 -25.193 1.00 42.29 ? 537 HOH A O   1 
HETATM 2550 O  O   . HOH F 6 .   ? -5.149  27.140 -50.592 1.00 59.59 ? 538 HOH A O   1 
HETATM 2551 O  O   . HOH F 6 .   ? -12.659 21.926 -26.579 0.50 45.17 ? 539 HOH A O   1 
HETATM 2552 O  O   . HOH F 6 .   ? -0.000  13.794 0.000   0.50 46.93 ? 540 HOH A O   1 
HETATM 2553 O  O   . HOH F 6 .   ? -6.454  31.865 -16.403 1.00 37.23 ? 541 HOH A O   1 
HETATM 2554 O  O   . HOH F 6 .   ? 4.906   30.871 -12.002 1.00 38.93 ? 542 HOH A O   1 
HETATM 2555 O  O   . HOH F 6 .   ? 4.748   33.975 -7.602  1.00 24.56 ? 543 HOH A O   1 
HETATM 2556 O  O   . HOH F 6 .   ? 1.828   41.749 -10.293 1.00 42.70 ? 544 HOH A O   1 
HETATM 2557 O  O   . HOH F 6 .   ? 24.272  10.580 -24.567 1.00 59.37 ? 545 HOH A O   1 
HETATM 2558 O  O   . HOH F 6 .   ? 12.443  37.601 -23.937 1.00 38.22 ? 546 HOH A O   1 
HETATM 2559 O  O   . HOH F 6 .   ? -14.777 47.126 -36.280 1.00 34.74 ? 547 HOH A O   1 
HETATM 2560 O  O   . HOH F 6 .   ? -3.472  39.219 -10.549 1.00 17.31 ? 548 HOH A O   1 
HETATM 2561 O  O   . HOH F 6 .   ? 20.305  25.425 -21.158 1.00 53.35 ? 549 HOH A O   1 
HETATM 2562 O  O   . HOH F 6 .   ? -18.676 14.174 -38.830 1.00 38.36 ? 550 HOH A O   1 
HETATM 2563 O  O   . HOH F 6 .   ? -21.120 32.796 -34.758 1.00 48.83 ? 551 HOH A O   1 
HETATM 2564 O  O   . HOH F 6 .   ? 17.490  28.507 -28.800 1.00 55.22 ? 552 HOH A O   1 
HETATM 2565 O  O   . HOH F 6 .   ? 15.737  32.376 -21.416 1.00 48.22 ? 553 HOH A O   1 
HETATM 2566 O  O   . HOH F 6 .   ? 2.544   40.044 -23.616 1.00 42.63 ? 554 HOH A O   1 
HETATM 2567 O  O   . HOH F 6 .   ? 13.009  32.970 -9.059  1.00 46.53 ? 555 HOH A O   1 
HETATM 2568 O  O   . HOH F 6 .   ? -10.869 15.253 -38.098 1.00 50.34 ? 556 HOH A O   1 
HETATM 2569 O  O   . HOH F 6 .   ? -12.107 30.451 -16.231 1.00 49.10 ? 557 HOH A O   1 
HETATM 2570 O  O   . HOH F 6 .   ? -12.928 14.325 -41.397 1.00 52.33 ? 558 HOH A O   1 
HETATM 2571 O  O   . HOH F 6 .   ? 6.455   26.749 4.483   1.00 43.94 ? 559 HOH A O   1 
HETATM 2572 O  O   . HOH F 6 .   ? -0.492  21.825 -49.039 1.00 53.92 ? 560 HOH A O   1 
HETATM 2573 O  O   . HOH F 6 .   ? -21.143 29.679 -30.588 1.00 33.29 ? 561 HOH A O   1 
HETATM 2574 O  O   . HOH F 6 .   ? -23.008 24.965 -39.771 1.00 43.30 ? 562 HOH A O   1 
HETATM 2575 O  O   . HOH F 6 .   ? -19.254 29.028 -38.935 1.00 51.91 ? 563 HOH A O   1 
HETATM 2576 O  O   . HOH F 6 .   ? -3.621  25.191 -12.481 1.00 37.73 ? 564 HOH A O   1 
HETATM 2577 O  O   . HOH F 6 .   ? -17.667 35.682 -25.324 1.00 34.55 ? 565 HOH A O   1 
HETATM 2578 O  O   . HOH F 6 .   ? 0.895   43.926 -7.664  1.00 59.79 ? 566 HOH A O   1 
HETATM 2579 O  O   . HOH F 6 .   ? -3.483  31.818 -2.293  1.00 52.27 ? 567 HOH A O   1 
HETATM 2580 O  O   . HOH F 6 .   ? 6.663   19.312 8.480   1.00 38.02 ? 568 HOH A O   1 
HETATM 2581 O  O   . HOH F 6 .   ? -21.866 39.128 -37.824 1.00 56.74 ? 569 HOH A O   1 
HETATM 2582 O  O   . HOH F 6 .   ? -1.464  73.991 -33.341 1.00 58.12 ? 570 HOH A O   1 
HETATM 2583 O  O   . HOH F 6 .   ? 8.077   53.161 -26.579 0.50 59.69 ? 571 HOH A O   1 
HETATM 2584 O  O   . HOH F 6 .   ? -21.000 36.373 -32.675 0.50 41.40 ? 572 HOH A O   1 
HETATM 2585 O  O   . HOH F 6 .   ? 21.000  36.373 -21.435 0.50 50.45 ? 573 HOH A O   1 
HETATM 2586 O  O   . HOH F 6 .   ? -21.000 36.373 -30.288 0.50 36.04 ? 574 HOH A O   1 
HETATM 2587 O  O   . HOH F 6 .   ? -4.185  26.643 -28.049 1.00 29.97 ? 575 HOH A O   1 
HETATM 2588 O  O   . HOH F 6 .   ? -0.102  33.756 -30.773 1.00 27.28 ? 576 HOH A O   1 
HETATM 2589 O  O   . HOH F 6 .   ? 10.516  36.250 -25.471 1.00 35.02 ? 577 HOH A O   1 
HETATM 2590 O  O   . HOH F 6 .   ? 0.821   21.002 -29.007 1.00 31.94 ? 578 HOH A O   1 
HETATM 2591 O  O   . HOH F 6 .   ? -0.122  30.712 -27.044 1.00 23.90 ? 579 HOH A O   1 
HETATM 2592 O  O   . HOH F 6 .   ? 9.587   25.628 -22.399 1.00 35.78 ? 580 HOH A O   1 
HETATM 2593 O  O   . HOH F 6 .   ? -3.224  43.951 -46.362 1.00 45.33 ? 581 HOH A O   1 
HETATM 2594 O  O   . HOH F 6 .   ? 3.224   19.328 -35.767 1.00 43.46 ? 582 HOH A O   1 
HETATM 2595 O  O   . HOH F 6 .   ? -17.522 35.555 -27.964 1.00 32.01 ? 583 HOH A O   1 
HETATM 2596 O  O   . HOH F 6 .   ? -2.207  35.357 -44.153 1.00 33.90 ? 584 HOH A O   1 
HETATM 2597 O  O   . HOH F 6 .   ? -7.745  21.819 -39.130 1.00 36.33 ? 585 HOH A O   1 
HETATM 2598 O  O   . HOH F 6 .   ? 7.926   28.278 -18.130 1.00 41.43 ? 586 HOH A O   1 
HETATM 2599 O  O   . HOH F 6 .   ? 1.005   49.609 -31.815 1.00 38.11 ? 587 HOH A O   1 
HETATM 2600 O  O   . HOH F 6 .   ? -6.116  20.421 -27.919 1.00 33.33 ? 588 HOH A O   1 
HETATM 2601 O  O   . HOH F 6 .   ? 5.318   23.698 -26.580 1.00 38.05 ? 589 HOH A O   1 
HETATM 2602 O  O   . HOH F 6 .   ? -5.275  41.903 -45.518 1.00 39.71 ? 590 HOH A O   1 
HETATM 2603 O  O   . HOH F 6 .   ? 19.226  13.200 -9.496  1.00 49.84 ? 591 HOH A O   1 
HETATM 2604 O  O   . HOH F 6 .   ? -11.185 35.128 -45.266 1.00 46.11 ? 592 HOH A O   1 
HETATM 2605 O  O   . HOH F 6 .   ? 7.975   34.570 -32.619 1.00 38.38 ? 593 HOH A O   1 
HETATM 2606 O  O   . HOH F 6 .   ? -10.909 39.433 -45.101 1.00 38.25 ? 594 HOH A O   1 
HETATM 2607 O  O   . HOH F 6 .   ? -1.135  18.127 -19.062 1.00 36.62 ? 595 HOH A O   1 
HETATM 2608 O  O   . HOH F 6 .   ? 12.616  30.079 -24.376 1.00 41.26 ? 596 HOH A O   1 
HETATM 2609 O  O   . HOH F 6 .   ? -0.228  23.447 -46.428 1.00 41.91 ? 597 HOH A O   1 
HETATM 2610 O  O   . HOH F 6 .   ? 4.641   21.763 -25.520 1.00 41.07 ? 598 HOH A O   1 
HETATM 2611 O  O   . HOH F 6 .   ? 2.634   46.360 -45.818 1.00 51.35 ? 599 HOH A O   1 
HETATM 2612 O  O   . HOH F 6 .   ? 4.846   44.651 -50.225 1.00 53.52 ? 600 HOH A O   1 
HETATM 2613 O  O   . HOH F 6 .   ? 12.577  24.352 -28.018 1.00 49.69 ? 601 HOH A O   1 
HETATM 2614 O  O   . HOH F 6 .   ? 10.276  33.323 -33.257 1.00 43.20 ? 602 HOH A O   1 
HETATM 2615 O  O   . HOH F 6 .   ? 2.635   19.507 -29.569 1.00 44.73 ? 603 HOH A O   1 
HETATM 2616 O  O   . HOH F 6 .   ? -1.359  12.402 -16.183 1.00 47.75 ? 604 HOH A O   1 
HETATM 2617 O  O   . HOH F 6 .   ? 1.728   25.172 -46.329 1.00 38.72 ? 605 HOH A O   1 
HETATM 2618 O  O   . HOH F 6 .   ? -19.079 37.564 -29.123 1.00 33.16 ? 606 HOH A O   1 
HETATM 2619 O  O   . HOH F 6 .   ? 8.321   11.811 1.546   1.00 50.14 ? 607 HOH A O   1 
HETATM 2620 O  O   . HOH F 6 .   ? 10.096  30.565 -27.097 1.00 31.48 ? 608 HOH A O   1 
HETATM 2621 O  O   . HOH F 6 .   ? -0.903  21.544 -44.043 1.00 43.51 ? 609 HOH A O   1 
HETATM 2622 O  O   . HOH F 6 .   ? 15.714  35.462 -31.072 1.00 52.83 ? 610 HOH A O   1 
HETATM 2623 O  O   . HOH F 6 .   ? 22.987  23.592 -7.676  1.00 55.01 ? 611 HOH A O   1 
HETATM 2624 O  O   . HOH F 6 .   ? 10.726  28.436 -28.771 1.00 41.29 ? 612 HOH A O   1 
HETATM 2625 O  O   . HOH F 6 .   ? 2.427   48.831 -40.515 1.00 47.27 ? 613 HOH A O   1 
HETATM 2626 O  O   . HOH F 6 .   ? 1.273   19.274 -12.848 1.00 41.18 ? 614 HOH A O   1 
HETATM 2627 O  O   . HOH F 6 .   ? -13.652 32.933 -44.494 1.00 55.58 ? 615 HOH A O   1 
HETATM 2628 O  O   . HOH F 6 .   ? 5.979   46.088 -42.788 1.00 42.78 ? 616 HOH A O   1 
HETATM 2629 O  O   . HOH F 6 .   ? 13.071  29.692 -43.827 1.00 48.33 ? 617 HOH A O   1 
HETATM 2630 O  O   . HOH F 6 .   ? -16.046 34.122 -44.528 1.00 51.84 ? 618 HOH A O   1 
HETATM 2631 O  O   . HOH F 6 .   ? 8.212   38.258 -48.550 1.00 46.02 ? 619 HOH A O   1 
HETATM 2632 O  O   . HOH F 6 .   ? -5.999  46.678 -44.127 1.00 50.72 ? 620 HOH A O   1 
HETATM 2633 O  O   . HOH F 6 .   ? 7.064   29.534 2.182   1.00 47.81 ? 621 HOH A O   1 
HETATM 2634 O  O   . HOH F 6 .   ? -0.935  46.120 -47.926 1.00 54.85 ? 622 HOH A O   1 
HETATM 2635 O  O   . HOH F 6 .   ? -15.980 31.637 -38.593 1.00 46.94 ? 623 HOH A O   1 
HETATM 2636 O  O   . HOH F 6 .   ? -1.543  15.353 -19.700 1.00 45.20 ? 624 HOH A O   1 
HETATM 2637 O  O   . HOH F 6 .   ? 1.682   21.867 -40.112 1.00 43.10 ? 625 HOH A O   1 
HETATM 2638 O  O   . HOH F 6 .   ? -8.191  44.088 -44.804 1.00 36.18 ? 626 HOH A O   1 
HETATM 2639 O  O   . HOH F 6 .   ? 10.721  26.596 -24.661 1.00 37.01 ? 627 HOH A O   1 
HETATM 2640 O  O   . HOH F 6 .   ? 10.349  28.997 -24.852 1.00 39.79 ? 628 HOH A O   1 
HETATM 2641 O  O   . HOH F 6 .   ? -15.837 24.501 -40.902 1.00 43.39 ? 629 HOH A O   1 
HETATM 2642 O  O   . HOH F 6 .   ? 5.342   25.199 -42.307 1.00 46.66 ? 630 HOH A O   1 
HETATM 2643 O  O   . HOH F 6 .   ? -16.476 33.811 -36.727 1.00 48.08 ? 631 HOH A O   1 
HETATM 2644 O  O   . HOH F 6 .   ? 10.464  36.058 -46.280 1.00 44.28 ? 632 HOH A O   1 
HETATM 2645 O  O   . HOH F 6 .   ? 7.171   16.015 -31.102 1.00 51.42 ? 633 HOH A O   1 
HETATM 2646 O  O   . HOH F 6 .   ? 4.378   32.603 -0.584  1.00 53.02 ? 634 HOH A O   1 
HETATM 2647 O  O   . HOH F 6 .   ? 10.107  20.701 -37.907 1.00 52.06 ? 635 HOH A O   1 
HETATM 2648 O  O   . HOH F 6 .   ? 4.366   35.063 -5.055  1.00 47.47 ? 636 HOH A O   1 
HETATM 2649 O  O   . HOH F 6 .   ? -8.763  42.180 -45.955 1.00 45.51 ? 637 HOH A O   1 
HETATM 2650 O  O   . HOH F 6 .   ? -7.042  18.904 -40.387 1.00 49.99 ? 638 HOH A O   1 
HETATM 2651 O  O   . HOH F 6 .   ? 19.068  25.909 -2.025  1.00 53.65 ? 639 HOH A O   1 
HETATM 2652 O  O   . HOH F 6 .   ? 1.326   32.698 -1.641  1.00 52.64 ? 640 HOH A O   1 
HETATM 2653 O  O   . HOH F 6 .   ? 9.086   18.211 -25.881 1.00 46.86 ? 641 HOH A O   1 
HETATM 2654 O  O   . HOH F 6 .   ? 10.260  55.745 -28.416 1.00 59.52 ? 642 HOH A O   1 
HETATM 2655 O  O   . HOH F 6 .   ? 3.394   34.361 -2.750  1.00 51.19 ? 643 HOH A O   1 
HETATM 2656 O  O   . HOH F 6 .   ? -0.009  18.660 -24.137 1.00 51.88 ? 644 HOH A O   1 
HETATM 2657 O  O   . HOH F 6 .   ? -0.694  19.890 -22.072 1.00 50.98 ? 645 HOH A O   1 
HETATM 2658 O  O   . HOH F 6 .   ? 2.096   22.036 -25.184 1.00 49.24 ? 646 HOH A O   1 
HETATM 2659 O  O   . HOH F 6 .   ? -12.061 38.446 -47.855 1.00 58.62 ? 647 HOH A O   1 
HETATM 2660 O  O   . HOH F 6 .   ? 28.811  20.500 -12.512 1.00 67.44 ? 648 HOH A O   1 
HETATM 2661 O  O   . HOH F 6 .   ? 14.858  19.334 -26.269 1.00 52.96 ? 649 HOH A O   1 
HETATM 2662 O  O   . HOH F 6 .   ? 11.214  20.320 -29.664 1.00 53.93 ? 650 HOH A O   1 
HETATM 2663 O  O   . HOH F 6 .   ? 7.556   8.810  -23.428 1.00 51.23 ? 651 HOH A O   1 
HETATM 2664 O  O   . HOH F 6 .   ? 6.711   7.728  -17.329 1.00 57.00 ? 652 HOH A O   1 
HETATM 2665 O  O   . HOH F 6 .   ? 3.324   56.141 -40.944 1.00 53.83 ? 653 HOH A O   1 
HETATM 2666 O  O   . HOH F 6 .   ? -11.373 27.401 -48.044 1.00 71.41 ? 654 HOH A O   1 
HETATM 2667 O  O   . HOH F 6 .   ? -3.628  35.231 -50.831 1.00 52.33 ? 655 HOH A O   1 
HETATM 2668 O  O   . HOH F 6 .   ? -3.221  38.643 -50.873 1.00 47.49 ? 656 HOH A O   1 
HETATM 2669 O  O   . HOH F 6 .   ? 1.060   16.927 -31.193 1.00 48.15 ? 657 HOH A O   1 
HETATM 2670 O  O   . HOH F 6 .   ? 1.379   18.073 -41.438 1.00 54.77 ? 658 HOH A O   1 
HETATM 2671 O  O   . HOH F 6 .   ? 7.512   48.612 -45.287 1.00 56.31 ? 659 HOH A O   1 
HETATM 2672 O  O   . HOH F 6 .   ? 4.913   6.816  0.550   1.00 61.82 ? 660 HOH A O   1 
HETATM 2673 O  O   . HOH F 6 .   ? 0.259   22.676 -23.728 1.00 48.50 ? 661 HOH A O   1 
HETATM 2674 O  O   . HOH F 6 .   ? -4.597  62.689 -44.402 1.00 51.09 ? 662 HOH A O   1 
HETATM 2675 O  O   . HOH F 6 .   ? -11.430 41.657 -46.244 1.00 53.06 ? 663 HOH A O   1 
HETATM 2676 O  O   . HOH F 6 .   ? -5.959  44.831 -47.141 1.00 43.01 ? 664 HOH A O   1 
HETATM 2677 O  O   . HOH F 6 .   ? -1.873  48.733 -38.393 1.00 45.37 ? 665 HOH A O   1 
HETATM 2678 O  O   . HOH F 6 .   ? -19.097 33.136 -28.710 1.00 44.79 ? 666 HOH A O   1 
HETATM 2679 O  O   . HOH F 6 .   ? -18.111 38.986 -38.676 1.00 51.33 ? 667 HOH A O   1 
HETATM 2680 O  O   . HOH F 6 .   ? 3.936   55.194 -36.105 1.00 51.90 ? 668 HOH A O   1 
HETATM 2681 O  O   . HOH F 6 .   ? -13.000 30.514 -46.312 1.00 57.47 ? 669 HOH A O   1 
HETATM 2682 O  O   . HOH F 6 .   ? 13.624  56.443 -27.968 1.00 67.13 ? 670 HOH A O   1 
HETATM 2683 O  O   . HOH F 6 .   ? 15.503  57.448 -26.579 0.50 64.83 ? 671 HOH A O   1 
HETATM 2684 O  O   . HOH F 6 .   ? -4.166  48.729 -42.847 1.00 56.06 ? 672 HOH A O   1 
HETATM 2685 O  O   . HOH F 6 .   ? -18.804 31.257 -30.282 1.00 41.90 ? 673 HOH A O   1 
HETATM 2686 O  O   A HOH F 6 .   ? 0.528   27.591 -17.529 0.63 29.24 ? 674 HOH A O   1 
HETATM 2687 O  O   B HOH F 6 .   ? -1.068  28.013 -18.382 0.37 31.49 ? 674 HOH A O   1 
HETATM 2688 O  O   . HOH F 6 .   ? -1.527  27.060 -21.712 1.00 37.29 ? 675 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   7   ?   ?   ?   A . n 
A 1 2   GLY 2   8   ?   ?   ?   A . n 
A 1 3   SER 3   9   ?   ?   ?   A . n 
A 1 4   SER 4   10  ?   ?   ?   A . n 
A 1 5   HIS 5   11  ?   ?   ?   A . n 
A 1 6   HIS 6   12  ?   ?   ?   A . n 
A 1 7   HIS 7   13  ?   ?   ?   A . n 
A 1 8   HIS 8   14  ?   ?   ?   A . n 
A 1 9   HIS 9   15  ?   ?   ?   A . n 
A 1 10  HIS 10  16  ?   ?   ?   A . n 
A 1 11  SER 11  17  ?   ?   ?   A . n 
A 1 12  SER 12  18  ?   ?   ?   A . n 
A 1 13  GLY 13  19  ?   ?   ?   A . n 
A 1 14  LEU 14  20  ?   ?   ?   A . n 
A 1 15  VAL 15  21  ?   ?   ?   A . n 
A 1 16  PRO 16  22  ?   ?   ?   A . n 
A 1 17  ARG 17  23  ?   ?   ?   A . n 
A 1 18  GLY 18  24  ?   ?   ?   A . n 
A 1 19  SER 19  25  ?   ?   ?   A . n 
A 1 20  HIS 20  26  26  HIS HIS A . n 
A 1 21  MET 21  27  27  MET MET A . n 
A 1 22  PRO 22  28  28  PRO PRO A . n 
A 1 23  LEU 23  29  29  LEU LEU A . n 
A 1 24  VAL 24  30  30  VAL VAL A . n 
A 1 25  ALA 25  31  31  ALA ALA A . n 
A 1 26  LEU 26  32  32  LEU LEU A . n 
A 1 27  LEU 27  33  33  LEU LEU A . n 
A 1 28  ASP 28  34  34  ASP ASP A . n 
A 1 29  GLY 29  35  35  GLY GLY A . n 
A 1 30  ARG 30  36  36  ARG ARG A . n 
A 1 31  ASP 31  37  37  ASP ASP A . n 
A 1 32  CYS 32  38  38  CYS CYS A . n 
A 1 33  THR 33  39  39  THR THR A . n 
A 1 34  VAL 34  40  40  VAL VAL A . n 
A 1 35  GLU 35  41  41  GLU GLU A . n 
A 1 36  MET 36  42  42  MET MET A . n 
A 1 37  PRO 37  43  43  PRO PRO A . n 
A 1 38  ILE 38  44  44  ILE ILE A . n 
A 1 39  LEU 39  45  45  LEU LEU A . n 
A 1 40  LYS 40  46  46  LYS LYS A . n 
A 1 41  ASP 41  47  47  ASP ASP A . n 
A 1 42  VAL 42  48  48  VAL VAL A . n 
A 1 43  ALA 43  49  49  ALA ALA A . n 
A 1 44  THR 44  50  50  THR THR A . n 
A 1 45  VAL 45  51  51  VAL VAL A . n 
A 1 46  ALA 46  52  52  ALA ALA A . n 
A 1 47  PHE 47  53  53  PHE PHE A . n 
A 1 48  CYS 48  54  54  CYS CYS A . n 
A 1 49  ASP 49  55  55  ASP ASP A . n 
A 1 50  ALA 50  56  56  ALA ALA A . n 
A 1 51  GLN 51  57  57  GLN GLN A . n 
A 1 52  SER 52  58  58  SER SER A . n 
A 1 53  THR 53  59  59  THR THR A . n 
A 1 54  GLN 54  60  60  GLN GLN A . n 
A 1 55  GLU 55  61  61  GLU GLU A . n 
A 1 56  ILE 56  62  62  ILE ILE A . n 
A 1 57  HIS 57  63  63  HIS HIS A . n 
A 1 58  GLU 58  64  64  GLU GLU A . n 
A 1 59  LYS 59  65  65  LYS LYS A . n 
A 1 60  VAL 60  66  66  VAL VAL A . n 
A 1 61  LEU 61  67  67  LEU LEU A . n 
A 1 62  ASN 62  68  68  ASN ASN A . n 
A 1 63  GLU 63  69  69  GLU GLU A . n 
A 1 64  ALA 64  70  70  ALA ALA A . n 
A 1 65  VAL 65  71  71  VAL VAL A . n 
A 1 66  GLY 66  72  72  GLY GLY A . n 
A 1 67  ALA 67  73  73  ALA ALA A . n 
A 1 68  LEU 68  74  74  LEU LEU A . n 
A 1 69  MET 69  75  75  MET MET A . n 
A 1 70  TYR 70  76  76  TYR TYR A . n 
A 1 71  HIS 71  77  77  HIS HIS A . n 
A 1 72  THR 72  78  78  THR THR A . n 
A 1 73  ILE 73  79  79  ILE ILE A . n 
A 1 74  THR 74  80  80  THR THR A . n 
A 1 75  LEU 75  81  81  LEU LEU A . n 
A 1 76  THR 76  82  82  THR THR A . n 
A 1 77  ARG 77  83  83  ARG ARG A . n 
A 1 78  GLU 78  84  84  GLU GLU A . n 
A 1 79  ASP 79  85  85  ASP ASP A . n 
A 1 80  LEU 80  86  86  LEU LEU A . n 
A 1 81  GLU 81  87  87  GLU GLU A . n 
A 1 82  LYS 82  88  88  LYS LYS A . n 
A 1 83  PHE 83  89  89  PHE PHE A . n 
A 1 84  LYS 84  90  90  LYS LYS A . n 
A 1 85  ALA 85  91  91  ALA ALA A . n 
A 1 86  LEU 86  92  92  LEU LEU A . n 
A 1 87  ARG 87  93  93  ARG ARG A . n 
A 1 88  ILE 88  94  94  ILE ILE A . n 
A 1 89  ILE 89  95  95  ILE ILE A . n 
A 1 90  VAL 90  96  96  VAL VAL A . n 
A 1 91  ARG 91  97  97  ARG ARG A . n 
A 1 92  ILE 92  98  98  ILE ILE A . n 
A 1 93  GLY 93  99  99  GLY GLY A . n 
A 1 94  SER 94  100 100 SER SER A . n 
A 1 95  GLY 95  101 101 GLY GLY A . n 
A 1 96  PHE 96  102 102 PHE PHE A . n 
A 1 97  ASP 97  103 103 ASP ASP A . n 
A 1 98  ASN 98  104 104 ASN ASN A . n 
A 1 99  ILE 99  105 105 ILE ILE A . n 
A 1 100 ASP 100 106 106 ASP ASP A . n 
A 1 101 ILE 101 107 107 ILE ILE A . n 
A 1 102 LYS 102 108 108 LYS LYS A . n 
A 1 103 SER 103 109 109 SER SER A . n 
A 1 104 ALA 104 110 110 ALA ALA A . n 
A 1 105 GLY 105 111 111 GLY GLY A . n 
A 1 106 ASP 106 112 112 ASP ASP A . n 
A 1 107 LEU 107 113 113 LEU LEU A . n 
A 1 108 GLY 108 114 114 GLY GLY A . n 
A 1 109 ILE 109 115 115 ILE ILE A . n 
A 1 110 ALA 110 116 116 ALA ALA A . n 
A 1 111 VAL 111 117 117 VAL VAL A . n 
A 1 112 CYS 112 118 118 CYS CYS A . n 
A 1 113 ASN 113 119 119 ASN ASN A . n 
A 1 114 VAL 114 120 120 VAL VAL A . n 
A 1 115 PRO 115 121 121 PRO PRO A . n 
A 1 116 ALA 116 122 122 ALA ALA A . n 
A 1 117 ALA 117 123 123 ALA ALA A . n 
A 1 118 SER 118 124 124 SER SER A . n 
A 1 119 VAL 119 125 125 VAL VAL A . n 
A 1 120 GLU 120 126 126 GLU GLU A . n 
A 1 121 GLU 121 127 127 GLU GLU A . n 
A 1 122 THR 122 128 128 THR THR A . n 
A 1 123 ALA 123 129 129 ALA ALA A . n 
A 1 124 ASP 124 130 130 ASP ASP A . n 
A 1 125 SER 125 131 131 SER SER A . n 
A 1 126 THR 126 132 132 THR THR A . n 
A 1 127 LEU 127 133 133 LEU LEU A . n 
A 1 128 CYS 128 134 134 CYS CYS A . n 
A 1 129 HIS 129 135 135 HIS HIS A . n 
A 1 130 ILE 130 136 136 ILE ILE A . n 
A 1 131 LEU 131 137 137 LEU LEU A . n 
A 1 132 ASN 132 138 138 ASN ASN A . n 
A 1 133 LEU 133 139 139 LEU LEU A . n 
A 1 134 TYR 134 140 140 TYR TYR A . n 
A 1 135 ARG 135 141 141 ARG ARG A . n 
A 1 136 ARG 136 142 142 ARG ARG A . n 
A 1 137 ALA 137 143 143 ALA ALA A . n 
A 1 138 THR 138 144 144 THR THR A . n 
A 1 139 TRP 139 145 145 TRP TRP A . n 
A 1 140 LEU 140 146 146 LEU LEU A . n 
A 1 141 HIS 141 147 147 HIS HIS A . n 
A 1 142 GLN 142 148 148 GLN GLN A . n 
A 1 143 ALA 143 149 149 ALA ALA A . n 
A 1 144 LEU 144 150 150 LEU LEU A . n 
A 1 145 ARG 145 151 151 ARG ARG A . n 
A 1 146 GLU 146 152 152 GLU GLU A . n 
A 1 147 GLY 147 153 153 GLY GLY A . n 
A 1 148 THR 148 154 154 THR THR A . n 
A 1 149 ARG 149 155 155 ARG ARG A . n 
A 1 150 VAL 150 156 156 VAL VAL A . n 
A 1 151 GLN 151 157 157 GLN GLN A . n 
A 1 152 SER 152 158 158 SER SER A . n 
A 1 153 VAL 153 159 159 VAL VAL A . n 
A 1 154 GLU 154 160 160 GLU GLU A . n 
A 1 155 GLN 155 161 161 GLN GLN A . n 
A 1 156 ILE 156 162 162 ILE ILE A . n 
A 1 157 ARG 157 163 163 ARG ARG A . n 
A 1 158 GLU 158 164 164 GLU GLU A . n 
A 1 159 VAL 159 165 165 VAL VAL A . n 
A 1 160 ALA 160 166 166 ALA ALA A . n 
A 1 161 SER 161 167 167 SER SER A . n 
A 1 162 GLY 162 168 168 GLY GLY A . n 
A 1 163 ALA 163 169 169 ALA ALA A . n 
A 1 164 ALA 164 170 170 ALA ALA A . n 
A 1 165 ARG 165 171 171 ARG ARG A . n 
A 1 166 ILE 166 172 172 ILE ILE A . n 
A 1 167 ARG 167 173 173 ARG ARG A . n 
A 1 168 GLY 168 174 174 GLY GLY A . n 
A 1 169 GLU 169 175 175 GLU GLU A . n 
A 1 170 THR 170 176 176 THR THR A . n 
A 1 171 LEU 171 177 177 LEU LEU A . n 
A 1 172 GLY 172 178 178 GLY GLY A . n 
A 1 173 ILE 173 179 179 ILE ILE A . n 
A 1 174 ILE 174 180 180 ILE ILE A . n 
A 1 175 GLY 175 181 181 GLY GLY A . n 
A 1 176 LEU 176 182 182 LEU LEU A . n 
A 1 177 GLY 177 183 183 GLY GLY A . n 
A 1 178 ARG 178 184 184 ARG ARG A . n 
A 1 179 VAL 179 185 185 VAL VAL A . n 
A 1 180 GLY 180 186 186 GLY GLY A . n 
A 1 181 GLN 181 187 187 GLN GLN A . n 
A 1 182 ALA 182 188 188 ALA ALA A . n 
A 1 183 VAL 183 189 189 VAL VAL A . n 
A 1 184 ALA 184 190 190 ALA ALA A . n 
A 1 185 LEU 185 191 191 LEU LEU A . n 
A 1 186 ARG 186 192 192 ARG ARG A . n 
A 1 187 ALA 187 193 193 ALA ALA A . n 
A 1 188 LYS 188 194 194 LYS LYS A . n 
A 1 189 ALA 189 195 195 ALA ALA A . n 
A 1 190 PHE 190 196 196 PHE PHE A . n 
A 1 191 GLY 191 197 197 GLY GLY A . n 
A 1 192 PHE 192 198 198 PHE PHE A . n 
A 1 193 ASN 193 199 199 ASN ASN A . n 
A 1 194 VAL 194 200 200 VAL VAL A . n 
A 1 195 LEU 195 201 201 LEU LEU A . n 
A 1 196 PHE 196 202 202 PHE PHE A . n 
A 1 197 TYR 197 203 203 TYR TYR A . n 
A 1 198 ASP 198 204 204 ASP ASP A . n 
A 1 199 PRO 199 205 205 PRO PRO A . n 
A 1 200 TYR 200 206 206 TYR TYR A . n 
A 1 201 LEU 201 207 207 LEU LEU A . n 
A 1 202 SER 202 208 208 SER SER A . n 
A 1 203 ASP 203 209 209 ASP ASP A . n 
A 1 204 GLY 204 210 210 GLY GLY A . n 
A 1 205 VAL 205 211 211 VAL VAL A . n 
A 1 206 GLU 206 212 212 GLU GLU A . n 
A 1 207 ARG 207 213 213 ARG ARG A . n 
A 1 208 ALA 208 214 214 ALA ALA A . n 
A 1 209 LEU 209 215 215 LEU LEU A . n 
A 1 210 GLY 210 216 216 GLY GLY A . n 
A 1 211 LEU 211 217 217 LEU LEU A . n 
A 1 212 GLN 212 218 218 GLN GLN A . n 
A 1 213 ARG 213 219 219 ARG ARG A . n 
A 1 214 VAL 214 220 220 VAL VAL A . n 
A 1 215 SER 215 221 221 SER SER A . n 
A 1 216 THR 216 222 222 THR THR A . n 
A 1 217 LEU 217 223 223 LEU LEU A . n 
A 1 218 GLN 218 224 224 GLN GLN A . n 
A 1 219 ASP 219 225 225 ASP ASP A . n 
A 1 220 LEU 220 226 226 LEU LEU A . n 
A 1 221 LEU 221 227 227 LEU LEU A . n 
A 1 222 PHE 222 228 228 PHE PHE A . n 
A 1 223 HIS 223 229 229 HIS HIS A . n 
A 1 224 SER 224 230 230 SER SER A . n 
A 1 225 ASP 225 231 231 ASP ASP A . n 
A 1 226 CYS 226 232 232 CYS CYS A . n 
A 1 227 VAL 227 233 233 VAL VAL A . n 
A 1 228 THR 228 234 234 THR THR A . n 
A 1 229 LEU 229 235 235 LEU LEU A . n 
A 1 230 HIS 230 236 236 HIS HIS A . n 
A 1 231 CYS 231 237 237 CYS CYS A . n 
A 1 232 GLY 232 238 238 GLY GLY A . n 
A 1 233 LEU 233 239 239 LEU LEU A . n 
A 1 234 ASN 234 240 240 ASN ASN A . n 
A 1 235 GLU 235 241 241 GLU GLU A . n 
A 1 236 HIS 236 242 242 HIS HIS A . n 
A 1 237 ASN 237 243 243 ASN ASN A . n 
A 1 238 HIS 238 244 244 HIS HIS A . n 
A 1 239 HIS 239 245 245 HIS HIS A . n 
A 1 240 LEU 240 246 246 LEU LEU A . n 
A 1 241 ILE 241 247 247 ILE ILE A . n 
A 1 242 ASN 242 248 248 ASN ASN A . n 
A 1 243 ASP 243 249 249 ASP ASP A . n 
A 1 244 PHE 244 250 250 PHE PHE A . n 
A 1 245 THR 245 251 251 THR THR A . n 
A 1 246 VAL 246 252 252 VAL VAL A . n 
A 1 247 LYS 247 253 253 LYS LYS A . n 
A 1 248 GLN 248 254 254 GLN GLN A . n 
A 1 249 MET 249 255 255 MET MET A . n 
A 1 250 ARG 250 256 256 ARG ARG A . n 
A 1 251 GLN 251 257 257 GLN GLN A . n 
A 1 252 GLY 252 258 258 GLY GLY A . n 
A 1 253 ALA 253 259 259 ALA ALA A . n 
A 1 254 PHE 254 260 260 PHE PHE A . n 
A 1 255 LEU 255 261 261 LEU LEU A . n 
A 1 256 VAL 256 262 262 VAL VAL A . n 
A 1 257 ASN 257 263 263 ASN ASN A . n 
A 1 258 THR 258 264 264 THR THR A . n 
A 1 259 ALA 259 265 265 ALA ALA A . n 
A 1 260 ARG 260 266 266 ARG ARG A . n 
A 1 261 GLY 261 267 267 GLY GLY A . n 
A 1 262 GLY 262 268 268 GLY GLY A . n 
A 1 263 LEU 263 269 269 LEU LEU A . n 
A 1 264 VAL 264 270 270 VAL VAL A . n 
A 1 265 ASP 265 271 271 ASP ASP A . n 
A 1 266 GLU 266 272 272 GLU GLU A . n 
A 1 267 LYS 267 273 273 LYS LYS A . n 
A 1 268 ALA 268 274 274 ALA ALA A . n 
A 1 269 LEU 269 275 275 LEU LEU A . n 
A 1 270 ALA 270 276 276 ALA ALA A . n 
A 1 271 GLN 271 277 277 GLN GLN A . n 
A 1 272 ALA 272 278 278 ALA ALA A . n 
A 1 273 LEU 273 279 279 LEU LEU A . n 
A 1 274 LYS 274 280 280 LYS LYS A . n 
A 1 275 GLU 275 281 281 GLU GLU A . n 
A 1 276 GLY 276 282 282 GLY GLY A . n 
A 1 277 ARG 277 283 283 ARG ARG A . n 
A 1 278 ILE 278 284 284 ILE ILE A . n 
A 1 279 ARG 279 285 285 ARG ARG A . n 
A 1 280 GLY 280 286 286 GLY GLY A . n 
A 1 281 ALA 281 287 287 ALA ALA A . n 
A 1 282 ALA 282 288 288 ALA ALA A . n 
A 1 283 LEU 283 289 289 LEU LEU A . n 
A 1 284 ASP 284 290 290 ASP ASP A . n 
A 1 285 VAL 285 291 291 VAL VAL A . n 
A 1 286 HIS 286 292 292 HIS HIS A . n 
A 1 287 GLU 287 293 293 GLU GLU A . n 
A 1 288 SER 288 294 294 SER SER A . n 
A 1 289 GLU 289 295 295 GLU GLU A . n 
A 1 290 PRO 290 296 296 PRO PRO A . n 
A 1 291 PHE 291 297 297 PHE PHE A . n 
A 1 292 SER 292 298 298 SER SER A . n 
A 1 293 PHE 293 299 299 PHE PHE A . n 
A 1 294 SER 294 300 300 SER SER A . n 
A 1 295 GLN 295 301 301 GLN GLN A . n 
A 1 296 GLY 296 302 302 GLY GLY A . n 
A 1 297 PRO 297 303 303 PRO PRO A . n 
A 1 298 LEU 298 304 304 LEU LEU A . n 
A 1 299 LYS 299 305 305 LYS LYS A . n 
A 1 300 ASP 300 306 306 ASP ASP A . n 
A 1 301 ALA 301 307 307 ALA ALA A . n 
A 1 302 PRO 302 308 308 PRO PRO A . n 
A 1 303 ASN 303 309 309 ASN ASN A . n 
A 1 304 LEU 304 310 310 LEU LEU A . n 
A 1 305 ILE 305 311 311 ILE ILE A . n 
A 1 306 CYS 306 312 312 CYS CYS A . n 
A 1 307 THR 307 313 313 THR THR A . n 
A 1 308 PRO 308 314 314 PRO PRO A . n 
A 1 309 HIS 309 315 315 HIS HIS A . n 
A 1 310 ALA 310 316 316 ALA ALA A . n 
A 1 311 ALA 311 317 317 ALA ALA A . n 
A 1 312 TRP 312 318 318 TRP TRP A . n 
A 1 313 TYR 313 319 319 TYR TYR A . n 
A 1 314 SER 314 320 320 SER SER A . n 
A 1 315 GLU 315 321 321 GLU GLU A . n 
A 1 316 GLN 316 322 322 GLN GLN A . n 
A 1 317 ALA 317 323 323 ALA ALA A . n 
A 1 318 SER 318 324 324 SER SER A . n 
A 1 319 ILE 319 325 325 ILE ILE A . n 
A 1 320 GLU 320 326 326 GLU GLU A . n 
A 1 321 MET 321 327 327 MET MET A . n 
A 1 322 ARG 322 328 328 ARG ARG A . n 
A 1 323 GLU 323 329 329 GLU GLU A . n 
A 1 324 GLU 324 330 330 GLU GLU A . n 
A 1 325 ALA 325 331 331 ALA ALA A . n 
A 1 326 ALA 326 332 332 ALA ALA A . n 
A 1 327 ARG 327 333 333 ARG ARG A . n 
A 1 328 GLU 328 334 334 GLU GLU A . n 
A 1 329 ILE 329 335 335 ILE ILE A . n 
A 1 330 ARG 330 336 336 ARG ARG A . n 
A 1 331 ARG 331 337 337 ARG ARG A . n 
A 1 332 ALA 332 338 338 ALA ALA A . n 
A 1 333 ILE 333 339 339 ILE ILE A . n 
A 1 334 THR 334 340 340 THR THR A . n 
A 1 335 GLY 335 341 341 GLY GLY A . n 
A 1 336 ARG 336 342 342 ARG ARG A . n 
A 1 337 ILE 337 343 343 ILE ILE A . n 
A 1 338 PRO 338 344 344 PRO PRO A . n 
A 1 339 ASP 339 345 345 ASP ASP A . n 
A 1 340 SER 340 346 346 SER SER A . n 
A 1 341 LEU 341 347 347 LEU LEU A . n 
A 1 342 LYS 342 348 348 LYS LYS A . n 
A 1 343 ASN 343 349 349 ASN ASN A . n 
A 1 344 CYS 344 350 350 CYS CYS A . n 
A 1 345 VAL 345 351 351 VAL VAL A . n 
A 1 346 ASN 346 352 352 ASN ASN A . n 
A 1 347 LYS 347 353 353 LYS LYS A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 NAI 1   401 1   NAI NAI A . 
C 3 3CR 1   402 1   3CR H1P A . 
D 4 CA  1   403 1   CA  CA  A . 
E 5 FMT 1   404 2   FMT FMT A . 
F 6 HOH 1   501 61  HOH HOH A . 
F 6 HOH 2   502 67  HOH HOH A . 
F 6 HOH 3   503 8   HOH HOH A . 
F 6 HOH 4   504 46  HOH HOH A . 
F 6 HOH 5   505 9   HOH HOH A . 
F 6 HOH 6   506 5   HOH HOH A . 
F 6 HOH 7   507 165 HOH HOH A . 
F 6 HOH 8   508 73  HOH HOH A . 
F 6 HOH 9   509 44  HOH HOH A . 
F 6 HOH 10  510 17  HOH HOH A . 
F 6 HOH 11  511 36  HOH HOH A . 
F 6 HOH 12  512 4   HOH HOH A . 
F 6 HOH 13  513 82  HOH HOH A . 
F 6 HOH 14  514 115 HOH HOH A . 
F 6 HOH 15  515 25  HOH HOH A . 
F 6 HOH 16  516 111 HOH HOH A . 
F 6 HOH 17  517 89  HOH HOH A . 
F 6 HOH 18  518 66  HOH HOH A . 
F 6 HOH 19  519 59  HOH HOH A . 
F 6 HOH 20  520 51  HOH HOH A . 
F 6 HOH 21  521 56  HOH HOH A . 
F 6 HOH 22  522 69  HOH HOH A . 
F 6 HOH 23  523 28  HOH HOH A . 
F 6 HOH 24  524 123 HOH HOH A . 
F 6 HOH 25  525 105 HOH HOH A . 
F 6 HOH 26  526 110 HOH HOH A . 
F 6 HOH 27  527 27  HOH HOH A . 
F 6 HOH 28  528 70  HOH HOH A . 
F 6 HOH 29  529 107 HOH HOH A . 
F 6 HOH 30  530 43  HOH HOH A . 
F 6 HOH 31  531 50  HOH HOH A . 
F 6 HOH 32  532 126 HOH HOH A . 
F 6 HOH 33  533 18  HOH HOH A . 
F 6 HOH 34  534 122 HOH HOH A . 
F 6 HOH 35  535 23  HOH HOH A . 
F 6 HOH 36  536 172 HOH HOH A . 
F 6 HOH 37  537 138 HOH HOH A . 
F 6 HOH 38  538 142 HOH HOH A . 
F 6 HOH 39  539 109 HOH HOH A . 
F 6 HOH 40  540 39  HOH HOH A . 
F 6 HOH 41  541 137 HOH HOH A . 
F 6 HOH 42  542 134 HOH HOH A . 
F 6 HOH 43  543 1   HOH HOH A . 
F 6 HOH 44  544 29  HOH HOH A . 
F 6 HOH 45  545 103 HOH HOH A . 
F 6 HOH 46  546 33  HOH HOH A . 
F 6 HOH 47  547 52  HOH HOH A . 
F 6 HOH 48  548 140 HOH HOH A . 
F 6 HOH 49  549 162 HOH HOH A . 
F 6 HOH 50  550 48  HOH HOH A . 
F 6 HOH 51  551 124 HOH HOH A . 
F 6 HOH 52  552 148 HOH HOH A . 
F 6 HOH 53  553 125 HOH HOH A . 
F 6 HOH 54  554 106 HOH HOH A . 
F 6 HOH 55  555 171 HOH HOH A . 
F 6 HOH 56  556 118 HOH HOH A . 
F 6 HOH 57  557 154 HOH HOH A . 
F 6 HOH 58  558 166 HOH HOH A . 
F 6 HOH 59  559 150 HOH HOH A . 
F 6 HOH 60  560 98  HOH HOH A . 
F 6 HOH 61  561 92  HOH HOH A . 
F 6 HOH 62  562 87  HOH HOH A . 
F 6 HOH 63  563 167 HOH HOH A . 
F 6 HOH 64  564 19  HOH HOH A . 
F 6 HOH 65  565 35  HOH HOH A . 
F 6 HOH 66  566 160 HOH HOH A . 
F 6 HOH 67  567 96  HOH HOH A . 
F 6 HOH 68  568 129 HOH HOH A . 
F 6 HOH 69  569 80  HOH HOH A . 
F 6 HOH 70  570 130 HOH HOH A . 
F 6 HOH 71  571 152 HOH HOH A . 
F 6 HOH 72  572 104 HOH HOH A . 
F 6 HOH 73  573 161 HOH HOH A . 
F 6 HOH 74  574 90  HOH HOH A . 
F 6 HOH 75  575 2   HOH HOH A . 
F 6 HOH 76  576 3   HOH HOH A . 
F 6 HOH 77  577 6   HOH HOH A . 
F 6 HOH 78  578 7   HOH HOH A . 
F 6 HOH 79  579 10  HOH HOH A . 
F 6 HOH 80  580 11  HOH HOH A . 
F 6 HOH 81  581 12  HOH HOH A . 
F 6 HOH 82  582 13  HOH HOH A . 
F 6 HOH 83  583 14  HOH HOH A . 
F 6 HOH 84  584 15  HOH HOH A . 
F 6 HOH 85  585 16  HOH HOH A . 
F 6 HOH 86  586 20  HOH HOH A . 
F 6 HOH 87  587 21  HOH HOH A . 
F 6 HOH 88  588 22  HOH HOH A . 
F 6 HOH 89  589 24  HOH HOH A . 
F 6 HOH 90  590 26  HOH HOH A . 
F 6 HOH 91  591 30  HOH HOH A . 
F 6 HOH 92  592 31  HOH HOH A . 
F 6 HOH 93  593 32  HOH HOH A . 
F 6 HOH 94  594 34  HOH HOH A . 
F 6 HOH 95  595 37  HOH HOH A . 
F 6 HOH 96  596 38  HOH HOH A . 
F 6 HOH 97  597 40  HOH HOH A . 
F 6 HOH 98  598 41  HOH HOH A . 
F 6 HOH 99  599 42  HOH HOH A . 
F 6 HOH 100 600 45  HOH HOH A . 
F 6 HOH 101 601 47  HOH HOH A . 
F 6 HOH 102 602 49  HOH HOH A . 
F 6 HOH 103 603 53  HOH HOH A . 
F 6 HOH 104 604 54  HOH HOH A . 
F 6 HOH 105 605 55  HOH HOH A . 
F 6 HOH 106 606 57  HOH HOH A . 
F 6 HOH 107 607 58  HOH HOH A . 
F 6 HOH 108 608 60  HOH HOH A . 
F 6 HOH 109 609 62  HOH HOH A . 
F 6 HOH 110 610 63  HOH HOH A . 
F 6 HOH 111 611 64  HOH HOH A . 
F 6 HOH 112 612 65  HOH HOH A . 
F 6 HOH 113 613 68  HOH HOH A . 
F 6 HOH 114 614 71  HOH HOH A . 
F 6 HOH 115 615 72  HOH HOH A . 
F 6 HOH 116 616 74  HOH HOH A . 
F 6 HOH 117 617 75  HOH HOH A . 
F 6 HOH 118 618 76  HOH HOH A . 
F 6 HOH 119 619 77  HOH HOH A . 
F 6 HOH 120 620 78  HOH HOH A . 
F 6 HOH 121 621 79  HOH HOH A . 
F 6 HOH 122 622 81  HOH HOH A . 
F 6 HOH 123 623 83  HOH HOH A . 
F 6 HOH 124 624 84  HOH HOH A . 
F 6 HOH 125 625 85  HOH HOH A . 
F 6 HOH 126 626 86  HOH HOH A . 
F 6 HOH 127 627 88  HOH HOH A . 
F 6 HOH 128 628 91  HOH HOH A . 
F 6 HOH 129 629 93  HOH HOH A . 
F 6 HOH 130 630 94  HOH HOH A . 
F 6 HOH 131 631 95  HOH HOH A . 
F 6 HOH 132 632 97  HOH HOH A . 
F 6 HOH 133 633 99  HOH HOH A . 
F 6 HOH 134 634 100 HOH HOH A . 
F 6 HOH 135 635 101 HOH HOH A . 
F 6 HOH 136 636 102 HOH HOH A . 
F 6 HOH 137 637 108 HOH HOH A . 
F 6 HOH 138 638 112 HOH HOH A . 
F 6 HOH 139 639 113 HOH HOH A . 
F 6 HOH 140 640 114 HOH HOH A . 
F 6 HOH 141 641 116 HOH HOH A . 
F 6 HOH 142 642 117 HOH HOH A . 
F 6 HOH 143 643 119 HOH HOH A . 
F 6 HOH 144 644 120 HOH HOH A . 
F 6 HOH 145 645 121 HOH HOH A . 
F 6 HOH 146 646 127 HOH HOH A . 
F 6 HOH 147 647 128 HOH HOH A . 
F 6 HOH 148 648 131 HOH HOH A . 
F 6 HOH 149 649 132 HOH HOH A . 
F 6 HOH 150 650 133 HOH HOH A . 
F 6 HOH 151 651 135 HOH HOH A . 
F 6 HOH 152 652 136 HOH HOH A . 
F 6 HOH 153 653 139 HOH HOH A . 
F 6 HOH 154 654 141 HOH HOH A . 
F 6 HOH 155 655 143 HOH HOH A . 
F 6 HOH 156 656 144 HOH HOH A . 
F 6 HOH 157 657 145 HOH HOH A . 
F 6 HOH 158 658 146 HOH HOH A . 
F 6 HOH 159 659 147 HOH HOH A . 
F 6 HOH 160 660 149 HOH HOH A . 
F 6 HOH 161 661 151 HOH HOH A . 
F 6 HOH 162 662 153 HOH HOH A . 
F 6 HOH 163 663 155 HOH HOH A . 
F 6 HOH 164 664 156 HOH HOH A . 
F 6 HOH 165 665 157 HOH HOH A . 
F 6 HOH 166 666 158 HOH HOH A . 
F 6 HOH 167 667 159 HOH HOH A . 
F 6 HOH 168 668 163 HOH HOH A . 
F 6 HOH 169 669 164 HOH HOH A . 
F 6 HOH 170 670 168 HOH HOH A . 
F 6 HOH 171 671 169 HOH HOH A . 
F 6 HOH 172 672 170 HOH HOH A . 
F 6 HOH 173 673 173 HOH HOH A . 
F 6 HOH 174 674 174 HOH HOH A . 
F 6 HOH 175 675 175 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 8510  ? 
1 MORE         -64   ? 
1 'SSA (A^2)'  24340 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555  x,y,z          1.0000000000 0.0000000000 0.0000000000 0.0000000000   0.0000000000 
1.0000000000  0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 12_564 x,x-y+1,-z-1/3 0.5000000000 0.8660254038 0.0000000000 -42.0000000000 0.8660254038 
-0.5000000000 0.0000000000 72.7461339179 0.0000000000 0.0000000000 -1.0000000000 -53.1573333333 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A HOH 539 ? F HOH . 
2 1 A HOH 540 ? F HOH . 
3 1 A HOH 571 ? F HOH . 
4 1 A HOH 572 ? F HOH . 
5 1 A HOH 573 ? F HOH . 
6 1 A HOH 574 ? F HOH . 
7 1 A HOH 671 ? F HOH . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O2 ? E FMT . ? A FMT 404 ? 1_555 CA ? D CA . ? A CA 403 ? 1_555 O  ? F HOH . ? A HOH 590 ? 1_555 91.3  ? 
2  O2 ? E FMT . ? A FMT 404 ? 1_555 CA ? D CA . ? A CA 403 ? 1_555 O1 ? E FMT . ? A FMT 404 ? 1_555 47.5  ? 
3  O  ? F HOH . ? A HOH 590 ? 1_555 CA ? D CA . ? A CA 403 ? 1_555 O1 ? E FMT . ? A FMT 404 ? 1_555 93.6  ? 
4  O2 ? E FMT . ? A FMT 404 ? 1_555 CA ? D CA . ? A CA 403 ? 1_555 O  ? F HOH . ? A HOH 581 ? 1_555 124.9 ? 
5  O  ? F HOH . ? A HOH 590 ? 1_555 CA ? D CA . ? A CA 403 ? 1_555 O  ? F HOH . ? A HOH 581 ? 1_555 73.4  ? 
6  O1 ? E FMT . ? A FMT 404 ? 1_555 CA ? D CA . ? A CA 403 ? 1_555 O  ? F HOH . ? A HOH 581 ? 1_555 80.2  ? 
7  O2 ? E FMT . ? A FMT 404 ? 1_555 CA ? D CA . ? A CA 403 ? 1_555 O  ? F HOH . ? A HOH 620 ? 1_555 83.6  ? 
8  O  ? F HOH . ? A HOH 590 ? 1_555 CA ? D CA . ? A CA 403 ? 1_555 O  ? F HOH . ? A HOH 620 ? 1_555 174.9 ? 
9  O1 ? E FMT . ? A FMT 404 ? 1_555 CA ? D CA . ? A CA 403 ? 1_555 O  ? F HOH . ? A HOH 620 ? 1_555 83.5  ? 
10 O  ? F HOH . ? A HOH 581 ? 1_555 CA ? D CA . ? A CA 403 ? 1_555 O  ? F HOH . ? A HOH 620 ? 1_555 110.0 ? 
11 O2 ? E FMT . ? A FMT 404 ? 1_555 CA ? D CA . ? A CA 403 ? 1_555 O  ? F HOH . ? A HOH 626 ? 1_555 79.5  ? 
12 O  ? F HOH . ? A HOH 590 ? 1_555 CA ? D CA . ? A CA 403 ? 1_555 O  ? F HOH . ? A HOH 626 ? 1_555 98.2  ? 
13 O1 ? E FMT . ? A FMT 404 ? 1_555 CA ? D CA . ? A CA 403 ? 1_555 O  ? F HOH . ? A HOH 626 ? 1_555 125.9 ? 
14 O  ? F HOH . ? A HOH 581 ? 1_555 CA ? D CA . ? A CA 403 ? 1_555 O  ? F HOH . ? A HOH 626 ? 1_555 153.6 ? 
15 O  ? F HOH . ? A HOH 620 ? 1_555 CA ? D CA . ? A CA 403 ? 1_555 O  ? F HOH . ? A HOH 626 ? 1_555 80.3  ? 
16 O2 ? E FMT . ? A FMT 404 ? 1_555 CA ? D CA . ? A CA 403 ? 1_555 O  ? F HOH . ? A HOH 664 ? 1_555 163.0 ? 
17 O  ? F HOH . ? A HOH 590 ? 1_555 CA ? D CA . ? A CA 403 ? 1_555 O  ? F HOH . ? A HOH 664 ? 1_555 96.3  ? 
18 O1 ? E FMT . ? A FMT 404 ? 1_555 CA ? D CA . ? A CA 403 ? 1_555 O  ? F HOH . ? A HOH 664 ? 1_555 146.2 ? 
19 O  ? F HOH . ? A HOH 581 ? 1_555 CA ? D CA . ? A CA 403 ? 1_555 O  ? F HOH . ? A HOH 664 ? 1_555 72.0  ? 
20 O  ? F HOH . ? A HOH 620 ? 1_555 CA ? D CA . ? A CA 403 ? 1_555 O  ? F HOH . ? A HOH 664 ? 1_555 88.4  ? 
21 O  ? F HOH . ? A HOH 626 ? 1_555 CA ? D CA . ? A CA 403 ? 1_555 O  ? F HOH . ? A HOH 664 ? 1_555 84.4  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2015-02-11 
2 'Structure model' 1 1 2015-04-29 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
_software.citation_id            ? 
_software.classification         refinement 
_software.compiler_name          ? 
_software.compiler_version       ? 
_software.contact_author         ? 
_software.contact_author_email   ? 
_software.date                   ? 
_software.description            ? 
_software.dependencies           ? 
_software.hardware               ? 
_software.language               ? 
_software.location               ? 
_software.mods                   ? 
_software.name                   PHENIX 
_software.os                     ? 
_software.os_version             ? 
_software.type                   ? 
_software.version                '(phenix.refine: 1.8.1_1168)' 
_software.pdbx_ordinal           1 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    HOH 
_pdbx_validate_symm_contact.auth_seq_id_1     525 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     529 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   4_565 
_pdbx_validate_symm_contact.dist              2.16 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 34  ? ? -103.19 53.66   
2 1 ASP A 55  ? ? 39.48   51.23   
3 1 TYR A 76  ? ? -91.19  -140.39 
4 1 LEU A 182 ? ? -103.21 63.01   
5 1 HIS A 236 ? ? -146.84 30.96   
6 1 ALA A 265 ? ? -99.69  -89.27  
# 
_pdbx_distant_solvent_atoms.id                                1 
_pdbx_distant_solvent_atoms.PDB_model_num                     1 
_pdbx_distant_solvent_atoms.auth_atom_id                      O 
_pdbx_distant_solvent_atoms.label_alt_id                      ? 
_pdbx_distant_solvent_atoms.auth_asym_id                      A 
_pdbx_distant_solvent_atoms.auth_comp_id                      HOH 
_pdbx_distant_solvent_atoms.auth_seq_id                       671 
_pdbx_distant_solvent_atoms.PDB_ins_code                      ? 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance   6.98 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance          . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A HIS 26  ? CG  ? A HIS 20  CG  
2  1 Y 1 A HIS 26  ? ND1 ? A HIS 20  ND1 
3  1 Y 1 A HIS 26  ? CD2 ? A HIS 20  CD2 
4  1 Y 1 A HIS 26  ? CE1 ? A HIS 20  CE1 
5  1 Y 1 A HIS 26  ? NE2 ? A HIS 20  NE2 
6  1 Y 1 A ARG 36  ? CG  ? A ARG 30  CG  
7  1 Y 1 A ARG 36  ? CD  ? A ARG 30  CD  
8  1 Y 1 A ARG 36  ? NE  ? A ARG 30  NE  
9  1 Y 1 A ARG 36  ? CZ  ? A ARG 30  CZ  
10 1 Y 1 A ARG 36  ? NH1 ? A ARG 30  NH1 
11 1 Y 1 A ARG 36  ? NH2 ? A ARG 30  NH2 
12 1 Y 1 A GLN 57  ? CG  ? A GLN 51  CG  
13 1 Y 1 A GLN 57  ? CD  ? A GLN 51  CD  
14 1 Y 1 A GLN 57  ? OE1 ? A GLN 51  OE1 
15 1 Y 1 A GLN 57  ? NE2 ? A GLN 51  NE2 
16 1 Y 1 A GLN 60  ? CG  ? A GLN 54  CG  
17 1 Y 1 A GLN 60  ? CD  ? A GLN 54  CD  
18 1 Y 1 A GLN 60  ? OE1 ? A GLN 54  OE1 
19 1 Y 1 A GLN 60  ? NE2 ? A GLN 54  NE2 
20 1 Y 1 A HIS 63  ? CG  ? A HIS 57  CG  
21 1 Y 1 A HIS 63  ? ND1 ? A HIS 57  ND1 
22 1 Y 1 A HIS 63  ? CD2 ? A HIS 57  CD2 
23 1 Y 1 A HIS 63  ? CE1 ? A HIS 57  CE1 
24 1 Y 1 A HIS 63  ? NE2 ? A HIS 57  NE2 
25 1 Y 1 A GLU 64  ? CG  ? A GLU 58  CG  
26 1 Y 1 A GLU 64  ? CD  ? A GLU 58  CD  
27 1 Y 1 A GLU 64  ? OE1 ? A GLU 58  OE1 
28 1 Y 1 A GLU 64  ? OE2 ? A GLU 58  OE2 
29 1 Y 1 A GLU 84  ? CG  ? A GLU 78  CG  
30 1 Y 1 A GLU 84  ? CD  ? A GLU 78  CD  
31 1 Y 1 A GLU 84  ? OE1 ? A GLU 78  OE1 
32 1 Y 1 A GLU 84  ? OE2 ? A GLU 78  OE2 
33 1 Y 1 A LYS 90  ? CG  ? A LYS 84  CG  
34 1 Y 1 A LYS 90  ? CD  ? A LYS 84  CD  
35 1 Y 1 A LYS 90  ? CE  ? A LYS 84  CE  
36 1 Y 1 A LYS 90  ? NZ  ? A LYS 84  NZ  
37 1 Y 1 A LYS 108 ? CG  ? A LYS 102 CG  
38 1 Y 1 A LYS 108 ? CD  ? A LYS 102 CD  
39 1 Y 1 A LYS 108 ? CE  ? A LYS 102 CE  
40 1 Y 1 A LYS 108 ? NZ  ? A LYS 102 NZ  
41 1 Y 1 A ARG 155 ? CG  ? A ARG 149 CG  
42 1 Y 1 A ARG 155 ? CD  ? A ARG 149 CD  
43 1 Y 1 A ARG 155 ? NE  ? A ARG 149 NE  
44 1 Y 1 A ARG 155 ? CZ  ? A ARG 149 CZ  
45 1 Y 1 A ARG 155 ? NH1 ? A ARG 149 NH1 
46 1 Y 1 A ARG 155 ? NH2 ? A ARG 149 NH2 
47 1 Y 1 A GLU 160 ? CG  ? A GLU 154 CG  
48 1 Y 1 A GLU 160 ? CD  ? A GLU 154 CD  
49 1 Y 1 A GLU 160 ? OE1 ? A GLU 154 OE1 
50 1 Y 1 A GLU 160 ? OE2 ? A GLU 154 OE2 
51 1 Y 1 A GLU 164 ? CG  ? A GLU 158 CG  
52 1 Y 1 A GLU 164 ? CD  ? A GLU 158 CD  
53 1 Y 1 A GLU 164 ? OE1 ? A GLU 158 OE1 
54 1 Y 1 A GLU 164 ? OE2 ? A GLU 158 OE2 
55 1 Y 1 A GLU 241 ? CG  ? A GLU 235 CG  
56 1 Y 1 A GLU 241 ? CD  ? A GLU 235 CD  
57 1 Y 1 A GLU 241 ? OE1 ? A GLU 235 OE1 
58 1 Y 1 A GLU 241 ? OE2 ? A GLU 235 OE2 
59 1 Y 1 A LYS 253 ? CG  ? A LYS 247 CG  
60 1 Y 1 A LYS 253 ? CD  ? A LYS 247 CD  
61 1 Y 1 A LYS 253 ? CE  ? A LYS 247 CE  
62 1 Y 1 A LYS 253 ? NZ  ? A LYS 247 NZ  
63 1 Y 1 A GLN 277 ? CD  ? A GLN 271 CD  
64 1 Y 1 A GLN 277 ? OE1 ? A GLN 271 OE1 
65 1 Y 1 A GLN 277 ? NE2 ? A GLN 271 NE2 
66 1 Y 1 A ARG 283 ? CG  ? A ARG 277 CG  
67 1 Y 1 A ARG 283 ? CD  ? A ARG 277 CD  
68 1 Y 1 A ARG 283 ? NE  ? A ARG 277 NE  
69 1 Y 1 A ARG 283 ? CZ  ? A ARG 277 CZ  
70 1 Y 1 A ARG 283 ? NH1 ? A ARG 277 NH1 
71 1 Y 1 A ARG 283 ? NH2 ? A ARG 277 NH2 
72 1 Y 1 A GLN 301 ? CG  ? A GLN 295 CG  
73 1 Y 1 A GLN 301 ? CD  ? A GLN 295 CD  
74 1 Y 1 A GLN 301 ? OE1 ? A GLN 295 OE1 
75 1 Y 1 A GLN 301 ? NE2 ? A GLN 295 NE2 
76 1 Y 1 A ASP 306 ? CG  ? A ASP 300 CG  
77 1 Y 1 A ASP 306 ? OD1 ? A ASP 300 OD1 
78 1 Y 1 A ASP 306 ? OD2 ? A ASP 300 OD2 
79 1 Y 1 A ARG 342 ? CG  ? A ARG 336 CG  
80 1 Y 1 A ARG 342 ? CD  ? A ARG 336 CD  
81 1 Y 1 A ARG 342 ? NE  ? A ARG 336 NE  
82 1 Y 1 A ARG 342 ? CZ  ? A ARG 336 CZ  
83 1 Y 1 A ARG 342 ? NH1 ? A ARG 336 NH1 
84 1 Y 1 A ARG 342 ? NH2 ? A ARG 336 NH2 
85 1 Y 1 A LYS 348 ? CD  ? A LYS 342 CD  
86 1 Y 1 A LYS 348 ? CE  ? A LYS 342 CE  
87 1 Y 1 A LYS 348 ? NZ  ? A LYS 342 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 7  ? A MET 1  
2  1 Y 1 A GLY 8  ? A GLY 2  
3  1 Y 1 A SER 9  ? A SER 3  
4  1 Y 1 A SER 10 ? A SER 4  
5  1 Y 1 A HIS 11 ? A HIS 5  
6  1 Y 1 A HIS 12 ? A HIS 6  
7  1 Y 1 A HIS 13 ? A HIS 7  
8  1 Y 1 A HIS 14 ? A HIS 8  
9  1 Y 1 A HIS 15 ? A HIS 9  
10 1 Y 1 A HIS 16 ? A HIS 10 
11 1 Y 1 A SER 17 ? A SER 11 
12 1 Y 1 A SER 18 ? A SER 12 
13 1 Y 1 A GLY 19 ? A GLY 13 
14 1 Y 1 A LEU 20 ? A LEU 14 
15 1 Y 1 A VAL 21 ? A VAL 15 
16 1 Y 1 A PRO 22 ? A PRO 16 
17 1 Y 1 A ARG 23 ? A ARG 17 
18 1 Y 1 A GLY 24 ? A GLY 18 
19 1 Y 1 A SER 25 ? A SER 19 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '1,4-DIHYDRONICOTINAMIDE ADENINE DINUCLEOTIDE' NAI 
3 '(2E)-2-(hydroxyimino)-3-phenylpropanoic acid' 3CR 
4 'CALCIUM ION'                                  CA  
5 'FORMIC ACID'                                  FMT 
6 water                                          HOH 
#