data_4U6R
# 
_entry.id   4U6R 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4U6R         
WWPDB D_1000202894 
# 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.db_id          4U79 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.details        . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4U6R 
_pdbx_database_status.recvd_initial_deposition_date   2014-07-29 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
_audit_author.name           'Mohr, C.' 
_audit_author.pdbx_ordinal   1 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Acs Med.Chem.Lett.' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1948-5875 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            6 
_citation.language                  ? 
_citation.page_first                68 
_citation.page_last                 72 
_citation.title                     
'Unfolded Protein Response in Cancer: IRE1 alpha Inhibition by Selective Kinase Ligands Does Not Impair Tumor Cell Viability.' 
_citation.year                      2015 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1021/ml500315b 
_citation.pdbx_database_id_PubMed   25589933 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Harrington, P.E.'     1  
primary 'Biswas, K.'           2  
primary 'Malwitz, D.'          3  
primary 'Tasker, A.S.'         4  
primary 'Mohr, C.'             5  
primary 'Andrews, K.L.'        6  
primary 'Dellamaggiore, K.'    7  
primary 'Kendall, R.'          8  
primary 'Beckmann, H.'         9  
primary 'Jaeckel, P.'          10 
primary 'Materna-Reichelt, S.' 11 
primary 'Allen, J.R.'          12 
primary 'Lipford, J.R.'        13 
# 
_cell.entry_id           4U6R 
_cell.length_a           76.847 
_cell.length_b           86.433 
_cell.length_c           91.818 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4U6R 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Serine/threonine-protein kinase/endoribonuclease IRE1' 52374.629 1  2.7.11.1 ? 'UNP residues 547-977' ? 
2 non-polymer syn 
'N-{4-[(3-{2-[(trans-4-aminocyclohexyl)amino]pyrimidin-4-yl}pyridin-2-yl)oxy]-3-methylnaphthalen-1-yl}-2-chlorobenzenesulfonamide' 
615.145   1  ?        ? ?                      ? 
3 non-polymer syn 'SULFATE ION' 96.063    5  ?        ? ?                      ? 
4 non-polymer syn 1,2-ETHANEDIOL 62.068    1  ?        ? ?                      ? 
5 non-polymer syn '4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID' 238.305   1  ?        ? ?                      ? 
6 water       nat water 18.015    82 ?        ? ?                      ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Endoplasmic reticulum-to-nucleus signaling 1,Inositol-requiring protein 1,hIRE1p,Ire1-alpha,IRE1a' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGHNHRHKHHHHHHHHENLYFQGPGSSPSLEQDDGDEETSVVIVGKISFCPKDVLGHGAEGTIVYRGMFDNRDVAVKRIL
PECFSFADREVQLLRESDEHPNVIRYFCTEKDRQFQYIAIELCAATLQEYVEQKDFAHLGLEPITLLQQTTSGLAHLHSL
NIVHRDLKPHNILISMPNAHGKIKAMISDFGLCKKLAVGRHSFSRRSGVPGTEGWIAPEMLSEDCKENPTYTVDIFSAGC
VFYYVISEGSHPFGKSLQRQANILLGACSLDCLHPEKHEDVIARELIEKMIAMDPQKRPSAKHVLKHPFFWSLEKQLQFF
QDVSDRIEKESLDGPIVKQLERGGRAVVKMDWRENITVPLQTDLRKFRTYKGGSVRDLLRAMRNKKHHYRELPAEVRETL
GTLPDDFVCYFTSRFPHLLAHTYRAMELCSHERLFQPYYFHEPPEPQPPVTPDAL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGHNHRHKHHHHHHHHENLYFQGPGSSPSLEQDDGDEETSVVIVGKISFCPKDVLGHGAEGTIVYRGMFDNRDVAVKRIL
PECFSFADREVQLLRESDEHPNVIRYFCTEKDRQFQYIAIELCAATLQEYVEQKDFAHLGLEPITLLQQTTSGLAHLHSL
NIVHRDLKPHNILISMPNAHGKIKAMISDFGLCKKLAVGRHSFSRRSGVPGTEGWIAPEMLSEDCKENPTYTVDIFSAGC
VFYYVISEGSHPFGKSLQRQANILLGACSLDCLHPEKHEDVIARELIEKMIAMDPQKRPSAKHVLKHPFFWSLEKQLQFF
QDVSDRIEKESLDGPIVKQLERGGRAVVKMDWRENITVPLQTDLRKFRTYKGGSVRDLLRAMRNKKHHYRELPAEVRETL
GTLPDDFVCYFTSRFPHLLAHTYRAMELCSHERLFQPYYFHEPPEPQPPVTPDAL
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   HIS n 
1 4   ASN n 
1 5   HIS n 
1 6   ARG n 
1 7   HIS n 
1 8   LYS n 
1 9   HIS n 
1 10  HIS n 
1 11  HIS n 
1 12  HIS n 
1 13  HIS n 
1 14  HIS n 
1 15  HIS n 
1 16  HIS n 
1 17  GLU n 
1 18  ASN n 
1 19  LEU n 
1 20  TYR n 
1 21  PHE n 
1 22  GLN n 
1 23  GLY n 
1 24  PRO n 
1 25  GLY n 
1 26  SER n 
1 27  SER n 
1 28  PRO n 
1 29  SER n 
1 30  LEU n 
1 31  GLU n 
1 32  GLN n 
1 33  ASP n 
1 34  ASP n 
1 35  GLY n 
1 36  ASP n 
1 37  GLU n 
1 38  GLU n 
1 39  THR n 
1 40  SER n 
1 41  VAL n 
1 42  VAL n 
1 43  ILE n 
1 44  VAL n 
1 45  GLY n 
1 46  LYS n 
1 47  ILE n 
1 48  SER n 
1 49  PHE n 
1 50  CYS n 
1 51  PRO n 
1 52  LYS n 
1 53  ASP n 
1 54  VAL n 
1 55  LEU n 
1 56  GLY n 
1 57  HIS n 
1 58  GLY n 
1 59  ALA n 
1 60  GLU n 
1 61  GLY n 
1 62  THR n 
1 63  ILE n 
1 64  VAL n 
1 65  TYR n 
1 66  ARG n 
1 67  GLY n 
1 68  MET n 
1 69  PHE n 
1 70  ASP n 
1 71  ASN n 
1 72  ARG n 
1 73  ASP n 
1 74  VAL n 
1 75  ALA n 
1 76  VAL n 
1 77  LYS n 
1 78  ARG n 
1 79  ILE n 
1 80  LEU n 
1 81  PRO n 
1 82  GLU n 
1 83  CYS n 
1 84  PHE n 
1 85  SER n 
1 86  PHE n 
1 87  ALA n 
1 88  ASP n 
1 89  ARG n 
1 90  GLU n 
1 91  VAL n 
1 92  GLN n 
1 93  LEU n 
1 94  LEU n 
1 95  ARG n 
1 96  GLU n 
1 97  SER n 
1 98  ASP n 
1 99  GLU n 
1 100 HIS n 
1 101 PRO n 
1 102 ASN n 
1 103 VAL n 
1 104 ILE n 
1 105 ARG n 
1 106 TYR n 
1 107 PHE n 
1 108 CYS n 
1 109 THR n 
1 110 GLU n 
1 111 LYS n 
1 112 ASP n 
1 113 ARG n 
1 114 GLN n 
1 115 PHE n 
1 116 GLN n 
1 117 TYR n 
1 118 ILE n 
1 119 ALA n 
1 120 ILE n 
1 121 GLU n 
1 122 LEU n 
1 123 CYS n 
1 124 ALA n 
1 125 ALA n 
1 126 THR n 
1 127 LEU n 
1 128 GLN n 
1 129 GLU n 
1 130 TYR n 
1 131 VAL n 
1 132 GLU n 
1 133 GLN n 
1 134 LYS n 
1 135 ASP n 
1 136 PHE n 
1 137 ALA n 
1 138 HIS n 
1 139 LEU n 
1 140 GLY n 
1 141 LEU n 
1 142 GLU n 
1 143 PRO n 
1 144 ILE n 
1 145 THR n 
1 146 LEU n 
1 147 LEU n 
1 148 GLN n 
1 149 GLN n 
1 150 THR n 
1 151 THR n 
1 152 SER n 
1 153 GLY n 
1 154 LEU n 
1 155 ALA n 
1 156 HIS n 
1 157 LEU n 
1 158 HIS n 
1 159 SER n 
1 160 LEU n 
1 161 ASN n 
1 162 ILE n 
1 163 VAL n 
1 164 HIS n 
1 165 ARG n 
1 166 ASP n 
1 167 LEU n 
1 168 LYS n 
1 169 PRO n 
1 170 HIS n 
1 171 ASN n 
1 172 ILE n 
1 173 LEU n 
1 174 ILE n 
1 175 SER n 
1 176 MET n 
1 177 PRO n 
1 178 ASN n 
1 179 ALA n 
1 180 HIS n 
1 181 GLY n 
1 182 LYS n 
1 183 ILE n 
1 184 LYS n 
1 185 ALA n 
1 186 MET n 
1 187 ILE n 
1 188 SER n 
1 189 ASP n 
1 190 PHE n 
1 191 GLY n 
1 192 LEU n 
1 193 CYS n 
1 194 LYS n 
1 195 LYS n 
1 196 LEU n 
1 197 ALA n 
1 198 VAL n 
1 199 GLY n 
1 200 ARG n 
1 201 HIS n 
1 202 SER n 
1 203 PHE n 
1 204 SER n 
1 205 ARG n 
1 206 ARG n 
1 207 SER n 
1 208 GLY n 
1 209 VAL n 
1 210 PRO n 
1 211 GLY n 
1 212 THR n 
1 213 GLU n 
1 214 GLY n 
1 215 TRP n 
1 216 ILE n 
1 217 ALA n 
1 218 PRO n 
1 219 GLU n 
1 220 MET n 
1 221 LEU n 
1 222 SER n 
1 223 GLU n 
1 224 ASP n 
1 225 CYS n 
1 226 LYS n 
1 227 GLU n 
1 228 ASN n 
1 229 PRO n 
1 230 THR n 
1 231 TYR n 
1 232 THR n 
1 233 VAL n 
1 234 ASP n 
1 235 ILE n 
1 236 PHE n 
1 237 SER n 
1 238 ALA n 
1 239 GLY n 
1 240 CYS n 
1 241 VAL n 
1 242 PHE n 
1 243 TYR n 
1 244 TYR n 
1 245 VAL n 
1 246 ILE n 
1 247 SER n 
1 248 GLU n 
1 249 GLY n 
1 250 SER n 
1 251 HIS n 
1 252 PRO n 
1 253 PHE n 
1 254 GLY n 
1 255 LYS n 
1 256 SER n 
1 257 LEU n 
1 258 GLN n 
1 259 ARG n 
1 260 GLN n 
1 261 ALA n 
1 262 ASN n 
1 263 ILE n 
1 264 LEU n 
1 265 LEU n 
1 266 GLY n 
1 267 ALA n 
1 268 CYS n 
1 269 SER n 
1 270 LEU n 
1 271 ASP n 
1 272 CYS n 
1 273 LEU n 
1 274 HIS n 
1 275 PRO n 
1 276 GLU n 
1 277 LYS n 
1 278 HIS n 
1 279 GLU n 
1 280 ASP n 
1 281 VAL n 
1 282 ILE n 
1 283 ALA n 
1 284 ARG n 
1 285 GLU n 
1 286 LEU n 
1 287 ILE n 
1 288 GLU n 
1 289 LYS n 
1 290 MET n 
1 291 ILE n 
1 292 ALA n 
1 293 MET n 
1 294 ASP n 
1 295 PRO n 
1 296 GLN n 
1 297 LYS n 
1 298 ARG n 
1 299 PRO n 
1 300 SER n 
1 301 ALA n 
1 302 LYS n 
1 303 HIS n 
1 304 VAL n 
1 305 LEU n 
1 306 LYS n 
1 307 HIS n 
1 308 PRO n 
1 309 PHE n 
1 310 PHE n 
1 311 TRP n 
1 312 SER n 
1 313 LEU n 
1 314 GLU n 
1 315 LYS n 
1 316 GLN n 
1 317 LEU n 
1 318 GLN n 
1 319 PHE n 
1 320 PHE n 
1 321 GLN n 
1 322 ASP n 
1 323 VAL n 
1 324 SER n 
1 325 ASP n 
1 326 ARG n 
1 327 ILE n 
1 328 GLU n 
1 329 LYS n 
1 330 GLU n 
1 331 SER n 
1 332 LEU n 
1 333 ASP n 
1 334 GLY n 
1 335 PRO n 
1 336 ILE n 
1 337 VAL n 
1 338 LYS n 
1 339 GLN n 
1 340 LEU n 
1 341 GLU n 
1 342 ARG n 
1 343 GLY n 
1 344 GLY n 
1 345 ARG n 
1 346 ALA n 
1 347 VAL n 
1 348 VAL n 
1 349 LYS n 
1 350 MET n 
1 351 ASP n 
1 352 TRP n 
1 353 ARG n 
1 354 GLU n 
1 355 ASN n 
1 356 ILE n 
1 357 THR n 
1 358 VAL n 
1 359 PRO n 
1 360 LEU n 
1 361 GLN n 
1 362 THR n 
1 363 ASP n 
1 364 LEU n 
1 365 ARG n 
1 366 LYS n 
1 367 PHE n 
1 368 ARG n 
1 369 THR n 
1 370 TYR n 
1 371 LYS n 
1 372 GLY n 
1 373 GLY n 
1 374 SER n 
1 375 VAL n 
1 376 ARG n 
1 377 ASP n 
1 378 LEU n 
1 379 LEU n 
1 380 ARG n 
1 381 ALA n 
1 382 MET n 
1 383 ARG n 
1 384 ASN n 
1 385 LYS n 
1 386 LYS n 
1 387 HIS n 
1 388 HIS n 
1 389 TYR n 
1 390 ARG n 
1 391 GLU n 
1 392 LEU n 
1 393 PRO n 
1 394 ALA n 
1 395 GLU n 
1 396 VAL n 
1 397 ARG n 
1 398 GLU n 
1 399 THR n 
1 400 LEU n 
1 401 GLY n 
1 402 THR n 
1 403 LEU n 
1 404 PRO n 
1 405 ASP n 
1 406 ASP n 
1 407 PHE n 
1 408 VAL n 
1 409 CYS n 
1 410 TYR n 
1 411 PHE n 
1 412 THR n 
1 413 SER n 
1 414 ARG n 
1 415 PHE n 
1 416 PRO n 
1 417 HIS n 
1 418 LEU n 
1 419 LEU n 
1 420 ALA n 
1 421 HIS n 
1 422 THR n 
1 423 TYR n 
1 424 ARG n 
1 425 ALA n 
1 426 MET n 
1 427 GLU n 
1 428 LEU n 
1 429 CYS n 
1 430 SER n 
1 431 HIS n 
1 432 GLU n 
1 433 ARG n 
1 434 LEU n 
1 435 PHE n 
1 436 GLN n 
1 437 PRO n 
1 438 TYR n 
1 439 TYR n 
1 440 PHE n 
1 441 HIS n 
1 442 GLU n 
1 443 PRO n 
1 444 PRO n 
1 445 GLU n 
1 446 PRO n 
1 447 GLN n 
1 448 PRO n 
1 449 PRO n 
1 450 VAL n 
1 451 THR n 
1 452 PRO n 
1 453 ASP n 
1 454 ALA n 
1 455 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   455 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'ERN1, IRE1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'cabbage looper' 
_entity_src_gen.pdbx_host_org_scientific_name      'Trichoplusia ni' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7111 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ERN1_HUMAN 
_struct_ref.pdbx_db_accession          O75460 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;GSSPSLEQDDGDEETSVVIVGKISFCPKDVLGHGAEGTIVYRGMFDNRDVAVKRILPECFSFADREVQLLRESDEHPNVI
RYFCTEKDRQFQYIAIELCAATLQEYVEQKDFAHLGLEPITLLQQTTSGLAHLHSLNIVHRDLKPHNILISMPNAHGKIK
AMISDFGLCKKLAVGRHSFSRRSGVPGTEGWIAPEMLSEDCKENPTYTVDIFSAGCVFYYVISEGSHPFGKSLQRQANIL
LGACSLDCLHPEKHEDVIARELIEKMIAMDPQKRPSAKHVLKHPFFWSLEKQLQFFQDVSDRIEKESLDGPIVKQLERGG
RAVVKMDWRENITVPLQTDLRKFRTYKGGSVRDLLRAMRNKKHHYRELPAEVRETLGSLPDDFVCYFTSRFPHLLAHTYR
AMELCSHERLFQPYYFHEPPEPQPPVTPDAL
;
_struct_ref.pdbx_align_begin           547 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              4U6R 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 25 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 455 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             O75460 
_struct_ref_seq.db_align_beg                  547 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  977 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       547 
_struct_ref_seq.pdbx_auth_seq_align_end       977 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4U6R MET A 1   ? UNP O75460 ?   ?   'initiating methionine' 523 1  
1 4U6R GLY A 2   ? UNP O75460 ?   ?   'expression tag'        524 2  
1 4U6R HIS A 3   ? UNP O75460 ?   ?   'expression tag'        525 3  
1 4U6R ASN A 4   ? UNP O75460 ?   ?   'expression tag'        526 4  
1 4U6R HIS A 5   ? UNP O75460 ?   ?   'expression tag'        527 5  
1 4U6R ARG A 6   ? UNP O75460 ?   ?   'expression tag'        528 6  
1 4U6R HIS A 7   ? UNP O75460 ?   ?   'expression tag'        529 7  
1 4U6R LYS A 8   ? UNP O75460 ?   ?   'expression tag'        530 8  
1 4U6R HIS A 9   ? UNP O75460 ?   ?   'expression tag'        531 9  
1 4U6R HIS A 10  ? UNP O75460 ?   ?   'expression tag'        532 10 
1 4U6R HIS A 11  ? UNP O75460 ?   ?   'expression tag'        533 11 
1 4U6R HIS A 12  ? UNP O75460 ?   ?   'expression tag'        534 12 
1 4U6R HIS A 13  ? UNP O75460 ?   ?   'expression tag'        535 13 
1 4U6R HIS A 14  ? UNP O75460 ?   ?   'expression tag'        536 14 
1 4U6R HIS A 15  ? UNP O75460 ?   ?   'expression tag'        537 15 
1 4U6R HIS A 16  ? UNP O75460 ?   ?   'expression tag'        538 16 
1 4U6R GLU A 17  ? UNP O75460 ?   ?   'expression tag'        539 17 
1 4U6R ASN A 18  ? UNP O75460 ?   ?   'expression tag'        540 18 
1 4U6R LEU A 19  ? UNP O75460 ?   ?   'expression tag'        541 19 
1 4U6R TYR A 20  ? UNP O75460 ?   ?   'expression tag'        542 20 
1 4U6R PHE A 21  ? UNP O75460 ?   ?   'expression tag'        543 21 
1 4U6R GLN A 22  ? UNP O75460 ?   ?   'expression tag'        544 22 
1 4U6R GLY A 23  ? UNP O75460 ?   ?   'expression tag'        545 23 
1 4U6R PRO A 24  ? UNP O75460 ?   ?   'expression tag'        546 24 
1 4U6R THR A 402 ? UNP O75460 SER 924 'see remark 999'        924 25 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
3E4 non-polymer         . 
'N-{4-[(3-{2-[(trans-4-aminocyclohexyl)amino]pyrimidin-4-yl}pyridin-2-yl)oxy]-3-methylnaphthalen-1-yl}-2-chlorobenzenesulfonamide' 
?                 'C32 H31 Cl N6 O3 S' 615.145 
ALA 'L-peptide linking' y ALANINE ?                 'C3 H7 N O2'         89.093  
ARG 'L-peptide linking' y ARGININE ?                 'C6 H15 N4 O2 1'     175.209 
ASN 'L-peptide linking' y ASPARAGINE ?                 'C4 H8 N2 O3'        132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                 'C4 H7 N O4'         133.103 
CYS 'L-peptide linking' y CYSTEINE ?                 'C3 H7 N O2 S'       121.158 
EDO non-polymer         . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2'           62.068  
EPE non-polymer         . '4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID' HEPES             'C8 H18 N2 O4 S'     238.305 
GLN 'L-peptide linking' y GLUTAMINE ?                 'C5 H10 N2 O3'       146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                 'C5 H9 N O4'         147.129 
GLY 'peptide linking'   y GLYCINE ?                 'C2 H5 N O2'         75.067  
HIS 'L-peptide linking' y HISTIDINE ?                 'C6 H10 N3 O2 1'     156.162 
HOH non-polymer         . WATER ?                 'H2 O'               18.015  
ILE 'L-peptide linking' y ISOLEUCINE ?                 'C6 H13 N O2'        131.173 
LEU 'L-peptide linking' y LEUCINE ?                 'C6 H13 N O2'        131.173 
LYS 'L-peptide linking' y LYSINE ?                 'C6 H15 N2 O2 1'     147.195 
MET 'L-peptide linking' y METHIONINE ?                 'C5 H11 N O2 S'      149.211 
PHE 'L-peptide linking' y PHENYLALANINE ?                 'C9 H11 N O2'        165.189 
PRO 'L-peptide linking' y PROLINE ?                 'C5 H9 N O2'         115.130 
SER 'L-peptide linking' y SERINE ?                 'C3 H7 N O3'         105.093 
SO4 non-polymer         . 'SULFATE ION' ?                 'O4 S -2'            96.063  
THR 'L-peptide linking' y THREONINE ?                 'C4 H9 N O3'         119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ?                 'C11 H12 N2 O2'      204.225 
TYR 'L-peptide linking' y TYROSINE ?                 'C9 H11 N O3'        181.189 
VAL 'L-peptide linking' y VALINE ?                 'C5 H11 N O2'        117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4U6R 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.91 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         57.75 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.2M Ammonium sulfate, 0.1M HEPES, 25% PEG3350, pH7.5' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'RIGAKU SATURN 944' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2011-09-01 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'VariMax HF' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.target                      ? 
_diffrn_source.type                        'RIGAKU FR-E SUPERBRIGHT' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_synchrotron_site       ? 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         4U6R 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.50 
_reflns.d_resolution_low                 29.47 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       21786 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             98.8 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  7.3 
_reflns.pdbx_Rmerge_I_obs                0.089 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            9.7 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.50 
_reflns_shell.d_res_low                   2.59 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         4.52 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        97.7 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.457 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             7.4 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            0.69 
_refine.aniso_B[1][2]                            -0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][2]                            -0.58 
_refine.aniso_B[2][3]                            -0.00 
_refine.aniso_B[3][3]                            -0.11 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               43.874 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               0.939 
_refine.correlation_coeff_Fo_to_Fc_free          0.913 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 4U6R 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.50 
_refine.ls_d_res_low                             29.47 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     20377 
_refine.ls_number_reflns_R_free                  1097 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    98.81 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.20386 
_refine.ls_R_factor_R_free                       0.24607 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.20170 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      3P23 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD WITH PHASES' 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       0.370 
_refine.pdbx_overall_ESU_R_Free                  0.258 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             15.495 
_refine.overall_SU_ML                            0.173 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         1 
_refine_hist.pdbx_number_atoms_protein        3260 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         87 
_refine_hist.number_atoms_solvent             82 
_refine_hist.number_atoms_total               3429 
_refine_hist.d_res_high                       2.50 
_refine_hist.d_res_low                        29.47 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.009  0.019  3426 ? r_bond_refined_d             ? ? 
'X-RAY DIFFRACTION' ? 0.001  0.020  3254 ? r_bond_other_d               ? ? 
'X-RAY DIFFRACTION' ? 1.350  1.982  4630 ? r_angle_refined_deg          ? ? 
'X-RAY DIFFRACTION' ? 0.836  3.002  7457 ? r_angle_other_deg            ? ? 
'X-RAY DIFFRACTION' ? 6.084  5.000  402  ? r_dihedral_angle_1_deg       ? ? 
'X-RAY DIFFRACTION' ? 31.419 22.963 162  ? r_dihedral_angle_2_deg       ? ? 
'X-RAY DIFFRACTION' ? 18.423 15.000 594  ? r_dihedral_angle_3_deg       ? ? 
'X-RAY DIFFRACTION' ? 18.831 15.000 28   ? r_dihedral_angle_4_deg       ? ? 
'X-RAY DIFFRACTION' ? 0.080  0.200  497  ? r_chiral_restr               ? ? 
'X-RAY DIFFRACTION' ? 0.005  0.021  3779 ? r_gen_planes_refined         ? ? 
'X-RAY DIFFRACTION' ? 0.001  0.020  806  ? r_gen_planes_other           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbd_refined                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbd_other                  ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbtor_refined              ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbtor_other                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_xyhbond_nbd_refined        ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_xyhbond_nbd_other          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_metal_ion_refined          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_metal_ion_other            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_vdw_refined       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_vdw_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_hbond_refined     ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_hbond_other       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_metal_ion_refined ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_metal_ion_other   ? ? 
'X-RAY DIFFRACTION' ? 1.391  2.890  1611 ? r_mcbond_it                  ? ? 
'X-RAY DIFFRACTION' ? 1.391  2.888  1610 ? r_mcbond_other               ? ? 
'X-RAY DIFFRACTION' ? 2.365  4.330  2012 ? r_mcangle_it                 ? ? 
'X-RAY DIFFRACTION' ? 2.364  4.331  2013 ? r_mcangle_other              ? ? 
'X-RAY DIFFRACTION' ? 1.656  3.203  1815 ? r_scbond_it                  ? ? 
'X-RAY DIFFRACTION' ? 1.656  3.203  1815 ? r_scbond_other               ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_scangle_it                 ? ? 
'X-RAY DIFFRACTION' ? 2.692  4.716  2619 ? r_scangle_other              ? ? 
'X-RAY DIFFRACTION' ? 5.106  23.039 3774 ? r_long_range_B_refined       ? ? 
'X-RAY DIFFRACTION' ? 5.078  23.021 3766 ? r_long_range_B_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_rigid_bond_restr           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_sphericity_free            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_sphericity_bonded          ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       2.502 
_refine_ls_shell.d_res_low                        2.567 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             73 
_refine_ls_shell.number_reflns_R_work             1471 
_refine_ls_shell.percent_reflns_obs               97.60 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.310 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.244 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
# 
_struct.entry_id                     4U6R 
_struct.title                        'Crystal structure of human IRE1 cytoplasmic domains in complex with a sulfonamide inhibitor.' 
_struct.pdbx_descriptor              'Serine/threonine-protein kinase/endoribonuclease IRE1 (E.C.2.7.11.1)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4U6R 
_struct_keywords.text            'Transferase, Kinase, Hydrolase, Endoribonuclease, TRANSFERASE-TRANSFERASE INHIBITOR complex' 
_struct_keywords.pdbx_keywords   'TRANSFERASE/TRANSFERASE INHIBITOR' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 4 ? 
I N N 5 ? 
J N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 LEU A 80  ? GLU A 82  ? LEU A 602 GLU A 604 5 ? 3  
HELX_P HELX_P2  AA2 CYS A 83  ? LEU A 93  ? CYS A 605 LEU A 615 1 ? 11 
HELX_P HELX_P3  AA3 LEU A 127 ? LYS A 134 ? LEU A 649 LYS A 656 1 ? 8  
HELX_P HELX_P4  AA4 ASP A 135 ? LEU A 139 ? ASP A 657 LEU A 661 5 ? 5  
HELX_P HELX_P5  AA5 LEU A 141 ? LEU A 160 ? LEU A 663 LEU A 682 1 ? 20 
HELX_P HELX_P6  AA6 ALA A 217 ? LEU A 221 ? ALA A 739 LEU A 743 5 ? 5  
HELX_P HELX_P7  AA7 TYR A 231 ? SER A 247 ? TYR A 753 SER A 769 1 ? 17 
HELX_P HELX_P8  AA8 GLN A 258 ? GLY A 266 ? GLN A 780 GLY A 788 1 ? 9  
HELX_P HELX_P9  AA9 LYS A 277 ? ILE A 291 ? LYS A 799 ILE A 813 1 ? 15 
HELX_P HELX_P10 AB1 ASP A 294 ? ARG A 298 ? ASP A 816 ARG A 820 5 ? 5  
HELX_P HELX_P11 AB2 SER A 300 ? HIS A 307 ? SER A 822 HIS A 829 1 ? 8  
HELX_P HELX_P12 AB3 PRO A 308 ? TRP A 311 ? PRO A 830 TRP A 833 5 ? 4  
HELX_P HELX_P13 AB4 SER A 312 ? GLU A 328 ? SER A 834 GLU A 850 1 ? 17 
HELX_P HELX_P14 AB5 GLY A 334 ? ARG A 342 ? GLY A 856 ARG A 864 1 ? 9  
HELX_P HELX_P15 AB6 GLY A 343 ? LYS A 349 ? GLY A 865 LYS A 871 1 ? 7  
HELX_P HELX_P16 AB7 TRP A 352 ? ILE A 356 ? TRP A 874 ILE A 878 5 ? 5  
HELX_P HELX_P17 AB8 THR A 357 ? LYS A 366 ? THR A 879 LYS A 888 1 ? 10 
HELX_P HELX_P18 AB9 SER A 374 ? HIS A 388 ? SER A 896 HIS A 910 1 ? 15 
HELX_P HELX_P19 AC1 PRO A 393 ? GLY A 401 ? PRO A 915 GLY A 923 1 ? 9  
HELX_P HELX_P20 AC2 PRO A 404 ? PHE A 415 ? PRO A 926 PHE A 937 1 ? 12 
HELX_P HELX_P21 AC3 HIS A 417 ? MET A 426 ? HIS A 939 MET A 948 1 ? 10 
HELX_P HELX_P22 AC4 GLU A 427 ? SER A 430 ? GLU A 949 SER A 952 5 ? 4  
HELX_P HELX_P23 AC5 GLU A 432 ? GLN A 436 ? GLU A 954 GLN A 958 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          LEU 
_struct_mon_prot_cis.label_seq_id           403 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           LEU 
_struct_mon_prot_cis.auth_seq_id            925 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    404 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     926 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -2.86 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 6 ? 
AA2 ? 3 ? 
AA3 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA1 5 6 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA3 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 VAL A 42  ? VAL A 44  ? VAL A 564 VAL A 566 
AA1 2 ILE A 47  ? GLY A 56  ? ILE A 569 GLY A 578 
AA1 3 ILE A 63  ? PHE A 69  ? ILE A 585 PHE A 591 
AA1 4 ARG A 72  ? ILE A 79  ? ARG A 594 ILE A 601 
AA1 5 GLN A 116 ? GLU A 121 ? GLN A 638 GLU A 643 
AA1 6 TYR A 106 ? LYS A 111 ? TYR A 628 LYS A 633 
AA2 1 CYS A 123 ? THR A 126 ? CYS A 645 THR A 648 
AA2 2 ILE A 172 ? SER A 175 ? ILE A 694 SER A 697 
AA2 3 ALA A 185 ? ILE A 187 ? ALA A 707 ILE A 709 
AA3 1 ILE A 162 ? VAL A 163 ? ILE A 684 VAL A 685 
AA3 2 LYS A 194 ? LYS A 195 ? LYS A 716 LYS A 717 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N VAL A 42  ? N VAL A 564 O PHE A 49  ? O PHE A 571 
AA1 2 3 N LEU A 55  ? N LEU A 577 O VAL A 64  ? O VAL A 586 
AA1 3 4 N ILE A 63  ? N ILE A 585 O ARG A 78  ? O ARG A 600 
AA1 4 5 N ALA A 75  ? N ALA A 597 O ILE A 120 ? O ILE A 642 
AA1 5 6 O TYR A 117 ? O TYR A 639 N GLU A 110 ? N GLU A 632 
AA2 1 2 N ALA A 125 ? N ALA A 647 O ILE A 174 ? O ILE A 696 
AA2 2 3 N LEU A 173 ? N LEU A 695 O MET A 186 ? O MET A 708 
AA3 1 2 N VAL A 163 ? N VAL A 685 O LYS A 194 ? O LYS A 716 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A 3E4 1001 ? 15 'binding site for residue 3E4 A 1001' 
AC2 Software A SO4 1002 ? 5  'binding site for residue SO4 A 1002' 
AC3 Software A SO4 1003 ? 3  'binding site for residue SO4 A 1003' 
AC4 Software A SO4 1004 ? 3  'binding site for residue SO4 A 1004' 
AC5 Software A SO4 1005 ? 4  'binding site for residue SO4 A 1005' 
AC6 Software A SO4 1006 ? 3  'binding site for residue SO4 A 1006' 
AC7 Software A EDO 1007 ? 2  'binding site for residue EDO A 1007' 
AC8 Software A EPE 1008 ? 7  'binding site for residue EPE A 1008' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 15 VAL A 64  ? VAL A 586  . ? 1_555 ? 
2  AC1 15 ALA A 75  ? ALA A 597  . ? 1_555 ? 
3  AC1 15 LYS A 77  ? LYS A 599  . ? 1_555 ? 
4  AC1 15 GLU A 90  ? GLU A 612  . ? 1_555 ? 
5  AC1 15 LEU A 94  ? LEU A 616  . ? 1_555 ? 
6  AC1 15 ILE A 120 ? ILE A 642  . ? 1_555 ? 
7  AC1 15 GLU A 121 ? GLU A 643  . ? 1_555 ? 
8  AC1 15 CYS A 123 ? CYS A 645  . ? 1_555 ? 
9  AC1 15 ALA A 124 ? ALA A 646  . ? 1_555 ? 
10 AC1 15 GLU A 129 ? GLU A 651  . ? 1_555 ? 
11 AC1 15 SER A 188 ? SER A 710  . ? 1_555 ? 
12 AC1 15 ASP A 189 ? ASP A 711  . ? 1_555 ? 
13 AC1 15 PHE A 190 ? PHE A 712  . ? 1_555 ? 
14 AC1 15 LYS A 329 ? LYS A 851  . ? 3_544 ? 
15 AC1 15 HOH J .   ? HOH A 1130 . ? 1_555 ? 
16 AC2 5  SER A 269 ? SER A 791  . ? 1_555 ? 
17 AC2 5  LEU A 270 ? LEU A 792  . ? 1_555 ? 
18 AC2 5  ASP A 271 ? ASP A 793  . ? 1_555 ? 
19 AC2 5  ARG A 284 ? ARG A 806  . ? 1_555 ? 
20 AC2 5  HOH J .   ? HOH A 1161 . ? 1_555 ? 
21 AC3 3  LYS A 255 ? LYS A 777  . ? 3_554 ? 
22 AC3 3  LYS A 315 ? LYS A 837  . ? 1_555 ? 
23 AC3 3  PRO A 437 ? PRO A 959  . ? 1_555 ? 
24 AC4 3  ARG A 72  ? ARG A 594  . ? 1_555 ? 
25 AC4 3  ARG A 105 ? ARG A 627  . ? 1_555 ? 
26 AC4 3  ARG A 397 ? ARG A 919  . ? 2_455 ? 
27 AC5 4  ARG A 200 ? ARG A 722  . ? 1_555 ? 
28 AC5 4  HIS A 201 ? HIS A 723  . ? 1_555 ? 
29 AC5 4  SER A 202 ? SER A 724  . ? 1_555 ? 
30 AC5 4  HOH J .   ? HOH A 1102 . ? 4_545 ? 
31 AC6 3  GLY A 343 ? GLY A 865  . ? 1_555 ? 
32 AC6 3  ARG A 345 ? ARG A 867  . ? 1_555 ? 
33 AC6 3  HOH J .   ? HOH A 1175 . ? 1_555 ? 
34 AC7 2  GLU A 142 ? GLU A 664  . ? 1_555 ? 
35 AC7 2  HOH J .   ? HOH A 1119 . ? 1_555 ? 
36 AC8 7  HIS A 158 ? HIS A 680  . ? 1_555 ? 
37 AC8 7  SER A 159 ? SER A 681  . ? 1_555 ? 
38 AC8 7  ASN A 161 ? ASN A 683  . ? 1_555 ? 
39 AC8 7  TYR A 231 ? TYR A 753  . ? 1_555 ? 
40 AC8 7  SER A 300 ? SER A 822  . ? 1_555 ? 
41 AC8 7  HOH J .   ? HOH A 1168 . ? 1_555 ? 
42 AC8 7  HOH J .   ? HOH A 1169 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4U6R 
_atom_sites.fract_transf_matrix[1][1]   0.013013 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011570 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010891 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . THR A 1 39  ? -4.452  -34.220 20.046  1.00 73.61  ? 561  THR A N   1 
ATOM   2    C  CA  . THR A 1 39  ? -4.357  -32.753 19.764  1.00 71.52  ? 561  THR A CA  1 
ATOM   3    C  C   . THR A 1 39  ? -5.244  -32.328 18.565  1.00 68.80  ? 561  THR A C   1 
ATOM   4    O  O   . THR A 1 39  ? -4.896  -32.529 17.396  1.00 66.37  ? 561  THR A O   1 
ATOM   5    C  CB  . THR A 1 39  ? -2.887  -32.308 19.591  1.00 70.30  ? 561  THR A CB  1 
ATOM   6    O  OG1 . THR A 1 39  ? -2.838  -30.926 19.219  1.00 68.71  ? 561  THR A OG1 1 
ATOM   7    C  CG2 . THR A 1 39  ? -2.151  -33.160 18.544  1.00 70.15  ? 561  THR A CG2 1 
ATOM   8    N  N   . SER A 1 40  ? -6.397  -31.737 18.882  1.00 66.30  ? 562  SER A N   1 
ATOM   9    C  CA  . SER A 1 40  ? -7.394  -31.390 17.884  1.00 63.24  ? 562  SER A CA  1 
ATOM   10   C  C   . SER A 1 40  ? -7.124  -30.037 17.238  1.00 59.90  ? 562  SER A C   1 
ATOM   11   O  O   . SER A 1 40  ? -7.243  -29.912 16.020  1.00 58.47  ? 562  SER A O   1 
ATOM   12   C  CB  . SER A 1 40  ? -8.787  -31.419 18.507  1.00 66.34  ? 562  SER A CB  1 
ATOM   13   O  OG  . SER A 1 40  ? -9.789  -31.266 17.514  1.00 67.44  ? 562  SER A OG  1 
ATOM   14   N  N   . VAL A 1 41  ? -6.779  -29.025 18.033  1.00 58.72  ? 563  VAL A N   1 
ATOM   15   C  CA  . VAL A 1 41  ? -6.368  -27.709 17.495  1.00 57.78  ? 563  VAL A CA  1 
ATOM   16   C  C   . VAL A 1 41  ? -5.054  -27.219 18.107  1.00 56.75  ? 563  VAL A C   1 
ATOM   17   O  O   . VAL A 1 41  ? -4.971  -26.987 19.304  1.00 58.87  ? 563  VAL A O   1 
ATOM   18   C  CB  . VAL A 1 41  ? -7.440  -26.612 17.717  1.00 59.83  ? 563  VAL A CB  1 
ATOM   19   C  CG1 . VAL A 1 41  ? -7.006  -25.277 17.113  1.00 58.29  ? 563  VAL A CG1 1 
ATOM   20   C  CG2 . VAL A 1 41  ? -8.763  -27.039 17.111  1.00 61.17  ? 563  VAL A CG2 1 
ATOM   21   N  N   . VAL A 1 42  ? -4.040  -27.037 17.272  1.00 54.48  ? 564  VAL A N   1 
ATOM   22   C  CA  . VAL A 1 42  ? -2.762  -26.462 17.702  1.00 53.84  ? 564  VAL A CA  1 
ATOM   23   C  C   . VAL A 1 42  ? -2.842  -24.929 17.716  1.00 53.15  ? 564  VAL A C   1 
ATOM   24   O  O   . VAL A 1 42  ? -3.333  -24.319 16.765  1.00 51.53  ? 564  VAL A O   1 
ATOM   25   C  CB  . VAL A 1 42  ? -1.613  -26.909 16.768  1.00 52.26  ? 564  VAL A CB  1 
ATOM   26   C  CG1 . VAL A 1 42  ? -0.335  -26.129 17.057  1.00 52.13  ? 564  VAL A CG1 1 
ATOM   27   C  CG2 . VAL A 1 42  ? -1.395  -28.414 16.889  1.00 51.96  ? 564  VAL A CG2 1 
ATOM   28   N  N   . ILE A 1 43  ? -2.370  -24.319 18.802  1.00 53.90  ? 565  ILE A N   1 
ATOM   29   C  CA  . ILE A 1 43  ? -2.262  -22.870 18.897  1.00 54.52  ? 565  ILE A CA  1 
ATOM   30   C  C   . ILE A 1 43  ? -0.821  -22.483 19.191  1.00 54.30  ? 565  ILE A C   1 
ATOM   31   O  O   . ILE A 1 43  ? -0.291  -22.820 20.235  1.00 54.96  ? 565  ILE A O   1 
ATOM   32   C  CB  . ILE A 1 43  ? -3.163  -22.282 19.990  1.00 57.52  ? 565  ILE A CB  1 
ATOM   33   C  CG1 . ILE A 1 43  ? -4.632  -22.656 19.740  1.00 58.79  ? 565  ILE A CG1 1 
ATOM   34   C  CG2 . ILE A 1 43  ? -3.007  -20.764 20.044  1.00 58.19  ? 565  ILE A CG2 1 
ATOM   35   C  CD1 . ILE A 1 43  ? -5.497  -22.610 20.984  1.00 61.38  ? 565  ILE A CD1 1 
ATOM   36   N  N   . VAL A 1 44  ? -0.198  -21.778 18.252  1.00 53.36  ? 566  VAL A N   1 
ATOM   37   C  CA  . VAL A 1 44  ? 1.131   -21.223 18.438  1.00 53.44  ? 566  VAL A CA  1 
ATOM   38   C  C   . VAL A 1 44  ? 1.025   -19.714 18.222  1.00 52.86  ? 566  VAL A C   1 
ATOM   39   O  O   . VAL A 1 44  ? 1.030   -19.215 17.085  1.00 49.80  ? 566  VAL A O   1 
ATOM   40   C  CB  . VAL A 1 44  ? 2.158   -21.902 17.499  1.00 53.30  ? 566  VAL A CB  1 
ATOM   41   C  CG1 . VAL A 1 44  ? 3.553   -21.312 17.673  1.00 53.66  ? 566  VAL A CG1 1 
ATOM   42   C  CG2 . VAL A 1 44  ? 2.208   -23.398 17.788  1.00 53.64  ? 566  VAL A CG2 1 
ATOM   43   N  N   . GLY A 1 45  ? 0.895   -19.000 19.335  1.00 54.33  ? 567  GLY A N   1 
ATOM   44   C  CA  . GLY A 1 45  ? 0.747   -17.554 19.317  1.00 55.58  ? 567  GLY A CA  1 
ATOM   45   C  C   . GLY A 1 45  ? -0.549  -17.141 18.656  1.00 55.74  ? 567  GLY A C   1 
ATOM   46   O  O   . GLY A 1 45  ? -1.619  -17.561 19.078  1.00 56.84  ? 567  GLY A O   1 
ATOM   47   N  N   . LYS A 1 46  ? -0.445  -16.340 17.600  1.00 54.54  ? 568  LYS A N   1 
ATOM   48   C  CA  . LYS A 1 46  ? -1.613  -15.799 16.909  1.00 54.52  ? 568  LYS A CA  1 
ATOM   49   C  C   . LYS A 1 46  ? -2.180  -16.768 15.863  1.00 51.16  ? 568  LYS A C   1 
ATOM   50   O  O   . LYS A 1 46  ? -3.240  -16.528 15.294  1.00 49.67  ? 568  LYS A O   1 
ATOM   51   C  CB  . LYS A 1 46  ? -1.233  -14.485 16.223  1.00 55.84  ? 568  LYS A CB  1 
ATOM   52   C  CG  . LYS A 1 46  ? -0.783  -13.378 17.166  1.00 58.66  ? 568  LYS A CG  1 
ATOM   53   C  CD  . LYS A 1 46  ? -1.965  -12.592 17.698  1.00 62.45  ? 568  LYS A CD  1 
ATOM   54   C  CE  . LYS A 1 46  ? -2.645  -11.761 16.610  1.00 62.67  ? 568  LYS A CE  1 
ATOM   55   N  NZ  . LYS A 1 46  ? -3.827  -11.041 17.156  1.00 64.92  ? 568  LYS A NZ  1 
ATOM   56   N  N   . ILE A 1 47  ? -1.456  -17.853 15.613  1.00 49.37  ? 569  ILE A N   1 
ATOM   57   C  CA  . ILE A 1 47  ? -1.806  -18.824 14.586  1.00 47.07  ? 569  ILE A CA  1 
ATOM   58   C  C   . ILE A 1 47  ? -2.478  -20.037 15.207  1.00 46.32  ? 569  ILE A C   1 
ATOM   59   O  O   . ILE A 1 47  ? -2.119  -20.467 16.293  1.00 47.71  ? 569  ILE A O   1 
ATOM   60   C  CB  . ILE A 1 47  ? -0.540  -19.291 13.828  1.00 46.03  ? 569  ILE A CB  1 
ATOM   61   C  CG1 . ILE A 1 47  ? 0.077   -18.132 13.053  1.00 45.02  ? 569  ILE A CG1 1 
ATOM   62   C  CG2 . ILE A 1 47  ? -0.852  -20.438 12.870  1.00 45.37  ? 569  ILE A CG2 1 
ATOM   63   C  CD1 . ILE A 1 47  ? 1.455   -18.439 12.513  1.00 43.94  ? 569  ILE A CD1 1 
ATOM   64   N  N   . SER A 1 48  ? -3.451  -20.593 14.504  1.00 44.61  ? 570  SER A N   1 
ATOM   65   C  CA  . SER A 1 48  ? -4.096  -21.815 14.943  1.00 44.73  ? 570  SER A CA  1 
ATOM   66   C  C   . SER A 1 48  ? -4.531  -22.663 13.753  1.00 43.09  ? 570  SER A C   1 
ATOM   67   O  O   . SER A 1 48  ? -4.824  -22.141 12.689  1.00 41.97  ? 570  SER A O   1 
ATOM   68   C  CB  . SER A 1 48  ? -5.277  -21.483 15.844  1.00 45.97  ? 570  SER A CB  1 
ATOM   69   O  OG  . SER A 1 48  ? -6.160  -20.620 15.179  1.00 45.31  ? 570  SER A OG  1 
ATOM   70   N  N   . PHE A 1 49  ? -4.553  -23.978 13.945  1.00 43.96  ? 571  PHE A N   1 
ATOM   71   C  CA  . PHE A 1 49  ? -4.966  -24.921 12.906  1.00 43.25  ? 571  PHE A CA  1 
ATOM   72   C  C   . PHE A 1 49  ? -5.216  -26.319 13.450  1.00 43.49  ? 571  PHE A C   1 
ATOM   73   O  O   . PHE A 1 49  ? -4.663  -26.706 14.481  1.00 44.64  ? 571  PHE A O   1 
ATOM   74   C  CB  . PHE A 1 49  ? -3.894  -25.040 11.836  1.00 42.30  ? 571  PHE A CB  1 
ATOM   75   C  CG  . PHE A 1 49  ? -2.581  -25.565 12.351  1.00 43.21  ? 571  PHE A CG  1 
ATOM   76   C  CD1 . PHE A 1 49  ? -1.665  -24.712 12.954  1.00 43.73  ? 571  PHE A CD1 1 
ATOM   77   C  CD2 . PHE A 1 49  ? -2.254  -26.909 12.224  1.00 43.33  ? 571  PHE A CD2 1 
ATOM   78   C  CE1 . PHE A 1 49  ? -0.452  -25.190 13.429  1.00 43.96  ? 571  PHE A CE1 1 
ATOM   79   C  CE2 . PHE A 1 49  ? -1.033  -27.384 12.685  1.00 44.16  ? 571  PHE A CE2 1 
ATOM   80   C  CZ  . PHE A 1 49  ? -0.133  -26.527 13.297  1.00 43.71  ? 571  PHE A CZ  1 
ATOM   81   N  N   . CYS A 1 50  ? -6.029  -27.072 12.716  1.00 42.48  ? 572  CYS A N   1 
ATOM   82   C  CA  . CYS A 1 50  ? -6.220  -28.484 12.953  1.00 42.60  ? 572  CYS A CA  1 
ATOM   83   C  C   . CYS A 1 50  ? -5.197  -29.229 12.109  1.00 41.51  ? 572  CYS A C   1 
ATOM   84   O  O   . CYS A 1 50  ? -5.157  -29.024 10.900  1.00 40.21  ? 572  CYS A O   1 
ATOM   85   C  CB  . CYS A 1 50  ? -7.647  -28.918 12.571  1.00 42.59  ? 572  CYS A CB  1 
ATOM   86   S  SG  . CYS A 1 50  ? -8.047  -30.634 12.996  1.00 42.07  ? 572  CYS A SG  1 
ATOM   87   N  N   . PRO A 1 51  ? -4.364  -30.086 12.734  1.00 42.88  ? 573  PRO A N   1 
ATOM   88   C  CA  . PRO A 1 51  ? -3.344  -30.879 12.019  1.00 43.54  ? 573  PRO A CA  1 
ATOM   89   C  C   . PRO A 1 51  ? -3.879  -31.779 10.908  1.00 43.91  ? 573  PRO A C   1 
ATOM   90   O  O   . PRO A 1 51  ? -3.117  -32.209 10.050  1.00 42.77  ? 573  PRO A O   1 
ATOM   91   C  CB  . PRO A 1 51  ? -2.728  -31.754 13.125  1.00 43.96  ? 573  PRO A CB  1 
ATOM   92   C  CG  . PRO A 1 51  ? -2.943  -30.996 14.377  1.00 44.78  ? 573  PRO A CG  1 
ATOM   93   C  CD  . PRO A 1 51  ? -4.244  -30.252 14.194  1.00 45.11  ? 573  PRO A CD  1 
ATOM   94   N  N   . LYS A 1 52  ? -5.166  -31.980 10.911  1.00 46.31  ? 574  LYS A N   1 
ATOM   95   C  CA  . LYS A 1 52  ? -5.804  -32.816 9.950   1.00 47.63  ? 574  LYS A CA  1 
ATOM   96   C  C   . LYS A 1 52  ? -6.051  -32.084 8.633   1.00 44.02  ? 574  LYS A C   1 
ATOM   97   O  O   . LYS A 1 52  ? -6.213  -32.694 7.617   1.00 42.44  ? 574  LYS A O   1 
ATOM   98   C  CB  . LYS A 1 52  ? -7.097  -33.302 10.570  1.00 52.46  ? 574  LYS A CB  1 
ATOM   99   C  CG  . LYS A 1 52  ? -7.377  -34.763 10.414  1.00 56.25  ? 574  LYS A CG  1 
ATOM   100  C  CD  . LYS A 1 52  ? -6.742  -35.575 11.498  1.00 60.78  ? 574  LYS A CD  1 
ATOM   101  C  CE  . LYS A 1 52  ? -6.458  -36.960 10.972  1.00 64.06  ? 574  LYS A CE  1 
ATOM   102  N  NZ  . LYS A 1 52  ? -7.345  -37.927 11.648  1.00 67.73  ? 574  LYS A NZ  1 
ATOM   103  N  N   . ASP A 1 53  ? -6.064  -30.766 8.681   1.00 42.40  ? 575  ASP A N   1 
ATOM   104  C  CA  . ASP A 1 53  ? -6.280  -29.925 7.493   1.00 40.38  ? 575  ASP A CA  1 
ATOM   105  C  C   . ASP A 1 53  ? -4.977  -29.665 6.740   1.00 38.75  ? 575  ASP A C   1 
ATOM   106  O  O   . ASP A 1 53  ? -4.513  -28.532 6.641   1.00 36.95  ? 575  ASP A O   1 
ATOM   107  C  CB  . ASP A 1 53  ? -6.948  -28.588 7.866   1.00 40.31  ? 575  ASP A CB  1 
ATOM   108  C  CG  . ASP A 1 53  ? -8.251  -28.763 8.614   1.00 41.24  ? 575  ASP A CG  1 
ATOM   109  O  OD1 . ASP A 1 53  ? -8.953  -29.756 8.383   1.00 42.33  ? 575  ASP A OD1 1 
ATOM   110  O  OD2 . ASP A 1 53  ? -8.568  -27.910 9.450   1.00 41.72  ? 575  ASP A OD2 1 
ATOM   111  N  N   . VAL A 1 54  ? -4.412  -30.735 6.191   1.00 39.67  ? 576  VAL A N   1 
ATOM   112  C  CA  . VAL A 1 54  ? -3.177  -30.688 5.410   1.00 39.05  ? 576  VAL A CA  1 
ATOM   113  C  C   . VAL A 1 54  ? -3.494  -30.204 3.999   1.00 38.83  ? 576  VAL A C   1 
ATOM   114  O  O   . VAL A 1 54  ? -4.376  -30.753 3.347   1.00 40.64  ? 576  VAL A O   1 
ATOM   115  C  CB  . VAL A 1 54  ? -2.507  -32.083 5.321   1.00 39.22  ? 576  VAL A CB  1 
ATOM   116  C  CG1 . VAL A 1 54  ? -1.140  -31.996 4.652   1.00 37.72  ? 576  VAL A CG1 1 
ATOM   117  C  CG2 . VAL A 1 54  ? -2.392  -32.708 6.705   1.00 40.56  ? 576  VAL A CG2 1 
ATOM   118  N  N   . LEU A 1 55  ? -2.796  -29.167 3.538   1.00 38.11  ? 577  LEU A N   1 
ATOM   119  C  CA  . LEU A 1 55  ? -2.989  -28.670 2.182   1.00 38.48  ? 577  LEU A CA  1 
ATOM   120  C  C   . LEU A 1 55  ? -1.960  -29.235 1.233   1.00 38.50  ? 577  LEU A C   1 
ATOM   121  O  O   . LEU A 1 55  ? -2.085  -29.063 0.029   1.00 39.47  ? 577  LEU A O   1 
ATOM   122  C  CB  . LEU A 1 55  ? -2.884  -27.143 2.142   1.00 37.44  ? 577  LEU A CB  1 
ATOM   123  C  CG  . LEU A 1 55  ? -3.926  -26.336 2.893   1.00 38.14  ? 577  LEU A CG  1 
ATOM   124  C  CD1 . LEU A 1 55  ? -3.597  -24.857 2.832   1.00 37.08  ? 577  LEU A CD1 1 
ATOM   125  C  CD2 . LEU A 1 55  ? -5.309  -26.624 2.332   1.00 39.11  ? 577  LEU A CD2 1 
ATOM   126  N  N   . GLY A 1 56  ? -0.917  -29.851 1.772   1.00 39.99  ? 578  GLY A N   1 
ATOM   127  C  CA  . GLY A 1 56  ? 0.187   -30.354 0.958   1.00 40.62  ? 578  GLY A CA  1 
ATOM   128  C  C   . GLY A 1 56  ? 1.545   -30.150 1.599   1.00 40.71  ? 578  GLY A C   1 
ATOM   129  O  O   . GLY A 1 56  ? 1.663   -29.954 2.806   1.00 40.56  ? 578  GLY A O   1 
ATOM   130  N  N   . HIS A 1 57  ? 2.579   -30.203 0.776   1.00 42.45  ? 579  HIS A N   1 
ATOM   131  C  CA  . HIS A 1 57  ? 3.942   -30.023 1.256   1.00 45.33  ? 579  HIS A CA  1 
ATOM   132  C  C   . HIS A 1 57  ? 4.701   -29.117 0.326   1.00 44.78  ? 579  HIS A C   1 
ATOM   133  O  O   . HIS A 1 57  ? 4.422   -29.085 -0.872  1.00 44.08  ? 579  HIS A O   1 
ATOM   134  C  CB  . HIS A 1 57  ? 4.666   -31.369 1.327   1.00 46.02  ? 579  HIS A CB  1 
ATOM   135  C  CG  . HIS A 1 57  ? 3.936   -32.400 2.119   1.00 46.52  ? 579  HIS A CG  1 
ATOM   136  N  ND1 . HIS A 1 57  ? 2.941   -33.179 1.578   1.00 47.41  ? 579  HIS A ND1 1 
ATOM   137  C  CD2 . HIS A 1 57  ? 4.045   -32.772 3.416   1.00 47.87  ? 579  HIS A CD2 1 
ATOM   138  C  CE1 . HIS A 1 57  ? 2.471   -33.992 2.509   1.00 48.96  ? 579  HIS A CE1 1 
ATOM   139  N  NE2 . HIS A 1 57  ? 3.129   -33.770 3.631   1.00 47.89  ? 579  HIS A NE2 1 
ATOM   140  N  N   . GLY A 1 58  ? 5.665   -28.394 0.893   1.00 47.25  ? 580  GLY A N   1 
ATOM   141  C  CA  . GLY A 1 58  ? 6.641   -27.630 0.117   1.00 47.45  ? 580  GLY A CA  1 
ATOM   142  C  C   . GLY A 1 58  ? 7.908   -28.445 -0.077  1.00 46.92  ? 580  GLY A C   1 
ATOM   143  O  O   . GLY A 1 58  ? 7.849   -29.592 -0.493  1.00 47.05  ? 580  GLY A O   1 
ATOM   144  N  N   . ALA A 1 59  ? 9.056   -27.859 0.238   1.00 46.79  ? 581  ALA A N   1 
ATOM   145  C  CA  . ALA A 1 59  ? 10.304  -28.594 0.202   1.00 47.28  ? 581  ALA A CA  1 
ATOM   146  C  C   . ALA A 1 59  ? 10.254  -29.757 1.189   1.00 47.79  ? 581  ALA A C   1 
ATOM   147  O  O   . ALA A 1 59  ? 9.541   -29.706 2.197   1.00 48.89  ? 581  ALA A O   1 
ATOM   148  C  CB  . ALA A 1 59  ? 11.474  -27.682 0.541   1.00 47.81  ? 581  ALA A CB  1 
ATOM   149  N  N   . GLU A 1 60  ? 11.035  -30.792 0.895   1.00 45.43  ? 582  GLU A N   1 
ATOM   150  C  CA  . GLU A 1 60  ? 11.184  -31.933 1.775   1.00 44.30  ? 582  GLU A CA  1 
ATOM   151  C  C   . GLU A 1 60  ? 11.454  -31.485 3.196   1.00 44.00  ? 582  GLU A C   1 
ATOM   152  O  O   . GLU A 1 60  ? 12.370  -30.718 3.438   1.00 46.25  ? 582  GLU A O   1 
ATOM   153  C  CB  . GLU A 1 60  ? 12.322  -32.822 1.281   1.00 44.98  ? 582  GLU A CB  1 
ATOM   154  C  CG  . GLU A 1 60  ? 12.357  -34.194 1.930   1.00 45.60  ? 582  GLU A CG  1 
ATOM   155  C  CD  . GLU A 1 60  ? 13.231  -35.173 1.174   1.00 45.30  ? 582  GLU A CD  1 
ATOM   156  O  OE1 . GLU A 1 60  ? 13.133  -36.396 1.442   1.00 45.29  ? 582  GLU A OE1 1 
ATOM   157  O  OE2 . GLU A 1 60  ? 14.009  -34.710 0.319   1.00 43.96  ? 582  GLU A OE2 1 
ATOM   158  N  N   . GLY A 1 61  ? 10.639  -31.951 4.134   1.00 43.70  ? 583  GLY A N   1 
ATOM   159  C  CA  . GLY A 1 61  ? 10.738  -31.519 5.525   1.00 43.20  ? 583  GLY A CA  1 
ATOM   160  C  C   . GLY A 1 61  ? 9.775   -30.420 5.942   1.00 42.69  ? 583  GLY A C   1 
ATOM   161  O  O   . GLY A 1 61  ? 9.796   -30.007 7.099   1.00 42.25  ? 583  GLY A O   1 
ATOM   162  N  N   . THR A 1 62  ? 8.953   -29.923 5.010   1.00 42.08  ? 584  THR A N   1 
ATOM   163  C  CA  . THR A 1 62  ? 7.890   -28.974 5.347   1.00 41.72  ? 584  THR A CA  1 
ATOM   164  C  C   . THR A 1 62  ? 6.491   -29.580 5.147   1.00 42.40  ? 584  THR A C   1 
ATOM   165  O  O   . THR A 1 62  ? 6.263   -30.422 4.267   1.00 42.41  ? 584  THR A O   1 
ATOM   166  C  CB  . THR A 1 62  ? 7.959   -27.665 4.522   1.00 40.42  ? 584  THR A CB  1 
ATOM   167  O  OG1 . THR A 1 62  ? 7.506   -27.903 3.187   1.00 38.93  ? 584  THR A OG1 1 
ATOM   168  C  CG2 . THR A 1 62  ? 9.368   -27.075 4.507   1.00 40.73  ? 584  THR A CG2 1 
ATOM   169  N  N   . ILE A 1 63  ? 5.546   -29.117 5.961   1.00 41.91  ? 585  ILE A N   1 
ATOM   170  C  CA  . ILE A 1 63  ? 4.143   -29.453 5.759   1.00 40.46  ? 585  ILE A CA  1 
ATOM   171  C  C   . ILE A 1 63  ? 3.299   -28.177 5.854   1.00 39.19  ? 585  ILE A C   1 
ATOM   172  O  O   . ILE A 1 63  ? 3.594   -27.273 6.644   1.00 38.96  ? 585  ILE A O   1 
ATOM   173  C  CB  . ILE A 1 63  ? 3.695   -30.591 6.723   1.00 41.27  ? 585  ILE A CB  1 
ATOM   174  C  CG1 . ILE A 1 63  ? 2.234   -30.970 6.490   1.00 40.37  ? 585  ILE A CG1 1 
ATOM   175  C  CG2 . ILE A 1 63  ? 3.975   -30.239 8.180   1.00 42.24  ? 585  ILE A CG2 1 
ATOM   176  C  CD1 . ILE A 1 63  ? 1.833   -32.233 7.207   1.00 41.90  ? 585  ILE A CD1 1 
ATOM   177  N  N   . VAL A 1 64  ? 2.280   -28.092 5.008   1.00 37.53  ? 586  VAL A N   1 
ATOM   178  C  CA  . VAL A 1 64  ? 1.384   -26.942 4.995   1.00 37.39  ? 586  VAL A CA  1 
ATOM   179  C  C   . VAL A 1 64  ? -0.014  -27.337 5.480   1.00 36.94  ? 586  VAL A C   1 
ATOM   180  O  O   . VAL A 1 64  ? -0.569  -28.335 5.022   1.00 35.92  ? 586  VAL A O   1 
ATOM   181  C  CB  . VAL A 1 64  ? 1.310   -26.291 3.599   1.00 37.05  ? 586  VAL A CB  1 
ATOM   182  C  CG1 . VAL A 1 64  ? 0.385   -25.093 3.616   1.00 37.78  ? 586  VAL A CG1 1 
ATOM   183  C  CG2 . VAL A 1 64  ? 2.695   -25.837 3.163   1.00 37.50  ? 586  VAL A CG2 1 
ATOM   184  N  N   . TYR A 1 65  ? -0.552  -26.544 6.409   1.00 36.66  ? 587  TYR A N   1 
ATOM   185  C  CA  . TYR A 1 65  ? -1.883  -26.748 6.985   1.00 38.12  ? 587  TYR A CA  1 
ATOM   186  C  C   . TYR A 1 65  ? -2.798  -25.572 6.640   1.00 37.32  ? 587  TYR A C   1 
ATOM   187  O  O   . TYR A 1 65  ? -2.329  -24.496 6.387   1.00 35.86  ? 587  TYR A O   1 
ATOM   188  C  CB  . TYR A 1 65  ? -1.790  -26.855 8.514   1.00 39.81  ? 587  TYR A CB  1 
ATOM   189  C  CG  . TYR A 1 65  ? -0.874  -27.941 9.053   1.00 40.60  ? 587  TYR A CG  1 
ATOM   190  C  CD1 . TYR A 1 65  ? -1.334  -29.239 9.244   1.00 41.98  ? 587  TYR A CD1 1 
ATOM   191  C  CD2 . TYR A 1 65  ? 0.440   -27.665 9.408   1.00 41.22  ? 587  TYR A CD2 1 
ATOM   192  C  CE1 . TYR A 1 65  ? -0.510  -30.234 9.752   1.00 42.51  ? 587  TYR A CE1 1 
ATOM   193  C  CE2 . TYR A 1 65  ? 1.276   -28.659 9.921   1.00 41.74  ? 587  TYR A CE2 1 
ATOM   194  C  CZ  . TYR A 1 65  ? 0.796   -29.940 10.091  1.00 42.12  ? 587  TYR A CZ  1 
ATOM   195  O  OH  . TYR A 1 65  ? 1.609   -30.933 10.593  1.00 42.88  ? 587  TYR A OH  1 
ATOM   196  N  N   . ARG A 1 66  ? -4.108  -25.782 6.629   1.00 39.22  ? 588  ARG A N   1 
ATOM   197  C  CA  . ARG A 1 66  ? -5.063  -24.659 6.593   1.00 40.40  ? 588  ARG A CA  1 
ATOM   198  C  C   . ARG A 1 66  ? -5.294  -24.187 8.031   1.00 40.79  ? 588  ARG A C   1 
ATOM   199  O  O   . ARG A 1 66  ? -5.338  -24.998 8.934   1.00 41.86  ? 588  ARG A O   1 
ATOM   200  C  CB  . ARG A 1 66  ? -6.394  -25.075 5.958   1.00 41.71  ? 588  ARG A CB  1 
ATOM   201  C  CG  . ARG A 1 66  ? -7.276  -23.932 5.473   1.00 42.72  ? 588  ARG A CG  1 
ATOM   202  C  CD  . ARG A 1 66  ? -8.714  -24.390 5.353   1.00 45.39  ? 588  ARG A CD  1 
ATOM   203  N  NE  . ARG A 1 66  ? -9.370  -24.257 6.639   1.00 50.29  ? 588  ARG A NE  1 
ATOM   204  C  CZ  . ARG A 1 66  ? -10.266 -25.096 7.148   1.00 54.29  ? 588  ARG A CZ  1 
ATOM   205  N  NH1 . ARG A 1 66  ? -10.790 -24.839 8.328   1.00 56.31  ? 588  ARG A NH1 1 
ATOM   206  N  NH2 . ARG A 1 66  ? -10.644 -26.191 6.504   1.00 57.16  ? 588  ARG A NH2 1 
ATOM   207  N  N   . GLY A 1 67  ? -5.422  -22.882 8.241   1.00 41.05  ? 589  GLY A N   1 
ATOM   208  C  CA  . GLY A 1 67  ? -5.577  -22.339 9.585   1.00 42.46  ? 589  GLY A CA  1 
ATOM   209  C  C   . GLY A 1 67  ? -6.155  -20.943 9.653   1.00 42.49  ? 589  GLY A C   1 
ATOM   210  O  O   . GLY A 1 67  ? -6.731  -20.445 8.688   1.00 40.82  ? 589  GLY A O   1 
ATOM   211  N  N   . MET A 1 68  ? -5.987  -20.326 10.817  1.00 44.45  ? 590  MET A N   1 
ATOM   212  C  CA  . MET A 1 68  ? -6.579  -19.027 11.120  1.00 46.51  ? 590  MET A CA  1 
ATOM   213  C  C   . MET A 1 68  ? -5.519  -18.099 11.706  1.00 45.72  ? 590  MET A C   1 
ATOM   214  O  O   . MET A 1 68  ? -4.640  -18.537 12.448  1.00 44.59  ? 590  MET A O   1 
ATOM   215  C  CB  . MET A 1 68  ? -7.716  -19.170 12.138  1.00 50.48  ? 590  MET A CB  1 
ATOM   216  C  CG  . MET A 1 68  ? -8.839  -20.121 11.755  1.00 52.31  ? 590  MET A CG  1 
ATOM   217  S  SD  . MET A 1 68  ? -9.914  -19.467 10.477  1.00 55.82  ? 590  MET A SD  1 
ATOM   218  C  CE  . MET A 1 68  ? -10.903 -18.299 11.413  1.00 56.40  ? 590  MET A CE  1 
ATOM   219  N  N   . PHE A 1 69  ? -5.604  -16.822 11.343  1.00 45.23  ? 591  PHE A N   1 
ATOM   220  C  CA  . PHE A 1 69  ? -4.793  -15.759 11.934  1.00 45.77  ? 591  PHE A CA  1 
ATOM   221  C  C   . PHE A 1 69  ? -5.668  -14.521 11.932  1.00 46.47  ? 591  PHE A C   1 
ATOM   222  O  O   . PHE A 1 69  ? -6.103  -14.092 10.868  1.00 45.38  ? 591  PHE A O   1 
ATOM   223  C  CB  . PHE A 1 69  ? -3.501  -15.502 11.122  1.00 44.23  ? 591  PHE A CB  1 
ATOM   224  C  CG  . PHE A 1 69  ? -2.806  -14.211 11.481  1.00 45.21  ? 591  PHE A CG  1 
ATOM   225  C  CD1 . PHE A 1 69  ? -2.040  -14.115 12.640  1.00 47.24  ? 591  PHE A CD1 1 
ATOM   226  C  CD2 . PHE A 1 69  ? -2.944  -13.078 10.678  1.00 44.91  ? 591  PHE A CD2 1 
ATOM   227  C  CE1 . PHE A 1 69  ? -1.420  -12.922 12.983  1.00 48.30  ? 591  PHE A CE1 1 
ATOM   228  C  CE2 . PHE A 1 69  ? -2.326  -11.886 11.008  1.00 45.85  ? 591  PHE A CE2 1 
ATOM   229  C  CZ  . PHE A 1 69  ? -1.565  -11.805 12.166  1.00 47.91  ? 591  PHE A CZ  1 
ATOM   230  N  N   . ASP A 1 70  ? -5.960  -13.976 13.111  1.00 48.77  ? 592  ASP A N   1 
ATOM   231  C  CA  . ASP A 1 70  ? -6.734  -12.734 13.244  1.00 49.66  ? 592  ASP A CA  1 
ATOM   232  C  C   . ASP A 1 70  ? -8.057  -12.791 12.472  1.00 48.96  ? 592  ASP A C   1 
ATOM   233  O  O   . ASP A 1 70  ? -8.428  -11.860 11.744  1.00 47.12  ? 592  ASP A O   1 
ATOM   234  C  CB  . ASP A 1 70  ? -5.869  -11.566 12.772  1.00 49.74  ? 592  ASP A CB  1 
ATOM   235  C  CG  . ASP A 1 70  ? -6.369  -10.225 13.254  1.00 52.13  ? 592  ASP A CG  1 
ATOM   236  O  OD1 . ASP A 1 70  ? -7.080  -10.147 14.284  1.00 54.23  ? 592  ASP A OD1 1 
ATOM   237  O  OD2 . ASP A 1 70  ? -6.029  -9.235  12.586  1.00 52.08  ? 592  ASP A OD2 1 
ATOM   238  N  N   . ASN A 1 71  ? -8.734  -13.924 12.624  1.00 49.44  ? 593  ASN A N   1 
ATOM   239  C  CA  . ASN A 1 71  ? -9.970  -14.232 11.907  1.00 49.95  ? 593  ASN A CA  1 
ATOM   240  C  C   . ASN A 1 71  ? -9.876  -14.282 10.380  1.00 47.92  ? 593  ASN A C   1 
ATOM   241  O  O   . ASN A 1 71  ? -10.894 -14.202 9.695   1.00 47.63  ? 593  ASN A O   1 
ATOM   242  C  CB  . ASN A 1 71  ? -11.081 -13.279 12.343  1.00 52.36  ? 593  ASN A CB  1 
ATOM   243  C  CG  . ASN A 1 71  ? -11.276 -13.267 13.844  1.00 54.99  ? 593  ASN A CG  1 
ATOM   244  O  OD1 . ASN A 1 71  ? -11.301 -14.310 14.494  1.00 55.52  ? 593  ASN A OD1 1 
ATOM   245  N  ND2 . ASN A 1 71  ? -11.417 -12.083 14.403  1.00 57.38  ? 593  ASN A ND2 1 
ATOM   246  N  N   . ARG A 1 72  ? -8.666  -14.443 9.849   1.00 47.13  ? 594  ARG A N   1 
ATOM   247  C  CA  . ARG A 1 72  ? -8.456  -14.612 8.409   1.00 45.88  ? 594  ARG A CA  1 
ATOM   248  C  C   . ARG A 1 72  ? -8.062  -16.058 8.118   1.00 43.98  ? 594  ARG A C   1 
ATOM   249  O  O   . ARG A 1 72  ? -7.443  -16.728 8.940   1.00 44.30  ? 594  ARG A O   1 
ATOM   250  C  CB  . ARG A 1 72  ? -7.352  -13.682 7.882   1.00 46.47  ? 594  ARG A CB  1 
ATOM   251  C  CG  . ARG A 1 72  ? -7.536  -12.182 8.155   1.00 49.63  ? 594  ARG A CG  1 
ATOM   252  C  CD  . ARG A 1 72  ? -6.218  -11.401 8.002   1.00 49.80  ? 594  ARG A CD  1 
ATOM   253  N  NE  . ARG A 1 72  ? -6.391  -9.944  7.914   1.00 50.63  ? 594  ARG A NE  1 
ATOM   254  C  CZ  . ARG A 1 72  ? -6.709  -9.275  6.801   1.00 50.57  ? 594  ARG A CZ  1 
ATOM   255  N  NH1 . ARG A 1 72  ? -6.840  -7.955  6.828   1.00 52.57  ? 594  ARG A NH1 1 
ATOM   256  N  NH2 . ARG A 1 72  ? -6.912  -9.906  5.654   1.00 49.03  ? 594  ARG A NH2 1 
ATOM   257  N  N   . ASP A 1 73  ? -8.415  -16.538 6.935   1.00 42.15  ? 595  ASP A N   1 
ATOM   258  C  CA  . ASP A 1 73  ? -7.949  -17.844 6.487   1.00 40.10  ? 595  ASP A CA  1 
ATOM   259  C  C   . ASP A 1 73  ? -6.513  -17.730 6.037   1.00 38.14  ? 595  ASP A C   1 
ATOM   260  O  O   . ASP A 1 73  ? -6.168  -16.832 5.271   1.00 37.21  ? 595  ASP A O   1 
ATOM   261  C  CB  . ASP A 1 73  ? -8.787  -18.361 5.327   1.00 39.20  ? 595  ASP A CB  1 
ATOM   262  C  CG  . ASP A 1 73  ? -10.176 -18.765 5.744   1.00 39.60  ? 595  ASP A CG  1 
ATOM   263  O  OD1 . ASP A 1 73  ? -10.350 -19.266 6.874   1.00 41.26  ? 595  ASP A OD1 1 
ATOM   264  O  OD2 . ASP A 1 73  ? -11.093 -18.591 4.926   1.00 39.10  ? 595  ASP A OD2 1 
ATOM   265  N  N   . VAL A 1 74  ? -5.679  -18.645 6.520   1.00 37.80  ? 596  VAL A N   1 
ATOM   266  C  CA  . VAL A 1 74  ? -4.271  -18.689 6.138   1.00 36.18  ? 596  VAL A CA  1 
ATOM   267  C  C   . VAL A 1 74  ? -3.799  -20.088 5.797   1.00 34.68  ? 596  VAL A C   1 
ATOM   268  O  O   . VAL A 1 74  ? -4.397  -21.088 6.184   1.00 33.42  ? 596  VAL A O   1 
ATOM   269  C  CB  . VAL A 1 74  ? -3.344  -18.139 7.250   1.00 37.74  ? 596  VAL A CB  1 
ATOM   270  C  CG1 . VAL A 1 74  ? -3.552  -16.635 7.437   1.00 38.91  ? 596  VAL A CG1 1 
ATOM   271  C  CG2 . VAL A 1 74  ? -3.535  -18.892 8.570   1.00 38.91  ? 596  VAL A CG2 1 
ATOM   272  N  N   . ALA A 1 75  ? -2.702  -20.127 5.053   1.00 34.87  ? 597  ALA A N   1 
ATOM   273  C  CA  . ALA A 1 75  ? -1.937  -21.359 4.835   1.00 35.07  ? 597  ALA A CA  1 
ATOM   274  C  C   . ALA A 1 75  ? -0.753  -21.288 5.776   1.00 34.85  ? 597  ALA A C   1 
ATOM   275  O  O   . ALA A 1 75  ? -0.084  -20.264 5.857   1.00 34.32  ? 597  ALA A O   1 
ATOM   276  C  CB  . ALA A 1 75  ? -1.477  -21.474 3.388   1.00 33.91  ? 597  ALA A CB  1 
ATOM   277  N  N   . VAL A 1 76  ? -0.525  -22.361 6.512   1.00 36.04  ? 598  VAL A N   1 
ATOM   278  C  CA  . VAL A 1 76  ? 0.509   -22.384 7.540   1.00 37.15  ? 598  VAL A CA  1 
ATOM   279  C  C   . VAL A 1 76  ? 1.535   -23.464 7.256   1.00 36.79  ? 598  VAL A C   1 
ATOM   280  O  O   . VAL A 1 76  ? 1.256   -24.656 7.400   1.00 36.07  ? 598  VAL A O   1 
ATOM   281  C  CB  . VAL A 1 76  ? -0.086  -22.624 8.923   1.00 38.65  ? 598  VAL A CB  1 
ATOM   282  C  CG1 . VAL A 1 76  ? 1.008   -22.537 9.974   1.00 40.42  ? 598  VAL A CG1 1 
ATOM   283  C  CG2 . VAL A 1 76  ? -1.174  -21.608 9.203   1.00 40.19  ? 598  VAL A CG2 1 
ATOM   284  N  N   . LYS A 1 77  ? 2.723   -23.035 6.861   1.00 37.25  ? 599  LYS A N   1 
ATOM   285  C  CA  . LYS A 1 77  ? 3.823   -23.946 6.600   1.00 38.84  ? 599  LYS A CA  1 
ATOM   286  C  C   . LYS A 1 77  ? 4.613   -24.183 7.875   1.00 39.48  ? 599  LYS A C   1 
ATOM   287  O  O   . LYS A 1 77  ? 5.107   -23.250 8.474   1.00 39.52  ? 599  LYS A O   1 
ATOM   288  C  CB  . LYS A 1 77  ? 4.720   -23.368 5.509   1.00 39.51  ? 599  LYS A CB  1 
ATOM   289  C  CG  . LYS A 1 77  ? 5.942   -24.205 5.169   1.00 41.34  ? 599  LYS A CG  1 
ATOM   290  C  CD  . LYS A 1 77  ? 6.213   -24.251 3.665   1.00 42.91  ? 599  LYS A CD  1 
ATOM   291  C  CE  . LYS A 1 77  ? 7.499   -23.547 3.264   1.00 44.84  ? 599  LYS A CE  1 
ATOM   292  N  NZ  . LYS A 1 77  ? 7.609   -23.517 1.776   1.00 46.46  ? 599  LYS A NZ  1 
ATOM   293  N  N   . ARG A 1 78  ? 4.709   -25.439 8.287   1.00 40.35  ? 600  ARG A N   1 
ATOM   294  C  CA  . ARG A 1 78  ? 5.545   -25.816 9.394   1.00 42.79  ? 600  ARG A CA  1 
ATOM   295  C  C   . ARG A 1 78  ? 6.931   -26.205 8.879   1.00 44.97  ? 600  ARG A C   1 
ATOM   296  O  O   . ARG A 1 78  ? 7.054   -27.014 7.961   1.00 45.36  ? 600  ARG A O   1 
ATOM   297  C  CB  . ARG A 1 78  ? 4.914   -26.987 10.122  1.00 44.03  ? 600  ARG A CB  1 
ATOM   298  C  CG  . ARG A 1 78  ? 5.500   -27.230 11.494  1.00 45.45  ? 600  ARG A CG  1 
ATOM   299  C  CD  . ARG A 1 78  ? 4.974   -28.508 12.089  1.00 46.33  ? 600  ARG A CD  1 
ATOM   300  N  NE  . ARG A 1 78  ? 5.608   -29.662 11.474  1.00 46.49  ? 600  ARG A NE  1 
ATOM   301  C  CZ  . ARG A 1 78  ? 5.379   -30.919 11.828  1.00 46.46  ? 600  ARG A CZ  1 
ATOM   302  N  NH1 . ARG A 1 78  ? 4.530   -31.191 12.798  1.00 46.81  ? 600  ARG A NH1 1 
ATOM   303  N  NH2 . ARG A 1 78  ? 6.023   -31.903 11.216  1.00 47.01  ? 600  ARG A NH2 1 
ATOM   304  N  N   . ILE A 1 79  ? 7.973   -25.626 9.459   1.00 48.51  ? 601  ILE A N   1 
ATOM   305  C  CA  . ILE A 1 79  ? 9.347   -25.934 9.038   1.00 51.85  ? 601  ILE A CA  1 
ATOM   306  C  C   . ILE A 1 79  ? 10.248  -26.295 10.220  1.00 52.00  ? 601  ILE A C   1 
ATOM   307  O  O   . ILE A 1 79  ? 10.063  -25.797 11.330  1.00 49.73  ? 601  ILE A O   1 
ATOM   308  C  CB  . ILE A 1 79  ? 10.020  -24.767 8.260   1.00 53.49  ? 601  ILE A CB  1 
ATOM   309  C  CG1 . ILE A 1 79  ? 10.333  -23.591 9.192   1.00 56.73  ? 601  ILE A CG1 1 
ATOM   310  C  CG2 . ILE A 1 79  ? 9.171   -24.312 7.074   1.00 52.60  ? 601  ILE A CG2 1 
ATOM   311  C  CD1 . ILE A 1 79  ? 10.943  -22.401 8.483   1.00 59.77  ? 601  ILE A CD1 1 
ATOM   312  N  N   . LEU A 1 80  ? 11.249  -27.126 9.933   1.00 54.38  ? 602  LEU A N   1 
ATOM   313  C  CA  . LEU A 1 80  ? 12.221  -27.604 10.924  1.00 59.35  ? 602  LEU A CA  1 
ATOM   314  C  C   . LEU A 1 80  ? 13.359  -26.599 11.219  1.00 60.58  ? 602  LEU A C   1 
ATOM   315  O  O   . LEU A 1 80  ? 13.533  -25.623 10.474  1.00 54.17  ? 602  LEU A O   1 
ATOM   316  C  CB  . LEU A 1 80  ? 12.815  -28.942 10.458  1.00 60.33  ? 602  LEU A CB  1 
ATOM   317  C  CG  . LEU A 1 80  ? 11.939  -30.188 10.614  1.00 60.66  ? 602  LEU A CG  1 
ATOM   318  C  CD1 . LEU A 1 80  ? 12.404  -31.273 9.654   1.00 61.01  ? 602  LEU A CD1 1 
ATOM   319  C  CD2 . LEU A 1 80  ? 11.952  -30.687 12.049  1.00 61.58  ? 602  LEU A CD2 1 
ATOM   320  N  N   . PRO A 1 81  ? 14.157  -26.867 12.237  1.00 66.67  ? 603  PRO A N   1 
ATOM   321  C  CA  . PRO A 1 81  ? 15.208  -25.939 12.671  1.00 70.45  ? 603  PRO A CA  1 
ATOM   322  C  C   . PRO A 1 81  ? 16.265  -25.660 11.595  1.00 70.81  ? 603  PRO A C   1 
ATOM   323  O  O   . PRO A 1 81  ? 16.749  -24.547 11.505  1.00 70.67  ? 603  PRO A O   1 
ATOM   324  C  CB  . PRO A 1 81  ? 15.812  -26.645 13.882  1.00 70.95  ? 603  PRO A CB  1 
ATOM   325  C  CG  . PRO A 1 81  ? 14.712  -27.505 14.390  1.00 70.02  ? 603  PRO A CG  1 
ATOM   326  C  CD  . PRO A 1 81  ? 14.009  -27.995 13.166  1.00 68.03  ? 603  PRO A CD  1 
ATOM   327  N  N   . GLU A 1 82  ? 16.599  -26.644 10.780  1.00 72.55  ? 604  GLU A N   1 
ATOM   328  C  CA  . GLU A 1 82  ? 17.612  -26.471 9.759   1.00 74.01  ? 604  GLU A CA  1 
ATOM   329  C  C   . GLU A 1 82  ? 17.213  -25.366 8.798   1.00 75.19  ? 604  GLU A C   1 
ATOM   330  O  O   . GLU A 1 82  ? 18.054  -24.801 8.118   1.00 75.46  ? 604  GLU A O   1 
ATOM   331  C  CB  . GLU A 1 82  ? 17.811  -27.762 8.985   1.00 76.38  ? 604  GLU A CB  1 
ATOM   332  C  CG  . GLU A 1 82  ? 16.714  -28.084 7.985   1.00 75.35  ? 604  GLU A CG  1 
ATOM   333  C  CD  . GLU A 1 82  ? 16.257  -29.517 8.101   1.00 76.39  ? 604  GLU A CD  1 
ATOM   334  O  OE1 . GLU A 1 82  ? 16.455  -30.093 9.185   1.00 79.83  ? 604  GLU A OE1 1 
ATOM   335  O  OE2 . GLU A 1 82  ? 15.715  -30.068 7.124   1.00 71.16  ? 604  GLU A OE2 1 
ATOM   336  N  N   . CYS A 1 83  ? 15.921  -25.098 8.704   1.00 77.67  ? 605  CYS A N   1 
ATOM   337  C  CA  . CYS A 1 83  ? 15.406  -24.053 7.830   1.00 80.23  ? 605  CYS A CA  1 
ATOM   338  C  C   . CYS A 1 83  ? 15.102  -22.702 8.479   1.00 80.46  ? 605  CYS A C   1 
ATOM   339  O  O   . CYS A 1 83  ? 14.526  -21.850 7.825   1.00 78.60  ? 605  CYS A O   1 
ATOM   340  C  CB  . CYS A 1 83  ? 14.118  -24.528 7.161   1.00 82.45  ? 605  CYS A CB  1 
ATOM   341  S  SG  . CYS A 1 83  ? 14.336  -25.714 5.841   1.00 83.72  ? 605  CYS A SG  1 
ATOM   342  N  N   . PHE A 1 84  ? 15.416  -22.509 9.754   1.00 80.29  ? 606  PHE A N   1 
ATOM   343  C  CA  . PHE A 1 84  ? 14.943  -21.307 10.441  1.00 80.56  ? 606  PHE A CA  1 
ATOM   344  C  C   . PHE A 1 84  ? 15.431  -19.952 9.913   1.00 82.21  ? 606  PHE A C   1 
ATOM   345  O  O   . PHE A 1 84  ? 14.624  -19.057 9.718   1.00 84.02  ? 606  PHE A O   1 
ATOM   346  C  CB  . PHE A 1 84  ? 15.221  -21.397 11.943  1.00 81.52  ? 606  PHE A CB  1 
ATOM   347  C  CG  . PHE A 1 84  ? 14.297  -22.319 12.684  1.00 79.70  ? 606  PHE A CG  1 
ATOM   348  C  CD1 . PHE A 1 84  ? 13.441  -23.164 12.005  1.00 76.46  ? 606  PHE A CD1 1 
ATOM   349  C  CD2 . PHE A 1 84  ? 14.296  -22.345 14.060  1.00 80.25  ? 606  PHE A CD2 1 
ATOM   350  C  CE1 . PHE A 1 84  ? 12.606  -24.015 12.688  1.00 74.76  ? 606  PHE A CE1 1 
ATOM   351  C  CE2 . PHE A 1 84  ? 13.457  -23.193 14.748  1.00 79.34  ? 606  PHE A CE2 1 
ATOM   352  C  CZ  . PHE A 1 84  ? 12.613  -24.029 14.060  1.00 76.73  ? 606  PHE A CZ  1 
ATOM   353  N  N   . SER A 1 85  ? 16.719  -19.793 9.636   1.00 84.11  ? 607  SER A N   1 
ATOM   354  C  CA  . SER A 1 85  ? 17.188  -18.516 9.032   1.00 84.64  ? 607  SER A CA  1 
ATOM   355  C  C   . SER A 1 85  ? 17.143  -18.491 7.478   1.00 85.09  ? 607  SER A C   1 
ATOM   356  O  O   . SER A 1 85  ? 17.288  -17.429 6.856   1.00 81.96  ? 607  SER A O   1 
ATOM   357  C  CB  . SER A 1 85  ? 18.574  -18.115 9.571   1.00 82.37  ? 607  SER A CB  1 
ATOM   358  O  OG  . SER A 1 85  ? 19.570  -19.034 9.187   1.00 78.45  ? 607  SER A OG  1 
ATOM   359  N  N   . PHE A 1 86  ? 16.924  -19.662 6.874   1.00 87.40  ? 608  PHE A N   1 
ATOM   360  C  CA  . PHE A 1 86  ? 16.664  -19.803 5.430   1.00 87.27  ? 608  PHE A CA  1 
ATOM   361  C  C   . PHE A 1 86  ? 15.300  -19.172 5.089   1.00 84.84  ? 608  PHE A C   1 
ATOM   362  O  O   . PHE A 1 86  ? 15.124  -18.609 4.008   1.00 84.32  ? 608  PHE A O   1 
ATOM   363  C  CB  . PHE A 1 86  ? 16.695  -21.306 5.042   1.00 90.07  ? 608  PHE A CB  1 
ATOM   364  C  CG  . PHE A 1 86  ? 16.989  -21.585 3.579   1.00 91.10  ? 608  PHE A CG  1 
ATOM   365  C  CD1 . PHE A 1 86  ? 16.024  -21.348 2.597   1.00 91.25  ? 608  PHE A CD1 1 
ATOM   366  C  CD2 . PHE A 1 86  ? 18.213  -22.141 3.188   1.00 91.91  ? 608  PHE A CD2 1 
ATOM   367  C  CE1 . PHE A 1 86  ? 16.284  -21.620 1.255   1.00 90.01  ? 608  PHE A CE1 1 
ATOM   368  C  CE2 . PHE A 1 86  ? 18.478  -22.413 1.848   1.00 91.37  ? 608  PHE A CE2 1 
ATOM   369  C  CZ  . PHE A 1 86  ? 17.512  -22.153 0.882   1.00 90.73  ? 608  PHE A CZ  1 
ATOM   370  N  N   . ALA A 1 87  ? 14.349  -19.259 6.025   1.00 81.84  ? 609  ALA A N   1 
ATOM   371  C  CA  . ALA A 1 87  ? 13.002  -18.684 5.867   1.00 78.39  ? 609  ALA A CA  1 
ATOM   372  C  C   . ALA A 1 87  ? 12.890  -17.255 6.403   1.00 76.78  ? 609  ALA A C   1 
ATOM   373  O  O   . ALA A 1 87  ? 12.047  -16.494 5.932   1.00 72.47  ? 609  ALA A O   1 
ATOM   374  C  CB  . ALA A 1 87  ? 11.959  -19.570 6.540   1.00 77.72  ? 609  ALA A CB  1 
ATOM   375  N  N   . ASP A 1 88  ? 13.712  -16.900 7.395   1.00 79.32  ? 610  ASP A N   1 
ATOM   376  C  CA  . ASP A 1 88  ? 13.813  -15.502 7.861   1.00 79.27  ? 610  ASP A CA  1 
ATOM   377  C  C   . ASP A 1 88  ? 14.379  -14.594 6.753   1.00 78.14  ? 610  ASP A C   1 
ATOM   378  O  O   . ASP A 1 88  ? 14.003  -13.425 6.659   1.00 76.41  ? 610  ASP A O   1 
ATOM   379  C  CB  . ASP A 1 88  ? 14.657  -15.381 9.153   1.00 79.75  ? 610  ASP A CB  1 
ATOM   380  C  CG  . ASP A 1 88  ? 13.879  -15.768 10.424  1.00 78.61  ? 610  ASP A CG  1 
ATOM   381  O  OD1 . ASP A 1 88  ? 12.702  -15.382 10.556  1.00 77.15  ? 610  ASP A OD1 1 
ATOM   382  O  OD2 . ASP A 1 88  ? 14.452  -16.439 11.307  1.00 76.23  ? 610  ASP A OD2 1 
ATOM   383  N  N   . ARG A 1 89  ? 15.267  -15.144 5.918   1.00 79.20  ? 611  ARG A N   1 
ATOM   384  C  CA  . ARG A 1 89  ? 15.789  -14.450 4.724   1.00 79.75  ? 611  ARG A CA  1 
ATOM   385  C  C   . ARG A 1 89  ? 14.678  -14.169 3.712   1.00 78.41  ? 611  ARG A C   1 
ATOM   386  O  O   . ARG A 1 89  ? 14.664  -13.118 3.079   1.00 78.18  ? 611  ARG A O   1 
ATOM   387  C  CB  . ARG A 1 89  ? 16.859  -15.304 4.028   1.00 80.11  ? 611  ARG A CB  1 
ATOM   388  C  CG  . ARG A 1 89  ? 18.166  -14.596 3.725   1.00 79.77  ? 611  ARG A CG  1 
ATOM   389  C  CD  . ARG A 1 89  ? 19.148  -14.734 4.879   1.00 80.17  ? 611  ARG A CD  1 
ATOM   390  N  NE  . ARG A 1 89  ? 20.531  -14.644 4.419   1.00 82.19  ? 611  ARG A NE  1 
ATOM   391  C  CZ  . ARG A 1 89  ? 21.605  -14.718 5.204   1.00 81.31  ? 611  ARG A CZ  1 
ATOM   392  N  NH1 . ARG A 1 89  ? 22.815  -14.632 4.666   1.00 80.95  ? 611  ARG A NH1 1 
ATOM   393  N  NH2 . ARG A 1 89  ? 21.484  -14.875 6.518   1.00 81.07  ? 611  ARG A NH2 1 
ATOM   394  N  N   . GLU A 1 90  ? 13.766  -15.126 3.557   1.00 79.09  ? 612  GLU A N   1 
ATOM   395  C  CA  . GLU A 1 90  ? 12.641  -15.011 2.626   1.00 81.15  ? 612  GLU A CA  1 
ATOM   396  C  C   . GLU A 1 90  ? 11.477  -14.162 3.164   1.00 82.18  ? 612  GLU A C   1 
ATOM   397  O  O   . GLU A 1 90  ? 10.690  -13.625 2.381   1.00 82.57  ? 612  GLU A O   1 
ATOM   398  C  CB  . GLU A 1 90  ? 12.125  -16.404 2.254   1.00 82.07  ? 612  GLU A CB  1 
ATOM   399  C  CG  . GLU A 1 90  ? 13.154  -17.301 1.576   1.00 82.60  ? 612  GLU A CG  1 
ATOM   400  C  CD  . GLU A 1 90  ? 12.714  -18.757 1.525   1.00 83.90  ? 612  GLU A CD  1 
ATOM   401  O  OE1 . GLU A 1 90  ? 13.577  -19.646 1.716   1.00 84.08  ? 612  GLU A OE1 1 
ATOM   402  O  OE2 . GLU A 1 90  ? 11.506  -19.014 1.305   1.00 79.98  ? 612  GLU A OE2 1 
ATOM   403  N  N   . VAL A 1 91  ? 11.363  -14.068 4.490   1.00 83.03  ? 613  VAL A N   1 
ATOM   404  C  CA  . VAL A 1 91  ? 10.372  -13.205 5.153   1.00 84.46  ? 613  VAL A CA  1 
ATOM   405  C  C   . VAL A 1 91  ? 10.808  -11.731 5.128   1.00 87.84  ? 613  VAL A C   1 
ATOM   406  O  O   . VAL A 1 91  ? 9.965   -10.840 4.998   1.00 89.73  ? 613  VAL A O   1 
ATOM   407  C  CB  . VAL A 1 91  ? 10.089  -13.680 6.610   1.00 84.14  ? 613  VAL A CB  1 
ATOM   408  C  CG1 . VAL A 1 91  ? 9.515   -12.568 7.489   1.00 83.18  ? 613  VAL A CG1 1 
ATOM   409  C  CG2 . VAL A 1 91  ? 9.154   -14.883 6.601   1.00 80.57  ? 613  VAL A CG2 1 
ATOM   410  N  N   . GLN A 1 92  ? 12.113  -11.480 5.244   1.00 89.00  ? 614  GLN A N   1 
ATOM   411  C  CA  . GLN A 1 92  ? 12.668  -10.123 5.119   1.00 88.94  ? 614  GLN A CA  1 
ATOM   412  C  C   . GLN A 1 92  ? 12.336  -9.532  3.739   1.00 90.17  ? 614  GLN A C   1 
ATOM   413  O  O   . GLN A 1 92  ? 11.959  -8.357  3.631   1.00 93.56  ? 614  GLN A O   1 
ATOM   414  C  CB  . GLN A 1 92  ? 14.193  -10.136 5.336   1.00 88.42  ? 614  GLN A CB  1 
ATOM   415  C  CG  . GLN A 1 92  ? 14.695  -9.237  6.461   1.00 87.10  ? 614  GLN A CG  1 
ATOM   416  C  CD  . GLN A 1 92  ? 14.511  -7.748  6.203   1.00 86.57  ? 614  GLN A CD  1 
ATOM   417  O  OE1 . GLN A 1 92  ? 14.638  -6.943  7.119   1.00 86.82  ? 614  GLN A OE1 1 
ATOM   418  N  NE2 . GLN A 1 92  ? 14.223  -7.374  4.962   1.00 82.83  ? 614  GLN A NE2 1 
ATOM   419  N  N   . LEU A 1 93  ? 12.475  -10.353 2.694   1.00 88.46  ? 615  LEU A N   1 
ATOM   420  C  CA  . LEU A 1 93  ? 12.084  -9.973  1.327   1.00 88.95  ? 615  LEU A CA  1 
ATOM   421  C  C   . LEU A 1 93  ? 10.578  -9.704  1.162   1.00 94.00  ? 615  LEU A C   1 
ATOM   422  O  O   . LEU A 1 93  ? 10.161  -9.010  0.231   1.00 93.55  ? 615  LEU A O   1 
ATOM   423  C  CB  . LEU A 1 93  ? 12.479  -11.080 0.332   1.00 83.95  ? 615  LEU A CB  1 
ATOM   424  C  CG  . LEU A 1 93  ? 13.970  -11.272 0.040   1.00 82.68  ? 615  LEU A CG  1 
ATOM   425  C  CD1 . LEU A 1 93  ? 14.195  -12.461 -0.877  1.00 79.85  ? 615  LEU A CD1 1 
ATOM   426  C  CD2 . LEU A 1 93  ? 14.565  -10.022 -0.584  1.00 83.56  ? 615  LEU A CD2 1 
ATOM   427  N  N   . LEU A 1 94  ? 9.776   -10.303 2.041   1.00 99.01  ? 616  LEU A N   1 
ATOM   428  C  CA  . LEU A 1 94  ? 8.323   -10.296 1.943   1.00 99.87  ? 616  LEU A CA  1 
ATOM   429  C  C   . LEU A 1 94  ? 7.513   -9.362  2.873   1.00 98.48  ? 616  LEU A C   1 
ATOM   430  O  O   . LEU A 1 94  ? 6.284   -9.424  2.908   1.00 99.60  ? 616  LEU A O   1 
ATOM   431  C  CB  . LEU A 1 94  ? 7.903   -11.768 1.975   1.00 101.69 ? 616  LEU A CB  1 
ATOM   432  C  CG  . LEU A 1 94  ? 7.117   -12.282 0.768   1.00 102.32 ? 616  LEU A CG  1 
ATOM   433  C  CD1 . LEU A 1 94  ? 7.617   -13.665 0.377   1.00 102.60 ? 616  LEU A CD1 1 
ATOM   434  C  CD2 . LEU A 1 94  ? 5.615   -12.289 1.033   1.00 102.27 ? 616  LEU A CD2 1 
ATOM   435  N  N   . ARG A 1 95  ? 8.199   -8.431  3.488   1.00 97.85  ? 617  ARG A N   1 
ATOM   436  C  CA  . ARG A 1 95  ? 7.580   -7.351  4.138   1.00 96.87  ? 617  ARG A CA  1 
ATOM   437  C  C   . ARG A 1 95  ? 7.802   -6.196  3.147   1.00 96.04  ? 617  ARG A C   1 
ATOM   438  O  O   . ARG A 1 95  ? 7.339   -5.079  3.369   1.00 91.11  ? 617  ARG A O   1 
ATOM   439  C  CB  . ARG A 1 95  ? 8.114   -7.014  5.528   1.00 93.78  ? 617  ARG A CB  1 
ATOM   440  C  CG  . ARG A 1 95  ? 7.613   -7.960  6.605   1.00 90.93  ? 617  ARG A CG  1 
ATOM   441  C  CD  . ARG A 1 95  ? 8.759   -8.538  7.412   1.00 88.16  ? 617  ARG A CD  1 
ATOM   442  N  NE  . ARG A 1 95  ? 8.894   -7.873  8.698   1.00 86.80  ? 617  ARG A NE  1 
ATOM   443  C  CZ  . ARG A 1 95  ? 8.678   -8.461  9.867   1.00 86.62  ? 617  ARG A CZ  1 
ATOM   444  N  NH1 . ARG A 1 95  ? 8.822   -7.774  10.990  1.00 86.47  ? 617  ARG A NH1 1 
ATOM   445  N  NH2 . ARG A 1 95  ? 8.317   -9.732  9.915   1.00 84.06  ? 617  ARG A NH2 1 
ATOM   446  N  N   . GLU A 1 96  ? 8.530   -6.481  2.066   1.00 93.78  ? 618  GLU A N   1 
ATOM   447  C  CA  . GLU A 1 96  ? 8.884   -5.485  1.067   1.00 94.55  ? 618  GLU A CA  1 
ATOM   448  C  C   . GLU A 1 96  ? 8.322   -5.746  -0.332  1.00 94.95  ? 618  GLU A C   1 
ATOM   449  O  O   . GLU A 1 96  ? 8.093   -4.810  -1.096  1.00 93.60  ? 618  GLU A O   1 
ATOM   450  C  CB  . GLU A 1 96  ? 10.404  -5.382  1.002   1.00 92.90  ? 618  GLU A CB  1 
ATOM   451  C  CG  . GLU A 1 96  ? 11.062  -5.507  2.366   1.00 91.28  ? 618  GLU A CG  1 
ATOM   452  C  CD  . GLU A 1 96  ? 10.639  -4.395  3.300   1.00 90.29  ? 618  GLU A CD  1 
ATOM   453  O  OE1 . GLU A 1 96  ? 11.403  -4.073  4.226   1.00 88.28  ? 618  GLU A OE1 1 
ATOM   454  O  OE2 . GLU A 1 96  ? 9.549   -3.832  3.099   1.00 88.12  ? 618  GLU A OE2 1 
ATOM   455  N  N   . SER A 1 97  ? 8.096   -7.016  -0.657  1.00 92.35  ? 619  SER A N   1 
ATOM   456  C  CA  . SER A 1 97  ? 7.537   -7.411  -1.964  1.00 89.87  ? 619  SER A CA  1 
ATOM   457  C  C   . SER A 1 97  ? 6.014   -7.664  -2.054  1.00 84.52  ? 619  SER A C   1 
ATOM   458  O  O   . SER A 1 97  ? 5.432   -7.454  -3.116  1.00 80.70  ? 619  SER A O   1 
ATOM   459  C  CB  . SER A 1 97  ? 8.222   -8.692  -2.499  1.00 87.42  ? 619  SER A CB  1 
ATOM   460  O  OG  . SER A 1 97  ? 8.326   -9.718  -1.522  1.00 86.95  ? 619  SER A OG  1 
ATOM   461  N  N   . ASP A 1 98  ? 5.417   -8.184  -0.986  1.00 83.00  ? 620  ASP A N   1 
ATOM   462  C  CA  . ASP A 1 98  ? 4.010   -8.542  -0.978  1.00 81.13  ? 620  ASP A CA  1 
ATOM   463  C  C   . ASP A 1 98  ? 2.983   -7.431  -0.766  1.00 80.12  ? 620  ASP A C   1 
ATOM   464  O  O   . ASP A 1 98  ? 1.853   -7.716  -0.414  1.00 86.97  ? 620  ASP A O   1 
ATOM   465  C  CB  . ASP A 1 98  ? 3.753   -9.671  0.054   1.00 81.05  ? 620  ASP A CB  1 
ATOM   466  C  CG  . ASP A 1 98  ? 3.275   -9.168  1.415   1.00 79.66  ? 620  ASP A CG  1 
ATOM   467  O  OD1 . ASP A 1 98  ? 4.068   -8.612  2.166   1.00 82.37  ? 620  ASP A OD1 1 
ATOM   468  O  OD2 . ASP A 1 98  ? 2.114   -9.378  1.758   1.00 73.88  ? 620  ASP A OD2 1 
ATOM   469  N  N   . GLU A 1 99  ? 3.378   -6.180  -1.001  1.00 72.24  ? 621  GLU A N   1 
ATOM   470  C  CA  . GLU A 1 99  ? 2.495   -5.030  -0.994  1.00 63.17  ? 621  GLU A CA  1 
ATOM   471  C  C   . GLU A 1 99  ? 1.952   -4.796  -2.373  1.00 55.79  ? 621  GLU A C   1 
ATOM   472  O  O   . GLU A 1 99  ? 1.667   -3.704  -2.762  1.00 59.76  ? 621  GLU A O   1 
ATOM   473  C  CB  . GLU A 1 99  ? 3.262   -3.815  -0.529  1.00 65.40  ? 621  GLU A CB  1 
ATOM   474  C  CG  . GLU A 1 99  ? 4.698   -3.792  -1.013  1.00 66.17  ? 621  GLU A CG  1 
ATOM   475  C  CD  . GLU A 1 99  ? 5.411   -2.495  -0.706  1.00 65.51  ? 621  GLU A CD  1 
ATOM   476  O  OE1 . GLU A 1 99  ? 6.169   -2.465  0.268   1.00 64.72  ? 621  GLU A OE1 1 
ATOM   477  O  OE2 . GLU A 1 99  ? 5.231   -1.523  -1.445  1.00 61.77  ? 621  GLU A OE2 1 
ATOM   478  N  N   . HIS A 1 100 ? 1.828   -5.856  -3.117  1.00 45.51  ? 622  HIS A N   1 
ATOM   479  C  CA  . HIS A 1 100 ? 1.313   -5.833  -4.492  1.00 39.85  ? 622  HIS A CA  1 
ATOM   480  C  C   . HIS A 1 100 ? 0.142   -6.800  -4.572  1.00 35.45  ? 622  HIS A C   1 
ATOM   481  O  O   . HIS A 1 100 ? 0.200   -7.866  -3.977  1.00 34.22  ? 622  HIS A O   1 
ATOM   482  C  CB  . HIS A 1 100 ? 2.407   -6.255  -5.482  1.00 37.87  ? 622  HIS A CB  1 
ATOM   483  C  CG  . HIS A 1 100 ? 2.085   -5.940  -6.909  1.00 35.74  ? 622  HIS A CG  1 
ATOM   484  N  ND1 . HIS A 1 100 ? 1.358   -6.788  -7.708  1.00 34.65  ? 622  HIS A ND1 1 
ATOM   485  C  CD2 . HIS A 1 100 ? 2.379   -4.864  -7.676  1.00 35.85  ? 622  HIS A CD2 1 
ATOM   486  C  CE1 . HIS A 1 100 ? 1.214   -6.253  -8.907  1.00 34.36  ? 622  HIS A CE1 1 
ATOM   487  N  NE2 . HIS A 1 100 ? 1.828   -5.085  -8.915  1.00 34.66  ? 622  HIS A NE2 1 
ATOM   488  N  N   . PRO A 1 101 ? -0.935  -6.439  -5.289  1.00 33.91  ? 623  PRO A N   1 
ATOM   489  C  CA  . PRO A 1 101 ? -2.109  -7.349  -5.290  1.00 33.18  ? 623  PRO A CA  1 
ATOM   490  C  C   . PRO A 1 101 ? -1.862  -8.781  -5.835  1.00 31.26  ? 623  PRO A C   1 
ATOM   491  O  O   . PRO A 1 101 ? -2.577  -9.681  -5.474  1.00 31.64  ? 623  PRO A O   1 
ATOM   492  C  CB  . PRO A 1 101 ? -3.147  -6.595  -6.128  1.00 32.80  ? 623  PRO A CB  1 
ATOM   493  C  CG  . PRO A 1 101 ? -2.382  -5.536  -6.850  1.00 33.84  ? 623  PRO A CG  1 
ATOM   494  C  CD  . PRO A 1 101 ? -1.235  -5.166  -5.964  1.00 34.37  ? 623  PRO A CD  1 
ATOM   495  N  N   . ASN A 1 102 ? -0.831  -8.978  -6.651  1.00 30.08  ? 624  ASN A N   1 
ATOM   496  C  CA  . ASN A 1 102 ? -0.535  -10.250 -7.302  1.00 28.52  ? 624  ASN A CA  1 
ATOM   497  C  C   . ASN A 1 102 ? 0.751   -10.897 -6.832  1.00 28.00  ? 624  ASN A C   1 
ATOM   498  O  O   . ASN A 1 102 ? 1.373   -11.674 -7.549  1.00 26.99  ? 624  ASN A O   1 
ATOM   499  C  CB  . ASN A 1 102 ? -0.455  -10.049 -8.809  1.00 28.28  ? 624  ASN A CB  1 
ATOM   500  C  CG  . ASN A 1 102 ? -1.642  -9.307  -9.361  1.00 27.62  ? 624  ASN A CG  1 
ATOM   501  O  OD1 . ASN A 1 102 ? -1.500  -8.216  -9.877  1.00 27.91  ? 624  ASN A OD1 1 
ATOM   502  N  ND2 . ASN A 1 102 ? -2.816  -9.887  -9.224  1.00 28.19  ? 624  ASN A ND2 1 
ATOM   503  N  N   . VAL A 1 103 ? 1.154   -10.541 -5.628  1.00 30.20  ? 625  VAL A N   1 
ATOM   504  C  CA  . VAL A 1 103 ? 2.140   -11.281 -4.865  1.00 30.44  ? 625  VAL A CA  1 
ATOM   505  C  C   . VAL A 1 103 ? 1.381   -11.696 -3.605  1.00 30.95  ? 625  VAL A C   1 
ATOM   506  O  O   . VAL A 1 103 ? 0.610   -10.922 -3.051  1.00 31.32  ? 625  VAL A O   1 
ATOM   507  C  CB  . VAL A 1 103 ? 3.370   -10.417 -4.505  1.00 31.11  ? 625  VAL A CB  1 
ATOM   508  C  CG1 . VAL A 1 103 ? 4.396   -11.214 -3.728  1.00 30.84  ? 625  VAL A CG1 1 
ATOM   509  C  CG2 . VAL A 1 103 ? 4.017   -9.865  -5.759  1.00 31.49  ? 625  VAL A CG2 1 
ATOM   510  N  N   . ILE A 1 104 ? 1.597   -12.933 -3.194  1.00 31.52  ? 626  ILE A N   1 
ATOM   511  C  CA  . ILE A 1 104 ? 0.945   -13.523 -2.046  1.00 33.19  ? 626  ILE A CA  1 
ATOM   512  C  C   . ILE A 1 104 ? 1.271   -12.731 -0.774  1.00 35.04  ? 626  ILE A C   1 
ATOM   513  O  O   . ILE A 1 104 ? 2.416   -12.372 -0.552  1.00 36.03  ? 626  ILE A O   1 
ATOM   514  C  CB  . ILE A 1 104 ? 1.305   -15.041 -1.946  1.00 33.43  ? 626  ILE A CB  1 
ATOM   515  C  CG1 . ILE A 1 104 ? 0.491   -15.741 -0.869  1.00 35.67  ? 626  ILE A CG1 1 
ATOM   516  C  CG2 . ILE A 1 104 ? 2.782   -15.299 -1.699  1.00 33.25  ? 626  ILE A CG2 1 
ATOM   517  C  CD1 . ILE A 1 104 ? -0.702  -16.486 -1.406  1.00 36.16  ? 626  ILE A CD1 1 
ATOM   518  N  N   . ARG A 1 105 ? 0.237   -12.429 0.018   1.00 38.15  ? 627  ARG A N   1 
ATOM   519  C  CA  . ARG A 1 105 ? 0.373   -11.690 1.273   1.00 41.15  ? 627  ARG A CA  1 
ATOM   520  C  C   . ARG A 1 105 ? 0.977   -12.545 2.387   1.00 40.23  ? 627  ARG A C   1 
ATOM   521  O  O   . ARG A 1 105 ? 0.521   -13.650 2.641   1.00 38.08  ? 627  ARG A O   1 
ATOM   522  C  CB  . ARG A 1 105 ? -0.984  -11.178 1.768   1.00 44.98  ? 627  ARG A CB  1 
ATOM   523  C  CG  . ARG A 1 105 ? -1.449  -9.867  1.175   1.00 47.86  ? 627  ARG A CG  1 
ATOM   524  C  CD  . ARG A 1 105 ? -2.745  -9.386  1.831   1.00 50.65  ? 627  ARG A CD  1 
ATOM   525  N  NE  . ARG A 1 105 ? -2.517  -8.686  3.097   1.00 52.71  ? 627  ARG A NE  1 
ATOM   526  C  CZ  . ARG A 1 105 ? -3.413  -7.915  3.707   1.00 55.67  ? 627  ARG A CZ  1 
ATOM   527  N  NH1 . ARG A 1 105 ? -3.104  -7.313  4.844   1.00 56.87  ? 627  ARG A NH1 1 
ATOM   528  N  NH2 . ARG A 1 105 ? -4.625  -7.737  3.189   1.00 58.04  ? 627  ARG A NH2 1 
ATOM   529  N  N   . TYR A 1 106 ? 1.991   -12.004 3.054   1.00 40.25  ? 628  TYR A N   1 
ATOM   530  C  CA  . TYR A 1 106 ? 2.580   -12.624 4.226   1.00 41.25  ? 628  TYR A CA  1 
ATOM   531  C  C   . TYR A 1 106 ? 1.847   -12.070 5.430   1.00 42.63  ? 628  TYR A C   1 
ATOM   532  O  O   . TYR A 1 106 ? 1.459   -10.905 5.430   1.00 42.58  ? 628  TYR A O   1 
ATOM   533  C  CB  . TYR A 1 106 ? 4.053   -12.267 4.315   1.00 42.24  ? 628  TYR A CB  1 
ATOM   534  C  CG  . TYR A 1 106 ? 4.667   -12.556 5.649   1.00 44.41  ? 628  TYR A CG  1 
ATOM   535  C  CD1 . TYR A 1 106 ? 4.998   -13.851 6.001   1.00 44.64  ? 628  TYR A CD1 1 
ATOM   536  C  CD2 . TYR A 1 106 ? 4.918   -11.535 6.571   1.00 46.56  ? 628  TYR A CD2 1 
ATOM   537  C  CE1 . TYR A 1 106 ? 5.559   -14.134 7.229   1.00 45.69  ? 628  TYR A CE1 1 
ATOM   538  C  CE2 . TYR A 1 106 ? 5.480   -11.813 7.808   1.00 47.21  ? 628  TYR A CE2 1 
ATOM   539  C  CZ  . TYR A 1 106 ? 5.796   -13.118 8.115   1.00 46.70  ? 628  TYR A CZ  1 
ATOM   540  O  OH  . TYR A 1 106 ? 6.352   -13.443 9.304   1.00 48.32  ? 628  TYR A OH  1 
ATOM   541  N  N   . PHE A 1 107 ? 1.595   -12.918 6.420   1.00 42.91  ? 629  PHE A N   1 
ATOM   542  C  CA  . PHE A 1 107 ? 0.875   -12.488 7.609   1.00 44.34  ? 629  PHE A CA  1 
ATOM   543  C  C   . PHE A 1 107 ? 1.654   -12.609 8.912   1.00 45.43  ? 629  PHE A C   1 
ATOM   544  O  O   . PHE A 1 107 ? 1.759   -11.649 9.665   1.00 48.50  ? 629  PHE A O   1 
ATOM   545  C  CB  . PHE A 1 107 ? -0.437  -13.260 7.737   1.00 44.55  ? 629  PHE A CB  1 
ATOM   546  C  CG  . PHE A 1 107 ? -1.543  -12.712 6.896   1.00 44.38  ? 629  PHE A CG  1 
ATOM   547  C  CD1 . PHE A 1 107 ? -1.924  -11.393 7.012   1.00 45.78  ? 629  PHE A CD1 1 
ATOM   548  C  CD2 . PHE A 1 107 ? -2.199  -13.516 5.987   1.00 43.63  ? 629  PHE A CD2 1 
ATOM   549  C  CE1 . PHE A 1 107 ? -2.944  -10.883 6.238   1.00 46.19  ? 629  PHE A CE1 1 
ATOM   550  C  CE2 . PHE A 1 107 ? -3.220  -13.014 5.210   1.00 43.07  ? 629  PHE A CE2 1 
ATOM   551  C  CZ  . PHE A 1 107 ? -3.592  -11.695 5.335   1.00 44.82  ? 629  PHE A CZ  1 
ATOM   552  N  N   . CYS A 1 108 ? 2.171   -13.798 9.191   1.00 44.99  ? 630  CYS A N   1 
ATOM   553  C  CA  . CYS A 1 108 ? 2.720   -14.069 10.509  1.00 46.88  ? 630  CYS A CA  1 
ATOM   554  C  C   . CYS A 1 108 ? 3.774   -15.168 10.544  1.00 46.31  ? 630  CYS A C   1 
ATOM   555  O  O   . CYS A 1 108 ? 3.761   -16.075 9.726   1.00 44.32  ? 630  CYS A O   1 
ATOM   556  C  CB  . CYS A 1 108 ? 1.566   -14.449 11.434  1.00 48.32  ? 630  CYS A CB  1 
ATOM   557  S  SG  . CYS A 1 108 ? 1.943   -14.450 13.190  1.00 51.24  ? 630  CYS A SG  1 
ATOM   558  N  N   . THR A 1 109 ? 4.670   -15.088 11.522  1.00 48.42  ? 631  THR A N   1 
ATOM   559  C  CA  . THR A 1 109 ? 5.592   -16.171 11.832  1.00 48.23  ? 631  THR A CA  1 
ATOM   560  C  C   . THR A 1 109 ? 5.527   -16.477 13.323  1.00 49.85  ? 631  THR A C   1 
ATOM   561  O  O   . THR A 1 109 ? 5.568   -15.568 14.142  1.00 50.73  ? 631  THR A O   1 
ATOM   562  C  CB  . THR A 1 109 ? 7.040   -15.824 11.453  1.00 48.23  ? 631  THR A CB  1 
ATOM   563  O  OG1 . THR A 1 109 ? 7.125   -15.585 10.046  1.00 48.97  ? 631  THR A OG1 1 
ATOM   564  C  CG2 . THR A 1 109 ? 7.969   -16.960 11.818  1.00 48.32  ? 631  THR A CG2 1 
ATOM   565  N  N   . GLU A 1 110 ? 5.432   -17.753 13.676  1.00 51.08  ? 632  GLU A N   1 
ATOM   566  C  CA  . GLU A 1 110 ? 5.391   -18.151 15.084  1.00 54.17  ? 632  GLU A CA  1 
ATOM   567  C  C   . GLU A 1 110 ? 6.314   -19.333 15.351  1.00 55.67  ? 632  GLU A C   1 
ATOM   568  O  O   . GLU A 1 110 ? 6.644   -20.122 14.459  1.00 52.80  ? 632  GLU A O   1 
ATOM   569  C  CB  . GLU A 1 110 ? 3.956   -18.458 15.540  1.00 54.17  ? 632  GLU A CB  1 
ATOM   570  C  CG  . GLU A 1 110 ? 3.004   -17.273 15.460  1.00 54.40  ? 632  GLU A CG  1 
ATOM   571  C  CD  . GLU A 1 110 ? 3.225   -16.257 16.566  1.00 56.40  ? 632  GLU A CD  1 
ATOM   572  O  OE1 . GLU A 1 110 ? 4.275   -16.344 17.228  1.00 56.22  ? 632  GLU A OE1 1 
ATOM   573  O  OE2 . GLU A 1 110 ? 2.349   -15.376 16.774  1.00 57.29  ? 632  GLU A OE2 1 
ATOM   574  N  N   . LYS A 1 111 ? 6.774   -19.405 16.591  1.00 61.94  ? 633  LYS A N   1 
ATOM   575  C  CA  . LYS A 1 111 ? 7.808   -20.344 16.974  1.00 65.72  ? 633  LYS A CA  1 
ATOM   576  C  C   . LYS A 1 111 ? 7.358   -21.270 18.079  1.00 65.26  ? 633  LYS A C   1 
ATOM   577  O  O   . LYS A 1 111 ? 6.880   -20.837 19.110  1.00 65.00  ? 633  LYS A O   1 
ATOM   578  C  CB  . LYS A 1 111 ? 9.063   -19.591 17.419  1.00 71.14  ? 633  LYS A CB  1 
ATOM   579  C  CG  . LYS A 1 111 ? 8.773   -18.308 18.185  1.00 77.48  ? 633  LYS A CG  1 
ATOM   580  C  CD  . LYS A 1 111 ? 10.048  -17.591 18.601  1.00 81.49  ? 633  LYS A CD  1 
ATOM   581  C  CE  . LYS A 1 111 ? 10.439  -17.910 20.037  1.00 84.51  ? 633  LYS A CE  1 
ATOM   582  N  NZ  . LYS A 1 111 ? 9.607   -17.194 21.042  1.00 87.48  ? 633  LYS A NZ  1 
ATOM   583  N  N   . ASP A 1 112 ? 7.529   -22.553 17.809  1.00 66.08  ? 634  ASP A N   1 
ATOM   584  C  CA  . ASP A 1 112 ? 7.356   -23.649 18.742  1.00 66.57  ? 634  ASP A CA  1 
ATOM   585  C  C   . ASP A 1 112 ? 8.633   -23.965 19.482  1.00 67.34  ? 634  ASP A C   1 
ATOM   586  O  O   . ASP A 1 112 ? 9.658   -23.342 19.278  1.00 65.77  ? 634  ASP A O   1 
ATOM   587  C  CB  . ASP A 1 112 ? 6.952   -24.898 17.976  1.00 64.31  ? 634  ASP A CB  1 
ATOM   588  C  CG  . ASP A 1 112 ? 5.747   -25.563 18.545  1.00 64.35  ? 634  ASP A CG  1 
ATOM   589  O  OD1 . ASP A 1 112 ? 5.181   -25.047 19.515  1.00 66.99  ? 634  ASP A OD1 1 
ATOM   590  O  OD2 . ASP A 1 112 ? 5.358   -26.610 18.016  1.00 62.58  ? 634  ASP A OD2 1 
ATOM   591  N  N   . ARG A 1 113 ? 8.552   -24.951 20.355  1.00 70.95  ? 635  ARG A N   1 
ATOM   592  C  CA  . ARG A 1 113 ? 9.728   -25.566 20.922  1.00 73.58  ? 635  ARG A CA  1 
ATOM   593  C  C   . ARG A 1 113 ? 10.524  -26.238 19.818  1.00 71.83  ? 635  ARG A C   1 
ATOM   594  O  O   . ARG A 1 113 ? 11.740  -26.243 19.862  1.00 72.08  ? 635  ARG A O   1 
ATOM   595  C  CB  . ARG A 1 113 ? 9.356   -26.589 21.993  1.00 76.88  ? 635  ARG A CB  1 
ATOM   596  C  CG  . ARG A 1 113 ? 7.977   -26.405 22.598  1.00 79.50  ? 635  ARG A CG  1 
ATOM   597  C  CD  . ARG A 1 113 ? 7.951   -26.869 24.043  1.00 82.63  ? 635  ARG A CD  1 
ATOM   598  N  NE  . ARG A 1 113 ? 8.245   -28.292 24.178  1.00 84.19  ? 635  ARG A NE  1 
ATOM   599  C  CZ  . ARG A 1 113 ? 7.330   -29.231 24.384  1.00 83.90  ? 635  ARG A CZ  1 
ATOM   600  N  NH1 . ARG A 1 113 ? 6.054   -28.902 24.470  1.00 85.34  ? 635  ARG A NH1 1 
ATOM   601  N  NH2 . ARG A 1 113 ? 7.690   -30.498 24.499  1.00 82.68  ? 635  ARG A NH2 1 
ATOM   602  N  N   . GLN A 1 114 ? 9.839   -26.854 18.858  1.00 70.72  ? 636  GLN A N   1 
ATOM   603  C  CA  . GLN A 1 114 ? 10.536  -27.545 17.771  1.00 69.23  ? 636  GLN A CA  1 
ATOM   604  C  C   . GLN A 1 114 ? 10.396  -27.023 16.335  1.00 65.69  ? 636  GLN A C   1 
ATOM   605  O  O   . GLN A 1 114 ? 11.125  -27.469 15.460  1.00 65.18  ? 636  GLN A O   1 
ATOM   606  C  CB  . GLN A 1 114 ? 10.194  -29.034 17.776  1.00 71.10  ? 636  GLN A CB  1 
ATOM   607  C  CG  . GLN A 1 114 ? 9.661   -29.567 19.089  1.00 74.97  ? 636  GLN A CG  1 
ATOM   608  C  CD  . GLN A 1 114 ? 9.073   -30.951 18.947  1.00 76.39  ? 636  GLN A CD  1 
ATOM   609  O  OE1 . GLN A 1 114 ? 9.420   -31.693 18.038  1.00 76.79  ? 636  GLN A OE1 1 
ATOM   610  N  NE2 . GLN A 1 114 ? 8.175   -31.300 19.847  1.00 77.88  ? 636  GLN A NE2 1 
ATOM   611  N  N   . PHE A 1 115 ? 9.469   -26.106 16.079  1.00 62.38  ? 637  PHE A N   1 
ATOM   612  C  CA  . PHE A 1 115 ? 9.117   -25.743 14.706  1.00 57.28  ? 637  PHE A CA  1 
ATOM   613  C  C   . PHE A 1 115 ? 8.923   -24.259 14.489  1.00 54.67  ? 637  PHE A C   1 
ATOM   614  O  O   . PHE A 1 115 ? 8.764   -23.510 15.433  1.00 54.04  ? 637  PHE A O   1 
ATOM   615  C  CB  . PHE A 1 115 ? 7.836   -26.443 14.271  1.00 56.99  ? 637  PHE A CB  1 
ATOM   616  C  CG  . PHE A 1 115 ? 7.944   -27.930 14.182  1.00 57.79  ? 637  PHE A CG  1 
ATOM   617  C  CD1 . PHE A 1 115 ? 8.677   -28.529 13.180  1.00 57.42  ? 637  PHE A CD1 1 
ATOM   618  C  CD2 . PHE A 1 115 ? 7.283   -28.728 15.082  1.00 58.57  ? 637  PHE A CD2 1 
ATOM   619  C  CE1 . PHE A 1 115 ? 8.767   -29.897 13.092  1.00 57.14  ? 637  PHE A CE1 1 
ATOM   620  C  CE2 . PHE A 1 115 ? 7.369   -30.096 15.003  1.00 59.13  ? 637  PHE A CE2 1 
ATOM   621  C  CZ  . PHE A 1 115 ? 8.109   -30.681 14.005  1.00 58.47  ? 637  PHE A CZ  1 
ATOM   622  N  N   . GLN A 1 116 ? 8.956   -23.840 13.228  1.00 51.96  ? 638  GLN A N   1 
ATOM   623  C  CA  . GLN A 1 116 ? 8.496   -22.503 12.877  1.00 51.18  ? 638  GLN A CA  1 
ATOM   624  C  C   . GLN A 1 116 ? 7.228   -22.617 12.056  1.00 48.63  ? 638  GLN A C   1 
ATOM   625  O  O   . GLN A 1 116 ? 7.042   -23.591 11.336  1.00 46.00  ? 638  GLN A O   1 
ATOM   626  C  CB  . GLN A 1 116 ? 9.543   -21.736 12.074  1.00 51.69  ? 638  GLN A CB  1 
ATOM   627  C  CG  . GLN A 1 116 ? 10.364  -20.756 12.904  1.00 54.73  ? 638  GLN A CG  1 
ATOM   628  C  CD  . GLN A 1 116 ? 11.202  -19.800 12.066  1.00 53.93  ? 638  GLN A CD  1 
ATOM   629  O  OE1 . GLN A 1 116 ? 10.937  -19.578 10.885  1.00 53.72  ? 638  GLN A OE1 1 
ATOM   630  N  NE2 . GLN A 1 116 ? 12.214  -19.215 12.689  1.00 55.92  ? 638  GLN A NE2 1 
ATOM   631  N  N   . TYR A 1 117 ? 6.380   -21.599 12.147  1.00 47.50  ? 639  TYR A N   1 
ATOM   632  C  CA  . TYR A 1 117 ? 5.102   -21.597 11.460  1.00 45.88  ? 639  TYR A CA  1 
ATOM   633  C  C   . TYR A 1 117 ? 4.974   -20.328 10.654  1.00 44.56  ? 639  TYR A C   1 
ATOM   634  O  O   . TYR A 1 117 ? 4.998   -19.248 11.214  1.00 44.87  ? 639  TYR A O   1 
ATOM   635  C  CB  . TYR A 1 117 ? 3.961   -21.692 12.478  1.00 47.05  ? 639  TYR A CB  1 
ATOM   636  C  CG  . TYR A 1 117 ? 4.001   -22.972 13.273  1.00 48.26  ? 639  TYR A CG  1 
ATOM   637  C  CD1 . TYR A 1 117 ? 4.730   -23.051 14.461  1.00 49.82  ? 639  TYR A CD1 1 
ATOM   638  C  CD2 . TYR A 1 117 ? 3.342   -24.118 12.829  1.00 47.58  ? 639  TYR A CD2 1 
ATOM   639  C  CE1 . TYR A 1 117 ? 4.785   -24.225 15.196  1.00 50.46  ? 639  TYR A CE1 1 
ATOM   640  C  CE2 . TYR A 1 117 ? 3.392   -25.302 13.561  1.00 49.19  ? 639  TYR A CE2 1 
ATOM   641  C  CZ  . TYR A 1 117 ? 4.121   -25.353 14.745  1.00 50.41  ? 639  TYR A CZ  1 
ATOM   642  O  OH  . TYR A 1 117 ? 4.190   -26.515 15.489  1.00 50.78  ? 639  TYR A OH  1 
ATOM   643  N  N   . ILE A 1 118 ? 4.835   -20.476 9.344   1.00 43.64  ? 640  ILE A N   1 
ATOM   644  C  CA  . ILE A 1 118 ? 4.667   -19.352 8.440   1.00 43.11  ? 640  ILE A CA  1 
ATOM   645  C  C   . ILE A 1 118 ? 3.247   -19.327 7.920   1.00 40.26  ? 640  ILE A C   1 
ATOM   646  O  O   . ILE A 1 118 ? 2.754   -20.305 7.397   1.00 38.82  ? 640  ILE A O   1 
ATOM   647  C  CB  . ILE A 1 118 ? 5.625   -19.432 7.241   1.00 44.15  ? 640  ILE A CB  1 
ATOM   648  C  CG1 . ILE A 1 118 ? 7.053   -19.691 7.702   1.00 47.06  ? 640  ILE A CG1 1 
ATOM   649  C  CG2 . ILE A 1 118 ? 5.567   -18.151 6.433   1.00 45.03  ? 640  ILE A CG2 1 
ATOM   650  C  CD1 . ILE A 1 118 ? 7.756   -18.470 8.239   1.00 50.78  ? 640  ILE A CD1 1 
ATOM   651  N  N   . ALA A 1 119 ? 2.597   -18.188 8.068   1.00 39.45  ? 641  ALA A N   1 
ATOM   652  C  CA  . ALA A 1 119 ? 1.205   -18.041 7.707   1.00 38.21  ? 641  ALA A CA  1 
ATOM   653  C  C   . ALA A 1 119 ? 1.086   -17.036 6.583   1.00 35.98  ? 641  ALA A C   1 
ATOM   654  O  O   . ALA A 1 119 ? 1.545   -15.911 6.697   1.00 35.12  ? 641  ALA A O   1 
ATOM   655  C  CB  . ALA A 1 119 ? 0.395   -17.595 8.916   1.00 40.00  ? 641  ALA A CB  1 
ATOM   656  N  N   . ILE A 1 120 ? 0.502   -17.473 5.482   1.00 34.80  ? 642  ILE A N   1 
ATOM   657  C  CA  . ILE A 1 120 ? 0.239   -16.598 4.364   1.00 35.26  ? 642  ILE A CA  1 
ATOM   658  C  C   . ILE A 1 120 ? -1.220  -16.734 3.956   1.00 35.01  ? 642  ILE A C   1 
ATOM   659  O  O   . ILE A 1 120 ? -1.933  -17.587 4.441   1.00 35.04  ? 642  ILE A O   1 
ATOM   660  C  CB  . ILE A 1 120 ? 1.175   -16.876 3.171   1.00 34.76  ? 642  ILE A CB  1 
ATOM   661  C  CG1 . ILE A 1 120 ? 0.871   -18.237 2.545   1.00 34.79  ? 642  ILE A CG1 1 
ATOM   662  C  CG2 . ILE A 1 120 ? 2.625   -16.795 3.617   1.00 35.44  ? 642  ILE A CG2 1 
ATOM   663  C  CD1 . ILE A 1 120 ? 1.648   -18.533 1.290   1.00 33.96  ? 642  ILE A CD1 1 
ATOM   664  N  N   . GLU A 1 121 ? -1.642  -15.869 3.061   1.00 35.67  ? 643  GLU A N   1 
ATOM   665  C  CA  . GLU A 1 121 ? -3.020  -15.805 2.608   1.00 37.37  ? 643  GLU A CA  1 
ATOM   666  C  C   . GLU A 1 121 ? -3.483  -17.153 2.042   1.00 36.11  ? 643  GLU A C   1 
ATOM   667  O  O   . GLU A 1 121 ? -2.779  -17.758 1.233   1.00 33.61  ? 643  GLU A O   1 
ATOM   668  C  CB  . GLU A 1 121 ? -3.095  -14.724 1.538   1.00 38.28  ? 643  GLU A CB  1 
ATOM   669  C  CG  . GLU A 1 121 ? -4.471  -14.393 1.026   1.00 40.63  ? 643  GLU A CG  1 
ATOM   670  C  CD  . GLU A 1 121 ? -4.410  -13.429 -0.127  1.00 39.93  ? 643  GLU A CD  1 
ATOM   671  O  OE1 . GLU A 1 121 ? -3.349  -12.785 -0.295  1.00 39.83  ? 643  GLU A OE1 1 
ATOM   672  O  OE2 . GLU A 1 121 ? -5.421  -13.344 -0.855  1.00 40.15  ? 643  GLU A OE2 1 
ATOM   673  N  N   . LEU A 1 122 ? -4.637  -17.638 2.500   1.00 35.93  ? 644  LEU A N   1 
ATOM   674  C  CA  . LEU A 1 122 ? -5.204  -18.862 1.956   1.00 36.08  ? 644  LEU A CA  1 
ATOM   675  C  C   . LEU A 1 122 ? -5.740  -18.585 0.558   1.00 34.32  ? 644  LEU A C   1 
ATOM   676  O  O   . LEU A 1 122 ? -6.426  -17.602 0.353   1.00 35.10  ? 644  LEU A O   1 
ATOM   677  C  CB  . LEU A 1 122 ? -6.324  -19.409 2.840   1.00 38.59  ? 644  LEU A CB  1 
ATOM   678  C  CG  . LEU A 1 122 ? -6.906  -20.765 2.401   1.00 39.71  ? 644  LEU A CG  1 
ATOM   679  C  CD1 . LEU A 1 122 ? -5.909  -21.887 2.628   1.00 39.77  ? 644  LEU A CD1 1 
ATOM   680  C  CD2 . LEU A 1 122 ? -8.208  -21.099 3.109   1.00 41.57  ? 644  LEU A CD2 1 
ATOM   681  N  N   . CYS A 1 123 ? -5.408  -19.463 -0.384  1.00 33.56  ? 645  CYS A N   1 
ATOM   682  C  CA  . CYS A 1 123 ? -5.857  -19.389 -1.765  1.00 33.28  ? 645  CYS A CA  1 
ATOM   683  C  C   . CYS A 1 123 ? -6.749  -20.583 -2.145  1.00 33.42  ? 645  CYS A C   1 
ATOM   684  O  O   . CYS A 1 123 ? -6.718  -21.621 -1.507  1.00 33.80  ? 645  CYS A O   1 
ATOM   685  C  CB  . CYS A 1 123 ? -4.646  -19.344 -2.675  1.00 32.66  ? 645  CYS A CB  1 
ATOM   686  S  SG  . CYS A 1 123 ? -3.678  -17.826 -2.574  1.00 33.17  ? 645  CYS A SG  1 
ATOM   687  N  N   . ALA A 1 124 ? -7.545  -20.419 -3.195  1.00 33.97  ? 646  ALA A N   1 
ATOM   688  C  CA  . ALA A 1 124 ? -8.493  -21.453 -3.633  1.00 34.77  ? 646  ALA A CA  1 
ATOM   689  C  C   . ALA A 1 124 ? -7.839  -22.552 -4.468  1.00 34.68  ? 646  ALA A C   1 
ATOM   690  O  O   . ALA A 1 124 ? -8.202  -23.710 -4.364  1.00 36.56  ? 646  ALA A O   1 
ATOM   691  C  CB  . ALA A 1 124 ? -9.629  -20.829 -4.417  1.00 34.23  ? 646  ALA A CB  1 
ATOM   692  N  N   . ALA A 1 125 ? -6.870  -22.187 -5.291  1.00 34.00  ? 647  ALA A N   1 
ATOM   693  C  CA  . ALA A 1 125 ? -6.342  -23.105 -6.280  1.00 33.61  ? 647  ALA A CA  1 
ATOM   694  C  C   . ALA A 1 125 ? -4.976  -22.683 -6.796  1.00 31.24  ? 647  ALA A C   1 
ATOM   695  O  O   . ALA A 1 125 ? -4.490  -21.612 -6.478  1.00 31.18  ? 647  ALA A O   1 
ATOM   696  C  CB  . ALA A 1 125 ? -7.321  -23.218 -7.444  1.00 33.76  ? 647  ALA A CB  1 
ATOM   697  N  N   . THR A 1 126 ? -4.356  -23.565 -7.571  1.00 30.31  ? 648  THR A N   1 
ATOM   698  C  CA  . THR A 1 126 ? -3.206  -23.212 -8.384  1.00 28.51  ? 648  THR A CA  1 
ATOM   699  C  C   . THR A 1 126 ? -3.644  -23.052 -9.814  1.00 27.36  ? 648  THR A C   1 
ATOM   700  O  O   . THR A 1 126 ? -4.709  -23.505 -10.222 1.00 26.42  ? 648  THR A O   1 
ATOM   701  C  CB  . THR A 1 126 ? -2.093  -24.274 -8.335  1.00 28.61  ? 648  THR A CB  1 
ATOM   702  O  OG1 . THR A 1 126 ? -2.484  -25.416 -9.093  1.00 28.34  ? 648  THR A OG1 1 
ATOM   703  C  CG2 . THR A 1 126 ? -1.792  -24.697 -6.890  1.00 28.97  ? 648  THR A CG2 1 
ATOM   704  N  N   . LEU A 1 127 ? -2.791  -22.400 -10.578 1.00 28.10  ? 649  LEU A N   1 
ATOM   705  C  CA  . LEU A 1 127 ? -3.029  -22.186 -11.996 1.00 28.20  ? 649  LEU A CA  1 
ATOM   706  C  C   . LEU A 1 127 ? -3.055  -23.514 -12.753 1.00 27.98  ? 649  LEU A C   1 
ATOM   707  O  O   . LEU A 1 127 ? -3.807  -23.662 -13.698 1.00 27.47  ? 649  LEU A O   1 
ATOM   708  C  CB  . LEU A 1 127 ? -1.978  -21.221 -12.573 1.00 28.17  ? 649  LEU A CB  1 
ATOM   709  C  CG  . LEU A 1 127 ? -2.099  -20.850 -14.059 1.00 28.97  ? 649  LEU A CG  1 
ATOM   710  C  CD1 . LEU A 1 127 ? -3.431  -20.205 -14.363 1.00 29.81  ? 649  LEU A CD1 1 
ATOM   711  C  CD2 . LEU A 1 127 ? -0.961  -19.941 -14.494 1.00 29.68  ? 649  LEU A CD2 1 
ATOM   712  N  N   . GLN A 1 128 ? -2.255  -24.484 -12.329 1.00 29.29  ? 650  GLN A N   1 
ATOM   713  C  CA  . GLN A 1 128 ? -2.327  -25.810 -12.924 1.00 31.72  ? 650  GLN A CA  1 
ATOM   714  C  C   . GLN A 1 128 ? -3.731  -26.382 -12.769 1.00 32.21  ? 650  GLN A C   1 
ATOM   715  O  O   . GLN A 1 128 ? -4.300  -26.870 -13.747 1.00 31.27  ? 650  GLN A O   1 
ATOM   716  C  CB  . GLN A 1 128 ? -1.303  -26.750 -12.320 1.00 34.86  ? 650  GLN A CB  1 
ATOM   717  C  CG  . GLN A 1 128 ? -1.434  -28.198 -12.776 1.00 40.56  ? 650  GLN A CG  1 
ATOM   718  C  CD  . GLN A 1 128 ? -0.371  -29.094 -12.164 1.00 44.56  ? 650  GLN A CD  1 
ATOM   719  O  OE1 . GLN A 1 128 ? 0.577   -29.498 -12.842 1.00 52.12  ? 650  GLN A OE1 1 
ATOM   720  N  NE2 . GLN A 1 128 ? -0.509  -29.395 -10.877 1.00 46.66  ? 650  GLN A NE2 1 
ATOM   721  N  N   . GLU A 1 129 ? -4.274  -26.297 -11.549 1.00 32.61  ? 651  GLU A N   1 
ATOM   722  C  CA  . GLU A 1 129 ? -5.590  -26.828 -11.228 1.00 34.77  ? 651  GLU A CA  1 
ATOM   723  C  C   . GLU A 1 129 ? -6.634  -26.166 -12.104 1.00 35.38  ? 651  GLU A C   1 
ATOM   724  O  O   . GLU A 1 129 ? -7.450  -26.849 -12.713 1.00 36.75  ? 651  GLU A O   1 
ATOM   725  C  CB  . GLU A 1 129 ? -5.936  -26.622 -9.743  1.00 35.95  ? 651  GLU A CB  1 
ATOM   726  C  CG  . GLU A 1 129 ? -5.217  -27.555 -8.781  1.00 36.94  ? 651  GLU A CG  1 
ATOM   727  C  CD  . GLU A 1 129 ? -5.507  -27.266 -7.318  1.00 38.02  ? 651  GLU A CD  1 
ATOM   728  O  OE1 . GLU A 1 129 ? -5.010  -28.011 -6.441  1.00 40.63  ? 651  GLU A OE1 1 
ATOM   729  O  OE2 . GLU A 1 129 ? -6.242  -26.309 -7.041  1.00 39.58  ? 651  GLU A OE2 1 
ATOM   730  N  N   . TYR A 1 130 ? -6.583  -24.836 -12.161 1.00 34.50  ? 652  TYR A N   1 
ATOM   731  C  CA  . TYR A 1 130 ? -7.438  -24.020 -13.039 1.00 35.03  ? 652  TYR A CA  1 
ATOM   732  C  C   . TYR A 1 130 ? -7.416  -24.489 -14.492 1.00 35.33  ? 652  TYR A C   1 
ATOM   733  O  O   . TYR A 1 130 ? -8.456  -24.693 -15.099 1.00 37.20  ? 652  TYR A O   1 
ATOM   734  C  CB  . TYR A 1 130 ? -6.979  -22.546 -12.971 1.00 34.08  ? 652  TYR A CB  1 
ATOM   735  C  CG  . TYR A 1 130 ? -7.828  -21.532 -13.699 1.00 32.56  ? 652  TYR A CG  1 
ATOM   736  C  CD1 . TYR A 1 130 ? -7.583  -21.213 -15.026 1.00 32.52  ? 652  TYR A CD1 1 
ATOM   737  C  CD2 . TYR A 1 130 ? -8.848  -20.858 -13.042 1.00 33.35  ? 652  TYR A CD2 1 
ATOM   738  C  CE1 . TYR A 1 130 ? -8.345  -20.255 -15.688 1.00 33.24  ? 652  TYR A CE1 1 
ATOM   739  C  CE2 . TYR A 1 130 ? -9.626  -19.907 -13.689 1.00 32.87  ? 652  TYR A CE2 1 
ATOM   740  C  CZ  . TYR A 1 130 ? -9.378  -19.603 -15.012 1.00 32.94  ? 652  TYR A CZ  1 
ATOM   741  O  OH  . TYR A 1 130 ? -10.150 -18.648 -15.653 1.00 31.13  ? 652  TYR A OH  1 
ATOM   742  N  N   . VAL A 1 131 ? -6.222  -24.648 -15.042 1.00 35.34  ? 653  VAL A N   1 
ATOM   743  C  CA  . VAL A 1 131 ? -6.062  -24.956 -16.458 1.00 36.45  ? 653  VAL A CA  1 
ATOM   744  C  C   . VAL A 1 131 ? -6.541  -26.373 -16.792 1.00 37.87  ? 653  VAL A C   1 
ATOM   745  O  O   . VAL A 1 131 ? -7.224  -26.564 -17.779 1.00 39.37  ? 653  VAL A O   1 
ATOM   746  C  CB  . VAL A 1 131 ? -4.586  -24.777 -16.896 1.00 36.27  ? 653  VAL A CB  1 
ATOM   747  C  CG1 . VAL A 1 131 ? -4.327  -25.355 -18.282 1.00 36.39  ? 653  VAL A CG1 1 
ATOM   748  C  CG2 . VAL A 1 131 ? -4.209  -23.307 -16.866 1.00 35.86  ? 653  VAL A CG2 1 
ATOM   749  N  N   . GLU A 1 132 ? -6.175  -27.345 -15.966 1.00 38.85  ? 654  GLU A N   1 
ATOM   750  C  CA  . GLU A 1 132 ? -6.419  -28.762 -16.257 1.00 42.14  ? 654  GLU A CA  1 
ATOM   751  C  C   . GLU A 1 132 ? -7.854  -29.213 -16.009 1.00 43.47  ? 654  GLU A C   1 
ATOM   752  O  O   . GLU A 1 132 ? -8.286  -30.175 -16.627 1.00 45.28  ? 654  GLU A O   1 
ATOM   753  C  CB  . GLU A 1 132 ? -5.511  -29.670 -15.418 1.00 42.35  ? 654  GLU A CB  1 
ATOM   754  C  CG  . GLU A 1 132 ? -4.007  -29.451 -15.554 1.00 42.41  ? 654  GLU A CG  1 
ATOM   755  C  CD  . GLU A 1 132 ? -3.323  -30.274 -16.637 1.00 42.01  ? 654  GLU A CD  1 
ATOM   756  O  OE1 . GLU A 1 132 ? -3.738  -31.413 -16.926 1.00 42.10  ? 654  GLU A OE1 1 
ATOM   757  O  OE2 . GLU A 1 132 ? -2.322  -29.774 -17.178 1.00 41.31  ? 654  GLU A OE2 1 
ATOM   758  N  N   . GLN A 1 133 ? -8.561  -28.536 -15.104 1.00 44.85  ? 655  GLN A N   1 
ATOM   759  C  CA  . GLN A 1 133 ? -9.889  -28.961 -14.629 1.00 47.44  ? 655  GLN A CA  1 
ATOM   760  C  C   . GLN A 1 133 ? -11.049 -28.115 -15.157 1.00 49.72  ? 655  GLN A C   1 
ATOM   761  O  O   . GLN A 1 133 ? -12.108 -28.653 -15.474 1.00 52.91  ? 655  GLN A O   1 
ATOM   762  C  CB  . GLN A 1 133 ? -9.931  -28.967 -13.096 1.00 46.98  ? 655  GLN A CB  1 
ATOM   763  C  CG  . GLN A 1 133 ? -9.014  -30.000 -12.455 1.00 48.22  ? 655  GLN A CG  1 
ATOM   764  C  CD  . GLN A 1 133 ? -8.791  -29.765 -10.971 1.00 49.68  ? 655  GLN A CD  1 
ATOM   765  O  OE1 . GLN A 1 133 ? -7.680  -29.961 -10.436 1.00 50.49  ? 655  GLN A OE1 1 
ATOM   766  N  NE2 . GLN A 1 133 ? -9.840  -29.338 -10.294 1.00 49.79  ? 655  GLN A NE2 1 
ATOM   767  N  N   . LYS A 1 134 ? -10.867 -26.804 -15.255 1.00 50.26  ? 656  LYS A N   1 
ATOM   768  C  CA  . LYS A 1 134 ? -11.967 -25.941 -15.675 1.00 52.73  ? 656  LYS A CA  1 
ATOM   769  C  C   . LYS A 1 134 ? -12.309 -26.048 -17.169 1.00 55.22  ? 656  LYS A C   1 
ATOM   770  O  O   . LYS A 1 134 ? -11.439 -26.286 -18.003 1.00 54.38  ? 656  LYS A O   1 
ATOM   771  C  CB  . LYS A 1 134 ? -11.689 -24.493 -15.296 1.00 51.78  ? 656  LYS A CB  1 
ATOM   772  C  CG  . LYS A 1 134 ? -11.578 -24.288 -13.794 1.00 53.73  ? 656  LYS A CG  1 
ATOM   773  C  CD  . LYS A 1 134 ? -11.921 -22.859 -13.385 1.00 54.88  ? 656  LYS A CD  1 
ATOM   774  C  CE  . LYS A 1 134 ? -12.693 -22.802 -12.070 1.00 57.68  ? 656  LYS A CE  1 
ATOM   775  N  NZ  . LYS A 1 134 ? -13.655 -21.662 -12.076 1.00 61.10  ? 656  LYS A NZ  1 
ATOM   776  N  N   . ASP A 1 135 ? -13.596 -25.889 -17.479 1.00 57.52  ? 657  ASP A N   1 
ATOM   777  C  CA  . ASP A 1 135 ? -14.082 -25.845 -18.853 1.00 58.71  ? 657  ASP A CA  1 
ATOM   778  C  C   . ASP A 1 135 ? -13.879 -24.423 -19.372 1.00 56.91  ? 657  ASP A C   1 
ATOM   779  O  O   . ASP A 1 135 ? -14.474 -23.473 -18.859 1.00 57.67  ? 657  ASP A O   1 
ATOM   780  C  CB  . ASP A 1 135 ? -15.566 -26.276 -18.923 1.00 60.87  ? 657  ASP A CB  1 
ATOM   781  C  CG  . ASP A 1 135 ? -16.187 -26.075 -20.305 1.00 61.32  ? 657  ASP A CG  1 
ATOM   782  O  OD1 . ASP A 1 135 ? -15.454 -26.083 -21.311 1.00 60.79  ? 657  ASP A OD1 1 
ATOM   783  O  OD2 . ASP A 1 135 ? -17.419 -25.895 -20.387 1.00 64.30  ? 657  ASP A OD2 1 
ATOM   784  N  N   . PHE A 1 136 ? -13.039 -24.290 -20.395 1.00 55.72  ? 658  PHE A N   1 
ATOM   785  C  CA  . PHE A 1 136 ? -12.671 -22.983 -20.948 1.00 53.83  ? 658  PHE A CA  1 
ATOM   786  C  C   . PHE A 1 136 ? -13.787 -22.301 -21.774 1.00 55.52  ? 658  PHE A C   1 
ATOM   787  O  O   . PHE A 1 136 ? -13.742 -21.089 -22.007 1.00 55.17  ? 658  PHE A O   1 
ATOM   788  C  CB  . PHE A 1 136 ? -11.363 -23.102 -21.754 1.00 52.96  ? 658  PHE A CB  1 
ATOM   789  C  CG  . PHE A 1 136 ? -10.110 -23.032 -20.903 1.00 51.71  ? 658  PHE A CG  1 
ATOM   790  C  CD1 . PHE A 1 136 ? -9.869  -23.974 -19.901 1.00 51.35  ? 658  PHE A CD1 1 
ATOM   791  C  CD2 . PHE A 1 136 ? -9.167  -22.017 -21.100 1.00 49.86  ? 658  PHE A CD2 1 
ATOM   792  C  CE1 . PHE A 1 136 ? -8.722  -23.903 -19.120 1.00 50.38  ? 658  PHE A CE1 1 
ATOM   793  C  CE2 . PHE A 1 136 ? -8.016  -21.942 -20.322 1.00 47.93  ? 658  PHE A CE2 1 
ATOM   794  C  CZ  . PHE A 1 136 ? -7.795  -22.882 -19.331 1.00 48.73  ? 658  PHE A CZ  1 
ATOM   795  N  N   . ALA A 1 137 ? -14.798 -23.059 -22.193 1.00 57.98  ? 659  ALA A N   1 
ATOM   796  C  CA  . ALA A 1 137 ? -15.965 -22.468 -22.864 1.00 59.96  ? 659  ALA A CA  1 
ATOM   797  C  C   . ALA A 1 137 ? -16.609 -21.337 -22.040 1.00 60.38  ? 659  ALA A C   1 
ATOM   798  O  O   . ALA A 1 137 ? -17.034 -20.333 -22.592 1.00 59.79  ? 659  ALA A O   1 
ATOM   799  C  CB  . ALA A 1 137 ? -16.997 -23.548 -23.182 1.00 60.65  ? 659  ALA A CB  1 
ATOM   800  N  N   . HIS A 1 138 ? -16.660 -21.493 -20.718 1.00 62.69  ? 660  HIS A N   1 
ATOM   801  C  CA  . HIS A 1 138 ? -17.373 -20.544 -19.856 1.00 63.58  ? 660  HIS A CA  1 
ATOM   802  C  C   . HIS A 1 138 ? -16.492 -19.492 -19.164 1.00 62.21  ? 660  HIS A C   1 
ATOM   803  O  O   . HIS A 1 138 ? -16.978 -18.755 -18.308 1.00 61.45  ? 660  HIS A O   1 
ATOM   804  C  CB  . HIS A 1 138 ? -18.176 -21.319 -18.807 1.00 65.66  ? 660  HIS A CB  1 
ATOM   805  C  CG  . HIS A 1 138 ? -19.318 -22.103 -19.384 1.00 70.24  ? 660  HIS A CG  1 
ATOM   806  N  ND1 . HIS A 1 138 ? -20.282 -21.531 -20.190 1.00 69.57  ? 660  HIS A ND1 1 
ATOM   807  C  CD2 . HIS A 1 138 ? -19.653 -23.411 -19.266 1.00 70.15  ? 660  HIS A CD2 1 
ATOM   808  C  CE1 . HIS A 1 138 ? -21.156 -22.453 -20.550 1.00 70.87  ? 660  HIS A CE1 1 
ATOM   809  N  NE2 . HIS A 1 138 ? -20.800 -23.601 -19.999 1.00 71.91  ? 660  HIS A NE2 1 
ATOM   810  N  N   . LEU A 1 139 ? -15.217 -19.396 -19.544 1.00 59.89  ? 661  LEU A N   1 
ATOM   811  C  CA  . LEU A 1 139 ? -14.264 -18.525 -18.834 1.00 55.40  ? 661  LEU A CA  1 
ATOM   812  C  C   . LEU A 1 139 ? -14.000 -17.146 -19.494 1.00 50.23  ? 661  LEU A C   1 
ATOM   813  O  O   . LEU A 1 139 ? -13.449 -16.257 -18.851 1.00 48.79  ? 661  LEU A O   1 
ATOM   814  C  CB  . LEU A 1 139 ? -12.947 -19.282 -18.593 1.00 54.54  ? 661  LEU A CB  1 
ATOM   815  C  CG  . LEU A 1 139 ? -13.011 -20.486 -17.631 1.00 54.18  ? 661  LEU A CG  1 
ATOM   816  C  CD1 . LEU A 1 139 ? -11.688 -21.243 -17.605 1.00 52.67  ? 661  LEU A CD1 1 
ATOM   817  C  CD2 . LEU A 1 139 ? -13.385 -20.062 -16.217 1.00 53.72  ? 661  LEU A CD2 1 
ATOM   818  N  N   . GLY A 1 140 ? -14.416 -16.967 -20.745 1.00 45.58  ? 662  GLY A N   1 
ATOM   819  C  CA  . GLY A 1 140 ? -14.205 -15.722 -21.474 1.00 43.68  ? 662  GLY A CA  1 
ATOM   820  C  C   . GLY A 1 140 ? -12.750 -15.289 -21.454 1.00 41.16  ? 662  GLY A C   1 
ATOM   821  O  O   . GLY A 1 140 ? -11.865 -16.066 -21.781 1.00 38.24  ? 662  GLY A O   1 
ATOM   822  N  N   . LEU A 1 141 ? -12.526 -14.056 -21.012 1.00 40.35  ? 663  LEU A N   1 
ATOM   823  C  CA  . LEU A 1 141 ? -11.207 -13.448 -20.938 1.00 40.03  ? 663  LEU A CA  1 
ATOM   824  C  C   . LEU A 1 141 ? -10.428 -13.711 -19.637 1.00 37.45  ? 663  LEU A C   1 
ATOM   825  O  O   . LEU A 1 141 ? -9.314  -13.247 -19.498 1.00 37.72  ? 663  LEU A O   1 
ATOM   826  C  CB  . LEU A 1 141 ? -11.361 -11.931 -21.104 1.00 42.16  ? 663  LEU A CB  1 
ATOM   827  C  CG  . LEU A 1 141 ? -11.904 -11.409 -22.440 1.00 44.14  ? 663  LEU A CG  1 
ATOM   828  C  CD1 . LEU A 1 141 ? -12.086 -9.900  -22.361 1.00 43.76  ? 663  LEU A CD1 1 
ATOM   829  C  CD2 . LEU A 1 141 ? -10.979 -11.784 -23.595 1.00 44.26  ? 663  LEU A CD2 1 
ATOM   830  N  N   . GLU A 1 142 ? -10.999 -14.430 -18.682 1.00 35.80  ? 664  GLU A N   1 
ATOM   831  C  CA  . GLU A 1 142 ? -10.358 -14.603 -17.376 1.00 35.43  ? 664  GLU A CA  1 
ATOM   832  C  C   . GLU A 1 142 ? -8.934  -15.188 -17.443 1.00 34.40  ? 664  GLU A C   1 
ATOM   833  O  O   . GLU A 1 142 ? -8.040  -14.681 -16.781 1.00 33.04  ? 664  GLU A O   1 
ATOM   834  C  CB  . GLU A 1 142 ? -11.227 -15.463 -16.454 1.00 37.07  ? 664  GLU A CB  1 
ATOM   835  C  CG  . GLU A 1 142 ? -10.849 -15.405 -14.986 1.00 37.52  ? 664  GLU A CG  1 
ATOM   836  C  CD  . GLU A 1 142 ? -11.866 -16.116 -14.111 1.00 39.56  ? 664  GLU A CD  1 
ATOM   837  O  OE1 . GLU A 1 142 ? -11.999 -17.356 -14.205 1.00 40.23  ? 664  GLU A OE1 1 
ATOM   838  O  OE2 . GLU A 1 142 ? -12.538 -15.428 -13.321 1.00 41.34  ? 664  GLU A OE2 1 
ATOM   839  N  N   . PRO A 1 143 ? -8.717  -16.250 -18.237 1.00 34.38  ? 665  PRO A N   1 
ATOM   840  C  CA  . PRO A 1 143 ? -7.377  -16.845 -18.245 1.00 33.72  ? 665  PRO A CA  1 
ATOM   841  C  C   . PRO A 1 143 ? -6.297  -15.853 -18.650 1.00 32.82  ? 665  PRO A C   1 
ATOM   842  O  O   . PRO A 1 143 ? -5.216  -15.836 -18.060 1.00 31.94  ? 665  PRO A O   1 
ATOM   843  C  CB  . PRO A 1 143 ? -7.491  -17.953 -19.282 1.00 34.53  ? 665  PRO A CB  1 
ATOM   844  C  CG  . PRO A 1 143 ? -8.952  -18.278 -19.323 1.00 35.40  ? 665  PRO A CG  1 
ATOM   845  C  CD  . PRO A 1 143 ? -9.641  -16.969 -19.135 1.00 35.06  ? 665  PRO A CD  1 
ATOM   846  N  N   . ILE A 1 144 ? -6.621  -15.014 -19.620 1.00 30.27  ? 666  ILE A N   1 
ATOM   847  C  CA  . ILE A 1 144 ? -5.731  -13.971 -20.071 1.00 29.59  ? 666  ILE A CA  1 
ATOM   848  C  C   . ILE A 1 144 ? -5.494  -12.880 -19.014 1.00 29.43  ? 666  ILE A C   1 
ATOM   849  O  O   . ILE A 1 144 ? -4.389  -12.366 -18.901 1.00 28.19  ? 666  ILE A O   1 
ATOM   850  C  CB  . ILE A 1 144 ? -6.235  -13.413 -21.417 1.00 30.25  ? 666  ILE A CB  1 
ATOM   851  C  CG1 . ILE A 1 144 ? -6.026  -14.492 -22.498 1.00 32.29  ? 666  ILE A CG1 1 
ATOM   852  C  CG2 . ILE A 1 144 ? -5.493  -12.145 -21.809 1.00 30.66  ? 666  ILE A CG2 1 
ATOM   853  C  CD1 . ILE A 1 144 ? -6.994  -14.411 -23.658 1.00 34.86  ? 666  ILE A CD1 1 
ATOM   854  N  N   . THR A 1 145 ? -6.525  -12.534 -18.251 1.00 29.44  ? 667  THR A N   1 
ATOM   855  C  CA  . THR A 1 145 ? -6.406  -11.623 -17.104 1.00 28.95  ? 667  THR A CA  1 
ATOM   856  C  C   . THR A 1 145 ? -5.501  -12.196 -15.998 1.00 28.34  ? 667  THR A C   1 
ATOM   857  O  O   . THR A 1 145 ? -4.762  -11.458 -15.347 1.00 25.94  ? 667  THR A O   1 
ATOM   858  C  CB  . THR A 1 145 ? -7.811  -11.346 -16.519 1.00 30.02  ? 667  THR A CB  1 
ATOM   859  O  OG1 . THR A 1 145 ? -8.609  -10.698 -17.506 1.00 31.71  ? 667  THR A OG1 1 
ATOM   860  C  CG2 . THR A 1 145 ? -7.791  -10.510 -15.259 1.00 29.91  ? 667  THR A CG2 1 
ATOM   861  N  N   . LEU A 1 146 ? -5.594  -13.502 -15.754 1.00 28.24  ? 668  LEU A N   1 
ATOM   862  C  CA  . LEU A 1 146 ? -4.721  -14.150 -14.777 1.00 27.66  ? 668  LEU A CA  1 
ATOM   863  C  C   . LEU A 1 146 ? -3.268  -14.082 -15.243 1.00 25.33  ? 668  LEU A C   1 
ATOM   864  O  O   . LEU A 1 146 ? -2.363  -13.985 -14.440 1.00 24.62  ? 668  LEU A O   1 
ATOM   865  C  CB  . LEU A 1 146 ? -5.103  -15.625 -14.558 1.00 28.14  ? 668  LEU A CB  1 
ATOM   866  C  CG  . LEU A 1 146 ? -6.443  -15.984 -13.914 1.00 29.58  ? 668  LEU A CG  1 
ATOM   867  C  CD1 . LEU A 1 146 ? -6.662  -17.497 -13.945 1.00 30.96  ? 668  LEU A CD1 1 
ATOM   868  C  CD2 . LEU A 1 146 ? -6.566  -15.470 -12.496 1.00 29.92  ? 668  LEU A CD2 1 
ATOM   869  N  N   . LEU A 1 147 ? -3.071  -14.191 -16.545 1.00 24.88  ? 669  LEU A N   1 
ATOM   870  C  CA  . LEU A 1 147 ? -1.759  -14.043 -17.160 1.00 25.10  ? 669  LEU A CA  1 
ATOM   871  C  C   . LEU A 1 147 ? -1.182  -12.614 -16.957 1.00 25.08  ? 669  LEU A C   1 
ATOM   872  O  O   . LEU A 1 147 ? -0.006  -12.463 -16.640 1.00 22.94  ? 669  LEU A O   1 
ATOM   873  C  CB  . LEU A 1 147 ? -1.841  -14.400 -18.638 1.00 24.91  ? 669  LEU A CB  1 
ATOM   874  C  CG  . LEU A 1 147 ? -1.271  -15.713 -19.174 1.00 25.68  ? 669  LEU A CG  1 
ATOM   875  C  CD1 . LEU A 1 147 ? -1.167  -16.859 -18.179 1.00 26.28  ? 669  LEU A CD1 1 
ATOM   876  C  CD2 . LEU A 1 147 ? -2.018  -16.138 -20.425 1.00 25.23  ? 669  LEU A CD2 1 
ATOM   877  N  N   . GLN A 1 148 ? -2.036  -11.605 -17.142 1.00 25.26  ? 670  GLN A N   1 
ATOM   878  C  CA  . GLN A 1 148 ? -1.725  -10.205 -16.889 1.00 26.48  ? 670  GLN A CA  1 
ATOM   879  C  C   . GLN A 1 148 ? -1.340  -9.948  -15.435 1.00 25.29  ? 670  GLN A C   1 
ATOM   880  O  O   . GLN A 1 148 ? -0.366  -9.264  -15.158 1.00 24.47  ? 670  GLN A O   1 
ATOM   881  C  CB  . GLN A 1 148 ? -2.926  -9.328  -17.281 1.00 28.97  ? 670  GLN A CB  1 
ATOM   882  C  CG  . GLN A 1 148 ? -2.753  -7.820  -17.110 1.00 32.76  ? 670  GLN A CG  1 
ATOM   883  C  CD  . GLN A 1 148 ? -3.916  -7.044  -17.730 1.00 36.78  ? 670  GLN A CD  1 
ATOM   884  O  OE1 . GLN A 1 148 ? -5.084  -7.237  -17.363 1.00 40.51  ? 670  GLN A OE1 1 
ATOM   885  N  NE2 . GLN A 1 148 ? -3.608  -6.176  -18.681 1.00 38.69  ? 670  GLN A NE2 1 
ATOM   886  N  N   . GLN A 1 149 ? -2.111  -10.505 -14.522 1.00 25.20  ? 671  GLN A N   1 
ATOM   887  C  CA  . GLN A 1 149 ? -1.882  -10.340 -13.102 1.00 25.44  ? 671  GLN A CA  1 
ATOM   888  C  C   . GLN A 1 149 ? -0.564  -10.960 -12.676 1.00 24.67  ? 671  GLN A C   1 
ATOM   889  O  O   . GLN A 1 149 ? 0.174   -10.374 -11.900 1.00 23.23  ? 671  GLN A O   1 
ATOM   890  C  CB  . GLN A 1 149 ? -3.036  -10.973 -12.315 1.00 26.35  ? 671  GLN A CB  1 
ATOM   891  C  CG  . GLN A 1 149 ? -4.299  -10.122 -12.282 1.00 26.64  ? 671  GLN A CG  1 
ATOM   892  C  CD  . GLN A 1 149 ? -5.585  -10.917 -12.036 1.00 26.69  ? 671  GLN A CD  1 
ATOM   893  O  OE1 . GLN A 1 149 ? -5.586  -12.133 -11.888 1.00 26.76  ? 671  GLN A OE1 1 
ATOM   894  N  NE2 . GLN A 1 149 ? -6.689  -10.214 -12.014 1.00 27.82  ? 671  GLN A NE2 1 
ATOM   895  N  N   . THR A 1 150 ? -0.293  -12.151 -13.191 1.00 24.16  ? 672  THR A N   1 
ATOM   896  C  CA  . THR A 1 150 ? 0.934   -12.864 -12.908 1.00 24.08  ? 672  THR A CA  1 
ATOM   897  C  C   . THR A 1 150 ? 2.136   -12.058 -13.357 1.00 24.30  ? 672  THR A C   1 
ATOM   898  O  O   . THR A 1 150 ? 3.071   -11.831 -12.586 1.00 25.08  ? 672  THR A O   1 
ATOM   899  C  CB  . THR A 1 150 ? 0.942   -14.216 -13.634 1.00 24.33  ? 672  THR A CB  1 
ATOM   900  O  OG1 . THR A 1 150 ? -0.126  -15.022 -13.152 1.00 24.30  ? 672  THR A OG1 1 
ATOM   901  C  CG2 . THR A 1 150 ? 2.250   -14.938 -13.432 1.00 25.14  ? 672  THR A CG2 1 
ATOM   902  N  N   . THR A 1 151 ? 2.107   -11.637 -14.616 1.00 23.90  ? 673  THR A N   1 
ATOM   903  C  CA  . THR A 1 151 ? 3.150   -10.802 -15.204 1.00 24.25  ? 673  THR A CA  1 
ATOM   904  C  C   . THR A 1 151 ? 3.376   -9.501  -14.437 1.00 24.57  ? 673  THR A C   1 
ATOM   905  O  O   . THR A 1 151 ? 4.489   -9.036  -14.277 1.00 25.80  ? 673  THR A O   1 
ATOM   906  C  CB  . THR A 1 151 ? 2.787   -10.448 -16.647 1.00 23.64  ? 673  THR A CB  1 
ATOM   907  O  OG1 . THR A 1 151 ? 2.541   -11.652 -17.372 1.00 22.04  ? 673  THR A OG1 1 
ATOM   908  C  CG2 . THR A 1 151 ? 3.928   -9.659  -17.314 1.00 24.24  ? 673  THR A CG2 1 
ATOM   909  N  N   . SER A 1 152 ? 2.291   -8.940  -13.962 1.00 24.41  ? 674  SER A N   1 
ATOM   910  C  CA  . SER A 1 152 ? 2.312   -7.730  -13.197 1.00 25.26  ? 674  SER A CA  1 
ATOM   911  C  C   . SER A 1 152 ? 2.992   -7.925  -11.839 1.00 25.39  ? 674  SER A C   1 
ATOM   912  O  O   . SER A 1 152 ? 3.770   -7.098  -11.400 1.00 25.24  ? 674  SER A O   1 
ATOM   913  C  CB  . SER A 1 152 ? 0.867   -7.249  -13.042 1.00 25.02  ? 674  SER A CB  1 
ATOM   914  O  OG  . SER A 1 152 ? 0.845   -6.192  -12.153 1.00 27.28  ? 674  SER A OG  1 
ATOM   915  N  N   . GLY A 1 153 ? 2.671   -9.032  -11.182 1.00 26.35  ? 675  GLY A N   1 
ATOM   916  C  CA  . GLY A 1 153 ? 3.342   -9.460  -9.950  1.00 26.84  ? 675  GLY A CA  1 
ATOM   917  C  C   . GLY A 1 153 ? 4.823   -9.669  -10.182 1.00 26.59  ? 675  GLY A C   1 
ATOM   918  O  O   . GLY A 1 153 ? 5.652   -9.262  -9.374  1.00 26.86  ? 675  GLY A O   1 
ATOM   919  N  N   . LEU A 1 154 ? 5.141   -10.267 -11.320 1.00 25.99  ? 676  LEU A N   1 
ATOM   920  C  CA  . LEU A 1 154 ? 6.510   -10.465 -11.728 1.00 26.79  ? 676  LEU A CA  1 
ATOM   921  C  C   . LEU A 1 154 ? 7.224   -9.147  -11.977 1.00 27.28  ? 676  LEU A C   1 
ATOM   922  O  O   . LEU A 1 154 ? 8.401   -9.024  -11.630 1.00 27.72  ? 676  LEU A O   1 
ATOM   923  C  CB  . LEU A 1 154 ? 6.564   -11.324 -12.989 1.00 27.57  ? 676  LEU A CB  1 
ATOM   924  C  CG  . LEU A 1 154 ? 7.917   -11.899 -13.385 1.00 28.49  ? 676  LEU A CG  1 
ATOM   925  C  CD1 . LEU A 1 154 ? 8.422   -12.839 -12.313 1.00 29.33  ? 676  LEU A CD1 1 
ATOM   926  C  CD2 . LEU A 1 154 ? 7.792   -12.629 -14.710 1.00 29.38  ? 676  LEU A CD2 1 
ATOM   927  N  N   . ALA A 1 155 ? 6.537   -8.169  -12.569 1.00 26.44  ? 677  ALA A N   1 
ATOM   928  C  CA  . ALA A 1 155 ? 7.174   -6.873  -12.824 1.00 27.38  ? 677  ALA A CA  1 
ATOM   929  C  C   . ALA A 1 155 ? 7.500   -6.156  -11.522 1.00 28.11  ? 677  ALA A C   1 
ATOM   930  O  O   . ALA A 1 155 ? 8.519   -5.472  -11.403 1.00 28.81  ? 677  ALA A O   1 
ATOM   931  C  CB  . ALA A 1 155 ? 6.308   -5.998  -13.699 1.00 26.91  ? 677  ALA A CB  1 
ATOM   932  N  N   . HIS A 1 156 ? 6.623   -6.331  -10.550 1.00 28.13  ? 678  HIS A N   1 
ATOM   933  C  CA  . HIS A 1 156 ? 6.817   -5.770  -9.236  1.00 29.29  ? 678  HIS A CA  1 
ATOM   934  C  C   . HIS A 1 156 ? 8.085   -6.326  -8.626  1.00 29.88  ? 678  HIS A C   1 
ATOM   935  O  O   . HIS A 1 156 ? 8.933   -5.566  -8.184  1.00 31.27  ? 678  HIS A O   1 
ATOM   936  C  CB  . HIS A 1 156 ? 5.609   -6.071  -8.338  1.00 28.82  ? 678  HIS A CB  1 
ATOM   937  C  CG  . HIS A 1 156 ? 5.750   -5.537  -6.951  1.00 30.03  ? 678  HIS A CG  1 
ATOM   938  N  ND1 . HIS A 1 156 ? 5.742   -4.189  -6.670  1.00 31.47  ? 678  HIS A ND1 1 
ATOM   939  C  CD2 . HIS A 1 156 ? 5.923   -6.168  -5.767  1.00 30.55  ? 678  HIS A CD2 1 
ATOM   940  C  CE1 . HIS A 1 156 ? 5.896   -4.014  -5.370  1.00 32.54  ? 678  HIS A CE1 1 
ATOM   941  N  NE2 . HIS A 1 156 ? 6.014   -5.199  -4.801  1.00 32.03  ? 678  HIS A NE2 1 
ATOM   942  N  N   . LEU A 1 157 ? 8.198   -7.652  -8.602  1.00 30.07  ? 679  LEU A N   1 
ATOM   943  C  CA  . LEU A 1 157 ? 9.381   -8.320  -8.092  1.00 31.10  ? 679  LEU A CA  1 
ATOM   944  C  C   . LEU A 1 157 ? 10.661  -7.854  -8.768  1.00 31.32  ? 679  LEU A C   1 
ATOM   945  O  O   . LEU A 1 157 ? 11.641  -7.510  -8.096  1.00 31.09  ? 679  LEU A O   1 
ATOM   946  C  CB  . LEU A 1 157 ? 9.258   -9.822  -8.255  1.00 32.73  ? 679  LEU A CB  1 
ATOM   947  C  CG  . LEU A 1 157 ? 8.855   -10.635 -7.026  1.00 34.77  ? 679  LEU A CG  1 
ATOM   948  C  CD1 . LEU A 1 157 ? 7.712   -9.992  -6.268  1.00 37.02  ? 679  LEU A CD1 1 
ATOM   949  C  CD2 . LEU A 1 157 ? 8.472   -12.050 -7.439  1.00 35.31  ? 679  LEU A CD2 1 
ATOM   950  N  N   . HIS A 1 158 ? 10.650  -7.825  -10.095 1.00 30.78  ? 680  HIS A N   1 
ATOM   951  C  CA  . HIS A 1 158 ? 11.828  -7.402  -10.841 1.00 31.12  ? 680  HIS A CA  1 
ATOM   952  C  C   . HIS A 1 158 ? 12.232  -5.963  -10.542 1.00 32.31  ? 680  HIS A C   1 
ATOM   953  O  O   . HIS A 1 158 ? 13.418  -5.634  -10.558 1.00 32.85  ? 680  HIS A O   1 
ATOM   954  C  CB  . HIS A 1 158 ? 11.606  -7.576  -12.335 1.00 30.14  ? 680  HIS A CB  1 
ATOM   955  C  CG  . HIS A 1 158 ? 11.609  -9.003  -12.784 1.00 29.54  ? 680  HIS A CG  1 
ATOM   956  N  ND1 . HIS A 1 158 ? 11.415  -9.371  -14.098 1.00 28.82  ? 680  HIS A ND1 1 
ATOM   957  C  CD2 . HIS A 1 158 ? 11.763  -10.150 -12.094 1.00 29.36  ? 680  HIS A CD2 1 
ATOM   958  C  CE1 . HIS A 1 158 ? 11.470  -10.680 -14.197 1.00 28.37  ? 680  HIS A CE1 1 
ATOM   959  N  NE2 . HIS A 1 158 ? 11.677  -11.178 -12.994 1.00 28.72  ? 680  HIS A NE2 1 
ATOM   960  N  N   . SER A 1 159 ? 11.237  -5.119  -10.275 1.00 32.93  ? 681  SER A N   1 
ATOM   961  C  CA  . SER A 1 159 ? 11.458  -3.707  -9.975  1.00 34.50  ? 681  SER A CA  1 
ATOM   962  C  C   . SER A 1 159 ? 12.109  -3.517  -8.605  1.00 35.99  ? 681  SER A C   1 
ATOM   963  O  O   . SER A 1 159 ? 12.678  -2.452  -8.330  1.00 37.42  ? 681  SER A O   1 
ATOM   964  C  CB  . SER A 1 159 ? 10.140  -2.918  -10.057 1.00 34.57  ? 681  SER A CB  1 
ATOM   965  O  OG  . SER A 1 159 ? 9.342   -3.076  -8.891  1.00 34.71  ? 681  SER A OG  1 
ATOM   966  N  N   . LEU A 1 160 ? 12.011  -4.549  -7.758  1.00 36.02  ? 682  LEU A N   1 
ATOM   967  C  CA  . LEU A 1 160 ? 12.711  -4.602  -6.462  1.00 37.06  ? 682  LEU A CA  1 
ATOM   968  C  C   . LEU A 1 160 ? 14.024  -5.387  -6.511  1.00 36.10  ? 682  LEU A C   1 
ATOM   969  O  O   . LEU A 1 160 ? 14.564  -5.721  -5.469  1.00 36.08  ? 682  LEU A O   1 
ATOM   970  C  CB  . LEU A 1 160 ? 11.798  -5.205  -5.384  1.00 37.24  ? 682  LEU A CB  1 
ATOM   971  C  CG  . LEU A 1 160 ? 10.543  -4.400  -5.036  1.00 38.60  ? 682  LEU A CG  1 
ATOM   972  C  CD1 . LEU A 1 160 ? 9.563   -5.230  -4.223  1.00 39.91  ? 682  LEU A CD1 1 
ATOM   973  C  CD2 . LEU A 1 160 ? 10.880  -3.126  -4.291  1.00 40.34  ? 682  LEU A CD2 1 
ATOM   974  N  N   . ASN A 1 161 ? 14.546  -5.645  -7.714  1.00 36.31  ? 683  ASN A N   1 
ATOM   975  C  CA  . ASN A 1 161 ? 15.794  -6.423  -7.911  1.00 36.57  ? 683  ASN A CA  1 
ATOM   976  C  C   . ASN A 1 161 ? 15.688  -7.906  -7.548  1.00 34.90  ? 683  ASN A C   1 
ATOM   977  O  O   . ASN A 1 161 ? 16.679  -8.549  -7.225  1.00 36.01  ? 683  ASN A O   1 
ATOM   978  C  CB  . ASN A 1 161 ? 16.970  -5.799  -7.134  1.00 38.15  ? 683  ASN A CB  1 
ATOM   979  C  CG  . ASN A 1 161 ? 17.670  -4.714  -7.902  1.00 39.21  ? 683  ASN A CG  1 
ATOM   980  O  OD1 . ASN A 1 161 ? 17.055  -3.976  -8.665  1.00 38.86  ? 683  ASN A OD1 1 
ATOM   981  N  ND2 . ASN A 1 161 ? 18.981  -4.607  -7.694  1.00 41.69  ? 683  ASN A ND2 1 
ATOM   982  N  N   . ILE A 1 162 ? 14.490  -8.452  -7.608  1.00 33.79  ? 684  ILE A N   1 
ATOM   983  C  CA  . ILE A 1 162 ? 14.269  -9.841  -7.250  1.00 32.83  ? 684  ILE A CA  1 
ATOM   984  C  C   . ILE A 1 162 ? 13.928  -10.668 -8.483  1.00 31.45  ? 684  ILE A C   1 
ATOM   985  O  O   . ILE A 1 162 ? 12.964  -10.374 -9.184  1.00 30.07  ? 684  ILE A O   1 
ATOM   986  C  CB  . ILE A 1 162 ? 13.121  -9.961  -6.253  1.00 32.89  ? 684  ILE A CB  1 
ATOM   987  C  CG1 . ILE A 1 162 ? 13.465  -9.201  -4.970  1.00 34.95  ? 684  ILE A CG1 1 
ATOM   988  C  CG2 . ILE A 1 162 ? 12.820  -11.426 -5.977  1.00 32.57  ? 684  ILE A CG2 1 
ATOM   989  C  CD1 . ILE A 1 162 ? 12.313  -9.061  -3.993  1.00 35.66  ? 684  ILE A CD1 1 
ATOM   990  N  N   . VAL A 1 163 ? 14.717  -11.707 -8.729  1.00 31.15  ? 685  VAL A N   1 
ATOM   991  C  CA  . VAL A 1 163 ? 14.412  -12.680 -9.752  1.00 30.03  ? 685  VAL A CA  1 
ATOM   992  C  C   . VAL A 1 163 ? 13.813  -13.864 -9.023  1.00 29.11  ? 685  VAL A C   1 
ATOM   993  O  O   . VAL A 1 163 ? 14.358  -14.314 -8.021  1.00 29.75  ? 685  VAL A O   1 
ATOM   994  C  CB  . VAL A 1 163 ? 15.678  -13.136 -10.505 1.00 30.97  ? 685  VAL A CB  1 
ATOM   995  C  CG1 . VAL A 1 163 ? 15.314  -13.931 -11.755 1.00 30.66  ? 685  VAL A CG1 1 
ATOM   996  C  CG2 . VAL A 1 163 ? 16.543  -11.952 -10.884 1.00 32.75  ? 685  VAL A CG2 1 
ATOM   997  N  N   . HIS A 1 164 ? 12.631  -14.305 -9.445  1.00 28.57  ? 686  HIS A N   1 
ATOM   998  C  CA  . HIS A 1 164 ? 11.988  -15.434 -8.787  1.00 28.72  ? 686  HIS A CA  1 
ATOM   999  C  C   . HIS A 1 164 ? 12.638  -16.819 -8.987  1.00 29.14  ? 686  HIS A C   1 
ATOM   1000 O  O   . HIS A 1 164 ? 12.869  -17.533 -8.021  1.00 28.08  ? 686  HIS A O   1 
ATOM   1001 C  CB  . HIS A 1 164 ? 10.518  -15.503 -9.281  1.00 28.11  ? 686  HIS A CB  1 
ATOM   1002 C  CG  . HIS A 1 164 ? 9.687   -16.528 -8.581  1.00 27.11  ? 686  HIS A CG  1 
ATOM   1003 N  ND1 . HIS A 1 164 ? 9.680   -17.854 -8.948  1.00 26.71  ? 686  HIS A ND1 1 
ATOM   1004 C  CD2 . HIS A 1 164 ? 8.826   -16.421 -7.545  1.00 27.00  ? 686  HIS A CD2 1 
ATOM   1005 C  CE1 . HIS A 1 164 ? 8.857   -18.521 -8.163  1.00 27.16  ? 686  HIS A CE1 1 
ATOM   1006 N  NE2 . HIS A 1 164 ? 8.326   -17.674 -7.302  1.00 27.52  ? 686  HIS A NE2 1 
ATOM   1007 N  N   . ARG A 1 165 ? 13.029  -17.119 -10.200 1.00 30.52  ? 687  ARG A N   1 
ATOM   1008 C  CA  . ARG A 1 165 ? 13.766  -18.307 -10.549 1.00 32.72  ? 687  ARG A CA  1 
ATOM   1009 C  C   . ARG A 1 165 ? 13.034  -19.686 -10.590 1.00 32.06  ? 687  ARG A C   1 
ATOM   1010 O  O   . ARG A 1 165 ? 13.596  -20.684 -11.021 1.00 32.90  ? 687  ARG A O   1 
ATOM   1011 C  CB  . ARG A 1 165 ? 15.024  -18.395 -9.723  1.00 36.29  ? 687  ARG A CB  1 
ATOM   1012 C  CG  . ARG A 1 165 ? 16.085  -17.391 -10.126 1.00 39.82  ? 687  ARG A CG  1 
ATOM   1013 C  CD  . ARG A 1 165 ? 17.261  -17.429 -9.175  1.00 43.78  ? 687  ARG A CD  1 
ATOM   1014 N  NE  . ARG A 1 165 ? 17.923  -18.725 -9.208  1.00 49.63  ? 687  ARG A NE  1 
ATOM   1015 C  CZ  . ARG A 1 165 ? 18.686  -19.195 -8.231  1.00 54.28  ? 687  ARG A CZ  1 
ATOM   1016 N  NH1 . ARG A 1 165 ? 18.891  -18.470 -7.143  1.00 56.50  ? 687  ARG A NH1 1 
ATOM   1017 N  NH2 . ARG A 1 165 ? 19.249  -20.388 -8.346  1.00 55.47  ? 687  ARG A NH2 1 
ATOM   1018 N  N   . ASP A 1 166 ? 11.767  -19.693 -10.149 1.00 31.48  ? 688  ASP A N   1 
ATOM   1019 C  CA  . ASP A 1 166 ? 10.990  -20.923 -10.086 1.00 32.24  ? 688  ASP A CA  1 
ATOM   1020 C  C   . ASP A 1 166 ? 9.553   -20.790 -10.544 1.00 30.49  ? 688  ASP A C   1 
ATOM   1021 O  O   . ASP A 1 166 ? 8.673   -21.439 -9.999  1.00 31.99  ? 688  ASP A O   1 
ATOM   1022 C  CB  . ASP A 1 166 ? 11.080  -21.573 -8.712  1.00 33.03  ? 688  ASP A CB  1 
ATOM   1023 C  CG  . ASP A 1 166 ? 10.842  -23.062 -8.750  1.00 32.69  ? 688  ASP A CG  1 
ATOM   1024 O  OD1 . ASP A 1 166 ? 10.939  -23.648 -9.840  1.00 32.48  ? 688  ASP A OD1 1 
ATOM   1025 O  OD2 . ASP A 1 166 ? 10.549  -23.646 -7.695  1.00 33.92  ? 688  ASP A OD2 1 
ATOM   1026 N  N   . LEU A 1 167 ? 9.302   -19.923 -11.513 1.00 29.77  ? 689  LEU A N   1 
ATOM   1027 C  CA  . LEU A 1 167 ? 7.942   -19.706 -11.979 1.00 30.52  ? 689  LEU A CA  1 
ATOM   1028 C  C   . LEU A 1 167 ? 7.370   -20.955 -12.639 1.00 28.15  ? 689  LEU A C   1 
ATOM   1029 O  O   . LEU A 1 167 ? 8.009   -21.563 -13.484 1.00 28.13  ? 689  LEU A O   1 
ATOM   1030 C  CB  . LEU A 1 167 ? 7.924   -18.544 -12.969 1.00 32.08  ? 689  LEU A CB  1 
ATOM   1031 C  CG  . LEU A 1 167 ? 6.726   -17.602 -12.995 1.00 34.72  ? 689  LEU A CG  1 
ATOM   1032 C  CD1 . LEU A 1 167 ? 6.330   -17.182 -11.592 1.00 36.72  ? 689  LEU A CD1 1 
ATOM   1033 C  CD2 . LEU A 1 167 ? 7.064   -16.388 -13.841 1.00 36.51  ? 689  LEU A CD2 1 
ATOM   1034 N  N   . LYS A 1 168 ? 6.147   -21.309 -12.267 1.00 27.10  ? 690  LYS A N   1 
ATOM   1035 C  CA  . LYS A 1 168 ? 5.434   -22.435 -12.881 1.00 26.97  ? 690  LYS A CA  1 
ATOM   1036 C  C   . LYS A 1 168 ? 3.929   -22.404 -12.520 1.00 26.24  ? 690  LYS A C   1 
ATOM   1037 O  O   . LYS A 1 168 ? 3.528   -21.688 -11.601 1.00 25.86  ? 690  LYS A O   1 
ATOM   1038 C  CB  . LYS A 1 168 ? 6.060   -23.747 -12.446 1.00 27.80  ? 690  LYS A CB  1 
ATOM   1039 C  CG  . LYS A 1 168 ? 6.084   -23.956 -10.940 1.00 28.74  ? 690  LYS A CG  1 
ATOM   1040 C  CD  . LYS A 1 168 ? 6.954   -25.137 -10.539 1.00 29.57  ? 690  LYS A CD  1 
ATOM   1041 C  CE  . LYS A 1 168 ? 7.065   -25.222 -9.034  1.00 29.02  ? 690  LYS A CE  1 
ATOM   1042 N  NZ  . LYS A 1 168 ? 7.851   -26.415 -8.690  1.00 30.17  ? 690  LYS A NZ  1 
ATOM   1043 N  N   . PRO A 1 169 ? 3.095   -23.172 -13.228 1.00 25.76  ? 691  PRO A N   1 
ATOM   1044 C  CA  . PRO A 1 169 ? 1.668   -23.139 -12.906 1.00 27.41  ? 691  PRO A CA  1 
ATOM   1045 C  C   . PRO A 1 169 ? 1.325   -23.639 -11.501 1.00 28.55  ? 691  PRO A C   1 
ATOM   1046 O  O   . PRO A 1 169 ? 0.327   -23.231 -10.931 1.00 27.22  ? 691  PRO A O   1 
ATOM   1047 C  CB  . PRO A 1 169 ? 1.038   -24.037 -13.970 1.00 27.50  ? 691  PRO A CB  1 
ATOM   1048 C  CG  . PRO A 1 169 ? 2.044   -24.100 -15.070 1.00 27.56  ? 691  PRO A CG  1 
ATOM   1049 C  CD  . PRO A 1 169 ? 3.371   -24.019 -14.392 1.00 26.96  ? 691  PRO A CD  1 
ATOM   1050 N  N   . HIS A 1 170 ? 2.201   -24.477 -10.962 1.00 31.20  ? 692  HIS A N   1 
ATOM   1051 C  CA  . HIS A 1 170 ? 2.050   -25.112 -9.662  1.00 33.10  ? 692  HIS A CA  1 
ATOM   1052 C  C   . HIS A 1 170 ? 2.148   -24.137 -8.486  1.00 30.48  ? 692  HIS A C   1 
ATOM   1053 O  O   . HIS A 1 170 ? 1.603   -24.412 -7.444  1.00 31.67  ? 692  HIS A O   1 
ATOM   1054 C  CB  . HIS A 1 170 ? 3.129   -26.199 -9.471  1.00 36.71  ? 692  HIS A CB  1 
ATOM   1055 C  CG  . HIS A 1 170 ? 3.236   -27.183 -10.604 1.00 41.81  ? 692  HIS A CG  1 
ATOM   1056 N  ND1 . HIS A 1 170 ? 3.783   -26.862 -11.834 1.00 43.09  ? 692  HIS A ND1 1 
ATOM   1057 C  CD2 . HIS A 1 170 ? 2.890   -28.491 -10.681 1.00 44.63  ? 692  HIS A CD2 1 
ATOM   1058 C  CE1 . HIS A 1 170 ? 3.748   -27.920 -12.621 1.00 45.32  ? 692  HIS A CE1 1 
ATOM   1059 N  NE2 . HIS A 1 170 ? 3.213   -28.922 -11.946 1.00 46.52  ? 692  HIS A NE2 1 
ATOM   1060 N  N   . ASN A 1 171 ? 2.855   -23.022 -8.644  1.00 28.45  ? 693  ASN A N   1 
ATOM   1061 C  CA  . ASN A 1 171 ? 2.953   -21.997 -7.594  1.00 26.60  ? 693  ASN A CA  1 
ATOM   1062 C  C   . ASN A 1 171 ? 2.409   -20.609 -7.975  1.00 25.02  ? 693  ASN A C   1 
ATOM   1063 O  O   . ASN A 1 171 ? 2.624   -19.619 -7.270  1.00 24.93  ? 693  ASN A O   1 
ATOM   1064 C  CB  . ASN A 1 171 ? 4.394   -21.888 -7.056  1.00 25.98  ? 693  ASN A CB  1 
ATOM   1065 C  CG  . ASN A 1 171 ? 5.421   -21.645 -8.142  1.00 24.78  ? 693  ASN A CG  1 
ATOM   1066 O  OD1 . ASN A 1 171 ? 5.109   -21.147 -9.198  1.00 24.64  ? 693  ASN A OD1 1 
ATOM   1067 N  ND2 . ASN A 1 171 ? 6.659   -22.002 -7.872  1.00 25.83  ? 693  ASN A ND2 1 
ATOM   1068 N  N   . ILE A 1 172 ? 1.703   -20.534 -9.079  1.00 24.55  ? 694  ILE A N   1 
ATOM   1069 C  CA  . ILE A 1 172 ? 0.889   -19.358 -9.361  1.00 25.42  ? 694  ILE A CA  1 
ATOM   1070 C  C   . ILE A 1 172 ? -0.503  -19.636 -8.764  1.00 25.78  ? 694  ILE A C   1 
ATOM   1071 O  O   . ILE A 1 172 ? -1.246  -20.485 -9.250  1.00 25.04  ? 694  ILE A O   1 
ATOM   1072 C  CB  . ILE A 1 172 ? 0.824   -19.049 -10.868 1.00 25.25  ? 694  ILE A CB  1 
ATOM   1073 C  CG1 . ILE A 1 172 ? 2.200   -18.652 -11.390 1.00 25.12  ? 694  ILE A CG1 1 
ATOM   1074 C  CG2 . ILE A 1 172 ? -0.191  -17.943 -11.141 1.00 25.81  ? 694  ILE A CG2 1 
ATOM   1075 C  CD1 . ILE A 1 172 ? 2.322   -18.745 -12.900 1.00 25.46  ? 694  ILE A CD1 1 
ATOM   1076 N  N   . LEU A 1 173 ? -0.830  -18.929 -7.690  1.00 26.92  ? 695  LEU A N   1 
ATOM   1077 C  CA  . LEU A 1 173 ? -1.993  -19.263 -6.880  1.00 28.56  ? 695  LEU A CA  1 
ATOM   1078 C  C   . LEU A 1 173 ? -3.172  -18.408 -7.268  1.00 28.65  ? 695  LEU A C   1 
ATOM   1079 O  O   . LEU A 1 173 ? -3.028  -17.269 -7.644  1.00 28.99  ? 695  LEU A O   1 
ATOM   1080 C  CB  . LEU A 1 173 ? -1.681  -19.115 -5.388  1.00 29.53  ? 695  LEU A CB  1 
ATOM   1081 C  CG  . LEU A 1 173 ? -0.429  -19.869 -4.923  1.00 29.65  ? 695  LEU A CG  1 
ATOM   1082 C  CD1 . LEU A 1 173 ? -0.224  -19.717 -3.430  1.00 31.07  ? 695  LEU A CD1 1 
ATOM   1083 C  CD2 . LEU A 1 173 ? -0.483  -21.343 -5.301  1.00 31.41  ? 695  LEU A CD2 1 
ATOM   1084 N  N   . ILE A 1 174 ? -4.342  -19.006 -7.202  1.00 29.97  ? 696  ILE A N   1 
ATOM   1085 C  CA  . ILE A 1 174 ? -5.576  -18.357 -7.538  1.00 30.09  ? 696  ILE A CA  1 
ATOM   1086 C  C   . ILE A 1 174 ? -6.268  -18.068 -6.222  1.00 30.09  ? 696  ILE A C   1 
ATOM   1087 O  O   . ILE A 1 174 ? -6.521  -18.975 -5.438  1.00 30.55  ? 696  ILE A O   1 
ATOM   1088 C  CB  . ILE A 1 174 ? -6.468  -19.273 -8.388  1.00 31.04  ? 696  ILE A CB  1 
ATOM   1089 C  CG1 . ILE A 1 174 ? -5.693  -19.835 -9.575  1.00 32.03  ? 696  ILE A CG1 1 
ATOM   1090 C  CG2 . ILE A 1 174 ? -7.718  -18.541 -8.854  1.00 31.35  ? 696  ILE A CG2 1 
ATOM   1091 C  CD1 . ILE A 1 174 ? -5.063  -18.788 -10.460 1.00 33.37  ? 696  ILE A CD1 1 
ATOM   1092 N  N   . SER A 1 175 ? -6.598  -16.805 -6.005  1.00 29.29  ? 697  SER A N   1 
ATOM   1093 C  CA  . SER A 1 175 ? -7.253  -16.366 -4.797  1.00 30.10  ? 697  SER A CA  1 
ATOM   1094 C  C   . SER A 1 175 ? -8.625  -17.001 -4.586  1.00 31.99  ? 697  SER A C   1 
ATOM   1095 O  O   . SER A 1 175 ? -9.234  -17.522 -5.508  1.00 30.92  ? 697  SER A O   1 
ATOM   1096 C  CB  . SER A 1 175 ? -7.438  -14.851 -4.858  1.00 29.46  ? 697  SER A CB  1 
ATOM   1097 O  OG  . SER A 1 175 ? -8.466  -14.511 -5.770  1.00 28.89  ? 697  SER A OG  1 
ATOM   1098 N  N   . MET A 1 176 ? -9.110  -16.906 -3.355  1.00 35.85  ? 698  MET A N   1 
ATOM   1099 C  CA  . MET A 1 176 ? -10.521 -17.144 -3.048  1.00 39.09  ? 698  MET A CA  1 
ATOM   1100 C  C   . MET A 1 176 ? -11.344 -16.097 -3.806  1.00 39.95  ? 698  MET A C   1 
ATOM   1101 O  O   . MET A 1 176 ? -10.944 -14.939 -3.858  1.00 39.20  ? 698  MET A O   1 
ATOM   1102 C  CB  . MET A 1 176 ? -10.796 -16.989 -1.541  1.00 41.66  ? 698  MET A CB  1 
ATOM   1103 C  CG  . MET A 1 176 ? -10.000 -17.899 -0.605  1.00 43.29  ? 698  MET A CG  1 
ATOM   1104 S  SD  . MET A 1 176 ? -10.391 -19.646 -0.758  1.00 45.07  ? 698  MET A SD  1 
ATOM   1105 C  CE  . MET A 1 176 ? -12.158 -19.619 -0.480  1.00 47.55  ? 698  MET A CE  1 
ATOM   1106 N  N   . PRO A 1 177 ? -12.487 -16.492 -4.404  1.00 41.69  ? 699  PRO A N   1 
ATOM   1107 C  CA  . PRO A 1 177 ? -13.331 -15.485 -5.061  1.00 42.45  ? 699  PRO A CA  1 
ATOM   1108 C  C   . PRO A 1 177 ? -13.944 -14.499 -4.083  1.00 42.06  ? 699  PRO A C   1 
ATOM   1109 O  O   . PRO A 1 177 ? -14.223 -14.868 -2.955  1.00 41.20  ? 699  PRO A O   1 
ATOM   1110 C  CB  . PRO A 1 177 ? -14.455 -16.319 -5.709  1.00 43.40  ? 699  PRO A CB  1 
ATOM   1111 C  CG  . PRO A 1 177 ? -14.470 -17.599 -4.950  1.00 44.31  ? 699  PRO A CG  1 
ATOM   1112 C  CD  . PRO A 1 177 ? -13.036 -17.851 -4.568  1.00 42.83  ? 699  PRO A CD  1 
ATOM   1113 N  N   . ASN A 1 178 ? -14.166 -13.264 -4.526  1.00 41.77  ? 700  ASN A N   1 
ATOM   1114 C  CA  . ASN A 1 178 ? -14.957 -12.316 -3.746  1.00 42.47  ? 700  ASN A CA  1 
ATOM   1115 C  C   . ASN A 1 178 ? -16.447 -12.536 -4.002  1.00 42.68  ? 700  ASN A C   1 
ATOM   1116 O  O   . ASN A 1 178 ? -16.822 -13.417 -4.770  1.00 41.41  ? 700  ASN A O   1 
ATOM   1117 C  CB  . ASN A 1 178 ? -14.516 -10.874 -4.016  1.00 42.39  ? 700  ASN A CB  1 
ATOM   1118 C  CG  . ASN A 1 178 ? -14.940 -10.360 -5.378  1.00 42.72  ? 700  ASN A CG  1 
ATOM   1119 O  OD1 . ASN A 1 178 ? -15.853 -10.877 -6.022  1.00 43.28  ? 700  ASN A OD1 1 
ATOM   1120 N  ND2 . ASN A 1 178 ? -14.281 -9.312  -5.815  1.00 42.72  ? 700  ASN A ND2 1 
ATOM   1121 N  N   . ALA A 1 179 ? -17.296 -11.732 -3.372  1.00 44.48  ? 701  ALA A N   1 
ATOM   1122 C  CA  . ALA A 1 179 ? -18.742 -11.967 -3.407  1.00 45.87  ? 701  ALA A CA  1 
ATOM   1123 C  C   . ALA A 1 179 ? -19.335 -11.944 -4.824  1.00 45.15  ? 701  ALA A C   1 
ATOM   1124 O  O   . ALA A 1 179 ? -20.415 -12.491 -5.053  1.00 45.42  ? 701  ALA A O   1 
ATOM   1125 C  CB  . ALA A 1 179 ? -19.470 -10.981 -2.493  1.00 47.87  ? 701  ALA A CB  1 
ATOM   1126 N  N   . HIS A 1 180 ? -18.633 -11.319 -5.768  1.00 44.63  ? 702  HIS A N   1 
ATOM   1127 C  CA  . HIS A 1 180 ? -19.040 -11.332 -7.183  1.00 43.87  ? 702  HIS A CA  1 
ATOM   1128 C  C   . HIS A 1 180 ? -18.324 -12.393 -8.018  1.00 41.19  ? 702  HIS A C   1 
ATOM   1129 O  O   . HIS A 1 180 ? -18.410 -12.365 -9.239  1.00 39.45  ? 702  HIS A O   1 
ATOM   1130 C  CB  . HIS A 1 180 ? -18.824 -9.956  -7.817  1.00 43.73  ? 702  HIS A CB  1 
ATOM   1131 C  CG  . HIS A 1 180 ? -19.439 -8.843  -7.040  1.00 45.41  ? 702  HIS A CG  1 
ATOM   1132 N  ND1 . HIS A 1 180 ? -20.798 -8.621  -7.012  1.00 48.63  ? 702  HIS A ND1 1 
ATOM   1133 C  CD2 . HIS A 1 180 ? -18.885 -7.900  -6.247  1.00 45.99  ? 702  HIS A CD2 1 
ATOM   1134 C  CE1 . HIS A 1 180 ? -21.056 -7.584  -6.238  1.00 49.42  ? 702  HIS A CE1 1 
ATOM   1135 N  NE2 . HIS A 1 180 ? -19.911 -7.127  -5.761  1.00 48.82  ? 702  HIS A NE2 1 
ATOM   1136 N  N   . GLY A 1 181 ? -17.623 -13.320 -7.367  1.00 41.50  ? 703  GLY A N   1 
ATOM   1137 C  CA  . GLY A 1 181 ? -16.963 -14.437 -8.049  1.00 40.50  ? 703  GLY A CA  1 
ATOM   1138 C  C   . GLY A 1 181 ? -15.690 -14.081 -8.785  1.00 39.72  ? 703  GLY A C   1 
ATOM   1139 O  O   . GLY A 1 181 ? -15.169 -14.894 -9.543  1.00 38.19  ? 703  GLY A O   1 
ATOM   1140 N  N   . LYS A 1 182 ? -15.192 -12.866 -8.556  1.00 40.81  ? 704  LYS A N   1 
ATOM   1141 C  CA  . LYS A 1 182 ? -13.976 -12.368 -9.183  1.00 40.60  ? 704  LYS A CA  1 
ATOM   1142 C  C   . LYS A 1 182 ? -12.755 -13.018 -8.515  1.00 37.65  ? 704  LYS A C   1 
ATOM   1143 O  O   . LYS A 1 182 ? -12.696 -13.151 -7.292  1.00 36.32  ? 704  LYS A O   1 
ATOM   1144 C  CB  . LYS A 1 182 ? -13.907 -10.841 -9.033  1.00 44.04  ? 704  LYS A CB  1 
ATOM   1145 C  CG  . LYS A 1 182 ? -13.437 -10.106 -10.277 1.00 46.93  ? 704  LYS A CG  1 
ATOM   1146 C  CD  . LYS A 1 182 ? -13.392 -8.592  -10.067 1.00 49.92  ? 704  LYS A CD  1 
ATOM   1147 C  CE  . LYS A 1 182 ? -12.073 -8.144  -9.439  1.00 51.55  ? 704  LYS A CE  1 
ATOM   1148 N  NZ  . LYS A 1 182 ? -12.230 -6.856  -8.704  1.00 54.22  ? 704  LYS A NZ  1 
ATOM   1149 N  N   . ILE A 1 183 ? -11.777 -13.407 -9.314  1.00 34.95  ? 705  ILE A N   1 
ATOM   1150 C  CA  . ILE A 1 183 ? -10.541 -14.011 -8.775  1.00 33.56  ? 705  ILE A CA  1 
ATOM   1151 C  C   . ILE A 1 183 ? -9.311  -13.292 -9.288  1.00 31.06  ? 705  ILE A C   1 
ATOM   1152 O  O   . ILE A 1 183 ? -9.404  -12.463 -10.174 1.00 30.18  ? 705  ILE A O   1 
ATOM   1153 C  CB  . ILE A 1 183 ? -10.407 -15.506 -9.146  1.00 33.05  ? 705  ILE A CB  1 
ATOM   1154 C  CG1 . ILE A 1 183 ? -10.592 -15.711 -10.655 1.00 32.13  ? 705  ILE A CG1 1 
ATOM   1155 C  CG2 . ILE A 1 183 ? -11.411 -16.333 -8.369  1.00 34.00  ? 705  ILE A CG2 1 
ATOM   1156 C  CD1 . ILE A 1 183 ? -10.310 -17.114 -11.113 1.00 31.72  ? 705  ILE A CD1 1 
ATOM   1157 N  N   . LYS A 1 184 ? -8.161  -13.624 -8.714  1.00 30.60  ? 706  LYS A N   1 
ATOM   1158 C  CA  . LYS A 1 184 ? -6.883  -13.117 -9.192  1.00 29.94  ? 706  LYS A CA  1 
ATOM   1159 C  C   . LYS A 1 184 ? -5.719  -14.070 -8.921  1.00 29.13  ? 706  LYS A C   1 
ATOM   1160 O  O   . LYS A 1 184 ? -5.753  -14.859 -7.987  1.00 27.94  ? 706  LYS A O   1 
ATOM   1161 C  CB  . LYS A 1 184 ? -6.581  -11.767 -8.548  1.00 30.87  ? 706  LYS A CB  1 
ATOM   1162 C  CG  . LYS A 1 184 ? -6.487  -11.848 -7.039  1.00 32.14  ? 706  LYS A CG  1 
ATOM   1163 C  CD  . LYS A 1 184 ? -5.920  -10.594 -6.412  1.00 31.96  ? 706  LYS A CD  1 
ATOM   1164 C  CE  . LYS A 1 184 ? -5.729  -10.857 -4.937  1.00 32.03  ? 706  LYS A CE  1 
ATOM   1165 N  NZ  . LYS A 1 184 ? -5.018  -9.749  -4.282  1.00 32.88  ? 706  LYS A NZ  1 
ATOM   1166 N  N   . ALA A 1 185 ? -4.681  -13.959 -9.747  1.00 28.95  ? 707  ALA A N   1 
ATOM   1167 C  CA  . ALA A 1 185 ? -3.452  -14.729 -9.583  1.00 28.80  ? 707  ALA A CA  1 
ATOM   1168 C  C   . ALA A 1 185 ? -2.456  -14.011 -8.695  1.00 28.50  ? 707  ALA A C   1 
ATOM   1169 O  O   . ALA A 1 185 ? -2.374  -12.795 -8.682  1.00 27.31  ? 707  ALA A O   1 
ATOM   1170 C  CB  . ALA A 1 185 ? -2.818  -14.995 -10.926 1.00 29.28  ? 707  ALA A CB  1 
ATOM   1171 N  N   . MET A 1 186 ? -1.702  -14.797 -7.949  1.00 30.78  ? 708  MET A N   1 
ATOM   1172 C  CA  . MET A 1 186 ? -0.682  -14.299 -7.040  1.00 32.29  ? 708  MET A CA  1 
ATOM   1173 C  C   . MET A 1 186 ? 0.544   -15.194 -7.158  1.00 30.94  ? 708  MET A C   1 
ATOM   1174 O  O   . MET A 1 186 ? 0.443   -16.422 -7.168  1.00 29.53  ? 708  MET A O   1 
ATOM   1175 C  CB  . MET A 1 186 ? -1.201  -14.296 -5.591  1.00 35.00  ? 708  MET A CB  1 
ATOM   1176 C  CG  . MET A 1 186 ? -2.267  -13.237 -5.326  1.00 37.60  ? 708  MET A CG  1 
ATOM   1177 S  SD  . MET A 1 186 ? -2.822  -13.144 -3.611  1.00 41.68  ? 708  MET A SD  1 
ATOM   1178 C  CE  . MET A 1 186 ? -3.845  -14.604 -3.573  1.00 41.24  ? 708  MET A CE  1 
ATOM   1179 N  N   . ILE A 1 187 ? 1.700   -14.564 -7.241  1.00 30.89  ? 709  ILE A N   1 
ATOM   1180 C  CA  . ILE A 1 187 ? 2.967   -15.274 -7.264  1.00 31.15  ? 709  ILE A CA  1 
ATOM   1181 C  C   . ILE A 1 187 ? 3.372   -15.641 -5.838  1.00 30.25  ? 709  ILE A C   1 
ATOM   1182 O  O   . ILE A 1 187 ? 3.202   -14.852 -4.910  1.00 28.18  ? 709  ILE A O   1 
ATOM   1183 C  CB  . ILE A 1 187 ? 4.050   -14.420 -7.952  1.00 33.67  ? 709  ILE A CB  1 
ATOM   1184 C  CG1 . ILE A 1 187 ? 3.780   -14.428 -9.452  1.00 34.41  ? 709  ILE A CG1 1 
ATOM   1185 C  CG2 . ILE A 1 187 ? 5.457   -14.922 -7.607  1.00 35.67  ? 709  ILE A CG2 1 
ATOM   1186 C  CD1 . ILE A 1 187 ? 4.677   -13.528 -10.256 1.00 36.82  ? 709  ILE A CD1 1 
ATOM   1187 N  N   . SER A 1 188 ? 3.884   -16.863 -5.702  1.00 29.13  ? 710  SER A N   1 
ATOM   1188 C  CA  . SER A 1 188 ? 4.255   -17.464 -4.427  1.00 28.68  ? 710  SER A CA  1 
ATOM   1189 C  C   . SER A 1 188 ? 5.587   -18.196 -4.592  1.00 28.86  ? 710  SER A C   1 
ATOM   1190 O  O   . SER A 1 188 ? 6.219   -18.119 -5.642  1.00 28.36  ? 710  SER A O   1 
ATOM   1191 C  CB  . SER A 1 188 ? 3.142   -18.388 -3.916  1.00 28.28  ? 710  SER A CB  1 
ATOM   1192 O  OG  . SER A 1 188 ? 3.100   -19.617 -4.620  1.00 26.42  ? 710  SER A OG  1 
ATOM   1193 N  N   . ASP A 1 189 ? 6.008   -18.892 -3.546  1.00 29.61  ? 711  ASP A N   1 
ATOM   1194 C  CA  . ASP A 1 189 ? 7.131   -19.827 -3.605  1.00 31.30  ? 711  ASP A CA  1 
ATOM   1195 C  C   . ASP A 1 189 ? 8.489   -19.136 -3.857  1.00 31.05  ? 711  ASP A C   1 
ATOM   1196 O  O   . ASP A 1 189 ? 9.090   -19.249 -4.910  1.00 29.03  ? 711  ASP A O   1 
ATOM   1197 C  CB  . ASP A 1 189 ? 6.826   -20.916 -4.637  1.00 31.36  ? 711  ASP A CB  1 
ATOM   1198 C  CG  . ASP A 1 189 ? 7.401   -22.247 -4.271  1.00 32.17  ? 711  ASP A CG  1 
ATOM   1199 O  OD1 . ASP A 1 189 ? 8.015   -22.358 -3.186  1.00 33.84  ? 711  ASP A OD1 1 
ATOM   1200 O  OD2 . ASP A 1 189 ? 7.218   -23.181 -5.081  1.00 32.42  ? 711  ASP A OD2 1 
ATOM   1201 N  N   . PHE A 1 190 ? 8.961   -18.429 -2.840  1.00 34.66  ? 712  PHE A N   1 
ATOM   1202 C  CA  . PHE A 1 190 ? 10.159  -17.582 -2.958  1.00 37.95  ? 712  PHE A CA  1 
ATOM   1203 C  C   . PHE A 1 190 ? 11.479  -18.225 -2.504  1.00 38.49  ? 712  PHE A C   1 
ATOM   1204 O  O   . PHE A 1 190 ? 12.489  -17.529 -2.382  1.00 38.62  ? 712  PHE A O   1 
ATOM   1205 C  CB  . PHE A 1 190 ? 9.922   -16.272 -2.215  1.00 39.62  ? 712  PHE A CB  1 
ATOM   1206 C  CG  . PHE A 1 190 ? 8.729   -15.527 -2.706  1.00 41.23  ? 712  PHE A CG  1 
ATOM   1207 C  CD1 . PHE A 1 190 ? 8.793   -14.781 -3.868  1.00 43.88  ? 712  PHE A CD1 1 
ATOM   1208 C  CD2 . PHE A 1 190 ? 7.535   -15.602 -2.039  1.00 42.84  ? 712  PHE A CD2 1 
ATOM   1209 C  CE1 . PHE A 1 190 ? 7.683   -14.108 -4.339  1.00 44.42  ? 712  PHE A CE1 1 
ATOM   1210 C  CE2 . PHE A 1 190 ? 6.425   -14.922 -2.501  1.00 42.93  ? 712  PHE A CE2 1 
ATOM   1211 C  CZ  . PHE A 1 190 ? 6.498   -14.177 -3.649  1.00 42.11  ? 712  PHE A CZ  1 
ATOM   1212 N  N   . GLY A 1 191 ? 11.461  -19.548 -2.306  1.00 38.47  ? 713  GLY A N   1 
ATOM   1213 C  CA  . GLY A 1 191 ? 12.620  -20.320 -1.876  1.00 38.61  ? 713  GLY A CA  1 
ATOM   1214 C  C   . GLY A 1 191 ? 13.832  -20.265 -2.780  1.00 39.25  ? 713  GLY A C   1 
ATOM   1215 O  O   . GLY A 1 191 ? 14.948  -20.521 -2.331  1.00 40.91  ? 713  GLY A O   1 
ATOM   1216 N  N   . LEU A 1 192 ? 13.637  -19.950 -4.053  1.00 39.05  ? 714  LEU A N   1 
ATOM   1217 C  CA  . LEU A 1 192 ? 14.770  -19.822 -4.971  1.00 40.13  ? 714  LEU A CA  1 
ATOM   1218 C  C   . LEU A 1 192 ? 15.017  -18.384 -5.429  1.00 38.74  ? 714  LEU A C   1 
ATOM   1219 O  O   . LEU A 1 192 ? 15.892  -18.152 -6.243  1.00 38.35  ? 714  LEU A O   1 
ATOM   1220 C  CB  . LEU A 1 192 ? 14.585  -20.747 -6.175  1.00 41.78  ? 714  LEU A CB  1 
ATOM   1221 C  CG  . LEU A 1 192 ? 14.493  -22.269 -5.946  1.00 43.92  ? 714  LEU A CG  1 
ATOM   1222 C  CD1 . LEU A 1 192 ? 14.709  -22.995 -7.278  1.00 44.66  ? 714  LEU A CD1 1 
ATOM   1223 C  CD2 . LEU A 1 192 ? 15.489  -22.764 -4.904  1.00 45.30  ? 714  LEU A CD2 1 
ATOM   1224 N  N   . CYS A 1 193 ? 14.257  -17.431 -4.889  1.00 40.04  ? 715  CYS A N   1 
ATOM   1225 C  CA  . CYS A 1 193 ? 14.416  -16.007 -5.207  1.00 41.91  ? 715  CYS A CA  1 
ATOM   1226 C  C   . CYS A 1 193 ? 15.805  -15.520 -4.916  1.00 42.35  ? 715  CYS A C   1 
ATOM   1227 O  O   . CYS A 1 193 ? 16.421  -15.944 -3.961  1.00 40.80  ? 715  CYS A O   1 
ATOM   1228 C  CB  . CYS A 1 193 ? 13.439  -15.135 -4.409  1.00 43.92  ? 715  CYS A CB  1 
ATOM   1229 S  SG  . CYS A 1 193 ? 11.793  -15.011 -5.169  1.00 51.94  ? 715  CYS A SG  1 
ATOM   1230 N  N   . LYS A 1 194 ? 16.282  -14.609 -5.747  1.00 44.53  ? 716  LYS A N   1 
ATOM   1231 C  CA  . LYS A 1 194 ? 17.570  -13.992 -5.546  1.00 48.23  ? 716  LYS A CA  1 
ATOM   1232 C  C   . LYS A 1 194 ? 17.415  -12.484 -5.717  1.00 48.45  ? 716  LYS A C   1 
ATOM   1233 O  O   . LYS A 1 194 ? 16.979  -12.018 -6.773  1.00 48.06  ? 716  LYS A O   1 
ATOM   1234 C  CB  . LYS A 1 194 ? 18.588  -14.576 -6.539  1.00 50.16  ? 716  LYS A CB  1 
ATOM   1235 C  CG  . LYS A 1 194 ? 19.940  -13.866 -6.575  1.00 52.35  ? 716  LYS A CG  1 
ATOM   1236 C  CD  . LYS A 1 194 ? 21.068  -14.593 -5.868  1.00 53.51  ? 716  LYS A CD  1 
ATOM   1237 C  CE  . LYS A 1 194 ? 22.339  -13.762 -5.974  1.00 56.40  ? 716  LYS A CE  1 
ATOM   1238 N  NZ  . LYS A 1 194 ? 23.509  -14.433 -5.357  1.00 58.16  ? 716  LYS A NZ  1 
ATOM   1239 N  N   . LYS A 1 195 ? 17.753  -11.737 -4.662  1.00 49.85  ? 717  LYS A N   1 
ATOM   1240 C  CA  . LYS A 1 195 ? 17.845  -10.279 -4.735  1.00 50.92  ? 717  LYS A CA  1 
ATOM   1241 C  C   . LYS A 1 195 ? 19.240  -9.885  -5.200  1.00 47.94  ? 717  LYS A C   1 
ATOM   1242 O  O   . LYS A 1 195 ? 20.215  -10.106 -4.517  1.00 45.82  ? 717  LYS A O   1 
ATOM   1243 C  CB  . LYS A 1 195 ? 17.532  -9.589  -3.395  1.00 54.73  ? 717  LYS A CB  1 
ATOM   1244 C  CG  . LYS A 1 195 ? 17.101  -8.134  -3.589  1.00 59.06  ? 717  LYS A CG  1 
ATOM   1245 C  CD  . LYS A 1 195 ? 17.577  -7.169  -2.510  1.00 63.15  ? 717  LYS A CD  1 
ATOM   1246 C  CE  . LYS A 1 195 ? 16.611  -7.095  -1.334  1.00 66.03  ? 717  LYS A CE  1 
ATOM   1247 N  NZ  . LYS A 1 195 ? 15.255  -6.619  -1.733  1.00 66.35  ? 717  LYS A NZ  1 
ATOM   1248 N  N   . LEU A 1 196 ? 19.304  -9.322  -6.391  1.00 47.25  ? 718  LEU A N   1 
ATOM   1249 C  CA  . LEU A 1 196 ? 20.528  -8.795  -6.932  1.00 49.17  ? 718  LEU A CA  1 
ATOM   1250 C  C   . LEU A 1 196 ? 20.936  -7.577  -6.117  1.00 50.54  ? 718  LEU A C   1 
ATOM   1251 O  O   . LEU A 1 196 ? 20.104  -6.716  -5.821  1.00 50.55  ? 718  LEU A O   1 
ATOM   1252 C  CB  . LEU A 1 196 ? 20.319  -8.401  -8.404  1.00 50.23  ? 718  LEU A CB  1 
ATOM   1253 C  CG  . LEU A 1 196 ? 20.552  -9.463  -9.488  1.00 49.49  ? 718  LEU A CG  1 
ATOM   1254 C  CD1 . LEU A 1 196 ? 19.720  -10.698 -9.236  1.00 49.12  ? 718  LEU A CD1 1 
ATOM   1255 C  CD2 . LEU A 1 196 ? 20.287  -8.895  -10.880 1.00 49.45  ? 718  LEU A CD2 1 
ATOM   1256 N  N   . ALA A 1 197 ? 22.210  -7.513  -5.748  1.00 52.44  ? 719  ALA A N   1 
ATOM   1257 C  CA  . ALA A 1 197 ? 22.725  -6.374  -5.006  1.00 55.96  ? 719  ALA A CA  1 
ATOM   1258 C  C   . ALA A 1 197 ? 22.641  -5.097  -5.850  1.00 56.74  ? 719  ALA A C   1 
ATOM   1259 O  O   . ALA A 1 197 ? 22.572  -5.165  -7.071  1.00 54.55  ? 719  ALA A O   1 
ATOM   1260 C  CB  . ALA A 1 197 ? 24.155  -6.635  -4.563  1.00 58.12  ? 719  ALA A CB  1 
ATOM   1261 N  N   . VAL A 1 198 ? 22.633  -3.945  -5.183  1.00 59.82  ? 720  VAL A N   1 
ATOM   1262 C  CA  . VAL A 1 198 ? 22.546  -2.635  -5.854  1.00 62.77  ? 720  VAL A CA  1 
ATOM   1263 C  C   . VAL A 1 198 ? 23.706  -2.468  -6.842  1.00 62.44  ? 720  VAL A C   1 
ATOM   1264 O  O   . VAL A 1 198 ? 24.854  -2.730  -6.499  1.00 64.32  ? 720  VAL A O   1 
ATOM   1265 C  CB  . VAL A 1 198 ? 22.572  -1.461  -4.838  1.00 65.76  ? 720  VAL A CB  1 
ATOM   1266 C  CG1 . VAL A 1 198 ? 22.528  -0.116  -5.571  1.00 66.39  ? 720  VAL A CG1 1 
ATOM   1267 C  CG2 . VAL A 1 198 ? 21.427  -1.593  -3.826  1.00 64.62  ? 720  VAL A CG2 1 
ATOM   1268 N  N   . GLY A 1 199 ? 23.401  -2.056  -8.066  1.00 61.04  ? 721  GLY A N   1 
ATOM   1269 C  CA  . GLY A 1 199 ? 24.413  -1.973  -9.124  1.00 62.71  ? 721  GLY A CA  1 
ATOM   1270 C  C   . GLY A 1 199 ? 24.902  -3.298  -9.706  1.00 61.68  ? 721  GLY A C   1 
ATOM   1271 O  O   . GLY A 1 199 ? 25.944  -3.335  -10.348 1.00 62.45  ? 721  GLY A O   1 
ATOM   1272 N  N   . ARG A 1 200 ? 24.173  -4.388  -9.468  1.00 60.19  ? 722  ARG A N   1 
ATOM   1273 C  CA  . ARG A 1 200 ? 24.370  -5.643  -10.205 1.00 59.55  ? 722  ARG A CA  1 
ATOM   1274 C  C   . ARG A 1 200 ? 23.132  -5.915  -11.080 1.00 55.62  ? 722  ARG A C   1 
ATOM   1275 O  O   . ARG A 1 200 ? 22.007  -5.682  -10.663 1.00 52.08  ? 722  ARG A O   1 
ATOM   1276 C  CB  . ARG A 1 200 ? 24.615  -6.823  -9.252  1.00 61.48  ? 722  ARG A CB  1 
ATOM   1277 C  CG  . ARG A 1 200 ? 25.977  -6.835  -8.563  1.00 65.48  ? 722  ARG A CG  1 
ATOM   1278 C  CD  . ARG A 1 200 ? 27.131  -7.196  -9.497  1.00 66.35  ? 722  ARG A CD  1 
ATOM   1279 N  NE  . ARG A 1 200 ? 27.023  -8.558  -10.038 1.00 66.80  ? 722  ARG A NE  1 
ATOM   1280 C  CZ  . ARG A 1 200 ? 27.474  -9.673  -9.455  1.00 66.54  ? 722  ARG A CZ  1 
ATOM   1281 N  NH1 . ARG A 1 200 ? 28.080  -9.643  -8.275  1.00 68.33  ? 722  ARG A NH1 1 
ATOM   1282 N  NH2 . ARG A 1 200 ? 27.320  -10.839 -10.065 1.00 65.36  ? 722  ARG A NH2 1 
ATOM   1283 N  N   . HIS A 1 201 ? 23.354  -6.433  -12.279 1.00 55.33  ? 723  HIS A N   1 
ATOM   1284 C  CA  . HIS A 1 201 ? 22.272  -6.644  -13.225 1.00 53.26  ? 723  HIS A CA  1 
ATOM   1285 C  C   . HIS A 1 201 ? 22.116  -8.090  -13.636 1.00 49.25  ? 723  HIS A C   1 
ATOM   1286 O  O   . HIS A 1 201 ? 21.289  -8.418  -14.465 1.00 49.06  ? 723  HIS A O   1 
ATOM   1287 C  CB  . HIS A 1 201 ? 22.482  -5.774  -14.459 1.00 56.02  ? 723  HIS A CB  1 
ATOM   1288 C  CG  . HIS A 1 201 ? 22.477  -4.312  -14.161 1.00 59.78  ? 723  HIS A CG  1 
ATOM   1289 N  ND1 . HIS A 1 201 ? 23.633  -3.575  -14.037 1.00 62.72  ? 723  HIS A ND1 1 
ATOM   1290 C  CD2 . HIS A 1 201 ? 21.456  -3.454  -13.941 1.00 59.27  ? 723  HIS A CD2 1 
ATOM   1291 C  CE1 . HIS A 1 201 ? 23.323  -2.323  -13.761 1.00 64.41  ? 723  HIS A CE1 1 
ATOM   1292 N  NE2 . HIS A 1 201 ? 22.010  -2.223  -13.696 1.00 62.65  ? 723  HIS A NE2 1 
ATOM   1293 N  N   . SER A 1 202 ? 22.914  -8.953  -13.039 1.00 48.34  ? 724  SER A N   1 
ATOM   1294 C  CA  . SER A 1 202 ? 22.893  -10.370 -13.353 1.00 46.89  ? 724  SER A CA  1 
ATOM   1295 C  C   . SER A 1 202 ? 23.303  -11.174 -12.139 1.00 45.15  ? 724  SER A C   1 
ATOM   1296 O  O   . SER A 1 202 ? 23.645  -10.623 -11.107 1.00 45.91  ? 724  SER A O   1 
ATOM   1297 C  CB  . SER A 1 202 ? 23.832  -10.668 -14.523 1.00 47.80  ? 724  SER A CB  1 
ATOM   1298 O  OG  . SER A 1 202 ? 25.178  -10.647 -14.115 1.00 49.36  ? 724  SER A OG  1 
ATOM   1299 N  N   . PHE A 1 203 ? 23.252  -12.486 -12.269 1.00 43.01  ? 725  PHE A N   1 
ATOM   1300 C  CA  . PHE A 1 203 ? 23.682  -13.359 -11.216 1.00 42.46  ? 725  PHE A CA  1 
ATOM   1301 C  C   . PHE A 1 203 ? 24.278  -14.583 -11.872 1.00 43.15  ? 725  PHE A C   1 
ATOM   1302 O  O   . PHE A 1 203 ? 23.926  -14.887 -13.009 1.00 43.17  ? 725  PHE A O   1 
ATOM   1303 C  CB  . PHE A 1 203 ? 22.507  -13.711 -10.317 1.00 42.22  ? 725  PHE A CB  1 
ATOM   1304 C  CG  . PHE A 1 203 ? 21.452  -14.547 -10.979 1.00 41.26  ? 725  PHE A CG  1 
ATOM   1305 C  CD1 . PHE A 1 203 ? 20.429  -13.950 -11.708 1.00 40.70  ? 725  PHE A CD1 1 
ATOM   1306 C  CD2 . PHE A 1 203 ? 21.465  -15.931 -10.853 1.00 41.10  ? 725  PHE A CD2 1 
ATOM   1307 C  CE1 . PHE A 1 203 ? 19.444  -14.715 -12.305 1.00 40.34  ? 725  PHE A CE1 1 
ATOM   1308 C  CE2 . PHE A 1 203 ? 20.473  -16.705 -11.445 1.00 41.06  ? 725  PHE A CE2 1 
ATOM   1309 C  CZ  . PHE A 1 203 ? 19.464  -16.096 -12.172 1.00 39.93  ? 725  PHE A CZ  1 
ATOM   1310 N  N   . SER A 1 204 ? 25.187  -15.268 -11.173 1.00 43.64  ? 726  SER A N   1 
ATOM   1311 C  CA  . SER A 1 204 ? 25.893  -16.423 -11.739 1.00 44.70  ? 726  SER A CA  1 
ATOM   1312 C  C   . SER A 1 204 ? 25.286  -17.770 -11.307 1.00 46.05  ? 726  SER A C   1 
ATOM   1313 O  O   . SER A 1 204 ? 24.538  -17.855 -10.328 1.00 44.98  ? 726  SER A O   1 
ATOM   1314 C  CB  . SER A 1 204 ? 27.386  -16.361 -11.399 1.00 44.87  ? 726  SER A CB  1 
ATOM   1315 O  OG  . SER A 1 204 ? 27.600  -16.259 -10.006 1.00 44.15  ? 726  SER A OG  1 
ATOM   1316 N  N   . ARG A 1 205 ? 25.614  -18.813 -12.068 1.00 48.97  ? 727  ARG A N   1 
ATOM   1317 C  CA  . ARG A 1 205 ? 25.127  -20.165 -11.821 1.00 48.96  ? 727  ARG A CA  1 
ATOM   1318 C  C   . ARG A 1 205 ? 25.683  -20.715 -10.522 1.00 48.33  ? 727  ARG A C   1 
ATOM   1319 O  O   . ARG A 1 205 ? 26.733  -20.322 -10.081 1.00 47.72  ? 727  ARG A O   1 
ATOM   1320 C  CB  . ARG A 1 205 ? 25.545  -21.111 -12.950 1.00 51.68  ? 727  ARG A CB  1 
ATOM   1321 C  CG  . ARG A 1 205 ? 24.986  -20.786 -14.323 1.00 54.13  ? 727  ARG A CG  1 
ATOM   1322 C  CD  . ARG A 1 205 ? 25.404  -21.852 -15.326 1.00 57.48  ? 727  ARG A CD  1 
ATOM   1323 N  NE  . ARG A 1 205 ? 25.070  -21.495 -16.708 1.00 60.64  ? 727  ARG A NE  1 
ATOM   1324 C  CZ  . ARG A 1 205 ? 25.193  -22.311 -17.761 1.00 64.16  ? 727  ARG A CZ  1 
ATOM   1325 N  NH1 . ARG A 1 205 ? 25.647  -23.555 -17.616 1.00 64.10  ? 727  ARG A NH1 1 
ATOM   1326 N  NH2 . ARG A 1 205 ? 24.853  -21.882 -18.976 1.00 66.30  ? 727  ARG A NH2 1 
ATOM   1327 N  N   . ARG A 1 206 ? 24.944  -21.630 -9.917  1.00 49.55  ? 728  ARG A N   1 
ATOM   1328 C  CA  . ARG A 1 206 ? 25.431  -22.423 -8.805  1.00 50.65  ? 728  ARG A CA  1 
ATOM   1329 C  C   . ARG A 1 206 ? 25.100  -23.880 -9.096  1.00 48.50  ? 728  ARG A C   1 
ATOM   1330 O  O   . ARG A 1 206 ? 24.422  -24.199 -10.066 1.00 44.50  ? 728  ARG A O   1 
ATOM   1331 C  CB  . ARG A 1 206 ? 24.790  -21.978 -7.484  1.00 52.70  ? 728  ARG A CB  1 
ATOM   1332 C  CG  . ARG A 1 206 ? 25.235  -20.602 -6.999  1.00 55.93  ? 728  ARG A CG  1 
ATOM   1333 C  CD  . ARG A 1 206 ? 24.657  -20.253 -5.624  1.00 55.81  ? 728  ARG A CD  1 
ATOM   1334 N  NE  . ARG A 1 206 ? 24.844  -18.832 -5.298  1.00 55.93  ? 728  ARG A NE  1 
ATOM   1335 C  CZ  . ARG A 1 206 ? 25.712  -18.332 -4.415  1.00 58.12  ? 728  ARG A CZ  1 
ATOM   1336 N  NH1 . ARG A 1 206 ? 26.526  -19.116 -3.700  1.00 57.04  ? 728  ARG A NH1 1 
ATOM   1337 N  NH2 . ARG A 1 206 ? 25.765  -17.011 -4.245  1.00 59.35  ? 728  ARG A NH2 1 
ATOM   1338 N  N   . SER A 1 207 ? 25.618  -24.767 -8.262  1.00 49.22  ? 729  SER A N   1 
ATOM   1339 C  CA  . SER A 1 207 ? 25.243  -26.170 -8.314  1.00 48.93  ? 729  SER A CA  1 
ATOM   1340 C  C   . SER A 1 207 ? 23.760  -26.318 -7.964  1.00 47.20  ? 729  SER A C   1 
ATOM   1341 O  O   . SER A 1 207 ? 23.150  -25.446 -7.354  1.00 45.36  ? 729  SER A O   1 
ATOM   1342 C  CB  . SER A 1 207 ? 26.108  -26.988 -7.336  1.00 48.65  ? 729  SER A CB  1 
ATOM   1343 O  OG  . SER A 1 207 ? 25.773  -26.678 -5.993  1.00 46.12  ? 729  SER A OG  1 
ATOM   1344 N  N   . GLY A 1 208 ? 23.177  -27.433 -8.356  1.00 49.11  ? 730  GLY A N   1 
ATOM   1345 C  CA  . GLY A 1 208 ? 21.819  -27.746 -7.932  1.00 50.01  ? 730  GLY A CA  1 
ATOM   1346 C  C   . GLY A 1 208 ? 20.824  -27.283 -8.956  1.00 50.16  ? 730  GLY A C   1 
ATOM   1347 O  O   . GLY A 1 208 ? 21.170  -26.529 -9.857  1.00 49.68  ? 730  GLY A O   1 
ATOM   1348 N  N   . VAL A 1 209 ? 19.583  -27.732 -8.794  1.00 51.94  ? 731  VAL A N   1 
ATOM   1349 C  CA  . VAL A 1 209 ? 18.536  -27.493 -9.783  1.00 51.97  ? 731  VAL A CA  1 
ATOM   1350 C  C   . VAL A 1 209 ? 18.013  -26.050 -9.681  1.00 48.79  ? 731  VAL A C   1 
ATOM   1351 O  O   . VAL A 1 209 ? 17.323  -25.692 -8.734  1.00 48.43  ? 731  VAL A O   1 
ATOM   1352 C  CB  . VAL A 1 209 ? 17.387  -28.554 -9.708  1.00 53.38  ? 731  VAL A CB  1 
ATOM   1353 C  CG1 . VAL A 1 209 ? 17.958  -29.971 -9.800  1.00 54.95  ? 731  VAL A CG1 1 
ATOM   1354 C  CG2 . VAL A 1 209 ? 16.553  -28.415 -8.444  1.00 54.01  ? 731  VAL A CG2 1 
ATOM   1355 N  N   . PRO A 1 210 ? 18.347  -25.209 -10.667 1.00 48.36  ? 732  PRO A N   1 
ATOM   1356 C  CA  . PRO A 1 210 ? 17.924  -23.810 -10.626 1.00 48.21  ? 732  PRO A CA  1 
ATOM   1357 C  C   . PRO A 1 210 ? 16.510  -23.610 -11.210 1.00 46.08  ? 732  PRO A C   1 
ATOM   1358 O  O   . PRO A 1 210 ? 16.346  -23.031 -12.297 1.00 42.75  ? 732  PRO A O   1 
ATOM   1359 C  CB  . PRO A 1 210 ? 18.985  -23.119 -11.485 1.00 49.80  ? 732  PRO A CB  1 
ATOM   1360 C  CG  . PRO A 1 210 ? 19.439  -24.180 -12.460 1.00 50.67  ? 732  PRO A CG  1 
ATOM   1361 C  CD  . PRO A 1 210 ? 19.034  -25.529 -11.934 1.00 49.24  ? 732  PRO A CD  1 
ATOM   1362 N  N   . GLY A 1 211 ? 15.509  -24.090 -10.468 1.00 43.87  ? 733  GLY A N   1 
ATOM   1363 C  CA  . GLY A 1 211 ? 14.107  -24.080 -10.907 1.00 40.86  ? 733  GLY A CA  1 
ATOM   1364 C  C   . GLY A 1 211 ? 13.456  -25.458 -10.913 1.00 37.48  ? 733  GLY A C   1 
ATOM   1365 O  O   . GLY A 1 211 ? 13.841  -26.342 -10.174 1.00 38.01  ? 733  GLY A O   1 
ATOM   1366 N  N   . THR A 1 212 ? 12.448  -25.626 -11.747 1.00 35.24  ? 734  THR A N   1 
ATOM   1367 C  CA  . THR A 1 212 ? 11.784  -26.902 -11.879 1.00 34.79  ? 734  THR A CA  1 
ATOM   1368 C  C   . THR A 1 212 ? 11.974  -27.406 -13.311 1.00 34.29  ? 734  THR A C   1 
ATOM   1369 O  O   . THR A 1 212 ? 11.780  -26.667 -14.250 1.00 33.34  ? 734  THR A O   1 
ATOM   1370 C  CB  . THR A 1 212 ? 10.288  -26.785 -11.515 1.00 33.58  ? 734  THR A CB  1 
ATOM   1371 O  OG1 . THR A 1 212 ? 10.153  -26.308 -10.174 1.00 31.56  ? 734  THR A OG1 1 
ATOM   1372 C  CG2 . THR A 1 212 ? 9.572   -28.133 -11.637 1.00 34.08  ? 734  THR A CG2 1 
ATOM   1373 N  N   . GLU A 1 213 ? 12.369  -28.664 -13.449 1.00 35.98  ? 735  GLU A N   1 
ATOM   1374 C  CA  . GLU A 1 213 ? 12.528  -29.308 -14.754 1.00 38.58  ? 735  GLU A CA  1 
ATOM   1375 C  C   . GLU A 1 213 ? 11.290  -29.110 -15.650 1.00 36.22  ? 735  GLU A C   1 
ATOM   1376 O  O   . GLU A 1 213 ? 10.163  -29.404 -15.257 1.00 33.29  ? 735  GLU A O   1 
ATOM   1377 C  CB  . GLU A 1 213 ? 12.808  -30.808 -14.590 1.00 42.96  ? 735  GLU A CB  1 
ATOM   1378 C  CG  . GLU A 1 213 ? 13.946  -31.318 -15.474 1.00 48.73  ? 735  GLU A CG  1 
ATOM   1379 C  CD  . GLU A 1 213 ? 13.799  -32.770 -15.927 1.00 50.82  ? 735  GLU A CD  1 
ATOM   1380 O  OE1 . GLU A 1 213 ? 12.994  -33.526 -15.327 1.00 52.87  ? 735  GLU A OE1 1 
ATOM   1381 O  OE2 . GLU A 1 213 ? 14.503  -33.141 -16.888 1.00 49.80  ? 735  GLU A OE2 1 
ATOM   1382 N  N   . GLY A 1 214 ? 11.536  -28.609 -16.854 1.00 35.34  ? 736  GLY A N   1 
ATOM   1383 C  CA  . GLY A 1 214 ? 10.503  -28.306 -17.815 1.00 35.48  ? 736  GLY A CA  1 
ATOM   1384 C  C   . GLY A 1 214 ? 10.167  -26.827 -17.909 1.00 34.48  ? 736  GLY A C   1 
ATOM   1385 O  O   . GLY A 1 214 ? 9.459   -26.418 -18.819 1.00 36.09  ? 736  GLY A O   1 
ATOM   1386 N  N   . TRP A 1 215 ? 10.657  -26.023 -16.971 1.00 32.19  ? 737  TRP A N   1 
ATOM   1387 C  CA  . TRP A 1 215 ? 10.386  -24.596 -16.957 1.00 30.00  ? 737  TRP A CA  1 
ATOM   1388 C  C   . TRP A 1 215 ? 11.651  -23.726 -16.810 1.00 29.94  ? 737  TRP A C   1 
ATOM   1389 O  O   . TRP A 1 215 ? 11.548  -22.525 -16.586 1.00 28.68  ? 737  TRP A O   1 
ATOM   1390 C  CB  . TRP A 1 215 ? 9.411   -24.292 -15.819 1.00 29.60  ? 737  TRP A CB  1 
ATOM   1391 C  CG  . TRP A 1 215 ? 8.212   -25.185 -15.801 1.00 29.14  ? 737  TRP A CG  1 
ATOM   1392 C  CD1 . TRP A 1 215 ? 8.092   -26.364 -15.143 1.00 29.76  ? 737  TRP A CD1 1 
ATOM   1393 C  CD2 . TRP A 1 215 ? 6.975   -24.980 -16.483 1.00 28.71  ? 737  TRP A CD2 1 
ATOM   1394 N  NE1 . TRP A 1 215 ? 6.862   -26.911 -15.366 1.00 29.94  ? 737  TRP A NE1 1 
ATOM   1395 C  CE2 . TRP A 1 215 ? 6.150   -26.081 -16.184 1.00 29.29  ? 737  TRP A CE2 1 
ATOM   1396 C  CE3 . TRP A 1 215 ? 6.478   -23.973 -17.314 1.00 27.67  ? 737  TRP A CE3 1 
ATOM   1397 C  CZ2 . TRP A 1 215 ? 4.867   -26.206 -16.691 1.00 28.67  ? 737  TRP A CZ2 1 
ATOM   1398 C  CZ3 . TRP A 1 215 ? 5.207   -24.099 -17.816 1.00 27.62  ? 737  TRP A CZ3 1 
ATOM   1399 C  CH2 . TRP A 1 215 ? 4.413   -25.207 -17.506 1.00 28.22  ? 737  TRP A CH2 1 
ATOM   1400 N  N   . ILE A 1 216 ? 12.834  -24.331 -16.951 1.00 31.34  ? 738  ILE A N   1 
ATOM   1401 C  CA  . ILE A 1 216 ? 14.117  -23.667 -16.677 1.00 30.82  ? 738  ILE A CA  1 
ATOM   1402 C  C   . ILE A 1 216 ? 14.676  -23.091 -17.974 1.00 30.42  ? 738  ILE A C   1 
ATOM   1403 O  O   . ILE A 1 216 ? 14.787  -23.790 -18.977 1.00 30.13  ? 738  ILE A O   1 
ATOM   1404 C  CB  . ILE A 1 216 ? 15.141  -24.636 -16.047 1.00 32.35  ? 738  ILE A CB  1 
ATOM   1405 C  CG1 . ILE A 1 216 ? 14.623  -25.187 -14.715 1.00 32.41  ? 738  ILE A CG1 1 
ATOM   1406 C  CG2 . ILE A 1 216 ? 16.491  -23.960 -15.828 1.00 33.10  ? 738  ILE A CG2 1 
ATOM   1407 C  CD1 . ILE A 1 216 ? 15.259  -26.503 -14.315 1.00 33.31  ? 738  ILE A CD1 1 
ATOM   1408 N  N   . ALA A 1 217 ? 14.996  -21.802 -17.943 1.00 29.60  ? 739  ALA A N   1 
ATOM   1409 C  CA  . ALA A 1 217 ? 15.582  -21.127 -19.080 1.00 31.38  ? 739  ALA A CA  1 
ATOM   1410 C  C   . ALA A 1 217 ? 16.934  -21.783 -19.446 1.00 32.67  ? 739  ALA A C   1 
ATOM   1411 O  O   . ALA A 1 217 ? 17.716  -22.145 -18.550 1.00 33.02  ? 739  ALA A O   1 
ATOM   1412 C  CB  . ALA A 1 217 ? 15.757  -19.642 -18.763 1.00 31.07  ? 739  ALA A CB  1 
ATOM   1413 N  N   . PRO A 1 218 ? 17.199  -21.960 -20.745 1.00 32.87  ? 740  PRO A N   1 
ATOM   1414 C  CA  . PRO A 1 218 ? 18.343  -22.744 -21.204 1.00 35.77  ? 740  PRO A CA  1 
ATOM   1415 C  C   . PRO A 1 218 ? 19.681  -22.255 -20.694 1.00 36.47  ? 740  PRO A C   1 
ATOM   1416 O  O   . PRO A 1 218 ? 20.548  -23.071 -20.424 1.00 36.19  ? 740  PRO A O   1 
ATOM   1417 C  CB  . PRO A 1 218 ? 18.285  -22.596 -22.728 1.00 36.30  ? 740  PRO A CB  1 
ATOM   1418 C  CG  . PRO A 1 218 ? 17.539  -21.343 -22.940 1.00 35.15  ? 740  PRO A CG  1 
ATOM   1419 C  CD  . PRO A 1 218 ? 16.478  -21.386 -21.884 1.00 33.78  ? 740  PRO A CD  1 
ATOM   1420 N  N   . GLU A 1 219 ? 19.821  -20.942 -20.537 1.00 36.90  ? 741  GLU A N   1 
ATOM   1421 C  CA  . GLU A 1 219 ? 21.065  -20.360 -20.030 1.00 38.96  ? 741  GLU A CA  1 
ATOM   1422 C  C   . GLU A 1 219 ? 21.410  -20.734 -18.586 1.00 39.96  ? 741  GLU A C   1 
ATOM   1423 O  O   . GLU A 1 219 ? 22.482  -20.401 -18.107 1.00 41.48  ? 741  GLU A O   1 
ATOM   1424 C  CB  . GLU A 1 219 ? 21.107  -18.831 -20.226 1.00 38.15  ? 741  GLU A CB  1 
ATOM   1425 C  CG  . GLU A 1 219 ? 20.128  -18.008 -19.391 1.00 36.26  ? 741  GLU A CG  1 
ATOM   1426 C  CD  . GLU A 1 219 ? 18.751  -17.848 -20.015 1.00 33.58  ? 741  GLU A CD  1 
ATOM   1427 O  OE1 . GLU A 1 219 ? 18.407  -18.579 -20.959 1.00 32.64  ? 741  GLU A OE1 1 
ATOM   1428 O  OE2 . GLU A 1 219 ? 17.997  -16.983 -19.542 1.00 32.28  ? 741  GLU A OE2 1 
ATOM   1429 N  N   . MET A 1 220 ? 20.539  -21.451 -17.897 1.00 40.83  ? 742  MET A N   1 
ATOM   1430 C  CA  . MET A 1 220 ? 20.873  -21.921 -16.556 1.00 43.52  ? 742  MET A CA  1 
ATOM   1431 C  C   . MET A 1 220 ? 21.577  -23.267 -16.542 1.00 46.93  ? 742  MET A C   1 
ATOM   1432 O  O   . MET A 1 220 ? 22.107  -23.675 -15.511 1.00 46.66  ? 742  MET A O   1 
ATOM   1433 C  CB  . MET A 1 220 ? 19.618  -22.052 -15.735 1.00 43.59  ? 742  MET A CB  1 
ATOM   1434 C  CG  . MET A 1 220 ? 18.864  -20.758 -15.587 1.00 43.83  ? 742  MET A CG  1 
ATOM   1435 S  SD  . MET A 1 220 ? 19.671  -19.705 -14.391 1.00 45.42  ? 742  MET A SD  1 
ATOM   1436 C  CE  . MET A 1 220 ? 18.255  -19.386 -13.321 1.00 44.31  ? 742  MET A CE  1 
ATOM   1437 N  N   . LEU A 1 221 ? 21.559  -23.950 -17.685 1.00 50.78  ? 743  LEU A N   1 
ATOM   1438 C  CA  . LEU A 1 221 ? 22.070  -25.316 -17.823 1.00 52.53  ? 743  LEU A CA  1 
ATOM   1439 C  C   . LEU A 1 221 ? 23.010  -25.544 -19.011 1.00 53.67  ? 743  LEU A C   1 
ATOM   1440 O  O   . LEU A 1 221 ? 23.715  -26.545 -19.027 1.00 55.68  ? 743  LEU A O   1 
ATOM   1441 C  CB  . LEU A 1 221 ? 20.879  -26.265 -17.997 1.00 52.65  ? 743  LEU A CB  1 
ATOM   1442 C  CG  . LEU A 1 221 ? 20.200  -26.997 -16.842 1.00 52.58  ? 743  LEU A CG  1 
ATOM   1443 C  CD1 . LEU A 1 221 ? 20.508  -26.445 -15.458 1.00 52.40  ? 743  LEU A CD1 1 
ATOM   1444 C  CD2 . LEU A 1 221 ? 18.701  -26.997 -17.113 1.00 51.82  ? 743  LEU A CD2 1 
ATOM   1445 N  N   . SER A 1 222 ? 23.016  -24.654 -20.002 1.00 56.00  ? 744  SER A N   1 
ATOM   1446 C  CA  . SER A 1 222 ? 23.653  -24.945 -21.296 1.00 60.11  ? 744  SER A CA  1 
ATOM   1447 C  C   . SER A 1 222 ? 25.182  -24.893 -21.263 1.00 63.82  ? 744  SER A C   1 
ATOM   1448 O  O   . SER A 1 222 ? 25.787  -24.351 -20.336 1.00 61.83  ? 744  SER A O   1 
ATOM   1449 C  CB  . SER A 1 222 ? 23.116  -24.025 -22.399 1.00 60.62  ? 744  SER A CB  1 
ATOM   1450 O  OG  . SER A 1 222 ? 23.515  -22.682 -22.202 1.00 62.03  ? 744  SER A OG  1 
ATOM   1451 N  N   . GLU A 1 223 ? 25.779  -25.459 -22.312 1.00 68.92  ? 745  GLU A N   1 
ATOM   1452 C  CA  . GLU A 1 223 ? 27.227  -25.646 -22.421 1.00 70.42  ? 745  GLU A CA  1 
ATOM   1453 C  C   . GLU A 1 223 ? 27.911  -24.386 -22.992 1.00 70.68  ? 745  GLU A C   1 
ATOM   1454 O  O   . GLU A 1 223 ? 27.386  -23.735 -23.917 1.00 65.58  ? 745  GLU A O   1 
ATOM   1455 C  CB  . GLU A 1 223 ? 27.568  -26.856 -23.334 1.00 73.36  ? 745  GLU A CB  1 
ATOM   1456 C  CG  . GLU A 1 223 ? 26.726  -28.126 -23.172 1.00 72.18  ? 745  GLU A CG  1 
ATOM   1457 C  CD  . GLU A 1 223 ? 27.153  -28.990 -22.003 1.00 71.06  ? 745  GLU A CD  1 
ATOM   1458 O  OE1 . GLU A 1 223 ? 26.872  -28.613 -20.848 1.00 68.50  ? 745  GLU A OE1 1 
ATOM   1459 O  OE2 . GLU A 1 223 ? 27.751  -30.055 -22.246 1.00 69.96  ? 745  GLU A OE2 1 
ATOM   1460 N  N   . ASP A 1 224 ? 29.091  -24.073 -22.444 1.00 71.20  ? 746  ASP A N   1 
ATOM   1461 C  CA  . ASP A 1 224 ? 29.939  -22.967 -22.908 1.00 72.35  ? 746  ASP A CA  1 
ATOM   1462 C  C   . ASP A 1 224 ? 29.188  -21.636 -23.009 1.00 69.49  ? 746  ASP A C   1 
ATOM   1463 O  O   . ASP A 1 224 ? 29.383  -20.864 -23.942 1.00 67.95  ? 746  ASP A O   1 
ATOM   1464 C  CB  . ASP A 1 224 ? 30.617  -23.331 -24.240 1.00 75.63  ? 746  ASP A CB  1 
ATOM   1465 C  CG  . ASP A 1 224 ? 31.816  -24.265 -24.052 1.00 79.27  ? 746  ASP A CG  1 
ATOM   1466 O  OD1 . ASP A 1 224 ? 31.775  -25.131 -23.150 1.00 78.65  ? 746  ASP A OD1 1 
ATOM   1467 O  OD2 . ASP A 1 224 ? 32.804  -24.127 -24.806 1.00 79.64  ? 746  ASP A OD2 1 
ATOM   1468 N  N   . CYS A 1 225 ? 28.338  -21.377 -22.024 1.00 66.76  ? 747  CYS A N   1 
ATOM   1469 C  CA  . CYS A 1 225 ? 27.570  -20.152 -21.974 1.00 65.53  ? 747  CYS A CA  1 
ATOM   1470 C  C   . CYS A 1 225 ? 28.434  -19.075 -21.342 1.00 64.80  ? 747  CYS A C   1 
ATOM   1471 O  O   . CYS A 1 225 ? 28.943  -19.264 -20.245 1.00 62.57  ? 747  CYS A O   1 
ATOM   1472 C  CB  . CYS A 1 225 ? 26.319  -20.369 -21.137 1.00 64.47  ? 747  CYS A CB  1 
ATOM   1473 S  SG  . CYS A 1 225 ? 25.218  -18.943 -21.081 1.00 64.03  ? 747  CYS A SG  1 
ATOM   1474 N  N   . LYS A 1 226 ? 28.592  -17.948 -22.029 1.00 65.44  ? 748  LYS A N   1 
ATOM   1475 C  CA  . LYS A 1 226 ? 29.527  -16.905 -21.594 1.00 67.44  ? 748  LYS A CA  1 
ATOM   1476 C  C   . LYS A 1 226 ? 28.877  -15.637 -20.995 1.00 64.63  ? 748  LYS A C   1 
ATOM   1477 O  O   . LYS A 1 226 ? 29.586  -14.696 -20.649 1.00 64.69  ? 748  LYS A O   1 
ATOM   1478 C  CB  . LYS A 1 226 ? 30.473  -16.540 -22.754 1.00 71.17  ? 748  LYS A CB  1 
ATOM   1479 C  CG  . LYS A 1 226 ? 31.702  -17.445 -22.876 1.00 73.46  ? 748  LYS A CG  1 
ATOM   1480 C  CD  . LYS A 1 226 ? 32.558  -17.062 -24.080 1.00 76.23  ? 748  LYS A CD  1 
ATOM   1481 C  CE  . LYS A 1 226 ? 34.051  -17.224 -23.816 1.00 78.51  ? 748  LYS A CE  1 
ATOM   1482 N  NZ  . LYS A 1 226 ? 34.510  -18.641 -23.811 1.00 79.34  ? 748  LYS A NZ  1 
ATOM   1483 N  N   . GLU A 1 227 ? 27.552  -15.602 -20.861 1.00 61.69  ? 749  GLU A N   1 
ATOM   1484 C  CA  . GLU A 1 227 ? 26.896  -14.490 -20.158 1.00 60.09  ? 749  GLU A CA  1 
ATOM   1485 C  C   . GLU A 1 227 ? 26.156  -15.027 -18.942 1.00 53.81  ? 749  GLU A C   1 
ATOM   1486 O  O   . GLU A 1 227 ? 25.690  -16.155 -18.937 1.00 52.18  ? 749  GLU A O   1 
ATOM   1487 C  CB  . GLU A 1 227 ? 25.939  -13.708 -21.072 1.00 62.72  ? 749  GLU A CB  1 
ATOM   1488 C  CG  . GLU A 1 227 ? 26.162  -12.185 -21.074 1.00 66.85  ? 749  GLU A CG  1 
ATOM   1489 C  CD  . GLU A 1 227 ? 25.955  -11.516 -19.709 1.00 67.82  ? 749  GLU A CD  1 
ATOM   1490 O  OE1 . GLU A 1 227 ? 26.945  -10.981 -19.164 1.00 67.23  ? 749  GLU A OE1 1 
ATOM   1491 O  OE2 . GLU A 1 227 ? 24.811  -11.518 -19.177 1.00 66.01  ? 749  GLU A OE2 1 
ATOM   1492 N  N   . ASN A 1 228 ? 26.084  -14.220 -17.897 1.00 50.02  ? 750  ASN A N   1 
ATOM   1493 C  CA  . ASN A 1 228 ? 25.359  -14.601 -16.706 1.00 47.00  ? 750  ASN A CA  1 
ATOM   1494 C  C   . ASN A 1 228 ? 23.859  -14.491 -16.904 1.00 44.02  ? 750  ASN A C   1 
ATOM   1495 O  O   . ASN A 1 228 ? 23.399  -13.625 -17.654 1.00 41.65  ? 750  ASN A O   1 
ATOM   1496 C  CB  . ASN A 1 228 ? 25.764  -13.727 -15.512 1.00 47.73  ? 750  ASN A CB  1 
ATOM   1497 C  CG  . ASN A 1 228 ? 27.068  -14.174 -14.854 1.00 49.20  ? 750  ASN A CG  1 
ATOM   1498 O  OD1 . ASN A 1 228 ? 27.821  -13.345 -14.378 1.00 50.51  ? 750  ASN A OD1 1 
ATOM   1499 N  ND2 . ASN A 1 228 ? 27.317  -15.480 -14.797 1.00 49.02  ? 750  ASN A ND2 1 
ATOM   1500 N  N   . PRO A 1 229 ? 23.091  -15.374 -16.231 1.00 42.64  ? 751  PRO A N   1 
ATOM   1501 C  CA  . PRO A 1 229 ? 21.641  -15.237 -16.208 1.00 41.83  ? 751  PRO A CA  1 
ATOM   1502 C  C   . PRO A 1 229 ? 21.157  -13.943 -15.567 1.00 41.25  ? 751  PRO A C   1 
ATOM   1503 O  O   . PRO A 1 229 ? 21.860  -13.319 -14.766 1.00 41.57  ? 751  PRO A O   1 
ATOM   1504 C  CB  . PRO A 1 229 ? 21.171  -16.433 -15.367 1.00 41.66  ? 751  PRO A CB  1 
ATOM   1505 C  CG  . PRO A 1 229 ? 22.380  -17.047 -14.785 1.00 42.07  ? 751  PRO A CG  1 
ATOM   1506 C  CD  . PRO A 1 229 ? 23.510  -16.673 -15.688 1.00 43.03  ? 751  PRO A CD  1 
ATOM   1507 N  N   . THR A 1 230 ? 19.941  -13.563 -15.921 1.00 40.01  ? 752  THR A N   1 
ATOM   1508 C  CA  . THR A 1 230 ? 19.340  -12.378 -15.361 1.00 38.96  ? 752  THR A CA  1 
ATOM   1509 C  C   . THR A 1 230 ? 17.802  -12.493 -15.348 1.00 35.15  ? 752  THR A C   1 
ATOM   1510 O  O   . THR A 1 230 ? 17.265  -13.599 -15.441 1.00 32.50  ? 752  THR A O   1 
ATOM   1511 C  CB  . THR A 1 230 ? 19.914  -11.118 -16.051 1.00 40.73  ? 752  THR A CB  1 
ATOM   1512 O  OG1 . THR A 1 230 ? 19.488  -9.958  -15.334 1.00 42.83  ? 752  THR A OG1 1 
ATOM   1513 C  CG2 . THR A 1 230 ? 19.496  -11.025 -17.510 1.00 40.93  ? 752  THR A CG2 1 
ATOM   1514 N  N   . TYR A 1 231 ? 17.103  -11.369 -15.193 1.00 33.66  ? 753  TYR A N   1 
ATOM   1515 C  CA  . TYR A 1 231 ? 15.631  -11.362 -14.988 1.00 32.03  ? 753  TYR A CA  1 
ATOM   1516 C  C   . TYR A 1 231 ? 14.866  -12.150 -16.070 1.00 29.85  ? 753  TYR A C   1 
ATOM   1517 O  O   . TYR A 1 231 ? 13.798  -12.708 -15.836 1.00 27.52  ? 753  TYR A O   1 
ATOM   1518 C  CB  . TYR A 1 231 ? 15.095  -9.915  -14.914 1.00 32.91  ? 753  TYR A CB  1 
ATOM   1519 C  CG  . TYR A 1 231 ? 15.734  -9.069  -13.816 1.00 35.17  ? 753  TYR A CG  1 
ATOM   1520 C  CD1 . TYR A 1 231 ? 15.270  -9.137  -12.513 1.00 36.18  ? 753  TYR A CD1 1 
ATOM   1521 C  CD2 . TYR A 1 231 ? 16.803  -8.207  -14.079 1.00 36.15  ? 753  TYR A CD2 1 
ATOM   1522 C  CE1 . TYR A 1 231 ? 15.850  -8.387  -11.500 1.00 37.78  ? 753  TYR A CE1 1 
ATOM   1523 C  CE2 . TYR A 1 231 ? 17.380  -7.454  -13.066 1.00 37.84  ? 753  TYR A CE2 1 
ATOM   1524 C  CZ  . TYR A 1 231 ? 16.889  -7.546  -11.778 1.00 37.90  ? 753  TYR A CZ  1 
ATOM   1525 O  OH  . TYR A 1 231 ? 17.427  -6.823  -10.741 1.00 39.52  ? 753  TYR A OH  1 
ATOM   1526 N  N   . THR A 1 232 ? 15.452  -12.202 -17.253 1.00 29.63  ? 754  THR A N   1 
ATOM   1527 C  CA  . THR A 1 232 ? 14.851  -12.825 -18.393 1.00 29.33  ? 754  THR A CA  1 
ATOM   1528 C  C   . THR A 1 232 ? 14.608  -14.320 -18.227 1.00 29.09  ? 754  THR A C   1 
ATOM   1529 O  O   . THR A 1 232 ? 13.839  -14.886 -18.990 1.00 28.64  ? 754  THR A O   1 
ATOM   1530 C  CB  . THR A 1 232 ? 15.657  -12.525 -19.676 1.00 29.72  ? 754  THR A CB  1 
ATOM   1531 O  OG1 . THR A 1 232 ? 17.032  -12.804 -19.464 1.00 32.17  ? 754  THR A OG1 1 
ATOM   1532 C  CG2 . THR A 1 232 ? 15.528  -11.058 -20.049 1.00 29.89  ? 754  THR A CG2 1 
ATOM   1533 N  N   . VAL A 1 233 ? 15.210  -14.950 -17.224 1.00 29.98  ? 755  VAL A N   1 
ATOM   1534 C  CA  . VAL A 1 233 ? 14.913  -16.350 -16.950 1.00 30.25  ? 755  VAL A CA  1 
ATOM   1535 C  C   . VAL A 1 233 ? 13.454  -16.519 -16.510 1.00 28.76  ? 755  VAL A C   1 
ATOM   1536 O  O   . VAL A 1 233 ? 12.821  -17.534 -16.798 1.00 28.11  ? 755  VAL A O   1 
ATOM   1537 C  CB  . VAL A 1 233 ? 15.862  -17.002 -15.899 1.00 30.68  ? 755  VAL A CB  1 
ATOM   1538 C  CG1 . VAL A 1 233 ? 17.325  -16.900 -16.317 1.00 31.97  ? 755  VAL A CG1 1 
ATOM   1539 C  CG2 . VAL A 1 233 ? 15.644  -16.439 -14.511 1.00 31.32  ? 755  VAL A CG2 1 
ATOM   1540 N  N   . ASP A 1 234 ? 12.937  -15.535 -15.786 1.00 27.76  ? 756  ASP A N   1 
ATOM   1541 C  CA  . ASP A 1 234 ? 11.530  -15.536 -15.414 1.00 26.82  ? 756  ASP A CA  1 
ATOM   1542 C  C   . ASP A 1 234 ? 10.631  -15.314 -16.624 1.00 26.28  ? 756  ASP A C   1 
ATOM   1543 O  O   . ASP A 1 234 ? 9.500   -15.770 -16.649 1.00 26.33  ? 756  ASP A O   1 
ATOM   1544 C  CB  . ASP A 1 234 ? 11.246  -14.464 -14.372 1.00 26.16  ? 756  ASP A CB  1 
ATOM   1545 C  CG  . ASP A 1 234 ? 11.856  -14.783 -13.035 1.00 26.53  ? 756  ASP A CG  1 
ATOM   1546 O  OD1 . ASP A 1 234 ? 12.136  -15.968 -12.764 1.00 26.47  ? 756  ASP A OD1 1 
ATOM   1547 O  OD2 . ASP A 1 234 ? 12.036  -13.843 -12.238 1.00 27.11  ? 756  ASP A OD2 1 
ATOM   1548 N  N   . ILE A 1 235 ? 11.130  -14.601 -17.620 1.00 26.23  ? 757  ILE A N   1 
ATOM   1549 C  CA  . ILE A 1 235 ? 10.346  -14.324 -18.801 1.00 25.70  ? 757  ILE A CA  1 
ATOM   1550 C  C   . ILE A 1 235 ? 10.193  -15.597 -19.637 1.00 25.34  ? 757  ILE A C   1 
ATOM   1551 O  O   . ILE A 1 235 ? 9.124   -15.854 -20.172 1.00 25.17  ? 757  ILE A O   1 
ATOM   1552 C  CB  . ILE A 1 235 ? 10.969  -13.211 -19.637 1.00 26.75  ? 757  ILE A CB  1 
ATOM   1553 C  CG1 . ILE A 1 235 ? 11.108  -11.923 -18.813 1.00 27.34  ? 757  ILE A CG1 1 
ATOM   1554 C  CG2 . ILE A 1 235 ? 10.152  -12.987 -20.906 1.00 27.33  ? 757  ILE A CG2 1 
ATOM   1555 C  CD1 . ILE A 1 235 ? 9.813   -11.334 -18.288 1.00 26.92  ? 757  ILE A CD1 1 
ATOM   1556 N  N   . PHE A 1 236 ? 11.255  -16.390 -19.729 1.00 25.30  ? 758  PHE A N   1 
ATOM   1557 C  CA  . PHE A 1 236 ? 11.199  -17.680 -20.395 1.00 25.19  ? 758  PHE A CA  1 
ATOM   1558 C  C   . PHE A 1 236 ? 10.183  -18.630 -19.732 1.00 24.06  ? 758  PHE A C   1 
ATOM   1559 O  O   . PHE A 1 236 ? 9.377   -19.267 -20.414 1.00 23.38  ? 758  PHE A O   1 
ATOM   1560 C  CB  . PHE A 1 236 ? 12.575  -18.324 -20.405 1.00 26.31  ? 758  PHE A CB  1 
ATOM   1561 C  CG  . PHE A 1 236 ? 12.585  -19.673 -21.028 1.00 28.27  ? 758  PHE A CG  1 
ATOM   1562 C  CD1 . PHE A 1 236 ? 12.234  -20.792 -20.290 1.00 29.24  ? 758  PHE A CD1 1 
ATOM   1563 C  CD2 . PHE A 1 236 ? 12.892  -19.825 -22.360 1.00 29.86  ? 758  PHE A CD2 1 
ATOM   1564 C  CE1 . PHE A 1 236 ? 12.202  -22.044 -20.869 1.00 29.88  ? 758  PHE A CE1 1 
ATOM   1565 C  CE2 . PHE A 1 236 ? 12.875  -21.073 -22.944 1.00 31.59  ? 758  PHE A CE2 1 
ATOM   1566 C  CZ  . PHE A 1 236 ? 12.531  -22.187 -22.192 1.00 31.26  ? 758  PHE A CZ  1 
ATOM   1567 N  N   . SER A 1 237 ? 10.248  -18.728 -18.411 1.00 22.33  ? 759  SER A N   1 
ATOM   1568 C  CA  . SER A 1 237 ? 9.327   -19.527 -17.662 1.00 22.13  ? 759  SER A CA  1 
ATOM   1569 C  C   . SER A 1 237 ? 7.893   -19.046 -17.845 1.00 21.23  ? 759  SER A C   1 
ATOM   1570 O  O   . SER A 1 237 ? 6.991   -19.846 -18.008 1.00 20.82  ? 759  SER A O   1 
ATOM   1571 C  CB  . SER A 1 237 ? 9.690   -19.478 -16.172 1.00 22.73  ? 759  SER A CB  1 
ATOM   1572 O  OG  . SER A 1 237 ? 10.933  -20.095 -15.923 1.00 23.71  ? 759  SER A OG  1 
ATOM   1573 N  N   . ALA A 1 238 ? 7.692   -17.734 -17.802 1.00 21.29  ? 760  ALA A N   1 
ATOM   1574 C  CA  . ALA A 1 238 ? 6.374   -17.155 -17.985 1.00 21.41  ? 760  ALA A CA  1 
ATOM   1575 C  C   . ALA A 1 238 ? 5.862   -17.419 -19.374 1.00 21.42  ? 760  ALA A C   1 
ATOM   1576 O  O   . ALA A 1 238 ? 4.710   -17.712 -19.558 1.00 21.20  ? 760  ALA A O   1 
ATOM   1577 C  CB  . ALA A 1 238 ? 6.392   -15.660 -17.699 1.00 21.37  ? 760  ALA A CB  1 
ATOM   1578 N  N   . GLY A 1 239 ? 6.738   -17.317 -20.351 1.00 23.11  ? 761  GLY A N   1 
ATOM   1579 C  CA  . GLY A 1 239 ? 6.389   -17.600 -21.729 1.00 24.21  ? 761  GLY A CA  1 
ATOM   1580 C  C   . GLY A 1 239 ? 5.803   -18.985 -21.870 1.00 24.34  ? 761  GLY A C   1 
ATOM   1581 O  O   . GLY A 1 239 ? 4.789   -19.163 -22.539 1.00 24.55  ? 761  GLY A O   1 
ATOM   1582 N  N   . CYS A 1 240 ? 6.459   -19.961 -21.256 1.00 24.75  ? 762  CYS A N   1 
ATOM   1583 C  CA  . CYS A 1 240 ? 5.938   -21.309 -21.200 1.00 25.86  ? 762  CYS A CA  1 
ATOM   1584 C  C   . CYS A 1 240 ? 4.590   -21.360 -20.497 1.00 25.08  ? 762  CYS A C   1 
ATOM   1585 O  O   . CYS A 1 240 ? 3.697   -22.039 -20.947 1.00 25.38  ? 762  CYS A O   1 
ATOM   1586 C  CB  . CYS A 1 240 ? 6.904   -22.231 -20.471 1.00 26.59  ? 762  CYS A CB  1 
ATOM   1587 S  SG  . CYS A 1 240 ? 8.476   -22.449 -21.290 1.00 28.40  ? 762  CYS A SG  1 
ATOM   1588 N  N   . VAL A 1 241 ? 4.457   -20.649 -19.385 1.00 24.90  ? 763  VAL A N   1 
ATOM   1589 C  CA  . VAL A 1 241 ? 3.200   -20.609 -18.634 1.00 24.46  ? 763  VAL A CA  1 
ATOM   1590 C  C   . VAL A 1 241 ? 2.065   -20.018 -19.459 1.00 24.19  ? 763  VAL A C   1 
ATOM   1591 O  O   . VAL A 1 241 ? 0.923   -20.504 -19.404 1.00 23.55  ? 763  VAL A O   1 
ATOM   1592 C  CB  . VAL A 1 241 ? 3.355   -19.839 -17.306 1.00 23.76  ? 763  VAL A CB  1 
ATOM   1593 C  CG1 . VAL A 1 241 ? 2.010   -19.629 -16.641 1.00 23.57  ? 763  VAL A CG1 1 
ATOM   1594 C  CG2 . VAL A 1 241 ? 4.253   -20.605 -16.354 1.00 24.40  ? 763  VAL A CG2 1 
ATOM   1595 N  N   . PHE A 1 242 ? 2.387   -18.971 -20.211 1.00 24.17  ? 764  PHE A N   1 
ATOM   1596 C  CA  . PHE A 1 242 ? 1.433   -18.317 -21.089 1.00 25.33  ? 764  PHE A CA  1 
ATOM   1597 C  C   . PHE A 1 242 ? 0.828   -19.320 -22.057 1.00 26.56  ? 764  PHE A C   1 
ATOM   1598 O  O   . PHE A 1 242 ? -0.399  -19.415 -22.172 1.00 27.06  ? 764  PHE A O   1 
ATOM   1599 C  CB  . PHE A 1 242 ? 2.108   -17.207 -21.911 1.00 26.34  ? 764  PHE A CB  1 
ATOM   1600 C  CG  . PHE A 1 242 ? 2.154   -15.853 -21.240 1.00 26.18  ? 764  PHE A CG  1 
ATOM   1601 C  CD1 . PHE A 1 242 ? 2.418   -15.717 -19.882 1.00 25.90  ? 764  PHE A CD1 1 
ATOM   1602 C  CD2 . PHE A 1 242 ? 1.997   -14.695 -22.006 1.00 27.33  ? 764  PHE A CD2 1 
ATOM   1603 C  CE1 . PHE A 1 242 ? 2.478   -14.470 -19.296 1.00 26.10  ? 764  PHE A CE1 1 
ATOM   1604 C  CE2 . PHE A 1 242 ? 2.066   -13.441 -21.426 1.00 27.10  ? 764  PHE A CE2 1 
ATOM   1605 C  CZ  . PHE A 1 242 ? 2.294   -13.332 -20.062 1.00 27.01  ? 764  PHE A CZ  1 
ATOM   1606 N  N   . TYR A 1 243 ? 1.685   -20.068 -22.750 1.00 26.38  ? 765  TYR A N   1 
ATOM   1607 C  CA  . TYR A 1 243 ? 1.208   -21.032 -23.723 1.00 27.92  ? 765  TYR A CA  1 
ATOM   1608 C  C   . TYR A 1 243 ? 0.456   -22.161 -23.049 1.00 27.86  ? 765  TYR A C   1 
ATOM   1609 O  O   . TYR A 1 243 ? -0.505  -22.689 -23.602 1.00 28.04  ? 765  TYR A O   1 
ATOM   1610 C  CB  . TYR A 1 243 ? 2.359   -21.620 -24.533 1.00 29.57  ? 765  TYR A CB  1 
ATOM   1611 C  CG  . TYR A 1 243 ? 1.913   -22.547 -25.640 1.00 30.91  ? 765  TYR A CG  1 
ATOM   1612 C  CD1 . TYR A 1 243 ? 1.416   -22.046 -26.831 1.00 32.13  ? 765  TYR A CD1 1 
ATOM   1613 C  CD2 . TYR A 1 243 ? 1.989   -23.910 -25.496 1.00 31.90  ? 765  TYR A CD2 1 
ATOM   1614 C  CE1 . TYR A 1 243 ? 1.018   -22.885 -27.852 1.00 33.39  ? 765  TYR A CE1 1 
ATOM   1615 C  CE2 . TYR A 1 243 ? 1.600   -24.751 -26.510 1.00 33.93  ? 765  TYR A CE2 1 
ATOM   1616 C  CZ  . TYR A 1 243 ? 1.107   -24.233 -27.685 1.00 33.98  ? 765  TYR A CZ  1 
ATOM   1617 O  OH  . TYR A 1 243 ? 0.708   -25.084 -28.685 1.00 34.89  ? 765  TYR A OH  1 
ATOM   1618 N  N   . TYR A 1 244 ? 0.932   -22.556 -21.874 1.00 27.56  ? 766  TYR A N   1 
ATOM   1619 C  CA  . TYR A 1 244 ? 0.266   -23.578 -21.101 1.00 28.59  ? 766  TYR A CA  1 
ATOM   1620 C  C   . TYR A 1 244 ? -1.188  -23.190 -20.774 1.00 28.16  ? 766  TYR A C   1 
ATOM   1621 O  O   . TYR A 1 244 ? -2.082  -24.018 -20.902 1.00 28.07  ? 766  TYR A O   1 
ATOM   1622 C  CB  . TYR A 1 244 ? 1.062   -23.911 -19.840 1.00 28.67  ? 766  TYR A CB  1 
ATOM   1623 C  CG  . TYR A 1 244 ? 0.350   -24.827 -18.883 1.00 29.71  ? 766  TYR A CG  1 
ATOM   1624 C  CD1 . TYR A 1 244 ? 0.441   -26.201 -19.013 1.00 32.20  ? 766  TYR A CD1 1 
ATOM   1625 C  CD2 . TYR A 1 244 ? -0.424  -24.322 -17.851 1.00 29.39  ? 766  TYR A CD2 1 
ATOM   1626 C  CE1 . TYR A 1 244 ? -0.220  -27.056 -18.139 1.00 32.56  ? 766  TYR A CE1 1 
ATOM   1627 C  CE2 . TYR A 1 244 ? -1.071  -25.167 -16.969 1.00 30.79  ? 766  TYR A CE2 1 
ATOM   1628 C  CZ  . TYR A 1 244 ? -0.961  -26.532 -17.117 1.00 32.14  ? 766  TYR A CZ  1 
ATOM   1629 O  OH  . TYR A 1 244 ? -1.612  -27.379 -16.251 1.00 34.89  ? 766  TYR A OH  1 
ATOM   1630 N  N   . VAL A 1 245 ? -1.420  -21.947 -20.365 1.00 27.38  ? 767  VAL A N   1 
ATOM   1631 C  CA  . VAL A 1 245 ? -2.776  -21.484 -20.086 1.00 28.10  ? 767  VAL A CA  1 
ATOM   1632 C  C   . VAL A 1 245 ? -3.652  -21.475 -21.352 1.00 29.76  ? 767  VAL A C   1 
ATOM   1633 O  O   . VAL A 1 245 ? -4.768  -22.022 -21.344 1.00 31.24  ? 767  VAL A O   1 
ATOM   1634 C  CB  . VAL A 1 245 ? -2.777  -20.080 -19.448 1.00 27.25  ? 767  VAL A CB  1 
ATOM   1635 C  CG1 . VAL A 1 245 ? -4.173  -19.469 -19.453 1.00 27.07  ? 767  VAL A CG1 1 
ATOM   1636 C  CG2 . VAL A 1 245 ? -2.202  -20.134 -18.045 1.00 26.90  ? 767  VAL A CG2 1 
ATOM   1637 N  N   . ILE A 1 246 ? -3.149  -20.867 -22.430 1.00 30.68  ? 768  ILE A N   1 
ATOM   1638 C  CA  . ILE A 1 246 ? -3.946  -20.714 -23.655 1.00 31.18  ? 768  ILE A CA  1 
ATOM   1639 C  C   . ILE A 1 246 ? -4.070  -21.968 -24.523 1.00 31.45  ? 768  ILE A C   1 
ATOM   1640 O  O   . ILE A 1 246 ? -4.995  -22.037 -25.319 1.00 31.99  ? 768  ILE A O   1 
ATOM   1641 C  CB  . ILE A 1 246 ? -3.521  -19.519 -24.542 1.00 31.24  ? 768  ILE A CB  1 
ATOM   1642 C  CG1 . ILE A 1 246 ? -2.113  -19.693 -25.106 1.00 32.38  ? 768  ILE A CG1 1 
ATOM   1643 C  CG2 . ILE A 1 246 ? -3.651  -18.225 -23.776 1.00 30.97  ? 768  ILE A CG2 1 
ATOM   1644 C  CD1 . ILE A 1 246 ? -1.707  -18.589 -26.057 1.00 32.80  ? 768  ILE A CD1 1 
ATOM   1645 N  N   . SER A 1 247 ? -3.172  -22.936 -24.378 1.00 31.23  ? 769  SER A N   1 
ATOM   1646 C  CA  . SER A 1 247 ? -3.292  -24.211 -25.102 1.00 32.59  ? 769  SER A CA  1 
ATOM   1647 C  C   . SER A 1 247 ? -4.176  -25.201 -24.348 1.00 33.74  ? 769  SER A C   1 
ATOM   1648 O  O   . SER A 1 247 ? -4.444  -26.303 -24.834 1.00 33.44  ? 769  SER A O   1 
ATOM   1649 C  CB  . SER A 1 247 ? -1.906  -24.843 -25.347 1.00 32.63  ? 769  SER A CB  1 
ATOM   1650 O  OG  . SER A 1 247 ? -1.286  -25.289 -24.153 1.00 30.71  ? 769  SER A OG  1 
ATOM   1651 N  N   . GLU A 1 248 ? -4.620  -24.786 -23.163 1.00 34.39  ? 770  GLU A N   1 
ATOM   1652 C  CA  . GLU A 1 248 ? -5.327  -25.640 -22.197 1.00 35.10  ? 770  GLU A CA  1 
ATOM   1653 C  C   . GLU A 1 248 ? -4.529  -26.846 -21.768 1.00 34.31  ? 770  GLU A C   1 
ATOM   1654 O  O   . GLU A 1 248 ? -5.071  -27.943 -21.668 1.00 36.01  ? 770  GLU A O   1 
ATOM   1655 C  CB  . GLU A 1 248 ? -6.699  -26.063 -22.709 1.00 37.23  ? 770  GLU A CB  1 
ATOM   1656 C  CG  . GLU A 1 248 ? -7.596  -24.879 -23.003 1.00 38.87  ? 770  GLU A CG  1 
ATOM   1657 C  CD  . GLU A 1 248 ? -8.993  -25.285 -23.377 1.00 40.97  ? 770  GLU A CD  1 
ATOM   1658 O  OE1 . GLU A 1 248 ? -9.528  -26.227 -22.744 1.00 43.19  ? 770  GLU A OE1 1 
ATOM   1659 O  OE2 . GLU A 1 248 ? -9.543  -24.648 -24.298 1.00 43.05  ? 770  GLU A OE2 1 
ATOM   1660 N  N   . GLY A 1 249 ? -3.241  -26.640 -21.507 1.00 33.25  ? 771  GLY A N   1 
ATOM   1661 C  CA  . GLY A 1 249 ? -2.409  -27.656 -20.860 1.00 33.22  ? 771  GLY A CA  1 
ATOM   1662 C  C   . GLY A 1 249 ? -1.190  -28.176 -21.582 1.00 32.88  ? 771  GLY A C   1 
ATOM   1663 O  O   . GLY A 1 249 ? -0.472  -28.980 -21.022 1.00 34.55  ? 771  GLY A O   1 
ATOM   1664 N  N   . SER A 1 250 ? -0.942  -27.731 -22.808 1.00 32.90  ? 772  SER A N   1 
ATOM   1665 C  CA  . SER A 1 250 ? 0.271   -28.136 -23.531 1.00 33.13  ? 772  SER A CA  1 
ATOM   1666 C  C   . SER A 1 250 ? 1.426   -27.256 -23.119 1.00 30.64  ? 772  SER A C   1 
ATOM   1667 O  O   . SER A 1 250 ? 1.254   -26.333 -22.347 1.00 29.81  ? 772  SER A O   1 
ATOM   1668 C  CB  . SER A 1 250 ? 0.071   -28.074 -25.039 1.00 33.76  ? 772  SER A CB  1 
ATOM   1669 O  OG  . SER A 1 250 ? -1.128  -28.726 -25.385 1.00 36.47  ? 772  SER A OG  1 
ATOM   1670 N  N   . HIS A 1 251 ? 2.597   -27.558 -23.648 1.00 30.44  ? 773  HIS A N   1 
ATOM   1671 C  CA  . HIS A 1 251 ? 3.834   -26.888 -23.279 1.00 29.98  ? 773  HIS A CA  1 
ATOM   1672 C  C   . HIS A 1 251 ? 4.619   -26.730 -24.575 1.00 29.65  ? 773  HIS A C   1 
ATOM   1673 O  O   . HIS A 1 251 ? 4.662   -27.663 -25.384 1.00 31.32  ? 773  HIS A O   1 
ATOM   1674 C  CB  . HIS A 1 251 ? 4.591   -27.761 -22.269 1.00 30.74  ? 773  HIS A CB  1 
ATOM   1675 C  CG  . HIS A 1 251 ? 5.727   -27.078 -21.565 1.00 31.05  ? 773  HIS A CG  1 
ATOM   1676 N  ND1 . HIS A 1 251 ? 6.951   -26.868 -22.155 1.00 31.09  ? 773  HIS A ND1 1 
ATOM   1677 C  CD2 . HIS A 1 251 ? 5.846   -26.620 -20.295 1.00 30.80  ? 773  HIS A CD2 1 
ATOM   1678 C  CE1 . HIS A 1 251 ? 7.761   -26.276 -21.301 1.00 30.62  ? 773  HIS A CE1 1 
ATOM   1679 N  NE2 . HIS A 1 251 ? 7.117   -26.116 -20.162 1.00 30.36  ? 773  HIS A NE2 1 
ATOM   1680 N  N   . PRO A 1 252 ? 5.231   -25.557 -24.799 1.00 28.56  ? 774  PRO A N   1 
ATOM   1681 C  CA  . PRO A 1 252 ? 5.981   -25.315 -26.027 1.00 29.37  ? 774  PRO A CA  1 
ATOM   1682 C  C   . PRO A 1 252 ? 7.047   -26.339 -26.343 1.00 30.62  ? 774  PRO A C   1 
ATOM   1683 O  O   . PRO A 1 252 ? 7.365   -26.520 -27.488 1.00 31.90  ? 774  PRO A O   1 
ATOM   1684 C  CB  . PRO A 1 252 ? 6.633   -23.961 -25.770 1.00 28.53  ? 774  PRO A CB  1 
ATOM   1685 C  CG  . PRO A 1 252 ? 5.690   -23.279 -24.872 1.00 27.52  ? 774  PRO A CG  1 
ATOM   1686 C  CD  . PRO A 1 252 ? 5.191   -24.352 -23.960 1.00 27.54  ? 774  PRO A CD  1 
ATOM   1687 N  N   . PHE A 1 253 ? 7.578   -27.012 -25.331 1.00 31.67  ? 775  PHE A N   1 
ATOM   1688 C  CA  . PHE A 1 253 ? 8.694   -27.940 -25.490 1.00 33.47  ? 775  PHE A CA  1 
ATOM   1689 C  C   . PHE A 1 253 ? 8.342   -29.424 -25.330 1.00 35.42  ? 775  PHE A C   1 
ATOM   1690 O  O   . PHE A 1 253 ? 9.243   -30.269 -25.214 1.00 36.50  ? 775  PHE A O   1 
ATOM   1691 C  CB  . PHE A 1 253 ? 9.820   -27.522 -24.538 1.00 32.56  ? 775  PHE A CB  1 
ATOM   1692 C  CG  . PHE A 1 253 ? 10.392  -26.180 -24.867 1.00 31.09  ? 775  PHE A CG  1 
ATOM   1693 C  CD1 . PHE A 1 253 ? 9.846   -25.033 -24.324 1.00 29.37  ? 775  PHE A CD1 1 
ATOM   1694 C  CD2 . PHE A 1 253 ? 11.452  -26.062 -25.765 1.00 32.02  ? 775  PHE A CD2 1 
ATOM   1695 C  CE1 . PHE A 1 253 ? 10.358  -23.784 -24.646 1.00 29.06  ? 775  PHE A CE1 1 
ATOM   1696 C  CE2 . PHE A 1 253 ? 11.970  -24.821 -26.091 1.00 31.48  ? 775  PHE A CE2 1 
ATOM   1697 C  CZ  . PHE A 1 253 ? 11.417  -23.678 -25.532 1.00 30.16  ? 775  PHE A CZ  1 
ATOM   1698 N  N   . GLY A 1 254 ? 7.050   -29.748 -25.366 1.00 36.25  ? 776  GLY A N   1 
ATOM   1699 C  CA  . GLY A 1 254 ? 6.594   -31.143 -25.422 1.00 38.31  ? 776  GLY A CA  1 
ATOM   1700 C  C   . GLY A 1 254 ? 6.060   -31.718 -24.122 1.00 38.83  ? 776  GLY A C   1 
ATOM   1701 O  O   . GLY A 1 254 ? 5.768   -30.996 -23.171 1.00 36.13  ? 776  GLY A O   1 
ATOM   1702 N  N   . LYS A 1 255 ? 5.914   -33.037 -24.100 1.00 42.52  ? 777  LYS A N   1 
ATOM   1703 C  CA  . LYS A 1 255 ? 5.449   -33.760 -22.910 1.00 44.55  ? 777  LYS A CA  1 
ATOM   1704 C  C   . LYS A 1 255 ? 6.528   -33.770 -21.822 1.00 43.63  ? 777  LYS A C   1 
ATOM   1705 O  O   . LYS A 1 255 ? 7.703   -33.595 -22.125 1.00 43.09  ? 777  LYS A O   1 
ATOM   1706 C  CB  . LYS A 1 255 ? 5.028   -35.197 -23.262 1.00 47.36  ? 777  LYS A CB  1 
ATOM   1707 C  CG  . LYS A 1 255 ? 3.655   -35.312 -23.937 1.00 48.88  ? 777  LYS A CG  1 
ATOM   1708 C  CD  . LYS A 1 255 ? 3.736   -35.664 -25.425 1.00 51.09  ? 777  LYS A CD  1 
ATOM   1709 C  CE  . LYS A 1 255 ? 4.145   -37.118 -25.631 1.00 53.32  ? 777  LYS A CE  1 
ATOM   1710 N  NZ  . LYS A 1 255 ? 3.959   -37.563 -27.039 1.00 54.54  ? 777  LYS A NZ  1 
ATOM   1711 N  N   . SER A 1 256 ? 6.115   -33.988 -20.569 1.00 43.76  ? 778  SER A N   1 
ATOM   1712 C  CA  . SER A 1 256 ? 6.977   -33.745 -19.406 1.00 44.56  ? 778  SER A CA  1 
ATOM   1713 C  C   . SER A 1 256 ? 8.273   -34.533 -19.410 1.00 46.14  ? 778  SER A C   1 
ATOM   1714 O  O   . SER A 1 256 ? 9.243   -34.107 -18.809 1.00 45.76  ? 778  SER A O   1 
ATOM   1715 C  CB  . SER A 1 256 ? 6.226   -33.945 -18.082 1.00 44.71  ? 778  SER A CB  1 
ATOM   1716 O  OG  . SER A 1 256 ? 5.786   -35.266 -17.906 1.00 45.64  ? 778  SER A OG  1 
ATOM   1717 N  N   . LEU A 1 257 ? 8.298   -35.646 -20.133 1.00 48.40  ? 779  LEU A N   1 
ATOM   1718 C  CA  . LEU A 1 257 ? 9.459   -36.514 -20.176 1.00 49.78  ? 779  LEU A CA  1 
ATOM   1719 C  C   . LEU A 1 257 ? 10.693  -35.915 -20.852 1.00 50.25  ? 779  LEU A C   1 
ATOM   1720 O  O   . LEU A 1 257 ? 11.799  -36.152 -20.408 1.00 50.66  ? 779  LEU A O   1 
ATOM   1721 C  CB  . LEU A 1 257 ? 9.102   -37.833 -20.874 1.00 52.35  ? 779  LEU A CB  1 
ATOM   1722 C  CG  . LEU A 1 257 ? 9.643   -39.142 -20.294 1.00 53.95  ? 779  LEU A CG  1 
ATOM   1723 C  CD1 . LEU A 1 257 ? 9.606   -40.209 -21.383 1.00 57.48  ? 779  LEU A CD1 1 
ATOM   1724 C  CD2 . LEU A 1 257 ? 11.039  -39.047 -19.688 1.00 53.14  ? 779  LEU A CD2 1 
ATOM   1725 N  N   . GLN A 1 258 ? 10.542  -35.185 -21.946 1.00 53.06  ? 780  GLN A N   1 
ATOM   1726 C  CA  . GLN A 1 258 ? 11.742  -34.687 -22.648 1.00 55.54  ? 780  GLN A CA  1 
ATOM   1727 C  C   . GLN A 1 258 ? 11.698  -33.189 -22.952 1.00 49.53  ? 780  GLN A C   1 
ATOM   1728 O  O   . GLN A 1 258 ? 12.368  -32.702 -23.854 1.00 48.10  ? 780  GLN A O   1 
ATOM   1729 C  CB  . GLN A 1 258 ? 12.025  -35.516 -23.915 1.00 61.85  ? 780  GLN A CB  1 
ATOM   1730 C  CG  . GLN A 1 258 ? 10.911  -35.492 -24.962 1.00 67.13  ? 780  GLN A CG  1 
ATOM   1731 C  CD  . GLN A 1 258 ? 9.934   -36.654 -24.838 1.00 69.71  ? 780  GLN A CD  1 
ATOM   1732 O  OE1 . GLN A 1 258 ? 8.720   -36.451 -24.727 1.00 70.46  ? 780  GLN A OE1 1 
ATOM   1733 N  NE2 . GLN A 1 258 ? 10.459  -37.879 -24.858 1.00 70.61  ? 780  GLN A NE2 1 
ATOM   1734 N  N   . ARG A 1 259 ? 10.957  -32.448 -22.146 1.00 45.84  ? 781  ARG A N   1 
ATOM   1735 C  CA  . ARG A 1 259 ? 10.828  -31.037 -22.394 1.00 44.59  ? 781  ARG A CA  1 
ATOM   1736 C  C   . ARG A 1 259 ? 12.021  -30.202 -21.935 1.00 42.95  ? 781  ARG A C   1 
ATOM   1737 O  O   . ARG A 1 259 ? 12.361  -29.225 -22.604 1.00 43.09  ? 781  ARG A O   1 
ATOM   1738 C  CB  . ARG A 1 259 ? 9.492   -30.483 -21.874 1.00 43.72  ? 781  ARG A CB  1 
ATOM   1739 C  CG  . ARG A 1 259 ? 9.288   -30.495 -20.388 1.00 42.88  ? 781  ARG A CG  1 
ATOM   1740 C  CD  . ARG A 1 259 ? 8.062   -29.676 -20.010 1.00 41.02  ? 781  ARG A CD  1 
ATOM   1741 N  NE  . ARG A 1 259 ? 6.797   -30.268 -20.459 1.00 41.28  ? 781  ARG A NE  1 
ATOM   1742 C  CZ  . ARG A 1 259 ? 5.682   -30.372 -19.728 1.00 40.31  ? 781  ARG A CZ  1 
ATOM   1743 N  NH1 . ARG A 1 259 ? 5.623   -29.978 -18.468 1.00 39.20  ? 781  ARG A NH1 1 
ATOM   1744 N  NH2 . ARG A 1 259 ? 4.602   -30.902 -20.267 1.00 41.79  ? 781  ARG A NH2 1 
ATOM   1745 N  N   . GLN A 1 260 ? 12.665  -30.565 -20.828 1.00 42.31  ? 782  GLN A N   1 
ATOM   1746 C  CA  . GLN A 1 260 ? 13.905  -29.885 -20.453 1.00 40.81  ? 782  GLN A CA  1 
ATOM   1747 C  C   . GLN A 1 260 ? 15.009  -30.134 -21.482 1.00 41.46  ? 782  GLN A C   1 
ATOM   1748 O  O   . GLN A 1 260 ? 15.738  -29.211 -21.843 1.00 40.84  ? 782  GLN A O   1 
ATOM   1749 C  CB  . GLN A 1 260 ? 14.386  -30.248 -19.048 1.00 40.56  ? 782  GLN A CB  1 
ATOM   1750 C  CG  . GLN A 1 260 ? 15.386  -29.228 -18.479 1.00 40.57  ? 782  GLN A CG  1 
ATOM   1751 C  CD  . GLN A 1 260 ? 14.835  -27.786 -18.453 1.00 39.78  ? 782  GLN A CD  1 
ATOM   1752 O  OE1 . GLN A 1 260 ? 13.885  -27.484 -17.730 1.00 38.15  ? 782  GLN A OE1 1 
ATOM   1753 N  NE2 . GLN A 1 260 ? 15.438  -26.896 -19.242 1.00 40.35  ? 782  GLN A NE2 1 
ATOM   1754 N  N   . ALA A 1 261 ? 15.119  -31.365 -21.969 1.00 42.47  ? 783  ALA A N   1 
ATOM   1755 C  CA  . ALA A 1 261 ? 16.077  -31.663 -23.028 1.00 43.95  ? 783  ALA A CA  1 
ATOM   1756 C  C   . ALA A 1 261 ? 15.719  -30.868 -24.291 1.00 43.21  ? 783  ALA A C   1 
ATOM   1757 O  O   . ALA A 1 261 ? 16.601  -30.363 -24.982 1.00 43.29  ? 783  ALA A O   1 
ATOM   1758 C  CB  . ALA A 1 261 ? 16.130  -33.163 -23.309 1.00 45.68  ? 783  ALA A CB  1 
ATOM   1759 N  N   . ASN A 1 262 ? 14.429  -30.738 -24.587 1.00 42.10  ? 784  ASN A N   1 
ATOM   1760 C  CA  . ASN A 1 262 ? 14.019  -29.934 -25.738 1.00 42.16  ? 784  ASN A CA  1 
ATOM   1761 C  C   . ASN A 1 262 ? 14.282  -28.450 -25.571 1.00 40.55  ? 784  ASN A C   1 
ATOM   1762 O  O   . ASN A 1 262 ? 14.568  -27.757 -26.546 1.00 40.38  ? 784  ASN A O   1 
ATOM   1763 C  CB  . ASN A 1 262 ? 12.551  -30.165 -26.082 1.00 42.70  ? 784  ASN A CB  1 
ATOM   1764 C  CG  . ASN A 1 262 ? 12.327  -31.481 -26.786 1.00 43.71  ? 784  ASN A CG  1 
ATOM   1765 O  OD1 . ASN A 1 262 ? 13.227  -32.003 -27.415 1.00 46.10  ? 784  ASN A OD1 1 
ATOM   1766 N  ND2 . ASN A 1 262 ? 11.127  -32.023 -26.675 1.00 43.61  ? 784  ASN A ND2 1 
ATOM   1767 N  N   . ILE A 1 263 ? 14.198  -27.963 -24.339 1.00 39.88  ? 785  ILE A N   1 
ATOM   1768 C  CA  . ILE A 1 263 ? 14.565  -26.582 -24.031 1.00 39.19  ? 785  ILE A CA  1 
ATOM   1769 C  C   . ILE A 1 263 ? 16.034  -26.304 -24.398 1.00 41.17  ? 785  ILE A C   1 
ATOM   1770 O  O   . ILE A 1 263 ? 16.322  -25.326 -25.086 1.00 41.93  ? 785  ILE A O   1 
ATOM   1771 C  CB  . ILE A 1 263 ? 14.285  -26.246 -22.548 1.00 37.78  ? 785  ILE A CB  1 
ATOM   1772 C  CG1 . ILE A 1 263 ? 12.781  -26.172 -22.298 1.00 36.10  ? 785  ILE A CG1 1 
ATOM   1773 C  CG2 . ILE A 1 263 ? 14.941  -24.927 -22.164 1.00 37.51  ? 785  ILE A CG2 1 
ATOM   1774 C  CD1 . ILE A 1 263 ? 12.389  -26.203 -20.837 1.00 35.47  ? 785  ILE A CD1 1 
ATOM   1775 N  N   . LEU A 1 264 ? 16.955  -27.170 -23.975 1.00 44.06  ? 786  LEU A N   1 
ATOM   1776 C  CA  . LEU A 1 264 ? 18.374  -27.003 -24.337 1.00 47.26  ? 786  LEU A CA  1 
ATOM   1777 C  C   . LEU A 1 264 ? 18.620  -27.104 -25.851 1.00 48.03  ? 786  LEU A C   1 
ATOM   1778 O  O   . LEU A 1 264 ? 19.518  -26.453 -26.366 1.00 48.84  ? 786  LEU A O   1 
ATOM   1779 C  CB  . LEU A 1 264 ? 19.282  -28.009 -23.615 1.00 49.57  ? 786  LEU A CB  1 
ATOM   1780 C  CG  . LEU A 1 264 ? 19.349  -28.108 -22.084 1.00 50.70  ? 786  LEU A CG  1 
ATOM   1781 C  CD1 . LEU A 1 264 ? 20.788  -28.390 -21.658 1.00 52.10  ? 786  LEU A CD1 1 
ATOM   1782 C  CD2 . LEU A 1 264 ? 18.818  -26.876 -21.360 1.00 49.95  ? 786  LEU A CD2 1 
ATOM   1783 N  N   . LEU A 1 265 ? 17.830  -27.917 -26.552 1.00 48.32  ? 787  LEU A N   1 
ATOM   1784 C  CA  . LEU A 1 265 ? 17.944  -28.043 -28.008 1.00 49.41  ? 787  LEU A CA  1 
ATOM   1785 C  C   . LEU A 1 265 ? 17.253  -26.928 -28.780 1.00 47.43  ? 787  LEU A C   1 
ATOM   1786 O  O   . LEU A 1 265 ? 17.397  -26.840 -29.981 1.00 47.66  ? 787  LEU A O   1 
ATOM   1787 C  CB  . LEU A 1 265 ? 17.389  -29.397 -28.480 1.00 51.04  ? 787  LEU A CB  1 
ATOM   1788 C  CG  . LEU A 1 265 ? 18.141  -30.673 -28.082 1.00 52.38  ? 787  LEU A CG  1 
ATOM   1789 C  CD1 . LEU A 1 265 ? 17.281  -31.899 -28.360 1.00 52.88  ? 787  LEU A CD1 1 
ATOM   1790 C  CD2 . LEU A 1 265 ? 19.489  -30.779 -28.782 1.00 54.00  ? 787  LEU A CD2 1 
ATOM   1791 N  N   . GLY A 1 266 ? 16.474  -26.091 -28.111 1.00 46.79  ? 788  GLY A N   1 
ATOM   1792 C  CA  . GLY A 1 266 ? 15.691  -25.057 -28.816 1.00 45.63  ? 788  GLY A CA  1 
ATOM   1793 C  C   . GLY A 1 266 ? 14.509  -25.544 -29.641 1.00 44.91  ? 788  GLY A C   1 
ATOM   1794 O  O   . GLY A 1 266 ? 13.936  -24.786 -30.417 1.00 44.51  ? 788  GLY A O   1 
ATOM   1795 N  N   . ALA A 1 267 ? 14.125  -26.798 -29.443 1.00 45.02  ? 789  ALA A N   1 
ATOM   1796 C  CA  . ALA A 1 267 ? 13.057  -27.423 -30.198 1.00 45.49  ? 789  ALA A CA  1 
ATOM   1797 C  C   . ALA A 1 267 ? 11.700  -27.185 -29.544 1.00 44.21  ? 789  ALA A C   1 
ATOM   1798 O  O   . ALA A 1 267 ? 11.262  -27.977 -28.724 1.00 43.87  ? 789  ALA A O   1 
ATOM   1799 C  CB  . ALA A 1 267 ? 13.324  -28.913 -30.312 1.00 47.54  ? 789  ALA A CB  1 
ATOM   1800 N  N   . CYS A 1 268 ? 11.040  -26.087 -29.915 1.00 44.47  ? 790  CYS A N   1 
ATOM   1801 C  CA  . CYS A 1 268 ? 9.684   -25.800 -29.459 1.00 42.96  ? 790  CYS A CA  1 
ATOM   1802 C  C   . CYS A 1 268 ? 8.684   -25.915 -30.594 1.00 42.18  ? 790  CYS A C   1 
ATOM   1803 O  O   . CYS A 1 268 ? 9.059   -26.006 -31.751 1.00 43.59  ? 790  CYS A O   1 
ATOM   1804 C  CB  . CYS A 1 268 ? 9.588   -24.401 -28.850 1.00 42.79  ? 790  CYS A CB  1 
ATOM   1805 S  SG  . CYS A 1 268 ? 9.700   -23.044 -30.031 1.00 45.54  ? 790  CYS A SG  1 
ATOM   1806 N  N   . SER A 1 269 ? 7.411   -25.896 -30.225 1.00 39.80  ? 791  SER A N   1 
ATOM   1807 C  CA  . SER A 1 269 ? 6.298   -25.923 -31.143 1.00 39.36  ? 791  SER A CA  1 
ATOM   1808 C  C   . SER A 1 269 ? 5.105   -25.267 -30.469 1.00 37.79  ? 791  SER A C   1 
ATOM   1809 O  O   . SER A 1 269 ? 4.826   -25.538 -29.296 1.00 35.54  ? 791  SER A O   1 
ATOM   1810 C  CB  . SER A 1 269 ? 5.941   -27.367 -31.491 1.00 41.14  ? 791  SER A CB  1 
ATOM   1811 O  OG  . SER A 1 269 ? 4.633   -27.449 -32.023 1.00 41.07  ? 791  SER A OG  1 
ATOM   1812 N  N   . LEU A 1 270 ? 4.396   -24.425 -31.221 1.00 37.71  ? 792  LEU A N   1 
ATOM   1813 C  CA  . LEU A 1 270 ? 3.205   -23.764 -30.735 1.00 37.06  ? 792  LEU A CA  1 
ATOM   1814 C  C   . LEU A 1 270 ? 2.038   -24.120 -31.655 1.00 38.62  ? 792  LEU A C   1 
ATOM   1815 O  O   . LEU A 1 270 ? 1.283   -23.255 -32.077 1.00 37.37  ? 792  LEU A O   1 
ATOM   1816 C  CB  . LEU A 1 270 ? 3.430   -22.248 -30.641 1.00 36.31  ? 792  LEU A CB  1 
ATOM   1817 C  CG  . LEU A 1 270 ? 4.696   -21.718 -29.940 1.00 36.50  ? 792  LEU A CG  1 
ATOM   1818 C  CD1 . LEU A 1 270 ? 4.868   -20.202 -30.040 1.00 35.53  ? 792  LEU A CD1 1 
ATOM   1819 C  CD2 . LEU A 1 270 ? 4.739   -22.119 -28.473 1.00 36.68  ? 792  LEU A CD2 1 
ATOM   1820 N  N   . ASP A 1 271 ? 1.913   -25.419 -31.931 1.00 42.87  ? 793  ASP A N   1 
ATOM   1821 C  CA  . ASP A 1 271 ? 0.818   -26.046 -32.711 1.00 46.12  ? 793  ASP A CA  1 
ATOM   1822 C  C   . ASP A 1 271 ? -0.558  -25.426 -32.589 1.00 44.58  ? 793  ASP A C   1 
ATOM   1823 O  O   . ASP A 1 271 ? -1.262  -25.261 -33.580 1.00 47.22  ? 793  ASP A O   1 
ATOM   1824 C  CB  . ASP A 1 271 ? 0.608   -27.496 -32.241 1.00 50.01  ? 793  ASP A CB  1 
ATOM   1825 C  CG  . ASP A 1 271 ? 1.684   -28.424 -32.686 1.00 53.41  ? 793  ASP A CG  1 
ATOM   1826 O  OD1 . ASP A 1 271 ? 2.457   -28.059 -33.592 1.00 56.31  ? 793  ASP A OD1 1 
ATOM   1827 O  OD2 . ASP A 1 271 ? 1.749   -29.533 -32.118 1.00 57.79  ? 793  ASP A OD2 1 
ATOM   1828 N  N   . CYS A 1 272 ? -0.974  -25.145 -31.366 1.00 42.54  ? 794  CYS A N   1 
ATOM   1829 C  CA  . CYS A 1 272 ? -2.354  -24.760 -31.118 1.00 42.73  ? 794  CYS A CA  1 
ATOM   1830 C  C   . CYS A 1 272 ? -2.696  -23.338 -31.594 1.00 40.36  ? 794  CYS A C   1 
ATOM   1831 O  O   . CYS A 1 272 ? -3.852  -22.941 -31.550 1.00 40.13  ? 794  CYS A O   1 
ATOM   1832 C  CB  . CYS A 1 272 ? -2.681  -24.927 -29.635 1.00 43.35  ? 794  CYS A CB  1 
ATOM   1833 S  SG  . CYS A 1 272 ? -2.364  -23.443 -28.663 1.00 48.02  ? 794  CYS A SG  1 
ATOM   1834 N  N   . LEU A 1 273 ? -1.698  -22.580 -32.043 1.00 38.97  ? 795  LEU A N   1 
ATOM   1835 C  CA  . LEU A 1 273 ? -1.907  -21.230 -32.562 1.00 38.06  ? 795  LEU A CA  1 
ATOM   1836 C  C   . LEU A 1 273 ? -1.976  -21.211 -34.091 1.00 38.64  ? 795  LEU A C   1 
ATOM   1837 O  O   . LEU A 1 273 ? -0.960  -21.355 -34.762 1.00 38.91  ? 795  LEU A O   1 
ATOM   1838 C  CB  . LEU A 1 273 ? -0.795  -20.290 -32.063 1.00 36.09  ? 795  LEU A CB  1 
ATOM   1839 C  CG  . LEU A 1 273 ? -0.667  -20.208 -30.540 1.00 34.73  ? 795  LEU A CG  1 
ATOM   1840 C  CD1 . LEU A 1 273 ? 0.536   -19.387 -30.117 1.00 33.65  ? 795  LEU A CD1 1 
ATOM   1841 C  CD2 . LEU A 1 273 ? -1.930  -19.642 -29.933 1.00 33.97  ? 795  LEU A CD2 1 
ATOM   1842 N  N   . HIS A 1 274 ? -3.158  -20.980 -34.647 1.00 39.00  ? 796  HIS A N   1 
ATOM   1843 C  CA  . HIS A 1 274 ? -3.335  -20.909 -36.091 1.00 40.88  ? 796  HIS A CA  1 
ATOM   1844 C  C   . HIS A 1 274 ? -2.623  -19.748 -36.711 1.00 39.39  ? 796  HIS A C   1 
ATOM   1845 O  O   . HIS A 1 274 ? -2.672  -18.638 -36.167 1.00 37.17  ? 796  HIS A O   1 
ATOM   1846 C  CB  . HIS A 1 274 ? -4.813  -20.832 -36.429 1.00 42.11  ? 796  HIS A CB  1 
ATOM   1847 C  CG  . HIS A 1 274 ? -5.122  -21.190 -37.854 1.00 45.01  ? 796  HIS A CG  1 
ATOM   1848 N  ND1 . HIS A 1 274 ? -4.843  -20.377 -38.875 1.00 46.60  ? 796  HIS A ND1 1 
ATOM   1849 C  CD2 . HIS A 1 274 ? -5.678  -22.330 -38.403 1.00 46.23  ? 796  HIS A CD2 1 
ATOM   1850 C  CE1 . HIS A 1 274 ? -5.207  -20.958 -40.018 1.00 48.18  ? 796  HIS A CE1 1 
ATOM   1851 N  NE2 . HIS A 1 274 ? -5.719  -22.155 -39.727 1.00 49.20  ? 796  HIS A NE2 1 
ATOM   1852 N  N   . PRO A 1 275 ? -1.964  -19.954 -37.851 1.00 41.14  ? 797  PRO A N   1 
ATOM   1853 C  CA  . PRO A 1 275 ? -1.148  -18.869 -38.418 1.00 40.79  ? 797  PRO A CA  1 
ATOM   1854 C  C   . PRO A 1 275 ? -1.950  -17.729 -39.045 1.00 39.93  ? 797  PRO A C   1 
ATOM   1855 O  O   . PRO A 1 275 ? -1.374  -16.735 -39.473 1.00 39.48  ? 797  PRO A O   1 
ATOM   1856 C  CB  . PRO A 1 275 ? -0.299  -19.584 -39.486 1.00 43.45  ? 797  PRO A CB  1 
ATOM   1857 C  CG  . PRO A 1 275 ? -1.137  -20.733 -39.933 1.00 44.87  ? 797  PRO A CG  1 
ATOM   1858 C  CD  . PRO A 1 275 ? -1.928  -21.160 -38.712 1.00 44.32  ? 797  PRO A CD  1 
ATOM   1859 N  N   . GLU A 1 276 ? -3.266  -17.873 -39.073 1.00 40.25  ? 798  GLU A N   1 
ATOM   1860 C  CA  . GLU A 1 276 ? -4.131  -16.976 -39.802 1.00 41.07  ? 798  GLU A CA  1 
ATOM   1861 C  C   . GLU A 1 276 ? -5.376  -16.637 -38.991 1.00 40.53  ? 798  GLU A C   1 
ATOM   1862 O  O   . GLU A 1 276 ? -6.416  -16.302 -39.549 1.00 40.94  ? 798  GLU A O   1 
ATOM   1863 C  CB  . GLU A 1 276 ? -4.494  -17.607 -41.154 1.00 44.06  ? 798  GLU A CB  1 
ATOM   1864 C  CG  . GLU A 1 276 ? -4.208  -16.712 -42.349 1.00 45.51  ? 798  GLU A CG  1 
ATOM   1865 C  CD  . GLU A 1 276 ? -2.727  -16.472 -42.587 1.00 46.02  ? 798  GLU A CD  1 
ATOM   1866 O  OE1 . GLU A 1 276 ? -2.366  -15.381 -43.060 1.00 46.37  ? 798  GLU A OE1 1 
ATOM   1867 O  OE2 . GLU A 1 276 ? -1.920  -17.375 -42.308 1.00 48.16  ? 798  GLU A OE2 1 
ATOM   1868 N  N   . LYS A 1 277 ? -5.241  -16.709 -37.671 1.00 40.57  ? 799  LYS A N   1 
ATOM   1869 C  CA  . LYS A 1 277 ? -6.242  -16.263 -36.703 1.00 40.93  ? 799  LYS A CA  1 
ATOM   1870 C  C   . LYS A 1 277 ? -5.581  -15.105 -35.916 1.00 37.60  ? 799  LYS A C   1 
ATOM   1871 O  O   . LYS A 1 277 ? -4.550  -15.291 -35.258 1.00 34.82  ? 799  LYS A O   1 
ATOM   1872 C  CB  . LYS A 1 277 ? -6.547  -17.405 -35.731 1.00 45.00  ? 799  LYS A CB  1 
ATOM   1873 C  CG  . LYS A 1 277 ? -8.000  -17.753 -35.444 1.00 47.93  ? 799  LYS A CG  1 
ATOM   1874 C  CD  . LYS A 1 277 ? -8.352  -19.135 -35.988 1.00 51.34  ? 799  LYS A CD  1 
ATOM   1875 C  CE  . LYS A 1 277 ? -8.992  -20.031 -34.933 1.00 52.91  ? 799  LYS A CE  1 
ATOM   1876 N  NZ  . LYS A 1 277 ? -9.179  -21.431 -35.428 1.00 52.22  ? 799  LYS A NZ  1 
ATOM   1877 N  N   . HIS A 1 278 ? -6.180  -13.925 -35.981 1.00 35.91  ? 800  HIS A N   1 
ATOM   1878 C  CA  . HIS A 1 278 ? -5.631  -12.706 -35.370 1.00 33.82  ? 800  HIS A CA  1 
ATOM   1879 C  C   . HIS A 1 278 ? -5.171  -12.871 -33.901 1.00 33.68  ? 800  HIS A C   1 
ATOM   1880 O  O   . HIS A 1 278 ? -4.042  -12.520 -33.563 1.00 31.86  ? 800  HIS A O   1 
ATOM   1881 C  CB  . HIS A 1 278 ? -6.664  -11.573 -35.537 1.00 32.61  ? 800  HIS A CB  1 
ATOM   1882 C  CG  . HIS A 1 278 ? -6.464  -10.406 -34.630 1.00 30.77  ? 800  HIS A CG  1 
ATOM   1883 N  ND1 . HIS A 1 278 ? -5.528  -9.427  -34.869 1.00 30.59  ? 800  HIS A ND1 1 
ATOM   1884 C  CD2 . HIS A 1 278 ? -7.105  -10.049 -33.494 1.00 29.90  ? 800  HIS A CD2 1 
ATOM   1885 C  CE1 . HIS A 1 278 ? -5.584  -8.529  -33.904 1.00 29.95  ? 800  HIS A CE1 1 
ATOM   1886 N  NE2 . HIS A 1 278 ? -6.541  -8.879  -33.063 1.00 29.61  ? 800  HIS A NE2 1 
ATOM   1887 N  N   . GLU A 1 279 ? -6.027  -13.439 -33.059 1.00 34.55  ? 801  GLU A N   1 
ATOM   1888 C  CA  . GLU A 1 279 ? -5.726  -13.633 -31.629 1.00 35.54  ? 801  GLU A CA  1 
ATOM   1889 C  C   . GLU A 1 279 ? -4.580  -14.636 -31.409 1.00 34.12  ? 801  GLU A C   1 
ATOM   1890 O  O   . GLU A 1 279 ? -3.786  -14.481 -30.496 1.00 32.65  ? 801  GLU A O   1 
ATOM   1891 C  CB  . GLU A 1 279 ? -6.982  -14.073 -30.837 1.00 38.24  ? 801  GLU A CB  1 
ATOM   1892 C  CG  . GLU A 1 279 ? -8.298  -13.340 -31.184 1.00 42.58  ? 801  GLU A CG  1 
ATOM   1893 C  CD  . GLU A 1 279 ? -9.011  -13.902 -32.431 1.00 46.53  ? 801  GLU A CD  1 
ATOM   1894 O  OE1 . GLU A 1 279 ? -9.447  -13.114 -33.307 1.00 48.68  ? 801  GLU A OE1 1 
ATOM   1895 O  OE2 . GLU A 1 279 ? -9.116  -15.141 -32.561 1.00 49.70  ? 801  GLU A OE2 1 
ATOM   1896 N  N   . ASP A 1 280 ? -4.493  -15.655 -32.261 1.00 34.55  ? 802  ASP A N   1 
ATOM   1897 C  CA  . ASP A 1 280 ? -3.393  -16.633 -32.213 1.00 33.61  ? 802  ASP A CA  1 
ATOM   1898 C  C   . ASP A 1 280 ? -2.068  -16.061 -32.721 1.00 31.87  ? 802  ASP A C   1 
ATOM   1899 O  O   . ASP A 1 280 ? -1.012  -16.396 -32.206 1.00 31.62  ? 802  ASP A O   1 
ATOM   1900 C  CB  . ASP A 1 280 ? -3.732  -17.888 -33.035 1.00 35.11  ? 802  ASP A CB  1 
ATOM   1901 C  CG  . ASP A 1 280 ? -4.875  -18.700 -32.448 1.00 34.76  ? 802  ASP A CG  1 
ATOM   1902 O  OD1 . ASP A 1 280 ? -5.432  -18.337 -31.401 1.00 35.49  ? 802  ASP A OD1 1 
ATOM   1903 O  OD2 . ASP A 1 280 ? -5.223  -19.715 -33.054 1.00 36.74  ? 802  ASP A OD2 1 
ATOM   1904 N  N   . VAL A 1 281 ? -2.137  -15.213 -33.738 1.00 30.98  ? 803  VAL A N   1 
ATOM   1905 C  CA  . VAL A 1 281 ? -0.962  -14.554 -34.289 1.00 30.78  ? 803  VAL A CA  1 
ATOM   1906 C  C   . VAL A 1 281 ? -0.374  -13.565 -33.285 1.00 29.62  ? 803  VAL A C   1 
ATOM   1907 O  O   . VAL A 1 281 ? 0.843   -13.475 -33.130 1.00 28.93  ? 803  VAL A O   1 
ATOM   1908 C  CB  . VAL A 1 281 ? -1.300  -13.829 -35.611 1.00 31.26  ? 803  VAL A CB  1 
ATOM   1909 C  CG1 . VAL A 1 281 ? -0.149  -12.973 -36.109 1.00 30.57  ? 803  VAL A CG1 1 
ATOM   1910 C  CG2 . VAL A 1 281 ? -1.682  -14.848 -36.671 1.00 34.15  ? 803  VAL A CG2 1 
ATOM   1911 N  N   . ILE A 1 282 ? -1.233  -12.810 -32.625 1.00 29.71  ? 804  ILE A N   1 
ATOM   1912 C  CA  . ILE A 1 282 ? -0.785  -11.866 -31.595 1.00 30.26  ? 804  ILE A CA  1 
ATOM   1913 C  C   . ILE A 1 282 ? -0.173  -12.644 -30.434 1.00 29.20  ? 804  ILE A C   1 
ATOM   1914 O  O   . ILE A 1 282 ? 0.867   -12.269 -29.917 1.00 29.58  ? 804  ILE A O   1 
ATOM   1915 C  CB  . ILE A 1 282 ? -1.937  -10.959 -31.090 1.00 30.85  ? 804  ILE A CB  1 
ATOM   1916 C  CG1 . ILE A 1 282 ? -2.381  -9.975  -32.168 1.00 31.93  ? 804  ILE A CG1 1 
ATOM   1917 C  CG2 . ILE A 1 282 ? -1.544  -10.208 -29.824 1.00 32.23  ? 804  ILE A CG2 1 
ATOM   1918 C  CD1 . ILE A 1 282 ? -1.358  -8.913  -32.536 1.00 33.47  ? 804  ILE A CD1 1 
ATOM   1919 N  N   . ALA A 1 283 ? -0.816  -13.737 -30.047 1.00 28.87  ? 805  ALA A N   1 
ATOM   1920 C  CA  . ALA A 1 283 ? -0.316  -14.588 -28.976 1.00 28.02  ? 805  ALA A CA  1 
ATOM   1921 C  C   . ALA A 1 283 ? 1.048   -15.150 -29.302 1.00 27.03  ? 805  ALA A C   1 
ATOM   1922 O  O   . ALA A 1 283 ? 1.962   -15.108 -28.484 1.00 25.18  ? 805  ALA A O   1 
ATOM   1923 C  CB  . ALA A 1 283 ? -1.295  -15.714 -28.704 1.00 29.12  ? 805  ALA A CB  1 
ATOM   1924 N  N   . ARG A 1 284 ? 1.163   -15.688 -30.508 1.00 28.52  ? 806  ARG A N   1 
ATOM   1925 C  CA  . ARG A 1 284 ? 2.414   -16.283 -31.014 1.00 28.60  ? 806  ARG A CA  1 
ATOM   1926 C  C   . ARG A 1 284 ? 3.560   -15.303 -31.018 1.00 28.02  ? 806  ARG A C   1 
ATOM   1927 O  O   . ARG A 1 284 ? 4.656   -15.637 -30.608 1.00 27.30  ? 806  ARG A O   1 
ATOM   1928 C  CB  . ARG A 1 284 ? 2.214   -16.790 -32.443 1.00 29.80  ? 806  ARG A CB  1 
ATOM   1929 C  CG  . ARG A 1 284 ? 3.446   -17.446 -33.049 1.00 31.17  ? 806  ARG A CG  1 
ATOM   1930 C  CD  . ARG A 1 284 ? 3.185   -17.863 -34.476 1.00 32.01  ? 806  ARG A CD  1 
ATOM   1931 N  NE  . ARG A 1 284 ? 2.354   -19.064 -34.560 1.00 32.87  ? 806  ARG A NE  1 
ATOM   1932 C  CZ  . ARG A 1 284 ? 2.793   -20.318 -34.438 1.00 33.05  ? 806  ARG A CZ  1 
ATOM   1933 N  NH1 . ARG A 1 284 ? 1.937   -21.326 -34.551 1.00 33.23  ? 806  ARG A NH1 1 
ATOM   1934 N  NH2 . ARG A 1 284 ? 4.074   -20.573 -34.196 1.00 33.18  ? 806  ARG A NH2 1 
ATOM   1935 N  N   . GLU A 1 285 ? 3.294   -14.090 -31.497 1.00 28.90  ? 807  GLU A N   1 
ATOM   1936 C  CA  . GLU A 1 285 ? 4.325   -13.069 -31.655 1.00 30.21  ? 807  GLU A CA  1 
ATOM   1937 C  C   . GLU A 1 285 ? 4.951   -12.768 -30.300 1.00 28.63  ? 807  GLU A C   1 
ATOM   1938 O  O   . GLU A 1 285 ? 6.146   -12.638 -30.184 1.00 27.87  ? 807  GLU A O   1 
ATOM   1939 C  CB  . GLU A 1 285 ? 3.718   -11.810 -32.270 1.00 33.09  ? 807  GLU A CB  1 
ATOM   1940 C  CG  . GLU A 1 285 ? 4.693   -10.850 -32.943 1.00 37.02  ? 807  GLU A CG  1 
ATOM   1941 C  CD  . GLU A 1 285 ? 5.518   -9.962  -31.979 1.00 38.79  ? 807  GLU A CD  1 
ATOM   1942 O  OE1 . GLU A 1 285 ? 6.699   -9.712  -32.334 1.00 41.46  ? 807  GLU A OE1 1 
ATOM   1943 O  OE2 . GLU A 1 285 ? 5.017   -9.499  -30.905 1.00 36.14  ? 807  GLU A OE2 1 
ATOM   1944 N  N   . LEU A 1 286 ? 4.121   -12.665 -29.273 1.00 27.76  ? 808  LEU A N   1 
ATOM   1945 C  CA  . LEU A 1 286 ? 4.599   -12.446 -27.925 1.00 27.59  ? 808  LEU A CA  1 
ATOM   1946 C  C   . LEU A 1 286 ? 5.332   -13.672 -27.373 1.00 27.09  ? 808  LEU A C   1 
ATOM   1947 O  O   . LEU A 1 286 ? 6.469   -13.563 -26.905 1.00 26.44  ? 808  LEU A O   1 
ATOM   1948 C  CB  . LEU A 1 286 ? 3.434   -12.070 -26.999 1.00 27.61  ? 808  LEU A CB  1 
ATOM   1949 C  CG  . LEU A 1 286 ? 3.703   -12.031 -25.496 1.00 26.59  ? 808  LEU A CG  1 
ATOM   1950 C  CD1 . LEU A 1 286 ? 4.771   -11.004 -25.236 1.00 27.86  ? 808  LEU A CD1 1 
ATOM   1951 C  CD2 . LEU A 1 286 ? 2.451   -11.725 -24.702 1.00 26.81  ? 808  LEU A CD2 1 
ATOM   1952 N  N   . ILE A 1 287 ? 4.682   -14.827 -27.438 1.00 26.37  ? 809  ILE A N   1 
ATOM   1953 C  CA  . ILE A 1 287 ? 5.207   -16.008 -26.767 1.00 26.87  ? 809  ILE A CA  1 
ATOM   1954 C  C   . ILE A 1 287 ? 6.548   -16.467 -27.340 1.00 27.58  ? 809  ILE A C   1 
ATOM   1955 O  O   . ILE A 1 287 ? 7.440   -16.836 -26.594 1.00 26.92  ? 809  ILE A O   1 
ATOM   1956 C  CB  . ILE A 1 287 ? 4.178   -17.159 -26.730 1.00 26.57  ? 809  ILE A CB  1 
ATOM   1957 C  CG1 . ILE A 1 287 ? 3.045   -16.801 -25.767 1.00 25.89  ? 809  ILE A CG1 1 
ATOM   1958 C  CG2 . ILE A 1 287 ? 4.817   -18.456 -26.270 1.00 26.90  ? 809  ILE A CG2 1 
ATOM   1959 C  CD1 . ILE A 1 287 ? 1.817   -17.674 -25.877 1.00 25.67  ? 809  ILE A CD1 1 
ATOM   1960 N  N   . GLU A 1 288 ? 6.707   -16.427 -28.649 1.00 30.07  ? 810  GLU A N   1 
ATOM   1961 C  CA  . GLU A 1 288 ? 7.959   -16.899 -29.243 1.00 32.35  ? 810  GLU A CA  1 
ATOM   1962 C  C   . GLU A 1 288 ? 9.155   -15.999 -28.835 1.00 31.55  ? 810  GLU A C   1 
ATOM   1963 O  O   . GLU A 1 288 ? 10.295  -16.471 -28.748 1.00 31.11  ? 810  GLU A O   1 
ATOM   1964 C  CB  . GLU A 1 288 ? 7.813   -17.117 -30.760 1.00 34.38  ? 810  GLU A CB  1 
ATOM   1965 C  CG  . GLU A 1 288 ? 7.803   -15.857 -31.596 1.00 37.39  ? 810  GLU A CG  1 
ATOM   1966 C  CD  . GLU A 1 288 ? 7.407   -16.085 -33.055 1.00 39.61  ? 810  GLU A CD  1 
ATOM   1967 O  OE1 . GLU A 1 288 ? 7.096   -17.240 -33.457 1.00 39.25  ? 810  GLU A OE1 1 
ATOM   1968 O  OE2 . GLU A 1 288 ? 7.408   -15.071 -33.793 1.00 39.63  ? 810  GLU A OE2 1 
ATOM   1969 N  N   . LYS A 1 289 ? 8.874   -14.742 -28.507 1.00 30.60  ? 811  LYS A N   1 
ATOM   1970 C  CA  . LYS A 1 289 ? 9.898   -13.837 -27.975 1.00 31.40  ? 811  LYS A CA  1 
ATOM   1971 C  C   . LYS A 1 289 ? 10.188  -14.068 -26.486 1.00 29.39  ? 811  LYS A C   1 
ATOM   1972 O  O   . LYS A 1 289 ? 11.333  -14.022 -26.074 1.00 28.45  ? 811  LYS A O   1 
ATOM   1973 C  CB  . LYS A 1 289 ? 9.522   -12.370 -28.246 1.00 32.63  ? 811  LYS A CB  1 
ATOM   1974 C  CG  . LYS A 1 289 ? 9.985   -11.922 -29.617 1.00 35.16  ? 811  LYS A CG  1 
ATOM   1975 C  CD  . LYS A 1 289 ? 9.242   -10.707 -30.139 1.00 37.54  ? 811  LYS A CD  1 
ATOM   1976 C  CE  . LYS A 1 289 ? 9.686   -10.419 -31.577 1.00 40.67  ? 811  LYS A CE  1 
ATOM   1977 N  NZ  . LYS A 1 289 ? 9.493   -9.004  -31.985 1.00 41.12  ? 811  LYS A NZ  1 
ATOM   1978 N  N   . MET A 1 290 ? 9.147   -14.340 -25.701 1.00 27.68  ? 812  MET A N   1 
ATOM   1979 C  CA  . MET A 1 290 ? 9.296   -14.645 -24.293 1.00 26.62  ? 812  MET A CA  1 
ATOM   1980 C  C   . MET A 1 290 ? 10.116  -15.913 -24.062 1.00 26.97  ? 812  MET A C   1 
ATOM   1981 O  O   . MET A 1 290 ? 10.814  -16.005 -23.068 1.00 26.71  ? 812  MET A O   1 
ATOM   1982 C  CB  . MET A 1 290 ? 7.940   -14.822 -23.631 1.00 26.00  ? 812  MET A CB  1 
ATOM   1983 C  CG  . MET A 1 290 ? 7.043   -13.593 -23.678 1.00 25.81  ? 812  MET A CG  1 
ATOM   1984 S  SD  . MET A 1 290 ? 5.427   -13.804 -22.914 1.00 23.99  ? 812  MET A SD  1 
ATOM   1985 C  CE  . MET A 1 290 ? 5.893   -13.897 -21.194 1.00 24.33  ? 812  MET A CE  1 
ATOM   1986 N  N   . ILE A 1 291 ? 10.020  -16.883 -24.970 1.00 27.69  ? 813  ILE A N   1 
ATOM   1987 C  CA  . ILE A 1 291 ? 10.751  -18.136 -24.840 1.00 28.52  ? 813  ILE A CA  1 
ATOM   1988 C  C   . ILE A 1 291 ? 11.945  -18.224 -25.779 1.00 29.68  ? 813  ILE A C   1 
ATOM   1989 O  O   . ILE A 1 291 ? 12.467  -19.314 -26.031 1.00 30.47  ? 813  ILE A O   1 
ATOM   1990 C  CB  . ILE A 1 291 ? 9.846   -19.374 -25.049 1.00 28.65  ? 813  ILE A CB  1 
ATOM   1991 C  CG1 . ILE A 1 291 ? 9.431   -19.538 -26.513 1.00 29.00  ? 813  ILE A CG1 1 
ATOM   1992 C  CG2 . ILE A 1 291 ? 8.644   -19.333 -24.116 1.00 27.59  ? 813  ILE A CG2 1 
ATOM   1993 C  CD1 . ILE A 1 291 ? 8.491   -20.693 -26.732 1.00 29.21  ? 813  ILE A CD1 1 
ATOM   1994 N  N   . ALA A 1 292 ? 12.389  -17.080 -26.279 1.00 30.38  ? 814  ALA A N   1 
ATOM   1995 C  CA  . ALA A 1 292 ? 13.581  -17.030 -27.120 1.00 32.35  ? 814  ALA A CA  1 
ATOM   1996 C  C   . ALA A 1 292 ? 14.784  -17.684 -26.454 1.00 33.50  ? 814  ALA A C   1 
ATOM   1997 O  O   . ALA A 1 292 ? 14.991  -17.590 -25.236 1.00 31.40  ? 814  ALA A O   1 
ATOM   1998 C  CB  . ALA A 1 292 ? 13.913  -15.593 -27.484 1.00 32.22  ? 814  ALA A CB  1 
ATOM   1999 N  N   . MET A 1 293 ? 15.585  -18.339 -27.278 1.00 37.72  ? 815  MET A N   1 
ATOM   2000 C  CA  . MET A 1 293 ? 16.768  -19.035 -26.795 1.00 40.43  ? 815  MET A CA  1 
ATOM   2001 C  C   . MET A 1 293 ? 17.826  -18.025 -26.360 1.00 38.71  ? 815  MET A C   1 
ATOM   2002 O  O   . MET A 1 293 ? 18.471  -18.219 -25.349 1.00 36.76  ? 815  MET A O   1 
ATOM   2003 C  CB  . MET A 1 293 ? 17.305  -19.993 -27.852 1.00 44.95  ? 815  MET A CB  1 
ATOM   2004 C  CG  . MET A 1 293 ? 17.624  -21.359 -27.275 1.00 51.34  ? 815  MET A CG  1 
ATOM   2005 S  SD  . MET A 1 293 ? 16.129  -22.353 -27.039 1.00 56.04  ? 815  MET A SD  1 
ATOM   2006 C  CE  . MET A 1 293 ? 15.498  -22.038 -25.415 1.00 57.41  ? 815  MET A CE  1 
ATOM   2007 N  N   . ASP A 1 294 ? 17.956  -16.941 -27.122 1.00 38.95  ? 816  ASP A N   1 
ATOM   2008 C  CA  . ASP A 1 294 ? 18.828  -15.834 -26.784 1.00 39.32  ? 816  ASP A CA  1 
ATOM   2009 C  C   . ASP A 1 294 ? 18.119  -14.991 -25.757 1.00 37.32  ? 816  ASP A C   1 
ATOM   2010 O  O   . ASP A 1 294 ? 17.112  -14.392 -26.074 1.00 34.47  ? 816  ASP A O   1 
ATOM   2011 C  CB  . ASP A 1 294 ? 19.143  -14.984 -28.020 1.00 41.58  ? 816  ASP A CB  1 
ATOM   2012 C  CG  . ASP A 1 294 ? 20.182  -13.897 -27.745 1.00 44.06  ? 816  ASP A CG  1 
ATOM   2013 O  OD1 . ASP A 1 294 ? 20.591  -13.700 -26.579 1.00 43.86  ? 816  ASP A OD1 1 
ATOM   2014 O  OD2 . ASP A 1 294 ? 20.594  -13.229 -28.713 1.00 46.82  ? 816  ASP A OD2 1 
ATOM   2015 N  N   . PRO A 1 295 ? 18.650  -14.936 -24.519 1.00 37.59  ? 817  PRO A N   1 
ATOM   2016 C  CA  . PRO A 1 295 ? 18.002  -14.206 -23.448 1.00 36.61  ? 817  PRO A CA  1 
ATOM   2017 C  C   . PRO A 1 295 ? 17.785  -12.724 -23.742 1.00 37.00  ? 817  PRO A C   1 
ATOM   2018 O  O   . PRO A 1 295 ? 16.814  -12.148 -23.282 1.00 34.38  ? 817  PRO A O   1 
ATOM   2019 C  CB  . PRO A 1 295 ? 18.977  -14.372 -22.273 1.00 37.25  ? 817  PRO A CB  1 
ATOM   2020 C  CG  . PRO A 1 295 ? 19.768  -15.571 -22.599 1.00 37.71  ? 817  PRO A CG  1 
ATOM   2021 C  CD  . PRO A 1 295 ? 19.926  -15.512 -24.072 1.00 38.11  ? 817  PRO A CD  1 
ATOM   2022 N  N   . GLN A 1 296 ? 18.683  -12.113 -24.498 1.00 40.73  ? 818  GLN A N   1 
ATOM   2023 C  CA  . GLN A 1 296 ? 18.567  -10.683 -24.779 1.00 43.92  ? 818  GLN A CA  1 
ATOM   2024 C  C   . GLN A 1 296 ? 17.434  -10.329 -25.736 1.00 41.67  ? 818  GLN A C   1 
ATOM   2025 O  O   . GLN A 1 296 ? 17.074  -9.172  -25.828 1.00 41.99  ? 818  GLN A O   1 
ATOM   2026 C  CB  . GLN A 1 296 ? 19.897  -10.119 -25.298 1.00 50.11  ? 818  GLN A CB  1 
ATOM   2027 C  CG  . GLN A 1 296 ? 20.895  -9.799  -24.186 1.00 53.61  ? 818  GLN A CG  1 
ATOM   2028 C  CD  . GLN A 1 296 ? 22.204  -9.274  -24.735 1.00 57.73  ? 818  GLN A CD  1 
ATOM   2029 O  OE1 . GLN A 1 296 ? 22.837  -9.924  -25.562 1.00 60.92  ? 818  GLN A OE1 1 
ATOM   2030 N  NE2 . GLN A 1 296 ? 22.610  -8.089  -24.290 1.00 58.97  ? 818  GLN A NE2 1 
ATOM   2031 N  N   . LYS A 1 297 ? 16.869  -11.318 -26.425 1.00 40.53  ? 819  LYS A N   1 
ATOM   2032 C  CA  . LYS A 1 297 ? 15.724  -11.096 -27.319 1.00 40.19  ? 819  LYS A CA  1 
ATOM   2033 C  C   . LYS A 1 297 ? 14.390  -11.152 -26.609 1.00 36.35  ? 819  LYS A C   1 
ATOM   2034 O  O   . LYS A 1 297 ? 13.391  -10.833 -27.195 1.00 35.18  ? 819  LYS A O   1 
ATOM   2035 C  CB  . LYS A 1 297 ? 15.715  -12.100 -28.479 1.00 43.08  ? 819  LYS A CB  1 
ATOM   2036 C  CG  . LYS A 1 297 ? 16.644  -11.735 -29.628 1.00 47.15  ? 819  LYS A CG  1 
ATOM   2037 C  CD  . LYS A 1 297 ? 16.382  -12.606 -30.853 1.00 51.11  ? 819  LYS A CD  1 
ATOM   2038 C  CE  . LYS A 1 297 ? 17.683  -13.082 -31.479 1.00 56.54  ? 819  LYS A CE  1 
ATOM   2039 N  NZ  . LYS A 1 297 ? 17.461  -14.270 -32.338 1.00 59.67  ? 819  LYS A NZ  1 
ATOM   2040 N  N   . ARG A 1 298 ? 14.384  -11.560 -25.346 1.00 34.75  ? 820  ARG A N   1 
ATOM   2041 C  CA  . ARG A 1 298 ? 13.163  -11.652 -24.554 1.00 32.31  ? 820  ARG A CA  1 
ATOM   2042 C  C   . ARG A 1 298 ? 12.781  -10.285 -23.984 1.00 30.88  ? 820  ARG A C   1 
ATOM   2043 O  O   . ARG A 1 298 ? 13.615  -9.580  -23.482 1.00 30.96  ? 820  ARG A O   1 
ATOM   2044 C  CB  . ARG A 1 298 ? 13.340  -12.661 -23.402 1.00 31.66  ? 820  ARG A CB  1 
ATOM   2045 C  CG  . ARG A 1 298 ? 13.741  -14.062 -23.845 1.00 31.75  ? 820  ARG A CG  1 
ATOM   2046 C  CD  . ARG A 1 298 ? 13.959  -15.003 -22.679 1.00 31.35  ? 820  ARG A CD  1 
ATOM   2047 N  NE  . ARG A 1 298 ? 14.884  -16.088 -23.028 1.00 32.08  ? 820  ARG A NE  1 
ATOM   2048 C  CZ  . ARG A 1 298 ? 15.637  -16.765 -22.158 1.00 31.39  ? 820  ARG A CZ  1 
ATOM   2049 N  NH1 . ARG A 1 298 ? 15.561  -16.496 -20.860 1.00 29.96  ? 820  ARG A NH1 1 
ATOM   2050 N  NH2 . ARG A 1 298 ? 16.477  -17.712 -22.598 1.00 31.95  ? 820  ARG A NH2 1 
ATOM   2051 N  N   . PRO A 1 299 ? 11.502  -9.917  -24.056 1.00 29.71  ? 821  PRO A N   1 
ATOM   2052 C  CA  . PRO A 1 299 ? 11.078  -8.644  -23.507 1.00 29.10  ? 821  PRO A CA  1 
ATOM   2053 C  C   . PRO A 1 299 ? 11.038  -8.674  -21.975 1.00 28.83  ? 821  PRO A C   1 
ATOM   2054 O  O   . PRO A 1 299 ? 10.832  -9.716  -21.388 1.00 28.32  ? 821  PRO A O   1 
ATOM   2055 C  CB  . PRO A 1 299 ? 9.674   -8.507  -24.061 1.00 28.13  ? 821  PRO A CB  1 
ATOM   2056 C  CG  . PRO A 1 299 ? 9.178   -9.898  -24.120 1.00 28.04  ? 821  PRO A CG  1 
ATOM   2057 C  CD  . PRO A 1 299 ? 10.357  -10.742 -24.475 1.00 28.76  ? 821  PRO A CD  1 
ATOM   2058 N  N   . SER A 1 300 ? 11.244  -7.540  -21.332 1.00 28.69  ? 822  SER A N   1 
ATOM   2059 C  CA  . SER A 1 300 ? 11.067  -7.462  -19.892 1.00 28.44  ? 822  SER A CA  1 
ATOM   2060 C  C   . SER A 1 300 ? 9.589   -7.591  -19.552 1.00 27.24  ? 822  SER A C   1 
ATOM   2061 O  O   . SER A 1 300 ? 8.729   -7.441  -20.423 1.00 26.01  ? 822  SER A O   1 
ATOM   2062 C  CB  . SER A 1 300 ? 11.590  -6.138  -19.350 1.00 29.09  ? 822  SER A CB  1 
ATOM   2063 O  OG  . SER A 1 300 ? 10.729  -5.086  -19.702 1.00 29.36  ? 822  SER A OG  1 
ATOM   2064 N  N   . ALA A 1 301 ? 9.312   -7.868  -18.285 1.00 26.74  ? 823  ALA A N   1 
ATOM   2065 C  CA  . ALA A 1 301 ? 7.946   -7.980  -17.799 1.00 27.54  ? 823  ALA A CA  1 
ATOM   2066 C  C   . ALA A 1 301 ? 7.084   -6.769  -18.171 1.00 28.34  ? 823  ALA A C   1 
ATOM   2067 O  O   . ALA A 1 301 ? 5.928   -6.939  -18.553 1.00 27.65  ? 823  ALA A O   1 
ATOM   2068 C  CB  . ALA A 1 301 ? 7.919   -8.217  -16.295 1.00 27.14  ? 823  ALA A CB  1 
ATOM   2069 N  N   . LYS A 1 302 ? 7.649   -5.565  -18.088 1.00 29.70  ? 824  LYS A N   1 
ATOM   2070 C  CA  . LYS A 1 302 ? 6.905   -4.345  -18.443 1.00 30.78  ? 824  LYS A CA  1 
ATOM   2071 C  C   . LYS A 1 302 ? 6.600   -4.209  -19.942 1.00 29.58  ? 824  LYS A C   1 
ATOM   2072 O  O   . LYS A 1 302 ? 5.532   -3.692  -20.311 1.00 28.09  ? 824  LYS A O   1 
ATOM   2073 C  CB  . LYS A 1 302 ? 7.597   -3.104  -17.881 1.00 33.17  ? 824  LYS A CB  1 
ATOM   2074 C  CG  . LYS A 1 302 ? 7.331   -2.964  -16.385 1.00 35.55  ? 824  LYS A CG  1 
ATOM   2075 C  CD  . LYS A 1 302 ? 7.973   -1.742  -15.766 1.00 39.09  ? 824  LYS A CD  1 
ATOM   2076 C  CE  . LYS A 1 302 ? 7.418   -1.488  -14.378 1.00 41.17  ? 824  LYS A CE  1 
ATOM   2077 N  NZ  . LYS A 1 302 ? 8.320   -0.592  -13.617 1.00 44.12  ? 824  LYS A NZ  1 
ATOM   2078 N  N   . HIS A 1 303 ? 7.508   -4.687  -20.789 1.00 29.43  ? 825  HIS A N   1 
ATOM   2079 C  CA  . HIS A 1 303 ? 7.240   -4.777  -22.231 1.00 30.30  ? 825  HIS A CA  1 
ATOM   2080 C  C   . HIS A 1 303 ? 6.075   -5.732  -22.486 1.00 26.72  ? 825  HIS A C   1 
ATOM   2081 O  O   . HIS A 1 303 ? 5.169   -5.427  -23.253 1.00 23.73  ? 825  HIS A O   1 
ATOM   2082 C  CB  . HIS A 1 303 ? 8.485   -5.225  -23.040 1.00 32.91  ? 825  HIS A CB  1 
ATOM   2083 C  CG  . HIS A 1 303 ? 9.602   -4.212  -23.095 1.00 36.99  ? 825  HIS A CG  1 
ATOM   2084 N  ND1 . HIS A 1 303 ? 10.693  -4.252  -22.247 1.00 38.97  ? 825  HIS A ND1 1 
ATOM   2085 C  CD2 . HIS A 1 303 ? 9.820   -3.161  -23.926 1.00 39.06  ? 825  HIS A CD2 1 
ATOM   2086 C  CE1 . HIS A 1 303 ? 11.520  -3.263  -22.540 1.00 39.46  ? 825  HIS A CE1 1 
ATOM   2087 N  NE2 . HIS A 1 303 ? 11.013  -2.586  -23.555 1.00 39.10  ? 825  HIS A NE2 1 
ATOM   2088 N  N   . VAL A 1 304 ? 6.093   -6.872  -21.801 1.00 26.59  ? 826  VAL A N   1 
ATOM   2089 C  CA  . VAL A 1 304 ? 5.034   -7.893  -21.919 1.00 25.24  ? 826  VAL A CA  1 
ATOM   2090 C  C   . VAL A 1 304 ? 3.651   -7.339  -21.532 1.00 24.73  ? 826  VAL A C   1 
ATOM   2091 O  O   . VAL A 1 304 ? 2.639   -7.602  -22.202 1.00 22.76  ? 826  VAL A O   1 
ATOM   2092 C  CB  . VAL A 1 304 ? 5.368   -9.154  -21.081 1.00 25.01  ? 826  VAL A CB  1 
ATOM   2093 C  CG1 . VAL A 1 304 ? 4.263   -10.183 -21.167 1.00 24.60  ? 826  VAL A CG1 1 
ATOM   2094 C  CG2 . VAL A 1 304 ? 6.649   -9.795  -21.557 1.00 26.15  ? 826  VAL A CG2 1 
ATOM   2095 N  N   . LEU A 1 305 ? 3.616   -6.553  -20.459 1.00 26.01  ? 827  LEU A N   1 
ATOM   2096 C  CA  . LEU A 1 305 ? 2.373   -5.926  -20.017 1.00 26.67  ? 827  LEU A CA  1 
ATOM   2097 C  C   . LEU A 1 305 ? 1.771   -4.977  -21.074 1.00 27.52  ? 827  LEU A C   1 
ATOM   2098 O  O   . LEU A 1 305 ? 0.546   -4.774  -21.110 1.00 25.98  ? 827  LEU A O   1 
ATOM   2099 C  CB  . LEU A 1 305 ? 2.594   -5.171  -18.725 1.00 26.65  ? 827  LEU A CB  1 
ATOM   2100 C  CG  . LEU A 1 305 ? 2.704   -6.006  -17.475 1.00 27.89  ? 827  LEU A CG  1 
ATOM   2101 C  CD1 . LEU A 1 305 ? 3.135   -5.128  -16.312 1.00 30.19  ? 827  LEU A CD1 1 
ATOM   2102 C  CD2 . LEU A 1 305 ? 1.395   -6.681  -17.144 1.00 27.94  ? 827  LEU A CD2 1 
ATOM   2103 N  N   . LYS A 1 306 ? 2.640   -4.415  -21.930 1.00 27.45  ? 828  LYS A N   1 
ATOM   2104 C  CA  . LYS A 1 306 ? 2.217   -3.500  -22.997 1.00 27.08  ? 828  LYS A CA  1 
ATOM   2105 C  C   . LYS A 1 306 ? 1.800   -4.138  -24.332 1.00 24.97  ? 828  LYS A C   1 
ATOM   2106 O  O   . LYS A 1 306 ? 1.181   -3.466  -25.166 1.00 24.40  ? 828  LYS A O   1 
ATOM   2107 C  CB  . LYS A 1 306 ? 3.309   -2.451  -23.225 1.00 28.96  ? 828  LYS A CB  1 
ATOM   2108 C  CG  . LYS A 1 306 ? 3.469   -1.471  -22.072 1.00 29.82  ? 828  LYS A CG  1 
ATOM   2109 C  CD  . LYS A 1 306 ? 2.334   -0.472  -22.033 1.00 30.34  ? 828  LYS A CD  1 
ATOM   2110 C  CE  . LYS A 1 306 ? 2.542   0.545   -20.938 1.00 32.04  ? 828  LYS A CE  1 
ATOM   2111 N  NZ  . LYS A 1 306 ? 1.475   1.579   -20.962 1.00 33.15  ? 828  LYS A NZ  1 
ATOM   2112 N  N   . HIS A 1 307 ? 2.088   -5.428  -24.504 1.00 23.91  ? 829  HIS A N   1 
ATOM   2113 C  CA  . HIS A 1 307 ? 1.801   -6.169  -25.741 1.00 23.31  ? 829  HIS A CA  1 
ATOM   2114 C  C   . HIS A 1 307 ? 0.294   -6.273  -26.061 1.00 23.33  ? 829  HIS A C   1 
ATOM   2115 O  O   . HIS A 1 307 ? -0.517  -6.334  -25.153 1.00 22.87  ? 829  HIS A O   1 
ATOM   2116 C  CB  . HIS A 1 307 ? 2.393   -7.580  -25.633 1.00 23.50  ? 829  HIS A CB  1 
ATOM   2117 C  CG  . HIS A 1 307 ? 2.630   -8.250  -26.951 1.00 22.67  ? 829  HIS A CG  1 
ATOM   2118 N  ND1 . HIS A 1 307 ? 1.644   -8.921  -27.629 1.00 22.02  ? 829  HIS A ND1 1 
ATOM   2119 C  CD2 . HIS A 1 307 ? 3.737   -8.338  -27.719 1.00 23.09  ? 829  HIS A CD2 1 
ATOM   2120 C  CE1 . HIS A 1 307 ? 2.122   -9.378  -28.767 1.00 22.60  ? 829  HIS A CE1 1 
ATOM   2121 N  NE2 . HIS A 1 307 ? 3.397   -9.054  -28.841 1.00 23.42  ? 829  HIS A NE2 1 
ATOM   2122 N  N   . PRO A 1 308 ? -0.081  -6.295  -27.357 1.00 23.81  ? 830  PRO A N   1 
ATOM   2123 C  CA  . PRO A 1 308 ? -1.494  -6.350  -27.743 1.00 24.70  ? 830  PRO A CA  1 
ATOM   2124 C  C   . PRO A 1 308 ? -2.260  -7.606  -27.309 1.00 25.37  ? 830  PRO A C   1 
ATOM   2125 O  O   . PRO A 1 308 ? -3.480  -7.622  -27.289 1.00 25.31  ? 830  PRO A O   1 
ATOM   2126 C  CB  . PRO A 1 308 ? -1.453  -6.206  -29.267 1.00 25.09  ? 830  PRO A CB  1 
ATOM   2127 C  CG  . PRO A 1 308 ? -0.044  -6.449  -29.661 1.00 25.22  ? 830  PRO A CG  1 
ATOM   2128 C  CD  . PRO A 1 308 ? 0.764   -5.965  -28.513 1.00 24.78  ? 830  PRO A CD  1 
ATOM   2129 N  N   . PHE A 1 309 ? -1.533  -8.636  -26.931 1.00 26.44  ? 831  PHE A N   1 
ATOM   2130 C  CA  . PHE A 1 309 ? -2.090  -9.800  -26.308 1.00 26.55  ? 831  PHE A CA  1 
ATOM   2131 C  C   . PHE A 1 309 ? -3.068  -9.421  -25.233 1.00 26.00  ? 831  PHE A C   1 
ATOM   2132 O  O   . PHE A 1 309 ? -4.068  -10.088 -25.082 1.00 27.06  ? 831  PHE A O   1 
ATOM   2133 C  CB  . PHE A 1 309 ? -0.950  -10.593 -25.699 1.00 27.89  ? 831  PHE A CB  1 
ATOM   2134 C  CG  . PHE A 1 309 ? -1.364  -11.887 -25.067 1.00 27.15  ? 831  PHE A CG  1 
ATOM   2135 C  CD1 . PHE A 1 309 ? -1.836  -12.917 -25.841 1.00 27.01  ? 831  PHE A CD1 1 
ATOM   2136 C  CD2 . PHE A 1 309 ? -1.188  -12.086 -23.714 1.00 27.40  ? 831  PHE A CD2 1 
ATOM   2137 C  CE1 . PHE A 1 309 ? -2.187  -14.110 -25.282 1.00 27.85  ? 831  PHE A CE1 1 
ATOM   2138 C  CE2 . PHE A 1 309 ? -1.524  -13.285 -23.139 1.00 28.28  ? 831  PHE A CE2 1 
ATOM   2139 C  CZ  . PHE A 1 309 ? -2.027  -14.302 -23.927 1.00 28.30  ? 831  PHE A CZ  1 
ATOM   2140 N  N   . PHE A 1 310 ? -2.760  -8.357  -24.489 1.00 25.98  ? 832  PHE A N   1 
ATOM   2141 C  CA  . PHE A 1 310 ? -3.598  -7.882  -23.379 1.00 25.48  ? 832  PHE A CA  1 
ATOM   2142 C  C   . PHE A 1 310 ? -4.620  -6.784  -23.723 1.00 26.17  ? 832  PHE A C   1 
ATOM   2143 O  O   . PHE A 1 310 ? -5.403  -6.398  -22.855 1.00 25.30  ? 832  PHE A O   1 
ATOM   2144 C  CB  . PHE A 1 310 ? -2.712  -7.408  -22.212 1.00 25.18  ? 832  PHE A CB  1 
ATOM   2145 C  CG  . PHE A 1 310 ? -1.871  -8.500  -21.607 1.00 24.46  ? 832  PHE A CG  1 
ATOM   2146 C  CD1 . PHE A 1 310 ? -2.467  -9.555  -20.914 1.00 24.18  ? 832  PHE A CD1 1 
ATOM   2147 C  CD2 . PHE A 1 310 ? -0.497  -8.489  -21.731 1.00 24.24  ? 832  PHE A CD2 1 
ATOM   2148 C  CE1 . PHE A 1 310 ? -1.702  -10.563 -20.359 1.00 23.61  ? 832  PHE A CE1 1 
ATOM   2149 C  CE2 . PHE A 1 310 ? 0.271   -9.507  -21.179 1.00 24.04  ? 832  PHE A CE2 1 
ATOM   2150 C  CZ  . PHE A 1 310 ? -0.334  -10.536 -20.488 1.00 23.40  ? 832  PHE A CZ  1 
ATOM   2151 N  N   . TRP A 1 311 ? -4.646  -6.296  -24.968 1.00 27.65  ? 833  TRP A N   1 
ATOM   2152 C  CA  . TRP A 1 311 ? -5.560  -5.185  -25.330 1.00 28.24  ? 833  TRP A CA  1 
ATOM   2153 C  C   . TRP A 1 311 ? -6.973  -5.615  -25.607 1.00 26.96  ? 833  TRP A C   1 
ATOM   2154 O  O   . TRP A 1 311 ? -7.197  -6.568  -26.300 1.00 27.41  ? 833  TRP A O   1 
ATOM   2155 C  CB  . TRP A 1 311 ? -5.088  -4.375  -26.549 1.00 27.89  ? 833  TRP A CB  1 
ATOM   2156 C  CG  . TRP A 1 311 ? -3.688  -3.860  -26.474 1.00 27.30  ? 833  TRP A CG  1 
ATOM   2157 C  CD1 . TRP A 1 311 ? -2.872  -3.856  -25.398 1.00 26.41  ? 833  TRP A CD1 1 
ATOM   2158 C  CD2 . TRP A 1 311 ? -2.951  -3.272  -27.541 1.00 27.18  ? 833  TRP A CD2 1 
ATOM   2159 N  NE1 . TRP A 1 311 ? -1.662  -3.333  -25.726 1.00 26.42  ? 833  TRP A NE1 1 
ATOM   2160 C  CE2 . TRP A 1 311 ? -1.680  -2.961  -27.041 1.00 27.30  ? 833  TRP A CE2 1 
ATOM   2161 C  CE3 . TRP A 1 311 ? -3.242  -2.983  -28.876 1.00 27.85  ? 833  TRP A CE3 1 
ATOM   2162 C  CZ2 . TRP A 1 311 ? -0.686  -2.373  -27.830 1.00 27.63  ? 833  TRP A CZ2 1 
ATOM   2163 C  CZ3 . TRP A 1 311 ? -2.259  -2.388  -29.658 1.00 28.56  ? 833  TRP A CZ3 1 
ATOM   2164 C  CH2 . TRP A 1 311 ? -0.991  -2.100  -29.130 1.00 27.65  ? 833  TRP A CH2 1 
ATOM   2165 N  N   . SER A 1 312 ? -7.921  -4.854  -25.081 1.00 27.99  ? 834  SER A N   1 
ATOM   2166 C  CA  . SER A 1 312 ? -9.317  -4.965  -25.476 1.00 28.67  ? 834  SER A CA  1 
ATOM   2167 C  C   . SER A 1 312 ? -9.485  -4.619  -26.942 1.00 28.69  ? 834  SER A C   1 
ATOM   2168 O  O   . SER A 1 312 ? -8.635  -4.003  -27.543 1.00 27.24  ? 834  SER A O   1 
ATOM   2169 C  CB  . SER A 1 312 ? -10.178 -4.008  -24.665 1.00 28.71  ? 834  SER A CB  1 
ATOM   2170 O  OG  . SER A 1 312 ? -9.871  -2.656  -24.984 1.00 30.21  ? 834  SER A OG  1 
ATOM   2171 N  N   . LEU A 1 313 ? -10.625 -4.991  -27.497 1.00 31.00  ? 835  LEU A N   1 
ATOM   2172 C  CA  . LEU A 1 313 ? -10.933 -4.662  -28.876 1.00 30.32  ? 835  LEU A CA  1 
ATOM   2173 C  C   . LEU A 1 313 ? -10.928 -3.162  -29.110 1.00 29.54  ? 835  LEU A C   1 
ATOM   2174 O  O   . LEU A 1 313 ? -10.390 -2.726  -30.114 1.00 28.47  ? 835  LEU A O   1 
ATOM   2175 C  CB  . LEU A 1 313 ? -12.261 -5.284  -29.300 1.00 31.57  ? 835  LEU A CB  1 
ATOM   2176 C  CG  . LEU A 1 313 ? -12.321 -6.817  -29.315 1.00 32.19  ? 835  LEU A CG  1 
ATOM   2177 C  CD1 . LEU A 1 313 ? -13.674 -7.241  -29.862 1.00 33.65  ? 835  LEU A CD1 1 
ATOM   2178 C  CD2 . LEU A 1 313 ? -11.186 -7.446  -30.113 1.00 31.16  ? 835  LEU A CD2 1 
ATOM   2179 N  N   . GLU A 1 314 ? -11.483 -2.363  -28.195 1.00 30.64  ? 836  GLU A N   1 
ATOM   2180 C  CA  . GLU A 1 314 ? -11.471 -0.894  -28.390 1.00 31.70  ? 836  GLU A CA  1 
ATOM   2181 C  C   . GLU A 1 314 ? -10.052 -0.292  -28.375 1.00 30.30  ? 836  GLU A C   1 
ATOM   2182 O  O   . GLU A 1 314 ? -9.771  0.653   -29.120 1.00 29.42  ? 836  GLU A O   1 
ATOM   2183 C  CB  . GLU A 1 314 ? -12.439 -0.132  -27.462 1.00 32.81  ? 836  GLU A CB  1 
ATOM   2184 C  CG  . GLU A 1 314 ? -12.093 -0.082  -25.972 1.00 34.96  ? 836  GLU A CG  1 
ATOM   2185 C  CD  . GLU A 1 314 ? -13.032 0.832   -25.161 1.00 36.42  ? 836  GLU A CD  1 
ATOM   2186 O  OE1 . GLU A 1 314 ? -12.997 0.733   -23.915 1.00 35.63  ? 836  GLU A OE1 1 
ATOM   2187 O  OE2 . GLU A 1 314 ? -13.789 1.648   -25.761 1.00 36.15  ? 836  GLU A OE2 1 
ATOM   2188 N  N   . LYS A 1 315 ? -9.157  -0.857  -27.573 1.00 29.09  ? 837  LYS A N   1 
ATOM   2189 C  CA  . LYS A 1 315 ? -7.785  -0.364  -27.534 1.00 28.67  ? 837  LYS A CA  1 
ATOM   2190 C  C   . LYS A 1 315 ? -7.023  -0.710  -28.811 1.00 27.30  ? 837  LYS A C   1 
ATOM   2191 O  O   . LYS A 1 315 ? -6.255  0.101   -29.295 1.00 26.41  ? 837  LYS A O   1 
ATOM   2192 C  CB  . LYS A 1 315 ? -7.032  -0.896  -26.321 1.00 29.25  ? 837  LYS A CB  1 
ATOM   2193 C  CG  . LYS A 1 315 ? -5.575  -0.449  -26.247 1.00 29.36  ? 837  LYS A CG  1 
ATOM   2194 C  CD  . LYS A 1 315 ? -4.961  -0.823  -24.920 1.00 30.09  ? 837  LYS A CD  1 
ATOM   2195 C  CE  . LYS A 1 315 ? -3.548  -0.282  -24.819 1.00 31.50  ? 837  LYS A CE  1 
ATOM   2196 N  NZ  . LYS A 1 315 ? -3.006  -0.388  -23.445 1.00 30.87  ? 837  LYS A NZ  1 
ATOM   2197 N  N   . GLN A 1 316 ? -7.237  -1.908  -29.334 1.00 26.39  ? 838  GLN A N   1 
ATOM   2198 C  CA  . GLN A 1 316 ? -6.715  -2.283  -30.652 1.00 26.93  ? 838  GLN A CA  1 
ATOM   2199 C  C   . GLN A 1 316 ? -7.179  -1.324  -31.750 1.00 27.11  ? 838  GLN A C   1 
ATOM   2200 O  O   . GLN A 1 316 ? -6.385  -0.875  -32.580 1.00 27.61  ? 838  GLN A O   1 
ATOM   2201 C  CB  . GLN A 1 316 ? -7.137  -3.695  -31.031 1.00 26.80  ? 838  GLN A CB  1 
ATOM   2202 C  CG  . GLN A 1 316 ? -6.557  -4.786  -30.150 1.00 26.97  ? 838  GLN A CG  1 
ATOM   2203 C  CD  . GLN A 1 316 ? -7.164  -6.140  -30.454 1.00 26.65  ? 838  GLN A CD  1 
ATOM   2204 O  OE1 . GLN A 1 316 ? -7.339  -6.509  -31.609 1.00 27.97  ? 838  GLN A OE1 1 
ATOM   2205 N  NE2 . GLN A 1 316 ? -7.478  -6.879  -29.426 1.00 26.37  ? 838  GLN A NE2 1 
ATOM   2206 N  N   . LEU A 1 317 ? -8.461  -1.009  -31.743 1.00 26.00  ? 839  LEU A N   1 
ATOM   2207 C  CA  . LEU A 1 317 ? -8.985  -0.072  -32.694 1.00 26.20  ? 839  LEU A CA  1 
ATOM   2208 C  C   . LEU A 1 317 ? -8.351  1.289   -32.471 1.00 25.52  ? 839  LEU A C   1 
ATOM   2209 O  O   . LEU A 1 317 ? -7.968  1.947   -33.421 1.00 26.38  ? 839  LEU A O   1 
ATOM   2210 C  CB  . LEU A 1 317 ? -10.517 0.006   -32.613 1.00 26.41  ? 839  LEU A CB  1 
ATOM   2211 C  CG  . LEU A 1 317 ? -11.158 1.006   -33.559 1.00 26.93  ? 839  LEU A CG  1 
ATOM   2212 C  CD1 . LEU A 1 317 ? -10.775 0.695   -34.996 1.00 27.11  ? 839  LEU A CD1 1 
ATOM   2213 C  CD2 . LEU A 1 317 ? -12.657 0.967   -33.370 1.00 28.00  ? 839  LEU A CD2 1 
ATOM   2214 N  N   . GLN A 1 318 ? -8.218  1.704   -31.223 1.00 25.01  ? 840  GLN A N   1 
ATOM   2215 C  CA  . GLN A 1 318 ? -7.601  2.992   -30.934 1.00 25.41  ? 840  GLN A CA  1 
ATOM   2216 C  C   . GLN A 1 318 ? -6.148  3.035   -31.383 1.00 24.97  ? 840  GLN A C   1 
ATOM   2217 O  O   . GLN A 1 318 ? -5.665  4.080   -31.770 1.00 26.14  ? 840  GLN A O   1 
ATOM   2218 C  CB  . GLN A 1 318 ? -7.689  3.322   -29.448 1.00 25.62  ? 840  GLN A CB  1 
ATOM   2219 C  CG  . GLN A 1 318 ? -7.285  4.739   -29.073 1.00 26.61  ? 840  GLN A CG  1 
ATOM   2220 C  CD  . GLN A 1 318 ? -8.234  5.792   -29.602 1.00 28.41  ? 840  GLN A CD  1 
ATOM   2221 O  OE1 . GLN A 1 318 ? -9.432  5.605   -29.589 1.00 29.35  ? 840  GLN A OE1 1 
ATOM   2222 N  NE2 . GLN A 1 318 ? -7.694  6.908   -30.061 1.00 30.08  ? 840  GLN A NE2 1 
ATOM   2223 N  N   . PHE A 1 319 ? -5.451  1.913   -31.319 1.00 24.27  ? 841  PHE A N   1 
ATOM   2224 C  CA  . PHE A 1 319 ? -4.078  1.836   -31.804 1.00 24.89  ? 841  PHE A CA  1 
ATOM   2225 C  C   . PHE A 1 319 ? -4.016  2.156   -33.292 1.00 25.18  ? 841  PHE A C   1 
ATOM   2226 O  O   . PHE A 1 319 ? -3.254  3.001   -33.719 1.00 24.31  ? 841  PHE A O   1 
ATOM   2227 C  CB  . PHE A 1 319 ? -3.481  0.451   -31.534 1.00 24.44  ? 841  PHE A CB  1 
ATOM   2228 C  CG  . PHE A 1 319 ? -2.077  0.291   -32.020 1.00 24.68  ? 841  PHE A CG  1 
ATOM   2229 C  CD1 . PHE A 1 319 ? -1.056  1.029   -31.466 1.00 25.35  ? 841  PHE A CD1 1 
ATOM   2230 C  CD2 . PHE A 1 319 ? -1.772  -0.614  -33.016 1.00 25.27  ? 841  PHE A CD2 1 
ATOM   2231 C  CE1 . PHE A 1 319 ? 0.247   0.884   -31.904 1.00 25.78  ? 841  PHE A CE1 1 
ATOM   2232 C  CE2 . PHE A 1 319 ? -0.470  -0.766  -33.460 1.00 25.62  ? 841  PHE A CE2 1 
ATOM   2233 C  CZ  . PHE A 1 319 ? 0.537   -0.007  -32.913 1.00 25.78  ? 841  PHE A CZ  1 
ATOM   2234 N  N   . PHE A 1 320 ? -4.865  1.482   -34.054 1.00 25.77  ? 842  PHE A N   1 
ATOM   2235 C  CA  . PHE A 1 320 ? -4.942  1.664   -35.493 1.00 26.44  ? 842  PHE A CA  1 
ATOM   2236 C  C   . PHE A 1 320 ? -5.151  3.111   -35.859 1.00 27.00  ? 842  PHE A C   1 
ATOM   2237 O  O   . PHE A 1 320 ? -4.523  3.607   -36.769 1.00 27.05  ? 842  PHE A O   1 
ATOM   2238 C  CB  . PHE A 1 320 ? -6.059  0.800   -36.081 1.00 26.08  ? 842  PHE A CB  1 
ATOM   2239 C  CG  . PHE A 1 320 ? -5.719  -0.659  -36.185 1.00 25.72  ? 842  PHE A CG  1 
ATOM   2240 C  CD1 . PHE A 1 320 ? -4.463  -1.078  -36.586 1.00 26.04  ? 842  PHE A CD1 1 
ATOM   2241 C  CD2 . PHE A 1 320 ? -6.674  -1.617  -35.916 1.00 25.58  ? 842  PHE A CD2 1 
ATOM   2242 C  CE1 . PHE A 1 320 ? -4.172  -2.427  -36.706 1.00 26.15  ? 842  PHE A CE1 1 
ATOM   2243 C  CE2 . PHE A 1 320 ? -6.386  -2.970  -36.034 1.00 25.65  ? 842  PHE A CE2 1 
ATOM   2244 C  CZ  . PHE A 1 320 ? -5.137  -3.375  -36.433 1.00 25.38  ? 842  PHE A CZ  1 
ATOM   2245 N  N   . GLN A 1 321 ? -6.019  3.772   -35.112 1.00 28.52  ? 843  GLN A N   1 
ATOM   2246 C  CA  . GLN A 1 321 ? -6.329  5.185   -35.290 1.00 31.08  ? 843  GLN A CA  1 
ATOM   2247 C  C   . GLN A 1 321 ? -5.174  6.121   -34.905 1.00 30.26  ? 843  GLN A C   1 
ATOM   2248 O  O   . GLN A 1 321 ? -4.850  7.041   -35.647 1.00 29.49  ? 843  GLN A O   1 
ATOM   2249 C  CB  . GLN A 1 321 ? -7.560  5.524   -34.462 1.00 33.48  ? 843  GLN A CB  1 
ATOM   2250 C  CG  . GLN A 1 321 ? -7.966  6.980   -34.505 1.00 37.45  ? 843  GLN A CG  1 
ATOM   2251 C  CD  . GLN A 1 321 ? -9.266  7.219   -33.755 1.00 40.04  ? 843  GLN A CD  1 
ATOM   2252 O  OE1 . GLN A 1 321 ? -10.273 6.548   -34.016 1.00 42.31  ? 843  GLN A OE1 1 
ATOM   2253 N  NE2 . GLN A 1 321 ? -9.257  8.175   -32.828 1.00 40.09  ? 843  GLN A NE2 1 
ATOM   2254 N  N   . ASP A 1 322 ? -4.575  5.890   -33.742 1.00 29.54  ? 844  ASP A N   1 
ATOM   2255 C  CA  . ASP A 1 322 ? -3.424  6.679   -33.325 1.00 30.55  ? 844  ASP A CA  1 
ATOM   2256 C  C   . ASP A 1 322 ? -2.267  6.512   -34.330 1.00 30.82  ? 844  ASP A C   1 
ATOM   2257 O  O   . ASP A 1 322 ? -1.573  7.480   -34.629 1.00 32.11  ? 844  ASP A O   1 
ATOM   2258 C  CB  . ASP A 1 322 ? -2.974  6.348   -31.901 1.00 29.91  ? 844  ASP A CB  1 
ATOM   2259 C  CG  . ASP A 1 322 ? -3.987  6.748   -30.834 1.00 30.41  ? 844  ASP A CG  1 
ATOM   2260 O  OD1 . ASP A 1 322 ? -4.920  7.548   -31.085 1.00 31.42  ? 844  ASP A OD1 1 
ATOM   2261 O  OD2 . ASP A 1 322 ? -3.842  6.234   -29.707 1.00 30.52  ? 844  ASP A OD2 1 
ATOM   2262 N  N   . VAL A 1 323 ? -2.091  5.312   -34.876 1.00 29.74  ? 845  VAL A N   1 
ATOM   2263 C  CA  . VAL A 1 323 ? -1.092  5.081   -35.910 1.00 30.89  ? 845  VAL A CA  1 
ATOM   2264 C  C   . VAL A 1 323 ? -1.389  5.866   -37.204 1.00 33.11  ? 845  VAL A C   1 
ATOM   2265 O  O   . VAL A 1 323 ? -0.493  6.411   -37.827 1.00 33.66  ? 845  VAL A O   1 
ATOM   2266 C  CB  . VAL A 1 323 ? -0.965  3.591   -36.219 1.00 30.32  ? 845  VAL A CB  1 
ATOM   2267 C  CG1 . VAL A 1 323 ? -0.136  3.361   -37.466 1.00 31.24  ? 845  VAL A CG1 1 
ATOM   2268 C  CG2 . VAL A 1 323 ? -0.340  2.863   -35.040 1.00 29.93  ? 845  VAL A CG2 1 
ATOM   2269 N  N   . SER A 1 324 ? -2.653  5.915   -37.599 1.00 34.31  ? 846  SER A N   1 
ATOM   2270 C  CA  . SER A 1 324 ? -3.064  6.581   -38.824 1.00 34.75  ? 846  SER A CA  1 
ATOM   2271 C  C   . SER A 1 324 ? -2.949  8.107   -38.706 1.00 34.94  ? 846  SER A C   1 
ATOM   2272 O  O   . SER A 1 324 ? -2.515  8.753   -39.650 1.00 35.67  ? 846  SER A O   1 
ATOM   2273 C  CB  . SER A 1 324 ? -4.485  6.120   -39.210 1.00 35.77  ? 846  SER A CB  1 
ATOM   2274 O  OG  . SER A 1 324 ? -5.039  6.880   -40.284 1.00 38.42  ? 846  SER A OG  1 
ATOM   2275 N  N   . ASP A 1 325 ? -3.325  8.670   -37.557 1.00 35.06  ? 847  ASP A N   1 
ATOM   2276 C  CA  . ASP A 1 325 ? -3.080  10.081  -37.241 1.00 36.37  ? 847  ASP A CA  1 
ATOM   2277 C  C   . ASP A 1 325 ? -1.586  10.427  -37.223 1.00 38.38  ? 847  ASP A C   1 
ATOM   2278 O  O   . ASP A 1 325 ? -1.198  11.551  -37.557 1.00 40.46  ? 847  ASP A O   1 
ATOM   2279 C  CB  . ASP A 1 325 ? -3.610  10.438  -35.857 1.00 36.45  ? 847  ASP A CB  1 
ATOM   2280 C  CG  . ASP A 1 325 ? -5.103  10.332  -35.737 1.00 36.23  ? 847  ASP A CG  1 
ATOM   2281 O  OD1 . ASP A 1 325 ? -5.817  10.282  -36.755 1.00 36.47  ? 847  ASP A OD1 1 
ATOM   2282 O  OD2 . ASP A 1 325 ? -5.569  10.279  -34.585 1.00 37.04  ? 847  ASP A OD2 1 
ATOM   2283 N  N   . ARG A 1 326 ? -0.767  9.468   -36.789 1.00 37.79  ? 848  ARG A N   1 
ATOM   2284 C  CA  . ARG A 1 326 ? 0.677   9.630   -36.718 1.00 38.61  ? 848  ARG A CA  1 
ATOM   2285 C  C   . ARG A 1 326 ? 1.367   9.624   -38.085 1.00 40.42  ? 848  ARG A C   1 
ATOM   2286 O  O   . ARG A 1 326 ? 2.369   10.318  -38.270 1.00 41.49  ? 848  ARG A O   1 
ATOM   2287 C  CB  . ARG A 1 326 ? 1.274   8.536   -35.827 1.00 38.08  ? 848  ARG A CB  1 
ATOM   2288 C  CG  . ARG A 1 326 ? 2.790   8.535   -35.717 1.00 38.78  ? 848  ARG A CG  1 
ATOM   2289 C  CD  . ARG A 1 326 ? 3.313   9.744   -34.953 1.00 40.05  ? 848  ARG A CD  1 
ATOM   2290 N  NE  . ARG A 1 326 ? 4.771   9.750   -34.931 1.00 40.89  ? 848  ARG A NE  1 
ATOM   2291 C  CZ  . ARG A 1 326 ? 5.555   10.163  -35.925 1.00 42.56  ? 848  ARG A CZ  1 
ATOM   2292 N  NH1 . ARG A 1 326 ? 5.055   10.627  -37.062 1.00 45.18  ? 848  ARG A NH1 1 
ATOM   2293 N  NH2 . ARG A 1 326 ? 6.864   10.115  -35.784 1.00 43.20  ? 848  ARG A NH2 1 
ATOM   2294 N  N   . ILE A 1 327 ? 0.861   8.839   -39.033 1.00 40.58  ? 849  ILE A N   1 
ATOM   2295 C  CA  . ILE A 1 327 ? 1.453   8.790   -40.376 1.00 42.16  ? 849  ILE A CA  1 
ATOM   2296 C  C   . ILE A 1 327 ? 0.648   9.597   -41.416 1.00 42.76  ? 849  ILE A C   1 
ATOM   2297 O  O   . ILE A 1 327 ? 0.995   9.617   -42.586 1.00 42.40  ? 849  ILE A O   1 
ATOM   2298 C  CB  . ILE A 1 327 ? 1.695   7.333   -40.842 1.00 42.59  ? 849  ILE A CB  1 
ATOM   2299 C  CG1 . ILE A 1 327 ? 0.376   6.595   -41.115 1.00 43.35  ? 849  ILE A CG1 1 
ATOM   2300 C  CG2 . ILE A 1 327 ? 2.498   6.570   -39.805 1.00 41.61  ? 849  ILE A CG2 1 
ATOM   2301 C  CD1 . ILE A 1 327 ? 0.558   5.123   -41.433 1.00 43.27  ? 849  ILE A CD1 1 
ATOM   2302 N  N   . GLU A 1 328 ? -0.398  10.283  -40.957 1.00 43.84  ? 850  GLU A N   1 
ATOM   2303 C  CA  . GLU A 1 328 ? -1.293  11.116  -41.782 1.00 45.08  ? 850  GLU A CA  1 
ATOM   2304 C  C   . GLU A 1 328 ? -0.549  12.140  -42.670 1.00 46.40  ? 850  GLU A C   1 
ATOM   2305 O  O   . GLU A 1 328 ? -0.969  12.420  -43.803 1.00 47.36  ? 850  GLU A O   1 
ATOM   2306 C  CB  . GLU A 1 328 ? -2.268  11.845  -40.833 1.00 47.40  ? 850  GLU A CB  1 
ATOM   2307 C  CG  . GLU A 1 328 ? -3.460  12.554  -41.458 1.00 50.55  ? 850  GLU A CG  1 
ATOM   2308 C  CD  . GLU A 1 328 ? -3.977  13.724  -40.617 1.00 53.14  ? 850  GLU A CD  1 
ATOM   2309 O  OE1 . GLU A 1 328 ? -3.156  14.560  -40.163 1.00 55.28  ? 850  GLU A OE1 1 
ATOM   2310 O  OE2 . GLU A 1 328 ? -5.215  13.833  -40.435 1.00 54.31  ? 850  GLU A OE2 1 
ATOM   2311 N  N   . LYS A 1 329 ? 0.545   12.699  -42.142 1.00 46.06  ? 851  LYS A N   1 
ATOM   2312 C  CA  . LYS A 1 329 ? 1.380   13.672  -42.846 1.00 44.81  ? 851  LYS A CA  1 
ATOM   2313 C  C   . LYS A 1 329 ? 2.847   13.243  -42.939 1.00 45.36  ? 851  LYS A C   1 
ATOM   2314 O  O   . LYS A 1 329 ? 3.730   14.086  -42.941 1.00 45.47  ? 851  LYS A O   1 
ATOM   2315 C  CB  . LYS A 1 329 ? 1.292   15.033  -42.164 1.00 44.62  ? 851  LYS A CB  1 
ATOM   2316 C  CG  . LYS A 1 329 ? -0.110  15.595  -42.093 1.00 44.09  ? 851  LYS A CG  1 
ATOM   2317 C  CD  . LYS A 1 329 ? -0.107  17.109  -42.029 1.00 45.48  ? 851  LYS A CD  1 
ATOM   2318 C  CE  . LYS A 1 329 ? -1.500  17.684  -41.893 1.00 45.82  ? 851  LYS A CE  1 
ATOM   2319 N  NZ  . LYS A 1 329 ? -2.169  17.184  -40.657 1.00 45.46  ? 851  LYS A NZ  1 
ATOM   2320 N  N   . GLU A 1 330 ? 3.100   11.941  -43.037 1.00 45.48  ? 852  GLU A N   1 
ATOM   2321 C  CA  . GLU A 1 330 ? 4.454   11.424  -43.240 1.00 48.49  ? 852  GLU A CA  1 
ATOM   2322 C  C   . GLU A 1 330 ? 4.750   11.164  -44.699 1.00 51.14  ? 852  GLU A C   1 
ATOM   2323 O  O   . GLU A 1 330 ? 3.846   10.957  -45.486 1.00 51.87  ? 852  GLU A O   1 
ATOM   2324 C  CB  . GLU A 1 330 ? 4.674   10.133  -42.466 1.00 48.63  ? 852  GLU A CB  1 
ATOM   2325 C  CG  . GLU A 1 330 ? 4.859   10.344  -40.979 1.00 49.36  ? 852  GLU A CG  1 
ATOM   2326 C  CD  . GLU A 1 330 ? 6.232   10.848  -40.629 1.00 50.96  ? 852  GLU A CD  1 
ATOM   2327 O  OE1 . GLU A 1 330 ? 7.201   10.310  -41.185 1.00 52.93  ? 852  GLU A OE1 1 
ATOM   2328 O  OE2 . GLU A 1 330 ? 6.335   11.757  -39.784 1.00 53.57  ? 852  GLU A OE2 1 
ATOM   2329 N  N   . SER A 1 331 ? 6.034   11.183  -45.050 1.00 55.03  ? 853  SER A N   1 
ATOM   2330 C  CA  . SER A 1 331 ? 6.455   10.962  -46.429 1.00 57.75  ? 853  SER A CA  1 
ATOM   2331 C  C   . SER A 1 331 ? 6.406   9.478   -46.758 1.00 57.72  ? 853  SER A C   1 
ATOM   2332 O  O   . SER A 1 331 ? 6.817   8.636   -45.956 1.00 56.83  ? 853  SER A O   1 
ATOM   2333 C  CB  . SER A 1 331 ? 7.877   11.509  -46.671 1.00 60.46  ? 853  SER A CB  1 
ATOM   2334 O  OG  . SER A 1 331 ? 8.706   10.566  -47.347 1.00 59.93  ? 853  SER A OG  1 
ATOM   2335 N  N   . LEU A 1 332 ? 5.937   9.170   -47.962 1.00 58.60  ? 854  LEU A N   1 
ATOM   2336 C  CA  . LEU A 1 332 ? 6.028   7.822   -48.509 1.00 60.49  ? 854  LEU A CA  1 
ATOM   2337 C  C   . LEU A 1 332 ? 7.428   7.180   -48.345 1.00 61.47  ? 854  LEU A C   1 
ATOM   2338 O  O   . LEU A 1 332 ? 7.528   5.966   -48.163 1.00 59.60  ? 854  LEU A O   1 
ATOM   2339 C  CB  . LEU A 1 332 ? 5.608   7.854   -49.985 1.00 63.22  ? 854  LEU A CB  1 
ATOM   2340 C  CG  . LEU A 1 332 ? 5.687   6.587   -50.854 1.00 65.54  ? 854  LEU A CG  1 
ATOM   2341 C  CD1 . LEU A 1 332 ? 5.259   5.310   -50.120 1.00 65.73  ? 854  LEU A CD1 1 
ATOM   2342 C  CD2 . LEU A 1 332 ? 4.859   6.804   -52.118 1.00 65.37  ? 854  LEU A CD2 1 
ATOM   2343 N  N   . ASP A 1 333 ? 8.494   7.984   -48.393 1.00 63.01  ? 855  ASP A N   1 
ATOM   2344 C  CA  . ASP A 1 333 ? 9.866   7.459   -48.295 1.00 65.35  ? 855  ASP A CA  1 
ATOM   2345 C  C   . ASP A 1 333 ? 10.544  7.665   -46.925 1.00 65.75  ? 855  ASP A C   1 
ATOM   2346 O  O   . ASP A 1 333 ? 11.700  7.263   -46.752 1.00 66.57  ? 855  ASP A O   1 
ATOM   2347 C  CB  . ASP A 1 333 ? 10.749  8.040   -49.416 1.00 67.00  ? 855  ASP A CB  1 
ATOM   2348 C  CG  . ASP A 1 333 ? 10.322  7.574   -50.812 1.00 68.05  ? 855  ASP A CG  1 
ATOM   2349 O  OD1 . ASP A 1 333 ? 10.184  6.352   -51.036 1.00 67.56  ? 855  ASP A OD1 1 
ATOM   2350 O  OD2 . ASP A 1 333 ? 10.128  8.432   -51.694 1.00 66.81  ? 855  ASP A OD2 1 
ATOM   2351 N  N   . GLY A 1 334 ? 9.842   8.263   -45.958 1.00 64.83  ? 856  GLY A N   1 
ATOM   2352 C  CA  . GLY A 1 334 ? 10.380  8.414   -44.595 1.00 64.72  ? 856  GLY A CA  1 
ATOM   2353 C  C   . GLY A 1 334 ? 10.562  7.055   -43.937 1.00 64.47  ? 856  GLY A C   1 
ATOM   2354 O  O   . GLY A 1 334 ? 10.008  6.068   -44.416 1.00 65.86  ? 856  GLY A O   1 
ATOM   2355 N  N   . PRO A 1 335 ? 11.339  6.983   -42.839 1.00 65.54  ? 857  PRO A N   1 
ATOM   2356 C  CA  . PRO A 1 335 ? 11.640  5.658   -42.250 1.00 64.39  ? 857  PRO A CA  1 
ATOM   2357 C  C   . PRO A 1 335 ? 10.417  4.947   -41.654 1.00 59.80  ? 857  PRO A C   1 
ATOM   2358 O  O   . PRO A 1 335 ? 10.309  3.715   -41.742 1.00 59.12  ? 857  PRO A O   1 
ATOM   2359 C  CB  . PRO A 1 335 ? 12.670  5.976   -41.151 1.00 63.25  ? 857  PRO A CB  1 
ATOM   2360 C  CG  . PRO A 1 335 ? 12.417  7.404   -40.800 1.00 64.56  ? 857  PRO A CG  1 
ATOM   2361 C  CD  . PRO A 1 335 ? 11.949  8.082   -42.066 1.00 66.16  ? 857  PRO A CD  1 
ATOM   2362 N  N   . ILE A 1 336 ? 9.515   5.721   -41.058 1.00 56.00  ? 858  ILE A N   1 
ATOM   2363 C  CA  . ILE A 1 336 ? 8.318   5.164   -40.412 1.00 52.90  ? 858  ILE A CA  1 
ATOM   2364 C  C   . ILE A 1 336 ? 7.430   4.418   -41.414 1.00 49.70  ? 858  ILE A C   1 
ATOM   2365 O  O   . ILE A 1 336 ? 7.169   3.225   -41.272 1.00 45.80  ? 858  ILE A O   1 
ATOM   2366 C  CB  . ILE A 1 336 ? 7.520   6.264   -39.692 1.00 51.34  ? 858  ILE A CB  1 
ATOM   2367 C  CG1 . ILE A 1 336 ? 8.322   6.762   -38.489 1.00 52.05  ? 858  ILE A CG1 1 
ATOM   2368 C  CG2 . ILE A 1 336 ? 6.178   5.736   -39.227 1.00 50.82  ? 858  ILE A CG2 1 
ATOM   2369 C  CD1 . ILE A 1 336 ? 7.675   7.901   -37.732 1.00 51.89  ? 858  ILE A CD1 1 
ATOM   2370 N  N   . VAL A 1 337 ? 7.001   5.126   -42.441 1.00 50.31  ? 859  VAL A N   1 
ATOM   2371 C  CA  . VAL A 1 337 ? 6.139   4.546   -43.458 1.00 51.60  ? 859  VAL A CA  1 
ATOM   2372 C  C   . VAL A 1 337 ? 6.854   3.419   -44.234 1.00 53.48  ? 859  VAL A C   1 
ATOM   2373 O  O   . VAL A 1 337 ? 6.217   2.455   -44.675 1.00 50.57  ? 859  VAL A O   1 
ATOM   2374 C  CB  . VAL A 1 337 ? 5.598   5.664   -44.374 1.00 52.48  ? 859  VAL A CB  1 
ATOM   2375 C  CG1 . VAL A 1 337 ? 4.960   5.113   -45.641 1.00 54.17  ? 859  VAL A CG1 1 
ATOM   2376 C  CG2 . VAL A 1 337 ? 4.614   6.528   -43.598 1.00 50.46  ? 859  VAL A CG2 1 
ATOM   2377 N  N   . LYS A 1 338 ? 8.176   3.529   -44.367 1.00 57.04  ? 860  LYS A N   1 
ATOM   2378 C  CA  . LYS A 1 338 ? 8.982   2.481   -45.000 1.00 59.04  ? 860  LYS A CA  1 
ATOM   2379 C  C   . LYS A 1 338 ? 8.876   1.173   -44.229 1.00 56.24  ? 860  LYS A C   1 
ATOM   2380 O  O   . LYS A 1 338 ? 8.625   0.123   -44.817 1.00 56.67  ? 860  LYS A O   1 
ATOM   2381 C  CB  . LYS A 1 338 ? 10.456  2.889   -45.076 1.00 64.68  ? 860  LYS A CB  1 
ATOM   2382 C  CG  . LYS A 1 338 ? 11.160  2.507   -46.370 1.00 68.64  ? 860  LYS A CG  1 
ATOM   2383 C  CD  . LYS A 1 338 ? 10.767  3.464   -47.489 1.00 72.66  ? 860  LYS A CD  1 
ATOM   2384 C  CE  . LYS A 1 338 ? 11.969  4.202   -48.060 1.00 76.26  ? 860  LYS A CE  1 
ATOM   2385 N  NZ  . LYS A 1 338 ? 12.638  3.410   -49.127 1.00 80.93  ? 860  LYS A NZ  1 
ATOM   2386 N  N   . GLN A 1 339 ? 9.088   1.239   -42.915 1.00 54.15  ? 861  GLN A N   1 
ATOM   2387 C  CA  . GLN A 1 339 ? 8.961   0.064   -42.035 1.00 53.21  ? 861  GLN A CA  1 
ATOM   2388 C  C   . GLN A 1 339 ? 7.588   -0.578  -42.108 1.00 49.48  ? 861  GLN A C   1 
ATOM   2389 O  O   . GLN A 1 339 ? 7.451   -1.806  -42.143 1.00 48.52  ? 861  GLN A O   1 
ATOM   2390 C  CB  . GLN A 1 339 ? 9.230   0.450   -40.574 1.00 55.37  ? 861  GLN A CB  1 
ATOM   2391 C  CG  . GLN A 1 339 ? 10.698  0.428   -40.194 1.00 58.49  ? 861  GLN A CG  1 
ATOM   2392 C  CD  . GLN A 1 339 ? 11.244  -0.978  -40.176 1.00 58.92  ? 861  GLN A CD  1 
ATOM   2393 O  OE1 . GLN A 1 339 ? 10.719  -1.844  -39.488 1.00 58.10  ? 861  GLN A OE1 1 
ATOM   2394 N  NE2 . GLN A 1 339 ? 12.286  -1.216  -40.959 1.00 62.17  ? 861  GLN A NE2 1 
ATOM   2395 N  N   . LEU A 1 340 ? 6.576   0.282   -42.117 1.00 46.48  ? 862  LEU A N   1 
ATOM   2396 C  CA  . LEU A 1 340 ? 5.188   -0.142  -42.159 1.00 43.89  ? 862  LEU A CA  1 
ATOM   2397 C  C   . LEU A 1 340 ? 4.846   -0.866  -43.452 1.00 43.56  ? 862  LEU A C   1 
ATOM   2398 O  O   . LEU A 1 340 ? 4.019   -1.770  -43.436 1.00 43.65  ? 862  LEU A O   1 
ATOM   2399 C  CB  . LEU A 1 340 ? 4.283   1.067   -41.961 1.00 42.59  ? 862  LEU A CB  1 
ATOM   2400 C  CG  . LEU A 1 340 ? 2.805   0.817   -41.757 1.00 43.11  ? 862  LEU A CG  1 
ATOM   2401 C  CD1 . LEU A 1 340 ? 2.509   0.125   -40.432 1.00 42.19  ? 862  LEU A CD1 1 
ATOM   2402 C  CD2 . LEU A 1 340 ? 2.068   2.145   -41.835 1.00 44.63  ? 862  LEU A CD2 1 
ATOM   2403 N  N   . GLU A 1 341 ? 5.486   -0.486  -44.559 1.00 44.00  ? 863  GLU A N   1 
ATOM   2404 C  CA  . GLU A 1 341 ? 5.245   -1.142  -45.846 1.00 44.82  ? 863  GLU A CA  1 
ATOM   2405 C  C   . GLU A 1 341 ? 6.129   -2.365  -46.113 1.00 46.82  ? 863  GLU A C   1 
ATOM   2406 O  O   . GLU A 1 341 ? 5.744   -3.235  -46.895 1.00 44.91  ? 863  GLU A O   1 
ATOM   2407 C  CB  . GLU A 1 341 ? 5.364   -0.143  -47.002 1.00 45.08  ? 863  GLU A CB  1 
ATOM   2408 C  CG  . GLU A 1 341 ? 4.358   0.999   -46.962 1.00 44.26  ? 863  GLU A CG  1 
ATOM   2409 C  CD  . GLU A 1 341 ? 2.910   0.558   -47.118 1.00 43.16  ? 863  GLU A CD  1 
ATOM   2410 O  OE1 . GLU A 1 341 ? 2.635   -0.651  -47.281 1.00 41.77  ? 863  GLU A OE1 1 
ATOM   2411 O  OE2 . GLU A 1 341 ? 2.034   1.441   -47.076 1.00 42.35  ? 863  GLU A OE2 1 
ATOM   2412 N  N   . ARG A 1 342 ? 7.297   -2.436  -45.470 1.00 50.24  ? 864  ARG A N   1 
ATOM   2413 C  CA  . ARG A 1 342 ? 8.201   -3.588  -45.609 1.00 53.54  ? 864  ARG A CA  1 
ATOM   2414 C  C   . ARG A 1 342 ? 7.478   -4.875  -45.246 1.00 51.09  ? 864  ARG A C   1 
ATOM   2415 O  O   . ARG A 1 342 ? 7.076   -5.046  -44.114 1.00 51.08  ? 864  ARG A O   1 
ATOM   2416 C  CB  . ARG A 1 342 ? 9.452   -3.400  -44.724 1.00 57.63  ? 864  ARG A CB  1 
ATOM   2417 C  CG  . ARG A 1 342 ? 10.266  -4.662  -44.420 1.00 61.59  ? 864  ARG A CG  1 
ATOM   2418 C  CD  . ARG A 1 342 ? 11.595  -4.373  -43.704 1.00 65.98  ? 864  ARG A CD  1 
ATOM   2419 N  NE  . ARG A 1 342 ? 12.724  -4.303  -44.640 1.00 69.57  ? 864  ARG A NE  1 
ATOM   2420 C  CZ  . ARG A 1 342 ? 13.093  -3.220  -45.337 1.00 72.67  ? 864  ARG A CZ  1 
ATOM   2421 N  NH1 . ARG A 1 342 ? 14.132  -3.289  -46.166 1.00 74.43  ? 864  ARG A NH1 1 
ATOM   2422 N  NH2 . ARG A 1 342 ? 12.446  -2.063  -45.218 1.00 71.49  ? 864  ARG A NH2 1 
ATOM   2423 N  N   . GLY A 1 343 ? 7.305   -5.775  -46.205 1.00 51.31  ? 865  GLY A N   1 
ATOM   2424 C  CA  . GLY A 1 343 ? 6.531   -7.002  -45.970 1.00 50.99  ? 865  GLY A CA  1 
ATOM   2425 C  C   . GLY A 1 343 ? 5.020   -6.779  -45.983 1.00 49.09  ? 865  GLY A C   1 
ATOM   2426 O  O   . GLY A 1 343 ? 4.258   -7.685  -45.643 1.00 47.55  ? 865  GLY A O   1 
ATOM   2427 N  N   . GLY A 1 344 ? 4.602   -5.584  -46.418 1.00 47.87  ? 866  GLY A N   1 
ATOM   2428 C  CA  . GLY A 1 344 ? 3.220   -5.131  -46.345 1.00 46.51  ? 866  GLY A CA  1 
ATOM   2429 C  C   . GLY A 1 344 ? 2.258   -5.911  -47.210 1.00 47.46  ? 866  GLY A C   1 
ATOM   2430 O  O   . GLY A 1 344 ? 1.180   -6.253  -46.757 1.00 44.81  ? 866  GLY A O   1 
ATOM   2431 N  N   . ARG A 1 345 ? 2.660   -6.211  -48.443 1.00 51.02  ? 867  ARG A N   1 
ATOM   2432 C  CA  . ARG A 1 345 ? 1.776   -6.855  -49.414 1.00 54.35  ? 867  ARG A CA  1 
ATOM   2433 C  C   . ARG A 1 345 ? 1.227   -8.199  -48.954 1.00 52.45  ? 867  ARG A C   1 
ATOM   2434 O  O   . ARG A 1 345 ? 0.049   -8.457  -49.129 1.00 52.34  ? 867  ARG A O   1 
ATOM   2435 C  CB  . ARG A 1 345 ? 2.466   -7.006  -50.786 1.00 60.68  ? 867  ARG A CB  1 
ATOM   2436 C  CG  . ARG A 1 345 ? 2.739   -5.678  -51.497 1.00 64.27  ? 867  ARG A CG  1 
ATOM   2437 C  CD  . ARG A 1 345 ? 3.033   -5.844  -52.985 1.00 69.81  ? 867  ARG A CD  1 
ATOM   2438 N  NE  . ARG A 1 345 ? 3.927   -4.791  -53.479 1.00 73.22  ? 867  ARG A NE  1 
ATOM   2439 C  CZ  . ARG A 1 345 ? 5.265   -4.844  -53.475 1.00 75.10  ? 867  ARG A CZ  1 
ATOM   2440 N  NH1 . ARG A 1 345 ? 5.968   -3.820  -53.944 1.00 76.87  ? 867  ARG A NH1 1 
ATOM   2441 N  NH2 . ARG A 1 345 ? 5.919   -5.908  -53.017 1.00 74.64  ? 867  ARG A NH2 1 
ATOM   2442 N  N   . ALA A 1 346 ? 2.064   -9.054  -48.374 1.00 51.80  ? 868  ALA A N   1 
ATOM   2443 C  CA  . ALA A 1 346 ? 1.585   -10.335 -47.833 1.00 50.16  ? 868  ALA A CA  1 
ATOM   2444 C  C   . ALA A 1 346 ? 0.532   -10.111 -46.754 1.00 47.72  ? 868  ALA A C   1 
ATOM   2445 O  O   . ALA A 1 346 ? -0.476  -10.823 -46.699 1.00 47.44  ? 868  ALA A O   1 
ATOM   2446 C  CB  . ALA A 1 346 ? 2.739   -11.153 -47.272 1.00 49.69  ? 868  ALA A CB  1 
ATOM   2447 N  N   . VAL A 1 347 ? 0.784   -9.115  -45.902 1.00 45.54  ? 869  VAL A N   1 
ATOM   2448 C  CA  . VAL A 1 347 ? -0.110  -8.742  -44.799 1.00 43.42  ? 869  VAL A CA  1 
ATOM   2449 C  C   . VAL A 1 347 ? -1.455  -8.241  -45.302 1.00 42.21  ? 869  VAL A C   1 
ATOM   2450 O  O   . VAL A 1 347 ? -2.493  -8.485  -44.701 1.00 42.56  ? 869  VAL A O   1 
ATOM   2451 C  CB  . VAL A 1 347 ? 0.535   -7.645  -43.924 1.00 42.92  ? 869  VAL A CB  1 
ATOM   2452 C  CG1 . VAL A 1 347 ? -0.461  -7.057  -42.937 1.00 41.17  ? 869  VAL A CG1 1 
ATOM   2453 C  CG2 . VAL A 1 347 ? 1.743   -8.209  -43.189 1.00 42.98  ? 869  VAL A CG2 1 
ATOM   2454 N  N   . VAL A 1 348 ? -1.415  -7.556  -46.428 1.00 42.86  ? 870  VAL A N   1 
ATOM   2455 C  CA  . VAL A 1 348 ? -2.578  -6.918  -47.025 1.00 43.20  ? 870  VAL A CA  1 
ATOM   2456 C  C   . VAL A 1 348 ? -3.281  -7.841  -48.052 1.00 44.46  ? 870  VAL A C   1 
ATOM   2457 O  O   . VAL A 1 348 ? -4.341  -7.500  -48.627 1.00 44.02  ? 870  VAL A O   1 
ATOM   2458 C  CB  . VAL A 1 348 ? -2.127  -5.528  -47.562 1.00 43.31  ? 870  VAL A CB  1 
ATOM   2459 C  CG1 . VAL A 1 348 ? -2.334  -5.345  -49.062 1.00 45.77  ? 870  VAL A CG1 1 
ATOM   2460 C  CG2 . VAL A 1 348 ? -2.749  -4.426  -46.730 1.00 41.52  ? 870  VAL A CG2 1 
ATOM   2461 N  N   . LYS A 1 349 ? -2.727  -9.042  -48.189 1.00 45.47  ? 871  LYS A N   1 
ATOM   2462 C  CA  . LYS A 1 349 ? -3.169  -10.024 -49.169 1.00 47.28  ? 871  LYS A CA  1 
ATOM   2463 C  C   . LYS A 1 349 ? -3.036  -9.532  -50.608 1.00 49.88  ? 871  LYS A C   1 
ATOM   2464 O  O   . LYS A 1 349 ? -3.896  -9.765  -51.450 1.00 50.44  ? 871  LYS A O   1 
ATOM   2465 C  CB  . LYS A 1 349 ? -4.585  -10.494 -48.848 1.00 46.40  ? 871  LYS A CB  1 
ATOM   2466 C  CG  . LYS A 1 349 ? -4.733  -10.981 -47.417 1.00 44.16  ? 871  LYS A CG  1 
ATOM   2467 C  CD  . LYS A 1 349 ? -5.826  -12.020 -47.274 1.00 43.70  ? 871  LYS A CD  1 
ATOM   2468 C  CE  . LYS A 1 349 ? -5.826  -12.621 -45.882 1.00 42.08  ? 871  LYS A CE  1 
ATOM   2469 N  NZ  . LYS A 1 349 ? -7.159  -13.148 -45.493 1.00 41.64  ? 871  LYS A NZ  1 
ATOM   2470 N  N   . MET A 1 350 ? -1.928  -8.845  -50.861 1.00 51.99  ? 872  MET A N   1 
ATOM   2471 C  CA  . MET A 1 350 ? -1.580  -8.328  -52.177 1.00 55.82  ? 872  MET A CA  1 
ATOM   2472 C  C   . MET A 1 350 ? -2.414  -7.128  -52.582 1.00 53.45  ? 872  MET A C   1 
ATOM   2473 O  O   . MET A 1 350 ? -1.876  -6.078  -52.911 1.00 52.64  ? 872  MET A O   1 
ATOM   2474 C  CB  . MET A 1 350 ? -1.753  -9.413  -53.239 1.00 61.94  ? 872  MET A CB  1 
ATOM   2475 C  CG  . MET A 1 350 ? -0.937  -10.672 -52.993 1.00 66.69  ? 872  MET A CG  1 
ATOM   2476 S  SD  . MET A 1 350 ? 0.796   -10.352 -52.613 1.00 74.52  ? 872  MET A SD  1 
ATOM   2477 C  CE  . MET A 1 350 ? 1.337   -9.543  -54.114 1.00 74.39  ? 872  MET A CE  1 
ATOM   2478 N  N   . ASP A 1 351 ? -3.729  -7.285  -52.541 1.00 51.99  ? 873  ASP A N   1 
ATOM   2479 C  CA  . ASP A 1 351 ? -4.649  -6.172  -52.671 1.00 50.93  ? 873  ASP A CA  1 
ATOM   2480 C  C   . ASP A 1 351 ? -5.672  -6.320  -51.565 1.00 48.95  ? 873  ASP A C   1 
ATOM   2481 O  O   . ASP A 1 351 ? -6.360  -7.333  -51.501 1.00 48.18  ? 873  ASP A O   1 
ATOM   2482 C  CB  . ASP A 1 351 ? -5.343  -6.202  -54.030 1.00 52.71  ? 873  ASP A CB  1 
ATOM   2483 C  CG  . ASP A 1 351 ? -6.121  -4.942  -54.319 1.00 51.88  ? 873  ASP A CG  1 
ATOM   2484 O  OD1 . ASP A 1 351 ? -6.537  -4.259  -53.367 1.00 49.96  ? 873  ASP A OD1 1 
ATOM   2485 O  OD2 . ASP A 1 351 ? -6.321  -4.639  -55.507 1.00 54.26  ? 873  ASP A OD2 1 
ATOM   2486 N  N   . TRP A 1 352 ? -5.806  -5.314  -50.709 1.00 46.46  ? 874  TRP A N   1 
ATOM   2487 C  CA  . TRP A 1 352 ? -6.781  -5.435  -49.610 1.00 44.73  ? 874  TRP A CA  1 
ATOM   2488 C  C   . TRP A 1 352 ? -8.210  -5.105  -50.038 1.00 45.11  ? 874  TRP A C   1 
ATOM   2489 O  O   . TRP A 1 352 ? -9.166  -5.569  -49.414 1.00 43.51  ? 874  TRP A O   1 
ATOM   2490 C  CB  . TRP A 1 352 ? -6.380  -4.629  -48.363 1.00 42.57  ? 874  TRP A CB  1 
ATOM   2491 C  CG  . TRP A 1 352 ? -6.085  -3.189  -48.574 1.00 42.05  ? 874  TRP A CG  1 
ATOM   2492 C  CD1 . TRP A 1 352 ? -4.854  -2.618  -48.699 1.00 42.00  ? 874  TRP A CD1 1 
ATOM   2493 C  CD2 . TRP A 1 352 ? -7.031  -2.122  -48.653 1.00 41.87  ? 874  TRP A CD2 1 
ATOM   2494 N  NE1 . TRP A 1 352 ? -4.973  -1.267  -48.866 1.00 42.35  ? 874  TRP A NE1 1 
ATOM   2495 C  CE2 . TRP A 1 352 ? -6.303  -0.933  -48.839 1.00 42.34  ? 874  TRP A CE2 1 
ATOM   2496 C  CE3 . TRP A 1 352 ? -8.420  -2.055  -48.585 1.00 42.16  ? 874  TRP A CE3 1 
ATOM   2497 C  CZ2 . TRP A 1 352 ? -6.920  0.315   -48.969 1.00 42.48  ? 874  TRP A CZ2 1 
ATOM   2498 C  CZ3 . TRP A 1 352 ? -9.034  -0.817  -48.724 1.00 43.53  ? 874  TRP A CZ3 1 
ATOM   2499 C  CH2 . TRP A 1 352 ? -8.280  0.354   -48.905 1.00 42.91  ? 874  TRP A CH2 1 
ATOM   2500 N  N   . ARG A 1 353 ? -8.345  -4.335  -51.116 1.00 46.90  ? 875  ARG A N   1 
ATOM   2501 C  CA  . ARG A 1 353 ? -9.649  -4.014  -51.699 1.00 47.47  ? 875  ARG A CA  1 
ATOM   2502 C  C   . ARG A 1 353 ? -10.384 -5.267  -52.184 1.00 48.40  ? 875  ARG A C   1 
ATOM   2503 O  O   . ARG A 1 353 ? -11.607 -5.316  -52.168 1.00 47.99  ? 875  ARG A O   1 
ATOM   2504 C  CB  . ARG A 1 353 ? -9.482  -3.049  -52.880 1.00 49.12  ? 875  ARG A CB  1 
ATOM   2505 C  CG  . ARG A 1 353 ? -8.829  -1.706  -52.555 1.00 49.04  ? 875  ARG A CG  1 
ATOM   2506 C  CD  . ARG A 1 353 ? -8.508  -0.911  -53.816 1.00 51.04  ? 875  ARG A CD  1 
ATOM   2507 N  NE  . ARG A 1 353 ? -7.617  -1.651  -54.711 1.00 53.47  ? 875  ARG A NE  1 
ATOM   2508 C  CZ  . ARG A 1 353 ? -7.110  -1.189  -55.850 1.00 53.94  ? 875  ARG A CZ  1 
ATOM   2509 N  NH1 . ARG A 1 353 ? -7.376  0.037   -56.257 1.00 54.78  ? 875  ARG A NH1 1 
ATOM   2510 N  NH2 . ARG A 1 353 ? -6.306  -1.958  -56.568 1.00 54.76  ? 875  ARG A NH2 1 
ATOM   2511 N  N   . GLU A 1 354 ? -9.626  -6.265  -52.629 1.00 50.07  ? 876  GLU A N   1 
ATOM   2512 C  CA  . GLU A 1 354 ? -10.183 -7.528  -53.118 1.00 52.73  ? 876  GLU A CA  1 
ATOM   2513 C  C   . GLU A 1 354 ? -10.612 -8.457  -51.960 1.00 50.29  ? 876  GLU A C   1 
ATOM   2514 O  O   . GLU A 1 354 ? -11.401 -9.374  -52.147 1.00 50.28  ? 876  GLU A O   1 
ATOM   2515 C  CB  . GLU A 1 354 ? -9.157  -8.226  -54.026 1.00 55.62  ? 876  GLU A CB  1 
ATOM   2516 C  CG  . GLU A 1 354 ? -9.740  -9.208  -55.035 1.00 59.67  ? 876  GLU A CG  1 
ATOM   2517 C  CD  . GLU A 1 354 ? -10.362 -8.529  -56.244 1.00 63.04  ? 876  GLU A CD  1 
ATOM   2518 O  OE1 . GLU A 1 354 ? -9.958  -7.391  -56.542 1.00 64.62  ? 876  GLU A OE1 1 
ATOM   2519 O  OE2 . GLU A 1 354 ? -11.245 -9.127  -56.907 1.00 64.77  ? 876  GLU A OE2 1 
ATOM   2520 N  N   . ASN A 1 355 ? -10.109 -8.208  -50.758 1.00 48.75  ? 877  ASN A N   1 
ATOM   2521 C  CA  . ASN A 1 355 ? -10.403 -9.074  -49.611 1.00 47.22  ? 877  ASN A CA  1 
ATOM   2522 C  C   . ASN A 1 355 ? -11.309 -8.432  -48.572 1.00 45.40  ? 877  ASN A C   1 
ATOM   2523 O  O   . ASN A 1 355 ? -11.282 -8.813  -47.413 1.00 45.06  ? 877  ASN A O   1 
ATOM   2524 C  CB  . ASN A 1 355 ? -9.100  -9.533  -48.968 1.00 46.04  ? 877  ASN A CB  1 
ATOM   2525 C  CG  . ASN A 1 355 ? -8.243  -10.340 -49.919 1.00 47.86  ? 877  ASN A CG  1 
ATOM   2526 O  OD1 . ASN A 1 355 ? -8.433  -11.545 -50.053 1.00 49.20  ? 877  ASN A OD1 1 
ATOM   2527 N  ND2 . ASN A 1 355 ? -7.301  -9.681  -50.592 1.00 47.82  ? 877  ASN A ND2 1 
ATOM   2528 N  N   . ILE A 1 356 ? -12.114 -7.467  -49.000 1.00 45.64  ? 878  ILE A N   1 
ATOM   2529 C  CA  . ILE A 1 356 ? -13.192 -6.908  -48.174 1.00 45.41  ? 878  ILE A CA  1 
ATOM   2530 C  C   . ILE A 1 356 ? -14.546 -7.133  -48.850 1.00 46.27  ? 878  ILE A C   1 
ATOM   2531 O  O   . ILE A 1 356 ? -14.607 -7.560  -50.000 1.00 47.38  ? 878  ILE A O   1 
ATOM   2532 C  CB  . ILE A 1 356 ? -12.989 -5.400  -47.889 1.00 45.14  ? 878  ILE A CB  1 
ATOM   2533 C  CG1 . ILE A 1 356 ? -12.868 -4.596  -49.192 1.00 46.03  ? 878  ILE A CG1 1 
ATOM   2534 C  CG2 . ILE A 1 356 ? -11.769 -5.192  -46.999 1.00 43.40  ? 878  ILE A CG2 1 
ATOM   2535 C  CD1 . ILE A 1 356 ? -12.647 -3.109  -48.995 1.00 45.72  ? 878  ILE A CD1 1 
ATOM   2536 N  N   . THR A 1 357 ? -15.628 -6.840  -48.141 1.00 45.88  ? 879  THR A N   1 
ATOM   2537 C  CA  . THR A 1 357 ? -16.966 -7.061  -48.679 1.00 46.58  ? 879  THR A CA  1 
ATOM   2538 C  C   . THR A 1 357 ? -17.326 -6.040  -49.757 1.00 48.19  ? 879  THR A C   1 
ATOM   2539 O  O   . THR A 1 357 ? -16.750 -4.960  -49.831 1.00 46.19  ? 879  THR A O   1 
ATOM   2540 C  CB  . THR A 1 357 ? -18.053 -7.047  -47.590 1.00 45.56  ? 879  THR A CB  1 
ATOM   2541 O  OG1 . THR A 1 357 ? -18.065 -5.769  -46.941 1.00 44.19  ? 879  THR A OG1 1 
ATOM   2542 C  CG2 . THR A 1 357 ? -17.825 -8.171  -46.563 1.00 44.94  ? 879  THR A CG2 1 
ATOM   2543 N  N   . VAL A 1 358 ? -18.316 -6.409  -50.575 1.00 52.43  ? 880  VAL A N   1 
ATOM   2544 C  CA  . VAL A 1 358 ? -18.668 -5.670  -51.790 1.00 53.78  ? 880  VAL A CA  1 
ATOM   2545 C  C   . VAL A 1 358 ? -19.186 -4.243  -51.497 1.00 52.52  ? 880  VAL A C   1 
ATOM   2546 O  O   . VAL A 1 358 ? -18.788 -3.299  -52.192 1.00 51.17  ? 880  VAL A O   1 
ATOM   2547 C  CB  . VAL A 1 358 ? -19.650 -6.475  -52.694 1.00 57.34  ? 880  VAL A CB  1 
ATOM   2548 C  CG1 . VAL A 1 358 ? -19.825 -5.775  -54.037 1.00 59.43  ? 880  VAL A CG1 1 
ATOM   2549 C  CG2 . VAL A 1 358 ? -19.158 -7.910  -52.923 1.00 58.56  ? 880  VAL A CG2 1 
ATOM   2550 N  N   . PRO A 1 359 ? -20.040 -4.069  -50.456 1.00 51.93  ? 881  PRO A N   1 
ATOM   2551 C  CA  . PRO A 1 359 ? -20.494 -2.690  -50.176 1.00 51.80  ? 881  PRO A CA  1 
ATOM   2552 C  C   . PRO A 1 359 ? -19.352 -1.733  -49.781 1.00 50.79  ? 881  PRO A C   1 
ATOM   2553 O  O   . PRO A 1 359 ? -19.349 -0.572  -50.203 1.00 51.67  ? 881  PRO A O   1 
ATOM   2554 C  CB  . PRO A 1 359 ? -21.504 -2.857  -49.017 1.00 51.39  ? 881  PRO A CB  1 
ATOM   2555 C  CG  . PRO A 1 359 ? -21.784 -4.320  -48.920 1.00 51.50  ? 881  PRO A CG  1 
ATOM   2556 C  CD  . PRO A 1 359 ? -20.600 -5.040  -49.495 1.00 50.90  ? 881  PRO A CD  1 
ATOM   2557 N  N   . LEU A 1 360 ? -18.389 -2.216  -48.997 1.00 48.98  ? 882  LEU A N   1 
ATOM   2558 C  CA  . LEU A 1 360 ? -17.269 -1.383  -48.569 1.00 47.03  ? 882  LEU A CA  1 
ATOM   2559 C  C   . LEU A 1 360 ? -16.312 -1.120  -49.730 1.00 47.40  ? 882  LEU A C   1 
ATOM   2560 O  O   . LEU A 1 360 ? -15.941 0.029   -49.980 1.00 46.24  ? 882  LEU A O   1 
ATOM   2561 C  CB  . LEU A 1 360 ? -16.524 -2.009  -47.381 1.00 46.09  ? 882  LEU A CB  1 
ATOM   2562 C  CG  . LEU A 1 360 ? -15.391 -1.150  -46.795 1.00 45.46  ? 882  LEU A CG  1 
ATOM   2563 C  CD1 . LEU A 1 360 ? -15.922 0.175   -46.280 1.00 45.86  ? 882  LEU A CD1 1 
ATOM   2564 C  CD2 . LEU A 1 360 ? -14.634 -1.866  -45.697 1.00 44.83  ? 882  LEU A CD2 1 
ATOM   2565 N  N   . GLN A 1 361 ? -15.930 -2.179  -50.442 1.00 47.90  ? 883  GLN A N   1 
ATOM   2566 C  CA  . GLN A 1 361 ? -15.103 -2.052  -51.643 1.00 49.37  ? 883  GLN A CA  1 
ATOM   2567 C  C   . GLN A 1 361 ? -15.648 -0.993  -52.632 1.00 49.50  ? 883  GLN A C   1 
ATOM   2568 O  O   . GLN A 1 361 ? -14.878 -0.235  -53.227 1.00 49.56  ? 883  GLN A O   1 
ATOM   2569 C  CB  . GLN A 1 361 ? -14.979 -3.421  -52.326 1.00 52.09  ? 883  GLN A CB  1 
ATOM   2570 C  CG  . GLN A 1 361 ? -14.031 -3.470  -53.526 1.00 54.21  ? 883  GLN A CG  1 
ATOM   2571 C  CD  . GLN A 1 361 ? -13.942 -4.859  -54.148 1.00 55.76  ? 883  GLN A CD  1 
ATOM   2572 O  OE1 . GLN A 1 361 ? -14.690 -5.770  -53.785 1.00 55.99  ? 883  GLN A OE1 1 
ATOM   2573 N  NE2 . GLN A 1 361 ? -13.015 -5.027  -55.083 1.00 57.33  ? 883  GLN A NE2 1 
ATOM   2574 N  N   . THR A 1 362 ? -16.968 -0.934  -52.781 1.00 49.33  ? 884  THR A N   1 
ATOM   2575 C  CA  . THR A 1 362 ? -17.611 0.058   -53.646 1.00 51.19  ? 884  THR A CA  1 
ATOM   2576 C  C   . THR A 1 362 ? -17.465 1.491   -53.108 1.00 50.26  ? 884  THR A C   1 
ATOM   2577 O  O   . THR A 1 362 ? -17.130 2.409   -53.855 1.00 50.73  ? 884  THR A O   1 
ATOM   2578 C  CB  . THR A 1 362 ? -19.108 -0.280  -53.845 1.00 52.52  ? 884  THR A CB  1 
ATOM   2579 O  OG1 . THR A 1 362 ? -19.229 -1.599  -54.391 1.00 52.53  ? 884  THR A OG1 1 
ATOM   2580 C  CG2 . THR A 1 362 ? -19.796 0.729   -54.773 1.00 53.73  ? 884  THR A CG2 1 
ATOM   2581 N  N   . ASP A 1 363 ? -17.723 1.668   -51.816 1.00 49.85  ? 885  ASP A N   1 
ATOM   2582 C  CA  . ASP A 1 363 ? -17.581 2.967   -51.155 1.00 49.68  ? 885  ASP A CA  1 
ATOM   2583 C  C   . ASP A 1 363 ? -16.160 3.539   -51.263 1.00 49.52  ? 885  ASP A C   1 
ATOM   2584 O  O   . ASP A 1 363 ? -16.000 4.748   -51.427 1.00 50.02  ? 885  ASP A O   1 
ATOM   2585 C  CB  . ASP A 1 363 ? -17.995 2.856   -49.679 1.00 49.47  ? 885  ASP A CB  1 
ATOM   2586 C  CG  . ASP A 1 363 ? -17.899 4.193   -48.927 1.00 50.62  ? 885  ASP A CG  1 
ATOM   2587 O  OD1 . ASP A 1 363 ? -18.439 5.220   -49.402 1.00 51.24  ? 885  ASP A OD1 1 
ATOM   2588 O  OD2 . ASP A 1 363 ? -17.273 4.208   -47.847 1.00 49.80  ? 885  ASP A OD2 1 
ATOM   2589 N  N   . LEU A 1 364 ? -15.138 2.684   -51.186 1.00 48.32  ? 886  LEU A N   1 
ATOM   2590 C  CA  . LEU A 1 364 ? -13.734 3.144   -51.230 1.00 48.14  ? 886  LEU A CA  1 
ATOM   2591 C  C   . LEU A 1 364 ? -13.186 3.378   -52.648 1.00 49.08  ? 886  LEU A C   1 
ATOM   2592 O  O   . LEU A 1 364 ? -12.417 4.308   -52.862 1.00 49.07  ? 886  LEU A O   1 
ATOM   2593 C  CB  . LEU A 1 364 ? -12.819 2.157   -50.487 1.00 46.73  ? 886  LEU A CB  1 
ATOM   2594 C  CG  . LEU A 1 364 ? -13.250 1.796   -49.067 1.00 44.84  ? 886  LEU A CG  1 
ATOM   2595 C  CD1 . LEU A 1 364 ? -12.336 0.738   -48.483 1.00 44.56  ? 886  LEU A CD1 1 
ATOM   2596 C  CD2 . LEU A 1 364 ? -13.284 3.024   -48.186 1.00 44.69  ? 886  LEU A CD2 1 
ATOM   2597 N  N   . ARG A 1 365 ? -13.564 2.520   -53.593 1.00 51.35  ? 887  ARG A N   1 
ATOM   2598 C  CA  . ARG A 1 365 ? -13.167 2.650   -55.003 1.00 54.90  ? 887  ARG A CA  1 
ATOM   2599 C  C   . ARG A 1 365 ? -13.522 4.039   -55.551 1.00 55.30  ? 887  ARG A C   1 
ATOM   2600 O  O   . ARG A 1 365 ? -12.718 4.664   -56.235 1.00 56.48  ? 887  ARG A O   1 
ATOM   2601 C  CB  . ARG A 1 365 ? -13.853 1.542   -55.839 1.00 59.31  ? 887  ARG A CB  1 
ATOM   2602 C  CG  . ARG A 1 365 ? -13.531 1.498   -57.341 1.00 63.40  ? 887  ARG A CG  1 
ATOM   2603 C  CD  . ARG A 1 365 ? -14.572 0.686   -58.123 1.00 65.71  ? 887  ARG A CD  1 
ATOM   2604 N  NE  . ARG A 1 365 ? -15.853 1.393   -58.298 1.00 67.44  ? 887  ARG A NE  1 
ATOM   2605 C  CZ  . ARG A 1 365 ? -16.177 2.188   -59.329 1.00 69.25  ? 887  ARG A CZ  1 
ATOM   2606 N  NH1 . ARG A 1 365 ? -17.375 2.770   -59.378 1.00 68.22  ? 887  ARG A NH1 1 
ATOM   2607 N  NH2 . ARG A 1 365 ? -15.323 2.412   -60.317 1.00 71.08  ? 887  ARG A NH2 1 
ATOM   2608 N  N   . LYS A 1 366 ? -14.705 4.514   -55.187 1.00 54.19  ? 888  LYS A N   1 
ATOM   2609 C  CA  . LYS A 1 366 ? -15.245 5.787   -55.636 1.00 55.71  ? 888  LYS A CA  1 
ATOM   2610 C  C   . LYS A 1 366 ? -14.369 6.980   -55.316 1.00 53.96  ? 888  LYS A C   1 
ATOM   2611 O  O   . LYS A 1 366 ? -14.293 7.917   -56.088 1.00 54.94  ? 888  LYS A O   1 
ATOM   2612 C  CB  . LYS A 1 366 ? -16.622 6.015   -55.012 1.00 57.38  ? 888  LYS A CB  1 
ATOM   2613 C  CG  . LYS A 1 366 ? -17.732 5.182   -55.620 1.00 60.01  ? 888  LYS A CG  1 
ATOM   2614 C  CD  . LYS A 1 366 ? -17.909 5.491   -57.094 1.00 64.98  ? 888  LYS A CD  1 
ATOM   2615 C  CE  . LYS A 1 366 ? -19.095 4.754   -57.690 1.00 65.80  ? 888  LYS A CE  1 
ATOM   2616 N  NZ  . LYS A 1 366 ? -20.134 4.433   -56.679 1.00 65.45  ? 888  LYS A NZ  1 
ATOM   2617 N  N   . PHE A 1 367 ? -13.754 6.955   -54.144 1.00 52.66  ? 889  PHE A N   1 
ATOM   2618 C  CA  . PHE A 1 367 ? -12.878 8.031   -53.707 1.00 51.80  ? 889  PHE A CA  1 
ATOM   2619 C  C   . PHE A 1 367 ? -11.647 8.126   -54.597 1.00 54.12  ? 889  PHE A C   1 
ATOM   2620 O  O   . PHE A 1 367 ? -11.065 9.190   -54.752 1.00 54.47  ? 889  PHE A O   1 
ATOM   2621 C  CB  . PHE A 1 367 ? -12.540 7.903   -52.226 1.00 49.32  ? 889  PHE A CB  1 
ATOM   2622 C  CG  . PHE A 1 367 ? -13.657 8.335   -51.323 1.00 47.80  ? 889  PHE A CG  1 
ATOM   2623 C  CD1 . PHE A 1 367 ? -14.057 9.655   -51.281 1.00 48.31  ? 889  PHE A CD1 1 
ATOM   2624 C  CD2 . PHE A 1 367 ? -14.323 7.417   -50.535 1.00 47.27  ? 889  PHE A CD2 1 
ATOM   2625 C  CE1 . PHE A 1 367 ? -15.087 10.058  -50.458 1.00 48.40  ? 889  PHE A CE1 1 
ATOM   2626 C  CE2 . PHE A 1 367 ? -15.356 7.811   -49.711 1.00 46.87  ? 889  PHE A CE2 1 
ATOM   2627 C  CZ  . PHE A 1 367 ? -15.738 9.133   -49.673 1.00 47.83  ? 889  PHE A CZ  1 
ATOM   2628 N  N   . ARG A 1 368 ? -11.251 6.994   -55.166 1.00 55.54  ? 890  ARG A N   1 
ATOM   2629 C  CA  . ARG A 1 368 ? -10.161 6.956   -56.128 1.00 55.56  ? 890  ARG A CA  1 
ATOM   2630 C  C   . ARG A 1 368 ? -8.852  7.395   -55.507 1.00 52.93  ? 890  ARG A C   1 
ATOM   2631 O  O   . ARG A 1 368 ? -8.014  7.997   -56.171 1.00 53.68  ? 890  ARG A O   1 
ATOM   2632 C  CB  . ARG A 1 368 ? -10.483 7.859   -57.321 1.00 59.20  ? 890  ARG A CB  1 
ATOM   2633 C  CG  . ARG A 1 368 ? -11.623 7.363   -58.196 1.00 62.41  ? 890  ARG A CG  1 
ATOM   2634 C  CD  . ARG A 1 368 ? -11.976 8.368   -59.281 1.00 66.14  ? 890  ARG A CD  1 
ATOM   2635 N  NE  . ARG A 1 368 ? -10.936 8.466   -60.301 1.00 68.73  ? 890  ARG A NE  1 
ATOM   2636 C  CZ  . ARG A 1 368 ? -10.766 9.514   -61.100 1.00 70.07  ? 890  ARG A CZ  1 
ATOM   2637 N  NH1 . ARG A 1 368 ? -11.570 10.560  -61.003 1.00 70.62  ? 890  ARG A NH1 1 
ATOM   2638 N  NH2 . ARG A 1 368 ? -9.792  9.515   -61.996 1.00 70.96  ? 890  ARG A NH2 1 
ATOM   2639 N  N   . THR A 1 369 ? -8.677  7.092   -54.228 1.00 49.74  ? 891  THR A N   1 
ATOM   2640 C  CA  . THR A 1 369 ? -7.458  7.482   -53.534 1.00 48.87  ? 891  THR A CA  1 
ATOM   2641 C  C   . THR A 1 369 ? -6.687  6.356   -52.847 1.00 45.74  ? 891  THR A C   1 
ATOM   2642 O  O   . THR A 1 369 ? -5.497  6.490   -52.595 1.00 45.71  ? 891  THR A O   1 
ATOM   2643 C  CB  . THR A 1 369 ? -7.743  8.610   -52.527 1.00 49.76  ? 891  THR A CB  1 
ATOM   2644 O  OG1 . THR A 1 369 ? -6.522  9.274   -52.192 1.00 50.75  ? 891  THR A OG1 1 
ATOM   2645 C  CG2 . THR A 1 369 ? -8.375  8.057   -51.272 1.00 50.14  ? 891  THR A CG2 1 
ATOM   2646 N  N   . TYR A 1 370 ? -7.353  5.249   -52.551 1.00 43.99  ? 892  TYR A N   1 
ATOM   2647 C  CA  . TYR A 1 370 ? -6.728  4.191   -51.770 1.00 43.44  ? 892  TYR A CA  1 
ATOM   2648 C  C   . TYR A 1 370 ? -5.944  3.232   -52.635 1.00 44.80  ? 892  TYR A C   1 
ATOM   2649 O  O   . TYR A 1 370 ? -6.503  2.634   -53.542 1.00 46.75  ? 892  TYR A O   1 
ATOM   2650 C  CB  . TYR A 1 370 ? -7.782  3.396   -51.013 1.00 41.59  ? 892  TYR A CB  1 
ATOM   2651 C  CG  . TYR A 1 370 ? -8.505  4.194   -49.968 1.00 40.31  ? 892  TYR A CG  1 
ATOM   2652 C  CD1 . TYR A 1 370 ? -7.930  4.440   -48.729 1.00 39.59  ? 892  TYR A CD1 1 
ATOM   2653 C  CD2 . TYR A 1 370 ? -9.767  4.689   -50.203 1.00 40.98  ? 892  TYR A CD2 1 
ATOM   2654 C  CE1 . TYR A 1 370 ? -8.597  5.172   -47.756 1.00 38.66  ? 892  TYR A CE1 1 
ATOM   2655 C  CE2 . TYR A 1 370 ? -10.448 5.409   -49.236 1.00 40.70  ? 892  TYR A CE2 1 
ATOM   2656 C  CZ  . TYR A 1 370 ? -9.862  5.651   -48.013 1.00 38.49  ? 892  TYR A CZ  1 
ATOM   2657 O  OH  . TYR A 1 370 ? -10.550 6.367   -47.066 1.00 36.67  ? 892  TYR A OH  1 
ATOM   2658 N  N   . LYS A 1 371 ? -4.658  3.077   -52.341 1.00 45.49  ? 893  LYS A N   1 
ATOM   2659 C  CA  . LYS A 1 371 ? -3.834  2.034   -52.954 1.00 47.19  ? 893  LYS A CA  1 
ATOM   2660 C  C   . LYS A 1 371 ? -4.010  0.716   -52.205 1.00 44.91  ? 893  LYS A C   1 
ATOM   2661 O  O   . LYS A 1 371 ? -3.778  0.644   -51.007 1.00 43.97  ? 893  LYS A O   1 
ATOM   2662 C  CB  . LYS A 1 371 ? -2.352  2.436   -52.958 1.00 49.33  ? 893  LYS A CB  1 
ATOM   2663 C  CG  . LYS A 1 371 ? -2.066  3.736   -53.696 1.00 51.81  ? 893  LYS A CG  1 
ATOM   2664 C  CD  . LYS A 1 371 ? -0.736  3.712   -54.438 1.00 55.36  ? 893  LYS A CD  1 
ATOM   2665 C  CE  . LYS A 1 371 ? -0.890  4.310   -55.830 1.00 58.18  ? 893  LYS A CE  1 
ATOM   2666 N  NZ  . LYS A 1 371 ? 0.281   3.973   -56.680 1.00 61.38  ? 893  LYS A NZ  1 
ATOM   2667 N  N   . GLY A 1 372 ? -4.402  -0.324  -52.929 1.00 45.11  ? 894  GLY A N   1 
ATOM   2668 C  CA  . GLY A 1 372 ? -4.700  -1.621  -52.342 1.00 44.05  ? 894  GLY A CA  1 
ATOM   2669 C  C   . GLY A 1 372 ? -3.490  -2.449  -51.960 1.00 43.55  ? 894  GLY A C   1 
ATOM   2670 O  O   . GLY A 1 372 ? -3.622  -3.469  -51.282 1.00 41.76  ? 894  GLY A O   1 
ATOM   2671 N  N   . GLY A 1 373 ? -2.314  -2.013  -52.401 1.00 44.97  ? 895  GLY A N   1 
ATOM   2672 C  CA  . GLY A 1 373 ? -1.051  -2.672  -52.063 1.00 45.91  ? 895  GLY A CA  1 
ATOM   2673 C  C   . GLY A 1 373 ? -0.330  -2.090  -50.856 1.00 45.00  ? 895  GLY A C   1 
ATOM   2674 O  O   . GLY A 1 373 ? 0.773   -2.524  -50.537 1.00 46.18  ? 895  GLY A O   1 
ATOM   2675 N  N   . SER A 1 374 ? -0.976  -1.144  -50.172 1.00 43.45  ? 896  SER A N   1 
ATOM   2676 C  CA  . SER A 1 374 ? -0.372  -0.341  -49.116 1.00 41.35  ? 896  SER A CA  1 
ATOM   2677 C  C   . SER A 1 374 ? -1.017  -0.614  -47.751 1.00 39.23  ? 896  SER A C   1 
ATOM   2678 O  O   . SER A 1 374 ? -2.228  -0.701  -47.632 1.00 38.28  ? 896  SER A O   1 
ATOM   2679 C  CB  . SER A 1 374 ? -0.533  1.137   -49.478 1.00 41.41  ? 896  SER A CB  1 
ATOM   2680 O  OG  . SER A 1 374 ? -0.486  1.962   -48.333 1.00 40.54  ? 896  SER A OG  1 
ATOM   2681 N  N   . VAL A 1 375 ? -0.189  -0.740  -46.724 1.00 38.82  ? 897  VAL A N   1 
ATOM   2682 C  CA  . VAL A 1 375 ? -0.662  -0.866  -45.348 1.00 38.08  ? 897  VAL A CA  1 
ATOM   2683 C  C   . VAL A 1 375 ? -1.185  0.471   -44.843 1.00 37.52  ? 897  VAL A C   1 
ATOM   2684 O  O   . VAL A 1 375 ? -2.196  0.535   -44.161 1.00 34.95  ? 897  VAL A O   1 
ATOM   2685 C  CB  . VAL A 1 375 ? 0.454   -1.395  -44.421 1.00 38.04  ? 897  VAL A CB  1 
ATOM   2686 C  CG1 . VAL A 1 375 ? 0.064   -1.285  -42.954 1.00 36.94  ? 897  VAL A CG1 1 
ATOM   2687 C  CG2 . VAL A 1 375 ? 0.776   -2.845  -44.773 1.00 38.98  ? 897  VAL A CG2 1 
ATOM   2688 N  N   . ARG A 1 376 ? -0.483  1.540   -45.185 1.00 39.06  ? 898  ARG A N   1 
ATOM   2689 C  CA  . ARG A 1 376 ? -0.894  2.861   -44.775 1.00 39.90  ? 898  ARG A CA  1 
ATOM   2690 C  C   . ARG A 1 376 ? -2.340  3.124   -45.196 1.00 39.71  ? 898  ARG A C   1 
ATOM   2691 O  O   . ARG A 1 376 ? -3.146  3.632   -44.417 1.00 37.84  ? 898  ARG A O   1 
ATOM   2692 C  CB  . ARG A 1 376 ? 0.005   3.900   -45.417 1.00 41.91  ? 898  ARG A CB  1 
ATOM   2693 C  CG  . ARG A 1 376 ? -0.213  5.309   -44.908 1.00 43.56  ? 898  ARG A CG  1 
ATOM   2694 C  CD  . ARG A 1 376 ? 0.299   6.306   -45.922 1.00 47.90  ? 898  ARG A CD  1 
ATOM   2695 N  NE  . ARG A 1 376 ? 0.949   7.441   -45.283 1.00 50.85  ? 898  ARG A NE  1 
ATOM   2696 C  CZ  . ARG A 1 376 ? 1.065   8.648   -45.818 1.00 53.61  ? 898  ARG A CZ  1 
ATOM   2697 N  NH1 . ARG A 1 376 ? 0.549   8.921   -47.007 1.00 57.78  ? 898  ARG A NH1 1 
ATOM   2698 N  NH2 . ARG A 1 376 ? 1.669   9.601   -45.143 1.00 54.77  ? 898  ARG A NH2 1 
ATOM   2699 N  N   . ASP A 1 377 ? -2.655  2.780   -46.435 1.00 39.49  ? 899  ASP A N   1 
ATOM   2700 C  CA  . ASP A 1 377 ? -3.957  3.125   -46.980 1.00 40.24  ? 899  ASP A CA  1 
ATOM   2701 C  C   . ASP A 1 377 ? -5.093  2.290   -46.411 1.00 37.27  ? 899  ASP A C   1 
ATOM   2702 O  O   . ASP A 1 377 ? -6.196  2.797   -46.269 1.00 35.35  ? 899  ASP A O   1 
ATOM   2703 C  CB  . ASP A 1 377 ? -3.950  3.082   -48.510 1.00 42.61  ? 899  ASP A CB  1 
ATOM   2704 C  CG  . ASP A 1 377 ? -3.456  4.362   -49.107 1.00 44.06  ? 899  ASP A CG  1 
ATOM   2705 O  OD1 . ASP A 1 377 ? -2.865  5.182   -48.378 1.00 45.50  ? 899  ASP A OD1 1 
ATOM   2706 O  OD2 . ASP A 1 377 ? -3.668  4.559   -50.308 1.00 47.15  ? 899  ASP A OD2 1 
ATOM   2707 N  N   . LEU A 1 378 ? -4.816  1.037   -46.063 1.00 36.00  ? 900  LEU A N   1 
ATOM   2708 C  CA  . LEU A 1 378 ? -5.804  0.225   -45.373 1.00 35.28  ? 900  LEU A CA  1 
ATOM   2709 C  C   . LEU A 1 378 ? -6.088  0.773   -43.984 1.00 34.20  ? 900  LEU A C   1 
ATOM   2710 O  O   . LEU A 1 378 ? -7.237  0.776   -43.530 1.00 33.42  ? 900  LEU A O   1 
ATOM   2711 C  CB  . LEU A 1 378 ? -5.360  -1.231  -45.281 1.00 35.46  ? 900  LEU A CB  1 
ATOM   2712 C  CG  . LEU A 1 378 ? -6.273  -2.167  -44.475 1.00 34.72  ? 900  LEU A CG  1 
ATOM   2713 C  CD1 . LEU A 1 378 ? -7.685  -2.192  -45.019 1.00 35.02  ? 900  LEU A CD1 1 
ATOM   2714 C  CD2 . LEU A 1 378 ? -5.689  -3.570  -44.444 1.00 35.14  ? 900  LEU A CD2 1 
ATOM   2715 N  N   . LEU A 1 379 ? -5.041  1.238   -43.310 1.00 33.66  ? 901  LEU A N   1 
ATOM   2716 C  CA  . LEU A 1 379 ? -5.210  1.848   -42.006 1.00 32.62  ? 901  LEU A CA  1 
ATOM   2717 C  C   . LEU A 1 379 ? -5.969  3.156   -42.131 1.00 32.26  ? 901  LEU A C   1 
ATOM   2718 O  O   . LEU A 1 379 ? -6.797  3.466   -41.301 1.00 32.09  ? 901  LEU A O   1 
ATOM   2719 C  CB  . LEU A 1 379 ? -3.864  2.048   -41.302 1.00 32.15  ? 901  LEU A CB  1 
ATOM   2720 C  CG  . LEU A 1 379 ? -3.107  0.782   -40.933 1.00 31.94  ? 901  LEU A CG  1 
ATOM   2721 C  CD1 . LEU A 1 379 ? -1.734  1.147   -40.387 1.00 32.64  ? 901  LEU A CD1 1 
ATOM   2722 C  CD2 . LEU A 1 379 ? -3.865  -0.077  -39.944 1.00 31.13  ? 901  LEU A CD2 1 
ATOM   2723 N  N   . ARG A 1 380 ? -5.700  3.903   -43.186 1.00 33.82  ? 902  ARG A N   1 
ATOM   2724 C  CA  . ARG A 1 380 ? -6.398  5.159   -43.434 1.00 35.14  ? 902  ARG A CA  1 
ATOM   2725 C  C   . ARG A 1 380 ? -7.880  4.918   -43.779 1.00 34.14  ? 902  ARG A C   1 
ATOM   2726 O  O   . ARG A 1 380 ? -8.756  5.657   -43.336 1.00 33.21  ? 902  ARG A O   1 
ATOM   2727 C  CB  . ARG A 1 380 ? -5.689  5.937   -44.546 1.00 37.99  ? 902  ARG A CB  1 
ATOM   2728 C  CG  . ARG A 1 380 ? -6.192  7.353   -44.747 1.00 41.82  ? 902  ARG A CG  1 
ATOM   2729 C  CD  . ARG A 1 380 ? -5.304  8.135   -45.706 1.00 46.04  ? 902  ARG A CD  1 
ATOM   2730 N  NE  . ARG A 1 380 ? -5.175  7.514   -47.039 1.00 48.54  ? 902  ARG A NE  1 
ATOM   2731 C  CZ  . ARG A 1 380 ? -5.921  7.811   -48.110 1.00 50.29  ? 902  ARG A CZ  1 
ATOM   2732 N  NH1 . ARG A 1 380 ? -6.894  8.725   -48.052 1.00 49.28  ? 902  ARG A NH1 1 
ATOM   2733 N  NH2 . ARG A 1 380 ? -5.693  7.179   -49.261 1.00 51.64  ? 902  ARG A NH2 1 
ATOM   2734 N  N   . ALA A 1 381 ? -8.156  3.889   -44.571 1.00 33.70  ? 903  ALA A N   1 
ATOM   2735 C  CA  . ALA A 1 381 ? -9.536  3.517   -44.856 1.00 34.50  ? 903  ALA A CA  1 
ATOM   2736 C  C   . ALA A 1 381 ? -10.273 3.144   -43.573 1.00 33.42  ? 903  ALA A C   1 
ATOM   2737 O  O   . ALA A 1 381 ? -11.409 3.539   -43.391 1.00 33.29  ? 903  ALA A O   1 
ATOM   2738 C  CB  . ALA A 1 381 ? -9.612  2.387   -45.869 1.00 35.08  ? 903  ALA A CB  1 
ATOM   2739 N  N   . MET A 1 382 ? -9.614  2.434   -42.672 1.00 32.91  ? 904  MET A N   1 
ATOM   2740 C  CA  . MET A 1 382 ? -10.219 2.137   -41.373 1.00 33.92  ? 904  MET A CA  1 
ATOM   2741 C  C   . MET A 1 382 ? -10.481 3.389   -40.542 1.00 34.06  ? 904  MET A C   1 
ATOM   2742 O  O   . MET A 1 382 ? -11.559 3.550   -39.986 1.00 33.11  ? 904  MET A O   1 
ATOM   2743 C  CB  . MET A 1 382 ? -9.336  1.206   -40.570 1.00 33.37  ? 904  MET A CB  1 
ATOM   2744 C  CG  . MET A 1 382 ? -9.179  -0.150  -41.217 1.00 34.60  ? 904  MET A CG  1 
ATOM   2745 S  SD  . MET A 1 382 ? -7.855  -1.114  -40.488 1.00 34.28  ? 904  MET A SD  1 
ATOM   2746 C  CE  . MET A 1 382 ? -8.388  -1.114  -38.785 1.00 32.22  ? 904  MET A CE  1 
ATOM   2747 N  N   . ARG A 1 383 ? -9.479  4.254   -40.453 1.00 35.40  ? 905  ARG A N   1 
ATOM   2748 C  CA  . ARG A 1 383 ? -9.598  5.508   -39.718 1.00 37.61  ? 905  ARG A CA  1 
ATOM   2749 C  C   . ARG A 1 383 ? -10.751 6.390   -40.241 1.00 36.83  ? 905  ARG A C   1 
ATOM   2750 O  O   . ARG A 1 383 ? -11.525 6.939   -39.453 1.00 35.33  ? 905  ARG A O   1 
ATOM   2751 C  CB  . ARG A 1 383 ? -8.280  6.288   -39.782 1.00 39.99  ? 905  ARG A CB  1 
ATOM   2752 C  CG  . ARG A 1 383 ? -8.089  7.289   -38.650 1.00 44.51  ? 905  ARG A CG  1 
ATOM   2753 C  CD  . ARG A 1 383 ? -8.566  8.696   -38.964 1.00 49.72  ? 905  ARG A CD  1 
ATOM   2754 N  NE  . ARG A 1 383 ? -8.483  9.524   -37.751 1.00 57.21  ? 905  ARG A NE  1 
ATOM   2755 C  CZ  . ARG A 1 383 ? -9.448  9.683   -36.836 1.00 59.77  ? 905  ARG A CZ  1 
ATOM   2756 N  NH1 . ARG A 1 383 ? -9.225  10.452  -35.784 1.00 63.95  ? 905  ARG A NH1 1 
ATOM   2757 N  NH2 . ARG A 1 383 ? -10.629 9.096   -36.951 1.00 60.07  ? 905  ARG A NH2 1 
ATOM   2758 N  N   . ASN A 1 384 ? -10.839 6.522   -41.562 1.00 36.16  ? 906  ASN A N   1 
ATOM   2759 C  CA  . ASN A 1 384 ? -11.885 7.316   -42.182 1.00 37.61  ? 906  ASN A CA  1 
ATOM   2760 C  C   . ASN A 1 384 ? -13.287 6.746   -41.929 1.00 36.47  ? 906  ASN A C   1 
ATOM   2761 O  O   . ASN A 1 384 ? -14.164 7.466   -41.503 1.00 36.46  ? 906  ASN A O   1 
ATOM   2762 C  CB  . ASN A 1 384 ? -11.625 7.480   -43.687 1.00 38.69  ? 906  ASN A CB  1 
ATOM   2763 C  CG  . ASN A 1 384 ? -10.516 8.482   -43.988 1.00 39.49  ? 906  ASN A CG  1 
ATOM   2764 O  OD1 . ASN A 1 384 ? -9.865  8.417   -45.034 1.00 40.28  ? 906  ASN A OD1 1 
ATOM   2765 N  ND2 . ASN A 1 384 ? -10.298 9.413   -43.076 1.00 39.45  ? 906  ASN A ND2 1 
ATOM   2766 N  N   . LYS A 1 385 ? -13.471 5.451   -42.156 1.00 36.26  ? 907  LYS A N   1 
ATOM   2767 C  CA  . LYS A 1 385 ? -14.753 4.793   -41.899 1.00 36.87  ? 907  LYS A CA  1 
ATOM   2768 C  C   . LYS A 1 385 ? -15.170 4.861   -40.431 1.00 36.93  ? 907  LYS A C   1 
ATOM   2769 O  O   . LYS A 1 385 ? -16.348 4.972   -40.142 1.00 37.00  ? 907  LYS A O   1 
ATOM   2770 C  CB  . LYS A 1 385 ? -14.742 3.339   -42.363 1.00 36.34  ? 907  LYS A CB  1 
ATOM   2771 C  CG  . LYS A 1 385 ? -14.566 3.108   -43.864 1.00 37.13  ? 907  LYS A CG  1 
ATOM   2772 C  CD  . LYS A 1 385 ? -15.537 3.882   -44.744 1.00 38.21  ? 907  LYS A CD  1 
ATOM   2773 C  CE  . LYS A 1 385 ? -14.814 4.936   -45.563 1.00 38.37  ? 907  LYS A CE  1 
ATOM   2774 N  NZ  . LYS A 1 385 ? -15.695 5.986   -46.120 1.00 39.33  ? 907  LYS A NZ  1 
ATOM   2775 N  N   . LYS A 1 386 ? -14.213 4.824   -39.512 1.00 37.51  ? 908  LYS A N   1 
ATOM   2776 C  CA  . LYS A 1 386 ? -14.516 5.067   -38.098 1.00 39.25  ? 908  LYS A CA  1 
ATOM   2777 C  C   . LYS A 1 386 ? -14.975 6.501   -37.818 1.00 40.70  ? 908  LYS A C   1 
ATOM   2778 O  O   . LYS A 1 386 ? -15.911 6.727   -37.054 1.00 40.22  ? 908  LYS A O   1 
ATOM   2779 C  CB  . LYS A 1 386 ? -13.302 4.757   -37.233 1.00 39.09  ? 908  LYS A CB  1 
ATOM   2780 C  CG  . LYS A 1 386 ? -13.556 4.909   -35.750 1.00 40.46  ? 908  LYS A CG  1 
ATOM   2781 C  CD  . LYS A 1 386 ? -12.267 4.796   -34.990 1.00 42.26  ? 908  LYS A CD  1 
ATOM   2782 C  CE  . LYS A 1 386 ? -12.513 4.677   -33.497 1.00 44.51  ? 908  LYS A CE  1 
ATOM   2783 N  NZ  . LYS A 1 386 ? -12.910 5.967   -32.882 1.00 45.97  ? 908  LYS A NZ  1 
ATOM   2784 N  N   . HIS A 1 387 ? -14.283 7.451   -38.425 1.00 43.66  ? 909  HIS A N   1 
ATOM   2785 C  CA  . HIS A 1 387 ? -14.529 8.875   -38.227 1.00 48.29  ? 909  HIS A CA  1 
ATOM   2786 C  C   . HIS A 1 387 ? -15.864 9.311   -38.803 1.00 49.42  ? 909  HIS A C   1 
ATOM   2787 O  O   . HIS A 1 387 ? -16.566 10.136  -38.229 1.00 49.40  ? 909  HIS A O   1 
ATOM   2788 C  CB  . HIS A 1 387 ? -13.408 9.650   -38.916 1.00 51.38  ? 909  HIS A CB  1 
ATOM   2789 C  CG  . HIS A 1 387 ? -13.524 11.136  -38.820 1.00 55.79  ? 909  HIS A CG  1 
ATOM   2790 N  ND1 . HIS A 1 387 ? -14.179 11.892  -39.767 1.00 59.11  ? 909  HIS A ND1 1 
ATOM   2791 C  CD2 . HIS A 1 387 ? -13.008 12.014  -37.928 1.00 59.62  ? 909  HIS A CD2 1 
ATOM   2792 C  CE1 . HIS A 1 387 ? -14.091 13.170  -39.444 1.00 62.20  ? 909  HIS A CE1 1 
ATOM   2793 N  NE2 . HIS A 1 387 ? -13.375 13.272  -38.337 1.00 61.13  ? 909  HIS A NE2 1 
ATOM   2794 N  N   . HIS A 1 388 ? -16.196 8.751   -39.956 1.00 51.06  ? 910  HIS A N   1 
ATOM   2795 C  CA  . HIS A 1 388 ? -17.350 9.171   -40.720 1.00 53.13  ? 910  HIS A CA  1 
ATOM   2796 C  C   . HIS A 1 388 ? -18.493 8.172   -40.568 1.00 52.28  ? 910  HIS A C   1 
ATOM   2797 O  O   . HIS A 1 388 ? -19.421 8.198   -41.368 1.00 52.04  ? 910  HIS A O   1 
ATOM   2798 C  CB  . HIS A 1 388 ? -16.961 9.305   -42.205 1.00 54.98  ? 910  HIS A CB  1 
ATOM   2799 C  CG  . HIS A 1 388 ? -16.139 10.517  -42.510 1.00 57.30  ? 910  HIS A CG  1 
ATOM   2800 N  ND1 . HIS A 1 388 ? -16.664 11.791  -42.497 1.00 60.14  ? 910  HIS A ND1 1 
ATOM   2801 C  CD2 . HIS A 1 388 ? -14.834 10.651  -42.849 1.00 60.24  ? 910  HIS A CD2 1 
ATOM   2802 C  CE1 . HIS A 1 388 ? -15.717 12.659  -42.807 1.00 61.72  ? 910  HIS A CE1 1 
ATOM   2803 N  NE2 . HIS A 1 388 ? -14.597 11.995  -43.025 1.00 61.63  ? 910  HIS A NE2 1 
ATOM   2804 N  N   . TYR A 1 389 ? -18.432 7.324   -39.535 1.00 50.34  ? 911  TYR A N   1 
ATOM   2805 C  CA  . TYR A 1 389 ? -19.283 6.135   -39.429 1.00 50.37  ? 911  TYR A CA  1 
ATOM   2806 C  C   . TYR A 1 389 ? -20.767 6.461   -39.498 1.00 52.81  ? 911  TYR A C   1 
ATOM   2807 O  O   . TYR A 1 389 ? -21.487 5.851   -40.281 1.00 51.82  ? 911  TYR A O   1 
ATOM   2808 C  CB  . TYR A 1 389 ? -18.974 5.354   -38.140 1.00 49.31  ? 911  TYR A CB  1 
ATOM   2809 C  CG  . TYR A 1 389 ? -19.729 4.038   -38.003 1.00 49.12  ? 911  TYR A CG  1 
ATOM   2810 C  CD1 . TYR A 1 389 ? -20.976 3.991   -37.393 1.00 50.19  ? 911  TYR A CD1 1 
ATOM   2811 C  CD2 . TYR A 1 389 ? -19.193 2.840   -38.477 1.00 48.90  ? 911  TYR A CD2 1 
ATOM   2812 C  CE1 . TYR A 1 389 ? -21.674 2.798   -37.266 1.00 49.78  ? 911  TYR A CE1 1 
ATOM   2813 C  CE2 . TYR A 1 389 ? -19.883 1.639   -38.347 1.00 47.99  ? 911  TYR A CE2 1 
ATOM   2814 C  CZ  . TYR A 1 389 ? -21.125 1.628   -37.740 1.00 48.45  ? 911  TYR A CZ  1 
ATOM   2815 O  OH  . TYR A 1 389 ? -21.832 0.464   -37.608 1.00 47.59  ? 911  TYR A OH  1 
ATOM   2816 N  N   . ARG A 1 390 ? -21.215 7.426   -38.696 1.00 55.84  ? 912  ARG A N   1 
ATOM   2817 C  CA  . ARG A 1 390 ? -22.632 7.814   -38.672 1.00 60.66  ? 912  ARG A CA  1 
ATOM   2818 C  C   . ARG A 1 390 ? -23.083 8.265   -40.079 1.00 59.26  ? 912  ARG A C   1 
ATOM   2819 O  O   . ARG A 1 390 ? -24.143 7.880   -40.550 1.00 56.35  ? 912  ARG A O   1 
ATOM   2820 C  CB  . ARG A 1 390 ? -22.906 8.928   -37.636 1.00 65.84  ? 912  ARG A CB  1 
ATOM   2821 C  CG  . ARG A 1 390 ? -22.340 8.707   -36.230 1.00 70.16  ? 912  ARG A CG  1 
ATOM   2822 C  CD  . ARG A 1 390 ? -23.350 8.192   -35.209 1.00 75.47  ? 912  ARG A CD  1 
ATOM   2823 N  NE  . ARG A 1 390 ? -23.941 6.900   -35.582 1.00 81.14  ? 912  ARG A NE  1 
ATOM   2824 C  CZ  . ARG A 1 390 ? -24.335 5.947   -34.727 1.00 82.78  ? 912  ARG A CZ  1 
ATOM   2825 N  NH1 . ARG A 1 390 ? -24.864 4.825   -35.202 1.00 82.84  ? 912  ARG A NH1 1 
ATOM   2826 N  NH2 . ARG A 1 390 ? -24.201 6.085   -33.410 1.00 82.18  ? 912  ARG A NH2 1 
ATOM   2827 N  N   . GLU A 1 391 ? -22.239 9.042   -40.753 1.00 58.34  ? 913  GLU A N   1 
ATOM   2828 C  CA  . GLU A 1 391 ? -22.530 9.582   -42.079 1.00 59.56  ? 913  GLU A CA  1 
ATOM   2829 C  C   . GLU A 1 391 ? -22.447 8.563   -43.232 1.00 56.84  ? 913  GLU A C   1 
ATOM   2830 O  O   . GLU A 1 391 ? -22.798 8.888   -44.357 1.00 57.92  ? 913  GLU A O   1 
ATOM   2831 C  CB  . GLU A 1 391 ? -21.586 10.771  -42.354 1.00 63.61  ? 913  GLU A CB  1 
ATOM   2832 C  CG  . GLU A 1 391 ? -21.737 11.944  -41.370 1.00 67.94  ? 913  GLU A CG  1 
ATOM   2833 C  CD  . GLU A 1 391 ? -20.444 12.318  -40.627 1.00 72.66  ? 913  GLU A CD  1 
ATOM   2834 O  OE1 . GLU A 1 391 ? -19.355 12.372  -41.245 1.00 73.49  ? 913  GLU A OE1 1 
ATOM   2835 O  OE2 . GLU A 1 391 ? -20.512 12.575  -39.404 1.00 76.65  ? 913  GLU A OE2 1 
ATOM   2836 N  N   . LEU A 1 392 ? -22.001 7.339   -42.969 1.00 55.21  ? 914  LEU A N   1 
ATOM   2837 C  CA  . LEU A 1 392 ? -21.849 6.318   -44.027 1.00 55.48  ? 914  LEU A CA  1 
ATOM   2838 C  C   . LEU A 1 392 ? -23.205 5.749   -44.440 1.00 54.49  ? 914  LEU A C   1 
ATOM   2839 O  O   . LEU A 1 392 ? -24.107 5.692   -43.632 1.00 54.83  ? 914  LEU A O   1 
ATOM   2840 C  CB  . LEU A 1 392 ? -20.949 5.152   -43.558 1.00 54.58  ? 914  LEU A CB  1 
ATOM   2841 C  CG  . LEU A 1 392 ? -19.489 5.424   -43.134 1.00 54.53  ? 914  LEU A CG  1 
ATOM   2842 C  CD1 . LEU A 1 392 ? -18.843 4.178   -42.542 1.00 54.41  ? 914  LEU A CD1 1 
ATOM   2843 C  CD2 . LEU A 1 392 ? -18.637 5.937   -44.283 1.00 54.06  ? 914  LEU A CD2 1 
ATOM   2844 N  N   . PRO A 1 393 ? -23.351 5.316   -45.695 1.00 54.59  ? 915  PRO A N   1 
ATOM   2845 C  CA  . PRO A 1 393 ? -24.595 4.654   -46.122 1.00 55.27  ? 915  PRO A CA  1 
ATOM   2846 C  C   . PRO A 1 393 ? -24.973 3.439   -45.271 1.00 54.12  ? 915  PRO A C   1 
ATOM   2847 O  O   . PRO A 1 393 ? -24.102 2.672   -44.887 1.00 51.19  ? 915  PRO A O   1 
ATOM   2848 C  CB  . PRO A 1 393 ? -24.275 4.217   -47.549 1.00 56.04  ? 915  PRO A CB  1 
ATOM   2849 C  CG  . PRO A 1 393 ? -23.304 5.242   -48.031 1.00 56.39  ? 915  PRO A CG  1 
ATOM   2850 C  CD  . PRO A 1 393 ? -22.474 5.625   -46.836 1.00 54.91  ? 915  PRO A CD  1 
ATOM   2851 N  N   . ALA A 1 394 ? -26.264 3.267   -44.999 1.00 54.56  ? 916  ALA A N   1 
ATOM   2852 C  CA  . ALA A 1 394 ? -26.746 2.211   -44.091 1.00 56.52  ? 916  ALA A CA  1 
ATOM   2853 C  C   . ALA A 1 394 ? -26.072 0.855   -44.273 1.00 56.58  ? 916  ALA A C   1 
ATOM   2854 O  O   . ALA A 1 394 ? -25.694 0.223   -43.305 1.00 55.30  ? 916  ALA A O   1 
ATOM   2855 C  CB  . ALA A 1 394 ? -28.258 2.042   -44.227 1.00 57.24  ? 916  ALA A CB  1 
ATOM   2856 N  N   . GLU A 1 395 ? -25.964 0.407   -45.518 1.00 60.05  ? 917  GLU A N   1 
ATOM   2857 C  CA  . GLU A 1 395 ? -25.449 -0.933  -45.841 1.00 60.85  ? 917  GLU A CA  1 
ATOM   2858 C  C   . GLU A 1 395 ? -23.926 -1.060  -45.666 1.00 57.04  ? 917  GLU A C   1 
ATOM   2859 O  O   . GLU A 1 395 ? -23.404 -2.164  -45.556 1.00 53.88  ? 917  GLU A O   1 
ATOM   2860 C  CB  . GLU A 1 395 ? -25.879 -1.342  -47.266 1.00 65.05  ? 917  GLU A CB  1 
ATOM   2861 C  CG  . GLU A 1 395 ? -25.292 -0.494  -48.396 1.00 67.93  ? 917  GLU A CG  1 
ATOM   2862 C  CD  . GLU A 1 395 ? -26.035 -0.635  -49.720 1.00 72.88  ? 917  GLU A CD  1 
ATOM   2863 O  OE1 . GLU A 1 395 ? -25.519 -0.112  -50.733 1.00 75.80  ? 917  GLU A OE1 1 
ATOM   2864 O  OE2 . GLU A 1 395 ? -27.129 -1.246  -49.757 1.00 73.77  ? 917  GLU A OE2 1 
ATOM   2865 N  N   . VAL A 1 396 ? -23.221 0.069   -45.665 1.00 55.24  ? 918  VAL A N   1 
ATOM   2866 C  CA  . VAL A 1 396 ? -21.812 0.089   -45.290 1.00 52.27  ? 918  VAL A CA  1 
ATOM   2867 C  C   . VAL A 1 396 ? -21.722 -0.065  -43.780 1.00 50.69  ? 918  VAL A C   1 
ATOM   2868 O  O   . VAL A 1 396 ? -20.943 -0.870  -43.281 1.00 49.02  ? 918  VAL A O   1 
ATOM   2869 C  CB  . VAL A 1 396 ? -21.117 1.394   -45.706 1.00 51.90  ? 918  VAL A CB  1 
ATOM   2870 C  CG1 . VAL A 1 396 ? -19.690 1.438   -45.177 1.00 51.07  ? 918  VAL A CG1 1 
ATOM   2871 C  CG2 . VAL A 1 396 ? -21.130 1.535   -47.217 1.00 53.68  ? 918  VAL A CG2 1 
ATOM   2872 N  N   . ARG A 1 397 ? -22.528 0.709   -43.056 1.00 50.94  ? 919  ARG A N   1 
ATOM   2873 C  CA  . ARG A 1 397 ? -22.586 0.596   -41.605 1.00 50.54  ? 919  ARG A CA  1 
ATOM   2874 C  C   . ARG A 1 397 ? -22.908 -0.821  -41.198 1.00 49.13  ? 919  ARG A C   1 
ATOM   2875 O  O   . ARG A 1 397 ? -22.272 -1.347  -40.301 1.00 48.71  ? 919  ARG A O   1 
ATOM   2876 C  CB  . ARG A 1 397 ? -23.603 1.555   -40.985 1.00 52.06  ? 919  ARG A CB  1 
ATOM   2877 C  CG  . ARG A 1 397 ? -23.275 3.022   -41.194 1.00 52.75  ? 919  ARG A CG  1 
ATOM   2878 C  CD  . ARG A 1 397 ? -24.066 3.935   -40.261 1.00 54.49  ? 919  ARG A CD  1 
ATOM   2879 N  NE  . ARG A 1 397 ? -25.520 3.700   -40.252 1.00 55.84  ? 919  ARG A NE  1 
ATOM   2880 C  CZ  . ARG A 1 397 ? -26.403 4.229   -41.104 1.00 55.77  ? 919  ARG A CZ  1 
ATOM   2881 N  NH1 . ARG A 1 397 ? -26.019 5.012   -42.102 1.00 56.26  ? 919  ARG A NH1 1 
ATOM   2882 N  NH2 . ARG A 1 397 ? -27.693 3.951   -40.972 1.00 56.41  ? 919  ARG A NH2 1 
ATOM   2883 N  N   . GLU A 1 398 ? -23.860 -1.453  -41.872 1.00 50.11  ? 920  GLU A N   1 
ATOM   2884 C  CA  . GLU A 1 398 ? -24.244 -2.812  -41.503 1.00 51.74  ? 920  GLU A CA  1 
ATOM   2885 C  C   . GLU A 1 398 ? -23.177 -3.857  -41.850 1.00 49.76  ? 920  GLU A C   1 
ATOM   2886 O  O   . GLU A 1 398 ? -23.034 -4.824  -41.110 1.00 50.40  ? 920  GLU A O   1 
ATOM   2887 C  CB  . GLU A 1 398 ? -25.592 -3.216  -42.110 1.00 54.88  ? 920  GLU A CB  1 
ATOM   2888 C  CG  . GLU A 1 398 ? -26.150 -4.522  -41.549 1.00 56.82  ? 920  GLU A CG  1 
ATOM   2889 C  CD  . GLU A 1 398 ? -27.341 -5.061  -42.336 1.00 60.61  ? 920  GLU A CD  1 
ATOM   2890 O  OE1 . GLU A 1 398 ? -27.544 -6.299  -42.356 1.00 61.37  ? 920  GLU A OE1 1 
ATOM   2891 O  OE2 . GLU A 1 398 ? -28.083 -4.252  -42.929 1.00 60.91  ? 920  GLU A OE2 1 
ATOM   2892 N  N   . THR A 1 399 ? -22.440 -3.692  -42.948 1.00 47.42  ? 921  THR A N   1 
ATOM   2893 C  CA  . THR A 1 399 ? -21.388 -4.661  -43.282 1.00 46.74  ? 921  THR A CA  1 
ATOM   2894 C  C   . THR A 1 399 ? -20.219 -4.579  -42.270 1.00 46.26  ? 921  THR A C   1 
ATOM   2895 O  O   . THR A 1 399 ? -19.689 -5.615  -41.842 1.00 44.25  ? 921  THR A O   1 
ATOM   2896 C  CB  . THR A 1 399 ? -20.903 -4.549  -44.763 1.00 47.85  ? 921  THR A CB  1 
ATOM   2897 O  OG1 . THR A 1 399 ? -20.101 -5.691  -45.111 1.00 48.13  ? 921  THR A OG1 1 
ATOM   2898 C  CG2 . THR A 1 399 ? -20.088 -3.294  -45.022 1.00 47.96  ? 921  THR A CG2 1 
ATOM   2899 N  N   . LEU A 1 400 ? -19.848 -3.354  -41.872 1.00 45.03  ? 922  LEU A N   1 
ATOM   2900 C  CA  . LEU A 1 400 ? -18.824 -3.136  -40.842 1.00 42.63  ? 922  LEU A CA  1 
ATOM   2901 C  C   . LEU A 1 400 ? -19.231 -3.643  -39.450 1.00 42.00  ? 922  LEU A C   1 
ATOM   2902 O  O   . LEU A 1 400 ? -18.386 -4.119  -38.697 1.00 41.54  ? 922  LEU A O   1 
ATOM   2903 C  CB  . LEU A 1 400 ? -18.449 -1.646  -40.752 1.00 41.87  ? 922  LEU A CB  1 
ATOM   2904 C  CG  . LEU A 1 400 ? -17.787 -1.002  -41.969 1.00 42.15  ? 922  LEU A CG  1 
ATOM   2905 C  CD1 . LEU A 1 400 ? -17.667 0.494   -41.764 1.00 42.71  ? 922  LEU A CD1 1 
ATOM   2906 C  CD2 . LEU A 1 400 ? -16.419 -1.599  -42.241 1.00 42.14  ? 922  LEU A CD2 1 
ATOM   2907 N  N   . GLY A 1 401 ? -20.515 -3.553  -39.111 1.00 43.68  ? 923  GLY A N   1 
ATOM   2908 C  CA  . GLY A 1 401 ? -20.984 -3.885  -37.766 1.00 43.86  ? 923  GLY A CA  1 
ATOM   2909 C  C   . GLY A 1 401 ? -20.751 -2.700  -36.852 1.00 44.91  ? 923  GLY A C   1 
ATOM   2910 O  O   . GLY A 1 401 ? -20.279 -1.650  -37.299 1.00 44.94  ? 923  GLY A O   1 
ATOM   2911 N  N   . THR A 1 402 ? -21.026 -2.875  -35.575 1.00 45.49  ? 924  THR A N   1 
ATOM   2912 C  CA  . THR A 1 402 ? -20.972 -1.779  -34.625 1.00 45.13  ? 924  THR A CA  1 
ATOM   2913 C  C   . THR A 1 402 ? -19.557 -1.392  -34.155 1.00 41.77  ? 924  THR A C   1 
ATOM   2914 O  O   . THR A 1 402 ? -18.617 -2.168  -34.230 1.00 37.66  ? 924  THR A O   1 
ATOM   2915 C  CB  . THR A 1 402 ? -21.942 -2.031  -33.439 1.00 46.90  ? 924  THR A CB  1 
ATOM   2916 O  OG1 . THR A 1 402 ? -21.485 -1.362  -32.263 1.00 48.59  ? 924  THR A OG1 1 
ATOM   2917 C  CG2 . THR A 1 402 ? -22.079 -3.500  -33.140 1.00 50.80  ? 924  THR A CG2 1 
ATOM   2918 N  N   . LEU A 1 403 ? -19.448 -0.158  -33.687 1.00 41.13  ? 925  LEU A N   1 
ATOM   2919 C  CA  . LEU A 1 403 ? -18.257 0.366   -33.080 1.00 40.55  ? 925  LEU A CA  1 
ATOM   2920 C  C   . LEU A 1 403 ? -18.357 0.166   -31.588 1.00 39.13  ? 925  LEU A C   1 
ATOM   2921 O  O   . LEU A 1 403 ? -19.426 0.359   -31.029 1.00 38.99  ? 925  LEU A O   1 
ATOM   2922 C  CB  . LEU A 1 403 ? -18.134 1.864   -33.355 1.00 41.56  ? 925  LEU A CB  1 
ATOM   2923 C  CG  . LEU A 1 403 ? -17.605 2.271   -34.718 1.00 42.41  ? 925  LEU A CG  1 
ATOM   2924 C  CD1 . LEU A 1 403 ? -17.847 3.749   -34.914 1.00 44.94  ? 925  LEU A CD1 1 
ATOM   2925 C  CD2 . LEU A 1 403 ? -16.120 1.982   -34.829 1.00 42.15  ? 925  LEU A CD2 1 
ATOM   2926 N  N   . PRO A 1 404 ? -17.239 -0.195  -30.933 1.00 38.25  ? 926  PRO A N   1 
ATOM   2927 C  CA  . PRO A 1 404 ? -15.930 -0.474  -31.533 1.00 36.77  ? 926  PRO A CA  1 
ATOM   2928 C  C   . PRO A 1 404 ? -15.679 -1.943  -31.890 1.00 35.89  ? 926  PRO A C   1 
ATOM   2929 O  O   . PRO A 1 404 ? -14.889 -2.219  -32.792 1.00 35.69  ? 926  PRO A O   1 
ATOM   2930 C  CB  . PRO A 1 404 ? -14.951 -0.029  -30.442 1.00 36.25  ? 926  PRO A CB  1 
ATOM   2931 C  CG  . PRO A 1 404 ? -15.700 -0.184  -29.164 1.00 36.48  ? 926  PRO A CG  1 
ATOM   2932 C  CD  . PRO A 1 404 ? -17.165 -0.121  -29.460 1.00 37.71  ? 926  PRO A CD  1 
ATOM   2933 N  N   . ASP A 1 405 ? -16.344 -2.864  -31.195 1.00 35.77  ? 927  ASP A N   1 
ATOM   2934 C  CA  . ASP A 1 405 ? -15.966 -4.279  -31.212 1.00 35.67  ? 927  ASP A CA  1 
ATOM   2935 C  C   . ASP A 1 405 ? -16.072 -4.959  -32.585 1.00 34.10  ? 927  ASP A C   1 
ATOM   2936 O  O   . ASP A 1 405 ? -15.097 -5.537  -33.062 1.00 32.26  ? 927  ASP A O   1 
ATOM   2937 C  CB  . ASP A 1 405 ? -16.743 -5.072  -30.137 1.00 37.24  ? 927  ASP A CB  1 
ATOM   2938 C  CG  . ASP A 1 405 ? -16.322 -4.707  -28.689 1.00 38.85  ? 927  ASP A CG  1 
ATOM   2939 O  OD1 . ASP A 1 405 ? -15.450 -3.825  -28.483 1.00 39.58  ? 927  ASP A OD1 1 
ATOM   2940 O  OD2 . ASP A 1 405 ? -16.871 -5.314  -27.745 1.00 40.61  ? 927  ASP A OD2 1 
ATOM   2941 N  N   . ASP A 1 406 ? -17.231 -4.881  -33.225 1.00 35.02  ? 928  ASP A N   1 
ATOM   2942 C  CA  . ASP A 1 406 ? -17.440 -5.553  -34.526 1.00 35.62  ? 928  ASP A CA  1 
ATOM   2943 C  C   . ASP A 1 406 ? -16.655 -4.919  -35.672 1.00 35.02  ? 928  ASP A C   1 
ATOM   2944 O  O   . ASP A 1 406 ? -16.124 -5.618  -36.546 1.00 34.38  ? 928  ASP A O   1 
ATOM   2945 C  CB  . ASP A 1 406 ? -18.921 -5.591  -34.895 1.00 37.00  ? 928  ASP A CB  1 
ATOM   2946 C  CG  . ASP A 1 406 ? -19.714 -6.488  -34.001 1.00 36.73  ? 928  ASP A CG  1 
ATOM   2947 O  OD1 . ASP A 1 406 ? -19.135 -7.258  -33.227 1.00 36.39  ? 928  ASP A OD1 1 
ATOM   2948 O  OD2 . ASP A 1 406 ? -20.937 -6.406  -34.067 1.00 39.89  ? 928  ASP A OD2 1 
ATOM   2949 N  N   . PHE A 1 407 ? -16.596 -3.592  -35.650 1.00 34.52  ? 929  PHE A N   1 
ATOM   2950 C  CA  . PHE A 1 407 ? -15.841 -2.819  -36.616 1.00 33.31  ? 929  PHE A CA  1 
ATOM   2951 C  C   . PHE A 1 407 ? -14.392 -3.280  -36.687 1.00 32.31  ? 929  PHE A C   1 
ATOM   2952 O  O   . PHE A 1 407 ? -13.891 -3.568  -37.764 1.00 31.98  ? 929  PHE A O   1 
ATOM   2953 C  CB  . PHE A 1 407 ? -15.925 -1.342  -36.236 1.00 32.89  ? 929  PHE A CB  1 
ATOM   2954 C  CG  . PHE A 1 407 ? -15.199 -0.418  -37.174 1.00 32.77  ? 929  PHE A CG  1 
ATOM   2955 C  CD1 . PHE A 1 407 ? -13.843 -0.192  -37.034 1.00 31.04  ? 929  PHE A CD1 1 
ATOM   2956 C  CD2 . PHE A 1 407 ? -15.886 0.262   -38.173 1.00 33.68  ? 929  PHE A CD2 1 
ATOM   2957 C  CE1 . PHE A 1 407 ? -13.184 0.673   -37.883 1.00 31.39  ? 929  PHE A CE1 1 
ATOM   2958 C  CE2 . PHE A 1 407 ? -15.225 1.144   -39.017 1.00 33.13  ? 929  PHE A CE2 1 
ATOM   2959 C  CZ  . PHE A 1 407 ? -13.875 1.345   -38.872 1.00 32.19  ? 929  PHE A CZ  1 
ATOM   2960 N  N   . VAL A 1 408 ? -13.717 -3.364  -35.544 1.00 31.55  ? 930  VAL A N   1 
ATOM   2961 C  CA  . VAL A 1 408 ? -12.295 -3.750  -35.549 1.00 31.33  ? 930  VAL A CA  1 
ATOM   2962 C  C   . VAL A 1 408 ? -12.108 -5.197  -36.029 1.00 31.19  ? 930  VAL A C   1 
ATOM   2963 O  O   . VAL A 1 408 ? -11.198 -5.479  -36.798 1.00 30.06  ? 930  VAL A O   1 
ATOM   2964 C  CB  . VAL A 1 408 ? -11.604 -3.450  -34.183 1.00 30.44  ? 930  VAL A CB  1 
ATOM   2965 C  CG1 . VAL A 1 408 ? -12.030 -4.421  -33.091 1.00 30.64  ? 930  VAL A CG1 1 
ATOM   2966 C  CG2 . VAL A 1 408 ? -10.086 -3.406  -34.315 1.00 29.77  ? 930  VAL A CG2 1 
ATOM   2967 N  N   . CYS A 1 409 ? -13.019 -6.080  -35.615 1.00 32.88  ? 931  CYS A N   1 
ATOM   2968 C  CA  . CYS A 1 409 ? -12.987 -7.496  -35.994 1.00 33.47  ? 931  CYS A CA  1 
ATOM   2969 C  C   . CYS A 1 409 ? -13.241 -7.714  -37.466 1.00 33.69  ? 931  CYS A C   1 
ATOM   2970 O  O   . CYS A 1 409 ? -12.748 -8.685  -38.032 1.00 34.01  ? 931  CYS A O   1 
ATOM   2971 C  CB  . CYS A 1 409 ? -13.974 -8.316  -35.158 1.00 34.80  ? 931  CYS A CB  1 
ATOM   2972 S  SG  . CYS A 1 409 ? -13.448 -8.520  -33.433 1.00 36.68  ? 931  CYS A SG  1 
ATOM   2973 N  N   . TYR A 1 410 ? -14.007 -6.818  -38.090 1.00 34.07  ? 932  TYR A N   1 
ATOM   2974 C  CA  . TYR A 1 410 ? -14.208 -6.847  -39.535 1.00 33.80  ? 932  TYR A CA  1 
ATOM   2975 C  C   . TYR A 1 410 ? -12.855 -6.896  -40.228 1.00 33.11  ? 932  TYR A C   1 
ATOM   2976 O  O   . TYR A 1 410 ? -12.650 -7.681  -41.155 1.00 32.69  ? 932  TYR A O   1 
ATOM   2977 C  CB  . TYR A 1 410 ? -15.029 -5.617  -40.001 1.00 35.79  ? 932  TYR A CB  1 
ATOM   2978 C  CG  . TYR A 1 410 ? -15.283 -5.549  -41.504 1.00 36.42  ? 932  TYR A CG  1 
ATOM   2979 C  CD1 . TYR A 1 410 ? -14.320 -5.043  -42.355 1.00 36.51  ? 932  TYR A CD1 1 
ATOM   2980 C  CD2 . TYR A 1 410 ? -16.471 -6.007  -42.061 1.00 38.13  ? 932  TYR A CD2 1 
ATOM   2981 C  CE1 . TYR A 1 410 ? -14.520 -4.982  -43.721 1.00 38.32  ? 932  TYR A CE1 1 
ATOM   2982 C  CE2 . TYR A 1 410 ? -16.690 -5.948  -43.437 1.00 39.88  ? 932  TYR A CE2 1 
ATOM   2983 C  CZ  . TYR A 1 410 ? -15.697 -5.433  -44.263 1.00 39.42  ? 932  TYR A CZ  1 
ATOM   2984 O  OH  . TYR A 1 410 ? -15.843 -5.361  -45.622 1.00 39.00  ? 932  TYR A OH  1 
ATOM   2985 N  N   . PHE A 1 411 ? -11.925 -6.073  -39.743 1.00 32.80  ? 933  PHE A N   1 
ATOM   2986 C  CA  . PHE A 1 411 ? -10.610 -5.909  -40.364 1.00 32.47  ? 933  PHE A CA  1 
ATOM   2987 C  C   . PHE A 1 411 ? -9.585  -6.935  -39.890 1.00 31.55  ? 933  PHE A C   1 
ATOM   2988 O  O   . PHE A 1 411 ? -8.844  -7.485  -40.706 1.00 30.66  ? 933  PHE A O   1 
ATOM   2989 C  CB  . PHE A 1 411 ? -10.100 -4.478  -40.147 1.00 32.75  ? 933  PHE A CB  1 
ATOM   2990 C  CG  . PHE A 1 411 ? -10.913 -3.439  -40.862 1.00 33.62  ? 933  PHE A CG  1 
ATOM   2991 C  CD1 . PHE A 1 411 ? -10.821 -3.295  -42.238 1.00 35.12  ? 933  PHE A CD1 1 
ATOM   2992 C  CD2 . PHE A 1 411 ? -11.782 -2.624  -40.172 1.00 34.09  ? 933  PHE A CD2 1 
ATOM   2993 C  CE1 . PHE A 1 411 ? -11.586 -2.355  -42.911 1.00 36.38  ? 933  PHE A CE1 1 
ATOM   2994 C  CE2 . PHE A 1 411 ? -12.549 -1.680  -40.835 1.00 35.49  ? 933  PHE A CE2 1 
ATOM   2995 C  CZ  . PHE A 1 411 ? -12.450 -1.541  -42.207 1.00 36.27  ? 933  PHE A CZ  1 
ATOM   2996 N  N   . THR A 1 412 ? -9.549  -7.190  -38.583 1.00 30.82  ? 934  THR A N   1 
ATOM   2997 C  CA  . THR A 1 412 ? -8.590  -8.149  -38.015 1.00 31.06  ? 934  THR A CA  1 
ATOM   2998 C  C   . THR A 1 412 ? -8.884  -9.606  -38.384 1.00 31.86  ? 934  THR A C   1 
ATOM   2999 O  O   . THR A 1 412 ? -7.962  -10.402 -38.551 1.00 32.10  ? 934  THR A O   1 
ATOM   3000 C  CB  . THR A 1 412 ? -8.439  -8.024  -36.477 1.00 30.60  ? 934  THR A CB  1 
ATOM   3001 O  OG1 . THR A 1 412 ? -9.677  -8.293  -35.802 1.00 30.67  ? 934  THR A OG1 1 
ATOM   3002 C  CG2 . THR A 1 412 ? -7.951  -6.659  -36.109 1.00 30.88  ? 934  THR A CG2 1 
ATOM   3003 N  N   . SER A 1 413 ? -10.157 -9.956  -38.522 1.00 33.56  ? 935  SER A N   1 
ATOM   3004 C  CA  . SER A 1 413 ? -10.528 -11.278 -39.020 1.00 34.45  ? 935  SER A CA  1 
ATOM   3005 C  C   . SER A 1 413 ? -10.178 -11.441 -40.508 1.00 36.12  ? 935  SER A C   1 
ATOM   3006 O  O   . SER A 1 413 ? -9.898  -12.543 -40.957 1.00 35.85  ? 935  SER A O   1 
ATOM   3007 C  CB  . SER A 1 413 ? -12.013 -11.535 -38.809 1.00 35.09  ? 935  SER A CB  1 
ATOM   3008 O  OG  . SER A 1 413 ? -12.780 -10.789 -39.739 1.00 35.62  ? 935  SER A OG  1 
ATOM   3009 N  N   . ARG A 1 414 ? -10.206 -10.356 -41.275 1.00 37.83  ? 936  ARG A N   1 
ATOM   3010 C  CA  . ARG A 1 414 ? -9.855  -10.437 -42.705 1.00 39.48  ? 936  ARG A CA  1 
ATOM   3011 C  C   . ARG A 1 414 ? -8.353  -10.311 -42.932 1.00 38.15  ? 936  ARG A C   1 
ATOM   3012 O  O   . ARG A 1 414 ? -7.815  -10.902 -43.861 1.00 38.52  ? 936  ARG A O   1 
ATOM   3013 C  CB  . ARG A 1 414 ? -10.632 -9.411  -43.538 1.00 40.51  ? 936  ARG A CB  1 
ATOM   3014 C  CG  . ARG A 1 414 ? -12.049 -9.870  -43.868 1.00 43.85  ? 936  ARG A CG  1 
ATOM   3015 C  CD  . ARG A 1 414 ? -12.988 -8.743  -44.319 1.00 45.25  ? 936  ARG A CD  1 
ATOM   3016 N  NE  . ARG A 1 414 ? -14.288 -8.859  -43.642 1.00 46.64  ? 936  ARG A NE  1 
ATOM   3017 C  CZ  . ARG A 1 414 ? -15.352 -9.493  -44.125 1.00 49.80  ? 936  ARG A CZ  1 
ATOM   3018 N  NH1 . ARG A 1 414 ? -15.328 -10.062 -45.329 1.00 54.09  ? 936  ARG A NH1 1 
ATOM   3019 N  NH2 . ARG A 1 414 ? -16.464 -9.545  -43.407 1.00 50.41  ? 936  ARG A NH2 1 
ATOM   3020 N  N   . PHE A 1 415 ? -7.680  -9.542  -42.083 1.00 37.29  ? 937  PHE A N   1 
ATOM   3021 C  CA  . PHE A 1 415 ? -6.225  -9.370  -42.181 1.00 37.50  ? 937  PHE A CA  1 
ATOM   3022 C  C   . PHE A 1 415 ? -5.582  -9.720  -40.837 1.00 35.53  ? 937  PHE A C   1 
ATOM   3023 O  O   . PHE A 1 415 ? -5.299  -8.840  -40.033 1.00 35.35  ? 937  PHE A O   1 
ATOM   3024 C  CB  . PHE A 1 415 ? -5.890  -7.949  -42.624 1.00 37.38  ? 937  PHE A CB  1 
ATOM   3025 C  CG  . PHE A 1 415 ? -6.628  -7.532  -43.860 1.00 38.45  ? 937  PHE A CG  1 
ATOM   3026 C  CD1 . PHE A 1 415 ? -6.159  -7.892  -45.114 1.00 40.10  ? 937  PHE A CD1 1 
ATOM   3027 C  CD2 . PHE A 1 415 ? -7.806  -6.799  -43.766 1.00 37.77  ? 937  PHE A CD2 1 
ATOM   3028 C  CE1 . PHE A 1 415 ? -6.857  -7.531  -46.251 1.00 41.50  ? 937  PHE A CE1 1 
ATOM   3029 C  CE2 . PHE A 1 415 ? -8.503  -6.439  -44.891 1.00 39.28  ? 937  PHE A CE2 1 
ATOM   3030 C  CZ  . PHE A 1 415 ? -8.032  -6.806  -46.137 1.00 41.24  ? 937  PHE A CZ  1 
ATOM   3031 N  N   . PRO A 1 416 ? -5.365  -11.019 -40.594 1.00 35.02  ? 938  PRO A N   1 
ATOM   3032 C  CA  . PRO A 1 416 ? -4.964  -11.480 -39.256 1.00 34.61  ? 938  PRO A CA  1 
ATOM   3033 C  C   . PRO A 1 416 ? -3.539  -11.121 -38.833 1.00 33.46  ? 938  PRO A C   1 
ATOM   3034 O  O   . PRO A 1 416 ? -3.211  -11.247 -37.655 1.00 31.98  ? 938  PRO A O   1 
ATOM   3035 C  CB  . PRO A 1 416 ? -5.158  -13.010 -39.327 1.00 34.73  ? 938  PRO A CB  1 
ATOM   3036 C  CG  . PRO A 1 416 ? -5.142  -13.342 -40.764 1.00 36.11  ? 938  PRO A CG  1 
ATOM   3037 C  CD  . PRO A 1 416 ? -5.638  -12.139 -41.512 1.00 36.17  ? 938  PRO A CD  1 
ATOM   3038 N  N   . HIS A 1 417 ? -2.713  -10.692 -39.780 1.00 34.05  ? 939  HIS A N   1 
ATOM   3039 C  CA  . HIS A 1 417 ? -1.383  -10.178 -39.476 1.00 34.54  ? 939  HIS A CA  1 
ATOM   3040 C  C   . HIS A 1 417 ? -1.309  -8.655  -39.418 1.00 33.41  ? 939  HIS A C   1 
ATOM   3041 O  O   . HIS A 1 417 ? -0.239  -8.125  -39.156 1.00 32.66  ? 939  HIS A O   1 
ATOM   3042 C  CB  . HIS A 1 417 ? -0.359  -10.671 -40.496 1.00 36.63  ? 939  HIS A CB  1 
ATOM   3043 C  CG  . HIS A 1 417 ? -0.016  -12.113 -40.348 1.00 38.07  ? 939  HIS A CG  1 
ATOM   3044 N  ND1 . HIS A 1 417 ? 1.081   -12.543 -39.637 1.00 38.35  ? 939  HIS A ND1 1 
ATOM   3045 C  CD2 . HIS A 1 417 ? -0.628  -13.224 -40.817 1.00 39.48  ? 939  HIS A CD2 1 
ATOM   3046 C  CE1 . HIS A 1 417 ? 1.121   -13.861 -39.666 1.00 39.36  ? 939  HIS A CE1 1 
ATOM   3047 N  NE2 . HIS A 1 417 ? 0.096   -14.298 -40.375 1.00 39.83  ? 939  HIS A NE2 1 
ATOM   3048 N  N   . LEU A 1 418 ? -2.421  -7.948  -39.632 1.00 32.73  ? 940  LEU A N   1 
ATOM   3049 C  CA  . LEU A 1 418 ? -2.352  -6.475  -39.700 1.00 32.49  ? 940  LEU A CA  1 
ATOM   3050 C  C   . LEU A 1 418 ? -1.803  -5.874  -38.408 1.00 30.63  ? 940  LEU A C   1 
ATOM   3051 O  O   . LEU A 1 418 ? -0.877  -5.072  -38.447 1.00 29.60  ? 940  LEU A O   1 
ATOM   3052 C  CB  . LEU A 1 418 ? -3.706  -5.855  -40.023 1.00 32.68  ? 940  LEU A CB  1 
ATOM   3053 C  CG  . LEU A 1 418 ? -3.734  -4.338  -40.246 1.00 33.18  ? 940  LEU A CG  1 
ATOM   3054 C  CD1 . LEU A 1 418 ? -2.753  -3.865  -41.302 1.00 33.89  ? 940  LEU A CD1 1 
ATOM   3055 C  CD2 . LEU A 1 418 ? -5.137  -3.897  -40.628 1.00 34.09  ? 940  LEU A CD2 1 
ATOM   3056 N  N   . LEU A 1 419 ? -2.353  -6.298  -37.276 1.00 29.85  ? 941  LEU A N   1 
ATOM   3057 C  CA  . LEU A 1 419 ? -1.984  -5.710  -35.993 1.00 29.89  ? 941  LEU A CA  1 
ATOM   3058 C  C   . LEU A 1 419 ? -0.561  -6.059  -35.604 1.00 29.97  ? 941  LEU A C   1 
ATOM   3059 O  O   . LEU A 1 419 ? 0.243   -5.174  -35.362 1.00 29.97  ? 941  LEU A O   1 
ATOM   3060 C  CB  . LEU A 1 419 ? -2.948  -6.106  -34.868 1.00 28.72  ? 941  LEU A CB  1 
ATOM   3061 C  CG  . LEU A 1 419 ? -2.668  -5.458  -33.492 1.00 29.03  ? 941  LEU A CG  1 
ATOM   3062 C  CD1 . LEU A 1 419 ? -2.427  -3.963  -33.617 1.00 29.67  ? 941  LEU A CD1 1 
ATOM   3063 C  CD2 . LEU A 1 419 ? -3.791  -5.708  -32.487 1.00 29.15  ? 941  LEU A CD2 1 
ATOM   3064 N  N   . ALA A 1 420 ? -0.254  -7.349  -35.555 1.00 30.68  ? 942  ALA A N   1 
ATOM   3065 C  CA  . ALA A 1 420 ? 1.090   -7.799  -35.197 1.00 30.44  ? 942  ALA A CA  1 
ATOM   3066 C  C   . ALA A 1 420 ? 2.141   -7.078  -36.017 1.00 30.61  ? 942  ALA A C   1 
ATOM   3067 O  O   . ALA A 1 420 ? 3.116   -6.568  -35.468 1.00 30.97  ? 942  ALA A O   1 
ATOM   3068 C  CB  . ALA A 1 420 ? 1.215   -9.298  -35.387 1.00 30.93  ? 942  ALA A CB  1 
ATOM   3069 N  N   . HIS A 1 421 ? 1.915   -7.012  -37.325 1.00 30.45  ? 943  HIS A N   1 
ATOM   3070 C  CA  . HIS A 1 421 ? 2.806   -6.310  -38.227 1.00 31.68  ? 943  HIS A CA  1 
ATOM   3071 C  C   . HIS A 1 421 ? 2.874   -4.812  -37.959 1.00 30.71  ? 943  HIS A C   1 
ATOM   3072 O  O   . HIS A 1 421 ? 3.944   -4.231  -37.980 1.00 31.38  ? 943  HIS A O   1 
ATOM   3073 C  CB  . HIS A 1 421 ? 2.373   -6.545  -39.674 1.00 33.89  ? 943  HIS A CB  1 
ATOM   3074 C  CG  . HIS A 1 421 ? 3.066   -5.672  -40.667 1.00 34.34  ? 943  HIS A CG  1 
ATOM   3075 N  ND1 . HIS A 1 421 ? 4.225   -6.048  -41.299 1.00 36.34  ? 943  HIS A ND1 1 
ATOM   3076 C  CD2 . HIS A 1 421 ? 2.757   -4.445  -41.141 1.00 35.00  ? 943  HIS A CD2 1 
ATOM   3077 C  CE1 . HIS A 1 421 ? 4.609   -5.085  -42.115 1.00 37.05  ? 943  HIS A CE1 1 
ATOM   3078 N  NE2 . HIS A 1 421 ? 3.734   -4.103  -42.042 1.00 36.69  ? 943  HIS A NE2 1 
ATOM   3079 N  N   . THR A 1 422 ? 1.735   -4.183  -37.708 1.00 29.51  ? 944  THR A N   1 
ATOM   3080 C  CA  . THR A 1 422 ? 1.723   -2.754  -37.440 1.00 28.45  ? 944  THR A CA  1 
ATOM   3081 C  C   . THR A 1 422 ? 2.390   -2.448  -36.101 1.00 28.49  ? 944  THR A C   1 
ATOM   3082 O  O   . THR A 1 422 ? 3.098   -1.443  -35.967 1.00 28.75  ? 944  THR A O   1 
ATOM   3083 C  CB  . THR A 1 422 ? 0.305   -2.186  -37.529 1.00 27.52  ? 944  THR A CB  1 
ATOM   3084 O  OG1 . THR A 1 422 ? -0.212  -2.439  -38.839 1.00 26.48  ? 944  THR A OG1 1 
ATOM   3085 C  CG2 . THR A 1 422 ? 0.306   -0.711  -37.272 1.00 27.97  ? 944  THR A CG2 1 
ATOM   3086 N  N   . TYR A 1 423 ? 2.224   -3.348  -35.137 1.00 28.48  ? 945  TYR A N   1 
ATOM   3087 C  CA  . TYR A 1 423 ? 2.870   -3.208  -33.834 1.00 29.15  ? 945  TYR A CA  1 
ATOM   3088 C  C   . TYR A 1 423 ? 4.418   -3.238  -33.909 1.00 31.63  ? 945  TYR A C   1 
ATOM   3089 O  O   . TYR A 1 423 ? 5.097   -2.469  -33.223 1.00 30.80  ? 945  TYR A O   1 
ATOM   3090 C  CB  . TYR A 1 423 ? 2.351   -4.280  -32.870 1.00 27.85  ? 945  TYR A CB  1 
ATOM   3091 C  CG  . TYR A 1 423 ? 2.736   -4.031  -31.437 1.00 26.68  ? 945  TYR A CG  1 
ATOM   3092 C  CD1 . TYR A 1 423 ? 2.284   -2.918  -30.776 1.00 26.68  ? 945  TYR A CD1 1 
ATOM   3093 C  CD2 . TYR A 1 423 ? 3.586   -4.885  -30.764 1.00 26.84  ? 945  TYR A CD2 1 
ATOM   3094 C  CE1 . TYR A 1 423 ? 2.637   -2.660  -29.473 1.00 27.08  ? 945  TYR A CE1 1 
ATOM   3095 C  CE2 . TYR A 1 423 ? 3.958   -4.641  -29.451 1.00 26.85  ? 945  TYR A CE2 1 
ATOM   3096 C  CZ  . TYR A 1 423 ? 3.472   -3.530  -28.802 1.00 27.34  ? 945  TYR A CZ  1 
ATOM   3097 O  OH  . TYR A 1 423 ? 3.819   -3.276  -27.488 1.00 27.83  ? 945  TYR A OH  1 
ATOM   3098 N  N   . ARG A 1 424 ? 4.968   -4.115  -34.743 1.00 34.80  ? 946  ARG A N   1 
ATOM   3099 C  CA  . ARG A 1 424 ? 6.426   -4.212  -34.899 1.00 37.63  ? 946  ARG A CA  1 
ATOM   3100 C  C   . ARG A 1 424 ? 6.989   -3.000  -35.580 1.00 37.56  ? 946  ARG A C   1 
ATOM   3101 O  O   . ARG A 1 424 ? 7.962   -2.436  -35.113 1.00 38.80  ? 946  ARG A O   1 
ATOM   3102 C  CB  . ARG A 1 424 ? 6.834   -5.456  -35.686 1.00 40.34  ? 946  ARG A CB  1 
ATOM   3103 C  CG  . ARG A 1 424 ? 6.503   -6.738  -34.966 1.00 42.63  ? 946  ARG A CG  1 
ATOM   3104 C  CD  . ARG A 1 424 ? 7.424   -7.861  -35.347 1.00 47.50  ? 946  ARG A CD  1 
ATOM   3105 N  NE  . ARG A 1 424 ? 6.817   -8.777  -36.301 1.00 51.62  ? 946  ARG A NE  1 
ATOM   3106 C  CZ  . ARG A 1 424 ? 6.847   -10.103 -36.203 1.00 55.56  ? 946  ARG A CZ  1 
ATOM   3107 N  NH1 . ARG A 1 424 ? 7.442   -10.709 -35.175 1.00 54.09  ? 946  ARG A NH1 1 
ATOM   3108 N  NH2 . ARG A 1 424 ? 6.263   -10.832 -37.148 1.00 59.73  ? 946  ARG A NH2 1 
ATOM   3109 N  N   . ALA A 1 425 ? 6.369   -2.601  -36.684 1.00 37.48  ? 947  ALA A N   1 
ATOM   3110 C  CA  . ALA A 1 425 ? 6.857   -1.482  -37.469 1.00 37.84  ? 947  ALA A CA  1 
ATOM   3111 C  C   . ALA A 1 425 ? 6.821   -0.188  -36.683 1.00 38.16  ? 947  ALA A C   1 
ATOM   3112 O  O   . ALA A 1 425 ? 7.716   0.624   -36.816 1.00 40.57  ? 947  ALA A O   1 
ATOM   3113 C  CB  . ALA A 1 425 ? 6.058   -1.341  -38.756 1.00 38.28  ? 947  ALA A CB  1 
ATOM   3114 N  N   . MET A 1 426 ? 5.793   0.017   -35.867 1.00 38.56  ? 948  MET A N   1 
ATOM   3115 C  CA  . MET A 1 426 ? 5.657   1.293   -35.151 1.00 40.29  ? 948  MET A CA  1 
ATOM   3116 C  C   . MET A 1 426 ? 6.467   1.372   -33.850 1.00 41.22  ? 948  MET A C   1 
ATOM   3117 O  O   . MET A 1 426 ? 6.365   2.352   -33.108 1.00 39.95  ? 948  MET A O   1 
ATOM   3118 C  CB  . MET A 1 426 ? 4.182   1.628   -34.889 1.00 38.80  ? 948  MET A CB  1 
ATOM   3119 C  CG  . MET A 1 426 ? 3.389   1.873   -36.160 1.00 40.19  ? 948  MET A CG  1 
ATOM   3120 S  SD  . MET A 1 426 ? 3.969   3.215   -37.196 1.00 38.34  ? 948  MET A SD  1 
ATOM   3121 C  CE  . MET A 1 426 ? 3.511   4.540   -36.119 1.00 39.37  ? 948  MET A CE  1 
ATOM   3122 N  N   . GLU A 1 427 ? 7.320   0.388   -33.630 1.00 43.41  ? 949  GLU A N   1 
ATOM   3123 C  CA  . GLU A 1 427 ? 8.237   0.426   -32.514 1.00 46.53  ? 949  GLU A CA  1 
ATOM   3124 C  C   . GLU A 1 427 ? 9.257   1.548   -32.685 1.00 45.10  ? 949  GLU A C   1 
ATOM   3125 O  O   . GLU A 1 427 ? 9.856   1.986   -31.725 1.00 44.25  ? 949  GLU A O   1 
ATOM   3126 C  CB  . GLU A 1 427 ? 8.927   -0.919  -32.361 1.00 50.94  ? 949  GLU A CB  1 
ATOM   3127 C  CG  . GLU A 1 427 ? 9.583   -1.131  -31.016 1.00 56.58  ? 949  GLU A CG  1 
ATOM   3128 C  CD  . GLU A 1 427 ? 9.654   -2.588  -30.640 1.00 61.27  ? 949  GLU A CD  1 
ATOM   3129 O  OE1 . GLU A 1 427 ? 8.955   -2.989  -29.686 1.00 66.75  ? 949  GLU A OE1 1 
ATOM   3130 O  OE2 . GLU A 1 427 ? 10.404  -3.330  -31.304 1.00 63.54  ? 949  GLU A OE2 1 
ATOM   3131 N  N   . LEU A 1 428 ? 9.433   2.016   -33.915 1.00 45.82  ? 950  LEU A N   1 
ATOM   3132 C  CA  . LEU A 1 428 ? 10.230  3.225   -34.195 1.00 47.12  ? 950  LEU A CA  1 
ATOM   3133 C  C   . LEU A 1 428 ? 9.760   4.444   -33.409 1.00 44.87  ? 950  LEU A C   1 
ATOM   3134 O  O   . LEU A 1 428 ? 10.549  5.323   -33.110 1.00 46.71  ? 950  LEU A O   1 
ATOM   3135 C  CB  . LEU A 1 428 ? 10.213  3.567   -35.697 1.00 50.66  ? 950  LEU A CB  1 
ATOM   3136 C  CG  . LEU A 1 428 ? 11.251  2.918   -36.635 1.00 53.80  ? 950  LEU A CG  1 
ATOM   3137 C  CD1 . LEU A 1 428 ? 12.675  3.177   -36.165 1.00 54.84  ? 950  LEU A CD1 1 
ATOM   3138 C  CD2 . LEU A 1 428 ? 11.023  1.419   -36.784 1.00 54.96  ? 950  LEU A CD2 1 
ATOM   3139 N  N   . CYS A 1 429 ? 8.475   4.491   -33.081 1.00 42.92  ? 951  CYS A N   1 
ATOM   3140 C  CA  . CYS A 1 429 ? 7.879   5.590   -32.336 1.00 41.37  ? 951  CYS A CA  1 
ATOM   3141 C  C   . CYS A 1 429 ? 7.559   5.222   -30.889 1.00 39.71  ? 951  CYS A C   1 
ATOM   3142 O  O   . CYS A 1 429 ? 6.702   5.839   -30.267 1.00 38.71  ? 951  CYS A O   1 
ATOM   3143 C  CB  . CYS A 1 429 ? 6.580   6.031   -33.030 1.00 41.68  ? 951  CYS A CB  1 
ATOM   3144 S  SG  . CYS A 1 429 ? 6.732   6.484   -34.770 1.00 41.32  ? 951  CYS A SG  1 
ATOM   3145 N  N   . SER A 1 430 ? 8.252   4.235   -30.333 1.00 40.60  ? 952  SER A N   1 
ATOM   3146 C  CA  . SER A 1 430 ? 7.900   3.713   -29.005 1.00 39.07  ? 952  SER A CA  1 
ATOM   3147 C  C   . SER A 1 430 ? 8.190   4.676   -27.873 1.00 39.87  ? 952  SER A C   1 
ATOM   3148 O  O   . SER A 1 430 ? 7.586   4.560   -26.833 1.00 38.59  ? 952  SER A O   1 
ATOM   3149 C  CB  . SER A 1 430 ? 8.583   2.362   -28.735 1.00 38.41  ? 952  SER A CB  1 
ATOM   3150 O  OG  . SER A 1 430 ? 9.969   2.482   -28.487 1.00 37.28  ? 952  SER A OG  1 
ATOM   3151 N  N   . HIS A 1 431 ? 9.089   5.634   -28.087 1.00 44.10  ? 953  HIS A N   1 
ATOM   3152 C  CA  . HIS A 1 431 ? 9.431   6.651   -27.073 1.00 46.85  ? 953  HIS A CA  1 
ATOM   3153 C  C   . HIS A 1 431 ? 8.491   7.850   -27.075 1.00 44.24  ? 953  HIS A C   1 
ATOM   3154 O  O   . HIS A 1 431 ? 8.477   8.630   -26.131 1.00 43.54  ? 953  HIS A O   1 
ATOM   3155 C  CB  . HIS A 1 431 ? 10.873  7.138   -27.276 1.00 52.28  ? 953  HIS A CB  1 
ATOM   3156 C  CG  . HIS A 1 431 ? 11.897  6.066   -27.065 1.00 58.22  ? 953  HIS A CG  1 
ATOM   3157 N  ND1 . HIS A 1 431 ? 12.140  5.502   -25.826 1.00 61.67  ? 953  HIS A ND1 1 
ATOM   3158 C  CD2 . HIS A 1 431 ? 12.720  5.432   -27.934 1.00 61.32  ? 953  HIS A CD2 1 
ATOM   3159 C  CE1 . HIS A 1 431 ? 13.075  4.576   -25.941 1.00 62.27  ? 953  HIS A CE1 1 
ATOM   3160 N  NE2 . HIS A 1 431 ? 13.443  4.514   -27.210 1.00 63.40  ? 953  HIS A NE2 1 
ATOM   3161 N  N   . GLU A 1 432 ? 7.709   7.993   -28.138 1.00 42.54  ? 954  GLU A N   1 
ATOM   3162 C  CA  . GLU A 1 432 ? 6.784   9.123   -28.281 1.00 42.62  ? 954  GLU A CA  1 
ATOM   3163 C  C   . GLU A 1 432 ? 5.596   8.995   -27.341 1.00 40.58  ? 954  GLU A C   1 
ATOM   3164 O  O   . GLU A 1 432 ? 5.054   7.918   -27.153 1.00 38.02  ? 954  GLU A O   1 
ATOM   3165 C  CB  . GLU A 1 432 ? 6.282   9.257   -29.731 1.00 42.12  ? 954  GLU A CB  1 
ATOM   3166 C  CG  . GLU A 1 432 ? 7.386   9.548   -30.737 1.00 43.25  ? 954  GLU A CG  1 
ATOM   3167 C  CD  . GLU A 1 432 ? 6.940   9.494   -32.192 1.00 43.02  ? 954  GLU A CD  1 
ATOM   3168 O  OE1 . GLU A 1 432 ? 7.825   9.600   -33.063 1.00 42.47  ? 954  GLU A OE1 1 
ATOM   3169 O  OE2 . GLU A 1 432 ? 5.725   9.344   -32.467 1.00 42.42  ? 954  GLU A OE2 1 
ATOM   3170 N  N   . ARG A 1 433 ? 5.182   10.124  -26.790 1.00 41.99  ? 955  ARG A N   1 
ATOM   3171 C  CA  . ARG A 1 433 ? 4.111   10.180  -25.811 1.00 42.69  ? 955  ARG A CA  1 
ATOM   3172 C  C   . ARG A 1 433 ? 2.767   9.624   -26.301 1.00 40.00  ? 955  ARG A C   1 
ATOM   3173 O  O   . ARG A 1 433 ? 2.049   8.989   -25.546 1.00 39.24  ? 955  ARG A O   1 
ATOM   3174 C  CB  . ARG A 1 433 ? 3.974   11.609  -25.294 1.00 45.32  ? 955  ARG A CB  1 
ATOM   3175 C  CG  . ARG A 1 433 ? 2.852   11.815  -24.306 1.00 48.09  ? 955  ARG A CG  1 
ATOM   3176 C  CD  . ARG A 1 433 ? 3.279   11.468  -22.901 1.00 50.14  ? 955  ARG A CD  1 
ATOM   3177 N  NE  . ARG A 1 433 ? 4.555   12.077  -22.567 1.00 54.07  ? 955  ARG A NE  1 
ATOM   3178 C  CZ  . ARG A 1 433 ? 4.689   13.136  -21.782 1.00 56.32  ? 955  ARG A CZ  1 
ATOM   3179 N  NH1 . ARG A 1 433 ? 5.887   13.621  -21.526 1.00 58.20  ? 955  ARG A NH1 1 
ATOM   3180 N  NH2 . ARG A 1 433 ? 3.626   13.703  -21.250 1.00 58.90  ? 955  ARG A NH2 1 
ATOM   3181 N  N   . LEU A 1 434 ? 2.442   9.858   -27.564 1.00 38.53  ? 956  LEU A N   1 
ATOM   3182 C  CA  . LEU A 1 434 ? 1.256   9.272   -28.185 1.00 37.19  ? 956  LEU A CA  1 
ATOM   3183 C  C   . LEU A 1 434 ? 1.190   7.744   -28.014 1.00 36.63  ? 956  LEU A C   1 
ATOM   3184 O  O   . LEU A 1 434 ? 0.109   7.182   -27.853 1.00 34.64  ? 956  LEU A O   1 
ATOM   3185 C  CB  . LEU A 1 434 ? 1.231   9.597   -29.688 1.00 37.85  ? 956  LEU A CB  1 
ATOM   3186 C  CG  . LEU A 1 434 ? -0.068  9.748   -30.512 1.00 37.55  ? 956  LEU A CG  1 
ATOM   3187 C  CD1 . LEU A 1 434 ? 0.155   9.135   -31.889 1.00 37.02  ? 956  LEU A CD1 1 
ATOM   3188 C  CD2 . LEU A 1 434 ? -1.327  9.178   -29.865 1.00 36.05  ? 956  LEU A CD2 1 
ATOM   3189 N  N   . PHE A 1 435 ? 2.349   7.082   -28.048 1.00 37.58  ? 957  PHE A N   1 
ATOM   3190 C  CA  . PHE A 1 435 ? 2.416   5.629   -28.069 1.00 37.27  ? 957  PHE A CA  1 
ATOM   3191 C  C   . PHE A 1 435 ? 2.769   4.938   -26.733 1.00 37.40  ? 957  PHE A C   1 
ATOM   3192 O  O   . PHE A 1 435 ? 3.067   3.743   -26.718 1.00 35.92  ? 957  PHE A O   1 
ATOM   3193 C  CB  . PHE A 1 435 ? 3.381   5.182   -29.180 1.00 37.00  ? 957  PHE A CB  1 
ATOM   3194 C  CG  . PHE A 1 435 ? 2.880   5.476   -30.568 1.00 37.45  ? 957  PHE A CG  1 
ATOM   3195 C  CD1 . PHE A 1 435 ? 1.885   4.701   -31.138 1.00 37.70  ? 957  PHE A CD1 1 
ATOM   3196 C  CD2 . PHE A 1 435 ? 3.400   6.522   -31.303 1.00 39.59  ? 957  PHE A CD2 1 
ATOM   3197 C  CE1 . PHE A 1 435 ? 1.409   4.971   -32.408 1.00 37.85  ? 957  PHE A CE1 1 
ATOM   3198 C  CE2 . PHE A 1 435 ? 2.935   6.800   -32.575 1.00 40.09  ? 957  PHE A CE2 1 
ATOM   3199 C  CZ  . PHE A 1 435 ? 1.937   6.023   -33.130 1.00 39.57  ? 957  PHE A CZ  1 
ATOM   3200 N  N   . GLN A 1 436 ? 2.707   5.644   -25.612 1.00 39.55  ? 958  GLN A N   1 
ATOM   3201 C  CA  . GLN A 1 436 ? 3.045   4.992   -24.335 1.00 40.39  ? 958  GLN A CA  1 
ATOM   3202 C  C   . GLN A 1 436 ? 1.923   4.128   -23.731 1.00 38.00  ? 958  GLN A C   1 
ATOM   3203 O  O   . GLN A 1 436 ? 2.195   3.307   -22.864 1.00 37.54  ? 958  GLN A O   1 
ATOM   3204 C  CB  . GLN A 1 436 ? 3.616   5.991   -23.321 1.00 44.21  ? 958  GLN A CB  1 
ATOM   3205 C  CG  . GLN A 1 436 ? 2.597   6.838   -22.594 1.00 48.45  ? 958  GLN A CG  1 
ATOM   3206 C  CD  . GLN A 1 436 ? 2.558   6.565   -21.104 1.00 51.71  ? 958  GLN A CD  1 
ATOM   3207 O  OE1 . GLN A 1 436 ? 2.097   5.498   -20.655 1.00 53.54  ? 958  GLN A OE1 1 
ATOM   3208 N  NE2 . GLN A 1 436 ? 3.026   7.545   -20.316 1.00 52.38  ? 958  GLN A NE2 1 
ATOM   3209 N  N   . PRO A 1 437 ? 0.667   4.268   -24.207 1.00 36.56  ? 959  PRO A N   1 
ATOM   3210 C  CA  . PRO A 1 437 ? -0.300  3.209   -23.862 1.00 34.50  ? 959  PRO A CA  1 
ATOM   3211 C  C   . PRO A 1 437 ? -0.024  1.855   -24.538 1.00 31.48  ? 959  PRO A C   1 
ATOM   3212 O  O   . PRO A 1 437 ? -0.552  0.830   -24.103 1.00 29.29  ? 959  PRO A O   1 
ATOM   3213 C  CB  . PRO A 1 437 ? -1.630  3.780   -24.359 1.00 35.49  ? 959  PRO A CB  1 
ATOM   3214 C  CG  . PRO A 1 437 ? -1.420  5.254   -24.429 1.00 36.33  ? 959  PRO A CG  1 
ATOM   3215 C  CD  . PRO A 1 437 ? 0.003   5.408   -24.860 1.00 37.22  ? 959  PRO A CD  1 
ATOM   3216 N  N   . TYR A 1 438 ? 0.803   1.870   -25.585 1.00 30.33  ? 960  TYR A N   1 
ATOM   3217 C  CA  . TYR A 1 438 ? 1.058   0.694   -26.417 1.00 28.96  ? 960  TYR A CA  1 
ATOM   3218 C  C   . TYR A 1 438 ? 2.465   0.091   -26.298 1.00 28.14  ? 960  TYR A C   1 
ATOM   3219 O  O   . TYR A 1 438 ? 2.667   -1.057  -26.659 1.00 26.30  ? 960  TYR A O   1 
ATOM   3220 C  CB  . TYR A 1 438 ? 0.774   1.033   -27.882 1.00 28.47  ? 960  TYR A CB  1 
ATOM   3221 C  CG  . TYR A 1 438 ? -0.534  1.769   -28.111 1.00 28.06  ? 960  TYR A CG  1 
ATOM   3222 C  CD1 . TYR A 1 438 ? -1.754  1.138   -27.946 1.00 27.19  ? 960  TYR A CD1 1 
ATOM   3223 C  CD2 . TYR A 1 438 ? -0.545  3.099   -28.512 1.00 29.07  ? 960  TYR A CD2 1 
ATOM   3224 C  CE1 . TYR A 1 438 ? -2.945  1.809   -28.162 1.00 27.05  ? 960  TYR A CE1 1 
ATOM   3225 C  CE2 . TYR A 1 438 ? -1.738  3.773   -28.724 1.00 28.87  ? 960  TYR A CE2 1 
ATOM   3226 C  CZ  . TYR A 1 438 ? -2.926  3.121   -28.550 1.00 27.31  ? 960  TYR A CZ  1 
ATOM   3227 O  OH  . TYR A 1 438 ? -4.080  3.792   -28.776 1.00 26.25  ? 960  TYR A OH  1 
ATOM   3228 N  N   . TYR A 1 439 ? 3.438   0.848   -25.823 1.00 29.20  ? 961  TYR A N   1 
ATOM   3229 C  CA  . TYR A 1 439 ? 4.783   0.299   -25.648 1.00 31.24  ? 961  TYR A CA  1 
ATOM   3230 C  C   . TYR A 1 439 ? 5.360   0.751   -24.319 1.00 32.94  ? 961  TYR A C   1 
ATOM   3231 O  O   . TYR A 1 439 ? 4.867   1.705   -23.724 1.00 33.42  ? 961  TYR A O   1 
ATOM   3232 C  CB  . TYR A 1 439 ? 5.721   0.763   -26.761 1.00 31.56  ? 961  TYR A CB  1 
ATOM   3233 C  CG  . TYR A 1 439 ? 5.298   0.466   -28.180 1.00 31.41  ? 961  TYR A CG  1 
ATOM   3234 C  CD1 . TYR A 1 439 ? 4.451   1.330   -28.867 1.00 31.07  ? 961  TYR A CD1 1 
ATOM   3235 C  CD2 . TYR A 1 439 ? 5.779   -0.657  -28.859 1.00 31.21  ? 961  TYR A CD2 1 
ATOM   3236 C  CE1 . TYR A 1 439 ? 4.085   1.084   -30.177 1.00 30.98  ? 961  TYR A CE1 1 
ATOM   3237 C  CE2 . TYR A 1 439 ? 5.403   -0.914  -30.168 1.00 31.18  ? 961  TYR A CE2 1 
ATOM   3238 C  CZ  . TYR A 1 439 ? 4.558   -0.036  -30.829 1.00 31.15  ? 961  TYR A CZ  1 
ATOM   3239 O  OH  . TYR A 1 439 ? 4.167   -0.275  -32.131 1.00 30.28  ? 961  TYR A OH  1 
ATOM   3240 N  N   . PHE A 1 440 ? 6.417   0.087   -23.870 1.00 35.52  ? 962  PHE A N   1 
ATOM   3241 C  CA  . PHE A 1 440 ? 7.098   0.514   -22.659 1.00 39.90  ? 962  PHE A CA  1 
ATOM   3242 C  C   . PHE A 1 440 ? 8.526   0.981   -22.912 1.00 44.00  ? 962  PHE A C   1 
ATOM   3243 O  O   . PHE A 1 440 ? 9.183   0.500   -23.826 1.00 41.79  ? 962  PHE A O   1 
ATOM   3244 C  CB  . PHE A 1 440 ? 7.105   -0.581  -21.597 1.00 39.26  ? 962  PHE A CB  1 
ATOM   3245 C  CG  . PHE A 1 440 ? 7.925   -0.231  -20.396 1.00 40.12  ? 962  PHE A CG  1 
ATOM   3246 C  CD1 . PHE A 1 440 ? 7.384   0.518   -19.370 1.00 41.50  ? 962  PHE A CD1 1 
ATOM   3247 C  CD2 . PHE A 1 440 ? 9.247   -0.619  -20.309 1.00 39.96  ? 962  PHE A CD2 1 
ATOM   3248 C  CE1 . PHE A 1 440 ? 8.141   0.858   -18.269 1.00 42.52  ? 962  PHE A CE1 1 
ATOM   3249 C  CE2 . PHE A 1 440 ? 10.009  -0.281  -19.212 1.00 40.59  ? 962  PHE A CE2 1 
ATOM   3250 C  CZ  . PHE A 1 440 ? 9.456   0.457   -18.190 1.00 41.63  ? 962  PHE A CZ  1 
ATOM   3251 N  N   . HIS A 1 441 ? 8.955   1.925   -22.071 1.00 51.67  ? 963  HIS A N   1 
ATOM   3252 C  CA  . HIS A 1 441 ? 10.306  2.508   -21.979 1.00 59.80  ? 963  HIS A CA  1 
ATOM   3253 C  C   . HIS A 1 441 ? 10.228  4.029   -21.951 1.00 61.76  ? 963  HIS A C   1 
ATOM   3254 O  O   . HIS A 1 441 ? 9.593   4.645   -22.809 1.00 63.23  ? 963  HIS A O   1 
ATOM   3255 C  CB  . HIS A 1 441 ? 11.261  2.051   -23.086 1.00 63.46  ? 963  HIS A CB  1 
ATOM   3256 C  CG  . HIS A 1 441 ? 12.402  1.216   -22.590 1.00 67.30  ? 963  HIS A CG  1 
ATOM   3257 N  ND1 . HIS A 1 441 ? 13.225  0.502   -23.434 1.00 67.59  ? 963  HIS A ND1 1 
ATOM   3258 C  CD2 . HIS A 1 441 ? 12.852  0.978   -21.336 1.00 66.27  ? 963  HIS A CD2 1 
ATOM   3259 C  CE1 . HIS A 1 441 ? 14.132  -0.140  -22.720 1.00 67.37  ? 963  HIS A CE1 1 
ATOM   3260 N  NE2 . HIS A 1 441 ? 13.928  0.132   -21.444 1.00 65.63  ? 963  HIS A NE2 1 
HETATM 3261 C  C21 . 3E4 B 2 .   ? -5.809  -25.013 -1.347  1.00 28.83  ? 1001 3E4 A C21 1 
HETATM 3262 C  C22 . 3E4 B 2 .   ? -6.027  -26.352 -1.984  1.00 28.29  ? 1001 3E4 A C22 1 
HETATM 3263 C  C23 . 3E4 B 2 .   ? -5.825  -26.262 -3.449  1.00 29.90  ? 1001 3E4 A C23 1 
HETATM 3264 N  N6  . 3E4 B 2 .   ? -5.846  -27.585 -3.996  1.00 30.56  ? 1001 3E4 A N6  1 
HETATM 3265 C  C24 . 3E4 B 2 .   ? -4.499  -25.634 -3.790  1.00 29.33  ? 1001 3E4 A C24 1 
HETATM 3266 C  C25 . 3E4 B 2 .   ? -4.231  -24.356 -3.050  1.00 29.07  ? 1001 3E4 A C25 1 
HETATM 3267 C  C20 . 3E4 B 2 .   ? -4.417  -24.526 -1.568  1.00 28.65  ? 1001 3E4 A C20 1 
HETATM 3268 N  N4  . 3E4 B 2 .   ? -4.235  -23.289 -0.849  1.00 29.41  ? 1001 3E4 A N4  1 
HETATM 3269 C  C12 . 3E4 B 2 .   ? -3.075  -22.799 -0.595  1.00 28.33  ? 1001 3E4 A C12 1 
HETATM 3270 N  N2  . 3E4 B 2 .   ? -2.049  -23.578 -0.564  1.00 27.26  ? 1001 3E4 A N2  1 
HETATM 3271 N  N3  . 3E4 B 2 .   ? -2.951  -21.519 -0.367  1.00 28.51  ? 1001 3E4 A N3  1 
HETATM 3272 C  C15 . 3E4 B 2 .   ? -1.802  -20.987 -0.118  1.00 27.41  ? 1001 3E4 A C15 1 
HETATM 3273 C  C13 . 3E4 B 2 .   ? -0.707  -21.795 -0.075  1.00 28.17  ? 1001 3E4 A C13 1 
HETATM 3274 C  C11 . 3E4 B 2 .   ? -0.861  -23.129 -0.321  1.00 28.55  ? 1001 3E4 A C11 1 
HETATM 3275 C  C14 . 3E4 B 2 .   ? 0.159   -24.050 -0.268  1.00 29.20  ? 1001 3E4 A C14 1 
HETATM 3276 C  C16 . 3E4 B 2 .   ? -0.225  -25.351 -0.151  1.00 29.51  ? 1001 3E4 A C16 1 
HETATM 3277 C  C17 . 3E4 B 2 .   ? 0.709   -26.329 -0.071  1.00 30.25  ? 1001 3E4 A C17 1 
HETATM 3278 C  C18 . 3E4 B 2 .   ? 2.004   -25.949 -0.090  1.00 29.15  ? 1001 3E4 A C18 1 
HETATM 3279 N  N5  . 3E4 B 2 .   ? 2.353   -24.704 -0.180  1.00 31.20  ? 1001 3E4 A N5  1 
HETATM 3280 C  C19 . 3E4 B 2 .   ? 1.490   -23.733 -0.262  1.00 30.43  ? 1001 3E4 A C19 1 
HETATM 3281 O  O1  . 3E4 B 2 .   ? 1.878   -22.456 -0.368  1.00 33.20  ? 1001 3E4 A O1  1 
HETATM 3282 C  C4  . 3E4 B 2 .   ? 3.082   -22.014 -0.053  1.00 32.88  ? 1001 3E4 A C4  1 
HETATM 3283 C  C5  . 3E4 B 2 .   ? 4.067   -21.896 -0.986  1.00 33.33  ? 1001 3E4 A C5  1 
HETATM 3284 C  C26 . 3E4 B 2 .   ? 3.877   -22.331 -2.400  1.00 31.42  ? 1001 3E4 A C26 1 
HETATM 3285 C  C6  . 3E4 B 2 .   ? 5.291   -21.432 -0.635  1.00 35.10  ? 1001 3E4 A C6  1 
HETATM 3286 C  C3  . 3E4 B 2 .   ? 3.320   -21.591 1.202   1.00 32.48  ? 1001 3E4 A C3  1 
HETATM 3287 C  C10 . 3E4 B 2 .   ? 2.331   -21.678 2.130   1.00 32.06  ? 1001 3E4 A C10 1 
HETATM 3288 C  C9  . 3E4 B 2 .   ? 2.539   -21.287 3.422   1.00 30.89  ? 1001 3E4 A C9  1 
HETATM 3289 C  C8  . 3E4 B 2 .   ? 3.752   -20.783 3.782   1.00 31.14  ? 1001 3E4 A C8  1 
HETATM 3290 C  C7  . 3E4 B 2 .   ? 4.752   -20.693 2.849   1.00 32.17  ? 1001 3E4 A C7  1 
HETATM 3291 C  C2  . 3E4 B 2 .   ? 4.538   -21.102 1.562   1.00 33.82  ? 1001 3E4 A C2  1 
HETATM 3292 C  C1  . 3E4 B 2 .   ? 5.537   -21.021 0.633   1.00 36.52  ? 1001 3E4 A C1  1 
HETATM 3293 N  N1  . 3E4 B 2 .   ? 6.707   -20.546 0.921   1.00 41.72  ? 1001 3E4 A N1  1 
HETATM 3294 S  S1  . 3E4 B 2 .   ? 7.174   -19.117 0.354   1.00 51.09  ? 1001 3E4 A S1  1 
HETATM 3295 O  O2  . 3E4 B 2 .   ? 6.399   -18.653 -0.786  1.00 47.06  ? 1001 3E4 A O2  1 
HETATM 3296 O  O3  . 3E4 B 2 .   ? 8.558   -19.217 0.080   1.00 51.10  ? 1001 3E4 A O3  1 
HETATM 3297 C  C27 . 3E4 B 2 .   ? 6.924   -17.844 1.373   1.00 52.56  ? 1001 3E4 A C27 1 
HETATM 3298 C  C32 . 3E4 B 2 .   ? 5.965   -16.970 0.938   1.00 52.06  ? 1001 3E4 A C32 1 
HETATM 3299 C  C31 . 3E4 B 2 .   ? 5.680   -15.873 1.712   1.00 52.33  ? 1001 3E4 A C31 1 
HETATM 3300 C  C30 . 3E4 B 2 .   ? 6.331   -15.660 2.902   1.00 52.15  ? 1001 3E4 A C30 1 
HETATM 3301 C  C29 . 3E4 B 2 .   ? 7.283   -16.528 3.332   1.00 52.63  ? 1001 3E4 A C29 1 
HETATM 3302 C  C28 . 3E4 B 2 .   ? 7.572   -17.606 2.566   1.00 53.23  ? 1001 3E4 A C28 1 
HETATM 3303 CL CL1 . 3E4 B 2 .   ? 8.756   -18.621 3.183   1.00 63.38  ? 1001 3E4 A CL1 1 
HETATM 3304 S  S   . SO4 C 3 .   ? 4.782   -24.202 -34.805 1.00 58.78  ? 1002 SO4 A S   1 
HETATM 3305 O  O1  . SO4 C 3 .   ? 5.199   -23.829 -36.175 1.00 58.12  ? 1002 SO4 A O1  1 
HETATM 3306 O  O2  . SO4 C 3 .   ? 3.354   -23.887 -34.613 1.00 55.68  ? 1002 SO4 A O2  1 
HETATM 3307 O  O3  . SO4 C 3 .   ? 4.950   -25.650 -34.556 1.00 56.50  ? 1002 SO4 A O3  1 
HETATM 3308 O  O4  . SO4 C 3 .   ? 5.618   -23.415 -33.864 1.00 60.50  ? 1002 SO4 A O4  1 
HETATM 3309 S  S   . SO4 D 3 .   ? -4.130  2.293   -21.243 1.00 62.02  ? 1003 SO4 A S   1 
HETATM 3310 O  O1  . SO4 D 3 .   ? -4.197  2.026   -22.699 1.00 60.49  ? 1003 SO4 A O1  1 
HETATM 3311 O  O2  . SO4 D 3 .   ? -2.771  2.788   -20.912 1.00 58.17  ? 1003 SO4 A O2  1 
HETATM 3312 O  O3  . SO4 D 3 .   ? -4.464  1.044   -20.525 1.00 55.65  ? 1003 SO4 A O3  1 
HETATM 3313 O  O4  . SO4 D 3 .   ? -5.109  3.345   -20.903 1.00 66.52  ? 1003 SO4 A O4  1 
HETATM 3314 S  S   . SO4 E 3 .   ? -8.031  -6.427  4.244   1.00 60.95  ? 1004 SO4 A S   1 
HETATM 3315 O  O1  . SO4 E 3 .   ? -7.937  -7.831  3.771   1.00 58.45  ? 1004 SO4 A O1  1 
HETATM 3316 O  O2  . SO4 E 3 .   ? -8.699  -5.652  3.186   1.00 55.69  ? 1004 SO4 A O2  1 
HETATM 3317 O  O3  . SO4 E 3 .   ? -6.678  -5.900  4.557   1.00 58.51  ? 1004 SO4 A O3  1 
HETATM 3318 O  O4  . SO4 E 3 .   ? -8.831  -6.359  5.484   1.00 60.38  ? 1004 SO4 A O4  1 
HETATM 3319 S  S   . SO4 F 3 .   ? 26.611  -7.582  -13.978 1.00 71.69  ? 1005 SO4 A S   1 
HETATM 3320 O  O1  . SO4 F 3 .   ? 27.847  -7.603  -14.795 1.00 71.84  ? 1005 SO4 A O1  1 
HETATM 3321 O  O2  . SO4 F 3 .   ? 25.538  -8.128  -14.831 1.00 75.09  ? 1005 SO4 A O2  1 
HETATM 3322 O  O3  . SO4 F 3 .   ? 26.782  -8.434  -12.790 1.00 71.31  ? 1005 SO4 A O3  1 
HETATM 3323 O  O4  . SO4 F 3 .   ? 26.239  -6.224  -13.505 1.00 66.85  ? 1005 SO4 A O4  1 
HETATM 3324 S  S   . SO4 G 3 .   ? 7.110   -6.236  -49.884 1.00 77.41  ? 1006 SO4 A S   1 
HETATM 3325 O  O1  . SO4 G 3 .   ? 7.682   -6.640  -51.179 1.00 77.76  ? 1006 SO4 A O1  1 
HETATM 3326 O  O2  . SO4 G 3 .   ? 5.990   -5.298  -50.088 1.00 75.37  ? 1006 SO4 A O2  1 
HETATM 3327 O  O3  . SO4 G 3 .   ? 6.588   -7.509  -49.316 1.00 61.42  ? 1006 SO4 A O3  1 
HETATM 3328 O  O4  . SO4 G 3 .   ? 8.146   -5.468  -49.114 1.00 62.47  ? 1006 SO4 A O4  1 
HETATM 3329 C  C1  . EDO H 4 .   ? -15.940 -16.314 -14.897 1.00 65.31  ? 1007 EDO A C1  1 
HETATM 3330 O  O1  . EDO H 4 .   ? -15.396 -16.775 -13.650 1.00 65.77  ? 1007 EDO A O1  1 
HETATM 3331 C  C2  . EDO H 4 .   ? -15.904 -14.789 -14.963 1.00 63.78  ? 1007 EDO A C2  1 
HETATM 3332 O  O2  . EDO H 4 .   ? -15.651 -14.388 -16.317 1.00 62.78  ? 1007 EDO A O2  1 
HETATM 3333 N  N1  . EPE I 5 .   ? 14.873  -5.014  -15.118 1.00 51.81  ? 1008 EPE A N1  1 
HETATM 3334 C  C2  . EPE I 5 .   ? 14.597  -5.350  -13.729 1.00 53.79  ? 1008 EPE A C2  1 
HETATM 3335 C  C3  . EPE I 5 .   ? 15.439  -4.411  -12.882 1.00 54.70  ? 1008 EPE A C3  1 
HETATM 3336 N  N4  . EPE I 5 .   ? 15.015  -3.043  -13.184 1.00 56.06  ? 1008 EPE A N4  1 
HETATM 3337 C  C5  . EPE I 5 .   ? 15.208  -2.704  -14.597 1.00 54.48  ? 1008 EPE A C5  1 
HETATM 3338 C  C6  . EPE I 5 .   ? 14.382  -3.674  -15.425 1.00 53.79  ? 1008 EPE A C6  1 
HETATM 3339 C  C7  . EPE I 5 .   ? 15.770  -2.106  -12.359 1.00 59.62  ? 1008 EPE A C7  1 
HETATM 3340 C  C8  . EPE I 5 .   ? 15.230  -2.136  -10.942 1.00 58.20  ? 1008 EPE A C8  1 
HETATM 3341 O  O8  . EPE I 5 .   ? 14.093  -1.282  -10.866 1.00 57.26  ? 1008 EPE A O8  1 
HETATM 3342 C  C9  . EPE I 5 .   ? 14.239  -5.992  -15.990 1.00 53.20  ? 1008 EPE A C9  1 
HETATM 3343 C  C10 . EPE I 5 .   ? 14.780  -5.821  -17.398 1.00 53.02  ? 1008 EPE A C10 1 
HETATM 3344 S  S   . EPE I 5 .   ? 15.014  -7.286  -18.100 1.00 53.02  ? 1008 EPE A S   1 
HETATM 3345 O  O1S . EPE I 5 .   ? 15.189  -7.099  -19.475 1.00 48.37  ? 1008 EPE A O1S 1 
HETATM 3346 O  O2S . EPE I 5 .   ? 13.762  -8.250  -17.822 1.00 50.97  ? 1008 EPE A O2S 1 
HETATM 3347 O  O3S . EPE I 5 .   ? 16.179  -7.897  -17.601 1.00 52.82  ? 1008 EPE A O3S 1 
HETATM 3348 O  O   . HOH J 6 .   ? 26.094  -14.729 -4.801  1.00 31.60  ? 1101 HOH A O   1 
HETATM 3349 O  O   . HOH J 6 .   ? -10.939 -33.184 16.500  1.00 53.98  ? 1102 HOH A O   1 
HETATM 3350 O  O   . HOH J 6 .   ? -12.357 12.423  -44.154 1.00 39.48  ? 1103 HOH A O   1 
HETATM 3351 O  O   . HOH J 6 .   ? -9.159  -21.595 7.315   1.00 23.79  ? 1104 HOH A O   1 
HETATM 3352 O  O   . HOH J 6 .   ? 24.251  -10.894 -8.508  1.00 33.84  ? 1105 HOH A O   1 
HETATM 3353 O  O   . HOH J 6 .   ? -2.587  7.444   -27.463 1.00 25.73  ? 1106 HOH A O   1 
HETATM 3354 O  O   . HOH J 6 .   ? -0.384  6.490   -49.028 1.00 34.68  ? 1107 HOH A O   1 
HETATM 3355 O  O   . HOH J 6 .   ? 10.626  9.777   -33.724 1.00 41.45  ? 1108 HOH A O   1 
HETATM 3356 O  O   . HOH J 6 .   ? -0.921  -27.753 -8.361  1.00 40.31  ? 1109 HOH A O   1 
HETATM 3357 O  O   . HOH J 6 .   ? 1.552   12.931  -39.421 1.00 43.14  ? 1110 HOH A O   1 
HETATM 3358 O  O   . HOH J 6 .   ? -13.150 -20.402 3.851   1.00 38.68  ? 1111 HOH A O   1 
HETATM 3359 O  O   . HOH J 6 .   ? 6.381   -29.069 -9.522  1.00 36.91  ? 1112 HOH A O   1 
HETATM 3360 O  O   . HOH J 6 .   ? -7.898  -29.936 -2.726  1.00 44.67  ? 1113 HOH A O   1 
HETATM 3361 O  O   . HOH J 6 .   ? 12.673  -30.832 -10.817 1.00 46.70  ? 1114 HOH A O   1 
HETATM 3362 O  O   . HOH J 6 .   ? 29.283  -17.899 -1.226  1.00 35.55  ? 1115 HOH A O   1 
HETATM 3363 O  O   . HOH J 6 .   ? -12.223 -13.076 -12.236 1.00 27.24  ? 1116 HOH A O   1 
HETATM 3364 O  O   . HOH J 6 .   ? -8.295  -0.314  -22.559 1.00 40.20  ? 1117 HOH A O   1 
HETATM 3365 O  O   . HOH J 6 .   ? -13.568 -3.364  -26.179 1.00 27.73  ? 1118 HOH A O   1 
HETATM 3366 O  O   . HOH J 6 .   ? -13.687 -18.534 -12.404 1.00 41.61  ? 1119 HOH A O   1 
HETATM 3367 O  O   . HOH J 6 .   ? -2.414  -9.461  -35.738 1.00 20.19  ? 1120 HOH A O   1 
HETATM 3368 O  O   . HOH J 6 .   ? -0.541  -14.163 -44.762 1.00 39.83  ? 1121 HOH A O   1 
HETATM 3369 O  O   . HOH J 6 .   ? -17.069 7.484   -34.761 1.00 32.16  ? 1122 HOH A O   1 
HETATM 3370 O  O   . HOH J 6 .   ? -8.650  -13.430 -37.027 1.00 47.09  ? 1123 HOH A O   1 
HETATM 3371 O  O   . HOH J 6 .   ? 9.741   -34.076 -28.275 1.00 40.30  ? 1124 HOH A O   1 
HETATM 3372 O  O   . HOH J 6 .   ? 1.758   -2.023  -5.225  1.00 42.33  ? 1125 HOH A O   1 
HETATM 3373 O  O   . HOH J 6 .   ? -8.231  -16.096 1.948   1.00 31.97  ? 1126 HOH A O   1 
HETATM 3374 O  O   . HOH J 6 .   ? 11.641  -18.813 -5.956  1.00 23.90  ? 1127 HOH A O   1 
HETATM 3375 O  O   . HOH J 6 .   ? 10.667  6.728   -30.546 1.00 34.54  ? 1128 HOH A O   1 
HETATM 3376 O  O   . HOH J 6 .   ? -9.634  -7.567  -33.175 1.00 34.25  ? 1129 HOH A O   1 
HETATM 3377 O  O   . HOH J 6 .   ? 5.203   -24.757 0.040   1.00 40.25  ? 1130 HOH A O   1 
HETATM 3378 O  O   . HOH J 6 .   ? 7.658   -12.671 -32.511 1.00 31.63  ? 1131 HOH A O   1 
HETATM 3379 O  O   . HOH J 6 .   ? 7.091   9.641   -23.953 1.00 41.56  ? 1132 HOH A O   1 
HETATM 3380 O  O   . HOH J 6 .   ? 1.092   -27.761 -28.607 1.00 42.37  ? 1133 HOH A O   1 
HETATM 3381 O  O   . HOH J 6 .   ? 10.425  -3.956  -33.443 1.00 47.06  ? 1134 HOH A O   1 
HETATM 3382 O  O   . HOH J 6 .   ? 6.928   -2.055  -25.476 1.00 26.86  ? 1135 HOH A O   1 
HETATM 3383 O  O   . HOH J 6 .   ? -11.313 2.768   -30.391 1.00 36.78  ? 1136 HOH A O   1 
HETATM 3384 O  O   . HOH J 6 .   ? 6.506   -19.598 -33.521 1.00 38.04  ? 1137 HOH A O   1 
HETATM 3385 O  O   . HOH J 6 .   ? -4.830  -8.037  -37.384 1.00 19.74  ? 1138 HOH A O   1 
HETATM 3386 O  O   . HOH J 6 .   ? 18.878  -14.561 -18.446 1.00 23.73  ? 1139 HOH A O   1 
HETATM 3387 O  O   . HOH J 6 .   ? -6.506  -7.166  -4.840  1.00 41.92  ? 1140 HOH A O   1 
HETATM 3388 O  O   . HOH J 6 .   ? 3.035   3.614   -48.570 1.00 45.32  ? 1141 HOH A O   1 
HETATM 3389 O  O   . HOH J 6 .   ? -18.993 -3.002  -29.793 1.00 49.28  ? 1142 HOH A O   1 
HETATM 3390 O  O   . HOH J 6 .   ? 21.163  -13.880 -19.442 1.00 27.95  ? 1143 HOH A O   1 
HETATM 3391 O  O   . HOH J 6 .   ? -5.331  9.248   -41.416 1.00 39.50  ? 1144 HOH A O   1 
HETATM 3392 O  O   . HOH J 6 .   ? 10.115  -23.201 -12.668 1.00 36.14  ? 1145 HOH A O   1 
HETATM 3393 O  O   . HOH J 6 .   ? -5.837  -18.033 15.111  1.00 31.24  ? 1146 HOH A O   1 
HETATM 3394 O  O   . HOH J 6 .   ? 0.267   -33.236 10.713  1.00 33.77  ? 1147 HOH A O   1 
HETATM 3395 O  O   . HOH J 6 .   ? -10.257 -11.218 -5.792  1.00 37.84  ? 1148 HOH A O   1 
HETATM 3396 O  O   . HOH J 6 .   ? -15.050 -12.419 -18.751 1.00 33.26  ? 1149 HOH A O   1 
HETATM 3397 O  O   . HOH J 6 .   ? 15.990  -17.705 -30.260 1.00 32.34  ? 1150 HOH A O   1 
HETATM 3398 O  O   . HOH J 6 .   ? 3.763   -4.082  -11.118 1.00 43.50  ? 1151 HOH A O   1 
HETATM 3399 O  O   . HOH J 6 .   ? -10.746 -0.568  -22.952 1.00 30.75  ? 1152 HOH A O   1 
HETATM 3400 O  O   . HOH J 6 .   ? 12.893  -21.233 -28.596 1.00 34.45  ? 1153 HOH A O   1 
HETATM 3401 O  O   . HOH J 6 .   ? 1.584   3.513   -18.855 1.00 50.14  ? 1154 HOH A O   1 
HETATM 3402 O  O   . HOH J 6 .   ? -8.815  -8.965  -9.886  1.00 35.13  ? 1155 HOH A O   1 
HETATM 3403 O  O   . HOH J 6 .   ? -4.334  -0.032  -56.114 1.00 43.09  ? 1156 HOH A O   1 
HETATM 3404 O  O   . HOH J 6 .   ? 3.197   -10.181 -38.534 1.00 37.61  ? 1157 HOH A O   1 
HETATM 3405 O  O   . HOH J 6 .   ? 7.181   -5.169  -30.968 1.00 35.01  ? 1158 HOH A O   1 
HETATM 3406 O  O   . HOH J 6 .   ? 2.167   -29.094 -15.815 1.00 34.55  ? 1159 HOH A O   1 
HETATM 3407 O  O   . HOH J 6 .   ? 13.769  -20.138 -15.897 1.00 27.08  ? 1160 HOH A O   1 
HETATM 3408 O  O   . HOH J 6 .   ? 7.910   -21.916 -32.701 1.00 40.03  ? 1161 HOH A O   1 
HETATM 3409 O  O   . HOH J 6 .   ? -7.189  -2.854  -22.994 1.00 28.70  ? 1162 HOH A O   1 
HETATM 3410 O  O   . HOH J 6 .   ? -12.508 -6.258  -25.875 1.00 28.65  ? 1163 HOH A O   1 
HETATM 3411 O  O   . HOH J 6 .   ? 8.483   -29.915 -29.512 1.00 28.37  ? 1164 HOH A O   1 
HETATM 3412 O  O   . HOH J 6 .   ? 4.013   -27.846 -28.156 1.00 39.59  ? 1165 HOH A O   1 
HETATM 3413 O  O   . HOH J 6 .   ? 2.722   -30.673 -24.738 1.00 25.14  ? 1166 HOH A O   1 
HETATM 3414 O  O   . HOH J 6 .   ? 10.062  -5.483  -16.094 1.00 24.06  ? 1167 HOH A O   1 
HETATM 3415 O  O   . HOH J 6 .   ? 11.502  -7.680  -16.309 1.00 21.03  ? 1168 HOH A O   1 
HETATM 3416 O  O   . HOH J 6 .   ? 12.042  -2.495  -13.222 1.00 36.01  ? 1169 HOH A O   1 
HETATM 3417 O  O   . HOH J 6 .   ? 10.030  -4.457  -13.600 1.00 34.51  ? 1170 HOH A O   1 
HETATM 3418 O  O   . HOH J 6 .   ? 11.223  -18.628 -13.324 1.00 30.26  ? 1171 HOH A O   1 
HETATM 3419 O  O   . HOH J 6 .   ? -5.932  -15.093 -43.942 1.00 43.60  ? 1172 HOH A O   1 
HETATM 3420 O  O   . HOH J 6 .   ? -9.857  -13.269 -52.573 1.00 45.76  ? 1173 HOH A O   1 
HETATM 3421 O  O   . HOH J 6 .   ? -14.758 -11.075 -47.533 1.00 42.83  ? 1174 HOH A O   1 
HETATM 3422 O  O   . HOH J 6 .   ? 5.100   -9.496  -48.272 1.00 39.95  ? 1175 HOH A O   1 
HETATM 3423 O  O   . HOH J 6 .   ? -0.084  -17.882 -34.980 1.00 34.45  ? 1176 HOH A O   1 
HETATM 3424 O  O   . HOH J 6 .   ? -10.587 -10.455 -32.000 1.00 66.41  ? 1177 HOH A O   1 
HETATM 3425 O  O   . HOH J 6 .   ? 20.786  -20.443 -24.042 1.00 57.52  ? 1178 HOH A O   1 
HETATM 3426 O  O   . HOH J 6 .   ? 7.420   -30.175 -16.610 1.00 50.05  ? 1179 HOH A O   1 
HETATM 3427 O  O   . HOH J 6 .   ? -8.147  -9.901  -30.233 1.00 54.27  ? 1180 HOH A O   1 
HETATM 3428 O  O   . HOH J 6 .   ? -10.275 -11.092 -35.340 1.00 52.14  ? 1181 HOH A O   1 
HETATM 3429 O  O   . HOH J 6 .   ? -19.229 -9.678  -50.121 1.00 60.40  ? 1182 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . THR A 39  ? 0.7492 1.2168 0.8308 0.0227  0.0851  0.3877  561 THR A N   
2    C CA  . THR A 39  ? 0.7401 1.1905 0.7870 0.0335  0.0928  0.3592  561 THR A CA  
3    C C   . THR A 39  ? 0.7027 1.1435 0.7679 0.0340  0.0951  0.3522  561 THR A C   
4    O O   . THR A 39  ? 0.6747 1.0900 0.7573 0.0250  0.0839  0.3407  561 THR A O   
5    C CB  . THR A 39  ? 0.7432 1.1633 0.7646 0.0304  0.0832  0.3336  561 THR A CB  
6    O OG1 . THR A 39  ? 0.7392 1.1404 0.7309 0.0389  0.0887  0.3074  561 THR A OG1 
7    C CG2 . THR A 39  ? 0.7392 1.1366 0.7897 0.0168  0.0670  0.3303  561 THR A CG2 
8    N N   . SER A 40  ? 0.6653 1.1282 0.7256 0.0456  0.1100  0.3600  562 SER A N   
9    C CA  . SER A 40  ? 0.6204 1.0816 0.7007 0.0468  0.1134  0.3588  562 SER A CA  
10   C C   . SER A 40  ? 0.5968 1.0303 0.6491 0.0546  0.1165  0.3275  562 SER A C   
11   O O   . SER A 40  ? 0.5794 0.9935 0.6486 0.0486  0.1100  0.3171  562 SER A O   
12   C CB  . SER A 40  ? 0.6425 1.1438 0.7343 0.0562  0.1283  0.3848  562 SER A CB  
13   O OG  . SER A 40  ? 0.6470 1.1501 0.7655 0.0548  0.1295  0.3885  562 SER A OG  
14   N N   . VAL A 41  ? 0.5973 1.0276 0.6062 0.0676  0.1256  0.3127  563 VAL A N   
15   C CA  . VAL A 41  ? 0.6055 1.0054 0.5844 0.0740  0.1265  0.2820  563 VAL A CA  
16   C C   . VAL A 41  ? 0.6124 0.9921 0.5520 0.0744  0.1209  0.2630  563 VAL A C   
17   O O   . VAL A 41  ? 0.6450 1.0370 0.5549 0.0836  0.1279  0.2663  563 VAL A O   
18   C CB  . VAL A 41  ? 0.6344 1.0444 0.5943 0.0925  0.1437  0.2790  563 VAL A CB  
19   C CG1 . VAL A 41  ? 0.6362 1.0117 0.5668 0.0979  0.1427  0.2478  563 VAL A CG1 
20   C CG2 . VAL A 41  ? 0.6304 1.0633 0.6305 0.0919  0.1490  0.2995  563 VAL A CG2 
21   N N   . VAL A 42  ? 0.5939 0.9433 0.5329 0.0646  0.1080  0.2436  564 VAL A N   
22   C CA  . VAL A 42  ? 0.6044 0.9330 0.5082 0.0634  0.1009  0.2249  564 VAL A CA  
23   C C   . VAL A 42  ? 0.6153 0.9240 0.4803 0.0751  0.1069  0.2018  564 VAL A C   
24   O O   . VAL A 42  ? 0.5964 0.8926 0.4690 0.0775  0.1093  0.1916  564 VAL A O   
25   C CB  . VAL A 42  ? 0.5858 0.8927 0.5072 0.0483  0.0846  0.2157  564 VAL A CB  
26   C CG1 . VAL A 42  ? 0.6029 0.8881 0.4898 0.0465  0.0768  0.1958  564 VAL A CG1 
27   C CG2 . VAL A 42  ? 0.5660 0.8884 0.5199 0.0382  0.0775  0.2372  564 VAL A CG2 
28   N N   . ILE A 43  ? 0.6403 0.9448 0.4629 0.0823  0.1087  0.1939  565 ILE A N   
29   C CA  . ILE A 43  ? 0.6705 0.9498 0.4511 0.0924  0.1112  0.1703  565 ILE A CA  
30   C C   . ILE A 43  ? 0.6850 0.9404 0.4375 0.0838  0.0967  0.1544  565 ILE A C   
31   O O   . ILE A 43  ? 0.6967 0.9609 0.4307 0.0829  0.0939  0.1606  565 ILE A O   
32   C CB  . ILE A 43  ? 0.7153 1.0079 0.4623 0.1125  0.1273  0.1736  565 ILE A CB  
33   C CG1 . ILE A 43  ? 0.7117 1.0331 0.4889 0.1216  0.1423  0.1927  565 ILE A CG1 
34   C CG2 . ILE A 43  ? 0.7499 1.0100 0.4510 0.1233  0.1280  0.1472  565 ILE A CG2 
35   C CD1 . ILE A 43  ? 0.7424 1.0919 0.4979 0.1400  0.1590  0.2070  565 ILE A CD1 
36   N N   . VAL A 44  ? 0.6834 0.9101 0.4340 0.0769  0.0872  0.1353  566 VAL A N   
37   C CA  . VAL A 44  ? 0.7012 0.9040 0.4251 0.0685  0.0728  0.1197  566 VAL A CA  
38   C C   . VAL A 44  ? 0.7155 0.8879 0.4050 0.0763  0.0732  0.0969  566 VAL A C   
39   O O   . VAL A 44  ? 0.6777 0.8332 0.3811 0.0725  0.0700  0.0862  566 VAL A O   
40   C CB  . VAL A 44  ? 0.6896 0.8884 0.4471 0.0510  0.0589  0.1212  566 VAL A CB  
41   C CG1 . VAL A 44  ? 0.7093 0.8870 0.4423 0.0415  0.0436  0.1077  566 VAL A CG1 
42   C CG2 . VAL A 44  ? 0.6744 0.9006 0.4632 0.0451  0.0586  0.1439  566 VAL A CG2 
43   N N   . GLY A 45  ? 0.7522 0.9169 0.3953 0.0880  0.0771  0.0898  567 GLY A N   
44   C CA  . GLY A 45  ? 0.7916 0.9244 0.3956 0.0977  0.0773  0.0681  567 GLY A CA  
45   C C   . GLY A 45  ? 0.7887 0.9239 0.4053 0.1112  0.0922  0.0673  567 GLY A C   
46   O O   . GLY A 45  ? 0.7915 0.9528 0.4153 0.1242  0.1079  0.0815  567 GLY A O   
47   N N   . LYS A 46  ? 0.7802 0.8904 0.4017 0.1077  0.0870  0.0525  568 LYS A N   
48   C CA  . LYS A 46  ? 0.7771 0.8859 0.4085 0.1203  0.0996  0.0500  568 LYS A CA  
49   C C   . LYS A 46  ? 0.7075 0.8414 0.3950 0.1132  0.1040  0.0660  568 LYS A C   
50   O O   . LYS A 46  ? 0.6814 0.8215 0.3842 0.1226  0.1149  0.0687  568 LYS A O   
51   C CB  . LYS A 46  ? 0.8135 0.8831 0.4251 0.1189  0.0910  0.0274  568 LYS A CB  
52   C CG  . LYS A 46  ? 0.8793 0.9170 0.4325 0.1266  0.0852  0.0093  568 LYS A CG  
53   C CD  . LYS A 46  ? 0.9395 0.9717 0.4616 0.1520  0.1017  0.0041  568 LYS A CD  
54   C CE  . LYS A 46  ? 0.9436 0.9599 0.4774 0.1584  0.1065  -0.0047 568 LYS A CE  
55   N NZ  . LYS A 46  ? 0.9828 0.9963 0.4875 0.1853  0.1240  -0.0082 568 LYS A NZ  
56   N N   . ILE A 47  ? 0.6707 0.8176 0.3877 0.0970  0.0946  0.0766  569 ILE A N   
57   C CA  . ILE A 47  ? 0.6189 0.7834 0.3861 0.0882  0.0949  0.0899  569 ILE A CA  
58   C C   . ILE A 47  ? 0.5904 0.7901 0.3794 0.0906  0.1033  0.1139  569 ILE A C   
59   O O   . ILE A 47  ? 0.6094 0.8205 0.3830 0.0913  0.1031  0.1214  569 ILE A O   
60   C CB  . ILE A 47  ? 0.6027 0.7571 0.3893 0.0696  0.0785  0.0863  569 ILE A CB  
61   C CG1 . ILE A 47  ? 0.6051 0.7281 0.3773 0.0657  0.0699  0.0656  569 ILE A CG1 
62   C CG2 . ILE A 47  ? 0.5727 0.7436 0.4076 0.0614  0.0778  0.1003  569 ILE A CG2 
63   C CD1 . ILE A 47  ? 0.5905 0.7048 0.3742 0.0492  0.0542  0.0621  569 ILE A CD1 
64   N N   . SER A 48  ? 0.5507 0.7679 0.3763 0.0911  0.1098  0.1270  570 SER A N   
65   C CA  . SER A 48  ? 0.5321 0.7825 0.3849 0.0904  0.1155  0.1521  570 SER A CA  
66   C C   . SER A 48  ? 0.4929 0.7509 0.3934 0.0801  0.1115  0.1629  570 SER A C   
67   O O   . SER A 48  ? 0.4799 0.7243 0.3905 0.0795  0.1106  0.1533  570 SER A O   
68   C CB  . SER A 48  ? 0.5458 0.8176 0.3833 0.1088  0.1330  0.1623  570 SER A CB  
69   O OG  . SER A 48  ? 0.5392 0.8046 0.3776 0.1188  0.1412  0.1553  570 SER A OG  
70   N N   . PHE A 49  ? 0.4879 0.7661 0.4164 0.0716  0.1080  0.1829  571 PHE A N   
71   C CA  . PHE A 49  ? 0.4624 0.7462 0.4347 0.0612  0.1021  0.1946  571 PHE A CA  
72   C C   . PHE A 49  ? 0.4485 0.7575 0.4467 0.0550  0.1004  0.2202  571 PHE A C   
73   O O   . PHE A 49  ? 0.4644 0.7825 0.4492 0.0549  0.0999  0.2267  571 PHE A O   
74   C CB  . PHE A 49  ? 0.4564 0.7139 0.4370 0.0490  0.0877  0.1797  571 PHE A CB  
75   C CG  . PHE A 49  ? 0.4728 0.7248 0.4443 0.0415  0.0780  0.1781  571 PHE A CG  
76   C CD1 . PHE A 49  ? 0.4957 0.7345 0.4312 0.0442  0.0764  0.1629  571 PHE A CD1 
77   C CD2 . PHE A 49  ? 0.4627 0.7218 0.4619 0.0315  0.0695  0.1924  571 PHE A CD2 
78   C CE1 . PHE A 49  ? 0.5017 0.7379 0.4306 0.0368  0.0669  0.1631  571 PHE A CE1 
79   C CE2 . PHE A 49  ? 0.4769 0.7320 0.4690 0.0255  0.0609  0.1919  571 PHE A CE2 
80   C CZ  . PHE A 49  ? 0.4859 0.7313 0.4436 0.0280  0.0598  0.1779  571 PHE A CZ  
81   N N   . CYS A 50  ? 0.4199 0.7387 0.4555 0.0488  0.0982  0.2350  572 CYS A N   
82   C CA  . CYS A 50  ? 0.4054 0.7419 0.4714 0.0395  0.0924  0.2589  572 CYS A CA  
83   C C   . CYS A 50  ? 0.3946 0.7073 0.4751 0.0262  0.0759  0.2513  572 CYS A C   
84   O O   . CYS A 50  ? 0.3815 0.6745 0.4718 0.0221  0.0698  0.2390  572 CYS A O   
85   C CB  . CYS A 50  ? 0.3871 0.7448 0.4864 0.0386  0.0963  0.2798  572 CYS A CB  
86   S SG  . CYS A 50  ? 0.3597 0.7416 0.4973 0.0268  0.0889  0.3135  572 CYS A SG  
87   N N   . PRO A 51  ? 0.4110 0.7261 0.4923 0.0204  0.0690  0.2590  573 PRO A N   
88   C CA  . PRO A 51  ? 0.4219 0.7159 0.5166 0.0099  0.0541  0.2535  573 PRO A CA  
89   C C   . PRO A 51  ? 0.4176 0.7033 0.5473 0.0011  0.0445  0.2615  573 PRO A C   
90   O O   . PRO A 51  ? 0.4083 0.6713 0.5453 -0.0047 0.0333  0.2518  573 PRO A O   
91   C CB  . PRO A 51  ? 0.4232 0.7304 0.5169 0.0071  0.0510  0.2683  573 PRO A CB  
92   C CG  . PRO A 51  ? 0.4367 0.7630 0.5016 0.0171  0.0636  0.2703  573 PRO A CG  
93   C CD  . PRO A 51  ? 0.4373 0.7744 0.5024 0.0254  0.0755  0.2716  573 PRO A CD  
94   N N   . LYS A 52  ? 0.4356 0.7392 0.5846 0.0011  0.0491  0.2782  574 LYS A N   
95   C CA  . LYS A 52  ? 0.4439 0.7408 0.6253 -0.0082 0.0390  0.2879  574 LYS A CA  
96   C C   . LYS A 52  ? 0.4047 0.6818 0.5861 -0.0076 0.0374  0.2696  574 LYS A C   
97   O O   . LYS A 52  ? 0.3834 0.6445 0.5846 -0.0155 0.0260  0.2698  574 LYS A O   
98   C CB  . LYS A 52  ? 0.4872 0.8155 0.6906 -0.0093 0.0443  0.3164  574 LYS A CB  
99   C CG  . LYS A 52  ? 0.5239 0.8529 0.7606 -0.0220 0.0306  0.3383  574 LYS A CG  
100  C CD  . LYS A 52  ? 0.5782 0.9175 0.8135 -0.0239 0.0285  0.3519  574 LYS A CD  
101  C CE  . LYS A 52  ? 0.6176 0.9379 0.8784 -0.0365 0.0101  0.3614  574 LYS A CE  
102  N NZ  . LYS A 52  ? 0.6463 0.9923 0.9350 -0.0437 0.0075  0.3946  574 LYS A NZ  
103  N N   . ASP A 53  ? 0.3922 0.6692 0.5495 0.0020  0.0483  0.2538  575 ASP A N   
104  C CA  . ASP A 53  ? 0.3732 0.6328 0.5281 0.0035  0.0480  0.2362  575 ASP A CA  
105  C C   . ASP A 53  ? 0.3671 0.5976 0.5075 0.0016  0.0400  0.2130  575 ASP A C   
106  O O   . ASP A 53  ? 0.3554 0.5767 0.4720 0.0077  0.0452  0.1947  575 ASP A O   
107  C CB  . ASP A 53  ? 0.3746 0.6464 0.5107 0.0156  0.0633  0.2307  575 ASP A CB  
108  C CG  . ASP A 53  ? 0.3709 0.6754 0.5207 0.0201  0.0735  0.2546  575 ASP A CG  
109  O OD1 . ASP A 53  ? 0.3705 0.6862 0.5516 0.0115  0.0671  0.2748  575 ASP A OD1 
110  O OD2 . ASP A 53  ? 0.3792 0.6983 0.5077 0.0325  0.0875  0.2539  575 ASP A OD2 
111  N N   . VAL A 54  ? 0.3786 0.5946 0.5341 -0.0066 0.0270  0.2149  576 VAL A N   
112  C CA  . VAL A 54  ? 0.3822 0.5732 0.5282 -0.0079 0.0190  0.1962  576 VAL A CA  
113  C C   . VAL A 54  ? 0.3837 0.5575 0.5340 -0.0086 0.0158  0.1829  576 VAL A C   
114  O O   . VAL A 54  ? 0.4004 0.5722 0.5716 -0.0135 0.0103  0.1914  576 VAL A O   
115  C CB  . VAL A 54  ? 0.3830 0.5640 0.5432 -0.0141 0.0068  0.2040  576 VAL A CB  
116  C CG1 . VAL A 54  ? 0.3750 0.5348 0.5235 -0.0128 0.0008  0.1862  576 VAL A CG1 
117  C CG2 . VAL A 54  ? 0.3932 0.5938 0.5543 -0.0147 0.0091  0.2216  576 VAL A CG2 
118  N N   . LEU A 55  ? 0.3851 0.5470 0.5159 -0.0044 0.0184  0.1632  577 LEU A N   
119  C CA  . LEU A 55  ? 0.3942 0.5402 0.5276 -0.0048 0.0153  0.1503  577 LEU A CA  
120  C C   . LEU A 55  ? 0.4011 0.5260 0.5360 -0.0073 0.0047  0.1404  577 LEU A C   
121  O O   . LEU A 55  ? 0.4169 0.5276 0.5553 -0.0080 0.0003  0.1312  577 LEU A O   
122  C CB  . LEU A 55  ? 0.3886 0.5336 0.5006 0.0015  0.0241  0.1353  577 LEU A CB  
123  C CG  . LEU A 55  ? 0.3938 0.5558 0.4996 0.0075  0.0361  0.1410  577 LEU A CG  
124  C CD1 . LEU A 55  ? 0.3912 0.5452 0.4724 0.0139  0.0425  0.1238  577 LEU A CD1 
125  C CD2 . LEU A 55  ? 0.3957 0.5656 0.5246 0.0056  0.0363  0.1526  577 LEU A CD2 
126  N N   . GLY A 56  ? 0.4216 0.5454 0.5524 -0.0075 0.0012  0.1422  578 GLY A N   
127  C CA  . GLY A 56  ? 0.4357 0.5416 0.5659 -0.0073 -0.0073 0.1332  578 GLY A CA  
128  C C   . GLY A 56  ? 0.4406 0.5501 0.5561 -0.0047 -0.0059 0.1289  578 GLY A C   
129  O O   . GLY A 56  ? 0.4365 0.5609 0.5439 -0.0046 -0.0010 0.1354  578 GLY A O   
130  N N   . HIS A 57  ? 0.4679 0.5649 0.5800 -0.0024 -0.0106 0.1186  579 HIS A N   
131  C CA  . HIS A 57  ? 0.5066 0.6083 0.6074 -0.0005 -0.0106 0.1158  579 HIS A CA  
132  C C   . HIS A 57  ? 0.5052 0.5999 0.5962 0.0020  -0.0103 0.1011  579 HIS A C   
133  O O   . HIS A 57  ? 0.4990 0.5815 0.5945 0.0036  -0.0124 0.0937  579 HIS A O   
134  C CB  . HIS A 57  ? 0.5133 0.6106 0.6245 0.0008  -0.0177 0.1239  579 HIS A CB  
135  C CG  . HIS A 57  ? 0.5138 0.6160 0.6377 -0.0025 -0.0200 0.1400  579 HIS A CG  
136  N ND1 . HIS A 57  ? 0.5235 0.6151 0.6628 -0.0050 -0.0252 0.1457  579 HIS A ND1 
137  C CD2 . HIS A 57  ? 0.5258 0.6432 0.6498 -0.0045 -0.0184 0.1530  579 HIS A CD2 
138  C CE1 . HIS A 57  ? 0.5365 0.6373 0.6864 -0.0087 -0.0268 0.1624  579 HIS A CE1 
139  N NE2 . HIS A 57  ? 0.5206 0.6376 0.6613 -0.0079 -0.0222 0.1670  579 HIS A NE2 
140  N N   . GLY A 58  ? 0.5381 0.6412 0.6158 0.0017  -0.0084 0.0980  580 GLY A N   
141  C CA  . GLY A 58  ? 0.5443 0.6441 0.6147 0.0031  -0.0095 0.0875  580 GLY A CA  
142  C C   . GLY A 58  ? 0.5351 0.6365 0.6113 0.0063  -0.0144 0.0912  580 GLY A C   
143  O O   . GLY A 58  ? 0.5354 0.6292 0.6233 0.0101  -0.0179 0.0954  580 GLY A O   
144  N N   . ALA A 59  ? 0.5330 0.6438 0.6011 0.0051  -0.0152 0.0905  581 ALA A N   
145  C CA  . ALA A 59  ? 0.5350 0.6519 0.6094 0.0088  -0.0189 0.0966  581 ALA A CA  
146  C C   . ALA A 59  ? 0.5377 0.6589 0.6191 0.0090  -0.0209 0.1090  581 ALA A C   
147  O O   . ALA A 59  ? 0.5516 0.6773 0.6288 0.0044  -0.0191 0.1139  581 ALA A O   
148  C CB  . ALA A 59  ? 0.5405 0.6701 0.6059 0.0051  -0.0204 0.0964  581 ALA A CB  
149  N N   . GLU A 60  ? 0.5047 0.6251 0.5962 0.0152  -0.0243 0.1147  582 GLU A N   
150  C CA  . GLU A 60  ? 0.4864 0.6108 0.5858 0.0159  -0.0272 0.1276  582 GLU A CA  
151  C C   . GLU A 60  ? 0.4798 0.6214 0.5705 0.0089  -0.0267 0.1350  582 GLU A C   
152  O O   . GLU A 60  ? 0.5074 0.6602 0.5899 0.0063  -0.0274 0.1338  582 GLU A O   
153  C CB  . GLU A 60  ? 0.4924 0.6160 0.6006 0.0250  -0.0304 0.1318  582 GLU A CB  
154  C CG  . GLU A 60  ? 0.4974 0.6189 0.6162 0.0277  -0.0343 0.1447  582 GLU A CG  
155  C CD  . GLU A 60  ? 0.4936 0.6068 0.6207 0.0399  -0.0372 0.1464  582 GLU A CD  
156  O OE1 . GLU A 60  ? 0.4936 0.5975 0.6298 0.0437  -0.0414 0.1550  582 GLU A OE1 
157  O OE2 . GLU A 60  ? 0.4767 0.5928 0.6009 0.0462  -0.0351 0.1397  582 GLU A OE2 
158  N N   . GLY A 61  ? 0.4748 0.6189 0.5667 0.0055  -0.0260 0.1434  583 GLY A N   
159  C CA  . GLY A 61  ? 0.4673 0.6268 0.5474 -0.0004 -0.0250 0.1499  583 GLY A CA  
160  C C   . GLY A 61  ? 0.4658 0.6259 0.5303 -0.0046 -0.0197 0.1431  583 GLY A C   
161  O O   . GLY A 61  ? 0.4613 0.6320 0.5118 -0.0082 -0.0187 0.1471  583 GLY A O   
162  N N   . THR A 62  ? 0.4618 0.6100 0.5269 -0.0033 -0.0165 0.1328  584 THR A N   
163  C CA  . THR A 62  ? 0.4617 0.6096 0.5140 -0.0052 -0.0106 0.1273  584 THR A CA  
164  C C   . THR A 62  ? 0.4671 0.6114 0.5324 -0.0040 -0.0074 0.1325  584 THR A C   
165  O O   . THR A 62  ? 0.4649 0.5993 0.5470 -0.0024 -0.0109 0.1339  584 THR A O   
166  C CB  . THR A 62  ? 0.4517 0.5909 0.4932 -0.0054 -0.0091 0.1120  584 THR A CB  
167  O OG1 . THR A 62  ? 0.4323 0.5597 0.4870 -0.0025 -0.0091 0.1064  584 THR A OG1 
168  C CG2 . THR A 62  ? 0.4574 0.6001 0.4901 -0.0079 -0.0139 0.1082  584 THR A CG2 
169  N N   . ILE A 63  ? 0.4613 0.6134 0.5176 -0.0045 -0.0013 0.1355  585 ILE A N   
170  C CA  . ILE A 63  ? 0.4389 0.5910 0.5075 -0.0039 0.0025  0.1412  585 ILE A CA  
171  C C   . ILE A 63  ? 0.4274 0.5807 0.4810 -0.0017 0.0106  0.1330  585 ILE A C   
172  O O   . ILE A 63  ? 0.4304 0.5880 0.4618 -0.0005 0.0141  0.1281  585 ILE A O   
173  C CB  . ILE A 63  ? 0.4410 0.6059 0.5213 -0.0054 0.0021  0.1602  585 ILE A CB  
174  C CG1 . ILE A 63  ? 0.4234 0.5907 0.5198 -0.0061 0.0047  0.1689  585 ILE A CG1 
175  C CG2 . ILE A 63  ? 0.4539 0.6351 0.5159 -0.0051 0.0062  0.1660  585 ILE A CG2 
176  C CD1 . ILE A 63  ? 0.4335 0.6116 0.5469 -0.0091 0.0019  0.1894  585 ILE A CD1 
177  N N   . VAL A 64  ? 0.4046 0.5522 0.4694 -0.0008 0.0126  0.1310  586 VAL A N   
178  C CA  . VAL A 64  ? 0.4061 0.5547 0.4598 0.0026  0.0207  0.1243  586 VAL A CA  
179  C C   . VAL A 64  ? 0.3920 0.5546 0.4571 0.0042  0.0268  0.1387  586 VAL A C   
180  O O   . VAL A 64  ? 0.3711 0.5343 0.4595 0.0008  0.0225  0.1490  586 VAL A O   
181  C CB  . VAL A 64  ? 0.4061 0.5393 0.4624 0.0028  0.0190  0.1106  586 VAL A CB  
182  C CG1 . VAL A 64  ? 0.4188 0.5526 0.4639 0.0072  0.0273  0.1045  586 VAL A CG1 
183  C CG2 . VAL A 64  ? 0.4186 0.5420 0.4643 0.0014  0.0137  0.0988  586 VAL A CG2 
184  N N   . TYR A 65  ? 0.3905 0.5641 0.4385 0.0097  0.0362  0.1397  587 TYR A N   
185  C CA  . TYR A 65  ? 0.3999 0.5919 0.4565 0.0133  0.0444  0.1546  587 TYR A CA  
186  C C   . TYR A 65  ? 0.3930 0.5836 0.4412 0.0202  0.0532  0.1467  587 TYR A C   
187  O O   . TYR A 65  ? 0.3858 0.5626 0.4140 0.0231  0.0541  0.1301  587 TYR A O   
188  C CB  . TYR A 65  ? 0.4207 0.6301 0.4619 0.0170  0.0502  0.1647  587 TYR A CB  
189  C CG  . TYR A 65  ? 0.4274 0.6405 0.4745 0.0111  0.0424  0.1739  587 TYR A CG  
190  C CD1 . TYR A 65  ? 0.4324 0.6577 0.5049 0.0067  0.0393  0.1938  587 TYR A CD1 
191  C CD2 . TYR A 65  ? 0.4443 0.6495 0.4722 0.0097  0.0376  0.1642  587 TYR A CD2 
192  C CE1 . TYR A 65  ? 0.4363 0.6643 0.5146 0.0020  0.0321  0.2029  587 TYR A CE1 
193  C CE2 . TYR A 65  ? 0.4472 0.6574 0.4814 0.0050  0.0308  0.1740  587 TYR A CE2 
194  C CZ  . TYR A 65  ? 0.4401 0.6612 0.4992 0.0017  0.0284  0.1929  587 TYR A CZ  
195  O OH  . TYR A 65  ? 0.4460 0.6712 0.5121 -0.0023 0.0216  0.2031  587 TYR A OH  
196  N N   . ARG A 66  ? 0.4065 0.6122 0.4713 0.0227  0.0592  0.1599  588 ARG A N   
197  C CA  . ARG A 66  ? 0.4233 0.6331 0.4785 0.0321  0.0701  0.1558  588 ARG A CA  
198  C C   . ARG A 66  ? 0.4311 0.6564 0.4624 0.0425  0.0816  0.1605  588 ARG A C   
199  O O   . ARG A 66  ? 0.4373 0.6801 0.4732 0.0416  0.0828  0.1760  588 ARG A O   
200  C CB  . ARG A 66  ? 0.4260 0.6481 0.5108 0.0307  0.0716  0.1699  588 ARG A CB  
201  C CG  . ARG A 66  ? 0.4403 0.6621 0.5207 0.0391  0.0802  0.1634  588 ARG A CG  
202  C CD  . ARG A 66  ? 0.4572 0.7020 0.5656 0.0395  0.0845  0.1843  588 ARG A CD  
203  N NE  . ARG A 66  ? 0.5131 0.7841 0.6135 0.0501  0.0979  0.1985  588 ARG A NE  
204  C CZ  . ARG A 66  ? 0.5467 0.8459 0.6702 0.0489  0.1011  0.2238  588 ARG A CZ  
205  N NH1 . ARG A 66  ? 0.5681 0.8916 0.6799 0.0609  0.1149  0.2352  588 ARG A NH1 
206  N NH2 . ARG A 66  ? 0.5704 0.8738 0.7278 0.0360  0.0901  0.2384  588 ARG A NH2 
207  N N   . GLY A 67  ? 0.4460 0.6634 0.4503 0.0528  0.0896  0.1471  589 GLY A N   
208  C CA  . GLY A 67  ? 0.4703 0.6976 0.4452 0.0647  0.1001  0.1484  589 GLY A CA  
209  C C   . GLY A 67  ? 0.4816 0.7009 0.4319 0.0787  0.1105  0.1365  589 GLY A C   
210  O O   . GLY A 67  ? 0.4589 0.6716 0.4207 0.0802  0.1118  0.1317  589 GLY A O   
211  N N   . MET A 68  ? 0.5185 0.7371 0.4332 0.0895  0.1173  0.1315  590 MET A N   
212  C CA  . MET A 68  ? 0.5571 0.7675 0.4427 0.1061  0.1284  0.1210  590 MET A CA  
213  C C   . MET A 68  ? 0.5710 0.7537 0.4125 0.1084  0.1231  0.1003  590 MET A C   
214  O O   . MET A 68  ? 0.5610 0.7438 0.3896 0.1025  0.1168  0.1009  590 MET A O   
215  C CB  . MET A 68  ? 0.5987 0.8389 0.4804 0.1218  0.1447  0.1385  590 MET A CB  
216  C CG  . MET A 68  ? 0.5966 0.8689 0.5222 0.1193  0.1498  0.1633  590 MET A CG  
217  S SD  . MET A 68  ? 0.6343 0.9044 0.5821 0.1236  0.1543  0.1618  590 MET A SD  
218  C CE  . MET A 68  ? 0.6493 0.9292 0.5646 0.1512  0.1751  0.1613  590 MET A CE  
219  N N   . PHE A 69  ? 0.5802 0.7386 0.3998 0.1162  0.1246  0.0827  591 PHE A N   
220  C CA  . PHE A 69  ? 0.6120 0.7410 0.3860 0.1202  0.1197  0.0629  591 PHE A CA  
221  C C   . PHE A 69  ? 0.6328 0.7487 0.3841 0.1385  0.1305  0.0532  591 PHE A C   
222  O O   . PHE A 69  ? 0.6154 0.7243 0.3847 0.1382  0.1309  0.0494  591 PHE A O   
223  C CB  . PHE A 69  ? 0.6008 0.7037 0.3762 0.1033  0.1023  0.0485  591 PHE A CB  
224  C CG  . PHE A 69  ? 0.6391 0.7078 0.3709 0.1063  0.0956  0.0277  591 PHE A CG  
225  C CD1 . PHE A 69  ? 0.6789 0.7397 0.3762 0.1061  0.0902  0.0231  591 PHE A CD1 
226  C CD2 . PHE A 69  ? 0.6461 0.6896 0.3706 0.1092  0.0937  0.0133  591 PHE A CD2 
227  C CE1 . PHE A 69  ? 0.7177 0.7442 0.3734 0.1079  0.0819  0.0042  591 PHE A CE1 
228  C CE2 . PHE A 69  ? 0.6828 0.6922 0.3673 0.1111  0.0859  -0.0051 591 PHE A CE2 
229  C CZ  . PHE A 69  ? 0.7237 0.7235 0.3730 0.1102  0.0794  -0.0099 591 PHE A CZ  
230  N N   . ASP A 70  ? 0.6759 0.7891 0.3880 0.1555  0.1395  0.0497  592 ASP A N   
231  C CA  . ASP A 70  ? 0.7022 0.7989 0.3856 0.1761  0.1501  0.0388  592 ASP A CA  
232  C C   . ASP A 70  ? 0.6749 0.7932 0.3923 0.1848  0.1629  0.0513  592 ASP A C   
233  O O   . ASP A 70  ? 0.6585 0.7583 0.3737 0.1909  0.1644  0.0409  592 ASP A O   
234  C CB  . ASP A 70  ? 0.7269 0.7789 0.3841 0.1707  0.1365  0.0144  592 ASP A CB  
235  C CG  . ASP A 70  ? 0.7809 0.8063 0.3937 0.1924  0.1441  -0.0007 592 ASP A CG  
236  O OD1 . ASP A 70  ? 0.8117 0.8488 0.4000 0.2127  0.1585  0.0040  592 ASP A OD1 
237  O OD2 . ASP A 70  ? 0.7950 0.7869 0.3969 0.1896  0.1354  -0.0172 592 ASP A OD2 
238  N N   . ASN A 71  ? 0.6566 0.8147 0.4072 0.1836  0.1709  0.0749  593 ASN A N   
239  C CA  . ASN A 71  ? 0.6409 0.8259 0.4310 0.1878  0.1808  0.0918  593 ASN A CA  
240  C C   . ASN A 71  ? 0.6068 0.7822 0.4318 0.1722  0.1704  0.0886  593 ASN A C   
241  O O   . ASN A 71  ? 0.5897 0.7794 0.4405 0.1772  0.1775  0.0980  593 ASN A O   
242  C CB  . ASN A 71  ? 0.6774 0.8661 0.4459 0.2145  0.1988  0.0917  593 ASN A CB  
243  C CG  . ASN A 71  ? 0.7184 0.9195 0.4515 0.2325  0.2109  0.0964  593 ASN A CG  
244  O OD1 . ASN A 71  ? 0.7109 0.9418 0.4569 0.2281  0.2133  0.1144  593 ASN A OD1 
245  N ND2 . ASN A 71  ? 0.7719 0.9492 0.4589 0.2535  0.2184  0.0802  593 ASN A ND2 
246  N N   . ARG A 72  ? 0.6037 0.7571 0.4301 0.1537  0.1537  0.0767  594 ARG A N   
247  C CA  . ARG A 72  ? 0.5798 0.7254 0.4381 0.1383  0.1431  0.0741  594 ARG A CA  
248  C C   . ARG A 72  ? 0.5384 0.7020 0.4305 0.1205  0.1343  0.0879  594 ARG A C   
249  O O   . ARG A 72  ? 0.5429 0.7131 0.4273 0.1159  0.1311  0.0924  594 ARG A O   
250  C CB  . ARG A 72  ? 0.6072 0.7147 0.4438 0.1310  0.1305  0.0509  594 ARG A CB  
251  C CG  . ARG A 72  ? 0.6689 0.7495 0.4675 0.1467  0.1354  0.0342  594 ARG A CG  
252  C CD  . ARG A 72  ? 0.6922 0.7357 0.4642 0.1370  0.1203  0.0135  594 ARG A CD  
253  N NE  . ARG A 72  ? 0.7230 0.7355 0.4652 0.1487  0.1215  -0.0030 594 ARG A NE  
254  C CZ  . ARG A 72  ? 0.7217 0.7224 0.4775 0.1482  0.1201  -0.0081 594 ARG A CZ  
255  N NH1 . ARG A 72  ? 0.7668 0.7373 0.4931 0.1595  0.1207  -0.0228 594 ARG A NH1 
256  N NH2 . ARG A 72  ? 0.6829 0.7000 0.4801 0.1370  0.1176  0.0012  594 ARG A NH2 
257  N N   . ASP A 73  ? 0.5011 0.6708 0.4295 0.1108  0.1295  0.0944  595 ASP A N   
258  C CA  . ASP A 73  ? 0.4624 0.6410 0.4202 0.0939  0.1188  0.1041  595 ASP A CA  
259  C C   . ASP A 73  ? 0.4496 0.6026 0.3969 0.0818  0.1049  0.0876  595 ASP A C   
260  O O   . ASP A 73  ? 0.4479 0.5791 0.3868 0.0808  0.1006  0.0724  595 ASP A O   
261  C CB  . ASP A 73  ? 0.4344 0.6242 0.4308 0.0876  0.1166  0.1150  595 ASP A CB  
262  C CG  . ASP A 73  ? 0.4224 0.6440 0.4382 0.0958  0.1282  0.1371  595 ASP A CG  
263  O OD1 . ASP A 73  ? 0.4385 0.6798 0.4493 0.1007  0.1347  0.1498  595 ASP A OD1 
264  O OD2 . ASP A 73  ? 0.4066 0.6353 0.4438 0.0969  0.1303  0.1431  595 ASP A OD2 
265  N N   . VAL A 74  ? 0.4433 0.6007 0.3924 0.0730  0.0979  0.0923  596 VAL A N   
266  C CA  . VAL A 74  ? 0.4312 0.5695 0.3740 0.0615  0.0849  0.0802  596 VAL A CA  
267  C C   . VAL A 74  ? 0.4001 0.5475 0.3700 0.0493  0.0762  0.0908  596 VAL A C   
268  O O   . VAL A 74  ? 0.3712 0.5389 0.3596 0.0488  0.0790  0.1078  596 VAL A O   
269  C CB  . VAL A 74  ? 0.4668 0.5941 0.3730 0.0640  0.0831  0.0707  596 VAL A CB  
270  C CG1 . VAL A 74  ? 0.4988 0.6066 0.3731 0.0747  0.0879  0.0554  596 VAL A CG1 
271  C CG2 . VAL A 74  ? 0.4766 0.6249 0.3770 0.0680  0.0888  0.0847  596 VAL A CG2 
272  N N   . ALA A 75  ? 0.4070 0.5388 0.3790 0.0401  0.0652  0.0808  597 ALA A N   
273  C CA  . ALA A 75  ? 0.4024 0.5379 0.3924 0.0302  0.0561  0.0876  597 ALA A CA  
274  C C   . ALA A 75  ? 0.4080 0.5403 0.3760 0.0281  0.0519  0.0838  597 ALA A C   
275  O O   . ALA A 75  ? 0.4138 0.5314 0.3586 0.0285  0.0494  0.0704  597 ALA A O   
276  C CB  . ALA A 75  ? 0.3867 0.5092 0.3927 0.0233  0.0475  0.0803  597 ALA A CB  
277  N N   . VAL A 76  ? 0.4159 0.5620 0.3913 0.0253  0.0504  0.0965  598 VAL A N   
278  C CA  . VAL A 76  ? 0.4365 0.5832 0.3917 0.0234  0.0466  0.0958  598 VAL A CA  
279  C C   . VAL A 76  ? 0.4257 0.5739 0.3981 0.0147  0.0367  0.1012  598 VAL A C   
280  O O   . VAL A 76  ? 0.4058 0.5661 0.3985 0.0128  0.0361  0.1155  598 VAL A O   
281  C CB  . VAL A 76  ? 0.4537 0.6177 0.3972 0.0299  0.0547  0.1073  598 VAL A CB  
282  C CG1 . VAL A 76  ? 0.4846 0.6474 0.4038 0.0276  0.0497  0.1051  598 VAL A CG1 
283  C CG2 . VAL A 76  ? 0.4787 0.6427 0.4055 0.0414  0.0662  0.1031  598 VAL A CG2 
284  N N   . LYS A 77  ? 0.4384 0.5744 0.4025 0.0099  0.0288  0.0907  599 LYS A N   
285  C CA  . LYS A 77  ? 0.4534 0.5912 0.4313 0.0036  0.0200  0.0952  599 LYS A CA  
286  C C   . LYS A 77  ? 0.4635 0.6101 0.4266 0.0016  0.0171  0.1013  599 LYS A C   
287  O O   . LYS A 77  ? 0.4742 0.6155 0.4117 0.0011  0.0154  0.0935  599 LYS A O   
288  C CB  . LYS A 77  ? 0.4660 0.5906 0.4447 -0.0001 0.0135  0.0834  599 LYS A CB  
289  C CG  . LYS A 77  ? 0.4839 0.6112 0.4756 -0.0045 0.0054  0.0877  599 LYS A CG  
290  C CD  . LYS A 77  ? 0.5016 0.6200 0.5088 -0.0048 0.0023  0.0814  599 LYS A CD  
291  C CE  . LYS A 77  ? 0.5297 0.6447 0.5294 -0.0084 -0.0038 0.0745  599 LYS A CE  
292  N NZ  . LYS A 77  ? 0.5480 0.6559 0.5611 -0.0071 -0.0050 0.0687  599 LYS A NZ  
293  N N   . ARG A 78  ? 0.4651 0.6241 0.4440 0.0001  0.0155  0.1156  600 ARG A N   
294  C CA  . ARG A 78  ? 0.4961 0.6648 0.4650 -0.0025 0.0115  0.1232  600 ARG A CA  
295  C C   . ARG A 78  ? 0.5213 0.6873 0.4999 -0.0078 0.0018  0.1225  600 ARG A C   
296  O O   . ARG A 78  ? 0.5194 0.6828 0.5213 -0.0080 -0.0008 0.1255  600 ARG A O   
297  C CB  . ARG A 78  ? 0.5018 0.6868 0.4844 -0.0011 0.0149  0.1409  600 ARG A CB  
298  C CG  . ARG A 78  ? 0.5207 0.7183 0.4880 -0.0024 0.0131  0.1498  600 ARG A CG  
299  C CD  . ARG A 78  ? 0.5202 0.7344 0.5058 -0.0021 0.0151  0.1694  600 ARG A CD  
300  N NE  . ARG A 78  ? 0.5141 0.7263 0.5261 -0.0061 0.0072  0.1767  600 ARG A NE  
301  C CZ  . ARG A 78  ? 0.5038 0.7261 0.5355 -0.0074 0.0056  0.1942  600 ARG A CZ  
302  N NH1 . ARG A 78  ? 0.5033 0.7420 0.5332 -0.0057 0.0117  0.2077  600 ARG A NH1 
303  N NH2 . ARG A 78  ? 0.5058 0.7218 0.5584 -0.0097 -0.0021 0.1987  600 ARG A NH2 
304  N N   . ILE A 79  ? 0.5723 0.7385 0.5322 -0.0117 -0.0039 0.1190  601 ILE A N   
305  C CA  . ILE A 79  ? 0.6109 0.7786 0.5804 -0.0163 -0.0128 0.1206  601 ILE A CA  
306  C C   . ILE A 79  ? 0.6115 0.7919 0.5722 -0.0203 -0.0186 0.1306  601 ILE A C   
307  O O   . ILE A 79  ? 0.5899 0.7728 0.5266 -0.0210 -0.0178 0.1305  601 ILE A O   
308  C CB  . ILE A 79  ? 0.6384 0.7948 0.5991 -0.0198 -0.0174 0.1073  601 ILE A CB  
309  C CG1 . ILE A 79  ? 0.6916 0.8432 0.6207 -0.0239 -0.0211 0.1007  601 ILE A CG1 
310  C CG2 . ILE A 79  ? 0.6289 0.7729 0.5969 -0.0162 -0.0121 0.0972  601 ILE A CG2 
311  C CD1 . ILE A 79  ? 0.7371 0.8763 0.6575 -0.0287 -0.0271 0.0890  601 ILE A CD1 
312  N N   . LEU A 80  ? 0.6332 0.8210 0.6121 -0.0220 -0.0244 0.1389  602 LEU A N   
313  C CA  . LEU A 80  ? 0.6924 0.8942 0.6683 -0.0258 -0.0309 0.1506  602 LEU A CA  
314  C C   . LEU A 80  ? 0.7140 0.9162 0.6717 -0.0332 -0.0398 0.1458  602 LEU A C   
315  O O   . LEU A 80  ? 0.6383 0.8297 0.5903 -0.0354 -0.0416 0.1341  602 LEU A O   
316  C CB  . LEU A 80  ? 0.6929 0.9021 0.6972 -0.0231 -0.0334 0.1624  602 LEU A CB  
317  C CG  . LEU A 80  ? 0.6907 0.9021 0.7119 -0.0185 -0.0289 0.1731  602 LEU A CG  
318  C CD1 . LEU A 80  ? 0.6875 0.8955 0.7351 -0.0140 -0.0314 0.1781  602 LEU A CD1 
319  C CD2 . LEU A 80  ? 0.6998 0.9261 0.7137 -0.0207 -0.0298 0.1871  602 LEU A CD2 
320  N N   . PRO A 81  ? 0.7893 1.0041 0.7398 -0.0378 -0.0464 0.1559  603 PRO A N   
321  C CA  . PRO A 81  ? 0.8431 1.0587 0.7750 -0.0466 -0.0571 0.1533  603 PRO A CA  
322  C C   . PRO A 81  ? 0.8418 1.0588 0.7899 -0.0501 -0.0632 0.1522  603 PRO A C   
323  O O   . PRO A 81  ? 0.8472 1.0573 0.7805 -0.0573 -0.0703 0.1448  603 PRO A O   
324  C CB  . PRO A 81  ? 0.8449 1.0774 0.7736 -0.0498 -0.0625 0.1683  603 PRO A CB  
325  C CG  . PRO A 81  ? 0.8306 1.0668 0.7629 -0.0427 -0.0530 0.1745  603 PRO A CG  
326  C CD  . PRO A 81  ? 0.7997 1.0284 0.7566 -0.0357 -0.0450 0.1711  603 PRO A CD  
327  N N   . GLU A 82  ? 0.8514 1.0766 0.8287 -0.0445 -0.0605 0.1597  604 GLU A N   
328  C CA  . GLU A 82  ? 0.8627 1.0930 0.8562 -0.0455 -0.0647 0.1607  604 GLU A CA  
329  C C   . GLU A 82  ? 0.8851 1.0999 0.8720 -0.0464 -0.0627 0.1456  604 GLU A C   
330  O O   . GLU A 82  ? 0.8852 1.1038 0.8780 -0.0502 -0.0678 0.1452  604 GLU A O   
331  C CB  . GLU A 82  ? 0.8808 1.1181 0.9033 -0.0356 -0.0600 0.1690  604 GLU A CB  
332  C CG  . GLU A 82  ? 0.8699 1.0916 0.9013 -0.0270 -0.0508 0.1598  604 GLU A CG  
333  C CD  . GLU A 82  ? 0.8776 1.0999 0.9248 -0.0192 -0.0468 0.1686  604 GLU A CD  
334  O OE1 . GLU A 82  ? 0.9182 1.1510 0.9641 -0.0213 -0.0494 0.1801  604 GLU A OE1 
335  O OE2 . GLU A 82  ? 0.8108 1.0221 0.8711 -0.0116 -0.0420 0.1645  604 GLU A OE2 
336  N N   . CYS A 83  ? 0.9250 1.1241 0.9019 -0.0425 -0.0551 0.1348  605 CYS A N   
337  C CA  . CYS A 83  ? 0.9649 1.1483 0.9352 -0.0428 -0.0526 0.1205  605 CYS A CA  
338  C C   . CYS A 83  ? 0.9827 1.1522 0.9222 -0.0493 -0.0565 0.1099  605 CYS A C   
339  O O   . CYS A 83  ? 0.9662 1.1209 0.8994 -0.0484 -0.0537 0.0981  605 CYS A O   
340  C CB  . CYS A 83  ? 0.9930 1.1667 0.9729 -0.0338 -0.0419 0.1149  605 CYS A CB  
341  S SG  . CYS A 83  ? 0.9972 1.1751 1.0087 -0.0252 -0.0383 0.1198  605 CYS A SG  
342  N N   . PHE A 84  ? 0.9865 1.1587 0.9055 -0.0548 -0.0628 0.1135  606 PHE A N   
343  C CA  . PHE A 84  ? 1.0071 1.1615 0.8922 -0.0582 -0.0656 0.1018  606 PHE A CA  
344  C C   . PHE A 84  ? 1.0368 1.1765 0.9104 -0.0662 -0.0745 0.0920  606 PHE A C   
345  O O   . PHE A 84  ? 1.0718 1.1919 0.9288 -0.0637 -0.0712 0.0789  606 PHE A O   
346  C CB  . PHE A 84  ? 1.0254 1.1846 0.8873 -0.0621 -0.0716 0.1074  606 PHE A CB  
347  C CG  . PHE A 84  ? 1.0000 1.1668 0.8612 -0.0535 -0.0613 0.1131  606 PHE A CG  
348  C CD1 . PHE A 84  ? 0.9496 1.1207 0.8349 -0.0446 -0.0496 0.1156  606 PHE A CD1 
349  C CD2 . PHE A 84  ? 1.0142 1.1843 0.8506 -0.0547 -0.0642 0.1169  606 PHE A CD2 
350  C CE1 . PHE A 84  ? 0.9246 1.1042 0.8117 -0.0381 -0.0414 0.1233  606 PHE A CE1 
351  C CE2 . PHE A 84  ? 0.9992 1.1792 0.8363 -0.0469 -0.0546 0.1243  606 PHE A CE2 
352  C CZ  . PHE A 84  ? 0.9554 1.1408 0.8192 -0.0391 -0.0433 0.1282  606 PHE A CZ  
353  N N   . SER A 85  ? 1.0541 1.2038 0.9380 -0.0756 -0.0858 0.0995  607 SER A N   
354  C CA  . SER A 85  ? 1.0675 1.2043 0.9443 -0.0844 -0.0951 0.0924  607 SER A CA  
355  C C   . SER A 85  ? 1.0635 1.2030 0.9666 -0.0804 -0.0890 0.0908  607 SER A C   
356  O O   . SER A 85  ? 1.0293 1.1570 0.9279 -0.0860 -0.0943 0.0843  607 SER A O   
357  C CB  . SER A 85  ? 1.0378 1.1828 0.9092 -0.0988 -0.1125 0.1017  607 SER A CB  
358  O OG  . SER A 85  ? 0.9685 1.1416 0.8708 -0.0995 -0.1137 0.1182  607 SER A OG  
359  N N   . PHE A 86  ? 1.0794 1.2331 1.0083 -0.0706 -0.0785 0.0968  608 PHE A N   
360  C CA  . PHE A 86  ? 1.0703 1.2247 1.0209 -0.0640 -0.0709 0.0939  608 PHE A CA  
361  C C   . PHE A 86  ? 1.0510 1.1836 0.9891 -0.0588 -0.0630 0.0790  608 PHE A C   
362  O O   . PHE A 86  ? 1.0442 1.1702 0.9892 -0.0579 -0.0611 0.0730  608 PHE A O   
363  C CB  . PHE A 86  ? 1.0921 1.2623 1.0679 -0.0539 -0.0629 0.1031  608 PHE A CB  
364  C CG  . PHE A 86  ? 1.0952 1.2718 1.0943 -0.0479 -0.0587 0.1043  608 PHE A CG  
365  C CD1 . PHE A 86  ? 1.1010 1.2639 1.1023 -0.0419 -0.0511 0.0935  608 PHE A CD1 
366  C CD2 . PHE A 86  ? 1.0921 1.2895 1.1105 -0.0468 -0.0619 0.1170  608 PHE A CD2 
367  C CE1 . PHE A 86  ? 1.0774 1.2457 1.0971 -0.0356 -0.0474 0.0942  608 PHE A CE1 
368  C CE2 . PHE A 86  ? 1.0771 1.2807 1.1140 -0.0391 -0.0570 0.1179  608 PHE A CE2 
369  C CZ  . PHE A 86  ? 1.0742 1.2625 1.1107 -0.0335 -0.0500 0.1060  608 PHE A CZ  
370  N N   . ALA A 87  ? 1.0220 1.1453 0.9421 -0.0549 -0.0581 0.0742  609 ALA A N   
371  C CA  . ALA A 87  ? 0.9885 1.0937 0.8962 -0.0487 -0.0499 0.0619  609 ALA A CA  
372  C C   . ALA A 87  ? 0.9855 1.0698 0.8620 -0.0539 -0.0563 0.0510  609 ALA A C   
373  O O   . ALA A 87  ? 0.9388 1.0069 0.8077 -0.0499 -0.0517 0.0404  609 ALA A O   
374  C CB  . ALA A 87  ? 0.9790 1.0880 0.8860 -0.0400 -0.0398 0.0645  609 ALA A CB  
375  N N   . ASP A 88  ? 1.0244 1.1076 0.8819 -0.0624 -0.0677 0.0536  610 ASP A N   
376  C CA  . ASP A 88  ? 1.0421 1.1016 0.8680 -0.0690 -0.0776 0.0431  610 ASP A CA  
377  C C   . ASP A 88  ? 1.0271 1.0794 0.8626 -0.0769 -0.0853 0.0405  610 ASP A C   
378  O O   . ASP A 88  ? 1.0199 1.0479 0.8355 -0.0783 -0.0889 0.0291  610 ASP A O   
379  C CB  . ASP A 88  ? 1.0558 1.1153 0.8589 -0.0780 -0.0906 0.0474  610 ASP A CB  
380  C CG  . ASP A 88  ? 1.0502 1.1072 0.8294 -0.0697 -0.0839 0.0454  610 ASP A CG  
381  O OD1 . ASP A 88  ? 1.0422 1.0842 0.8051 -0.0594 -0.0740 0.0349  610 ASP A OD1 
382  O OD2 . ASP A 88  ? 1.0162 1.0876 0.7928 -0.0731 -0.0884 0.0552  610 ASP A OD2 
383  N N   . ARG A 89  ? 1.0234 1.0969 0.8890 -0.0809 -0.0874 0.0517  611 ARG A N   
384  C CA  . ARG A 89  ? 1.0255 1.0987 0.9058 -0.0868 -0.0924 0.0522  611 ARG A CA  
385  C C   . ARG A 89  ? 1.0103 1.0722 0.8966 -0.0775 -0.0810 0.0422  611 ARG A C   
386  O O   . ARG A 89  ? 1.0133 1.0614 0.8958 -0.0819 -0.0855 0.0365  611 ARG A O   
387  C CB  . ARG A 89  ? 1.0096 1.1123 0.9221 -0.0885 -0.0933 0.0675  611 ARG A CB  
388  C CG  . ARG A 89  ? 1.0002 1.1112 0.9194 -0.1023 -0.1079 0.0766  611 ARG A CG  
389  C CD  . ARG A 89  ? 1.0051 1.1254 0.9156 -0.1126 -0.1208 0.0866  611 ARG A CD  
390  N NE  . ARG A 89  ? 1.0160 1.1593 0.9476 -0.1228 -0.1313 0.1027  611 ARG A NE  
391  C CZ  . ARG A 89  ? 1.0006 1.1576 0.9315 -0.1339 -0.1446 0.1154  611 ARG A CZ  
392  N NH1 . ARG A 89  ? 0.9801 1.1615 0.9342 -0.1423 -0.1528 0.1319  611 ARG A NH1 
393  N NH2 . ARG A 89  ? 1.0081 1.1564 0.9157 -0.1367 -0.1497 0.1129  611 ARG A NH2 
394  N N   . GLU A 90  ? 1.0133 1.0816 0.9101 -0.0656 -0.0672 0.0414  612 GLU A N   
395  C CA  . GLU A 90  ? 1.0398 1.0997 0.9440 -0.0567 -0.0564 0.0335  612 GLU A CA  
396  C C   . GLU A 90  ? 1.0692 1.1056 0.9476 -0.0518 -0.0523 0.0210  612 GLU A C   
397  O O   . GLU A 90  ? 1.0770 1.1027 0.9577 -0.0472 -0.0469 0.0138  612 GLU A O   
398  C CB  . GLU A 90  ? 1.0390 1.1142 0.9650 -0.0470 -0.0452 0.0389  612 GLU A CB  
399  C CG  . GLU A 90  ? 1.0303 1.1266 0.9816 -0.0478 -0.0470 0.0500  612 GLU A CG  
400  C CD  . GLU A 90  ? 1.0379 1.1448 1.0053 -0.0387 -0.0386 0.0554  612 GLU A CD  
401  O OE1 . GLU A 90  ? 1.0309 1.1537 1.0100 -0.0388 -0.0411 0.0658  612 GLU A OE1 
402  O OE2 . GLU A 90  ? 0.9903 1.0894 0.9590 -0.0317 -0.0302 0.0502  612 GLU A OE2 
403  N N   . VAL A 91  ? 1.0907 1.1200 0.9442 -0.0517 -0.0546 0.0190  613 VAL A N   
404  C CA  . VAL A 91  ? 1.1264 1.1326 0.9501 -0.0455 -0.0511 0.0072  613 VAL A CA  
405  C C   . VAL A 91  ? 1.1850 1.1660 0.9865 -0.0535 -0.0636 -0.0017 613 VAL A C   
406  O O   . VAL A 91  ? 1.2213 1.1808 1.0071 -0.0474 -0.0601 -0.0126 613 VAL A O   
407  C CB  . VAL A 91  ? 1.1286 1.1372 0.9311 -0.0408 -0.0484 0.0087  613 VAL A CB  
408  C CG1 . VAL A 91  ? 1.1386 1.1204 0.9013 -0.0362 -0.0497 -0.0038 613 VAL A CG1 
409  C CG2 . VAL A 91  ? 1.0711 1.0980 0.8922 -0.0303 -0.0337 0.0153  613 VAL A CG2 
410  N N   . GLN A 92  ? 1.1991 1.1825 1.0002 -0.0671 -0.0787 0.0038  614 GLN A N   
411  C CA  . GLN A 92  ? 1.2116 1.1718 0.9959 -0.0778 -0.0935 -0.0020 614 GLN A CA  
412  C C   . GLN A 92  ? 1.2231 1.1782 1.0249 -0.0769 -0.0903 -0.0050 614 GLN A C   
413  O O   . GLN A 92  ? 1.2814 1.2091 1.0644 -0.0773 -0.0948 -0.0152 614 GLN A O   
414  C CB  . GLN A 92  ? 1.1994 1.1709 0.9892 -0.0941 -0.1105 0.0092  614 GLN A CB  
415  C CG  . GLN A 92  ? 1.2030 1.1500 0.9563 -0.1040 -0.1276 0.0039  614 GLN A CG  
416  C CD  . GLN A 92  ? 1.2153 1.1271 0.9471 -0.1086 -0.1377 -0.0077 614 GLN A CD  
417  O OE1 . GLN A 92  ? 1.2399 1.1233 0.9356 -0.1134 -0.1504 -0.0159 614 GLN A OE1 
418  N NE2 . GLN A 92  ? 1.1610 1.0728 0.9133 -0.1071 -0.1328 -0.0083 614 GLN A NE2 
419  N N   . LEU A 93  ? 1.1816 1.1619 1.0177 -0.0749 -0.0829 0.0037  615 LEU A N   
420  C CA  . LEU A 93  ? 1.1819 1.1614 1.0362 -0.0724 -0.0779 0.0018  615 LEU A CA  
421  C C   . LEU A 93  ? 1.2538 1.2179 1.0998 -0.0593 -0.0652 -0.0092 615 LEU A C   
422  O O   . LEU A 93  ? 1.2494 1.2040 1.1011 -0.0580 -0.0637 -0.0134 615 LEU A O   
423  C CB  . LEU A 93  ? 1.0971 1.1066 0.9862 -0.0704 -0.0714 0.0128  615 LEU A CB  
424  C CG  . LEU A 93  ? 1.0688 1.0986 0.9743 -0.0814 -0.0818 0.0260  615 LEU A CG  
425  C CD1 . LEU A 93  ? 1.0139 1.0706 0.9494 -0.0747 -0.0727 0.0349  615 LEU A CD1 
426  C CD2 . LEU A 93  ? 1.0832 1.1036 0.9882 -0.0925 -0.0935 0.0269  615 LEU A CD2 
427  N N   . LEU A 94  ? 1.3207 1.2854 1.1557 -0.0495 -0.0559 -0.0119 616 LEU A N   
428  C CA  . LEU A 94  ? 1.3348 1.2929 1.1670 -0.0359 -0.0421 -0.0185 616 LEU A CA  
429  C C   . LEU A 94  ? 1.3376 1.2693 1.1350 -0.0282 -0.0403 -0.0299 616 LEU A C   
430  O O   . LEU A 94  ? 1.3528 1.2830 1.1484 -0.0155 -0.0276 -0.0334 616 LEU A O   
431  C CB  . LEU A 94  ? 1.3427 1.3255 1.1955 -0.0293 -0.0311 -0.0102 616 LEU A CB  
432  C CG  . LEU A 94  ? 1.3383 1.3315 1.2179 -0.0231 -0.0213 -0.0081 616 LEU A CG  
433  C CD1 . LEU A 94  ? 1.3255 1.3421 1.2308 -0.0246 -0.0199 0.0024  616 LEU A CD1 
434  C CD2 . LEU A 94  ? 1.3409 1.3298 1.2153 -0.0109 -0.0089 -0.0118 616 LEU A CD2 
435  N N   . ARG A 95  ? 1.3456 1.2559 1.1165 -0.0358 -0.0536 -0.0355 617 ARG A N   
436  C CA  . ARG A 95  ? 1.3550 1.2345 1.0912 -0.0288 -0.0545 -0.0480 617 ARG A CA  
437  C C   . ARG A 95  ? 1.3500 1.2100 1.0891 -0.0355 -0.0633 -0.0526 617 ARG A C   
438  O O   . ARG A 95  ? 1.3065 1.1356 1.0195 -0.0307 -0.0661 -0.0637 617 ARG A O   
439  C CB  . ARG A 95  ? 1.3338 1.1962 1.0330 -0.0321 -0.0651 -0.0528 617 ARG A CB  
440  C CG  . ARG A 95  ? 1.2958 1.1733 0.9858 -0.0219 -0.0543 -0.0498 617 ARG A CG  
441  C CD  . ARG A 95  ? 1.2585 1.1473 0.9437 -0.0333 -0.0655 -0.0424 617 ARG A CD  
442  N NE  . ARG A 95  ? 1.2648 1.1283 0.9049 -0.0322 -0.0740 -0.0514 617 ARG A NE  
443  C CZ  . ARG A 95  ? 1.2662 1.1373 0.8876 -0.0253 -0.0690 -0.0498 617 ARG A CZ  
444  N NH1 . ARG A 95  ? 1.2879 1.1329 0.8645 -0.0239 -0.0779 -0.0593 617 ARG A NH1 
445  N NH2 . ARG A 95  ? 1.2147 1.1182 0.8610 -0.0198 -0.0559 -0.0385 617 ARG A NH2 
446  N N   . GLU A 96  ? 1.3049 1.1832 1.0753 -0.0459 -0.0676 -0.0434 618 GLU A N   
447  C CA  . GLU A 96  ? 1.3164 1.1820 1.0941 -0.0541 -0.0766 -0.0444 618 GLU A CA  
448  C C   . GLU A 96  ? 1.3058 1.1873 1.1147 -0.0494 -0.0662 -0.0406 618 GLU A C   
449  O O   . GLU A 96  ? 1.2932 1.1598 1.1035 -0.0505 -0.0689 -0.0441 618 GLU A O   
450  C CB  . GLU A 96  ? 1.2908 1.1636 1.0754 -0.0723 -0.0938 -0.0353 618 GLU A CB  
451  C CG  . GLU A 96  ? 1.2805 1.1471 1.0404 -0.0781 -0.1039 -0.0356 618 GLU A CG  
452  C CD  . GLU A 96  ? 1.2958 1.1220 1.0129 -0.0750 -0.1110 -0.0499 618 GLU A CD  
453  O OE1 . GLU A 96  ? 1.2830 1.0952 0.9762 -0.0846 -0.1261 -0.0509 618 GLU A OE1 
454  O OE2 . GLU A 96  ? 1.2781 1.0855 0.9845 -0.0625 -0.1020 -0.0600 618 GLU A OE2 
455  N N   . SER A 97  ? 1.2552 1.1653 1.0882 -0.0443 -0.0550 -0.0334 619 SER A N   
456  C CA  . SER A 97  ? 1.2094 1.1347 1.0705 -0.0395 -0.0456 -0.0299 619 SER A CA  
457  C C   . SER A 97  ? 1.1413 1.0658 1.0041 -0.0248 -0.0305 -0.0343 619 SER A C   
458  O O   . SER A 97  ? 1.0874 1.0134 0.9653 -0.0215 -0.0258 -0.0345 619 SER A O   
459  C CB  . SER A 97  ? 1.1590 1.1150 1.0475 -0.0427 -0.0436 -0.0188 619 SER A CB  
460  O OG  . SER A 97  ? 1.1502 1.1178 1.0356 -0.0402 -0.0405 -0.0153 619 SER A OG  
461  N N   . ASP A 98  ? 1.1258 1.0517 0.9760 -0.0165 -0.0233 -0.0358 620 ASP A N   
462  C CA  . ASP A 98  ? 1.0990 1.0297 0.9538 -0.0031 -0.0090 -0.0365 620 ASP A CA  
463  C C   . ASP A 98  ? 1.1003 1.0085 0.9353 0.0074  -0.0041 -0.0456 620 ASP A C   
464  O O   . ASP A 98  ? 1.1856 1.0991 1.0198 0.0196  0.0080  -0.0450 620 ASP A O   
465  C CB  . ASP A 98  ? 1.0934 1.0398 0.9464 0.0020  -0.0022 -0.0313 620 ASP A CB  
466  C CG  . ASP A 98  ? 1.0916 1.0232 0.9120 0.0106  0.0010  -0.0375 620 ASP A CG  
467  O OD1 . ASP A 98  ? 1.1392 1.0554 0.9351 0.0052  -0.0089 -0.0424 620 ASP A OD1 
468  O OD2 . ASP A 98  ? 1.0172 0.9538 0.8361 0.0229  0.0132  -0.0366 620 ASP A OD2 
469  N N   . GLU A 99  ? 1.0135 0.8974 0.8339 0.0028  -0.0135 -0.0526 621 GLU A N   
470  C CA  . GLU A 99  ? 0.9125 0.7719 0.7156 0.0127  -0.0102 -0.0614 621 GLU A CA  
471  C C   . GLU A 99  ? 0.8091 0.6739 0.6367 0.0137  -0.0064 -0.0588 621 GLU A C   
472  O O   . GLU A 99  ? 0.8690 0.7131 0.6885 0.0159  -0.0090 -0.0644 621 GLU A O   
473  C CB  . GLU A 99  ? 0.9614 0.7885 0.7352 0.0061  -0.0247 -0.0701 621 GLU A CB  
474  C CG  . GLU A 99  ? 0.9659 0.7974 0.7509 -0.0127 -0.0402 -0.0647 621 GLU A CG  
475  C CD  . GLU A 99  ? 0.9773 0.7753 0.7365 -0.0216 -0.0569 -0.0716 621 GLU A CD  
476  O OE1 . GLU A 99  ? 0.9775 0.7662 0.7156 -0.0282 -0.0670 -0.0734 621 GLU A OE1 
477  O OE2 . GLU A 99  ? 0.9353 0.7159 0.6957 -0.0227 -0.0610 -0.0746 621 GLU A OE2 
478  N N   . HIS A 100 ? 0.6601 0.5520 0.5171 0.0118  -0.0010 -0.0502 622 HIS A N   
479  C CA  . HIS A 100 ? 0.5771 0.4779 0.4590 0.0122  0.0024  -0.0466 622 HIS A CA  
480  C C   . HIS A 100 ? 0.5092 0.4299 0.4077 0.0219  0.0154  -0.0410 622 HIS A C   
481  O O   . HIS A 100 ? 0.4871 0.4233 0.3897 0.0222  0.0187  -0.0361 622 HIS A O   
482  C CB  . HIS A 100 ? 0.5405 0.4553 0.4429 -0.0006 -0.0058 -0.0406 622 HIS A CB  
483  C CG  . HIS A 100 ? 0.5059 0.4245 0.4274 -0.0015 -0.0052 -0.0384 622 HIS A CG  
484  N ND1 . HIS A 100 ? 0.4787 0.4156 0.4222 0.0027  0.0024  -0.0334 622 HIS A ND1 
485  C CD2 . HIS A 100 ? 0.5115 0.4176 0.4329 -0.0065 -0.0121 -0.0399 622 HIS A CD2 
486  C CE1 . HIS A 100 ? 0.4715 0.4076 0.4265 0.0010  0.0006  -0.0325 622 HIS A CE1 
487  N NE2 . HIS A 100 ? 0.4852 0.4038 0.4281 -0.0045 -0.0077 -0.0358 622 HIS A NE2 
488  N N   . PRO A 101 ? 0.4862 0.4070 0.3953 0.0293  0.0220  -0.0403 623 PRO A N   
489  C CA  . PRO A 101 ? 0.4648 0.4055 0.3904 0.0376  0.0333  -0.0331 623 PRO A CA  
490  C C   . PRO A 101 ? 0.4246 0.3885 0.3748 0.0307  0.0323  -0.0247 623 PRO A C   
491  O O   . PRO A 101 ? 0.4212 0.4001 0.3810 0.0352  0.0390  -0.0180 623 PRO A O   
492  C CB  . PRO A 101 ? 0.4586 0.3950 0.3927 0.0445  0.0380  -0.0331 623 PRO A CB  
493  C CG  . PRO A 101 ? 0.4796 0.3978 0.4081 0.0373  0.0283  -0.0390 623 PRO A CG  
494  C CD  . PRO A 101 ? 0.4994 0.4020 0.4044 0.0313  0.0199  -0.0451 623 PRO A CD  
495  N N   . ASN A 102 ? 0.4059 0.3719 0.3650 0.0204  0.0237  -0.0246 624 ASN A N   
496  C CA  . ASN A 102 ? 0.3734 0.3571 0.3530 0.0155  0.0220  -0.0182 624 ASN A CA  
497  C C   . ASN A 102 ? 0.3664 0.3549 0.3424 0.0086  0.0160  -0.0170 624 ASN A C   
498  O O   . ASN A 102 ? 0.3458 0.3445 0.3353 0.0040  0.0123  -0.0135 624 ASN A O   
499  C CB  . ASN A 102 ? 0.3650 0.3503 0.3594 0.0117  0.0183  -0.0179 624 ASN A CB  
500  C CG  . ASN A 102 ? 0.3568 0.3373 0.3556 0.0177  0.0230  -0.0184 624 ASN A CG  
501  O OD1 . ASN A 102 ? 0.3658 0.3349 0.3597 0.0166  0.0201  -0.0222 624 ASN A OD1 
502  N ND2 . ASN A 102 ? 0.3575 0.3474 0.3664 0.0238  0.0299  -0.0133 624 ASN A ND2 
503  N N   . VAL A 103 ? 0.4035 0.3842 0.3597 0.0086  0.0149  -0.0199 625 VAL A N   
504  C CA  . VAL A 103 ? 0.4055 0.3933 0.3576 0.0037  0.0108  -0.0170 625 VAL A CA  
505  C C   . VAL A 103 ? 0.4143 0.4049 0.3566 0.0110  0.0182  -0.0152 625 VAL A C   
506  O O   . VAL A 103 ? 0.4275 0.4077 0.3547 0.0184  0.0233  -0.0193 625 VAL A O   
507  C CB  . VAL A 103 ? 0.4235 0.3996 0.3588 -0.0041 0.0010  -0.0210 625 VAL A CB  
508  C CG1 . VAL A 103 ? 0.4176 0.4036 0.3505 -0.0094 -0.0035 -0.0164 625 VAL A CG1 
509  C CG2 . VAL A 103 ? 0.4252 0.4003 0.3709 -0.0107 -0.0054 -0.0210 625 VAL A CG2 
510  N N   . ILE A 104 ? 0.4137 0.4190 0.3650 0.0098  0.0190  -0.0082 626 ILE A N   
511  C CA  . ILE A 104 ? 0.4341 0.4470 0.3800 0.0158  0.0257  -0.0034 626 ILE A CA  
512  C C   . ILE A 104 ? 0.4715 0.4724 0.3875 0.0178  0.0248  -0.0090 626 ILE A C   
513  O O   . ILE A 104 ? 0.4904 0.4837 0.3948 0.0105  0.0159  -0.0126 626 ILE A O   
514  C CB  . ILE A 104 ? 0.4259 0.4555 0.3887 0.0123  0.0244  0.0059  626 ILE A CB  
515  C CG1 . ILE A 104 ? 0.4510 0.4915 0.4129 0.0181  0.0317  0.0137  626 ILE A CG1 
516  C CG2 . ILE A 104 ? 0.4248 0.4555 0.3830 0.0047  0.0159  0.0061  626 ILE A CG2 
517  C CD1 . ILE A 104 ? 0.4460 0.4974 0.4304 0.0214  0.0371  0.0218  626 ILE A CD1 
518  N N   . ARG A 105 ? 0.5157 0.5150 0.4190 0.0282  0.0338  -0.0094 627 ARG A N   
519  C CA  . ARG A 105 ? 0.5691 0.5549 0.4396 0.0330  0.0341  -0.0156 627 ARG A CA  
520  C C   . ARG A 105 ? 0.5563 0.5529 0.4194 0.0303  0.0323  -0.0100 627 ARG A C   
521  O O   . ARG A 105 ? 0.5172 0.5336 0.3960 0.0324  0.0382  0.0004  627 ARG A O   
522  C CB  . ARG A 105 ? 0.6222 0.6056 0.4813 0.0481  0.0463  -0.0166 627 ARG A CB  
523  C CG  . ARG A 105 ? 0.6684 0.6316 0.5183 0.0536  0.0472  -0.0259 627 ARG A CG  
524  C CD  . ARG A 105 ? 0.7089 0.6710 0.5447 0.0711  0.0604  -0.0261 627 ARG A CD  
525  N NE  . ARG A 105 ? 0.7544 0.6979 0.5506 0.0787  0.0603  -0.0348 627 ARG A NE  
526  C CZ  . ARG A 105 ? 0.8029 0.7360 0.5762 0.0957  0.0700  -0.0393 627 ARG A CZ  
527  N NH1 . ARG A 105 ? 0.8380 0.7512 0.5717 0.1024  0.0683  -0.0486 627 ARG A NH1 
528  N NH2 . ARG A 105 ? 0.8248 0.7670 0.6133 0.1068  0.0813  -0.0345 627 ARG A NH2 
529  N N   . TYR A 106 ? 0.5692 0.5521 0.4082 0.0248  0.0232  -0.0162 628 TYR A N   
530  C CA  . TYR A 106 ? 0.5834 0.5740 0.4100 0.0226  0.0206  -0.0118 628 TYR A CA  
531  C C   . TYR A 106 ? 0.6144 0.5960 0.4093 0.0349  0.0278  -0.0163 628 TYR A C   
532  O O   . TYR A 106 ? 0.6281 0.5880 0.4019 0.0415  0.0287  -0.0268 628 TYR A O   
533  C CB  . TYR A 106 ? 0.6028 0.5833 0.4189 0.0099  0.0057  -0.0154 628 TYR A CB  
534  C CG  . TYR A 106 ? 0.6367 0.6191 0.4314 0.0077  0.0013  -0.0133 628 TYR A CG  
535  C CD1 . TYR A 106 ? 0.6265 0.6320 0.4376 0.0048  0.0023  -0.0015 628 TYR A CD1 
536  C CD2 . TYR A 106 ? 0.6844 0.6439 0.4409 0.0088  -0.0049 -0.0231 628 TYR A CD2 
537  C CE1 . TYR A 106 ? 0.6451 0.6540 0.4371 0.0027  -0.0020 0.0015  628 TYR A CE1 
538  C CE2 . TYR A 106 ? 0.6991 0.6605 0.4341 0.0066  -0.0098 -0.0210 628 TYR A CE2 
539  C CZ  . TYR A 106 ? 0.6776 0.6652 0.4317 0.0034  -0.0080 -0.0082 628 TYR A CZ  
540  O OH  . TYR A 106 ? 0.7031 0.6948 0.4381 0.0009  -0.0129 -0.0047 628 TYR A OH  
541  N N   . PHE A 107 ? 0.6134 0.6119 0.4052 0.0394  0.0338  -0.0078 629 PHE A N   
542  C CA  . PHE A 107 ? 0.6434 0.6371 0.4043 0.0531  0.0423  -0.0105 629 PHE A CA  
543  C C   . PHE A 107 ? 0.6676 0.6586 0.4000 0.0507  0.0362  -0.0112 629 PHE A C   
544  O O   . PHE A 107 ? 0.7269 0.6953 0.4208 0.0562  0.0333  -0.0223 629 PHE A O   
545  C CB  . PHE A 107 ? 0.6315 0.6501 0.4110 0.0643  0.0579  0.0019  629 PHE A CB  
546  C CG  . PHE A 107 ? 0.6263 0.6424 0.4176 0.0731  0.0666  0.0001  629 PHE A CG  
547  C CD1 . PHE A 107 ? 0.6612 0.6535 0.4247 0.0836  0.0692  -0.0126 629 PHE A CD1 
548  C CD2 . PHE A 107 ? 0.5974 0.6335 0.4269 0.0709  0.0712  0.0112  629 PHE A CD2 
549  C CE1 . PHE A 107 ? 0.6627 0.6539 0.4383 0.0922  0.0773  -0.0132 629 PHE A CE1 
550  C CE2 . PHE A 107 ? 0.5866 0.6218 0.4279 0.0783  0.0784  0.0107  629 PHE A CE2 
551  C CZ  . PHE A 107 ? 0.6246 0.6386 0.4398 0.0892  0.0820  -0.0010 629 PHE A CZ  
552  N N   . CYS A 108 ? 0.6489 0.6618 0.3988 0.0431  0.0339  0.0009  630 CYS A N   
553  C CA  . CYS A 108 ? 0.6800 0.6960 0.4053 0.0424  0.0302  0.0034  630 CYS A CA  
554  C C   . CYS A 108 ? 0.6600 0.6934 0.4060 0.0291  0.0215  0.0142  630 CYS A C   
555  O O   . CYS A 108 ? 0.6172 0.6671 0.3995 0.0243  0.0228  0.0235  630 CYS A O   
556  C CB  . CYS A 108 ? 0.6958 0.7280 0.4120 0.0578  0.0456  0.0110  630 CYS A CB  
557  S SG  . CYS A 108 ? 0.7473 0.7789 0.4209 0.0626  0.0440  0.0112  630 CYS A SG  
558  N N   . THR A 109 ? 0.6966 0.7254 0.4179 0.0238  0.0121  0.0131  631 THR A N   
559  C CA  . THR A 109 ? 0.6825 0.7304 0.4197 0.0137  0.0053  0.0253  631 THR A CA  
560  C C   . THR A 109 ? 0.7091 0.7651 0.4199 0.0188  0.0076  0.0305  631 THR A C   
561  O O   . THR A 109 ? 0.7399 0.7770 0.4103 0.0231  0.0045  0.0201  631 THR A O   
562  C CB  . THR A 109 ? 0.6857 0.7235 0.4234 -0.0015 -0.0117 0.0217  631 THR A CB  
563  O OG1 . THR A 109 ? 0.6881 0.7214 0.4510 -0.0057 -0.0131 0.0183  631 THR A OG1 
564  C CG2 . THR A 109 ? 0.6740 0.7333 0.4285 -0.0100 -0.0178 0.0355  631 THR A CG2 
565  N N   . GLU A 110 ? 0.7087 0.7912 0.4407 0.0186  0.0123  0.0465  632 GLU A N   
566  C CA  . GLU A 110 ? 0.7515 0.8456 0.4612 0.0231  0.0146  0.0540  632 GLU A CA  
567  C C   . GLU A 110 ? 0.7568 0.8711 0.4873 0.0125  0.0072  0.0687  632 GLU A C   
568  O O   . GLU A 110 ? 0.7047 0.8293 0.4722 0.0058  0.0050  0.0763  632 GLU A O   
569  C CB  . GLU A 110 ? 0.7465 0.8559 0.4559 0.0384  0.0322  0.0614  632 GLU A CB  
570  C CG  . GLU A 110 ? 0.7638 0.8547 0.4486 0.0519  0.0410  0.0478  632 GLU A CG  
571  C CD  . GLU A 110 ? 0.8140 0.8837 0.4453 0.0586  0.0375  0.0350  632 GLU A CD  
572  O OE1 . GLU A 110 ? 0.8187 0.8845 0.4329 0.0493  0.0250  0.0347  632 GLU A OE1 
573  O OE2 . GLU A 110 ? 0.8385 0.8945 0.4439 0.0737  0.0468  0.0254  632 GLU A OE2 
574  N N   . LYS A 111 ? 0.8439 0.9620 0.5477 0.0118  0.0027  0.0721  633 LYS A N   
575  C CA  . LYS A 111 ? 0.8817 1.0162 0.5991 0.0014  -0.0066 0.0850  633 LYS A CA  
576  C C   . LYS A 111 ? 0.8689 1.0269 0.5839 0.0073  0.0009  0.1005  633 LYS A C   
577  O O   . LYS A 111 ? 0.8777 1.0339 0.5581 0.0161  0.0059  0.0978  633 LYS A O   
578  C CB  . LYS A 111 ? 0.9649 1.0835 0.6545 -0.0091 -0.0236 0.0768  633 LYS A CB  
579  C CG  . LYS A 111 ? 1.0705 1.1639 0.7093 -0.0028 -0.0252 0.0609  633 LYS A CG  
580  C CD  . LYS A 111 ? 1.1361 1.2118 0.7483 -0.0157 -0.0450 0.0538  633 LYS A CD  
581  C CE  . LYS A 111 ? 1.1811 1.2652 0.7646 -0.0164 -0.0503 0.0606  633 LYS A CE  
582  N NZ  . LYS A 111 ? 1.2402 1.3087 0.7749 -0.0023 -0.0437 0.0500  633 LYS A NZ  
583  N N   . ASP A 112 ? 0.8596 1.0390 0.6119 0.0029  0.0015  0.1170  634 ASP A N   
584  C CA  . ASP A 112 ? 0.8553 1.0595 0.6144 0.0048  0.0055  0.1356  634 ASP A CA  
585  C C   . ASP A 112 ? 0.8662 1.0763 0.6163 -0.0048 -0.0076 0.1419  634 ASP A C   
586  O O   . ASP A 112 ? 0.8545 1.0505 0.5940 -0.0135 -0.0202 0.1326  634 ASP A O   
587  C CB  . ASP A 112 ? 0.8057 1.0261 0.6117 0.0037  0.0103  0.1503  634 ASP A CB  
588  C CG  . ASP A 112 ? 0.7971 1.0375 0.6104 0.0125  0.0232  0.1649  634 ASP A CG  
589  O OD1 . ASP A 112 ? 0.8397 1.0838 0.6220 0.0212  0.0304  0.1638  634 ASP A OD1 
590  O OD2 . ASP A 112 ? 0.7584 1.0108 0.6084 0.0109  0.0257  0.1781  634 ASP A OD2 
591  N N   . ARG A 113 ? 0.9024 1.1351 0.6583 -0.0037 -0.0050 0.1595  635 ARG A N   
592  C CA  . ARG A 113 ? 0.9310 1.1748 0.6900 -0.0131 -0.0168 0.1703  635 ARG A CA  
593  C C   . ARG A 113 ? 0.8949 1.1402 0.6941 -0.0214 -0.0238 0.1750  635 ARG A C   
594  O O   . ARG A 113 ? 0.8978 1.1433 0.6977 -0.0304 -0.0362 0.1764  635 ARG A O   
595  C CB  . ARG A 113 ? 0.9633 1.2326 0.7251 -0.0094 -0.0113 0.1905  635 ARG A CB  
596  C CG  . ARG A 113 ? 0.9998 1.2764 0.7445 0.0036  0.0040  0.1923  635 ARG A CG  
597  C CD  . ARG A 113 ? 1.0393 1.3366 0.7638 0.0067  0.0056  0.2070  635 ARG A CD  
598  N NE  . ARG A 113 ? 1.0394 1.3600 0.7996 0.0009  0.0033  0.2300  635 ARG A NE  
599  C CZ  . ARG A 113 ? 1.0207 1.3632 0.8040 0.0059  0.0135  0.2487  635 ARG A CZ  
600  N NH1 . ARG A 113 ? 1.0398 1.3869 0.8157 0.0170  0.0277  0.2483  635 ARG A NH1 
601  N NH2 . ARG A 113 ? 0.9890 1.3488 0.8036 -0.0002 0.0092  0.2690  635 ARG A NH2 
602  N N   . GLN A 114 ? 0.8689 1.1165 0.7015 -0.0178 -0.0161 0.1786  636 GLN A N   
603  C CA  . GLN A 114 ? 0.8381 1.0855 0.7068 -0.0232 -0.0218 0.1823  636 GLN A CA  
604  C C   . GLN A 114 ? 0.7945 1.0247 0.6768 -0.0228 -0.0207 0.1684  636 GLN A C   
605  O O   . GLN A 114 ? 0.7802 1.0095 0.6869 -0.0264 -0.0261 0.1700  636 GLN A O   
606  C CB  . GLN A 114 ? 0.8454 1.1094 0.7468 -0.0214 -0.0181 0.2015  636 GLN A CB  
607  C CG  . GLN A 114 ? 0.8916 1.1741 0.7828 -0.0183 -0.0133 0.2167  636 GLN A CG  
608  C CD  . GLN A 114 ? 0.8936 1.1894 0.8194 -0.0167 -0.0093 0.2353  636 GLN A CD  
609  O OE1 . GLN A 114 ? 0.8903 1.1813 0.8461 -0.0189 -0.0134 0.2385  636 GLN A OE1 
610  N NE2 . GLN A 114 ? 0.9088 1.2206 0.8295 -0.0124 -0.0015 0.2480  636 GLN A NE2 
611  N N   . PHE A 115 ? 0.7619 0.9794 0.6288 -0.0174 -0.0133 0.1554  637 PHE A N   
612  C CA  . PHE A 115 ? 0.6966 0.9003 0.5796 -0.0161 -0.0107 0.1446  637 PHE A CA  
613  C C   . PHE A 115 ? 0.6790 0.8632 0.5349 -0.0149 -0.0104 0.1260  637 PHE A C   
614  O O   . PHE A 115 ? 0.6839 0.8631 0.5062 -0.0125 -0.0100 0.1206  637 PHE A O   
615  C CB  . PHE A 115 ? 0.6835 0.8928 0.5891 -0.0097 -0.0001 0.1513  637 PHE A CB  
616  C CG  . PHE A 115 ? 0.6787 0.9014 0.6157 -0.0113 -0.0016 0.1685  637 PHE A CG  
617  C CD1 . PHE A 115 ? 0.6672 0.8852 0.6291 -0.0146 -0.0080 0.1691  637 PHE A CD1 
618  C CD2 . PHE A 115 ? 0.6817 0.9210 0.6228 -0.0086 0.0034  0.1845  637 PHE A CD2 
619  C CE1 . PHE A 115 ? 0.6521 0.8783 0.6407 -0.0149 -0.0101 0.1840  637 PHE A CE1 
620  C CE2 . PHE A 115 ? 0.6759 0.9249 0.6460 -0.0106 0.0008  0.2008  637 PHE A CE2 
621  C CZ  . PHE A 115 ? 0.6627 0.9032 0.6557 -0.0135 -0.0063 0.1998  637 PHE A CZ  
622  N N   . GLN A 116 ? 0.6445 0.8161 0.5138 -0.0161 -0.0112 0.1163  638 GLN A N   
623  C CA  . GLN A 116 ? 0.6480 0.8004 0.4964 -0.0133 -0.0091 0.0997  638 GLN A CA  
624  C C   . GLN A 116 ? 0.6104 0.7612 0.4761 -0.0059 0.0020  0.0981  638 GLN A C   
625  O O   . GLN A 116 ? 0.5639 0.7229 0.4609 -0.0062 0.0038  0.1062  638 GLN A O   
626  C CB  . GLN A 116 ? 0.6589 0.7980 0.5069 -0.0215 -0.0197 0.0899  638 GLN A CB  
627  C CG  . GLN A 116 ? 0.7124 0.8408 0.5265 -0.0278 -0.0304 0.0831  638 GLN A CG  
628  C CD  . GLN A 116 ? 0.7074 0.8211 0.5204 -0.0360 -0.0407 0.0735  638 GLN A CD  
629  O OE1 . GLN A 116 ? 0.7009 0.8088 0.5313 -0.0347 -0.0375 0.0682  638 GLN A OE1 
630  N NE2 . GLN A 116 ? 0.7415 0.8497 0.5336 -0.0453 -0.0540 0.0721  638 GLN A NE2 
631  N N   . TYR A 117 ? 0.6070 0.7459 0.4516 0.0009  0.0085  0.0874  639 TYR A N   
632  C CA  . TYR A 117 ? 0.5817 0.7207 0.4408 0.0084  0.0192  0.0867  639 TYR A CA  
633  C C   . TYR A 117 ? 0.5757 0.6935 0.4239 0.0095  0.0186  0.0703  639 TYR A C   
634  O O   . TYR A 117 ? 0.5951 0.6986 0.4110 0.0124  0.0177  0.0596  639 TYR A O   
635  C CB  . TYR A 117 ? 0.5970 0.7476 0.4432 0.0187  0.0309  0.0937  639 TYR A CB  
636  C CG  . TYR A 117 ? 0.6006 0.7737 0.4595 0.0173  0.0318  0.1122  639 TYR A CG  
637  C CD1 . TYR A 117 ? 0.6259 0.8044 0.4625 0.0153  0.0271  0.1158  639 TYR A CD1 
638  C CD2 . TYR A 117 ? 0.5754 0.7635 0.4690 0.0172  0.0359  0.1266  639 TYR A CD2 
639  C CE1 . TYR A 117 ? 0.6228 0.8226 0.4718 0.0139  0.0276  0.1338  639 TYR A CE1 
640  C CE2 . TYR A 117 ? 0.5851 0.7927 0.4914 0.0153  0.0357  0.1446  639 TYR A CE2 
641  C CZ  . TYR A 117 ? 0.6055 0.8197 0.4900 0.0139  0.0320  0.1484  639 TYR A CZ  
642  O OH  . TYR A 117 ? 0.5993 0.8335 0.4965 0.0120  0.0315  0.1673  639 TYR A OH  
643  N N   . ILE A 118 ? 0.5564 0.6712 0.4305 0.0074  0.0184  0.0684  640 ILE A N   
644  C CA  . ILE A 118 ? 0.5577 0.6542 0.4262 0.0081  0.0179  0.0546  640 ILE A CA  
645  C C   . ILE A 118 ? 0.5168 0.6155 0.3974 0.0166  0.0291  0.0555  640 ILE A C   
646  O O   . ILE A 118 ? 0.4851 0.5960 0.3938 0.0164  0.0321  0.0652  640 ILE A O   
647  C CB  . ILE A 118 ? 0.5658 0.6578 0.4537 -0.0005 0.0090  0.0518  640 ILE A CB  
648  C CG1 . ILE A 118 ? 0.6028 0.6990 0.4865 -0.0092 -0.0018 0.0554  640 ILE A CG1 
649  C CG2 . ILE A 118 ? 0.5863 0.6594 0.4651 -0.0008 0.0073  0.0382  640 ILE A CG2 
650  C CD1 . ILE A 118 ? 0.6652 0.7461 0.5182 -0.0138 -0.0102 0.0457  640 ILE A CD1 
651  N N   . ALA A 119 ? 0.5180 0.6040 0.3769 0.0240  0.0343  0.0455  641 ALA A N   
652  C CA  . ALA A 119 ? 0.4979 0.5879 0.3659 0.0335  0.0457  0.0473  641 ALA A CA  
653  C C   . ALA A 119 ? 0.4754 0.5473 0.3444 0.0333  0.0440  0.0350  641 ALA A C   
654  O O   . ALA A 119 ? 0.4794 0.5316 0.3234 0.0332  0.0394  0.0225  641 ALA A O   
655  C CB  . ALA A 119 ? 0.5284 0.6216 0.3697 0.0459  0.0558  0.0482  641 ALA A CB  
656  N N   . ILE A 120 ? 0.4488 0.5268 0.3468 0.0324  0.0463  0.0392  642 ILE A N   
657  C CA  . ILE A 120 ? 0.4580 0.5219 0.3598 0.0329  0.0458  0.0297  642 ILE A CA  
658  C C   . ILE A 120 ? 0.4459 0.5198 0.3645 0.0408  0.0561  0.0361  642 ILE A C   
659  O O   . ILE A 120 ? 0.4362 0.5285 0.3668 0.0441  0.0622  0.0489  642 ILE A O   
660  C CB  . ILE A 120 ? 0.4468 0.5066 0.3672 0.0223  0.0359  0.0271  642 ILE A CB  
661  C CG1 . ILE A 120 ? 0.4316 0.5065 0.3836 0.0196  0.0361  0.0384  642 ILE A CG1 
662  C CG2 . ILE A 120 ? 0.4616 0.5163 0.3686 0.0144  0.0258  0.0240  642 ILE A CG2 
663  C CD1 . ILE A 120 ? 0.4171 0.4876 0.3858 0.0125  0.0281  0.0356  642 ILE A CD1 
664  N N   . GLU A 121 ? 0.4575 0.5199 0.3778 0.0432  0.0571  0.0283  643 GLU A N   
665  C CA  . GLU A 121 ? 0.4712 0.5421 0.4066 0.0508  0.0662  0.0340  643 GLU A CA  
666  C C   . GLU A 121 ? 0.4378 0.5271 0.4071 0.0454  0.0653  0.0480  643 GLU A C   
667  O O   . GLU A 121 ? 0.4022 0.4885 0.3863 0.0359  0.0564  0.0472  643 GLU A O   
668  C CB  . GLU A 121 ? 0.4888 0.5426 0.4230 0.0511  0.0641  0.0229  643 GLU A CB  
669  C CG  . GLU A 121 ? 0.5123 0.5723 0.4592 0.0595  0.0729  0.0272  643 GLU A CG  
670  C CD  . GLU A 121 ? 0.5085 0.5519 0.4567 0.0579  0.0690  0.0172  643 GLU A CD  
671  O OE1 . GLU A 121 ? 0.5184 0.5437 0.4514 0.0523  0.0609  0.0060  643 GLU A OE1 
672  O OE2 . GLU A 121 ? 0.5033 0.5534 0.4690 0.0616  0.0735  0.0220  643 GLU A OE2 
673  N N   . LEU A 122 ? 0.4255 0.5336 0.4062 0.0516  0.0741  0.0614  644 LEU A N   
674  C CA  . LEU A 122 ? 0.4115 0.5348 0.4245 0.0457  0.0717  0.0756  644 LEU A CA  
675  C C   . LEU A 122 ? 0.3853 0.5027 0.4159 0.0434  0.0690  0.0727  644 LEU A C   
676  O O   . LEU A 122 ? 0.3981 0.5128 0.4230 0.0510  0.0755  0.0688  644 LEU A O   
677  C CB  . LEU A 122 ? 0.4321 0.5797 0.4544 0.0521  0.0812  0.0934  644 LEU A CB  
678  C CG  . LEU A 122 ? 0.4299 0.5928 0.4862 0.0440  0.0765  0.1106  644 LEU A CG  
679  C CD1 . LEU A 122 ? 0.4297 0.5907 0.4907 0.0346  0.0670  0.1135  644 LEU A CD1 
680  C CD2 . LEU A 122 ? 0.4401 0.6298 0.5094 0.0505  0.0865  0.1303  644 LEU A CD2 
681  N N   . CYS A 123 ? 0.3700 0.4847 0.4205 0.0336  0.0593  0.0746  645 CYS A N   
682  C CA  . CYS A 123 ? 0.3628 0.4718 0.4301 0.0301  0.0548  0.0726  645 CYS A CA  
683  C C   . CYS A 123 ? 0.3508 0.4724 0.4465 0.0249  0.0511  0.0882  645 CYS A C   
684  O O   . CYS A 123 ? 0.3498 0.4809 0.4536 0.0217  0.0492  0.0992  645 CYS A O   
685  C CB  . CYS A 123 ? 0.3620 0.4538 0.4249 0.0237  0.0453  0.0600  645 CYS A CB  
686  S SG  . CYS A 123 ? 0.3834 0.4588 0.4181 0.0267  0.0463  0.0429  645 CYS A SG  
687  N N   . ALA A 124 ? 0.3530 0.4739 0.4637 0.0235  0.0490  0.0897  646 ALA A N   
688  C CA  . ALA A 124 ? 0.3507 0.4819 0.4884 0.0173  0.0436  0.1050  646 ALA A CA  
689  C C   . ALA A 124 ? 0.3511 0.4686 0.4978 0.0075  0.0295  0.1027  646 ALA A C   
690  O O   . ALA A 124 ? 0.3677 0.4904 0.5311 0.0014  0.0231  0.1154  646 ALA A O   
691  C CB  . ALA A 124 ? 0.3381 0.4745 0.4880 0.0193  0.0459  0.1084  646 ALA A CB  
692  N N   . ALA A 125 ? 0.3524 0.4519 0.4873 0.0066  0.0247  0.0869  647 ALA A N   
693  C CA  . ALA A 125 ? 0.3502 0.4353 0.4916 0.0001  0.0123  0.0833  647 ALA A CA  
694  C C   . ALA A 125 ? 0.3307 0.4012 0.4550 0.0016  0.0101  0.0672  647 ALA A C   
695  O O   . ALA A 125 ? 0.3351 0.4055 0.4442 0.0058  0.0167  0.0590  647 ALA A O   
696  C CB  . ALA A 125 ? 0.3480 0.4301 0.5047 -0.0039 0.0059  0.0865  647 ALA A CB  
697  N N   . THR A 126 ? 0.3223 0.3802 0.4492 -0.0016 0.0004  0.0637  648 THR A N   
698  C CA  . THR A 126 ? 0.3076 0.3537 0.4221 0.0003  -0.0023 0.0503  648 THR A CA  
699  C C   . THR A 126 ? 0.2946 0.3315 0.4133 -0.0008 -0.0078 0.0453  648 THR A C   
700  O O   . THR A 126 ? 0.2786 0.3150 0.4103 -0.0044 -0.0126 0.0521  648 THR A O   
701  C CB  . THR A 126 ? 0.3122 0.3509 0.4239 0.0003  -0.0084 0.0491  648 THR A CB  
702  O OG1 . THR A 126 ? 0.3092 0.3365 0.4310 -0.0023 -0.0184 0.0522  648 THR A OG1 
703  C CG2 . THR A 126 ? 0.3138 0.3625 0.4246 0.0002  -0.0048 0.0571  648 THR A CG2 
704  N N   . LEU A 127 ? 0.3099 0.3404 0.4175 0.0018  -0.0077 0.0342  649 LEU A N   
705  C CA  . LEU A 127 ? 0.3138 0.3357 0.4221 0.0016  -0.0127 0.0284  649 LEU A CA  
706  C C   . LEU A 127 ? 0.3139 0.3227 0.4264 0.0002  -0.0237 0.0289  649 LEU A C   
707  O O   . LEU A 127 ? 0.3082 0.3100 0.4255 -0.0022 -0.0300 0.0288  649 LEU A O   
708  C CB  . LEU A 127 ? 0.3182 0.3385 0.4137 0.0050  -0.0099 0.0181  649 LEU A CB  
709  C CG  . LEU A 127 ? 0.3311 0.3446 0.4249 0.0057  -0.0139 0.0120  649 LEU A CG  
710  C CD1 . LEU A 127 ? 0.3379 0.3545 0.4403 0.0033  -0.0128 0.0154  649 LEU A CD1 
711  C CD2 . LEU A 127 ? 0.3431 0.3585 0.4259 0.0086  -0.0109 0.0047  649 LEU A CD2 
712  N N   . GLN A 128 ? 0.3331 0.3370 0.4428 0.0017  -0.0267 0.0297  650 GLN A N   
713  C CA  . GLN A 128 ? 0.3685 0.3561 0.4806 0.0011  -0.0379 0.0304  650 GLN A CA  
714  C C   . GLN A 128 ? 0.3697 0.3566 0.4975 -0.0064 -0.0442 0.0413  650 GLN A C   
715  O O   . GLN A 128 ? 0.3617 0.3348 0.4917 -0.0092 -0.0545 0.0403  650 GLN A O   
716  C CB  . GLN A 128 ? 0.4110 0.3944 0.5192 0.0046  -0.0394 0.0313  650 GLN A CB  
717  C CG  . GLN A 128 ? 0.4892 0.4524 0.5994 0.0044  -0.0518 0.0327  650 GLN A CG  
718  C CD  . GLN A 128 ? 0.5426 0.5017 0.6490 0.0093  -0.0526 0.0340  650 GLN A CD  
719  O OE1 . GLN A 128 ? 0.6459 0.5933 0.7411 0.0175  -0.0551 0.0261  650 GLN A OE1 
720  N NE2 . GLN A 128 ? 0.5624 0.5325 0.6780 0.0053  -0.0498 0.0447  650 GLN A NE2 
721  N N   . GLU A 129 ? 0.3662 0.3687 0.5042 -0.0095 -0.0384 0.0524  651 GLU A N   
722  C CA  . GLU A 129 ? 0.3858 0.3936 0.5416 -0.0168 -0.0431 0.0666  651 GLU A CA  
723  C C   . GLU A 129 ? 0.3906 0.4006 0.5530 -0.0197 -0.0448 0.0671  651 GLU A C   
724  O O   . GLU A 129 ? 0.4073 0.4090 0.5799 -0.0262 -0.0564 0.0731  651 GLU A O   
725  C CB  . GLU A 129 ? 0.3911 0.4202 0.5545 -0.0171 -0.0332 0.0785  651 GLU A CB  
726  C CG  . GLU A 129 ? 0.4041 0.4327 0.5666 -0.0169 -0.0343 0.0835  651 GLU A CG  
727  C CD  . GLU A 129 ? 0.4092 0.4599 0.5756 -0.0161 -0.0237 0.0945  651 GLU A CD  
728  O OE1 . GLU A 129 ? 0.4413 0.4943 0.6081 -0.0165 -0.0243 0.1007  651 GLU A OE1 
729  O OE2 . GLU A 129 ? 0.4235 0.4888 0.5916 -0.0144 -0.0148 0.0974  651 GLU A OE2 
730  N N   . TYR A 130 ? 0.3782 0.3983 0.5342 -0.0152 -0.0343 0.0612  652 TYR A N   
731  C CA  . TYR A 130 ? 0.3826 0.4055 0.5431 -0.0164 -0.0344 0.0604  652 TYR A CA  
732  C C   . TYR A 130 ? 0.3940 0.3979 0.5506 -0.0189 -0.0472 0.0534  652 TYR A C   
733  O O   . TYR A 130 ? 0.4144 0.4170 0.5822 -0.0248 -0.0553 0.0598  652 TYR A O   
734  C CB  . TYR A 130 ? 0.3720 0.4021 0.5209 -0.0099 -0.0224 0.0516  652 TYR A CB  
735  C CG  . TYR A 130 ? 0.3495 0.3846 0.5031 -0.0097 -0.0202 0.0516  652 TYR A CG  
736  C CD1 . TYR A 130 ? 0.3548 0.3792 0.5017 -0.0096 -0.0257 0.0424  652 TYR A CD1 
737  C CD2 . TYR A 130 ? 0.3506 0.4023 0.5144 -0.0082 -0.0118 0.0612  652 TYR A CD2 
738  C CE1 . TYR A 130 ? 0.3606 0.3902 0.5121 -0.0094 -0.0238 0.0431  652 TYR A CE1 
739  C CE2 . TYR A 130 ? 0.3411 0.3979 0.5099 -0.0069 -0.0094 0.0620  652 TYR A CE2 
740  C CZ  . TYR A 130 ? 0.3476 0.3931 0.5109 -0.0082 -0.0157 0.0531  652 TYR A CZ  
741  O OH  . TYR A 130 ? 0.3209 0.3720 0.4898 -0.0070 -0.0136 0.0548  652 TYR A OH  
742  N N   . VAL A 131 ? 0.4042 0.3944 0.5442 -0.0139 -0.0491 0.0407  653 VAL A N   
743  C CA  . VAL A 131 ? 0.4273 0.3995 0.5581 -0.0133 -0.0593 0.0318  653 VAL A CA  
744  C C   . VAL A 131 ? 0.4500 0.4038 0.5852 -0.0190 -0.0751 0.0362  653 VAL A C   
745  O O   . VAL A 131 ? 0.4723 0.4154 0.6082 -0.0232 -0.0858 0.0357  653 VAL A O   
746  C CB  . VAL A 131 ? 0.4337 0.3989 0.5454 -0.0045 -0.0557 0.0185  653 VAL A CB  
747  C CG1 . VAL A 131 ? 0.4463 0.3911 0.5452 -0.0015 -0.0665 0.0095  653 VAL A CG1 
748  C CG2 . VAL A 131 ? 0.4251 0.4049 0.5324 -0.0011 -0.0439 0.0143  653 VAL A CG2 
749  N N   . GLU A 132 ? 0.4631 0.4122 0.6006 -0.0194 -0.0775 0.0407  654 GLU A N   
750  C CA  . GLU A 132 ? 0.5120 0.4386 0.6507 -0.0240 -0.0937 0.0437  654 GLU A CA  
751  C C   . GLU A 132 ? 0.5202 0.4511 0.6805 -0.0363 -0.1031 0.0599  654 GLU A C   
752  O O   . GLU A 132 ? 0.5502 0.4594 0.7109 -0.0423 -0.1200 0.0616  654 GLU A O   
753  C CB  . GLU A 132 ? 0.5179 0.4380 0.6531 -0.0201 -0.0933 0.0444  654 GLU A CB  
754  C CG  . GLU A 132 ? 0.5260 0.4431 0.6424 -0.0081 -0.0854 0.0313  654 GLU A CG  
755  C CD  . GLU A 132 ? 0.5363 0.4253 0.6345 -0.0007 -0.0956 0.0196  654 GLU A CD  
756  O OE1 . GLU A 132 ? 0.5453 0.4108 0.6434 -0.0042 -0.1104 0.0215  654 GLU A OE1 
757  O OE2 . GLU A 132 ? 0.5321 0.4224 0.6151 0.0094  -0.0886 0.0087  654 GLU A OE2 
758  N N   . GLN A 133 ? 0.5230 0.4811 0.7001 -0.0394 -0.0926 0.0723  655 GLN A N   
759  C CA  . GLN A 133 ? 0.5438 0.5136 0.7451 -0.0503 -0.0988 0.0920  655 GLN A CA  
760  C C   . GLN A 133 ? 0.5636 0.5483 0.7773 -0.0546 -0.0981 0.0986  655 GLN A C   
761  O O   . GLN A 133 ? 0.5989 0.5825 0.8288 -0.0651 -0.1111 0.1113  655 GLN A O   
762  C CB  . GLN A 133 ? 0.5263 0.5192 0.7394 -0.0496 -0.0873 0.1049  655 GLN A CB  
763  C CG  . GLN A 133 ? 0.5482 0.5287 0.7552 -0.0480 -0.0905 0.1039  655 GLN A CG  
764  C CD  . GLN A 133 ? 0.5572 0.5613 0.7692 -0.0446 -0.0763 0.1127  655 GLN A CD  
765  O OE1 . GLN A 133 ? 0.5728 0.5728 0.7727 -0.0385 -0.0714 0.1059  655 GLN A OE1 
766  N NE2 . GLN A 133 ? 0.5443 0.5741 0.7736 -0.0479 -0.0694 0.1283  655 GLN A NE2 
767  N N   . LYS A 134 ? 0.5681 0.5663 0.7752 -0.0471 -0.0839 0.0911  656 LYS A N   
768  C CA  . LYS A 134 ? 0.5899 0.6040 0.8096 -0.0497 -0.0817 0.0984  656 LYS A CA  
769  C C   . LYS A 134 ? 0.6288 0.6254 0.8440 -0.0546 -0.0963 0.0924  656 LYS A C   
770  O O   . LYS A 134 ? 0.6326 0.6064 0.8273 -0.0510 -0.1022 0.0766  656 LYS A O   
771  C CB  . LYS A 134 ? 0.5743 0.6055 0.7875 -0.0398 -0.0629 0.0925  656 LYS A CB  
772  C CG  . LYS A 134 ? 0.5914 0.6413 0.8087 -0.0350 -0.0489 0.0999  656 LYS A CG  
773  C CD  . LYS A 134 ? 0.5998 0.6688 0.8168 -0.0271 -0.0327 0.1003  656 LYS A CD  
774  C CE  . LYS A 134 ? 0.6222 0.7159 0.8535 -0.0250 -0.0224 0.1171  656 LYS A CE  
775  N NZ  . LYS A 134 ? 0.6566 0.7687 0.8962 -0.0195 -0.0124 0.1236  656 LYS A NZ  
776  N N   . ASP A 135 ? 0.6474 0.6562 0.8819 -0.0624 -0.1020 0.1064  657 ASP A N   
777  C CA  . ASP A 135 ? 0.6675 0.6638 0.8994 -0.0679 -0.1157 0.1029  657 ASP A CA  
778  C C   . ASP A 135 ? 0.6445 0.6503 0.8675 -0.0592 -0.1030 0.0931  657 ASP A C   
779  O O   . ASP A 135 ? 0.6414 0.6719 0.8777 -0.0561 -0.0902 0.1020  657 ASP A O   
780  C CB  . ASP A 135 ? 0.6819 0.6899 0.9409 -0.0811 -0.1281 0.1245  657 ASP A CB  
781  C CG  . ASP A 135 ? 0.6911 0.6900 0.9488 -0.0873 -0.1419 0.1228  657 ASP A CG  
782  O OD1 . ASP A 135 ? 0.7006 0.6753 0.9338 -0.0837 -0.1479 0.1045  657 ASP A OD1 
783  O OD2 . ASP A 135 ? 0.7146 0.7325 0.9962 -0.0955 -0.1464 0.1408  657 ASP A OD2 
784  N N   . PHE A 136 ? 0.6437 0.6296 0.8438 -0.0547 -0.1068 0.0756  658 PHE A N   
785  C CA  . PHE A 136 ? 0.6210 0.6135 0.8109 -0.0467 -0.0959 0.0657  658 PHE A CA  
786  C C   . PHE A 136 ? 0.6349 0.6378 0.8369 -0.0514 -0.1001 0.0734  658 PHE A C   
787  O O   . PHE A 136 ? 0.6273 0.6413 0.8275 -0.0454 -0.0894 0.0701  658 PHE A O   
788  C CB  . PHE A 136 ? 0.6261 0.5974 0.7886 -0.0398 -0.0979 0.0466  658 PHE A CB  
789  C CG  . PHE A 136 ? 0.6139 0.5857 0.7652 -0.0313 -0.0856 0.0386  658 PHE A CG  
790  C CD1 . PHE A 136 ? 0.6089 0.5778 0.7642 -0.0326 -0.0864 0.0430  658 PHE A CD1 
791  C CD2 . PHE A 136 ? 0.5935 0.5697 0.7314 -0.0227 -0.0741 0.0280  658 PHE A CD2 
792  C CE1 . PHE A 136 ? 0.5993 0.5699 0.7449 -0.0252 -0.0759 0.0366  658 PHE A CE1 
793  C CE2 . PHE A 136 ? 0.5715 0.5493 0.7003 -0.0161 -0.0644 0.0221  658 PHE A CE2 
794  C CZ  . PHE A 136 ? 0.5814 0.5566 0.7137 -0.0173 -0.0652 0.0262  658 PHE A CZ  
795  N N   . ALA A 137 ? 0.6627 0.6622 0.8780 -0.0626 -0.1164 0.0848  659 ALA A N   
796  C CA  . ALA A 137 ? 0.6780 0.6911 0.9090 -0.0682 -0.1211 0.0957  659 ALA A CA  
797  C C   . ALA A 137 ? 0.6664 0.7109 0.9170 -0.0628 -0.1032 0.1078  659 ALA A C   
798  O O   . ALA A 137 ? 0.6541 0.7092 0.9085 -0.0601 -0.0988 0.1091  659 ALA A O   
799  C CB  . ALA A 137 ? 0.6836 0.6910 0.9298 -0.0829 -0.1421 0.1098  659 ALA A CB  
800  N N   . HIS A 138 ? 0.6874 0.7458 0.9486 -0.0601 -0.0927 0.1163  660 HIS A N   
801  C CA  . HIS A 138 ? 0.6833 0.7708 0.9619 -0.0536 -0.0761 0.1290  660 HIS A CA  
802  C C   . HIS A 138 ? 0.6701 0.7603 0.9331 -0.0398 -0.0564 0.1168  660 HIS A C   
803  O O   . HIS A 138 ? 0.6505 0.7610 0.9232 -0.0324 -0.0420 0.1254  660 HIS A O   
804  C CB  . HIS A 138 ? 0.6958 0.8013 0.9976 -0.0590 -0.0767 0.1496  660 HIS A CB  
805  C CG  . HIS A 138 ? 0.7449 0.8549 1.0688 -0.0734 -0.0953 0.1673  660 HIS A CG  
806  N ND1 . HIS A 138 ? 0.7277 0.8499 1.0657 -0.0769 -0.0998 0.1767  660 HIS A ND1 
807  C CD2 . HIS A 138 ? 0.7424 0.8457 1.0772 -0.0862 -0.1116 0.1782  660 HIS A CD2 
808  C CE1 . HIS A 138 ? 0.7375 0.8612 1.0942 -0.0917 -0.1187 0.1928  660 HIS A CE1 
809  N NE2 . HIS A 138 ? 0.7553 0.8667 1.1103 -0.0979 -0.1265 0.1940  660 HIS A NE2 
810  N N   . LEU A 139 ? 0.6557 0.7257 0.8942 -0.0359 -0.0561 0.0975  661 LEU A N   
811  C CA  . LEU A 139 ? 0.6039 0.6740 0.8271 -0.0251 -0.0403 0.0864  661 LEU A CA  
812  C C   . LEU A 139 ? 0.5420 0.6111 0.7555 -0.0185 -0.0334 0.0774  661 LEU A C   
813  O O   . LEU A 139 ? 0.5263 0.5971 0.7302 -0.0102 -0.0207 0.0712  661 LEU A O   
814  C CB  . LEU A 139 ? 0.6050 0.6575 0.8097 -0.0247 -0.0428 0.0738  661 LEU A CB  
815  C CG  . LEU A 139 ? 0.5975 0.6513 0.8097 -0.0288 -0.0461 0.0822  661 LEU A CG  
816  C CD1 . LEU A 139 ? 0.5910 0.6256 0.7848 -0.0278 -0.0500 0.0693  661 LEU A CD1 
817  C CD2 . LEU A 139 ? 0.5820 0.6560 0.8030 -0.0233 -0.0315 0.0921  661 LEU A CD2 
818  N N   . GLY A 140 ? 0.4833 0.5492 0.6993 -0.0227 -0.0425 0.0774  662 GLY A N   
819  C CA  . GLY A 140 ? 0.4620 0.5270 0.6705 -0.0176 -0.0377 0.0706  662 GLY A CA  
820  C C   . GLY A 140 ? 0.4418 0.4942 0.6278 -0.0121 -0.0321 0.0545  662 GLY A C   
821  O O   . GLY A 140 ? 0.4135 0.4528 0.5866 -0.0142 -0.0387 0.0457  662 GLY A O   
822  N N   . LEU A 141 ? 0.4315 0.4880 0.6136 -0.0047 -0.0201 0.0517  663 LEU A N   
823  C CA  . LEU A 141 ? 0.4369 0.4838 0.6003 -0.0004 -0.0150 0.0390  663 LEU A CA  
824  C C   . LEU A 141 ? 0.4078 0.4524 0.5626 0.0026  -0.0081 0.0350  663 LEU A C   
825  O O   . LEU A 141 ? 0.4183 0.4560 0.5588 0.0051  -0.0048 0.0259  663 LEU A O   
826  C CB  . LEU A 141 ? 0.4634 0.5126 0.6260 0.0050  -0.0076 0.0385  663 LEU A CB  
827  C CG  . LEU A 141 ? 0.4857 0.5370 0.6543 0.0028  -0.0134 0.0413  663 LEU A CG  
828  C CD1 . LEU A 141 ? 0.4803 0.5330 0.6491 0.0092  -0.0050 0.0419  663 LEU A CD1 
829  C CD2 . LEU A 141 ? 0.4946 0.5368 0.6503 -0.0011 -0.0222 0.0327  663 LEU A CD2 
830  N N   . GLU A 142 ? 0.3815 0.4332 0.5455 0.0021  -0.0062 0.0430  664 GLU A N   
831  C CA  . GLU A 142 ? 0.3797 0.4311 0.5355 0.0055  0.0010  0.0405  664 GLU A CA  
832  C C   . GLU A 142 ? 0.3755 0.4154 0.5163 0.0036  -0.0031 0.0301  664 GLU A C   
833  O O   . GLU A 142 ? 0.3634 0.4001 0.4918 0.0070  0.0028  0.0238  664 GLU A O   
834  C CB  . GLU A 142 ? 0.3919 0.4548 0.5617 0.0043  0.0023  0.0529  664 GLU A CB  
835  C CG  . GLU A 142 ? 0.3989 0.4654 0.5612 0.0096  0.0120  0.0528  664 GLU A CG  
836  C CD  . GLU A 142 ? 0.4142 0.4965 0.5925 0.0094  0.0147  0.0679  664 GLU A CD  
837  O OE1 . GLU A 142 ? 0.4193 0.5022 0.6071 0.0019  0.0057  0.0741  664 GLU A OE1 
838  O OE2 . GLU A 142 ? 0.4318 0.5261 0.6129 0.0172  0.0256  0.0743  664 GLU A OE2 
839  N N   . PRO A 143 ? 0.3773 0.4104 0.5183 -0.0012 -0.0136 0.0285  665 PRO A N   
840  C CA  . PRO A 143 ? 0.3767 0.4005 0.5039 -0.0008 -0.0162 0.0198  665 PRO A CA  
841  C C   . PRO A 143 ? 0.3707 0.3917 0.4846 0.0025  -0.0125 0.0109  665 PRO A C   
842  O O   . PRO A 143 ? 0.3632 0.3828 0.4675 0.0043  -0.0092 0.0063  665 PRO A O   
843  C CB  . PRO A 143 ? 0.3900 0.4044 0.5176 -0.0046 -0.0285 0.0189  665 PRO A CB  
844  C CG  . PRO A 143 ? 0.3933 0.4134 0.5383 -0.0096 -0.0332 0.0302  665 PRO A CG  
845  C CD  . PRO A 143 ? 0.3826 0.4148 0.5348 -0.0069 -0.0242 0.0346  665 PRO A CD  
846  N N   . ILE A 144 ? 0.3379 0.3594 0.4527 0.0026  -0.0134 0.0100  666 ILE A N   
847  C CA  . ILE A 144 ? 0.3329 0.3533 0.4380 0.0046  -0.0106 0.0041  666 ILE A CA  
848  C C   . ILE A 144 ? 0.3317 0.3533 0.4331 0.0070  -0.0021 0.0036  666 ILE A C   
849  O O   . ILE A 144 ? 0.3201 0.3394 0.4115 0.0072  -0.0007 -0.0011 666 ILE A O   
850  C CB  . ILE A 144 ? 0.3401 0.3610 0.4481 0.0037  -0.0147 0.0048  666 ILE A CB  
851  C CG1 . ILE A 144 ? 0.3693 0.3850 0.4727 0.0025  -0.0241 0.0020  666 ILE A CG1 
852  C CG2 . ILE A 144 ? 0.3474 0.3689 0.4485 0.0052  -0.0114 0.0016  666 ILE A CG2 
853  C CD1 . ILE A 144 ? 0.4000 0.4158 0.5089 0.0001  -0.0309 0.0051  666 ILE A CD1 
854  N N   . THR A 145 ? 0.3283 0.3534 0.4369 0.0090  0.0031  0.0088  667 THR A N   
855  C CA  . THR A 145 ? 0.3251 0.3483 0.4266 0.0129  0.0111  0.0075  667 THR A CA  
856  C C   . THR A 145 ? 0.3210 0.3426 0.4132 0.0126  0.0126  0.0047  667 THR A C   
857  O O   . THR A 145 ? 0.2963 0.3126 0.3765 0.0137  0.0154  0.0002  667 THR A O   
858  C CB  . THR A 145 ? 0.3332 0.3628 0.4446 0.0175  0.0173  0.0151  667 THR A CB  
859  O OG1 . THR A 145 ? 0.3510 0.3826 0.4714 0.0181  0.0160  0.0185  667 THR A OG1 
860  C CG2 . THR A 145 ? 0.3366 0.3624 0.4374 0.0239  0.0259  0.0132  667 THR A CG2 
861  N N   . LEU A 146 ? 0.3166 0.3422 0.4144 0.0108  0.0099  0.0081  668 LEU A N   
862  C CA  . LEU A 146 ? 0.3118 0.3370 0.4021 0.0104  0.0107  0.0065  668 LEU A CA  
863  C C   . LEU A 146 ? 0.2869 0.3080 0.3673 0.0085  0.0069  0.0000  668 LEU A C   
864  O O   . LEU A 146 ? 0.2813 0.3016 0.3526 0.0082  0.0083  -0.0022 668 LEU A O   
865  C CB  . LEU A 146 ? 0.3135 0.3425 0.4131 0.0083  0.0070  0.0123  668 LEU A CB  
866  C CG  . LEU A 146 ? 0.3247 0.3622 0.4370 0.0090  0.0102  0.0224  668 LEU A CG  
867  C CD1 . LEU A 146 ? 0.3386 0.3771 0.4607 0.0047  0.0031  0.0285  668 LEU A CD1 
868  C CD2 . LEU A 146 ? 0.3295 0.3720 0.4355 0.0138  0.0195  0.0245  668 LEU A CD2 
869  N N   . LEU A 147 ? 0.2809 0.3009 0.3634 0.0074  0.0018  -0.0019 669 LEU A N   
870  C CA  . LEU A 147 ? 0.2865 0.3062 0.3612 0.0069  -0.0009 -0.0062 669 LEU A CA  
871  C C   . LEU A 147 ? 0.2889 0.3075 0.3566 0.0057  0.0016  -0.0081 669 LEU A C   
872  O O   . LEU A 147 ? 0.2636 0.2837 0.3245 0.0042  0.0008  -0.0093 669 LEU A O   
873  C CB  . LEU A 147 ? 0.2834 0.3028 0.3603 0.0075  -0.0061 -0.0073 669 LEU A CB  
874  C CG  . LEU A 147 ? 0.2948 0.3122 0.3687 0.0097  -0.0111 -0.0091 669 LEU A CG  
875  C CD1 . LEU A 147 ? 0.3027 0.3180 0.3778 0.0100  -0.0115 -0.0075 669 LEU A CD1 
876  C CD2 . LEU A 147 ? 0.2899 0.3027 0.3659 0.0102  -0.0171 -0.0098 669 LEU A CD2 
877  N N   . GLN A 148 ? 0.2914 0.3068 0.3616 0.0062  0.0037  -0.0075 670 GLN A N   
878  C CA  . GLN A 148 ? 0.3112 0.3207 0.3743 0.0053  0.0051  -0.0093 670 GLN A CA  
879  C C   . GLN A 148 ? 0.3013 0.3054 0.3540 0.0054  0.0077  -0.0112 670 GLN A C   
880  O O   . GLN A 148 ? 0.2953 0.2951 0.3392 0.0020  0.0051  -0.0131 670 GLN A O   
881  C CB  . GLN A 148 ? 0.3421 0.3481 0.4106 0.0078  0.0074  -0.0078 670 GLN A CB  
882  C CG  . GLN A 148 ? 0.3960 0.3918 0.4569 0.0077  0.0080  -0.0097 670 GLN A CG  
883  C CD  . GLN A 148 ? 0.4452 0.4388 0.5134 0.0112  0.0099  -0.0073 670 GLN A CD  
884  O OE1 . GLN A 148 ? 0.4898 0.4856 0.5640 0.0163  0.0147  -0.0045 670 GLN A OE1 
885  N NE2 . GLN A 148 ? 0.4699 0.4611 0.5391 0.0085  0.0063  -0.0066 670 GLN A NE2 
886  N N   . GLN A 149 ? 0.2995 0.3046 0.3533 0.0088  0.0121  -0.0097 671 GLN A N   
887  C CA  . GLN A 149 ? 0.3080 0.3086 0.3501 0.0102  0.0151  -0.0114 671 GLN A CA  
888  C C   . GLN A 149 ? 0.2990 0.3027 0.3356 0.0059  0.0112  -0.0120 671 GLN A C   
889  O O   . GLN A 149 ? 0.2871 0.2846 0.3111 0.0038  0.0097  -0.0146 671 GLN A O   
890  C CB  . GLN A 149 ? 0.3161 0.3218 0.3631 0.0154  0.0212  -0.0072 671 GLN A CB  
891  C CG  . GLN A 149 ? 0.3201 0.3231 0.3690 0.0218  0.0270  -0.0057 671 GLN A CG  
892  C CD  . GLN A 149 ? 0.3122 0.3272 0.3748 0.0258  0.0320  0.0026  671 GLN A CD  
893  O OE1 . GLN A 149 ? 0.3076 0.3311 0.3782 0.0230  0.0301  0.0072  671 GLN A OE1 
894  N NE2 . GLN A 149 ? 0.3250 0.3409 0.3912 0.0324  0.0377  0.0057  671 GLN A NE2 
895  N N   . THR A 150 ? 0.2867 0.2991 0.3322 0.0050  0.0090  -0.0095 672 THR A N   
896  C CA  . THR A 150 ? 0.2849 0.3023 0.3276 0.0025  0.0058  -0.0088 672 THR A CA  
897  C C   . THR A 150 ? 0.2893 0.3069 0.3270 -0.0017 0.0016  -0.0099 672 THR A C   
898  O O   . THR A 150 ? 0.3017 0.3195 0.3316 -0.0051 -0.0007 -0.0096 672 THR A O   
899  C CB  . THR A 150 ? 0.2828 0.3063 0.3352 0.0041  0.0037  -0.0066 672 THR A CB  
900  O OG1 . THR A 150 ? 0.2804 0.3039 0.3391 0.0061  0.0059  -0.0036 672 THR A OG1 
901  C CG2 . THR A 150 ? 0.2920 0.3212 0.3421 0.0035  0.0011  -0.0055 672 THR A CG2 
902  N N   . THR A 151 ? 0.2821 0.3012 0.3250 -0.0019 -0.0001 -0.0099 673 THR A N   
903  C CA  . THR A 151 ? 0.2861 0.3081 0.3272 -0.0062 -0.0042 -0.0085 673 THR A CA  
904  C C   . THR A 151 ? 0.2970 0.3083 0.3282 -0.0109 -0.0064 -0.0099 673 THR A C   
905  O O   . THR A 151 ? 0.3131 0.3266 0.3406 -0.0167 -0.0114 -0.0074 673 THR A O   
906  C CB  . THR A 151 ? 0.2753 0.2998 0.3231 -0.0050 -0.0048 -0.0078 673 THR A CB  
907  O OG1 . THR A 151 ? 0.2512 0.2816 0.3047 -0.0003 -0.0041 -0.0078 673 THR A OG1 
908  C CG2 . THR A 151 ? 0.2806 0.3119 0.3285 -0.0095 -0.0088 -0.0038 673 THR A CG2 
909  N N   . SER A 152 ? 0.3006 0.2999 0.3271 -0.0081 -0.0032 -0.0135 674 SER A N   
910  C CA  . SER A 152 ? 0.3208 0.3047 0.3344 -0.0103 -0.0052 -0.0167 674 SER A CA  
911  C C   . SER A 152 ? 0.3278 0.3081 0.3287 -0.0128 -0.0072 -0.0180 674 SER A C   
912  O O   . SER A 152 ? 0.3326 0.3037 0.3228 -0.0188 -0.0137 -0.0188 674 SER A O   
913  C CB  . SER A 152 ? 0.3216 0.2953 0.3335 -0.0032 0.0008  -0.0198 674 SER A CB  
914  O OG  . SER A 152 ? 0.3619 0.3176 0.3572 -0.0028 -0.0006 -0.0242 674 SER A OG  
915  N N   . GLY A 153 ? 0.3372 0.3245 0.3394 -0.0087 -0.0025 -0.0174 675 GLY A N   
916  C CA  . GLY A 153 ? 0.3466 0.3346 0.3387 -0.0108 -0.0042 -0.0172 675 GLY A CA  
917  C C   . GLY A 153 ? 0.3390 0.3369 0.3343 -0.0182 -0.0112 -0.0127 675 GLY A C   
918  O O   . GLY A 153 ? 0.3476 0.3410 0.3319 -0.0239 -0.0170 -0.0124 675 GLY A O   
919  N N   . LEU A 154 ? 0.3221 0.3334 0.3320 -0.0176 -0.0110 -0.0087 676 LEU A N   
920  C CA  . LEU A 154 ? 0.3259 0.3506 0.3414 -0.0225 -0.0161 -0.0027 676 LEU A CA  
921  C C   . LEU A 154 ? 0.3348 0.3550 0.3466 -0.0307 -0.0235 -0.0005 676 LEU A C   
922  O O   . LEU A 154 ? 0.3383 0.3656 0.3492 -0.0375 -0.0299 0.0051  676 LEU A O   
923  C CB  . LEU A 154 ? 0.3268 0.3650 0.3558 -0.0173 -0.0133 0.0002  676 LEU A CB  
924  C CG  . LEU A 154 ? 0.3302 0.3862 0.3659 -0.0180 -0.0157 0.0074  676 LEU A CG  
925  C CD1 . LEU A 154 ? 0.3399 0.4007 0.3736 -0.0173 -0.0158 0.0095  676 LEU A CD1 
926  C CD2 . LEU A 154 ? 0.3357 0.4004 0.3801 -0.0105 -0.0124 0.0080  676 LEU A CD2 
927  N N   . ALA A 155 ? 0.3282 0.3373 0.3391 -0.0307 -0.0235 -0.0035 677 ALA A N   
928  C CA  . ALA A 155 ? 0.3433 0.3458 0.3512 -0.0394 -0.0318 -0.0006 677 ALA A CA  
929  C C   . ALA A 155 ? 0.3642 0.3491 0.3547 -0.0456 -0.0388 -0.0037 677 ALA A C   
930  O O   . ALA A 155 ? 0.3742 0.3580 0.3623 -0.0558 -0.0489 0.0015  677 ALA A O   
931  C CB  . ALA A 155 ? 0.3398 0.3324 0.3501 -0.0373 -0.0304 -0.0031 677 ALA A CB  
932  N N   . HIS A 156 ? 0.3732 0.3447 0.3510 -0.0395 -0.0339 -0.0115 678 HIS A N   
933  C CA  . HIS A 156 ? 0.4010 0.3541 0.3578 -0.0429 -0.0396 -0.0161 678 HIS A CA  
934  C C   . HIS A 156 ? 0.4043 0.3700 0.3610 -0.0505 -0.0461 -0.0099 678 HIS A C   
935  O O   . HIS A 156 ? 0.4281 0.3848 0.3753 -0.0606 -0.0575 -0.0080 678 HIS A O   
936  C CB  . HIS A 156 ? 0.4026 0.3452 0.3472 -0.0322 -0.0305 -0.0240 678 HIS A CB  
937  C CG  . HIS A 156 ? 0.4331 0.3559 0.3520 -0.0335 -0.0354 -0.0298 678 HIS A CG  
938  N ND1 . HIS A 156 ? 0.4666 0.3624 0.3668 -0.0363 -0.0430 -0.0357 678 HIS A ND1 
939  C CD2 . HIS A 156 ? 0.4430 0.3677 0.3502 -0.0321 -0.0345 -0.0308 678 HIS A CD2 
940  C CE1 . HIS A 156 ? 0.4933 0.3738 0.3692 -0.0362 -0.0468 -0.0411 678 HIS A CE1 
941  N NE2 . HIS A 156 ? 0.4793 0.3784 0.3594 -0.0338 -0.0414 -0.0378 678 HIS A NE2 
942  N N   . LEU A 157 ? 0.3965 0.3820 0.3640 -0.0459 -0.0398 -0.0063 679 LEU A N   
943  C CA  . LEU A 157 ? 0.4034 0.4043 0.3739 -0.0515 -0.0447 0.0010  679 LEU A CA  
944  C C   . LEU A 157 ? 0.3985 0.4119 0.3795 -0.0615 -0.0539 0.0110  679 LEU A C   
945  O O   . LEU A 157 ? 0.3976 0.4112 0.3727 -0.0714 -0.0641 0.0160  679 LEU A O   
946  C CB  . LEU A 157 ? 0.4134 0.4332 0.3969 -0.0435 -0.0361 0.0040  679 LEU A CB  
947  C CG  . LEU A 157 ? 0.4429 0.4607 0.4174 -0.0391 -0.0321 0.0014  679 LEU A CG  
948  C CD1 . LEU A 157 ? 0.4844 0.4811 0.4410 -0.0351 -0.0288 -0.0077 679 LEU A CD1 
949  C CD2 . LEU A 157 ? 0.4401 0.4722 0.4294 -0.0307 -0.0239 0.0040  679 LEU A CD2 
950  N N   . HIS A 158 ? 0.3825 0.4076 0.3793 -0.0592 -0.0507 0.0150  680 HIS A N   
951  C CA  . HIS A 158 ? 0.3773 0.4187 0.3864 -0.0675 -0.0580 0.0267  680 HIS A CA  
952  C C   . HIS A 158 ? 0.4011 0.4257 0.4009 -0.0805 -0.0710 0.0283  680 HIS A C   
953  O O   . HIS A 158 ? 0.4017 0.4385 0.4081 -0.0912 -0.0809 0.0398  680 HIS A O   
954  C CB  . HIS A 158 ? 0.3550 0.4104 0.3796 -0.0612 -0.0514 0.0298  680 HIS A CB  
955  C CG  . HIS A 158 ? 0.3379 0.4119 0.3725 -0.0503 -0.0420 0.0312  680 HIS A CG  
956  N ND1 . HIS A 158 ? 0.3213 0.4072 0.3665 -0.0426 -0.0359 0.0328  680 HIS A ND1 
957  C CD2 . HIS A 158 ? 0.3337 0.4141 0.3677 -0.0453 -0.0385 0.0307  680 HIS A CD2 
958  C CE1 . HIS A 158 ? 0.3107 0.4074 0.3601 -0.0332 -0.0296 0.0326  680 HIS A CE1 
959  N NE2 . HIS A 158 ? 0.3179 0.4116 0.3617 -0.0348 -0.0310 0.0318  680 HIS A NE2 
960  N N   . SER A 159 ? 0.4233 0.4197 0.4080 -0.0791 -0.0714 0.0175  681 SER A N   
961  C CA  . SER A 159 ? 0.4554 0.4281 0.4275 -0.0900 -0.0844 0.0167  681 SER A CA  
962  C C   . SER A 159 ? 0.4845 0.4446 0.4386 -0.0987 -0.0955 0.0157  681 SER A C   
963  O O   . SER A 159 ? 0.5112 0.4547 0.4561 -0.1112 -0.1103 0.0182  681 SER A O   
964  C CB  . SER A 159 ? 0.4698 0.4145 0.4293 -0.0830 -0.0804 0.0046  681 SER A CB  
965  O OG  . SER A 159 ? 0.4853 0.4102 0.4236 -0.0755 -0.0760 -0.0073 681 SER A OG  
966  N N   . LEU A 160 ? 0.4844 0.4513 0.4330 -0.0925 -0.0892 0.0124  682 LEU A N   
967  C CA  . LEU A 160 ? 0.5048 0.4656 0.4377 -0.1001 -0.0990 0.0130  682 LEU A CA  
968  C C   . LEU A 160 ? 0.4760 0.4689 0.4268 -0.1069 -0.1030 0.0279  682 LEU A C   
969  O O   . LEU A 160 ? 0.4786 0.4725 0.4199 -0.1115 -0.1088 0.0297  682 LEU A O   
970  C CB  . LEU A 160 ? 0.5172 0.4663 0.4317 -0.0892 -0.0901 0.0015  682 LEU A CB  
971  C CG  . LEU A 160 ? 0.5525 0.4693 0.4448 -0.0812 -0.0864 -0.0128 682 LEU A CG  
972  C CD1 . LEU A 160 ? 0.5727 0.4888 0.4548 -0.0678 -0.0736 -0.0205 682 LEU A CD1 
973  C CD2 . LEU A 160 ? 0.5941 0.4786 0.4600 -0.0906 -0.1021 -0.0181 682 LEU A CD2 
974  N N   . ASN A 161 ? 0.4615 0.4808 0.4374 -0.1070 -0.0999 0.0393  683 ASN A N   
975  C CA  . ASN A 161 ? 0.4467 0.5004 0.4422 -0.1105 -0.1015 0.0551  683 ASN A CA  
976  C C   . ASN A 161 ? 0.4187 0.4886 0.4187 -0.0989 -0.0902 0.0541  683 ASN A C   
977  O O   . ASN A 161 ? 0.4224 0.5142 0.4316 -0.1017 -0.0931 0.0651  683 ASN A O   
978  C CB  . ASN A 161 ? 0.4685 0.5219 0.4593 -0.1277 -0.1195 0.0651  683 ASN A CB  
979  C CG  . ASN A 161 ? 0.4767 0.5343 0.4787 -0.1408 -0.1313 0.0770  683 ASN A CG  
980  O OD1 . ASN A 161 ? 0.4767 0.5212 0.4788 -0.1395 -0.1298 0.0725  683 ASN A OD1 
981  N ND2 . ASN A 161 ? 0.4978 0.5754 0.5108 -0.1541 -0.1439 0.0940  683 ASN A ND2 
982  N N   . ILE A 162 ? 0.4098 0.4696 0.4046 -0.0862 -0.0779 0.0423  684 ILE A N   
983  C CA  . ILE A 162 ? 0.3925 0.4638 0.3911 -0.0757 -0.0682 0.0411  684 ILE A CA  
984  C C   . ILE A 162 ? 0.3643 0.4507 0.3799 -0.0639 -0.0567 0.0421  684 ILE A C   
985  O O   . ILE A 162 ? 0.3507 0.4262 0.3657 -0.0586 -0.0511 0.0346  684 ILE A O   
986  C CB  . ILE A 162 ? 0.4073 0.4560 0.3865 -0.0703 -0.0636 0.0283  684 ILE A CB  
987  C CG1 . ILE A 162 ? 0.4463 0.4778 0.4038 -0.0804 -0.0752 0.0260  684 ILE A CG1 
988  C CG2 . ILE A 162 ? 0.3969 0.4579 0.3827 -0.0600 -0.0539 0.0286  684 ILE A CG2 
989  C CD1 . ILE A 162 ? 0.4710 0.4785 0.4054 -0.0742 -0.0707 0.0130  684 ILE A CD1 
990  N N   . VAL A 163 ? 0.3479 0.4583 0.3774 -0.0591 -0.0536 0.0513  685 VAL A N   
991  C CA  . VAL A 163 ? 0.3262 0.4475 0.3674 -0.0462 -0.0433 0.0508  685 VAL A CA  
992  C C   . VAL A 163 ? 0.3177 0.4337 0.3548 -0.0382 -0.0373 0.0454  685 VAL A C   
993  O O   . VAL A 163 ? 0.3248 0.4461 0.3596 -0.0409 -0.0405 0.0499  685 VAL A O   
994  C CB  . VAL A 163 ? 0.3228 0.4733 0.3807 -0.0433 -0.0430 0.0647  685 VAL A CB  
995  C CG1 . VAL A 163 ? 0.3140 0.4712 0.3796 -0.0291 -0.0331 0.0623  685 VAL A CG1 
996  C CG2 . VAL A 163 ? 0.3400 0.5007 0.4036 -0.0549 -0.0517 0.0750  685 VAL A CG2 
997  N N   . HIS A 164 ? 0.3150 0.4196 0.3510 -0.0297 -0.0299 0.0364  686 HIS A N   
998  C CA  . HIS A 164 ? 0.3192 0.4187 0.3531 -0.0231 -0.0250 0.0328  686 HIS A CA  
999  C C   . HIS A 164 ? 0.3161 0.4306 0.3605 -0.0148 -0.0222 0.0393  686 HIS A C   
1000 O O   . HIS A 164 ? 0.3021 0.4194 0.3454 -0.0146 -0.0229 0.0425  686 HIS A O   
1001 C CB  . HIS A 164 ? 0.3173 0.4016 0.3493 -0.0174 -0.0191 0.0234  686 HIS A CB  
1002 C CG  . HIS A 164 ? 0.3070 0.3853 0.3378 -0.0124 -0.0150 0.0209  686 HIS A CG  
1003 N ND1 . HIS A 164 ? 0.2974 0.3805 0.3370 -0.0046 -0.0122 0.0231  686 HIS A ND1 
1004 C CD2 . HIS A 164 ? 0.3121 0.3800 0.3338 -0.0137 -0.0134 0.0174  686 HIS A CD2 
1005 C CE1 . HIS A 164 ? 0.3059 0.3822 0.3438 -0.0030 -0.0100 0.0220  686 HIS A CE1 
1006 N NE2 . HIS A 164 ? 0.3163 0.3853 0.3438 -0.0080 -0.0099 0.0190  686 HIS A NE2 
1007 N N   . ARG A 165 ? 0.3272 0.4518 0.3807 -0.0079 -0.0195 0.0419  687 ARG A N   
1008 C CA  . ARG A 165 ? 0.3478 0.4859 0.4097 0.0020  -0.0168 0.0480  687 ARG A CA  
1009 C C   . ARG A 165 ? 0.3429 0.4701 0.4050 0.0124  -0.0127 0.0430  687 ARG A C   
1010 O O   . ARG A 165 ? 0.3495 0.4839 0.4167 0.0226  -0.0105 0.0466  687 ARG A O   
1011 C CB  . ARG A 165 ? 0.3858 0.5413 0.4517 -0.0024 -0.0211 0.0593  687 ARG A CB  
1012 C CG  . ARG A 165 ? 0.4227 0.5959 0.4944 -0.0094 -0.0255 0.0687  687 ARG A CG  
1013 C CD  . ARG A 165 ? 0.4658 0.6560 0.5418 -0.0161 -0.0316 0.0810  687 ARG A CD  
1014 N NE  . ARG A 165 ? 0.5318 0.7370 0.6168 -0.0044 -0.0273 0.0882  687 ARG A NE  
1015 C CZ  . ARG A 165 ? 0.5856 0.8026 0.6741 -0.0070 -0.0309 0.0974  687 ARG A CZ  
1016 N NH1 . ARG A 165 ? 0.6165 0.8314 0.6987 -0.0215 -0.0395 0.1000  687 ARG A NH1 
1017 N NH2 . ARG A 165 ? 0.5938 0.8232 0.6908 0.0054  -0.0265 0.1040  687 ARG A NH2 
1018 N N   . ASP A 166 ? 0.3433 0.4529 0.3998 0.0098  -0.0119 0.0353  688 ASP A N   
1019 C CA  . ASP A 166 ? 0.3561 0.4548 0.4140 0.0166  -0.0100 0.0323  688 ASP A CA  
1020 C C   . ASP A 166 ? 0.3401 0.4225 0.3958 0.0165  -0.0085 0.0241  688 ASP A C   
1021 O O   . ASP A 166 ? 0.3620 0.4351 0.4183 0.0166  -0.0082 0.0231  688 ASP A O   
1022 C CB  . ASP A 166 ? 0.3658 0.4656 0.4234 0.0141  -0.0112 0.0371  688 ASP A CB  
1023 C CG  . ASP A 166 ? 0.3620 0.4556 0.4245 0.0224  -0.0108 0.0383  688 ASP A CG  
1024 O OD1 . ASP A 166 ? 0.3599 0.4495 0.4247 0.0314  -0.0101 0.0359  688 ASP A OD1 
1025 O OD2 . ASP A 166 ? 0.3782 0.4696 0.4411 0.0202  -0.0115 0.0418  688 ASP A OD2 
1026 N N   . LEU A 167 ? 0.3320 0.4127 0.3865 0.0158  -0.0079 0.0199  689 LEU A N   
1027 C CA  . LEU A 167 ? 0.3463 0.4135 0.3998 0.0153  -0.0068 0.0134  689 LEU A CA  
1028 C C   . LEU A 167 ? 0.3185 0.3761 0.3751 0.0227  -0.0076 0.0110  689 LEU A C   
1029 O O   . LEU A 167 ? 0.3177 0.3771 0.3742 0.0306  -0.0082 0.0109  689 LEU A O   
1030 C CB  . LEU A 167 ? 0.3661 0.4348 0.4182 0.0134  -0.0066 0.0105  689 LEU A CB  
1031 C CG  . LEU A 167 ? 0.4036 0.4622 0.4535 0.0087  -0.0056 0.0057  689 LEU A CG  
1032 C CD1 . LEU A 167 ? 0.4318 0.4865 0.4768 0.0031  -0.0049 0.0060  689 LEU A CD1 
1033 C CD2 . LEU A 167 ? 0.4253 0.4878 0.4742 0.0060  -0.0063 0.0052  689 LEU A CD2 
1034 N N   . LYS A 168 ? 0.3081 0.3550 0.3667 0.0205  -0.0081 0.0096  690 LYS A N   
1035 C CA  . LYS A 168 ? 0.3095 0.3440 0.3711 0.0250  -0.0113 0.0078  690 LYS A CA  
1036 C C   . LYS A 168 ? 0.3012 0.3282 0.3676 0.0197  -0.0117 0.0082  690 LYS A C   
1037 O O   . LYS A 168 ? 0.2947 0.3269 0.3611 0.0147  -0.0082 0.0104  690 LYS A O   
1038 C CB  . LYS A 168 ? 0.3201 0.3530 0.3833 0.0301  -0.0135 0.0116  690 LYS A CB  
1039 C CG  . LYS A 168 ? 0.3291 0.3678 0.3952 0.0252  -0.0124 0.0182  690 LYS A CG  
1040 C CD  . LYS A 168 ? 0.3386 0.3783 0.4066 0.0306  -0.0145 0.0231  690 LYS A CD  
1041 C CE  . LYS A 168 ? 0.3282 0.3763 0.3982 0.0253  -0.0134 0.0304  690 LYS A CE  
1042 N NZ  . LYS A 168 ? 0.3415 0.3901 0.4147 0.0308  -0.0158 0.0360  690 LYS A NZ  
1043 N N   . PRO A 169 ? 0.2980 0.3129 0.3678 0.0212  -0.0164 0.0069  691 PRO A N   
1044 C CA  . PRO A 169 ? 0.3176 0.3291 0.3949 0.0157  -0.0171 0.0100  691 PRO A CA  
1045 C C   . PRO A 169 ? 0.3285 0.3448 0.4116 0.0123  -0.0156 0.0181  691 PRO A C   
1046 O O   . PRO A 169 ? 0.3084 0.3293 0.3966 0.0084  -0.0127 0.0223  691 PRO A O   
1047 C CB  . PRO A 169 ? 0.3229 0.3196 0.4024 0.0172  -0.0250 0.0080  691 PRO A CB  
1048 C CG  . PRO A 169 ? 0.3284 0.3209 0.3979 0.0246  -0.0264 0.0009  691 PRO A CG  
1049 C CD  . PRO A 169 ? 0.3183 0.3219 0.3842 0.0280  -0.0217 0.0026  691 PRO A CD  
1050 N N   . HIS A 170 ? 0.3622 0.3790 0.4442 0.0147  -0.0171 0.0209  692 HIS A N   
1051 C CA  . HIS A 170 ? 0.3830 0.4047 0.4699 0.0121  -0.0165 0.0294  692 HIS A CA  
1052 C C   . HIS A 170 ? 0.3470 0.3821 0.4292 0.0093  -0.0093 0.0317  692 HIS A C   
1053 O O   . HIS A 170 ? 0.3589 0.3995 0.4448 0.0068  -0.0074 0.0391  692 HIS A O   
1054 C CB  . HIS A 170 ? 0.4300 0.4487 0.5160 0.0166  -0.0200 0.0316  692 HIS A CB  
1055 C CG  . HIS A 170 ? 0.5003 0.5023 0.5859 0.0220  -0.0273 0.0277  692 HIS A CG  
1056 N ND1 . HIS A 170 ? 0.5207 0.5180 0.5984 0.0281  -0.0277 0.0191  692 HIS A ND1 
1057 C CD2 . HIS A 170 ? 0.5393 0.5267 0.6298 0.0229  -0.0351 0.0312  692 HIS A CD2 
1058 C CE1 . HIS A 170 ? 0.5557 0.5353 0.6311 0.0335  -0.0349 0.0163  692 HIS A CE1 
1059 N NE2 . HIS A 170 ? 0.5710 0.5426 0.6540 0.0300  -0.0402 0.0232  692 HIS A NE2 
1060 N N   . ASN A 171 ? 0.3227 0.3623 0.3958 0.0097  -0.0061 0.0259  693 ASN A N   
1061 C CA  . ASN A 171 ? 0.2995 0.3469 0.3642 0.0070  -0.0010 0.0262  693 ASN A CA  
1062 C C   . ASN A 171 ? 0.2821 0.3274 0.3413 0.0059  0.0024  0.0203  693 ASN A C   
1063 O O   . ASN A 171 ? 0.2838 0.3310 0.3324 0.0044  0.0054  0.0183  693 ASN A O   
1064 C CB  . ASN A 171 ? 0.2919 0.3459 0.3492 0.0066  -0.0020 0.0267  693 ASN A CB  
1065 C CG  . ASN A 171 ? 0.2769 0.3312 0.3333 0.0087  -0.0044 0.0224  693 ASN A CG  
1066 O OD1 . ASN A 171 ? 0.2764 0.3262 0.3335 0.0097  -0.0044 0.0174  693 ASN A OD1 
1067 N ND2 . ASN A 171 ? 0.2880 0.3498 0.3435 0.0098  -0.0063 0.0258  693 ASN A ND2 
1068 N N   . ILE A 172 ? 0.2759 0.3157 0.3413 0.0068  0.0013  0.0176  694 ILE A N   
1069 C CA  . ILE A 172 ? 0.2883 0.3262 0.3514 0.0064  0.0048  0.0142  694 ILE A CA  
1070 C C   . ILE A 172 ? 0.2893 0.3302 0.3600 0.0066  0.0082  0.0207  694 ILE A C   
1071 O O   . ILE A 172 ? 0.2765 0.3160 0.3591 0.0059  0.0049  0.0251  694 ILE A O   
1072 C CB  . ILE A 172 ? 0.2867 0.3195 0.3530 0.0071  0.0019  0.0091  694 ILE A CB  
1073 C CG1 . ILE A 172 ? 0.2870 0.3212 0.3464 0.0074  -0.0001 0.0050  694 ILE A CG1 
1074 C CG2 . ILE A 172 ? 0.2944 0.3255 0.3610 0.0069  0.0054  0.0074  694 ILE A CG2 
1075 C CD1 . ILE A 172 ? 0.2915 0.3225 0.3535 0.0098  -0.0033 0.0015  694 ILE A CD1 
1076 N N   . LEU A 173 ? 0.3050 0.3499 0.3679 0.0078  0.0143  0.0219  695 LEU A N   
1077 C CA  . LEU A 173 ? 0.3212 0.3737 0.3905 0.0095  0.0190  0.0305  695 LEU A CA  
1078 C C   . LEU A 173 ? 0.3208 0.3740 0.3938 0.0123  0.0237  0.0306  695 LEU A C   
1079 O O   . LEU A 173 ? 0.3302 0.3771 0.3943 0.0139  0.0254  0.0231  695 LEU A O   
1080 C CB  . LEU A 173 ? 0.3357 0.3938 0.3926 0.0113  0.0239  0.0329  695 LEU A CB  
1081 C CG  . LEU A 173 ? 0.3383 0.3972 0.3912 0.0085  0.0192  0.0336  695 LEU A CG  
1082 C CD1 . LEU A 173 ? 0.3587 0.4236 0.3983 0.0099  0.0234  0.0367  695 LEU A CD1 
1083 C CD2 . LEU A 173 ? 0.3547 0.4150 0.4238 0.0063  0.0137  0.0407  695 LEU A CD2 
1084 N N   . ILE A 174 ? 0.3298 0.3912 0.4176 0.0124  0.0249  0.0406  696 ILE A N   
1085 C CA  . ILE A 174 ? 0.3275 0.3933 0.4227 0.0154  0.0294  0.0440  696 ILE A CA  
1086 C C   . ILE A 174 ? 0.3248 0.4025 0.4160 0.0216  0.0394  0.0514  696 ILE A C   
1087 O O   . ILE A 174 ? 0.3248 0.4132 0.4230 0.0207  0.0402  0.0618  696 ILE A O   
1088 C CB  . ILE A 174 ? 0.3312 0.4004 0.4477 0.0107  0.0230  0.0527  696 ILE A CB  
1089 C CG1 . ILE A 174 ? 0.3478 0.4040 0.4650 0.0058  0.0125  0.0454  696 ILE A CG1 
1090 C CG2 . ILE A 174 ? 0.3299 0.4054 0.4560 0.0134  0.0269  0.0571  696 ILE A CG2 
1091 C CD1 . ILE A 174 ? 0.3716 0.4187 0.4778 0.0074  0.0124  0.0334  696 ILE A CD1 
1092 N N   . SER A 175 ? 0.3194 0.3948 0.3989 0.0286  0.0468  0.0465  697 SER A N   
1093 C CA  . SER A 175 ? 0.3293 0.4141 0.4003 0.0376  0.0576  0.0517  697 SER A CA  
1094 C C   . SER A 175 ? 0.3393 0.4447 0.4316 0.0398  0.0622  0.0688  697 SER A C   
1095 O O   . SER A 175 ? 0.3172 0.4270 0.4307 0.0342  0.0567  0.0755  697 SER A O   
1096 C CB  . SER A 175 ? 0.3299 0.4044 0.3849 0.0458  0.0635  0.0424  697 SER A CB  
1097 O OG  . SER A 175 ? 0.3160 0.3949 0.3869 0.0477  0.0649  0.0467  697 SER A OG  
1098 N N   . MET A 176 ? 0.3862 0.5043 0.4715 0.0482  0.0722  0.0762  698 MET A N   
1099 C CA  . MET A 176 ? 0.4136 0.5547 0.5171 0.0536  0.0800  0.0937  698 MET A CA  
1100 C C   . MET A 176 ? 0.4235 0.5634 0.5311 0.0600  0.0844  0.0917  698 MET A C   
1101 O O   . MET A 176 ? 0.4264 0.5499 0.5131 0.0665  0.0875  0.0776  698 MET A O   
1102 C CB  . MET A 176 ? 0.4464 0.6010 0.5355 0.0648  0.0922  0.1001  698 MET A CB  
1103 C CG  . MET A 176 ? 0.4683 0.6259 0.5504 0.0602  0.0894  0.1028  698 MET A CG  
1104 S SD  . MET A 176 ? 0.4739 0.6493 0.5894 0.0477  0.0809  0.1230  698 MET A SD  
1105 C CE  . MET A 176 ? 0.4876 0.6940 0.6253 0.0555  0.0918  0.1455  698 MET A CE  
1106 N N   . PRO A 177 ? 0.4309 0.5873 0.5657 0.0577  0.0835  0.1065  699 PRO A N   
1107 C CA  . PRO A 177 ? 0.4384 0.5964 0.5783 0.0648  0.0885  0.1066  699 PRO A CA  
1108 C C   . PRO A 177 ? 0.4355 0.6017 0.5608 0.0828  0.1046  0.1085  699 PRO A C   
1109 O O   . PRO A 177 ? 0.4202 0.6026 0.5425 0.0893  0.1128  0.1183  699 PRO A O   
1110 C CB  . PRO A 177 ? 0.4321 0.6106 0.6064 0.0574  0.0834  0.1259  699 PRO A CB  
1111 C CG  . PRO A 177 ? 0.4352 0.6280 0.6203 0.0512  0.0808  0.1394  699 PRO A CG  
1112 C CD  . PRO A 177 ? 0.4307 0.6035 0.5933 0.0474  0.0763  0.1240  699 PRO A CD  
1113 N N   . ASN A 178 ? 0.4389 0.5938 0.5545 0.0916  0.1090  0.0997  700 ASN A N   
1114 C CA  . ASN A 178 ? 0.4490 0.6117 0.5528 0.1110  0.1246  0.1029  700 ASN A CA  
1115 C C   . ASN A 178 ? 0.4313 0.6246 0.5658 0.1157  0.1309  0.1249  700 ASN A C   
1116 O O   . ASN A 178 ? 0.4013 0.6072 0.5649 0.1022  0.1214  0.1368  700 ASN A O   
1117 C CB  . ASN A 178 ? 0.4660 0.6006 0.5442 0.1193  0.1262  0.0840  700 ASN A CB  
1118 C CG  . ASN A 178 ? 0.4660 0.5962 0.5610 0.1157  0.1210  0.0836  700 ASN A CG  
1119 O OD1 . ASN A 178 ? 0.4560 0.6073 0.5810 0.1113  0.1195  0.0991  700 ASN A OD1 
1120 N ND2 . ASN A 178 ? 0.4815 0.5844 0.5572 0.1169  0.1176  0.0667  700 ASN A ND2 
1121 N N   . ALA A 179 ? 0.4526 0.6573 0.5802 0.1351  0.1463  0.1308  701 ALA A N   
1122 C CA  . ALA A 179 ? 0.4484 0.6884 0.6061 0.1416  0.1544  0.1553  701 ALA A CA  
1123 C C   . ALA A 179 ? 0.4282 0.6724 0.6148 0.1318  0.1453  0.1618  701 ALA A C   
1124 O O   . ALA A 179 ? 0.4107 0.6853 0.6296 0.1293  0.1458  0.1846  701 ALA A O   
1125 C CB  . ALA A 179 ? 0.4761 0.7256 0.6172 0.1676  0.1740  0.1585  701 ALA A CB  
1126 N N   . HIS A 180 ? 0.4350 0.6500 0.6106 0.1257  0.1362  0.1432  702 HIS A N   
1127 C CA  . HIS A 180 ? 0.4171 0.6330 0.6167 0.1148  0.1256  0.1473  702 HIS A CA  
1128 C C   . HIS A 180 ? 0.3831 0.5891 0.5928 0.0925  0.1073  0.1434  702 HIS A C   
1129 O O   . HIS A 180 ? 0.3589 0.5589 0.5811 0.0829  0.0968  0.1420  702 HIS A O   
1130 C CB  . HIS A 180 ? 0.4286 0.6209 0.6121 0.1227  0.1271  0.1316  702 HIS A CB  
1131 C CG  . HIS A 180 ? 0.4538 0.6488 0.6226 0.1463  0.1442  0.1324  702 HIS A CG  
1132 N ND1 . HIS A 180 ? 0.4778 0.7015 0.6683 0.1585  0.1547  0.1521  702 HIS A ND1 
1133 C CD2 . HIS A 180 ? 0.4807 0.6527 0.6143 0.1607  0.1524  0.1162  702 HIS A CD2 
1134 C CE1 . HIS A 180 ? 0.4972 0.7151 0.6653 0.1812  0.1699  0.1474  702 HIS A CE1 
1135 N NE2 . HIS A 180 ? 0.5127 0.6974 0.6449 0.1827  0.1682  0.1249  702 HIS A NE2 
1136 N N   . GLY A 181 ? 0.3899 0.5938 0.5931 0.0853  0.1035  0.1417  703 GLY A N   
1137 C CA  . GLY A 181 ? 0.3774 0.5720 0.5892 0.0663  0.0869  0.1390  703 GLY A CA  
1138 C C   . GLY A 181 ? 0.3846 0.5482 0.5764 0.0600  0.0780  0.1166  703 GLY A C   
1139 O O   . GLY A 181 ? 0.3662 0.5207 0.5640 0.0464  0.0646  0.1133  703 GLY A O   
1140 N N   . LYS A 182 ? 0.4119 0.5592 0.5795 0.0704  0.0853  0.1019  704 LYS A N   
1141 C CA  . LYS A 182 ? 0.4246 0.5449 0.5733 0.0652  0.0778  0.0824  704 LYS A CA  
1142 C C   . LYS A 182 ? 0.3960 0.5060 0.5286 0.0597  0.0740  0.0738  704 LYS A C   
1143 O O   . LYS A 182 ? 0.3807 0.4964 0.5028 0.0661  0.0816  0.0761  704 LYS A O   
1144 C CB  . LYS A 182 ? 0.4796 0.5855 0.6083 0.0779  0.0860  0.0717  704 LYS A CB  
1145 C CG  . LYS A 182 ? 0.5230 0.6111 0.6490 0.0727  0.0781  0.0609  704 LYS A CG  
1146 C CD  . LYS A 182 ? 0.5730 0.6445 0.6792 0.0849  0.0852  0.0512  704 LYS A CD  
1147 C CE  . LYS A 182 ? 0.6112 0.6593 0.6880 0.0844  0.0831  0.0352  704 LYS A CE  
1148 N NZ  . LYS A 182 ? 0.6578 0.6905 0.7116 0.0994  0.0919  0.0281  704 LYS A NZ  
1149 N N   . ILE A 183 ? 0.3673 0.4631 0.4975 0.0486  0.0625  0.0644  705 ILE A N   
1150 C CA  . ILE A 183 ? 0.3574 0.4440 0.4737 0.0434  0.0583  0.0567  705 ILE A CA  
1151 C C   . ILE A 183 ? 0.3386 0.4045 0.4369 0.0408  0.0534  0.0405  705 ILE A C   
1152 O O   . ILE A 183 ? 0.3301 0.3884 0.4284 0.0413  0.0518  0.0357  705 ILE A O   
1153 C CB  . ILE A 183 ? 0.3439 0.4357 0.4762 0.0323  0.0483  0.0635  705 ILE A CB  
1154 C CG1 . ILE A 183 ? 0.3296 0.4163 0.4749 0.0248  0.0380  0.0626  705 ILE A CG1 
1155 C CG2 . ILE A 183 ? 0.3434 0.4561 0.4923 0.0333  0.0522  0.0810  705 ILE A CG2 
1156 C CD1 . ILE A 183 ? 0.3219 0.4063 0.4771 0.0147  0.0264  0.0658  705 ILE A CD1 
1157 N N   . LYS A 184 ? 0.3400 0.3985 0.4243 0.0376  0.0507  0.0339  706 LYS A N   
1158 C CA  . LYS A 184 ? 0.3416 0.3841 0.4118 0.0332  0.0446  0.0214  706 LYS A CA  
1159 C C   . LYS A 184 ? 0.3331 0.3742 0.3994 0.0266  0.0386  0.0192  706 LYS A C   
1160 O O   . LYS A 184 ? 0.3152 0.3642 0.3821 0.0270  0.0406  0.0249  706 LYS A O   
1161 C CB  . LYS A 184 ? 0.3649 0.3948 0.4132 0.0398  0.0496  0.0128  706 LYS A CB  
1162 C CG  . LYS A 184 ? 0.3856 0.4170 0.4184 0.0454  0.0557  0.0135  706 LYS A CG  
1163 C CD  . LYS A 184 ? 0.3984 0.4114 0.4045 0.0502  0.0571  0.0026  706 LYS A CD  
1164 C CE  . LYS A 184 ? 0.4043 0.4193 0.3934 0.0548  0.0617  0.0032  706 LYS A CE  
1165 N NZ  . LYS A 184 ? 0.4320 0.4256 0.3918 0.0575  0.0600  -0.0084 706 LYS A NZ  
1166 N N   . ALA A 185 ? 0.3350 0.3675 0.3976 0.0213  0.0315  0.0119  707 ALA A N   
1167 C CA  . ALA A 185 ? 0.3348 0.3662 0.3932 0.0164  0.0261  0.0096  707 ALA A CA  
1168 C C   . ALA A 185 ? 0.3396 0.3644 0.3787 0.0165  0.0268  0.0036  707 ALA A C   
1169 O O   . ALA A 185 ? 0.3316 0.3470 0.3593 0.0182  0.0280  -0.0021 707 ALA A O   
1170 C CB  . ALA A 185 ? 0.3400 0.3682 0.4041 0.0120  0.0188  0.0062  707 ALA A CB  
1171 N N   . MET A 186 ? 0.3686 0.3971 0.4040 0.0143  0.0250  0.0054  708 MET A N   
1172 C CA  . MET A 186 ? 0.3954 0.4187 0.4128 0.0129  0.0238  0.0011  708 MET A CA  
1173 C C   . MET A 186 ? 0.3755 0.4035 0.3964 0.0077  0.0176  0.0026  708 MET A C   
1174 O O   . MET A 186 ? 0.3515 0.3869 0.3837 0.0076  0.0168  0.0083  708 MET A O   
1175 C CB  . MET A 186 ? 0.4326 0.4584 0.4390 0.0179  0.0301  0.0039  708 MET A CB  
1176 C CG  . MET A 186 ? 0.4701 0.4901 0.4682 0.0256  0.0373  0.0016  708 MET A CG  
1177 S SD  . MET A 186 ? 0.5267 0.5498 0.5071 0.0344  0.0460  0.0043  708 MET A SD  
1178 C CE  . MET A 186 ? 0.5053 0.5506 0.5110 0.0354  0.0505  0.0191  708 MET A CE  
1179 N N   . ILE A 187 ? 0.3795 0.4031 0.3910 0.0036  0.0128  -0.0016 709 ILE A N   
1180 C CA  . ILE A 187 ? 0.3798 0.4100 0.3938 -0.0003 0.0075  0.0009  709 ILE A CA  
1181 C C   . ILE A 187 ? 0.3707 0.4040 0.3748 -0.0011 0.0077  0.0038  709 ILE A C   
1182 O O   . ILE A 187 ? 0.3520 0.3787 0.3401 -0.0007 0.0091  0.0009  709 ILE A O   
1183 C CB  . ILE A 187 ? 0.4136 0.4416 0.4242 -0.0050 0.0020  -0.0020 709 ILE A CB  
1184 C CG1 . ILE A 187 ? 0.4186 0.4477 0.4411 -0.0035 0.0018  -0.0029 709 ILE A CG1 
1185 C CG2 . ILE A 187 ? 0.4362 0.4730 0.4463 -0.0088 -0.0030 0.0021  709 ILE A CG2 
1186 C CD1 . ILE A 187 ? 0.4496 0.4788 0.4708 -0.0076 -0.0028 -0.0040 709 ILE A CD1 
1187 N N   . SER A 188 ? 0.3506 0.3930 0.3633 -0.0014 0.0059  0.0095  710 SER A N   
1188 C CA  . SER A 188 ? 0.3449 0.3930 0.3517 -0.0021 0.0058  0.0144  710 SER A CA  
1189 C C   . SER A 188 ? 0.3426 0.3988 0.3553 -0.0048 0.0003  0.0186  710 SER A C   
1190 O O   . SER A 188 ? 0.3335 0.3911 0.3529 -0.0053 -0.0026 0.0173  710 SER A O   
1191 C CB  . SER A 188 ? 0.3357 0.3885 0.3502 0.0018  0.0109  0.0203  710 SER A CB  
1192 O OG  . SER A 188 ? 0.3052 0.3617 0.3368 0.0026  0.0088  0.0250  710 SER A OG  
1193 N N   . ASP A 189 ? 0.3506 0.4135 0.3608 -0.0055 -0.0005 0.0244  711 ASP A N   
1194 C CA  . ASP A 189 ? 0.3662 0.4385 0.3846 -0.0061 -0.0047 0.0304  711 ASP A CA  
1195 C C   . ASP A 189 ? 0.3628 0.4396 0.3774 -0.0107 -0.0103 0.0302  711 ASP A C   
1196 O O   . ASP A 189 ? 0.3327 0.4137 0.3565 -0.0092 -0.0118 0.0307  711 ASP A O   
1197 C CB  . ASP A 189 ? 0.3616 0.4336 0.3962 -0.0010 -0.0040 0.0321  711 ASP A CB  
1198 C CG  . ASP A 189 ? 0.3670 0.4455 0.4096 0.0013  -0.0061 0.0398  711 ASP A CG  
1199 O OD1 . ASP A 189 ? 0.3875 0.4734 0.4247 -0.0013 -0.0075 0.0450  711 ASP A OD1 
1200 O OD2 . ASP A 189 ? 0.3680 0.4426 0.4212 0.0060  -0.0069 0.0405  711 ASP A OD2 
1201 N N   . PHE A 190 ? 0.4134 0.4898 0.4135 -0.0163 -0.0137 0.0304  712 PHE A N   
1202 C CA  . PHE A 190 ? 0.4556 0.5352 0.4510 -0.0233 -0.0209 0.0313  712 PHE A CA  
1203 C C   . PHE A 190 ? 0.4555 0.5507 0.4563 -0.0262 -0.0262 0.0411  712 PHE A C   
1204 O O   . PHE A 190 ? 0.4568 0.5567 0.4537 -0.0336 -0.0335 0.0442  712 PHE A O   
1205 C CB  . PHE A 190 ? 0.4883 0.5543 0.4627 -0.0288 -0.0242 0.0250  712 PHE A CB  
1206 C CG  . PHE A 190 ? 0.5151 0.5667 0.4848 -0.0252 -0.0191 0.0163  712 PHE A CG  
1207 C CD1 . PHE A 190 ? 0.5481 0.5957 0.5236 -0.0266 -0.0205 0.0130  712 PHE A CD1 
1208 C CD2 . PHE A 190 ? 0.5407 0.5851 0.5020 -0.0196 -0.0124 0.0129  712 PHE A CD2 
1209 C CE1 . PHE A 190 ? 0.5601 0.5952 0.5325 -0.0229 -0.0159 0.0059  712 PHE A CE1 
1210 C CE2 . PHE A 190 ? 0.5463 0.5797 0.5050 -0.0153 -0.0073 0.0063  712 PHE A CE2 
1211 C CZ  . PHE A 190 ? 0.5359 0.5639 0.5001 -0.0171 -0.0092 0.0025  712 PHE A CZ  
1212 N N   . GLY A 191 ? 0.4493 0.5523 0.4602 -0.0205 -0.0232 0.0469  713 GLY A N   
1213 C CA  . GLY A 191 ? 0.4435 0.5620 0.4615 -0.0211 -0.0270 0.0572  713 GLY A CA  
1214 C C   . GLY A 191 ? 0.4432 0.5752 0.4729 -0.0210 -0.0302 0.0629  713 GLY A C   
1215 O O   . GLY A 191 ? 0.4580 0.6048 0.4918 -0.0237 -0.0349 0.0725  713 GLY A O   
1216 N N   . LEU A 192 ? 0.4396 0.5687 0.4754 -0.0173 -0.0275 0.0583  714 LEU A N   
1217 C CA  . LEU A 192 ? 0.4445 0.5891 0.4912 -0.0160 -0.0293 0.0648  714 LEU A CA  
1218 C C   . LEU A 192 ? 0.4287 0.5722 0.4711 -0.0245 -0.0337 0.0628  714 LEU A C   
1219 O O   . LEU A 192 ? 0.4157 0.5737 0.4678 -0.0242 -0.0351 0.0694  714 LEU A O   
1220 C CB  . LEU A 192 ? 0.4616 0.6069 0.5192 -0.0034 -0.0232 0.0634  714 LEU A CB  
1221 C CG  . LEU A 192 ? 0.4867 0.6316 0.5506 0.0062  -0.0203 0.0664  714 LEU A CG  
1222 C CD1 . LEU A 192 ? 0.4928 0.6392 0.5648 0.0191  -0.0163 0.0658  714 LEU A CD1 
1223 C CD2 . LEU A 192 ? 0.4982 0.6578 0.5652 0.0041  -0.0239 0.0777  714 LEU A CD2 
1224 N N   . CYS A 193 ? 0.4558 0.5822 0.4834 -0.0315 -0.0359 0.0547  715 CYS A N   
1225 C CA  . CYS A 193 ? 0.4835 0.6039 0.5048 -0.0404 -0.0415 0.0523  715 CYS A CA  
1226 C C   . CYS A 193 ? 0.4832 0.6185 0.5075 -0.0503 -0.0513 0.0634  715 CYS A C   
1227 O O   . CYS A 193 ? 0.4615 0.6048 0.4839 -0.0537 -0.0556 0.0700  715 CYS A O   
1228 C CB  . CYS A 193 ? 0.5233 0.6207 0.5247 -0.0450 -0.0430 0.0420  715 CYS A CB  
1229 S SG  . CYS A 193 ? 0.6309 0.7114 0.6311 -0.0364 -0.0333 0.0301  715 CYS A SG  
1230 N N   . LYS A 194 ? 0.5075 0.6474 0.5372 -0.0557 -0.0555 0.0667  716 LYS A N   
1231 C CA  . LYS A 194 ? 0.5480 0.7025 0.5822 -0.0674 -0.0665 0.0791  716 LYS A CA  
1232 C C   . LYS A 194 ? 0.5594 0.6976 0.5839 -0.0788 -0.0749 0.0751  716 LYS A C   
1233 O O   . LYS A 194 ? 0.5541 0.6886 0.5834 -0.0758 -0.0710 0.0716  716 LYS A O   
1234 C CB  . LYS A 194 ? 0.5548 0.7395 0.6114 -0.0614 -0.0632 0.0928  716 LYS A CB  
1235 C CG  . LYS A 194 ? 0.5723 0.7778 0.6390 -0.0736 -0.0742 0.1091  716 LYS A CG  
1236 C CD  . LYS A 194 ? 0.5759 0.8051 0.6521 -0.0750 -0.0782 0.1237  716 LYS A CD  
1237 C CE  . LYS A 194 ? 0.6014 0.8522 0.6893 -0.0890 -0.0903 0.1414  716 LYS A CE  
1238 N NZ  . LYS A 194 ? 0.6104 0.8886 0.7106 -0.0906 -0.0946 0.1583  716 LYS A NZ  
1239 N N   . LYS A 195 ? 0.5860 0.7125 0.5955 -0.0916 -0.0872 0.0754  717 LYS A N   
1240 C CA  . LYS A 195 ? 0.6083 0.7181 0.6081 -0.1044 -0.0988 0.0738  717 LYS A CA  
1241 C C   . LYS A 195 ? 0.5565 0.6908 0.5741 -0.1157 -0.1093 0.0921  717 LYS A C   
1242 O O   . LYS A 195 ? 0.5237 0.6725 0.5446 -0.1235 -0.1179 0.1034  717 LYS A O   
1243 C CB  . LYS A 195 ? 0.6757 0.7569 0.6471 -0.1127 -0.1088 0.0645  717 LYS A CB  
1244 C CG  . LYS A 195 ? 0.7450 0.7976 0.7014 -0.1203 -0.1170 0.0563  717 LYS A CG  
1245 C CD  . LYS A 195 ? 0.8119 0.8424 0.7450 -0.1353 -0.1353 0.0551  717 LYS A CD  
1246 C CE  . LYS A 195 ? 0.8690 0.8697 0.7702 -0.1293 -0.1331 0.0387  717 LYS A CE  
1247 N NZ  . LYS A 195 ? 0.8844 0.8614 0.7751 -0.1184 -0.1229 0.0237  717 LYS A NZ  
1248 N N   . LEU A 196 ? 0.5414 0.6823 0.5717 -0.1161 -0.1081 0.0962  718 LEU A N   
1249 C CA  . LEU A 196 ? 0.5517 0.7165 0.6001 -0.1272 -0.1178 0.1150  718 LEU A CA  
1250 C C   . LEU A 196 ? 0.5804 0.7255 0.6145 -0.1470 -0.1377 0.1169  718 LEU A C   
1251 O O   . LEU A 196 ? 0.5993 0.7092 0.6121 -0.1505 -0.1421 0.1025  718 LEU A O   
1252 C CB  . LEU A 196 ? 0.5576 0.7308 0.6200 -0.1223 -0.1112 0.1175  718 LEU A CB  
1253 C CG  . LEU A 196 ? 0.5311 0.7354 0.6137 -0.1061 -0.0963 0.1246  718 LEU A CG  
1254 C CD1 . LEU A 196 ? 0.5314 0.7280 0.6069 -0.0899 -0.0829 0.1114  718 LEU A CD1 
1255 C CD2 . LEU A 196 ? 0.5259 0.7351 0.6178 -0.1028 -0.0916 0.1262  718 LEU A CD2 
1256 N N   . ALA A 197 ? 0.5936 0.7604 0.6387 -0.1597 -0.1503 0.1350  719 ALA A N   
1257 C CA  . ALA A 197 ? 0.6485 0.7970 0.6807 -0.1806 -0.1723 0.1390  719 ALA A CA  
1258 C C   . ALA A 197 ? 0.6614 0.7976 0.6968 -0.1902 -0.1804 0.1412  719 ALA A C   
1259 O O   . ALA A 197 ? 0.6209 0.7760 0.6756 -0.1827 -0.1701 0.1468  719 ALA A O   
1260 C CB  . ALA A 197 ? 0.6600 0.8399 0.7083 -0.1927 -0.1843 0.1612  719 ALA A CB  
1261 N N   . VAL A 198 ? 0.7186 0.8214 0.7331 -0.2064 -0.1993 0.1364  720 VAL A N   
1262 C CA  . VAL A 198 ? 0.7618 0.8467 0.7766 -0.2173 -0.2100 0.1383  720 VAL A CA  
1263 C C   . VAL A 198 ? 0.7321 0.8586 0.7818 -0.2269 -0.2151 0.1654  720 VAL A C   
1264 O O   . VAL A 198 ? 0.7417 0.8960 0.8060 -0.2373 -0.2247 0.1844  720 VAL A O   
1265 C CB  . VAL A 198 ? 0.8240 0.8652 0.8094 -0.2351 -0.2334 0.1309  720 VAL A CB  
1266 C CG1 . VAL A 198 ? 0.8377 0.8597 0.8253 -0.2469 -0.2457 0.1344  720 VAL A CG1 
1267 C CG2 . VAL A 198 ? 0.8350 0.8364 0.7837 -0.2238 -0.2275 0.1047  720 VAL A CG2 
1268 N N   . GLY A 199 ? 0.7075 0.8406 0.7712 -0.2226 -0.2081 0.1684  721 GLY A N   
1269 C CA  . GLY A 199 ? 0.7027 0.8796 0.8004 -0.2281 -0.2092 0.1948  721 GLY A CA  
1270 C C   . GLY A 199 ? 0.6655 0.8909 0.7872 -0.2116 -0.1906 0.2063  721 GLY A C   
1271 O O   . GLY A 199 ? 0.6522 0.9190 0.8015 -0.2160 -0.1924 0.2311  721 GLY A O   
1272 N N   . ARG A 200 ? 0.6517 0.8724 0.7629 -0.1924 -0.1733 0.1895  722 ARG A N   
1273 C CA  . ARG A 200 ? 0.6250 0.8829 0.7546 -0.1728 -0.1536 0.1955  722 ARG A CA  
1274 C C   . ARG A 200 ? 0.5823 0.8259 0.7050 -0.1547 -0.1360 0.1775  722 ARG A C   
1275 O O   . ARG A 200 ? 0.5575 0.7634 0.6579 -0.1522 -0.1346 0.1564  722 ARG A O   
1276 C CB  . ARG A 200 ? 0.6480 0.9143 0.7737 -0.1653 -0.1490 0.1932  722 ARG A CB  
1277 C CG  . ARG A 200 ? 0.6856 0.9779 0.8244 -0.1797 -0.1634 0.2152  722 ARG A CG  
1278 C CD  . ARG A 200 ? 0.6679 1.0132 0.8399 -0.1758 -0.1584 0.2423  722 ARG A CD  
1279 N NE  . ARG A 200 ? 0.6633 1.0312 0.8437 -0.1508 -0.1367 0.2400  722 ARG A NE  
1280 C CZ  . ARG A 200 ? 0.6529 1.0379 0.8374 -0.1418 -0.1313 0.2441  722 ARG A CZ  
1281 N NH1 . ARG A 200 ? 0.6763 1.0617 0.8583 -0.1556 -0.1454 0.2513  722 ARG A NH1 
1282 N NH2 . ARG A 200 ? 0.6307 1.0315 0.8212 -0.1185 -0.1124 0.2410  722 ARG A NH2 
1283 N N   . HIS A 201 ? 0.5621 0.8370 0.7033 -0.1415 -0.1227 0.1866  723 HIS A N   
1284 C CA  . HIS A 201 ? 0.5414 0.8052 0.6772 -0.1259 -0.1079 0.1720  723 HIS A CA  
1285 C C   . HIS A 201 ? 0.4837 0.7646 0.6231 -0.1038 -0.0900 0.1675  723 HIS A C   
1286 O O   . HIS A 201 ? 0.4847 0.7590 0.6202 -0.0901 -0.0781 0.1565  723 HIS A O   
1287 C CB  . HIS A 201 ? 0.5667 0.8451 0.7166 -0.1299 -0.1093 0.1843  723 HIS A CB  
1288 C CG  . HIS A 201 ? 0.6236 0.8790 0.7687 -0.1510 -0.1274 0.1869  723 HIS A CG  
1289 N ND1 . HIS A 201 ? 0.6497 0.9236 0.8099 -0.1695 -0.1435 0.2095  723 HIS A ND1 
1290 C CD2 . HIS A 201 ? 0.6373 0.8511 0.7637 -0.1563 -0.1328 0.1702  723 HIS A CD2 
1291 C CE1 . HIS A 201 ? 0.6853 0.9271 0.8350 -0.1860 -0.1590 0.2056  723 HIS A CE1 
1292 N NE2 . HIS A 201 ? 0.6824 0.8872 0.8109 -0.1773 -0.1522 0.1815  723 HIS A NE2 
1293 N N   . SER A 202 ? 0.4631 0.7643 0.6092 -0.1007 -0.0892 0.1762  724 SER A N   
1294 C CA  . SER A 202 ? 0.4386 0.7549 0.5879 -0.0797 -0.0738 0.1734  724 SER A CA  
1295 C C   . SER A 202 ? 0.4169 0.7349 0.5636 -0.0801 -0.0764 0.1743  724 SER A C   
1296 O O   . SER A 202 ? 0.4306 0.7406 0.5730 -0.0966 -0.0900 0.1779  724 SER A O   
1297 C CB  . SER A 202 ? 0.4292 0.7875 0.5993 -0.0693 -0.0660 0.1925  724 SER A CB  
1298 O OG  . SER A 202 ? 0.4324 0.8234 0.6199 -0.0773 -0.0733 0.2154  724 SER A OG  
1299 N N   . PHE A 203 ? 0.3865 0.7132 0.5345 -0.0618 -0.0639 0.1708  725 PHE A N   
1300 C CA  . PHE A 203 ? 0.3779 0.7096 0.5257 -0.0601 -0.0651 0.1736  725 PHE A CA  
1301 C C   . PHE A 203 ? 0.3730 0.7328 0.5335 -0.0396 -0.0524 0.1822  725 PHE A C   
1302 O O   . PHE A 203 ? 0.3724 0.7346 0.5333 -0.0248 -0.0415 0.1775  725 PHE A O   
1303 C CB  . PHE A 203 ? 0.3941 0.6890 0.5210 -0.0594 -0.0642 0.1523  725 PHE A CB  
1304 C CG  . PHE A 203 ? 0.3894 0.6692 0.5092 -0.0416 -0.0507 0.1365  725 PHE A CG  
1305 C CD1 . PHE A 203 ? 0.3917 0.6513 0.5033 -0.0408 -0.0477 0.1239  725 PHE A CD1 
1306 C CD2 . PHE A 203 ? 0.3854 0.6696 0.5065 -0.0262 -0.0421 0.1347  725 PHE A CD2 
1307 C CE1 . PHE A 203 ? 0.3941 0.6395 0.4993 -0.0261 -0.0371 0.1102  725 PHE A CE1 
1308 C CE2 . PHE A 203 ? 0.3930 0.6603 0.5067 -0.0114 -0.0320 0.1203  725 PHE A CE2 
1309 C CZ  . PHE A 203 ? 0.3877 0.6361 0.4935 -0.0119 -0.0299 0.1083  725 PHE A CZ  
1310 N N   . SER A 204 ? 0.3692 0.7498 0.5392 -0.0381 -0.0541 0.1949  726 SER A N   
1311 C CA  . SER A 204 ? 0.3690 0.7779 0.5516 -0.0174 -0.0424 0.2051  726 SER A CA  
1312 C C   . SER A 204 ? 0.3961 0.7858 0.5678 -0.0021 -0.0343 0.1910  726 SER A C   
1313 O O   . SER A 204 ? 0.3963 0.7583 0.5546 -0.0098 -0.0391 0.1780  726 SER A O   
1314 C CB  . SER A 204 ? 0.3504 0.8001 0.5542 -0.0232 -0.0484 0.2319  726 SER A CB  
1315 O OG  . SER A 204 ? 0.3448 0.7871 0.5455 -0.0391 -0.0608 0.2342  726 SER A OG  
1316 N N   . ARG A 205 ? 0.4263 0.8308 0.6035 0.0203  -0.0223 0.1942  727 ARG A N   
1317 C CA  . ARG A 205 ? 0.4349 0.8218 0.6034 0.0365  -0.0150 0.1827  727 ARG A CA  
1318 C C   . ARG A 205 ? 0.4229 0.8168 0.5967 0.0315  -0.0206 0.1912  727 ARG A C   
1319 O O   . ARG A 205 ? 0.4012 0.8231 0.5890 0.0221  -0.0272 0.2099  727 ARG A O   
1320 C CB  . ARG A 205 ? 0.4630 0.8652 0.6353 0.0625  -0.0021 0.1862  727 ARG A CB  
1321 C CG  . ARG A 205 ? 0.4990 0.8941 0.6636 0.0715  0.0048  0.1770  727 ARG A CG  
1322 C CD  . ARG A 205 ? 0.5380 0.9444 0.7015 0.0995  0.0174  0.1789  727 ARG A CD  
1323 N NE  . ARG A 205 ? 0.5805 0.9867 0.7369 0.1089  0.0239  0.1734  727 ARG A NE  
1324 C CZ  . ARG A 205 ? 0.6269 1.0354 0.7753 0.1342  0.0348  0.1703  727 ARG A CZ  
1325 N NH1 . ARG A 205 ? 0.6263 1.0360 0.7732 0.1537  0.0405  0.1719  727 ARG A NH1 
1326 N NH2 . ARG A 205 ? 0.6570 1.0650 0.7973 0.1407  0.0396  0.1654  727 ARG A NH2 
1327 N N   . ARG A 206 ? 0.4505 0.8189 0.6133 0.0371  -0.0187 0.1782  728 ARG A N   
1328 C CA  . ARG A 206 ? 0.4607 0.8355 0.6282 0.0372  -0.0218 0.1860  728 ARG A CA  
1329 C C   . ARG A 206 ? 0.4390 0.8010 0.6026 0.0593  -0.0123 0.1785  728 ARG A C   
1330 O O   . ARG A 206 ? 0.3969 0.7418 0.5519 0.0720  -0.0051 0.1658  728 ARG A O   
1331 C CB  . ARG A 206 ? 0.4977 0.8509 0.6537 0.0178  -0.0319 0.1783  728 ARG A CB  
1332 C CG  . ARG A 206 ? 0.5350 0.8976 0.6926 -0.0047 -0.0441 0.1864  728 ARG A CG  
1333 C CD  . ARG A 206 ? 0.5460 0.8861 0.6883 -0.0210 -0.0539 0.1783  728 ARG A CD  
1334 N NE  . ARG A 206 ? 0.5497 0.8882 0.6873 -0.0419 -0.0663 0.1809  728 ARG A NE  
1335 C CZ  . ARG A 206 ? 0.5717 0.9240 0.7125 -0.0577 -0.0793 0.1943  728 ARG A CZ  
1336 N NH1 . ARG A 206 ? 0.5482 0.9207 0.6985 -0.0557 -0.0814 0.2079  728 ARG A NH1 
1337 N NH2 . ARG A 206 ? 0.5923 0.9367 0.7262 -0.0762 -0.0914 0.1944  728 ARG A NH2 
1338 N N   . SER A 207 ? 0.4435 0.8133 0.6133 0.0637  -0.0133 0.1871  729 SER A N   
1339 C CA  . SER A 207 ? 0.4473 0.7996 0.6124 0.0821  -0.0069 0.1798  729 SER A CA  
1340 C C   . SER A 207 ? 0.4440 0.7568 0.5926 0.0758  -0.0090 0.1598  729 SER A C   
1341 O O   . SER A 207 ? 0.4265 0.7287 0.5681 0.0575  -0.0153 0.1539  729 SER A O   
1342 C CB  . SER A 207 ? 0.4343 0.8037 0.6106 0.0852  -0.0092 0.1950  729 SER A CB  
1343 O OG  . SER A 207 ? 0.4063 0.7675 0.5785 0.0657  -0.0187 0.1944  729 SER A OG  
1344 N N   . GLY A 208 ? 0.4778 0.7684 0.6198 0.0916  -0.0039 0.1501  730 GLY A N   
1345 C CA  . GLY A 208 ? 0.5046 0.7612 0.6345 0.0859  -0.0064 0.1348  730 GLY A CA  
1346 C C   . GLY A 208 ? 0.5167 0.7531 0.6359 0.0866  -0.0039 0.1194  730 GLY A C   
1347 O O   . GLY A 208 ? 0.5061 0.7552 0.6264 0.0880  -0.0012 0.1205  730 GLY A O   
1348 N N   . VAL A 209 ? 0.5524 0.7588 0.6624 0.0849  -0.0053 0.1067  731 VAL A N   
1349 C CA  . VAL A 209 ? 0.5632 0.7480 0.6633 0.0868  -0.0036 0.0921  731 VAL A CA  
1350 C C   . VAL A 209 ? 0.5237 0.7098 0.6205 0.0697  -0.0060 0.0879  731 VAL A C   
1351 O O   . VAL A 209 ? 0.5232 0.7002 0.6167 0.0565  -0.0098 0.0850  731 VAL A O   
1352 C CB  . VAL A 209 ? 0.5940 0.7469 0.6872 0.0911  -0.0054 0.0819  731 VAL A CB  
1353 C CG1 . VAL A 209 ? 0.6147 0.7631 0.7101 0.1085  -0.0043 0.0862  731 VAL A CG1 
1354 C CG2 . VAL A 209 ? 0.6050 0.7492 0.6981 0.0756  -0.0100 0.0812  731 VAL A CG2 
1355 N N   . PRO A 210 ? 0.5142 0.7117 0.6113 0.0708  -0.0035 0.0880  732 PRO A N   
1356 C CA  . PRO A 210 ? 0.5133 0.7110 0.6076 0.0553  -0.0064 0.0847  732 PRO A CA  
1357 C C   . PRO A 210 ? 0.4981 0.6700 0.5828 0.0540  -0.0056 0.0697  732 PRO A C   
1358 O O   . PRO A 210 ? 0.4566 0.6287 0.5389 0.0565  -0.0034 0.0656  732 PRO A O   
1359 C CB  . PRO A 210 ? 0.5224 0.7459 0.6237 0.0581  -0.0043 0.0941  732 PRO A CB  
1360 C CG  . PRO A 210 ? 0.5319 0.7595 0.6339 0.0795  0.0025  0.0952  732 PRO A CG  
1361 C CD  . PRO A 210 ? 0.5213 0.7298 0.6198 0.0879  0.0024  0.0905  732 PRO A CD  
1362 N N   . GLY A 211 ? 0.4782 0.6302 0.5585 0.0500  -0.0076 0.0633  733 GLY A N   
1363 C CA  . GLY A 211 ? 0.4502 0.5787 0.5237 0.0490  -0.0075 0.0512  733 GLY A CA  
1364 C C   . GLY A 211 ? 0.4141 0.5235 0.4863 0.0574  -0.0081 0.0471  733 GLY A C   
1365 O O   . GLY A 211 ? 0.4191 0.5300 0.4949 0.0605  -0.0092 0.0529  733 GLY A O   
1366 N N   . THR A 212 ? 0.3936 0.4845 0.4608 0.0603  -0.0084 0.0377  734 THR A N   
1367 C CA  . THR A 212 ? 0.3955 0.4653 0.4610 0.0670  -0.0113 0.0339  734 THR A CA  
1368 C C   . THR A 212 ? 0.3947 0.4552 0.4531 0.0813  -0.0106 0.0278  734 THR A C   
1369 O O   . THR A 212 ? 0.3837 0.4454 0.4376 0.0816  -0.0090 0.0227  734 THR A O   
1370 C CB  . THR A 212 ? 0.3856 0.4394 0.4510 0.0569  -0.0142 0.0291  734 THR A CB  
1371 O OG1 . THR A 212 ? 0.3557 0.4187 0.4247 0.0459  -0.0137 0.0346  734 THR A OG1 
1372 C CG2 . THR A 212 ? 0.3994 0.4308 0.4648 0.0617  -0.0193 0.0271  734 THR A CG2 
1373 N N   . GLU A 213 ? 0.4202 0.4705 0.4763 0.0939  -0.0121 0.0285  735 GLU A N   
1374 C CA  . GLU A 213 ? 0.4615 0.4980 0.5065 0.1100  -0.0122 0.0215  735 GLU A CA  
1375 C C   . GLU A 213 ? 0.4413 0.4568 0.4781 0.1065  -0.0163 0.0105  735 GLU A C   
1376 O O   . GLU A 213 ? 0.4092 0.4073 0.4483 0.0972  -0.0223 0.0080  735 GLU A O   
1377 C CB  . GLU A 213 ? 0.5236 0.5428 0.5657 0.1225  -0.0156 0.0222  735 GLU A CB  
1378 C CG  . GLU A 213 ? 0.5981 0.6216 0.6317 0.1439  -0.0109 0.0222  735 GLU A CG  
1379 C CD  . GLU A 213 ? 0.6394 0.6307 0.6609 0.1593  -0.0164 0.0156  735 GLU A CD  
1380 O OE1 . GLU A 213 ? 0.6723 0.6405 0.6960 0.1523  -0.0246 0.0145  735 GLU A OE1 
1381 O OE2 . GLU A 213 ? 0.6313 0.6204 0.6404 0.1789  -0.0126 0.0122  735 GLU A OE2 
1382 N N   . GLY A 214 ? 0.4316 0.4513 0.4597 0.1141  -0.0131 0.0057  736 GLY A N   
1383 C CA  . GLY A 214 ? 0.4416 0.4451 0.4613 0.1114  -0.0168 -0.0038 736 GLY A CA  
1384 C C   . GLY A 214 ? 0.4215 0.4417 0.4468 0.0990  -0.0135 -0.0027 736 GLY A C   
1385 O O   . GLY A 214 ? 0.4468 0.4587 0.4658 0.0977  -0.0153 -0.0093 736 GLY A O   
1386 N N   . TRP A 215 ? 0.3816 0.4236 0.4179 0.0897  -0.0097 0.0054  737 TRP A N   
1387 C CA  . TRP A 215 ? 0.3480 0.4030 0.3888 0.0779  -0.0075 0.0065  737 TRP A CA  
1388 C C   . TRP A 215 ? 0.3361 0.4192 0.3824 0.0771  -0.0026 0.0154  737 TRP A C   
1389 O O   . TRP A 215 ? 0.3155 0.4083 0.3660 0.0659  -0.0021 0.0177  737 TRP A O   
1390 C CB  . TRP A 215 ? 0.3428 0.3916 0.3903 0.0635  -0.0101 0.0071  737 TRP A CB  
1391 C CG  . TRP A 215 ? 0.3452 0.3706 0.3914 0.0625  -0.0156 0.0022  737 TRP A CG  
1392 C CD1 . TRP A 215 ? 0.3561 0.3704 0.4044 0.0645  -0.0192 0.0043  737 TRP A CD1 
1393 C CD2 . TRP A 215 ? 0.3452 0.3565 0.3892 0.0586  -0.0191 -0.0039 737 TRP A CD2 
1394 N NE1 . TRP A 215 ? 0.3652 0.3591 0.4132 0.0613  -0.0254 0.0004  737 TRP A NE1 
1395 C CE2 . TRP A 215 ? 0.3583 0.3506 0.4039 0.0575  -0.0255 -0.0045 737 TRP A CE2 
1396 C CE3 . TRP A 215 ? 0.3320 0.3455 0.3739 0.0553  -0.0181 -0.0077 737 TRP A CE3 
1397 C CZ2 . TRP A 215 ? 0.3557 0.3324 0.4014 0.0528  -0.0314 -0.0083 737 TRP A CZ2 
1398 C CZ3 . TRP A 215 ? 0.3366 0.3347 0.3781 0.0515  -0.0232 -0.0120 737 TRP A CZ3 
1399 C CH2 . TRP A 215 ? 0.3495 0.3298 0.3931 0.0500  -0.0300 -0.0120 737 TRP A CH2 
1400 N N   . ILE A 216 ? 0.3496 0.4452 0.3961 0.0890  0.0004  0.0213  738 ILE A N   
1401 C CA  . ILE A 216 ? 0.3304 0.4553 0.3851 0.0877  0.0039  0.0330  738 ILE A CA  
1402 C C   . ILE A 216 ? 0.3211 0.4616 0.3732 0.0956  0.0083  0.0352  738 ILE A C   
1403 O O   . ILE A 216 ? 0.3225 0.4573 0.3651 0.1115  0.0109  0.0309  738 ILE A O   
1404 C CB  . ILE A 216 ? 0.3450 0.4797 0.4043 0.0967  0.0054  0.0412  738 ILE A CB  
1405 C CG1 . ILE A 216 ? 0.3490 0.4708 0.4116 0.0882  0.0010  0.0408  738 ILE A CG1 
1406 C CG2 . ILE A 216 ? 0.3400 0.5079 0.4097 0.0948  0.0081  0.0554  738 ILE A CG2 
1407 C CD1 . ILE A 216 ? 0.3605 0.4807 0.4245 0.1001  0.0013  0.0453  738 ILE A CD1 
1408 N N   . ALA A 217 ? 0.3023 0.4610 0.3615 0.0844  0.0084  0.0419  739 ALA A N   
1409 C CA  . ALA A 217 ? 0.3182 0.4962 0.3778 0.0897  0.0122  0.0472  739 ALA A CA  
1410 C C   . ALA A 217 ? 0.3258 0.5273 0.3882 0.1062  0.0181  0.0577  739 ALA A C   
1411 O O   . ALA A 217 ? 0.3233 0.5371 0.3943 0.1057  0.0179  0.0666  739 ALA A O   
1412 C CB  . ALA A 217 ? 0.3063 0.4988 0.3754 0.0724  0.0094  0.0547  739 ALA A CB  
1413 N N   . PRO A 218 ? 0.3287 0.5369 0.3831 0.1218  0.0235  0.0571  740 PRO A N   
1414 C CA  . PRO A 218 ? 0.3595 0.5868 0.4129 0.1423  0.0306  0.0652  740 PRO A CA  
1415 C C   . PRO A 218 ? 0.3496 0.6149 0.4213 0.1386  0.0329  0.0851  740 PRO A C   
1416 O O   . PRO A 218 ? 0.3406 0.6184 0.4159 0.1514  0.0367  0.0927  740 PRO A O   
1417 C CB  . PRO A 218 ? 0.3692 0.6000 0.4102 0.1560  0.0358  0.0619  740 PRO A CB  
1418 C CG  . PRO A 218 ? 0.3542 0.5829 0.3985 0.1381  0.0316  0.0598  740 PRO A CG  
1419 C CD  . PRO A 218 ? 0.3459 0.5464 0.3912 0.1222  0.0239  0.0498  740 PRO A CD  
1420 N N   . GLU A 219 ? 0.3455 0.6277 0.4289 0.1208  0.0295  0.0939  741 GLU A N   
1421 C CA  . GLU A 219 ? 0.3533 0.6714 0.4554 0.1136  0.0289  0.1143  741 GLU A CA  
1422 C C   . GLU A 219 ? 0.3635 0.6810 0.4740 0.1048  0.0238  0.1189  741 GLU A C   
1423 O O   . GLU A 219 ? 0.3677 0.7146 0.4936 0.0993  0.0223  0.1365  741 GLU A O   
1424 C CB  . GLU A 219 ? 0.3352 0.6676 0.4468 0.0951  0.0242  0.1227  741 GLU A CB  
1425 C CG  . GLU A 219 ? 0.3205 0.6272 0.4302 0.0728  0.0147  0.1131  741 GLU A CG  
1426 C CD  . GLU A 219 ? 0.3011 0.5780 0.3968 0.0727  0.0147  0.0954  741 GLU A CD  
1427 O OE1 . GLU A 219 ? 0.2956 0.5643 0.3800 0.0893  0.0205  0.0872  741 GLU A OE1 
1428 O OE2 . GLU A 219 ? 0.2903 0.5510 0.3853 0.0562  0.0083  0.0897  741 GLU A OE2 
1429 N N   . MET A 220 ? 0.3880 0.6742 0.4893 0.1035  0.0208  0.1048  742 MET A N   
1430 C CA  . MET A 220 ? 0.4198 0.7061 0.5277 0.0973  0.0167  0.1095  742 MET A CA  
1431 C C   . MET A 220 ? 0.4605 0.7535 0.5691 0.1174  0.0223  0.1140  742 MET A C   
1432 O O   . MET A 220 ? 0.4519 0.7525 0.5687 0.1142  0.0196  0.1220  742 MET A O   
1433 C CB  . MET A 220 ? 0.4349 0.6873 0.5341 0.0862  0.0110  0.0946  742 MET A CB  
1434 C CG  . MET A 220 ? 0.4417 0.6845 0.5391 0.0674  0.0056  0.0896  742 MET A CG  
1435 S SD  . MET A 220 ? 0.4517 0.7136 0.5605 0.0467  -0.0026 0.1035  742 MET A SD  
1436 C CE  . MET A 220 ? 0.4531 0.6803 0.5503 0.0321  -0.0085 0.0882  742 MET A CE  
1437 N N   . LEU A 221 ? 0.5143 0.8025 0.6124 0.1386  0.0296  0.1084  743 LEU A N   
1438 C CA  . LEU A 221 ? 0.5387 0.8250 0.6323 0.1615  0.0351  0.1091  743 LEU A CA  
1439 C C   . LEU A 221 ? 0.5453 0.8566 0.6373 0.1848  0.0453  0.1177  743 LEU A C   
1440 O O   . LEU A 221 ? 0.5688 0.8865 0.6602 0.2045  0.0507  0.1227  743 LEU A O   
1441 C CB  . LEU A 221 ? 0.5608 0.8034 0.6361 0.1683  0.0328  0.0889  743 LEU A CB  
1442 C CG  . LEU A 221 ? 0.5690 0.7850 0.6436 0.1601  0.0260  0.0821  743 LEU A CG  
1443 C CD1 . LEU A 221 ? 0.5565 0.7879 0.6465 0.1404  0.0210  0.0927  743 LEU A CD1 
1444 C CD2 . LEU A 221 ? 0.5759 0.7557 0.6373 0.1528  0.0209  0.0643  743 LEU A CD2 
1445 N N   . SER A 222 ? 0.5707 0.8960 0.6612 0.1840  0.0485  0.1197  744 SER A N   
1446 C CA  . SER A 222 ? 0.6192 0.9625 0.7021 0.2090  0.0591  0.1242  744 SER A CA  
1447 C C   . SER A 222 ? 0.6440 1.0355 0.7453 0.2189  0.0663  0.1488  744 SER A C   
1448 O O   . SER A 222 ? 0.6039 1.0191 0.7263 0.2020  0.0615  0.1644  744 SER A O   
1449 C CB  . SER A 222 ? 0.6284 0.9718 0.7032 0.2052  0.0601  0.1191  744 SER A CB  
1450 O OG  . SER A 222 ? 0.6299 1.0030 0.7239 0.1851  0.0571  0.1344  744 SER A OG  
1451 N N   . GLU A 223 ? 0.7071 1.1126 0.7991 0.2469  0.0775  0.1522  745 GLU A N   
1452 C CA  . GLU A 223 ? 0.7055 1.1573 0.8130 0.2632  0.0868  0.1757  745 GLU A CA  
1453 C C   . GLU A 223 ? 0.6875 1.1855 0.8125 0.2548  0.0899  0.1965  745 GLU A C   
1454 O O   . GLU A 223 ? 0.6275 1.1214 0.7427 0.2528  0.0909  0.1902  745 GLU A O   
1455 C CB  . GLU A 223 ? 0.7515 1.1972 0.8385 0.3008  0.0989  0.1702  745 GLU A CB  
1456 C CG  . GLU A 223 ? 0.7626 1.1547 0.8253 0.3126  0.0954  0.1462  745 GLU A CG  
1457 C CD  . GLU A 223 ? 0.7459 1.1345 0.8195 0.3140  0.0927  0.1515  745 GLU A CD  
1458 O OE1 . GLU A 223 ? 0.7095 1.0945 0.7985 0.2878  0.0828  0.1538  745 GLU A OE1 
1459 O OE2 . GLU A 223 ? 0.7350 1.1229 0.8001 0.3423  0.1005  0.1531  745 GLU A OE2 
1460 N N   . ASP A 224 ? 0.6703 1.2128 0.8221 0.2499  0.0906  0.2225  746 ASP A N   
1461 C CA  . ASP A 224 ? 0.6612 1.2536 0.8343 0.2422  0.0928  0.2477  746 ASP A CA  
1462 C C   . ASP A 224 ? 0.6276 1.2099 0.8027 0.2140  0.0827  0.2430  746 ASP A C   
1463 O O   . ASP A 224 ? 0.5989 1.2052 0.7778 0.2144  0.0866  0.2529  746 ASP A O   
1464 C CB  . ASP A 224 ? 0.6951 1.3172 0.8613 0.2746  0.1091  0.2572  746 ASP A CB  
1465 C CG  . ASP A 224 ? 0.7271 1.3811 0.9037 0.2994  0.1193  0.2749  746 ASP A CG  
1466 O OD1 . ASP A 224 ? 0.7268 1.3597 0.9018 0.3017  0.1159  0.2679  746 ASP A OD1 
1467 O OD2 . ASP A 224 ? 0.7124 1.4142 0.8995 0.3170  0.1310  0.2971  746 ASP A OD2 
1468 N N   . CYS A 225 ? 0.6056 1.1529 0.7782 0.1902  0.0701  0.2287  747 CYS A N   
1469 C CA  . CYS A 225 ? 0.5945 1.1274 0.7679 0.1639  0.0600  0.2228  747 CYS A CA  
1470 C C   . CYS A 225 ? 0.5646 1.1324 0.7651 0.1404  0.0510  0.2475  747 CYS A C   
1471 O O   . CYS A 225 ? 0.5300 1.1048 0.7428 0.1311  0.0448  0.2560  747 CYS A O   
1472 C CB  . CYS A 225 ? 0.6029 1.0851 0.7616 0.1505  0.0510  0.1982  747 CYS A CB  
1473 S SG  . CYS A 225 ? 0.6062 1.0646 0.7620 0.1218  0.0398  0.1878  747 CYS A SG  
1474 N N   . LYS A 226 ? 0.5626 1.1514 0.7723 0.1301  0.0493  0.2593  748 LYS A N   
1475 C CA  . LYS A 226 ? 0.5668 1.1921 0.8036 0.1085  0.0400  0.2862  748 LYS A CA  
1476 C C   . LYS A 226 ? 0.5386 1.1402 0.7770 0.0759  0.0235  0.2807  748 LYS A C   
1477 O O   . LYS A 226 ? 0.5242 1.1506 0.7830 0.0558  0.0132  0.3018  748 LYS A O   
1478 C CB  . LYS A 226 ? 0.5920 1.2682 0.8438 0.1205  0.0493  0.3114  748 LYS A CB  
1479 C CG  . LYS A 226 ? 0.6024 1.3216 0.8671 0.1442  0.0610  0.3318  748 LYS A CG  
1480 C CD  . LYS A 226 ? 0.6157 1.3867 0.8940 0.1578  0.0717  0.3571  748 LYS A CD  
1481 C CE  . LYS A 226 ? 0.6154 1.4443 0.9234 0.1631  0.0750  0.3915  748 LYS A CE  
1482 N NZ  . LYS A 226 ? 0.6260 1.4620 0.9267 0.1955  0.0892  0.3897  748 LYS A NZ  
1483 N N   . GLU A 227 ? 0.5243 1.0780 0.7414 0.0709  0.0204  0.2535  749 GLU A N   
1484 C CA  . GLU A 227 ? 0.5134 1.0405 0.7292 0.0426  0.0054  0.2464  749 GLU A CA  
1485 C C   . GLU A 227 ? 0.4513 0.9395 0.6535 0.0367  0.0000  0.2265  749 GLU A C   
1486 O O   . GLU A 227 ? 0.4411 0.9115 0.6300 0.0540  0.0080  0.2115  749 GLU A O   
1487 C CB  . GLU A 227 ? 0.5566 1.0647 0.7618 0.0391  0.0057  0.2349  749 GLU A CB  
1488 C CG  . GLU A 227 ? 0.6013 1.1187 0.8201 0.0143  -0.0068 0.2492  749 GLU A CG  
1489 C CD  . GLU A 227 ? 0.6219 1.1144 0.8406 -0.0113 -0.0234 0.2451  749 GLU A CD  
1490 O OE1 . GLU A 227 ? 0.6005 1.1168 0.8369 -0.0266 -0.0336 0.2661  749 GLU A OE1 
1491 O OE2 . GLU A 227 ? 0.6193 1.0690 0.8197 -0.0159 -0.0265 0.2216  749 GLU A OE2 
1492 N N   . ASN A 228 ? 0.4066 0.8820 0.6118 0.0124  -0.0143 0.2275  750 ASN A N   
1493 C CA  . ASN A 228 ? 0.3848 0.8248 0.5763 0.0057  -0.0198 0.2098  750 ASN A CA  
1494 C C   . ASN A 228 ? 0.3679 0.7657 0.5390 0.0061  -0.0182 0.1843  750 ASN A C   
1495 O O   . ASN A 228 ? 0.3404 0.7326 0.5095 0.0011  -0.0192 0.1819  750 ASN A O   
1496 C CB  . ASN A 228 ? 0.3926 0.8309 0.5903 -0.0198 -0.0362 0.2186  750 ASN A CB  
1497 C CG  . ASN A 228 ? 0.3942 0.8660 0.6090 -0.0209 -0.0394 0.2398  750 ASN A CG  
1498 O OD1 . ASN A 228 ? 0.4014 0.8892 0.6287 -0.0400 -0.0523 0.2568  750 ASN A OD1 
1499 N ND2 . ASN A 228 ? 0.3889 0.8696 0.6039 -0.0011 -0.0289 0.2390  750 ASN A ND2 
1500 N N   . PRO A 229 ? 0.3643 0.7340 0.5217 0.0120  -0.0159 0.1669  751 PRO A N   
1501 C CA  . PRO A 229 ? 0.3728 0.7035 0.5129 0.0098  -0.0161 0.1447  751 PRO A CA  
1502 C C   . PRO A 229 ? 0.3733 0.6849 0.5093 -0.0121 -0.0276 0.1409  751 PRO A C   
1503 O O   . PRO A 229 ? 0.3722 0.6925 0.5148 -0.0275 -0.0378 0.1521  751 PRO A O   
1504 C CB  . PRO A 229 ? 0.3803 0.6915 0.5112 0.0175  -0.0134 0.1329  751 PRO A CB  
1505 C CG  . PRO A 229 ? 0.3727 0.7102 0.5155 0.0207  -0.0138 0.1485  751 PRO A CG  
1506 C CD  . PRO A 229 ? 0.3671 0.7426 0.5254 0.0250  -0.0110 0.1681  751 PRO A CD  
1507 N N   . THR A 230 ? 0.3706 0.6548 0.4947 -0.0129 -0.0264 0.1250  752 THR A N   
1508 C CA  . THR A 230 ? 0.3672 0.6288 0.4845 -0.0303 -0.0360 0.1190  752 THR A CA  
1509 C C   . THR A 230 ? 0.3353 0.5629 0.4372 -0.0264 -0.0322 0.0982  752 THR A C   
1510 O O   . THR A 230 ? 0.3060 0.5261 0.4029 -0.0133 -0.0246 0.0890  752 THR A O   
1511 C CB  . THR A 230 ? 0.3808 0.6581 0.5085 -0.0412 -0.0422 0.1327  752 THR A CB  
1512 O OG1 . THR A 230 ? 0.4181 0.6711 0.5380 -0.0590 -0.0538 0.1278  752 THR A OG1 
1513 C CG2 . THR A 230 ? 0.3811 0.6639 0.5101 -0.0307 -0.0340 0.1309  752 THR A CG2 
1514 N N   . TYR A 231 ? 0.3256 0.5325 0.4207 -0.0378 -0.0382 0.0918  753 TYR A N   
1515 C CA  . TYR A 231 ? 0.3199 0.4957 0.4014 -0.0356 -0.0354 0.0739  753 TYR A CA  
1516 C C   . TYR A 231 ? 0.2932 0.4671 0.3739 -0.0205 -0.0255 0.0660  753 TYR A C   
1517 O O   . TYR A 231 ? 0.2727 0.4273 0.3454 -0.0152 -0.0217 0.0536  753 TYR A O   
1518 C CB  . TYR A 231 ? 0.3393 0.4962 0.4150 -0.0479 -0.0427 0.0703  753 TYR A CB  
1519 C CG  . TYR A 231 ? 0.3711 0.5222 0.4429 -0.0636 -0.0549 0.0757  753 TYR A CG  
1520 C CD1 . TYR A 231 ? 0.3959 0.5257 0.4533 -0.0670 -0.0579 0.0663  753 TYR A CD1 
1521 C CD2 . TYR A 231 ? 0.3748 0.5420 0.4567 -0.0752 -0.0641 0.0910  753 TYR A CD2 
1522 C CE1 . TYR A 231 ? 0.4210 0.5429 0.4713 -0.0810 -0.0702 0.0701  753 TYR A CE1 
1523 C CE2 . TYR A 231 ? 0.4005 0.5597 0.4775 -0.0907 -0.0775 0.0958  753 TYR A CE2 
1524 C CZ  . TYR A 231 ? 0.4153 0.5501 0.4748 -0.0932 -0.0807 0.0843  753 TYR A CZ  
1525 O OH  . TYR A 231 ? 0.4426 0.5660 0.4931 -0.1081 -0.0949 0.0874  753 TYR A OH  
1526 N N   . THR A 232 ? 0.2806 0.4756 0.3694 -0.0138 -0.0218 0.0744  754 THR A N   
1527 C CA  . THR A 232 ? 0.2784 0.4717 0.3642 0.0000  -0.0141 0.0678  754 THR A CA  
1528 C C   . THR A 232 ? 0.2790 0.4665 0.3596 0.0133  -0.0084 0.0604  754 THR A C   
1529 O O   . THR A 232 ? 0.2789 0.4558 0.3533 0.0232  -0.0041 0.0515  754 THR A O   
1530 C CB  . THR A 232 ? 0.2718 0.4916 0.3657 0.0052  -0.0111 0.0799  754 THR A CB  
1531 O OG1 . THR A 232 ? 0.2902 0.5379 0.3942 0.0067  -0.0111 0.0950  754 THR A OG1 
1532 C CG2 . THR A 232 ? 0.2728 0.4921 0.3708 -0.0075 -0.0169 0.0849  754 THR A CG2 
1533 N N   . VAL A 233 ? 0.2881 0.4803 0.3707 0.0130  -0.0095 0.0642  755 VAL A N   
1534 C CA  . VAL A 233 ? 0.2961 0.4792 0.3740 0.0244  -0.0055 0.0573  755 VAL A CA  
1535 C C   . VAL A 233 ? 0.2897 0.4441 0.3590 0.0217  -0.0063 0.0434  755 VAL A C   
1536 O O   . VAL A 233 ? 0.2870 0.4292 0.3517 0.0313  -0.0034 0.0358  755 VAL A O   
1537 C CB  . VAL A 233 ? 0.2959 0.4909 0.3788 0.0244  -0.0068 0.0655  755 VAL A CB  
1538 C CG1 . VAL A 233 ? 0.2978 0.5251 0.3917 0.0279  -0.0057 0.0818  755 VAL A CG1 
1539 C CG2 . VAL A 233 ? 0.3082 0.4928 0.3889 0.0094  -0.0134 0.0645  755 VAL A CG2 
1540 N N   . ASP A 234 ? 0.2814 0.4248 0.3484 0.0089  -0.0106 0.0408  756 ASP A N   
1541 C CA  . ASP A 234 ? 0.2795 0.3995 0.3398 0.0069  -0.0103 0.0296  756 ASP A CA  
1542 C C   . ASP A 234 ? 0.2759 0.3879 0.3346 0.0111  -0.0081 0.0234  756 ASP A C   
1543 O O   . ASP A 234 ? 0.2828 0.3792 0.3383 0.0139  -0.0068 0.0155  756 ASP A O   
1544 C CB  . ASP A 234 ? 0.2760 0.3862 0.3319 -0.0055 -0.0148 0.0284  756 ASP A CB  
1545 C CG  . ASP A 234 ? 0.2803 0.3935 0.3343 -0.0100 -0.0177 0.0323  756 ASP A CG  
1546 O OD1 . ASP A 234 ? 0.2769 0.3954 0.3334 -0.0031 -0.0153 0.0340  756 ASP A OD1 
1547 O OD2 . ASP A 234 ? 0.2910 0.3995 0.3397 -0.0203 -0.0231 0.0334  756 ASP A OD2 
1548 N N   . ILE A 235 ? 0.2702 0.3944 0.3321 0.0111  -0.0081 0.0284  757 ILE A N   
1549 C CA  . ILE A 235 ? 0.2660 0.3844 0.3260 0.0147  -0.0065 0.0237  757 ILE A CA  
1550 C C   . ILE A 235 ? 0.2633 0.3803 0.3193 0.0284  -0.0031 0.0194  757 ILE A C   
1551 O O   . ILE A 235 ? 0.2674 0.3699 0.3190 0.0312  -0.0031 0.0116  757 ILE A O   
1552 C CB  . ILE A 235 ? 0.2728 0.4062 0.3374 0.0108  -0.0077 0.0318  757 ILE A CB  
1553 C CG1 . ILE A 235 ? 0.2807 0.4104 0.3476 -0.0035 -0.0133 0.0355  757 ILE A CG1 
1554 C CG2 . ILE A 235 ? 0.2827 0.4111 0.3447 0.0153  -0.0060 0.0273  757 ILE A CG2 
1555 C CD1 . ILE A 235 ? 0.2853 0.3911 0.3465 -0.0090 -0.0148 0.0261  757 ILE A CD1 
1556 N N   . PHE A 236 ? 0.2579 0.3888 0.3147 0.0370  -0.0008 0.0247  758 PHE A N   
1557 C CA  . PHE A 236 ? 0.2605 0.3861 0.3103 0.0515  0.0017  0.0199  758 PHE A CA  
1558 C C   . PHE A 236 ? 0.2553 0.3576 0.3014 0.0515  -0.0006 0.0110  758 PHE A C   
1559 O O   . PHE A 236 ? 0.2541 0.3409 0.2933 0.0575  -0.0019 0.0033  758 PHE A O   
1560 C CB  . PHE A 236 ? 0.2675 0.4126 0.3195 0.0614  0.0051  0.0283  758 PHE A CB  
1561 C CG  . PHE A 236 ? 0.2985 0.4348 0.3407 0.0781  0.0074  0.0226  758 PHE A CG  
1562 C CD1 . PHE A 236 ? 0.3174 0.4365 0.3570 0.0810  0.0053  0.0173  758 PHE A CD1 
1563 C CD2 . PHE A 236 ? 0.3190 0.4622 0.3532 0.0912  0.0110  0.0222  758 PHE A CD2 
1564 C CE1 . PHE A 236 ? 0.3336 0.4395 0.3624 0.0962  0.0057  0.0112  758 PHE A CE1 
1565 C CE2 . PHE A 236 ? 0.3495 0.4800 0.3708 0.1078  0.0121  0.0153  758 PHE A CE2 
1566 C CZ  . PHE A 236 ? 0.3530 0.4632 0.3715 0.1100  0.0089  0.0095  758 PHE A CZ  
1567 N N   . SER A 237 ? 0.2325 0.3331 0.2829 0.0446  -0.0019 0.0131  759 SER A N   
1568 C CA  . SER A 237 ? 0.2364 0.3190 0.2856 0.0432  -0.0040 0.0076  759 SER A CA  
1569 C C   . SER A 237 ? 0.2302 0.2978 0.2787 0.0370  -0.0058 0.0013  759 SER A C   
1570 O O   . SER A 237 ? 0.2306 0.2832 0.2772 0.0395  -0.0080 -0.0036 759 SER A O   
1571 C CB  . SER A 237 ? 0.2411 0.3280 0.2946 0.0358  -0.0046 0.0125  759 SER A CB  
1572 O OG  . SER A 237 ? 0.2481 0.3488 0.3039 0.0418  -0.0035 0.0193  759 SER A OG  
1573 N N   . ALA A 238 ? 0.2289 0.3005 0.2794 0.0287  -0.0054 0.0025  760 ALA A N   
1574 C CA  . ALA A 238 ? 0.2343 0.2942 0.2852 0.0238  -0.0063 -0.0022 760 ALA A CA  
1575 C C   . ALA A 238 ? 0.2371 0.2919 0.2850 0.0297  -0.0075 -0.0062 760 ALA A C   
1576 O O   . ALA A 238 ? 0.2383 0.2806 0.2865 0.0288  -0.0096 -0.0101 760 ALA A O   
1577 C CB  . ALA A 238 ? 0.2320 0.2957 0.2843 0.0152  -0.0060 0.0000  760 ALA A CB  
1578 N N   . GLY A 239 ? 0.2559 0.3216 0.3006 0.0357  -0.0063 -0.0042 761 GLY A N   
1579 C CA  . GLY A 239 ? 0.2734 0.3348 0.3116 0.0429  -0.0075 -0.0082 761 GLY A CA  
1580 C C   . GLY A 239 ? 0.2828 0.3269 0.3151 0.0492  -0.0111 -0.0143 761 GLY A C   
1581 O O   . GLY A 239 ? 0.2908 0.3221 0.3198 0.0489  -0.0152 -0.0191 761 GLY A O   
1582 N N   . CYS A 240 ? 0.2887 0.3319 0.3197 0.0544  -0.0107 -0.0135 762 CYS A N   
1583 C CA  . CYS A 240 ? 0.3107 0.3348 0.3370 0.0591  -0.0155 -0.0183 762 CYS A CA  
1584 C C   . CYS A 240 ? 0.3024 0.3141 0.3362 0.0489  -0.0195 -0.0191 762 CYS A C   
1585 O O   . CYS A 240 ? 0.3128 0.3080 0.3437 0.0492  -0.0257 -0.0230 762 CYS A O   
1586 C CB  . CYS A 240 ? 0.3192 0.3459 0.3453 0.0655  -0.0140 -0.0154 762 CYS A CB  
1587 S SG  . CYS A 240 ? 0.3395 0.3820 0.3575 0.0809  -0.0088 -0.0129 762 CYS A SG  
1588 N N   . VAL A 241 ? 0.2945 0.3143 0.3373 0.0401  -0.0163 -0.0146 763 VAL A N   
1589 C CA  . VAL A 241 ? 0.2889 0.3012 0.3394 0.0318  -0.0181 -0.0135 763 VAL A CA  
1590 C C   . VAL A 241 ? 0.2865 0.2939 0.3387 0.0283  -0.0204 -0.0156 763 VAL A C   
1591 O O   . VAL A 241 ? 0.2801 0.2775 0.3371 0.0248  -0.0249 -0.0151 763 VAL A O   
1592 C CB  . VAL A 241 ? 0.2749 0.2971 0.3308 0.0252  -0.0133 -0.0091 763 VAL A CB  
1593 C CG1 . VAL A 241 ? 0.2718 0.2892 0.3346 0.0189  -0.0132 -0.0073 763 VAL A CG1 
1594 C CG2 . VAL A 241 ? 0.2819 0.3078 0.3375 0.0274  -0.0125 -0.0058 763 VAL A CG2 
1595 N N   . PHE A 242 ? 0.2844 0.3000 0.3340 0.0287  -0.0178 -0.0164 764 PHE A N   
1596 C CA  . PHE A 242 ? 0.2995 0.3123 0.3506 0.0259  -0.0198 -0.0177 764 PHE A CA  
1597 C C   . PHE A 242 ? 0.3215 0.3205 0.3671 0.0295  -0.0273 -0.0216 764 PHE A C   
1598 O O   . PHE A 242 ? 0.3284 0.3200 0.3798 0.0244  -0.0319 -0.0207 764 PHE A O   
1599 C CB  . PHE A 242 ? 0.3097 0.3337 0.3573 0.0272  -0.0168 -0.0172 764 PHE A CB  
1600 C CG  . PHE A 242 ? 0.3031 0.3351 0.3566 0.0206  -0.0125 -0.0136 764 PHE A CG  
1601 C CD1 . PHE A 242 ? 0.2981 0.3316 0.3543 0.0170  -0.0098 -0.0116 764 PHE A CD1 
1602 C CD2 . PHE A 242 ? 0.3157 0.3523 0.3703 0.0184  -0.0119 -0.0123 764 PHE A CD2 
1603 C CE1 . PHE A 242 ? 0.2991 0.3357 0.3569 0.0116  -0.0072 -0.0096 764 PHE A CE1 
1604 C CE2 . PHE A 242 ? 0.3105 0.3505 0.3688 0.0127  -0.0094 -0.0096 764 PHE A CE2 
1605 C CZ  . PHE A 242 ? 0.3097 0.3481 0.3685 0.0095  -0.0074 -0.0088 764 PHE A CZ  
1606 N N   . TYR A 243 ? 0.3243 0.3197 0.3582 0.0384  -0.0291 -0.0255 765 TYR A N   
1607 C CA  . TYR A 243 ? 0.3529 0.3311 0.3767 0.0429  -0.0375 -0.0309 765 TYR A CA  
1608 C C   . TYR A 243 ? 0.3559 0.3181 0.3844 0.0391  -0.0446 -0.0303 765 TYR A C   
1609 O O   . TYR A 243 ? 0.3638 0.3109 0.3906 0.0362  -0.0539 -0.0321 765 TYR A O   
1610 C CB  . TYR A 243 ? 0.3798 0.3564 0.3873 0.0562  -0.0368 -0.0357 765 TYR A CB  
1611 C CG  . TYR A 243 ? 0.4091 0.3644 0.4008 0.0624  -0.0463 -0.0430 765 TYR A CG  
1612 C CD1 . TYR A 243 ? 0.4276 0.3816 0.4118 0.0625  -0.0496 -0.0458 765 TYR A CD1 
1613 C CD2 . TYR A 243 ? 0.4314 0.3663 0.4145 0.0679  -0.0530 -0.0472 765 TYR A CD2 
1614 C CE1 . TYR A 243 ? 0.4565 0.3890 0.4231 0.0680  -0.0597 -0.0533 765 TYR A CE1 
1615 C CE2 . TYR A 243 ? 0.4708 0.3820 0.4362 0.0736  -0.0633 -0.0550 765 TYR A CE2 
1616 C CZ  . TYR A 243 ? 0.4749 0.3847 0.4314 0.0735  -0.0669 -0.0583 765 TYR A CZ  
1617 O OH  . TYR A 243 ? 0.5019 0.3858 0.4380 0.0789  -0.0787 -0.0667 765 TYR A OH  
1618 N N   . TYR A 244 ? 0.3491 0.3147 0.3833 0.0387  -0.0411 -0.0269 766 TYR A N   
1619 C CA  . TYR A 244 ? 0.3640 0.3174 0.4050 0.0342  -0.0472 -0.0240 766 TYR A CA  
1620 C C   . TYR A 244 ? 0.3533 0.3080 0.4085 0.0231  -0.0499 -0.0182 766 TYR A C   
1621 O O   . TYR A 244 ? 0.3557 0.2966 0.4143 0.0188  -0.0595 -0.0164 766 TYR A O   
1622 C CB  . TYR A 244 ? 0.3611 0.3218 0.4065 0.0353  -0.0418 -0.0199 766 TYR A CB  
1623 C CG  . TYR A 244 ? 0.3738 0.3261 0.4289 0.0295  -0.0469 -0.0143 766 TYR A CG  
1624 C CD1 . TYR A 244 ? 0.4134 0.3466 0.4634 0.0333  -0.0555 -0.0158 766 TYR A CD1 
1625 C CD2 . TYR A 244 ? 0.3615 0.3248 0.4305 0.0207  -0.0431 -0.0068 766 TYR A CD2 
1626 C CE1 . TYR A 244 ? 0.4168 0.3429 0.4773 0.0268  -0.0611 -0.0088 766 TYR A CE1 
1627 C CE2 . TYR A 244 ? 0.3773 0.3362 0.4563 0.0155  -0.0472 0.0005  766 TYR A CE2 
1628 C CZ  . TYR A 244 ? 0.4015 0.3424 0.4774 0.0178  -0.0566 0.0001  766 TYR A CZ  
1629 O OH  . TYR A 244 ? 0.4337 0.3709 0.5212 0.0115  -0.0616 0.0091  766 TYR A OH  
1630 N N   . VAL A 245 ? 0.3354 0.3061 0.3986 0.0189  -0.0419 -0.0148 767 VAL A N   
1631 C CA  . VAL A 245 ? 0.3388 0.3134 0.4155 0.0109  -0.0427 -0.0086 767 VAL A CA  
1632 C C   . VAL A 245 ? 0.3629 0.3294 0.4385 0.0087  -0.0511 -0.0101 767 VAL A C   
1633 O O   . VAL A 245 ? 0.3805 0.3410 0.4654 0.0025  -0.0589 -0.0047 767 VAL A O   
1634 C CB  . VAL A 245 ? 0.3209 0.3115 0.4029 0.0093  -0.0322 -0.0059 767 VAL A CB  
1635 C CG1 . VAL A 245 ? 0.3130 0.3082 0.4072 0.0040  -0.0321 -0.0001 767 VAL A CG1 
1636 C CG2 . VAL A 245 ? 0.3138 0.3111 0.3973 0.0094  -0.0258 -0.0031 767 VAL A CG2 
1637 N N   . ILE A 246 ? 0.3777 0.3453 0.4426 0.0133  -0.0501 -0.0161 768 ILE A N   
1638 C CA  . ILE A 246 ? 0.3868 0.3485 0.4494 0.0113  -0.0577 -0.0174 768 ILE A CA  
1639 C C   . ILE A 246 ? 0.4014 0.3418 0.4516 0.0133  -0.0708 -0.0226 768 ILE A C   
1640 O O   . ILE A 246 ? 0.4105 0.3438 0.4611 0.0087  -0.0800 -0.0218 768 ILE A O   
1641 C CB  . ILE A 246 ? 0.3863 0.3580 0.4426 0.0146  -0.0524 -0.0202 768 ILE A CB  
1642 C CG1 . ILE A 246 ? 0.4064 0.3779 0.4459 0.0244  -0.0497 -0.0270 768 ILE A CG1 
1643 C CG2 . ILE A 246 ? 0.3736 0.3612 0.4418 0.0113  -0.0424 -0.0150 768 ILE A CG2 
1644 C CD1 . ILE A 246 ? 0.4097 0.3926 0.4440 0.0272  -0.0455 -0.0278 768 ILE A CD1 
1645 N N   . SER A 247 ? 0.4062 0.3355 0.4449 0.0202  -0.0723 -0.0277 769 SER A N   
1646 C CA  . SER A 247 ? 0.4368 0.3405 0.4611 0.0231  -0.0859 -0.0335 769 SER A CA  
1647 C C   . SER A 247 ? 0.4513 0.3428 0.4878 0.0141  -0.0956 -0.0270 769 SER A C   
1648 O O   . SER A 247 ? 0.4590 0.3259 0.4856 0.0138  -0.1095 -0.0305 769 SER A O   
1649 C CB  . SER A 247 ? 0.4464 0.3420 0.4513 0.0369  -0.0831 -0.0419 769 SER A CB  
1650 O OG  . SER A 247 ? 0.4185 0.3181 0.4305 0.0383  -0.0776 -0.0385 769 SER A OG  
1651 N N   . GLU A 248 ? 0.4470 0.3555 0.5040 0.0069  -0.0886 -0.0171 770 GLU A N   
1652 C CA  . GLU A 248 ? 0.4525 0.3566 0.5245 -0.0012 -0.0947 -0.0077 770 GLU A CA  
1653 C C   . GLU A 248 ? 0.4507 0.3388 0.5142 0.0040  -0.0985 -0.0109 770 GLU A C   
1654 O O   . GLU A 248 ? 0.4772 0.3473 0.5436 -0.0013 -0.1113 -0.0072 770 GLU A O   
1655 C CB  . GLU A 248 ? 0.4800 0.3741 0.5607 -0.0117 -0.1094 -0.0015 770 GLU A CB  
1656 C CG  . GLU A 248 ? 0.4903 0.4031 0.5833 -0.0170 -0.1051 0.0043  770 GLU A CG  
1657 C CD  . GLU A 248 ? 0.5145 0.4220 0.6203 -0.0286 -0.1195 0.0137  770 GLU A CD  
1658 O OE1 . GLU A 248 ? 0.5407 0.4422 0.6583 -0.0360 -0.1280 0.0228  770 GLU A OE1 
1659 O OE2 . GLU A 248 ? 0.5400 0.4506 0.6452 -0.0308 -0.1227 0.0133  770 GLU A OE2 
1660 N N   . GLY A 249 ? 0.4382 0.3329 0.4922 0.0140  -0.0880 -0.0165 771 GLY A N   
1661 C CA  . GLY A 249 ? 0.4426 0.3277 0.4919 0.0197  -0.0886 -0.0173 771 GLY A CA  
1662 C C   . GLY A 249 ? 0.4501 0.3217 0.4775 0.0339  -0.0889 -0.0281 771 GLY A C   
1663 O O   . GLY A 249 ? 0.4743 0.3394 0.4989 0.0396  -0.0886 -0.0279 771 GLY A O   
1664 N N   . SER A 250 ? 0.4564 0.3252 0.4684 0.0407  -0.0888 -0.0365 772 SER A N   
1665 C CA  . SER A 250 ? 0.4695 0.3297 0.4597 0.0568  -0.0867 -0.0459 772 SER A CA  
1666 C C   . SER A 250 ? 0.4276 0.3155 0.4210 0.0630  -0.0710 -0.0438 772 SER A C   
1667 O O   . SER A 250 ? 0.4047 0.3138 0.4141 0.0545  -0.0632 -0.0369 772 SER A O   
1668 C CB  . SER A 250 ? 0.4887 0.3350 0.4590 0.0626  -0.0934 -0.0551 772 SER A CB  
1669 O OG  . SER A 250 ? 0.5313 0.3537 0.5009 0.0535  -0.1096 -0.0555 772 SER A OG  
1670 N N   . HIS A 251 ? 0.4309 0.3176 0.4081 0.0781  -0.0669 -0.0493 773 HIS A N   
1671 C CA  . HIS A 251 ? 0.4152 0.3282 0.3958 0.0845  -0.0535 -0.0456 773 HIS A CA  
1672 C C   . HIS A 251 ? 0.4167 0.3320 0.3780 0.0994  -0.0501 -0.0519 773 HIS A C   
1673 O O   . HIS A 251 ? 0.4522 0.3441 0.3939 0.1105  -0.0570 -0.0600 773 HIS A O   
1674 C CB  . HIS A 251 ? 0.4240 0.3356 0.4083 0.0893  -0.0517 -0.0420 773 HIS A CB  
1675 C CG  . HIS A 251 ? 0.4155 0.3558 0.4086 0.0913  -0.0397 -0.0351 773 HIS A CG  
1676 N ND1 . HIS A 251 ? 0.4141 0.3688 0.3984 0.1046  -0.0322 -0.0354 773 HIS A ND1 
1677 C CD2 . HIS A 251 ? 0.4013 0.3584 0.4106 0.0817  -0.0348 -0.0270 773 HIS A CD2 
1678 C CE1 . HIS A 251 ? 0.3959 0.3753 0.3923 0.1016  -0.0242 -0.0270 773 HIS A CE1 
1679 N NE2 . HIS A 251 ? 0.3879 0.3677 0.3981 0.0878  -0.0260 -0.0227 773 HIS A NE2 
1680 N N   . PRO A 252 ? 0.3923 0.3349 0.3579 0.0999  -0.0400 -0.0478 774 PRO A N   
1681 C CA  . PRO A 252 ? 0.4055 0.3557 0.3546 0.1139  -0.0355 -0.0513 774 PRO A CA  
1682 C C   . PRO A 252 ? 0.4291 0.3725 0.3617 0.1335  -0.0333 -0.0547 774 PRO A C   
1683 O O   . PRO A 252 ? 0.4535 0.3923 0.3662 0.1474  -0.0328 -0.0605 774 PRO A O   
1684 C CB  . PRO A 252 ? 0.3791 0.3629 0.3421 0.1088  -0.0249 -0.0421 774 PRO A CB  
1685 C CG  . PRO A 252 ? 0.3596 0.3453 0.3408 0.0907  -0.0269 -0.0383 774 PRO A CG  
1686 C CD  . PRO A 252 ? 0.3650 0.3315 0.3500 0.0872  -0.0331 -0.0395 774 PRO A CD  
1687 N N   . PHE A 253 ? 0.4401 0.3830 0.3801 0.1355  -0.0318 -0.0510 775 PHE A N   
1688 C CA  . PHE A 253 ? 0.4683 0.4081 0.3955 0.1552  -0.0281 -0.0523 775 PHE A CA  
1689 C C   . PHE A 253 ? 0.5091 0.4121 0.4244 0.1615  -0.0385 -0.0597 775 PHE A C   
1690 O O   . PHE A 253 ? 0.5269 0.4256 0.4342 0.1774  -0.0357 -0.0599 775 PHE A O   
1691 C CB  . PHE A 253 ? 0.4404 0.4118 0.3850 0.1550  -0.0176 -0.0404 775 PHE A CB  
1692 C CG  . PHE A 253 ? 0.4076 0.4131 0.3603 0.1521  -0.0085 -0.0326 775 PHE A CG  
1693 C CD1 . PHE A 253 ? 0.3759 0.3944 0.3456 0.1329  -0.0085 -0.0276 775 PHE A CD1 
1694 C CD2 . PHE A 253 ? 0.4168 0.4407 0.3594 0.1692  -0.0004 -0.0298 775 PHE A CD2 
1695 C CE1 . PHE A 253 ? 0.3601 0.4070 0.3371 0.1293  -0.0018 -0.0202 775 PHE A CE1 
1696 C CE2 . PHE A 253 ? 0.3961 0.4523 0.3479 0.1653  0.0069  -0.0207 775 PHE A CE2 
1697 C CZ  . PHE A 253 ? 0.3703 0.4364 0.3394 0.1445  0.0054  -0.0161 775 PHE A CZ  
1698 N N   . GLY A 254 ? 0.5288 0.4055 0.4431 0.1495  -0.0511 -0.0650 776 GLY A N   
1699 C CA  . GLY A 254 ? 0.5727 0.4096 0.4734 0.1541  -0.0642 -0.0725 776 GLY A CA  
1700 C C   . GLY A 254 ? 0.5759 0.4039 0.4955 0.1404  -0.0706 -0.0661 776 GLY A C   
1701 O O   . GLY A 254 ? 0.5265 0.3769 0.4693 0.1251  -0.0660 -0.0568 776 GLY A O   
1702 N N   . LYS A 255 ? 0.6378 0.4316 0.5461 0.1464  -0.0817 -0.0709 777 LYS A N   
1703 C CA  . LYS A 255 ? 0.6614 0.4446 0.5865 0.1349  -0.0889 -0.0638 777 LYS A CA  
1704 C C   . LYS A 255 ? 0.6371 0.4446 0.5761 0.1395  -0.0773 -0.0545 777 LYS A C   
1705 O O   . LYS A 255 ? 0.6276 0.4509 0.5588 0.1554  -0.0666 -0.0551 777 LYS A O   
1706 C CB  . LYS A 255 ? 0.7184 0.4549 0.6263 0.1401  -0.1060 -0.0712 777 LYS A CB  
1707 C CG  . LYS A 255 ? 0.7482 0.4587 0.6501 0.1272  -0.1224 -0.0762 777 LYS A CG  
1708 C CD  . LYS A 255 ? 0.7974 0.4788 0.6650 0.1423  -0.1298 -0.0914 777 LYS A CD  
1709 C CE  . LYS A 255 ? 0.8475 0.4864 0.6920 0.1580  -0.1407 -0.0996 777 LYS A CE  
1710 N NZ  . LYS A 255 ? 0.8873 0.4897 0.6954 0.1702  -0.1523 -0.1154 777 LYS A NZ  
1711 N N   . SER A 256 ? 0.6304 0.4422 0.5902 0.1256  -0.0798 -0.0448 778 SER A N   
1712 C CA  . SER A 256 ? 0.6257 0.4658 0.6017 0.1251  -0.0689 -0.0343 778 SER A CA  
1713 C C   . SER A 256 ? 0.6497 0.4871 0.6162 0.1450  -0.0646 -0.0345 778 SER A C   
1714 O O   . SER A 256 ? 0.6320 0.4985 0.6081 0.1482  -0.0536 -0.0268 778 SER A O   
1715 C CB  . SER A 256 ? 0.6197 0.4624 0.6168 0.1077  -0.0732 -0.0239 778 SER A CB  
1716 O OG  . SER A 256 ? 0.6430 0.4536 0.6376 0.1078  -0.0863 -0.0238 778 SER A OG  
1717 N N   . LEU A 257 ? 0.6968 0.4989 0.6432 0.1588  -0.0736 -0.0434 779 LEU A N   
1718 C CA  . LEU A 257 ? 0.7202 0.5153 0.6558 0.1801  -0.0701 -0.0441 779 LEU A CA  
1719 C C   . LEU A 257 ? 0.7204 0.5421 0.6469 0.1984  -0.0555 -0.0449 779 LEU A C   
1720 O O   . LEU A 257 ? 0.7184 0.5569 0.6496 0.2103  -0.0471 -0.0379 779 LEU A O   
1721 C CB  . LEU A 257 ? 0.7773 0.5223 0.6896 0.1915  -0.0846 -0.0551 779 LEU A CB  
1722 C CG  . LEU A 257 ? 0.8056 0.5286 0.7158 0.2029  -0.0895 -0.0523 779 LEU A CG  
1723 C CD1 . LEU A 257 ? 0.8773 0.5518 0.7550 0.2216  -0.1008 -0.0670 779 LEU A CD1 
1724 C CD2 . LEU A 257 ? 0.7814 0.5368 0.7011 0.2161  -0.0744 -0.0429 779 LEU A CD2 
1725 N N   . GLN A 258 ? 0.7585 0.5851 0.6723 0.2016  -0.0526 -0.0522 780 GLN A N   
1726 C CA  . GLN A 258 ? 0.7840 0.6371 0.6891 0.2204  -0.0388 -0.0512 780 GLN A CA  
1727 C C   . GLN A 258 ? 0.6932 0.5809 0.6079 0.2096  -0.0304 -0.0473 780 GLN A C   
1728 O O   . GLN A 258 ? 0.6727 0.5777 0.5770 0.2229  -0.0218 -0.0481 780 GLN A O   
1729 C CB  . GLN A 258 ? 0.8849 0.7082 0.7569 0.2456  -0.0415 -0.0641 780 GLN A CB  
1730 C CG  . GLN A 258 ? 0.9686 0.7615 0.8205 0.2411  -0.0529 -0.0776 780 GLN A CG  
1731 C CD  . GLN A 258 ? 1.0210 0.7642 0.8633 0.2354  -0.0717 -0.0856 780 GLN A CD  
1732 O OE1 . GLN A 258 ? 1.0320 0.7630 0.8820 0.2145  -0.0828 -0.0867 780 GLN A OE1 
1733 N NE2 . GLN A 258 ? 1.0476 0.7619 0.8734 0.2541  -0.0758 -0.0903 780 GLN A NE2 
1734 N N   . ARG A 259 ? 0.6356 0.5351 0.5710 0.1861  -0.0324 -0.0416 781 ARG A N   
1735 C CA  . ARG A 259 ? 0.6076 0.5351 0.5517 0.1752  -0.0261 -0.0383 781 ARG A CA  
1736 C C   . ARG A 259 ? 0.5681 0.5372 0.5267 0.1764  -0.0136 -0.0261 781 ARG A C   
1737 O O   . ARG A 259 ? 0.5626 0.5541 0.5207 0.1775  -0.0070 -0.0239 781 ARG A O   
1738 C CB  . ARG A 259 ? 0.5940 0.5160 0.5513 0.1517  -0.0331 -0.0382 781 ARG A CB  
1739 C CG  . ARG A 259 ? 0.5737 0.5036 0.5518 0.1370  -0.0337 -0.0292 781 ARG A CG  
1740 C CD  . ARG A 259 ? 0.5455 0.4776 0.5356 0.1166  -0.0371 -0.0280 781 ARG A CD  
1741 N NE  . ARG A 259 ? 0.5610 0.4627 0.5448 0.1113  -0.0491 -0.0348 781 ARG A NE  
1742 C CZ  . ARG A 259 ? 0.5470 0.4410 0.5435 0.0958  -0.0557 -0.0311 781 ARG A CZ  
1743 N NH1 . ARG A 259 ? 0.5211 0.4332 0.5351 0.0850  -0.0512 -0.0219 781 ARG A NH1 
1744 N NH2 . ARG A 259 ? 0.5762 0.4443 0.5674 0.0913  -0.0675 -0.0359 781 ARG A NH2 
1745 N N   . GLN A 260 ? 0.5518 0.5319 0.5237 0.1756  -0.0112 -0.0170 782 GLN A N   
1746 C CA  . GLN A 260 ? 0.5157 0.5347 0.5003 0.1779  -0.0009 -0.0044 782 GLN A CA  
1747 C C   . GLN A 260 ? 0.5242 0.5552 0.4961 0.2019  0.0072  -0.0033 782 GLN A C   
1748 O O   . GLN A 260 ? 0.5034 0.5669 0.4813 0.2032  0.0153  0.0048  782 GLN A O   
1749 C CB  . GLN A 260 ? 0.5037 0.5327 0.5046 0.1720  -0.0008 0.0058  782 GLN A CB  
1750 C CG  . GLN A 260 ? 0.4847 0.5544 0.5022 0.1653  0.0066  0.0198  782 GLN A CG  
1751 C CD  . GLN A 260 ? 0.4681 0.5505 0.4927 0.1463  0.0064  0.0203  782 GLN A CD  
1752 O OE1 . GLN A 260 ? 0.4492 0.5209 0.4792 0.1296  0.0012  0.0177  782 GLN A OE1 
1753 N NE2 . GLN A 260 ? 0.4675 0.5733 0.4923 0.1495  0.0122  0.0246  782 GLN A NE2 
1754 N N   . ALA A 261 ? 0.5517 0.5563 0.5056 0.2213  0.0048  -0.0111 783 ALA A N   
1755 C CA  . ALA A 261 ? 0.5732 0.5861 0.5107 0.2475  0.0131  -0.0116 783 ALA A CA  
1756 C C   . ALA A 261 ? 0.5670 0.5836 0.4912 0.2491  0.0152  -0.0179 783 ALA A C   
1757 O O   . ALA A 261 ? 0.5589 0.6048 0.4810 0.2616  0.0254  -0.0111 783 ALA A O   
1758 C CB  . ALA A 261 ? 0.6143 0.5904 0.5308 0.2686  0.0086  -0.0211 783 ALA A CB  
1759 N N   . ASN A 262 ? 0.5645 0.5539 0.4812 0.2359  0.0053  -0.0292 784 ASN A N   
1760 C CA  . ASN A 262 ? 0.5676 0.5611 0.4731 0.2354  0.0064  -0.0344 784 ASN A CA  
1761 C C   . ASN A 262 ? 0.5271 0.5603 0.4532 0.2204  0.0132  -0.0225 784 ASN A C   
1762 O O   . ASN A 262 ? 0.5211 0.5725 0.4407 0.2266  0.0191  -0.0207 784 ASN A O   
1763 C CB  . ASN A 262 ? 0.5909 0.5465 0.4849 0.2242  -0.0068 -0.0480 784 ASN A CB  
1764 C CG  . ASN A 262 ? 0.6273 0.5413 0.4922 0.2424  -0.0147 -0.0618 784 ASN A CG  
1765 O OD1 . ASN A 262 ? 0.6632 0.5781 0.5102 0.2668  -0.0082 -0.0636 784 ASN A OD1 
1766 N ND2 . ASN A 262 ? 0.6399 0.5172 0.4997 0.2308  -0.0291 -0.0709 784 ASN A ND2 
1767 N N   . ILE A 263 ? 0.5065 0.5525 0.4562 0.2011  0.0121  -0.0141 785 ILE A N   
1768 C CA  . ILE A 263 ? 0.4795 0.5609 0.4486 0.1866  0.0173  -0.0022 785 ILE A CA  
1769 C C   . ILE A 263 ? 0.4908 0.6095 0.4641 0.2010  0.0282  0.0111  785 ILE A C   
1770 O O   . ILE A 263 ? 0.4916 0.6341 0.4676 0.1996  0.0329  0.0172  785 ILE A O   
1771 C CB  . ILE A 263 ? 0.4537 0.5385 0.4433 0.1657  0.0134  0.0036  785 ILE A CB  
1772 C CG1 . ILE A 263 ? 0.4420 0.4990 0.4306 0.1500  0.0044  -0.0063 785 ILE A CG1 
1773 C CG2 . ILE A 263 ? 0.4325 0.5528 0.4399 0.1535  0.0181  0.0169  785 ILE A CG2 
1774 C CD1 . ILE A 263 ? 0.4302 0.4838 0.4337 0.1340  0.0006  -0.0026 785 ILE A CD1 
1775 N N   . LEU A 264 ? 0.5248 0.6497 0.4995 0.2151  0.0322  0.0168  786 LEU A N   
1776 C CA  . LEU A 264 ? 0.5510 0.7139 0.5310 0.2308  0.0431  0.0313  786 LEU A CA  
1777 C C   . LEU A 264 ? 0.5667 0.7327 0.5254 0.2529  0.0497  0.0273  786 LEU A C   
1778 O O   . LEU A 264 ? 0.5623 0.7657 0.5278 0.2596  0.0586  0.0407  786 LEU A O   
1779 C CB  . LEU A 264 ? 0.5767 0.7447 0.5618 0.2440  0.0462  0.0384  786 LEU A CB  
1780 C CG  . LEU A 264 ? 0.5837 0.7539 0.5887 0.2274  0.0412  0.0454  786 LEU A CG  
1781 C CD1 . LEU A 264 ? 0.5857 0.7895 0.6042 0.2393  0.0487  0.0628  786 LEU A CD1 
1782 C CD2 . LEU A 264 ? 0.5656 0.7450 0.5871 0.1985  0.0360  0.0490  786 LEU A CD2 
1783 N N   . LEU A 265 ? 0.5920 0.7192 0.5248 0.2640  0.0448  0.0096  787 LEU A N   
1784 C CA  . LEU A 265 ? 0.6149 0.7398 0.5225 0.2852  0.0499  0.0033  787 LEU A CA  
1785 C C   . LEU A 265 ? 0.5885 0.7193 0.4944 0.2723  0.0481  0.0012  787 LEU A C   
1786 O O   . LEU A 265 ? 0.5961 0.7316 0.4831 0.2879  0.0529  -0.0015 787 LEU A O   
1787 C CB  . LEU A 265 ? 0.6620 0.7387 0.5388 0.3026  0.0434  -0.0156 787 LEU A CB  
1788 C CG  . LEU A 265 ? 0.6850 0.7506 0.5547 0.3240  0.0461  -0.0155 787 LEU A CG  
1789 C CD1 . LEU A 265 ? 0.7195 0.7284 0.5613 0.3325  0.0344  -0.0356 787 LEU A CD1 
1790 C CD2 . LEU A 265 ? 0.6970 0.7952 0.5596 0.3528  0.0612  -0.0052 787 LEU A CD2 
1791 N N   . GLY A 266 ? 0.5748 0.7043 0.4988 0.2449  0.0411  0.0021  788 GLY A N   
1792 C CA  . GLY A 266 ? 0.5601 0.6911 0.4827 0.2322  0.0382  -0.0006 788 GLY A CA  
1793 C C   . GLY A 266 ? 0.5724 0.6640 0.4699 0.2351  0.0296  -0.0189 788 GLY A C   
1794 O O   . GLY A 266 ? 0.5682 0.6618 0.4611 0.2288  0.0280  -0.0210 788 GLY A O   
1795 N N   . ALA A 267 ? 0.5911 0.6462 0.4733 0.2433  0.0229  -0.0311 789 ALA A N   
1796 C CA  . ALA A 267 ? 0.6191 0.6334 0.4759 0.2465  0.0124  -0.0482 789 ALA A CA  
1797 C C   . ALA A 267 ? 0.6058 0.5986 0.4752 0.2208  0.0004  -0.0530 789 ALA A C   
1798 O O   . ALA A 267 ? 0.6083 0.5770 0.4814 0.2151  -0.0072 -0.0572 789 ALA A O   
1799 C CB  . ALA A 267 ? 0.6633 0.6462 0.4969 0.2679  0.0094  -0.0583 789 ALA A CB  
1800 N N   . CYS A 268 ? 0.6032 0.6065 0.4800 0.2060  -0.0010 -0.0513 790 CYS A N   
1801 C CA  . CYS A 268 ? 0.5867 0.5716 0.4740 0.1838  -0.0115 -0.0553 790 CYS A CA  
1802 C C   . CYS A 268 ? 0.5918 0.5522 0.4584 0.1845  -0.0208 -0.0665 790 CYS A C   
1803 O O   . CYS A 268 ? 0.6170 0.5781 0.4612 0.2008  -0.0181 -0.0707 790 CYS A O   
1804 C CB  . CYS A 268 ? 0.5660 0.5798 0.4800 0.1644  -0.0072 -0.0440 790 CYS A CB  
1805 S SG  . CYS A 268 ? 0.5925 0.6326 0.5051 0.1638  -0.0016 -0.0386 790 CYS A SG  
1806 N N   . SER A 269 ? 0.5656 0.5062 0.4402 0.1667  -0.0316 -0.0701 791 SER A N   
1807 C CA  . SER A 269 ? 0.5723 0.4907 0.4326 0.1623  -0.0425 -0.0787 791 SER A CA  
1808 C C   . SER A 269 ? 0.5445 0.4633 0.4282 0.1385  -0.0483 -0.0743 791 SER A C   
1809 O O   . SER A 269 ? 0.5115 0.4264 0.4126 0.1282  -0.0503 -0.0708 791 SER A O   
1810 C CB  . SER A 269 ? 0.6170 0.4935 0.4524 0.1721  -0.0549 -0.0914 791 SER A CB  
1811 O OG  . SER A 269 ? 0.6266 0.4789 0.4550 0.1609  -0.0692 -0.0977 791 SER A OG  
1812 N N   . LEU A 270 ? 0.5417 0.4658 0.4254 0.1310  -0.0509 -0.0741 792 LEU A N   
1813 C CA  . LEU A 270 ? 0.5263 0.4513 0.4306 0.1108  -0.0560 -0.0697 792 LEU A CA  
1814 C C   . LEU A 270 ? 0.5590 0.4590 0.4494 0.1069  -0.0701 -0.0769 792 LEU A C   
1815 O O   . LEU A 270 ? 0.5380 0.4463 0.4357 0.0972  -0.0720 -0.0737 792 LEU A O   
1816 C CB  . LEU A 270 ? 0.5000 0.4577 0.4221 0.1033  -0.0458 -0.0600 792 LEU A CB  
1817 C CG  . LEU A 270 ? 0.4892 0.4743 0.4232 0.1066  -0.0330 -0.0516 792 LEU A CG  
1818 C CD1 . LEU A 270 ? 0.4630 0.4756 0.4113 0.0987  -0.0260 -0.0424 792 LEU A CD1 
1819 C CD2 . LEU A 270 ? 0.4872 0.4694 0.4369 0.0996  -0.0325 -0.0487 792 LEU A CD2 
1820 N N   . ASP A 271 ? 0.6302 0.4984 0.5003 0.1146  -0.0807 -0.0863 793 ASP A N   
1821 C CA  . ASP A 271 ? 0.6871 0.5240 0.5412 0.1104  -0.0981 -0.0940 793 ASP A CA  
1822 C C   . ASP A 271 ? 0.6599 0.4997 0.5340 0.0902  -0.1058 -0.0877 793 ASP A C   
1823 O O   . ASP A 271 ? 0.7001 0.5312 0.5629 0.0873  -0.1151 -0.0908 793 ASP A O   
1824 C CB  . ASP A 271 ? 0.7507 0.5528 0.5965 0.1116  -0.1104 -0.0999 793 ASP A CB  
1825 C CG  . ASP A 271 ? 0.8091 0.5942 0.6259 0.1338  -0.1087 -0.1096 793 ASP A CG  
1826 O OD1 . ASP A 271 ? 0.8483 0.6451 0.6463 0.1494  -0.1002 -0.1133 793 ASP A OD1 
1827 O OD2 . ASP A 271 ? 0.8740 0.6345 0.6873 0.1363  -0.1157 -0.1129 793 ASP A OD2 
1828 N N   . CYS A 272 ? 0.6207 0.4721 0.5236 0.0768  -0.1027 -0.0786 794 CYS A N   
1829 C CA  . CYS A 272 ? 0.6161 0.4684 0.5390 0.0589  -0.1105 -0.0715 794 CYS A CA  
1830 C C   . CYS A 272 ? 0.5743 0.4516 0.5076 0.0535  -0.1039 -0.0658 794 CYS A C   
1831 O O   . CYS A 272 ? 0.5654 0.4451 0.5141 0.0405  -0.1099 -0.0596 794 CYS A O   
1832 C CB  . CYS A 272 ? 0.6134 0.4714 0.5622 0.0485  -0.1081 -0.0630 794 CYS A CB  
1833 S SG  . CYS A 272 ? 0.6515 0.5470 0.6260 0.0435  -0.0896 -0.0529 794 CYS A SG  
1834 N N   . LEU A 273 ? 0.5527 0.4492 0.4788 0.0635  -0.0918 -0.0664 795 LEU A N   
1835 C CA  . LEU A 273 ? 0.5309 0.4498 0.4654 0.0593  -0.0859 -0.0607 795 LEU A CA  
1836 C C   . LEU A 273 ? 0.5484 0.4608 0.4589 0.0664  -0.0922 -0.0664 795 LEU A C   
1837 O O   . LEU A 273 ? 0.5578 0.4729 0.4476 0.0811  -0.0869 -0.0714 795 LEU A O   
1838 C CB  . LEU A 273 ? 0.4935 0.4399 0.4380 0.0635  -0.0697 -0.0551 795 LEU A CB  
1839 C CG  . LEU A 273 ? 0.4667 0.4203 0.4324 0.0568  -0.0634 -0.0497 795 LEU A CG  
1840 C CD1 . LEU A 273 ? 0.4431 0.4206 0.4150 0.0609  -0.0500 -0.0448 795 LEU A CD1 
1841 C CD2 . LEU A 273 ? 0.4492 0.4052 0.4365 0.0422  -0.0661 -0.0430 795 LEU A CD2 
1842 N N   . HIS A 274 ? 0.5540 0.4603 0.4675 0.0564  -0.1027 -0.0646 796 HIS A N   
1843 C CA  . HIS A 274 ? 0.5875 0.4877 0.4781 0.0616  -0.1099 -0.0694 796 HIS A CA  
1844 C C   . HIS A 274 ? 0.5598 0.4873 0.4493 0.0680  -0.0976 -0.0650 796 HIS A C   
1845 O O   . HIS A 274 ? 0.5159 0.4664 0.4299 0.0604  -0.0884 -0.0552 796 HIS A O   
1846 C CB  . HIS A 274 ? 0.6032 0.4944 0.5023 0.0472  -0.1242 -0.0656 796 HIS A CB  
1847 C CG  . HIS A 274 ? 0.6551 0.5295 0.5253 0.0516  -0.1372 -0.0729 796 HIS A CG  
1848 N ND1 . HIS A 274 ? 0.6738 0.5637 0.5332 0.0574  -0.1326 -0.0720 796 HIS A ND1 
1849 C CD2 . HIS A 274 ? 0.6890 0.5302 0.5371 0.0508  -0.1560 -0.0815 796 HIS A CD2 
1850 C CE1 . HIS A 274 ? 0.7105 0.5791 0.5411 0.0609  -0.1469 -0.0800 796 HIS A CE1 
1851 N NE2 . HIS A 274 ? 0.7363 0.5736 0.5593 0.0567  -0.1619 -0.0863 796 HIS A NE2 
1852 N N   . PRO A 275 ? 0.5923 0.5177 0.4532 0.0822  -0.0973 -0.0713 797 PRO A N   
1853 C CA  . PRO A 275 ? 0.5780 0.5330 0.4390 0.0889  -0.0846 -0.0649 797 PRO A CA  
1854 C C   . PRO A 275 ? 0.5586 0.5280 0.4308 0.0787  -0.0868 -0.0567 797 PRO A C   
1855 O O   . PRO A 275 ? 0.5431 0.5376 0.4192 0.0819  -0.0772 -0.0493 797 PRO A O   
1856 C CB  . PRO A 275 ? 0.6267 0.5735 0.4508 0.1089  -0.0844 -0.0741 797 PRO A CB  
1857 C CG  . PRO A 275 ? 0.6645 0.5742 0.4660 0.1086  -0.1021 -0.0858 797 PRO A CG  
1858 C CD  . PRO A 275 ? 0.6543 0.5499 0.4797 0.0934  -0.1090 -0.0842 797 PRO A CD  
1859 N N   . GLU A 276 ? 0.5651 0.5199 0.4444 0.0663  -0.0996 -0.0566 798 GLU A N   
1860 C CA  . GLU A 276 ? 0.5698 0.5345 0.4563 0.0577  -0.1043 -0.0496 798 GLU A CA  
1861 C C   . GLU A 276 ? 0.5531 0.5173 0.4697 0.0409  -0.1093 -0.0420 798 GLU A C   
1862 O O   . GLU A 276 ? 0.5567 0.5205 0.4784 0.0324  -0.1184 -0.0374 798 GLU A O   
1863 C CB  . GLU A 276 ? 0.6243 0.5709 0.4789 0.0632  -0.1179 -0.0577 798 GLU A CB  
1864 C CG  . GLU A 276 ? 0.6398 0.6061 0.4834 0.0689  -0.1138 -0.0532 798 GLU A CG  
1865 C CD  . GLU A 276 ? 0.6439 0.6291 0.4754 0.0850  -0.0986 -0.0530 798 GLU A CD  
1866 O OE1 . GLU A 276 ? 0.6370 0.6490 0.4759 0.0858  -0.0900 -0.0431 798 GLU A OE1 
1867 O OE2 . GLU A 276 ? 0.6800 0.6543 0.4958 0.0968  -0.0954 -0.0613 798 GLU A OE2 
1868 N N   . LYS A 277 ? 0.5465 0.5124 0.4827 0.0370  -0.1026 -0.0398 799 LYS A N   
1869 C CA  . LYS A 277 ? 0.5393 0.5101 0.5057 0.0238  -0.1027 -0.0311 799 LYS A CA  
1870 C C   . LYS A 277 ? 0.4835 0.4765 0.4685 0.0242  -0.0867 -0.0243 799 LYS A C   
1871 O O   . LYS A 277 ? 0.4482 0.4440 0.4310 0.0301  -0.0781 -0.0271 799 LYS A O   
1872 C CB  . LYS A 277 ? 0.5954 0.5482 0.5661 0.0202  -0.1084 -0.0345 799 LYS A CB  
1873 C CG  . LYS A 277 ? 0.6300 0.5742 0.6168 0.0073  -0.1205 -0.0286 799 LYS A CG  
1874 C CD  . LYS A 277 ? 0.6895 0.6054 0.6560 0.0065  -0.1382 -0.0364 799 LYS A CD  
1875 C CE  . LYS A 277 ? 0.7083 0.6121 0.6899 -0.0022 -0.1451 -0.0330 799 LYS A CE  
1876 N NZ  . LYS A 277 ? 0.7175 0.5894 0.6772 -0.0025 -0.1635 -0.0414 799 LYS A NZ  
1877 N N   . HIS A 278 ? 0.4515 0.4588 0.4542 0.0177  -0.0839 -0.0151 800 HIS A N   
1878 C CA  . HIS A 278 ? 0.4140 0.4389 0.4322 0.0172  -0.0711 -0.0086 800 HIS A CA  
1879 C C   . HIS A 278 ? 0.4091 0.4328 0.4377 0.0167  -0.0633 -0.0096 800 HIS A C   
1880 O O   . HIS A 278 ? 0.3840 0.4161 0.4105 0.0210  -0.0547 -0.0098 800 HIS A O   
1881 C CB  . HIS A 278 ? 0.3894 0.4235 0.4262 0.0097  -0.0718 0.0012  800 HIS A CB  
1882 C CG  . HIS A 278 ? 0.3565 0.4011 0.4116 0.0074  -0.0612 0.0075  800 HIS A CG  
1883 N ND1 . HIS A 278 ? 0.3505 0.4071 0.4046 0.0100  -0.0541 0.0109  800 HIS A ND1 
1884 C CD2 . HIS A 278 ? 0.3397 0.3832 0.4130 0.0030  -0.0574 0.0112  800 HIS A CD2 
1885 C CE1 . HIS A 278 ? 0.3362 0.3955 0.4061 0.0067  -0.0476 0.0153  800 HIS A CE1 
1886 N NE2 . HIS A 278 ? 0.3310 0.3825 0.4116 0.0034  -0.0487 0.0151  800 HIS A NE2 
1887 N N   . GLU A 279 ? 0.4197 0.4340 0.4592 0.0112  -0.0670 -0.0093 801 GLU A N   
1888 C CA  . GLU A 279 ? 0.4293 0.4425 0.4784 0.0104  -0.0602 -0.0096 801 GLU A CA  
1889 C C   . GLU A 279 ? 0.4189 0.4252 0.4524 0.0175  -0.0589 -0.0173 801 GLU A C   
1890 O O   . GLU A 279 ? 0.3974 0.4087 0.4345 0.0192  -0.0509 -0.0173 801 GLU A O   
1891 C CB  . GLU A 279 ? 0.4603 0.4676 0.5251 0.0033  -0.0645 -0.0054 801 GLU A CB  
1892 C CG  . GLU A 279 ? 0.5080 0.5218 0.5882 -0.0028 -0.0679 0.0033  801 GLU A CG  
1893 C CD  . GLU A 279 ? 0.5629 0.5697 0.6353 -0.0057 -0.0816 0.0032  801 GLU A CD  
1894 O OE1 . GLU A 279 ? 0.5867 0.6012 0.6615 -0.0072 -0.0836 0.0078  801 GLU A OE1 
1895 O OE2 . GLU A 279 ? 0.6112 0.6033 0.6737 -0.0067 -0.0913 -0.0016 801 GLU A OE2 
1896 N N   . ASP A 280 ? 0.4346 0.4284 0.4498 0.0221  -0.0674 -0.0239 802 ASP A N   
1897 C CA  . ASP A 280 ? 0.4310 0.4171 0.4290 0.0316  -0.0663 -0.0315 802 ASP A CA  
1898 C C   . ASP A 280 ? 0.4071 0.4086 0.3951 0.0407  -0.0572 -0.0315 802 ASP A C   
1899 O O   . ASP A 280 ? 0.4040 0.4090 0.3882 0.0470  -0.0510 -0.0332 802 ASP A O   
1900 C CB  . ASP A 280 ? 0.4640 0.4282 0.4419 0.0353  -0.0791 -0.0395 802 ASP A CB  
1901 C CG  . ASP A 280 ? 0.4617 0.4095 0.4494 0.0259  -0.0896 -0.0384 802 ASP A CG  
1902 O OD1 . ASP A 280 ? 0.4609 0.4164 0.4710 0.0178  -0.0858 -0.0312 802 ASP A OD1 
1903 O OD2 . ASP A 280 ? 0.4989 0.4258 0.4710 0.0269  -0.1024 -0.0443 802 ASP A OD2 
1904 N N   . VAL A 281 ? 0.3933 0.4055 0.3783 0.0412  -0.0569 -0.0281 803 VAL A N   
1905 C CA  . VAL A 281 ? 0.3867 0.4175 0.3653 0.0486  -0.0487 -0.0248 803 VAL A CA  
1906 C C   . VAL A 281 ? 0.3606 0.4069 0.3578 0.0435  -0.0393 -0.0173 803 VAL A C   
1907 O O   . VAL A 281 ? 0.3486 0.4073 0.3432 0.0491  -0.0324 -0.0151 803 VAL A O   
1908 C CB  . VAL A 281 ? 0.3920 0.4313 0.3646 0.0489  -0.0514 -0.0212 803 VAL A CB  
1909 C CG1 . VAL A 281 ? 0.3759 0.4387 0.3470 0.0544  -0.0425 -0.0141 803 VAL A CG1 
1910 C CG2 . VAL A 281 ? 0.4420 0.4649 0.3904 0.0555  -0.0614 -0.0297 803 VAL A CG2 
1911 N N   . ILE A 282 ? 0.3560 0.4016 0.3713 0.0333  -0.0394 -0.0129 804 ILE A N   
1912 C CA  . ILE A 282 ? 0.3548 0.4096 0.3851 0.0281  -0.0322 -0.0073 804 ILE A CA  
1913 C C   . ILE A 282 ? 0.3431 0.3931 0.3733 0.0299  -0.0292 -0.0109 804 ILE A C   
1914 O O   . ILE A 282 ? 0.3437 0.4038 0.3764 0.0305  -0.0236 -0.0077 804 ILE A O   
1915 C CB  . ILE A 282 ? 0.3579 0.4095 0.4048 0.0192  -0.0329 -0.0030 804 ILE A CB  
1916 C CG1 . ILE A 282 ? 0.3681 0.4273 0.4176 0.0172  -0.0349 0.0027  804 ILE A CG1 
1917 C CG2 . ILE A 282 ? 0.3709 0.4249 0.4287 0.0149  -0.0268 0.0000  804 ILE A CG2 
1918 C CD1 . ILE A 282 ? 0.3822 0.4567 0.4328 0.0175  -0.0302 0.0095  804 ILE A CD1 
1919 N N   . ALA A 283 ? 0.3447 0.3796 0.3725 0.0300  -0.0339 -0.0165 805 ALA A N   
1920 C CA  . ALA A 283 ? 0.3358 0.3653 0.3634 0.0318  -0.0319 -0.0195 805 ALA A CA  
1921 C C   . ALA A 283 ? 0.3256 0.3612 0.3402 0.0418  -0.0287 -0.0216 805 ALA A C   
1922 O O   . ALA A 283 ? 0.2983 0.3416 0.3167 0.0426  -0.0234 -0.0192 805 ALA A O   
1923 C CB  . ALA A 283 ? 0.3558 0.3677 0.3829 0.0300  -0.0392 -0.0238 805 ALA A CB  
1924 N N   . ARG A 284 ? 0.3510 0.3832 0.3495 0.0500  -0.0323 -0.0256 806 ARG A N   
1925 C CA  . ARG A 284 ? 0.3550 0.3934 0.3382 0.0631  -0.0286 -0.0275 806 ARG A CA  
1926 C C   . ARG A 284 ? 0.3371 0.4007 0.3267 0.0642  -0.0201 -0.0186 806 ARG A C   
1927 O O   . ARG A 284 ? 0.3253 0.3983 0.3139 0.0703  -0.0150 -0.0164 806 ARG A O   
1928 C CB  . ARG A 284 ? 0.3797 0.4105 0.3420 0.0723  -0.0338 -0.0332 806 ARG A CB  
1929 C CG  . ARG A 284 ? 0.4015 0.4382 0.3448 0.0889  -0.0292 -0.0356 806 ARG A CG  
1930 C CD  . ARG A 284 ? 0.4232 0.4507 0.3424 0.0988  -0.0346 -0.0420 806 ARG A CD  
1931 N NE  . ARG A 284 ? 0.4493 0.4450 0.3545 0.0999  -0.0460 -0.0530 806 ARG A NE  
1932 C CZ  . ARG A 284 ? 0.4630 0.4409 0.3519 0.1111  -0.0483 -0.0611 806 ARG A CZ  
1933 N NH1 . ARG A 284 ? 0.4796 0.4263 0.3566 0.1096  -0.0611 -0.0702 806 ARG A NH1 
1934 N NH2 . ARG A 284 ? 0.4616 0.4523 0.3467 0.1236  -0.0386 -0.0592 806 ARG A NH2 
1935 N N   . GLU A 285 ? 0.3419 0.4168 0.3393 0.0578  -0.0194 -0.0122 807 GLU A N   
1936 C CA  . GLU A 285 ? 0.3482 0.4471 0.3525 0.0572  -0.0133 -0.0017 807 GLU A CA  
1937 C C   . GLU A 285 ? 0.3220 0.4259 0.3397 0.0507  -0.0099 0.0026  807 GLU A C   
1938 O O   . GLU A 285 ? 0.3060 0.4273 0.3256 0.0539  -0.0054 0.0095  807 GLU A O   
1939 C CB  . GLU A 285 ? 0.3800 0.4850 0.3921 0.0494  -0.0149 0.0043  807 GLU A CB  
1940 C CG  . GLU A 285 ? 0.4202 0.5504 0.4358 0.0504  -0.0106 0.0161  807 GLU A CG  
1941 C CD  . GLU A 285 ? 0.4333 0.5755 0.4649 0.0417  -0.0078 0.0256  807 GLU A CD  
1942 O OE1 . GLU A 285 ? 0.4592 0.6240 0.4921 0.0454  -0.0038 0.0355  807 GLU A OE1 
1943 O OE2 . GLU A 285 ? 0.4003 0.5301 0.4425 0.0315  -0.0098 0.0240  807 GLU A OE2 
1944 N N   . LEU A 286 ? 0.3129 0.4022 0.3395 0.0417  -0.0124 -0.0008 808 LEU A N   
1945 C CA  . LEU A 286 ? 0.3072 0.3978 0.3431 0.0357  -0.0102 0.0018  808 LEU A CA  
1946 C C   . LEU A 286 ? 0.3032 0.3927 0.3333 0.0431  -0.0085 -0.0013 808 LEU A C   
1947 O O   . LEU A 286 ? 0.2892 0.3926 0.3229 0.0437  -0.0051 0.0047  808 LEU A O   
1948 C CB  . LEU A 286 ? 0.3099 0.3851 0.3542 0.0265  -0.0124 -0.0013 808 LEU A CB  
1949 C CG  . LEU A 286 ? 0.2962 0.3678 0.3462 0.0212  -0.0108 -0.0010 808 LEU A CG  
1950 C CD1 . LEU A 286 ? 0.3063 0.3913 0.3610 0.0164  -0.0094 0.0069  808 LEU A CD1 
1951 C CD2 . LEU A 286 ? 0.3018 0.3593 0.3576 0.0152  -0.0119 -0.0039 808 LEU A CD2 
1952 N N   . ILE A 287 ? 0.3023 0.3752 0.3244 0.0481  -0.0116 -0.0097 809 ILE A N   
1953 C CA  . ILE A 287 ? 0.3119 0.3794 0.3297 0.0542  -0.0109 -0.0128 809 ILE A CA  
1954 C C   . ILE A 287 ? 0.3188 0.4011 0.3280 0.0668  -0.0065 -0.0099 809 ILE A C   
1955 O O   . ILE A 287 ? 0.3069 0.3967 0.3193 0.0693  -0.0035 -0.0065 809 ILE A O   
1956 C CB  . ILE A 287 ? 0.3179 0.3622 0.3295 0.0559  -0.0170 -0.0215 809 ILE A CB  
1957 C CG1 . ILE A 287 ? 0.3082 0.3434 0.3322 0.0440  -0.0193 -0.0212 809 ILE A CG1 
1958 C CG2 . ILE A 287 ? 0.3266 0.3641 0.3314 0.0643  -0.0170 -0.0245 809 ILE A CG2 
1959 C CD1 . ILE A 287 ? 0.3126 0.3283 0.3346 0.0425  -0.0266 -0.0263 809 ILE A CD1 
1960 N N   . GLU A 288 ? 0.3520 0.4402 0.3504 0.0754  -0.0058 -0.0101 810 GLU A N   
1961 C CA  . GLU A 288 ? 0.3788 0.4827 0.3677 0.0901  -0.0003 -0.0067 810 GLU A CA  
1962 C C   . GLU A 288 ? 0.3543 0.4873 0.3574 0.0863  0.0055  0.0071  810 GLU A C   
1963 O O   . GLU A 288 ? 0.3439 0.4921 0.3458 0.0960  0.0105  0.0125  810 GLU A O   
1964 C CB  . GLU A 288 ? 0.4110 0.5139 0.3816 0.1019  -0.0008 -0.0106 810 GLU A CB  
1965 C CG  . GLU A 288 ? 0.4413 0.5627 0.4166 0.0972  0.0010  -0.0024 810 GLU A CG  
1966 C CD  . GLU A 288 ? 0.4775 0.5943 0.4331 0.1074  -0.0010 -0.0076 810 GLU A CD  
1967 O OE1 . GLU A 288 ? 0.4865 0.5823 0.4223 0.1182  -0.0048 -0.0189 810 GLU A OE1 
1968 O OE2 . GLU A 288 ? 0.4711 0.6043 0.4304 0.1041  0.0005  0.0001  810 GLU A OE2 
1969 N N   . LYS A 289 ? 0.3357 0.4746 0.3525 0.0717  0.0040  0.0131  811 LYS A N   
1970 C CA  . LYS A 289 ? 0.3335 0.4950 0.3645 0.0643  0.0063  0.0262  811 LYS A CA  
1971 C C   . LYS A 289 ? 0.3069 0.4636 0.3461 0.0574  0.0052  0.0265  811 LYS A C   
1972 O O   . LYS A 289 ? 0.2865 0.4620 0.3324 0.0578  0.0075  0.0360  811 LYS A O   
1973 C CB  . LYS A 289 ? 0.3443 0.5108 0.3848 0.0518  0.0037  0.0325  811 LYS A CB  
1974 C CG  . LYS A 289 ? 0.3703 0.5578 0.4080 0.0583  0.0066  0.0408  811 LYS A CG  
1975 C CD  . LYS A 289 ? 0.3993 0.5845 0.4425 0.0482  0.0031  0.0437  811 LYS A CD  
1976 C CE  . LYS A 289 ? 0.4332 0.6404 0.4716 0.0565  0.0064  0.0523  811 LYS A CE  
1977 N NZ  . LYS A 289 ? 0.4324 0.6479 0.4820 0.0450  0.0034  0.0623  811 LYS A NZ  
1978 N N   . MET A 290 ? 0.2933 0.4264 0.3319 0.0513  0.0016  0.0170  812 MET A N   
1979 C CA  . MET A 290 ? 0.2802 0.4073 0.3240 0.0456  0.0005  0.0164  812 MET A CA  
1980 C C   . MET A 290 ? 0.2846 0.4161 0.3241 0.0570  0.0033  0.0165  812 MET A C   
1981 O O   . MET A 290 ? 0.2768 0.4154 0.3225 0.0536  0.0036  0.0216  812 MET A O   
1982 C CB  . MET A 290 ? 0.2806 0.3835 0.3237 0.0395  -0.0028 0.0071  812 MET A CB  
1983 C CG  . MET A 290 ? 0.2787 0.3754 0.3266 0.0292  -0.0050 0.0068  812 MET A CG  
1984 S SD  . MET A 290 ? 0.2632 0.3364 0.3120 0.0240  -0.0074 -0.0016 812 MET A SD  
1985 C CE  . MET A 290 ? 0.2668 0.3389 0.3189 0.0185  -0.0067 0.0001  812 MET A CE  
1986 N N   . ILE A 291 ? 0.2996 0.4253 0.3271 0.0709  0.0046  0.0107  813 ILE A N   
1987 C CA  . ILE A 291 ? 0.3120 0.4384 0.3332 0.0841  0.0071  0.0098  813 ILE A CA  
1988 C C   . ILE A 291 ? 0.3201 0.4704 0.3370 0.0983  0.0133  0.0176  813 ILE A C   
1989 O O   . ILE A 291 ? 0.3339 0.4828 0.3411 0.1141  0.0162  0.0154  813 ILE A O   
1990 C CB  . ILE A 291 ? 0.3275 0.4255 0.3356 0.0915  0.0032  -0.0029 813 ILE A CB  
1991 C CG1 . ILE A 291 ? 0.3394 0.4303 0.3322 0.1013  0.0023  -0.0091 813 ILE A CG1 
1992 C CG2 . ILE A 291 ? 0.3185 0.3969 0.3330 0.0781  -0.0022 -0.0080 813 ILE A CG2 
1993 C CD1 . ILE A 291 ? 0.3568 0.4169 0.3362 0.1061  -0.0044 -0.0213 813 ILE A CD1 
1994 N N   . ALA A 292 ? 0.3192 0.4916 0.3435 0.0933  0.0154  0.0276  814 ALA A N   
1995 C CA  . ALA A 292 ? 0.3346 0.5362 0.3582 0.1058  0.0220  0.0388  814 ALA A CA  
1996 C C   . ALA A 292 ? 0.3416 0.5599 0.3712 0.1135  0.0261  0.0472  814 ALA A C   
1997 O O   . ALA A 292 ? 0.3113 0.5294 0.3524 0.1025  0.0232  0.0507  814 ALA A O   
1998 C CB  . ALA A 292 ? 0.3212 0.5460 0.3573 0.0949  0.0221  0.0517  814 ALA A CB  
1999 N N   . MET A 293 ? 0.3930 0.6265 0.4137 0.1334  0.0332  0.0510  815 MET A N   
2000 C CA  . MET A 293 ? 0.4195 0.6713 0.4454 0.1442  0.0383  0.0601  815 MET A CA  
2001 C C   . MET A 293 ? 0.3781 0.6663 0.4263 0.1330  0.0393  0.0806  815 MET A C   
2002 O O   . MET A 293 ? 0.3465 0.6438 0.4065 0.1285  0.0382  0.0881  815 MET A O   
2003 C CB  . MET A 293 ? 0.4808 0.7381 0.4890 0.1711  0.0463  0.0584  815 MET A CB  
2004 C CG  . MET A 293 ? 0.5687 0.8122 0.5699 0.1850  0.0476  0.0529  815 MET A CG  
2005 S SD  . MET A 293 ? 0.6522 0.8418 0.6351 0.1832  0.0384  0.0291  815 MET A SD  
2006 C CE  . MET A 293 ? 0.6678 0.8445 0.6692 0.1578  0.0301  0.0284  815 MET A CE  
2007 N N   . ASP A 294 ? 0.3728 0.6805 0.4268 0.1274  0.0400  0.0901  816 ASP A N   
2008 C CA  . ASP A 294 ? 0.3596 0.6989 0.4354 0.1132  0.0382  0.1101  816 ASP A CA  
2009 C C   . ASP A 294 ? 0.3384 0.6574 0.4223 0.0888  0.0280  0.1056  816 ASP A C   
2010 O O   . ASP A 294 ? 0.3103 0.6103 0.3891 0.0807  0.0242  0.0966  816 ASP A O   
2011 C CB  . ASP A 294 ? 0.3785 0.7441 0.4572 0.1157  0.0419  0.1223  816 ASP A CB  
2012 C CG  . ASP A 294 ? 0.3898 0.7914 0.4928 0.1015  0.0392  0.1465  816 ASP A CG  
2013 O OD1 . ASP A 294 ? 0.3823 0.7856 0.4987 0.0876  0.0330  0.1525  816 ASP A OD1 
2014 O OD2 . ASP A 294 ? 0.4139 0.8425 0.5224 0.1036  0.0425  0.1603  816 ASP A OD2 
2015 N N   . PRO A 295 ? 0.3364 0.6596 0.4323 0.0780  0.0234  0.1120  817 PRO A N   
2016 C CA  . PRO A 295 ? 0.3299 0.6315 0.4297 0.0570  0.0140  0.1065  817 PRO A CA  
2017 C C   . PRO A 295 ? 0.3314 0.6359 0.4386 0.0407  0.0080  0.1129  817 PRO A C   
2018 O O   . PRO A 295 ? 0.3083 0.5864 0.4115 0.0286  0.0021  0.1024  817 PRO A O   
2019 C CB  . PRO A 295 ? 0.3294 0.6450 0.4409 0.0505  0.0107  0.1174  817 PRO A CB  
2020 C CG  . PRO A 295 ? 0.3298 0.6632 0.4400 0.0710  0.0193  0.1221  817 PRO A CG  
2021 C CD  . PRO A 295 ? 0.3308 0.6808 0.4366 0.0853  0.0269  0.1261  817 PRO A CD  
2022 N N   . GLN A 296 ? 0.3642 0.7010 0.4824 0.0409  0.0096  0.1308  818 GLN A N   
2023 C CA  . GLN A 296 ? 0.4006 0.7407 0.5275 0.0246  0.0027  0.1391  818 GLN A CA  
2024 C C   . GLN A 296 ? 0.3814 0.7040 0.4978 0.0272  0.0043  0.1279  818 GLN A C   
2025 O O   . GLN A 296 ? 0.3859 0.7021 0.5074 0.0132  -0.0022 0.1309  818 GLN A O   
2026 C CB  . GLN A 296 ? 0.4587 0.8418 0.6034 0.0227  0.0032  0.1649  818 GLN A CB  
2027 C CG  . GLN A 296 ? 0.4931 0.8904 0.6533 0.0083  -0.0050 0.1796  818 GLN A CG  
2028 C CD  . GLN A 296 ? 0.5232 0.9664 0.7038 0.0060  -0.0050 0.2078  818 GLN A CD  
2029 O OE1 . GLN A 296 ? 0.5528 1.0262 0.7355 0.0246  0.0061  0.2173  818 GLN A OE1 
2030 N NE2 . GLN A 296 ? 0.5325 0.9807 0.7274 -0.0163 -0.0178 0.2219  818 GLN A NE2 
2031 N N   . LYS A 297 ? 0.3752 0.6882 0.4766 0.0447  0.0118  0.1151  819 LYS A N   
2032 C CA  . LYS A 297 ? 0.3806 0.6755 0.4708 0.0474  0.0124  0.1037  819 LYS A CA  
2033 C C   . LYS A 297 ? 0.3474 0.6041 0.4297 0.0398  0.0075  0.0854  819 LYS A C   
2034 O O   . LYS A 297 ? 0.3398 0.5812 0.4158 0.0389  0.0064  0.0774  819 LYS A O   
2035 C CB  . LYS A 297 ? 0.4202 0.7211 0.4955 0.0695  0.0212  0.0986  819 LYS A CB  
2036 C CG  . LYS A 297 ? 0.4579 0.7959 0.5377 0.0782  0.0272  0.1160  819 LYS A CG  
2037 C CD  . LYS A 297 ? 0.5153 0.8521 0.5745 0.1002  0.0349  0.1075  819 LYS A CD  
2038 C CE  . LYS A 297 ? 0.5717 0.9455 0.6311 0.1187  0.0448  0.1223  819 LYS A CE  
2039 N NZ  . LYS A 297 ? 0.6233 0.9866 0.6570 0.1432  0.0518  0.1093  819 LYS A NZ  
2040 N N   . ARG A 298 ? 0.3312 0.5747 0.4145 0.0347  0.0047  0.0802  820 ARG A N   
2041 C CA  . ARG A 298 ? 0.3134 0.5241 0.3903 0.0283  0.0009  0.0649  820 ARG A CA  
2042 C C   . ARG A 298 ? 0.2966 0.4969 0.3799 0.0107  -0.0063 0.0669  820 ARG A C   
2043 O O   . ARG A 298 ? 0.2906 0.5027 0.3831 0.0005  -0.0109 0.0781  820 ARG A O   
2044 C CB  . ARG A 298 ? 0.3087 0.5109 0.3834 0.0307  0.0012  0.0597  820 ARG A CB  
2045 C CG  . ARG A 298 ? 0.3101 0.5185 0.3776 0.0488  0.0074  0.0572  820 ARG A CG  
2046 C CD  . ARG A 298 ? 0.3077 0.5085 0.3749 0.0502  0.0070  0.0540  820 ARG A CD  
2047 N NE  . ARG A 298 ? 0.3127 0.5288 0.3775 0.0668  0.0128  0.0583  820 ARG A NE  
2048 C CZ  . ARG A 298 ? 0.3001 0.5234 0.3693 0.0694  0.0134  0.0631  820 ARG A CZ  
2049 N NH1 . ARG A 298 ? 0.2824 0.4985 0.3575 0.0558  0.0082  0.0636  820 ARG A NH1 
2050 N NH2 . ARG A 298 ? 0.3032 0.5410 0.3699 0.0868  0.0195  0.0676  820 ARG A NH2 
2051 N N   . PRO A 299 ? 0.2913 0.4683 0.3693 0.0073  -0.0081 0.0562  821 PRO A N   
2052 C CA  . PRO A 299 ? 0.2868 0.4504 0.3685 -0.0069 -0.0145 0.0568  821 PRO A CA  
2053 C C   . PRO A 299 ? 0.2892 0.4374 0.3686 -0.0144 -0.0182 0.0520  821 PRO A C   
2054 O O   . PRO A 299 ? 0.2866 0.4283 0.3610 -0.0084 -0.0152 0.0448  821 PRO A O   
2055 C CB  . PRO A 299 ? 0.2825 0.4276 0.3587 -0.0044 -0.0133 0.0464  821 PRO A CB  
2056 C CG  . PRO A 299 ? 0.2862 0.4245 0.3545 0.0071  -0.0088 0.0364  821 PRO A CG  
2057 C CD  . PRO A 299 ? 0.2883 0.4480 0.3565 0.0164  -0.0050 0.0428  821 PRO A CD  
2058 N N   . SER A 300 ? 0.2891 0.4303 0.3709 -0.0273 -0.0253 0.0562  822 SER A N   
2059 C CA  . SER A 300 ? 0.2940 0.4169 0.3695 -0.0338 -0.0292 0.0501  822 SER A CA  
2060 C C   . SER A 300 ? 0.2901 0.3880 0.3570 -0.0301 -0.0262 0.0359  822 SER A C   
2061 O O   . SER A 300 ? 0.2758 0.3693 0.3432 -0.0258 -0.0233 0.0323  822 SER A O   
2062 C CB  . SER A 300 ? 0.3038 0.4208 0.3806 -0.0484 -0.0393 0.0570  822 SER A CB  
2063 O OG  . SER A 300 ? 0.3139 0.4132 0.3883 -0.0521 -0.0418 0.0532  822 SER A OG  
2064 N N   . ALA A 301 ? 0.2908 0.3746 0.3504 -0.0316 -0.0268 0.0293  823 ALA A N   
2065 C CA  . ALA A 301 ? 0.3103 0.3734 0.3628 -0.0280 -0.0235 0.0181  823 ALA A CA  
2066 C C   . ALA A 301 ? 0.3259 0.3740 0.3769 -0.0310 -0.0252 0.0156  823 ALA A C   
2067 O O   . ALA A 301 ? 0.3196 0.3602 0.3707 -0.0251 -0.0208 0.0099  823 ALA A O   
2068 C CB  . ALA A 301 ? 0.3119 0.3637 0.3556 -0.0303 -0.0246 0.0137  823 ALA A CB  
2069 N N   . LYS A 302 ? 0.3448 0.3885 0.3952 -0.0402 -0.0325 0.0208  824 LYS A N   
2070 C CA  . LYS A 302 ? 0.3643 0.3919 0.4131 -0.0429 -0.0350 0.0191  824 LYS A CA  
2071 C C   . LYS A 302 ? 0.3419 0.3813 0.4006 -0.0396 -0.0325 0.0235  824 LYS A C   
2072 O O   . LYS A 302 ? 0.3272 0.3545 0.3855 -0.0368 -0.0308 0.0196  824 LYS A O   
2073 C CB  . LYS A 302 ? 0.4004 0.4158 0.4443 -0.0544 -0.0454 0.0232  824 LYS A CB  
2074 C CG  . LYS A 302 ? 0.4433 0.4362 0.4712 -0.0555 -0.0476 0.0144  824 LYS A CG  
2075 C CD  . LYS A 302 ? 0.4971 0.4721 0.5160 -0.0672 -0.0600 0.0168  824 LYS A CD  
2076 C CE  . LYS A 302 ? 0.5396 0.4869 0.5378 -0.0651 -0.0611 0.0054  824 LYS A CE  
2077 N NZ  . LYS A 302 ? 0.5862 0.5172 0.5728 -0.0775 -0.0752 0.0077  824 LYS A NZ  
2078 N N   . HIS A 303 ? 0.3293 0.3928 0.3961 -0.0387 -0.0318 0.0321  825 HIS A N   
2079 C CA  . HIS A 303 ? 0.3338 0.4104 0.4071 -0.0334 -0.0285 0.0357  825 HIS A CA  
2080 C C   . HIS A 303 ? 0.2914 0.3622 0.3615 -0.0234 -0.0220 0.0260  825 HIS A C   
2081 O O   . HIS A 303 ? 0.2545 0.3209 0.3263 -0.0209 -0.0208 0.0243  825 HIS A O   
2082 C CB  . HIS A 303 ? 0.3551 0.4603 0.4352 -0.0317 -0.0276 0.0468  825 HIS A CB  
2083 C CG  . HIS A 303 ? 0.4004 0.5170 0.4880 -0.0425 -0.0348 0.0606  825 HIS A CG  
2084 N ND1 . HIS A 303 ? 0.4225 0.5462 0.5118 -0.0492 -0.0394 0.0669  825 HIS A ND1 
2085 C CD2 . HIS A 303 ? 0.4218 0.5454 0.5169 -0.0486 -0.0391 0.0710  825 HIS A CD2 
2086 C CE1 . HIS A 303 ? 0.4224 0.5566 0.5205 -0.0596 -0.0468 0.0809  825 HIS A CE1 
2087 N NE2 . HIS A 303 ? 0.4166 0.5508 0.5184 -0.0594 -0.0466 0.0837  825 HIS A NE2 
2088 N N   . VAL A 304 ? 0.2913 0.3617 0.3575 -0.0187 -0.0188 0.0205  826 VAL A N   
2089 C CA  . VAL A 304 ? 0.2770 0.3411 0.3410 -0.0107 -0.0143 0.0125  826 VAL A CA  
2090 C C   . VAL A 304 ? 0.2769 0.3228 0.3400 -0.0114 -0.0136 0.0069  826 VAL A C   
2091 O O   . VAL A 304 ? 0.2519 0.2955 0.3174 -0.0072 -0.0120 0.0044  826 VAL A O   
2092 C CB  . VAL A 304 ? 0.2748 0.3401 0.3354 -0.0069 -0.0122 0.0091  826 VAL A CB  
2093 C CG1 . VAL A 304 ? 0.2727 0.3301 0.3321 -0.0005 -0.0096 0.0023  826 VAL A CG1 
2094 C CG2 . VAL A 304 ? 0.2825 0.3667 0.3443 -0.0034 -0.0117 0.0149  826 VAL A CG2 
2095 N N   . LEU A 305 ? 0.2987 0.3319 0.3578 -0.0162 -0.0153 0.0054  827 LEU A N   
2096 C CA  . LEU A 305 ? 0.3133 0.3297 0.3703 -0.0149 -0.0136 0.0008  827 LEU A CA  
2097 C C   . LEU A 305 ? 0.3229 0.3373 0.3854 -0.0152 -0.0148 0.0037  827 LEU A C   
2098 O O   . LEU A 305 ? 0.3055 0.3117 0.3699 -0.0113 -0.0120 0.0012  827 LEU A O   
2099 C CB  . LEU A 305 ? 0.3213 0.3224 0.3689 -0.0188 -0.0158 -0.0018 827 LEU A CB  
2100 C CG  . LEU A 305 ? 0.3400 0.3390 0.3809 -0.0170 -0.0134 -0.0058 827 LEU A CG  
2101 C CD1 . LEU A 305 ? 0.3785 0.3619 0.4068 -0.0218 -0.0176 -0.0081 827 LEU A CD1 
2102 C CD2 . LEU A 305 ? 0.3412 0.3369 0.3835 -0.0096 -0.0069 -0.0099 827 LEU A CD2 
2103 N N   . LYS A 306 ? 0.3176 0.3417 0.3837 -0.0198 -0.0189 0.0106  828 LYS A N   
2104 C CA  . LYS A 306 ? 0.3109 0.3353 0.3827 -0.0209 -0.0207 0.0152  828 LYS A CA  
2105 C C   . LYS A 306 ? 0.2778 0.3161 0.3548 -0.0159 -0.0186 0.0171  828 LYS A C   
2106 O O   . LYS A 306 ? 0.2692 0.3069 0.3509 -0.0159 -0.0196 0.0202  828 LYS A O   
2107 C CB  . LYS A 306 ? 0.3331 0.3606 0.4067 -0.0294 -0.0271 0.0236  828 LYS A CB  
2108 C CG  . LYS A 306 ? 0.3535 0.3598 0.4199 -0.0353 -0.0320 0.0214  828 LYS A CG  
2109 C CD  . LYS A 306 ? 0.3674 0.3532 0.4321 -0.0331 -0.0321 0.0182  828 LYS A CD  
2110 C CE  . LYS A 306 ? 0.4009 0.3618 0.4546 -0.0379 -0.0380 0.0151  828 LYS A CE  
2111 N NZ  . LYS A 306 ? 0.4228 0.3626 0.4740 -0.0338 -0.0378 0.0124  828 LYS A NZ  
2112 N N   . HIS A 307 ? 0.2617 0.3103 0.3367 -0.0113 -0.0163 0.0147  829 HIS A N   
2113 C CA  . HIS A 307 ? 0.2505 0.3095 0.3259 -0.0058 -0.0156 0.0150  829 HIS A CA  
2114 C C   . HIS A 307 ? 0.2525 0.3029 0.3309 -0.0032 -0.0153 0.0116  829 HIS A C   
2115 O O   . HIS A 307 ? 0.2500 0.2891 0.3298 -0.0030 -0.0136 0.0077  829 HIS A O   
2116 C CB  . HIS A 307 ? 0.2524 0.3182 0.3224 -0.0005 -0.0139 0.0115  829 HIS A CB  
2117 C CG  . HIS A 307 ? 0.2394 0.3167 0.3051 0.0058  -0.0140 0.0125  829 HIS A CG  
2118 N ND1 . HIS A 307 ? 0.2341 0.3058 0.2968 0.0102  -0.0154 0.0078  829 HIS A ND1 
2119 C CD2 . HIS A 307 ? 0.2401 0.3344 0.3030 0.0092  -0.0132 0.0180  829 HIS A CD2 
2120 C CE1 . HIS A 307 ? 0.2405 0.3223 0.2959 0.0163  -0.0158 0.0089  829 HIS A CE1 
2121 N NE2 . HIS A 307 ? 0.2458 0.3426 0.3013 0.0168  -0.0135 0.0152  829 HIS A NE2 
2122 N N   . PRO A 308 ? 0.2560 0.3133 0.3354 -0.0011 -0.0170 0.0141  830 PRO A N   
2123 C CA  . PRO A 308 ? 0.2678 0.3191 0.3516 0.0002  -0.0181 0.0128  830 PRO A CA  
2124 C C   . PRO A 308 ? 0.2786 0.3238 0.3614 0.0031  -0.0182 0.0071  830 PRO A C   
2125 O O   . PRO A 308 ? 0.2774 0.3177 0.3666 0.0030  -0.0190 0.0076  830 PRO A O   
2126 C CB  . PRO A 308 ? 0.2697 0.3316 0.3520 0.0016  -0.0211 0.0171  830 PRO A CB  
2127 C CG  . PRO A 308 ? 0.2695 0.3440 0.3449 0.0034  -0.0203 0.0192  830 PRO A CG  
2128 C CD  . PRO A 308 ? 0.2639 0.3361 0.3417 -0.0008 -0.0184 0.0205  830 PRO A CD  
2129 N N   . PHE A 309 ? 0.2942 0.3402 0.3703 0.0054  -0.0177 0.0032  831 PHE A N   
2130 C CA  . PHE A 309 ? 0.2980 0.3370 0.3738 0.0070  -0.0183 -0.0012 831 PHE A CA  
2131 C C   . PHE A 309 ? 0.2905 0.3226 0.3746 0.0048  -0.0155 -0.0003 831 PHE A C   
2132 O O   . PHE A 309 ? 0.3034 0.3323 0.3926 0.0050  -0.0171 -0.0002 831 PHE A O   
2133 C CB  . PHE A 309 ? 0.3167 0.3573 0.3856 0.0092  -0.0166 -0.0042 831 PHE A CB  
2134 C CG  . PHE A 309 ? 0.3101 0.3432 0.3782 0.0108  -0.0179 -0.0080 831 PHE A CG  
2135 C CD1 . PHE A 309 ? 0.3112 0.3395 0.3753 0.0135  -0.0233 -0.0106 831 PHE A CD1 
2136 C CD2 . PHE A 309 ? 0.3136 0.3439 0.3836 0.0095  -0.0147 -0.0086 831 PHE A CD2 
2137 C CE1 . PHE A 309 ? 0.3247 0.3447 0.3887 0.0140  -0.0260 -0.0131 831 PHE A CE1 
2138 C CE2 . PHE A 309 ? 0.3265 0.3511 0.3969 0.0106  -0.0161 -0.0105 831 PHE A CE2 
2139 C CZ  . PHE A 309 ? 0.3293 0.3484 0.3975 0.0125  -0.0221 -0.0124 831 PHE A CZ  
2140 N N   . PHE A 310 ? 0.2908 0.3206 0.3758 0.0031  -0.0119 0.0009  832 PHE A N   
2141 C CA  . PHE A 310 ? 0.2854 0.3078 0.3748 0.0034  -0.0079 0.0012  832 PHE A CA  
2142 C C   . PHE A 310 ? 0.2925 0.3123 0.3893 0.0041  -0.0070 0.0051  832 PHE A C   
2143 O O   . PHE A 310 ? 0.2823 0.2967 0.3822 0.0068  -0.0028 0.0058  832 PHE A O   
2144 C CB  . PHE A 310 ? 0.2858 0.3028 0.3681 0.0022  -0.0053 -0.0012 832 PHE A CB  
2145 C CG  . PHE A 310 ? 0.2776 0.2974 0.3545 0.0022  -0.0053 -0.0040 832 PHE A CG  
2146 C CD1 . PHE A 310 ? 0.2737 0.2925 0.3527 0.0042  -0.0037 -0.0051 832 PHE A CD1 
2147 C CD2 . PHE A 310 ? 0.2749 0.2999 0.3463 0.0001  -0.0071 -0.0038 832 PHE A CD2 
2148 C CE1 . PHE A 310 ? 0.2673 0.2879 0.3419 0.0045  -0.0040 -0.0070 832 PHE A CE1 
2149 C CE2 . PHE A 310 ? 0.2724 0.3009 0.3399 0.0010  -0.0068 -0.0054 832 PHE A CE2 
2150 C CZ  . PHE A 310 ? 0.2651 0.2903 0.3337 0.0033  -0.0054 -0.0076 832 PHE A CZ  
2151 N N   . TRP A 311 ? 0.3089 0.3333 0.4082 0.0029  -0.0105 0.0084  833 TRP A N   
2152 C CA  . TRP A 311 ? 0.3146 0.3368 0.4216 0.0037  -0.0099 0.0131  833 TRP A CA  
2153 C C   . TRP A 311 ? 0.2936 0.3196 0.4111 0.0057  -0.0103 0.0169  833 TRP A C   
2154 O O   . TRP A 311 ? 0.2970 0.3287 0.4157 0.0043  -0.0148 0.0172  833 TRP A O   
2155 C CB  . TRP A 311 ? 0.3086 0.3354 0.4158 0.0012  -0.0137 0.0172  833 TRP A CB  
2156 C CG  . TRP A 311 ? 0.3035 0.3303 0.4036 -0.0022 -0.0147 0.0169  833 TRP A CG  
2157 C CD1 . TRP A 311 ? 0.2965 0.3172 0.3899 -0.0035 -0.0131 0.0134  833 TRP A CD1 
2158 C CD2 . TRP A 311 ? 0.2993 0.3344 0.3992 -0.0052 -0.0181 0.0222  833 TRP A CD2 
2159 N NE1 . TRP A 311 ? 0.2961 0.3213 0.3865 -0.0079 -0.0160 0.0166  833 TRP A NE1 
2160 C CE2 . TRP A 311 ? 0.3025 0.3374 0.3973 -0.0088 -0.0187 0.0226  833 TRP A CE2 
2161 C CE3 . TRP A 311 ? 0.3034 0.3475 0.4072 -0.0054 -0.0211 0.0279  833 TRP A CE3 
2162 C CZ2 . TRP A 311 ? 0.3031 0.3483 0.3984 -0.0128 -0.0218 0.0296  833 TRP A CZ2 
2163 C CZ3 . TRP A 311 ? 0.3097 0.3633 0.4123 -0.0085 -0.0235 0.0341  833 TRP A CZ3 
2164 C CH2 . TRP A 311 ? 0.2987 0.3537 0.3980 -0.0122 -0.0237 0.0355  833 TRP A CH2 
2165 N N   . SER A 312 ? 0.3055 0.3279 0.4302 0.0093  -0.0060 0.0204  834 SER A N   
2166 C CA  . SER A 312 ? 0.3073 0.3365 0.4455 0.0111  -0.0065 0.0273  834 SER A CA  
2167 C C   . SER A 312 ? 0.3042 0.3393 0.4464 0.0082  -0.0126 0.0318  834 SER A C   
2168 O O   . SER A 312 ? 0.2885 0.3221 0.4244 0.0062  -0.0146 0.0306  834 SER A O   
2169 C CB  . SER A 312 ? 0.3073 0.3321 0.4514 0.0178  0.0007  0.0309  834 SER A CB  
2170 O OG  . SER A 312 ? 0.3301 0.3467 0.4711 0.0191  0.0010  0.0312  834 SER A OG  
2171 N N   . LEU A 313 ? 0.3270 0.3702 0.4808 0.0076  -0.0159 0.0383  835 LEU A N   
2172 C CA  . LEU A 313 ? 0.3150 0.3645 0.4727 0.0049  -0.0223 0.0434  835 LEU A CA  
2173 C C   . LEU A 313 ? 0.3049 0.3518 0.4658 0.0074  -0.0193 0.0474  835 LEU A C   
2174 O O   . LEU A 313 ? 0.2919 0.3410 0.4487 0.0047  -0.0235 0.0486  835 LEU A O   
2175 C CB  . LEU A 313 ? 0.3234 0.3818 0.4943 0.0030  -0.0274 0.0512  835 LEU A CB  
2176 C CG  . LEU A 313 ? 0.3322 0.3909 0.4999 -0.0013 -0.0340 0.0482  835 LEU A CG  
2177 C CD1 . LEU A 313 ? 0.3429 0.4104 0.5252 -0.0050 -0.0414 0.0582  835 LEU A CD1 
2178 C CD2 . LEU A 313 ? 0.3267 0.3806 0.4765 -0.0038 -0.0400 0.0397  835 LEU A CD2 
2179 N N   . GLU A 314 ? 0.3188 0.3600 0.4856 0.0133  -0.0122 0.0497  836 GLU A N   
2180 C CA  . GLU A 314 ? 0.3339 0.3681 0.5024 0.0164  -0.0103 0.0531  836 GLU A CA  
2181 C C   . GLU A 314 ? 0.3240 0.3480 0.4791 0.0130  -0.0116 0.0475  836 GLU A C   
2182 O O   . GLU A 314 ? 0.3130 0.3355 0.4693 0.0111  -0.0147 0.0517  836 GLU A O   
2183 C CB  . GLU A 314 ? 0.3476 0.3758 0.5233 0.0258  -0.0024 0.0566  836 GLU A CB  
2184 C CG  . GLU A 314 ? 0.3828 0.3980 0.5477 0.0313  0.0048  0.0490  836 GLU A CG  
2185 C CD  . GLU A 314 ? 0.4026 0.4101 0.5712 0.0433  0.0132  0.0522  836 GLU A CD  
2186 O OE1 . GLU A 314 ? 0.3982 0.3977 0.5580 0.0496  0.0199  0.0469  836 GLU A OE1 
2187 O OE2 . GLU A 314 ? 0.3950 0.4044 0.5742 0.0475  0.0133  0.0602  836 GLU A OE2 
2188 N N   . LYS A 315 ? 0.3142 0.3330 0.4583 0.0116  -0.0101 0.0395  837 LYS A N   
2189 C CA  . LYS A 315 ? 0.3147 0.3267 0.4481 0.0073  -0.0122 0.0360  837 LYS A CA  
2190 C C   . LYS A 315 ? 0.2936 0.3185 0.4252 0.0016  -0.0180 0.0386  837 LYS A C   
2191 O O   . LYS A 315 ? 0.2830 0.3075 0.4128 -0.0019 -0.0209 0.0421  837 LYS A O   
2192 C CB  . LYS A 315 ? 0.3279 0.3327 0.4506 0.0072  -0.0094 0.0280  837 LYS A CB  
2193 C CG  . LYS A 315 ? 0.3340 0.3341 0.4473 0.0016  -0.0127 0.0261  837 LYS A CG  
2194 C CD  . LYS A 315 ? 0.3496 0.3410 0.4527 0.0018  -0.0103 0.0190  837 LYS A CD  
2195 C CE  . LYS A 315 ? 0.3713 0.3586 0.4669 -0.0050 -0.0149 0.0191  837 LYS A CE  
2196 N NZ  . LYS A 315 ? 0.3709 0.3464 0.4555 -0.0052 -0.0137 0.0127  837 LYS A NZ  
2197 N N   . GLN A 316 ? 0.2786 0.3142 0.4099 0.0012  -0.0201 0.0373  838 GLN A N   
2198 C CA  . GLN A 316 ? 0.2828 0.3303 0.4100 -0.0016 -0.0253 0.0395  838 GLN A CA  
2199 C C   . GLN A 316 ? 0.2808 0.3338 0.4154 -0.0027 -0.0285 0.0483  838 GLN A C   
2200 O O   . GLN A 316 ? 0.2860 0.3461 0.4171 -0.0052 -0.0310 0.0524  838 GLN A O   
2201 C CB  . GLN A 316 ? 0.2804 0.3333 0.4046 -0.0009 -0.0284 0.0361  838 GLN A CB  
2202 C CG  . GLN A 316 ? 0.2865 0.3354 0.4028 0.0000  -0.0264 0.0282  838 GLN A CG  
2203 C CD  . GLN A 316 ? 0.2828 0.3326 0.3972 0.0002  -0.0310 0.0254  838 GLN A CD  
2204 O OE1 . GLN A 316 ? 0.2993 0.3538 0.4096 -0.0003 -0.0371 0.0265  838 GLN A OE1 
2205 N NE2 . GLN A 316 ? 0.2802 0.3248 0.3968 0.0008  -0.0290 0.0222  838 GLN A NE2 
2206 N N   . LEU A 317 ? 0.2636 0.3151 0.4091 -0.0005 -0.0281 0.0526  839 LEU A N   
2207 C CA  . LEU A 317 ? 0.2617 0.3180 0.4157 -0.0011 -0.0311 0.0618  839 LEU A CA  
2208 C C   . LEU A 317 ? 0.2558 0.3033 0.4103 -0.0019 -0.0297 0.0650  839 LEU A C   
2209 O O   . LEU A 317 ? 0.2642 0.3181 0.4200 -0.0050 -0.0334 0.0720  839 LEU A O   
2210 C CB  . LEU A 317 ? 0.2594 0.3169 0.4272 0.0022  -0.0304 0.0671  839 LEU A CB  
2211 C CG  . LEU A 317 ? 0.2607 0.3236 0.4390 0.0022  -0.0334 0.0778  839 LEU A CG  
2212 C CD1 . LEU A 317 ? 0.2605 0.3363 0.4331 -0.0025 -0.0406 0.0811  839 LEU A CD1 
2213 C CD2 . LEU A 317 ? 0.2679 0.3346 0.4613 0.0061  -0.0322 0.0841  839 LEU A CD2 
2214 N N   . GLN A 318 ? 0.2552 0.2875 0.4077 0.0005  -0.0253 0.0603  840 GLN A N   
2215 C CA  . GLN A 318 ? 0.2651 0.2842 0.4160 -0.0011 -0.0261 0.0626  840 GLN A CA  
2216 C C   . GLN A 318 ? 0.2598 0.2853 0.4038 -0.0082 -0.0301 0.0641  840 GLN A C   
2217 O O   . GLN A 318 ? 0.2748 0.2972 0.4213 -0.0122 -0.0340 0.0710  840 GLN A O   
2218 C CB  . GLN A 318 ? 0.2764 0.2753 0.4219 0.0034  -0.0215 0.0555  840 GLN A CB  
2219 C CG  . GLN A 318 ? 0.2967 0.2753 0.4390 0.0026  -0.0239 0.0572  840 GLN A CG  
2220 C CD  . GLN A 318 ? 0.3179 0.2911 0.4704 0.0069  -0.0245 0.0651  840 GLN A CD  
2221 O OE1 . GLN A 318 ? 0.3258 0.3033 0.4863 0.0143  -0.0200 0.0668  840 GLN A OE1 
2222 N NE2 . GLN A 318 ? 0.3416 0.3062 0.4951 0.0021  -0.0305 0.0714  840 GLN A NE2 
2223 N N   . PHE A 319 ? 0.2503 0.2853 0.3867 -0.0095 -0.0294 0.0587  841 PHE A N   
2224 C CA  . PHE A 319 ? 0.2562 0.3023 0.3871 -0.0146 -0.0321 0.0617  841 PHE A CA  
2225 C C   . PHE A 319 ? 0.2531 0.3157 0.3880 -0.0165 -0.0358 0.0717  841 PHE A C   
2226 O O   . PHE A 319 ? 0.2397 0.3068 0.3772 -0.0213 -0.0389 0.0803  841 PHE A O   
2227 C CB  . PHE A 319 ? 0.2509 0.3049 0.3727 -0.0131 -0.0299 0.0541  841 PHE A CB  
2228 C CG  . PHE A 319 ? 0.2508 0.3193 0.3675 -0.0162 -0.0313 0.0582  841 PHE A CG  
2229 C CD1 . PHE A 319 ? 0.2603 0.3252 0.3775 -0.0218 -0.0330 0.0620  841 PHE A CD1 
2230 C CD2 . PHE A 319 ? 0.2546 0.3403 0.3654 -0.0130 -0.0312 0.0586  841 PHE A CD2 
2231 C CE1 . PHE A 319 ? 0.2607 0.3430 0.3760 -0.0246 -0.0341 0.0683  841 PHE A CE1 
2232 C CE2 . PHE A 319 ? 0.2551 0.3570 0.3614 -0.0137 -0.0311 0.0636  841 PHE A CE2 
2233 C CZ  . PHE A 319 ? 0.2556 0.3579 0.3659 -0.0197 -0.0322 0.0695  841 PHE A CZ  
2234 N N   . PHE A 320 ? 0.2574 0.3287 0.3928 -0.0130 -0.0361 0.0712  842 PHE A N   
2235 C CA  . PHE A 320 ? 0.2601 0.3474 0.3969 -0.0137 -0.0397 0.0799  842 PHE A CA  
2236 C C   . PHE A 320 ? 0.2646 0.3491 0.4123 -0.0169 -0.0424 0.0909  842 PHE A C   
2237 O O   . PHE A 320 ? 0.2606 0.3581 0.4091 -0.0201 -0.0452 0.1005  842 PHE A O   
2238 C CB  . PHE A 320 ? 0.2546 0.3461 0.3904 -0.0103 -0.0415 0.0771  842 PHE A CB  
2239 C CG  . PHE A 320 ? 0.2529 0.3491 0.3754 -0.0075 -0.0415 0.0682  842 PHE A CG  
2240 C CD1 . PHE A 320 ? 0.2572 0.3640 0.3681 -0.0064 -0.0407 0.0675  842 PHE A CD1 
2241 C CD2 . PHE A 320 ? 0.2532 0.3435 0.3752 -0.0056 -0.0428 0.0618  842 PHE A CD2 
2242 C CE1 . PHE A 320 ? 0.2627 0.3713 0.3597 -0.0021 -0.0408 0.0589  842 PHE A CE1 
2243 C CE2 . PHE A 320 ? 0.2583 0.3493 0.3670 -0.0032 -0.0444 0.0536  842 PHE A CE2 
2244 C CZ  . PHE A 320 ? 0.2567 0.3555 0.3520 -0.0007 -0.0432 0.0513  842 PHE A CZ  
2245 N N   . GLN A 321 ? 0.2869 0.3542 0.4424 -0.0153 -0.0412 0.0899  843 GLN A N   
2246 C CA  . GLN A 321 ? 0.3189 0.3777 0.4844 -0.0169 -0.0438 0.0993  843 GLN A CA  
2247 C C   . GLN A 321 ? 0.3119 0.3618 0.4763 -0.0230 -0.0467 0.1033  843 GLN A C   
2248 O O   . GLN A 321 ? 0.2985 0.3530 0.4691 -0.0276 -0.0513 0.1150  843 GLN A O   
2249 C CB  . GLN A 321 ? 0.3529 0.3945 0.5248 -0.0107 -0.0406 0.0957  843 GLN A CB  
2250 C CG  . GLN A 321 ? 0.4048 0.4326 0.5856 -0.0100 -0.0428 0.1039  843 GLN A CG  
2251 C CD  . GLN A 321 ? 0.4402 0.4542 0.6268 -0.0008 -0.0379 0.1010  843 GLN A CD  
2252 O OE1 . GLN A 321 ? 0.4629 0.4886 0.6558 0.0033  -0.0356 0.1017  843 GLN A OE1 
2253 N NE2 . GLN A 321 ? 0.4500 0.4392 0.6342 0.0027  -0.0368 0.0985  843 GLN A NE2 
2254 N N   . ASP A 322 ? 0.3095 0.3467 0.4664 -0.0237 -0.0449 0.0946  844 ASP A N   
2255 C CA  . ASP A 322 ? 0.3257 0.3542 0.4809 -0.0311 -0.0494 0.0985  844 ASP A CA  
2256 C C   . ASP A 322 ? 0.3201 0.3743 0.4764 -0.0373 -0.0523 0.1088  844 ASP A C   
2257 O O   . ASP A 322 ? 0.3344 0.3892 0.4964 -0.0448 -0.0582 0.1202  844 ASP A O   
2258 C CB  . ASP A 322 ? 0.3263 0.3383 0.4718 -0.0310 -0.0476 0.0872  844 ASP A CB  
2259 C CG  . ASP A 322 ? 0.3425 0.3278 0.4852 -0.0241 -0.0447 0.0786  844 ASP A CG  
2260 O OD1 . ASP A 322 ? 0.3563 0.3318 0.5056 -0.0200 -0.0450 0.0825  844 ASP A OD1 
2261 O OD2 . ASP A 322 ? 0.3504 0.3254 0.4838 -0.0218 -0.0415 0.0683  844 ASP A OD2 
2262 N N   . VAL A 323 ? 0.3013 0.3765 0.4521 -0.0337 -0.0485 0.1057  845 VAL A N   
2263 C CA  . VAL A 323 ? 0.3073 0.4092 0.4572 -0.0362 -0.0494 0.1156  845 VAL A CA  
2264 C C   . VAL A 323 ? 0.3284 0.4432 0.4864 -0.0380 -0.0529 0.1296  845 VAL A C   
2265 O O   . VAL A 323 ? 0.3286 0.4592 0.4912 -0.0434 -0.0559 0.1431  845 VAL A O   
2266 C CB  . VAL A 323 ? 0.2987 0.4158 0.4374 -0.0293 -0.0445 0.1073  845 VAL A CB  
2267 C CG1 . VAL A 323 ? 0.3019 0.4476 0.4375 -0.0284 -0.0442 0.1176  845 VAL A CG1 
2268 C CG2 . VAL A 323 ? 0.2986 0.4082 0.4306 -0.0288 -0.0416 0.0972  845 VAL A CG2 
2269 N N   . SER A 324 ? 0.3444 0.4541 0.5053 -0.0337 -0.0527 0.1278  846 SER A N   
2270 C CA  . SER A 324 ? 0.3434 0.4653 0.5116 -0.0348 -0.0561 0.1407  846 SER A CA  
2271 C C   . SER A 324 ? 0.3457 0.4553 0.5264 -0.0416 -0.0617 0.1525  846 SER A C   
2272 O O   . SER A 324 ? 0.3476 0.4728 0.5347 -0.0462 -0.0654 0.1676  846 SER A O   
2273 C CB  . SER A 324 ? 0.3569 0.4771 0.5253 -0.0286 -0.0552 0.1356  846 SER A CB  
2274 O OG  . SER A 324 ? 0.3846 0.5137 0.5615 -0.0298 -0.0591 0.1484  846 SER A OG  
2275 N N   . ASP A 325 ? 0.3561 0.4370 0.5391 -0.0418 -0.0624 0.1458  847 ASP A N   
2276 C CA  . ASP A 325 ? 0.3764 0.4382 0.5674 -0.0482 -0.0690 0.1545  847 ASP A CA  
2277 C C   . ASP A 325 ? 0.3988 0.4688 0.5907 -0.0585 -0.0742 0.1639  847 ASP A C   
2278 O O   . ASP A 325 ? 0.4231 0.4898 0.6244 -0.0664 -0.0818 0.1781  847 ASP A O   
2279 C CB  . ASP A 325 ? 0.3902 0.4175 0.5773 -0.0447 -0.0683 0.1424  847 ASP A CB  
2280 C CG  . ASP A 325 ? 0.3898 0.4077 0.5792 -0.0345 -0.0635 0.1361  847 ASP A CG  
2281 O OD1 . ASP A 325 ? 0.3851 0.4188 0.5819 -0.0319 -0.0630 0.1432  847 ASP A OD1 
2282 O OD2 . ASP A 325 ? 0.4094 0.4050 0.5930 -0.0287 -0.0600 0.1245  847 ASP A OD2 
2283 N N   . ARG A 326 ? 0.3907 0.4712 0.5741 -0.0585 -0.0706 0.1570  848 ARG A N   
2284 C CA  . ARG A 326 ? 0.3964 0.4892 0.5816 -0.0676 -0.0747 0.1666  848 ARG A CA  
2285 C C   . ARG A 326 ? 0.4050 0.5342 0.5965 -0.0702 -0.0750 0.1842  848 ARG A C   
2286 O O   . ARG A 326 ? 0.4124 0.5515 0.6126 -0.0800 -0.0811 0.2000  848 ARG A O   
2287 C CB  . ARG A 326 ? 0.3927 0.4869 0.5672 -0.0652 -0.0699 0.1540  848 ARG A CB  
2288 C CG  . ARG A 326 ? 0.3951 0.5062 0.5722 -0.0736 -0.0733 0.1643  848 ARG A CG  
2289 C CD  . ARG A 326 ? 0.4169 0.5049 0.5999 -0.0859 -0.0842 0.1710  848 ARG A CD  
2290 N NE  . ARG A 326 ? 0.4189 0.5274 0.6074 -0.0954 -0.0886 0.1841  848 ARG A NE  
2291 C CZ  . ARG A 326 ? 0.4262 0.5640 0.6269 -0.1018 -0.0918 0.2053  848 ARG A CZ  
2292 N NH1 . ARG A 326 ? 0.4531 0.6027 0.6608 -0.1001 -0.0915 0.2157  848 ARG A NH1 
2293 N NH2 . ARG A 326 ? 0.4256 0.5833 0.6324 -0.1100 -0.0953 0.2177  848 ARG A NH2 
2294 N N   . ILE A 327 ? 0.4019 0.5515 0.5884 -0.0616 -0.0689 0.1823  849 ILE A N   
2295 C CA  . ILE A 327 ? 0.4093 0.5942 0.5982 -0.0616 -0.0681 0.1983  849 ILE A CA  
2296 C C   . ILE A 327 ? 0.4130 0.6017 0.6101 -0.0622 -0.0716 0.2097  849 ILE A C   
2297 O O   . ILE A 327 ? 0.3984 0.6160 0.5966 -0.0615 -0.0709 0.2234  849 ILE A O   
2298 C CB  . ILE A 327 ? 0.4123 0.6197 0.5862 -0.0512 -0.0598 0.1900  849 ILE A CB  
2299 C CG1 . ILE A 327 ? 0.4281 0.6266 0.5924 -0.0421 -0.0567 0.1758  849 ILE A CG1 
2300 C CG2 . ILE A 327 ? 0.4033 0.6070 0.5707 -0.0505 -0.0565 0.1801  849 ILE A CG2 
2301 C CD1 . ILE A 327 ? 0.4283 0.6406 0.5752 -0.0320 -0.0505 0.1650  849 ILE A CD1 
2302 N N   . GLU A 328 ? 0.4343 0.5944 0.6369 -0.0628 -0.0750 0.2049  850 GLU A N   
2303 C CA  . GLU A 328 ? 0.4472 0.6064 0.6593 -0.0629 -0.0787 0.2150  850 GLU A CA  
2304 C C   . GLU A 328 ? 0.4536 0.6312 0.6782 -0.0719 -0.0851 0.2389  850 GLU A C   
2305 O O   . GLU A 328 ? 0.4586 0.6533 0.6876 -0.0707 -0.0860 0.2505  850 GLU A O   
2306 C CB  . GLU A 328 ? 0.4875 0.6089 0.7045 -0.0622 -0.0815 0.2069  850 GLU A CB  
2307 C CG  . GLU A 328 ? 0.5263 0.6419 0.7526 -0.0592 -0.0839 0.2135  850 GLU A CG  
2308 C CD  . GLU A 328 ? 0.5688 0.6478 0.8025 -0.0604 -0.0888 0.2128  850 GLU A CD  
2309 O OE1 . GLU A 328 ? 0.5995 0.6640 0.8367 -0.0690 -0.0957 0.2191  850 GLU A OE1 
2310 O OE2 . GLU A 328 ? 0.5876 0.6522 0.8236 -0.0524 -0.0864 0.2068  850 GLU A OE2 
2311 N N   . LYS A 329 ? 0.4483 0.6226 0.6792 -0.0817 -0.0902 0.2473  851 LYS A N   
2312 C CA  . LYS A 329 ? 0.4218 0.6138 0.6668 -0.0924 -0.0975 0.2720  851 LYS A CA  
2313 C C   . LYS A 329 ? 0.4188 0.6407 0.6639 -0.0969 -0.0960 0.2820  851 LYS A C   
2314 O O   . LYS A 329 ? 0.4140 0.6415 0.6724 -0.1090 -0.1040 0.3004  851 LYS A O   
2315 C CB  . LYS A 329 ? 0.4272 0.5846 0.6837 -0.1025 -0.1088 0.2778  851 LYS A CB  
2316 C CG  . LYS A 329 ? 0.4294 0.5581 0.6876 -0.0969 -0.1101 0.2708  851 LYS A CG  
2317 C CD  . LYS A 329 ? 0.4504 0.5553 0.7223 -0.1066 -0.1224 0.2852  851 LYS A CD  
2318 C CE  . LYS A 329 ? 0.4640 0.5393 0.7375 -0.0989 -0.1229 0.2783  851 LYS A CE  
2319 N NZ  . LYS A 329 ? 0.4740 0.5190 0.7344 -0.0895 -0.1173 0.2538  851 LYS A NZ  
2320 N N   . GLU A 330 ? 0.4185 0.6599 0.6496 -0.0871 -0.0862 0.2712  852 GLU A N   
2321 C CA  . GLU A 330 ? 0.4457 0.7203 0.6763 -0.0881 -0.0826 0.2814  852 GLU A CA  
2322 C C   . GLU A 330 ? 0.4659 0.7826 0.6947 -0.0820 -0.0773 0.2967  852 GLU A C   
2323 O O   . GLU A 330 ? 0.4766 0.7961 0.6979 -0.0742 -0.0745 0.2926  852 GLU A O   
2324 C CB  . GLU A 330 ? 0.4539 0.7249 0.6691 -0.0796 -0.0748 0.2612  852 GLU A CB  
2325 C CG  . GLU A 330 ? 0.4733 0.7120 0.6902 -0.0869 -0.0798 0.2506  852 GLU A CG  
2326 C CD  . GLU A 330 ? 0.4853 0.7366 0.7142 -0.0991 -0.0861 0.2675  852 GLU A CD  
2327 O OE1 . GLU A 330 ? 0.4976 0.7863 0.7273 -0.0963 -0.0808 0.2790  852 GLU A OE1 
2328 O OE2 . GLU A 330 ? 0.5252 0.7483 0.7617 -0.1109 -0.0966 0.2694  852 GLU A OE2 
2329 N N   . SER A 331 ? 0.5016 0.8523 0.7371 -0.0853 -0.0761 0.3154  853 SER A N   
2330 C CA  . SER A 331 ? 0.5222 0.9168 0.7550 -0.0783 -0.0701 0.3322  853 SER A CA  
2331 C C   . SER A 331 ? 0.5255 0.9338 0.7339 -0.0604 -0.0581 0.3153  853 SER A C   
2332 O O   . SER A 331 ? 0.5192 0.9211 0.7192 -0.0559 -0.0537 0.3014  853 SER A O   
2333 C CB  . SER A 331 ? 0.5392 0.9688 0.7893 -0.0874 -0.0725 0.3607  853 SER A CB  
2334 O OG  . SER A 331 ? 0.5221 0.9936 0.7615 -0.0746 -0.0610 0.3665  853 SER A OG  
2335 N N   . LEU A 332 ? 0.5346 0.9614 0.7307 -0.0502 -0.0536 0.3173  854 LEU A N   
2336 C CA  . LEU A 332 ? 0.5615 1.0048 0.7320 -0.0325 -0.0433 0.3049  854 LEU A CA  
2337 C C   . LEU A 332 ? 0.5653 1.0373 0.7329 -0.0263 -0.0355 0.3114  854 LEU A C   
2338 O O   . LEU A 332 ? 0.5491 1.0188 0.6965 -0.0131 -0.0281 0.2939  854 LEU A O   
2339 C CB  . LEU A 332 ? 0.5921 1.0585 0.7516 -0.0245 -0.0414 0.3139  854 LEU A CB  
2340 C CG  . LEU A 332 ? 0.6254 1.1105 0.7542 -0.0049 -0.0321 0.3039  854 LEU A CG  
2341 C CD1 . LEU A 332 ? 0.6440 1.1008 0.7527 0.0042  -0.0291 0.2743  854 LEU A CD1 
2342 C CD2 . LEU A 332 ? 0.6239 1.1176 0.7423 -0.0008 -0.0343 0.3087  854 LEU A CD2 
2343 N N   . ASP A 333 ? 0.5691 1.0676 0.7576 -0.0360 -0.0376 0.3373  855 ASP A N   
2344 C CA  . ASP A 333 ? 0.5873 1.1189 0.7768 -0.0304 -0.0301 0.3480  855 ASP A CA  
2345 C C   . ASP A 333 ? 0.5917 1.1088 0.7978 -0.0431 -0.0353 0.3480  855 ASP A C   
2346 O O   . ASP A 333 ? 0.5915 1.1364 0.8014 -0.0397 -0.0300 0.3582  855 ASP A O   
2347 C CB  . ASP A 333 ? 0.5877 1.1696 0.7884 -0.0303 -0.0273 0.3807  855 ASP A CB  
2348 C CG  . ASP A 333 ? 0.6015 1.2047 0.7794 -0.0133 -0.0194 0.3804  855 ASP A CG  
2349 O OD1 . ASP A 333 ? 0.6051 1.2071 0.7548 0.0053  -0.0104 0.3610  855 ASP A OD1 
2350 O OD2 . ASP A 333 ? 0.5771 1.1972 0.7642 -0.0185 -0.0230 0.3996  855 ASP A OD2 
2351 N N   . GLY A 334 ? 0.5913 1.0660 0.8059 -0.0564 -0.0455 0.3367  856 GLY A N   
2352 C CA  . GLY A 334 ? 0.5927 1.0480 0.8183 -0.0678 -0.0515 0.3332  856 GLY A CA  
2353 C C   . GLY A 334 ? 0.5974 1.0469 0.8053 -0.0551 -0.0427 0.3117  856 GLY A C   
2354 O O   . GLY A 334 ? 0.6223 1.0712 0.8087 -0.0390 -0.0342 0.2954  856 GLY A O   
2355 N N   . PRO A 335 ? 0.6100 1.0542 0.8262 -0.0627 -0.0458 0.3119  857 PRO A N   
2356 C CA  . PRO A 335 ? 0.6008 1.0441 0.8017 -0.0501 -0.0370 0.2944  857 PRO A CA  
2357 C C   . PRO A 335 ? 0.5627 0.9645 0.7450 -0.0434 -0.0357 0.2631  857 PRO A C   
2358 O O   . PRO A 335 ? 0.5598 0.9633 0.7233 -0.0278 -0.0268 0.2476  857 PRO A O   
2359 C CB  . PRO A 335 ? 0.5806 1.0249 0.7979 -0.0635 -0.0436 0.3041  857 PRO A CB  
2360 C CG  . PRO A 335 ? 0.5986 1.0209 0.8334 -0.0839 -0.0582 0.3142  857 PRO A CG  
2361 C CD  . PRO A 335 ? 0.6129 1.0492 0.8517 -0.0833 -0.0585 0.3276  857 PRO A CD  
2362 N N   . ILE A 336 ? 0.5248 0.8902 0.7125 -0.0545 -0.0447 0.2551  858 ILE A N   
2363 C CA  . ILE A 336 ? 0.5029 0.8305 0.6766 -0.0495 -0.0439 0.2283  858 ILE A CA  
2364 C C   . ILE A 336 ? 0.4670 0.7981 0.6235 -0.0351 -0.0373 0.2177  858 ILE A C   
2365 O O   . ILE A 336 ? 0.4252 0.7502 0.5648 -0.0233 -0.0312 0.2004  858 ILE A O   
2366 C CB  . ILE A 336 ? 0.4921 0.7832 0.6753 -0.0626 -0.0541 0.2247  858 ILE A CB  
2367 C CG1 . ILE A 336 ? 0.5017 0.7807 0.6952 -0.0755 -0.0615 0.2288  858 ILE A CG1 
2368 C CG2 . ILE A 336 ? 0.5007 0.7592 0.6712 -0.0557 -0.0520 0.2006  858 ILE A CG2 
2369 C CD1 . ILE A 336 ? 0.5103 0.7509 0.7103 -0.0875 -0.0723 0.2256  858 ILE A CD1 
2370 N N   . VAL A 337 ? 0.4699 0.8108 0.6307 -0.0367 -0.0397 0.2292  859 VAL A N   
2371 C CA  . VAL A 337 ? 0.4908 0.8347 0.6352 -0.0248 -0.0357 0.2211  859 VAL A CA  
2372 C C   . VAL A 337 ? 0.5107 0.8842 0.6371 -0.0089 -0.0261 0.2210  859 VAL A C   
2373 O O   . VAL A 337 ? 0.4831 0.8497 0.5886 0.0033  -0.0226 0.2055  859 VAL A O   
2374 C CB  . VAL A 337 ? 0.4965 0.8462 0.6511 -0.0312 -0.0411 0.2361  859 VAL A CB  
2375 C CG1 . VAL A 337 ? 0.5196 0.8818 0.6568 -0.0192 -0.0374 0.2329  859 VAL A CG1 
2376 C CG2 . VAL A 337 ? 0.4792 0.7925 0.6455 -0.0420 -0.0493 0.2299  859 VAL A CG2 
2377 N N   . LYS A 338 ? 0.5427 0.9480 0.6767 -0.0087 -0.0224 0.2386  860 LYS A N   
2378 C CA  . LYS A 338 ? 0.5639 0.9984 0.6811 0.0085  -0.0121 0.2396  860 LYS A CA  
2379 C C   . LYS A 338 ? 0.5409 0.9548 0.6411 0.0185  -0.0079 0.2161  860 LYS A C   
2380 O O   . LYS A 338 ? 0.5544 0.9683 0.6306 0.0345  -0.0024 0.2034  860 LYS A O   
2381 C CB  . LYS A 338 ? 0.6169 1.0904 0.7502 0.0057  -0.0090 0.2648  860 LYS A CB  
2382 C CG  . LYS A 338 ? 0.6565 1.1731 0.7783 0.0218  0.0009  0.2791  860 LYS A CG  
2383 C CD  . LYS A 338 ? 0.7004 1.2324 0.8279 0.0173  -0.0025 0.2958  860 LYS A CD  
2384 C CE  . LYS A 338 ? 0.7238 1.3034 0.8704 0.0137  0.0000  0.3291  860 LYS A CE  
2385 N NZ  . LYS A 338 ? 0.7762 1.3954 0.9032 0.0358  0.0131  0.3362  860 LYS A NZ  
2386 N N   . GLN A 339 ? 0.5166 0.9122 0.6285 0.0089  -0.0112 0.2106  861 GLN A N   
2387 C CA  . GLN A 339 ? 0.5162 0.8905 0.6150 0.0163  -0.0081 0.1893  861 GLN A CA  
2388 C C   . GLN A 339 ? 0.4851 0.8282 0.5669 0.0215  -0.0100 0.1670  861 GLN A C   
2389 O O   . GLN A 339 ? 0.4820 0.8173 0.5441 0.0345  -0.0058 0.1516  861 GLN A O   
2390 C CB  . GLN A 339 ? 0.5442 0.9005 0.6592 0.0025  -0.0133 0.1877  861 GLN A CB  
2391 C CG  . GLN A 339 ? 0.5710 0.9545 0.6968 0.0011  -0.0105 0.2030  861 GLN A CG  
2392 C CD  . GLN A 339 ? 0.5785 0.9723 0.6878 0.0185  -0.0011 0.1937  861 GLN A CD  
2393 O OE1 . GLN A 339 ? 0.5809 0.9482 0.6784 0.0231  -0.0005 0.1733  861 GLN A OE1 
2394 N NE2 . GLN A 339 ? 0.6072 1.0398 0.7153 0.0292  0.0065  0.2095  861 GLN A NE2 
2395 N N   . LEU A 340 ? 0.4501 0.7751 0.5408 0.0110  -0.0170 0.1667  862 LEU A N   
2396 C CA  . LEU A 340 ? 0.4301 0.7276 0.5100 0.0133  -0.0201 0.1492  862 LEU A CA  
2397 C C   . LEU A 340 ? 0.4299 0.7373 0.4879 0.0266  -0.0178 0.1452  862 LEU A C   
2398 O O   . LEU A 340 ? 0.4430 0.7299 0.4855 0.0326  -0.0194 0.1280  862 LEU A O   
2399 C CB  . LEU A 340 ? 0.4136 0.6946 0.5101 0.0002  -0.0274 0.1536  862 LEU A CB  
2400 C CG  . LEU A 340 ? 0.4311 0.6838 0.5231 0.0000  -0.0312 0.1383  862 LEU A CG  
2401 C CD1 . LEU A 340 ? 0.4283 0.6559 0.5187 -0.0004 -0.0307 0.1217  862 LEU A CD1 
2402 C CD2 . LEU A 340 ? 0.4476 0.6917 0.5564 -0.0105 -0.0372 0.1475  862 LEU A CD2 
2403 N N   . GLU A 341 ? 0.4258 0.7641 0.4817 0.0312  -0.0148 0.1614  863 GLU A N   
2404 C CA  . GLU A 341 ? 0.4410 0.7897 0.4723 0.0452  -0.0126 0.1581  863 GLU A CA  
2405 C C   . GLU A 341 ? 0.4697 0.8310 0.4782 0.0632  -0.0043 0.1519  863 GLU A C   
2406 O O   . GLU A 341 ? 0.4564 0.8121 0.4380 0.0763  -0.0040 0.1406  863 GLU A O   
2407 C CB  . GLU A 341 ? 0.4333 0.8090 0.4706 0.0430  -0.0132 0.1785  863 GLU A CB  
2408 C CG  . GLU A 341 ? 0.4213 0.7831 0.4772 0.0280  -0.0217 0.1839  863 GLU A CG  
2409 C CD  . GLU A 341 ? 0.4204 0.7546 0.4648 0.0288  -0.0277 0.1671  863 GLU A CD  
2410 O OE1 . GLU A 341 ? 0.4144 0.7376 0.4351 0.0397  -0.0269 0.1505  863 GLU A OE1 
2411 O OE2 . GLU A 341 ? 0.4089 0.7319 0.4684 0.0182  -0.0340 0.1715  863 GLU A OE2 
2412 N N   . ARG A 342 ? 0.5046 0.8814 0.5229 0.0642  0.0016  0.1593  864 ARG A N   
2413 C CA  . ARG A 342 ? 0.5488 0.9380 0.5476 0.0825  0.0103  0.1544  864 ARG A CA  
2414 C C   . ARG A 342 ? 0.5367 0.8914 0.5133 0.0906  0.0080  0.1286  864 ARG A C   
2415 O O   . ARG A 342 ? 0.5416 0.8713 0.5281 0.0816  0.0041  0.1181  864 ARG A O   
2416 C CB  . ARG A 342 ? 0.5878 0.9958 0.6061 0.0788  0.0151  0.1666  864 ARG A CB  
2417 C CG  . ARG A 342 ? 0.6418 1.0538 0.6446 0.0956  0.0232  0.1583  864 ARG A CG  
2418 C CD  . ARG A 342 ? 0.6812 1.1199 0.7057 0.0917  0.0279  0.1753  864 ARG A CD  
2419 N NE  . ARG A 342 ? 0.7124 1.1963 0.7349 0.1048  0.0375  0.1957  864 ARG A NE  
2420 C CZ  . ARG A 342 ? 0.7359 1.2514 0.7739 0.0981  0.0376  0.2195  864 ARG A CZ  
2421 N NH1 . ARG A 342 ? 0.7446 1.3036 0.7797 0.1123  0.0476  0.2384  864 ARG A NH1 
2422 N NH2 . ARG A 342 ? 0.7182 1.2231 0.7749 0.0779  0.0279  0.2258  864 ARG A NH2 
2423 N N   . GLY A 343 ? 0.5505 0.9028 0.4962 0.1076  0.0097  0.1188  865 GLY A N   
2424 C CA  . GLY A 343 ? 0.5659 0.8824 0.4892 0.1142  0.0049  0.0947  865 GLY A CA  
2425 C C   . GLY A 343 ? 0.5505 0.8387 0.4758 0.1018  -0.0065 0.0852  865 GLY A C   
2426 O O   . GLY A 343 ? 0.5455 0.8029 0.4583 0.1029  -0.0126 0.0673  865 GLY A O   
2427 N N   . GLY A 344 ? 0.5258 0.8257 0.4672 0.0905  -0.0097 0.0986  866 GLY A N   
2428 C CA  . GLY A 344 ? 0.5128 0.7912 0.4633 0.0773  -0.0196 0.0941  866 GLY A CA  
2429 C C   . GLY A 344 ? 0.5397 0.8001 0.4634 0.0840  -0.0271 0.0809  866 GLY A C   
2430 O O   . GLY A 344 ? 0.5146 0.7479 0.4402 0.0767  -0.0353 0.0695  866 GLY A O   
2431 N N   . ARG A 345 ? 0.5882 0.8641 0.4861 0.0980  -0.0247 0.0831  867 ARG A N   
2432 C CA  . ARG A 345 ? 0.6455 0.9049 0.5146 0.1040  -0.0336 0.0718  867 ARG A CA  
2433 C C   . ARG A 345 ? 0.6398 0.8633 0.4900 0.1080  -0.0406 0.0500  867 ARG A C   
2434 O O   . ARG A 345 ? 0.6476 0.8485 0.4925 0.1011  -0.0523 0.0417  867 ARG A O   
2435 C CB  . ARG A 345 ? 0.7277 1.0104 0.5676 0.1214  -0.0285 0.0773  867 ARG A CB  
2436 C CG  . ARG A 345 ? 0.7561 1.0737 0.6123 0.1162  -0.0246 0.1002  867 ARG A CG  
2437 C CD  . ARG A 345 ? 0.8305 1.1674 0.6546 0.1323  -0.0224 0.1043  867 ARG A CD  
2438 N NE  . ARG A 345 ? 0.8543 1.2340 0.6940 0.1329  -0.0130 0.1291  867 ARG A NE  
2439 C CZ  . ARG A 345 ? 0.8682 1.2773 0.7081 0.1447  -0.0002 0.1398  867 ARG A CZ  
2440 N NH1 . ARG A 345 ? 0.8715 1.3204 0.7289 0.1426  0.0064  0.1648  867 ARG A NH1 
2441 N NH2 . ARG A 345 ? 0.8705 1.2710 0.6944 0.1588  0.0059  0.1273  867 ARG A NH2 
2442 N N   . ALA A 346 ? 0.6361 0.8548 0.4774 0.1185  -0.0342 0.0420  868 ALA A N   
2443 C CA  . ALA A 346 ? 0.6322 0.8155 0.4581 0.1212  -0.0413 0.0223  868 ALA A CA  
2444 C C   . ALA A 346 ? 0.5988 0.7621 0.4522 0.1022  -0.0488 0.0196  868 ALA A C   
2445 O O   . ALA A 346 ? 0.6077 0.7429 0.4519 0.0981  -0.0603 0.0077  868 ALA A O   
2446 C CB  . ALA A 346 ? 0.6288 0.8133 0.4459 0.1350  -0.0319 0.0171  868 ALA A CB  
2447 N N   . VAL A 347 ? 0.5552 0.7335 0.4417 0.0910  -0.0426 0.0315  869 VAL A N   
2448 C CA  . VAL A 347 ? 0.5242 0.6874 0.4380 0.0747  -0.0472 0.0308  869 VAL A CA  
2449 C C   . VAL A 347 ? 0.5093 0.6652 0.4294 0.0644  -0.0573 0.0333  869 VAL A C   
2450 O O   . VAL A 347 ? 0.5170 0.6531 0.4470 0.0553  -0.0646 0.0277  869 VAL A O   
2451 C CB  . VAL A 347 ? 0.5021 0.6830 0.4458 0.0663  -0.0388 0.0438  869 VAL A CB  
2452 C CG1 . VAL A 347 ? 0.4760 0.6429 0.4455 0.0511  -0.0430 0.0444  869 VAL A CG1 
2453 C CG2 . VAL A 347 ? 0.5018 0.6877 0.4435 0.0739  -0.0304 0.0413  869 VAL A CG2 
2454 N N   . VAL A 348 ? 0.5133 0.6875 0.4277 0.0663  -0.0575 0.0431  870 VAL A N   
2455 C CA  . VAL A 348 ? 0.5156 0.6885 0.4375 0.0570  -0.0663 0.0488  870 VAL A CA  
2456 C C   . VAL A 348 ? 0.5467 0.7043 0.4381 0.0624  -0.0778 0.0385  870 VAL A C   
2457 O O   . VAL A 348 ? 0.5412 0.6959 0.4355 0.0548  -0.0875 0.0422  870 VAL A O   
2458 C CB  . VAL A 348 ? 0.5021 0.7042 0.4392 0.0540  -0.0604 0.0675  870 VAL A CB  
2459 C CG1 . VAL A 348 ? 0.5355 0.7503 0.4533 0.0591  -0.0648 0.0731  870 VAL A CG1 
2460 C CG2 . VAL A 348 ? 0.4685 0.6689 0.4400 0.0395  -0.0608 0.0764  870 VAL A CG2 
2461 N N   . LYS A 349 ? 0.5734 0.7184 0.4359 0.0751  -0.0779 0.0252  871 LYS A N   
2462 C CA  . LYS A 349 ? 0.6144 0.7411 0.4411 0.0828  -0.0892 0.0134  871 LYS A CA  
2463 C C   . LYS A 349 ? 0.6475 0.7930 0.4547 0.0897  -0.0898 0.0209  871 LYS A C   
2464 O O   . LYS A 349 ? 0.6641 0.7983 0.4540 0.0876  -0.1026 0.0174  871 LYS A O   
2465 C CB  . LYS A 349 ? 0.6101 0.7098 0.4430 0.0700  -0.1045 0.0066  871 LYS A CB  
2466 C CG  . LYS A 349 ? 0.5807 0.6642 0.4331 0.0636  -0.1033 0.0008  871 LYS A CG  
2467 C CD  . LYS A 349 ? 0.5879 0.6405 0.4321 0.0570  -0.1195 -0.0099 871 LYS A CD  
2468 C CE  . LYS A 349 ? 0.5669 0.6049 0.4271 0.0529  -0.1173 -0.0155 871 LYS A CE  
2469 N NZ  . LYS A 349 ? 0.5648 0.5820 0.4354 0.0399  -0.1319 -0.0176 871 LYS A NZ  
2470 N N   . MET A 350 ? 0.6629 0.8386 0.4739 0.0973  -0.0763 0.0326  872 MET A N   
2471 C CA  . MET A 350 ? 0.7091 0.9090 0.5030 0.1056  -0.0739 0.0425  872 MET A CA  
2472 C C   . MET A 350 ? 0.6670 0.8804 0.4836 0.0913  -0.0790 0.0574  872 MET A C   
2473 O O   . MET A 350 ? 0.6417 0.8851 0.4731 0.0904  -0.0709 0.0746  872 MET A O   
2474 C CB  . MET A 350 ? 0.8083 0.9902 0.5548 0.1197  -0.0825 0.0279  872 MET A CB  
2475 C CG  . MET A 350 ? 0.8834 1.0489 0.6016 0.1371  -0.0782 0.0121  872 MET A CG  
2476 S SD  . MET A 350 ? 0.9677 1.1680 0.6957 0.1508  -0.0563 0.0232  872 MET A SD  
2477 C CE  . MET A 350 ? 0.9584 1.1976 0.6704 0.1619  -0.0494 0.0397  872 MET A CE  
2478 N N   . ASP A 351 ? 0.6541 0.8460 0.4751 0.0798  -0.0928 0.0522  873 ASP A N   
2479 C CA  . ASP A 351 ? 0.6284 0.8299 0.4770 0.0650  -0.0979 0.0661  873 ASP A CA  
2480 C C   . ASP A 351 ? 0.6024 0.7816 0.4759 0.0514  -0.1046 0.0611  873 ASP A C   
2481 O O   . ASP A 351 ? 0.6059 0.7599 0.4647 0.0503  -0.1157 0.0480  873 ASP A O   
2482 C CB  . ASP A 351 ? 0.6583 0.8609 0.4835 0.0662  -0.1094 0.0677  873 ASP A CB  
2483 C CG  . ASP A 351 ? 0.6331 0.8517 0.4864 0.0532  -0.1128 0.0853  873 ASP A CG  
2484 O OD1 . ASP A 351 ? 0.5969 0.8148 0.4865 0.0416  -0.1106 0.0920  873 ASP A OD1 
2485 O OD2 . ASP A 351 ? 0.6643 0.8956 0.5018 0.0556  -0.1178 0.0924  873 ASP A OD2 
2486 N N   . TRP A 352 ? 0.5556 0.7436 0.4662 0.0412  -0.0986 0.0720  874 TRP A N   
2487 C CA  . TRP A 352 ? 0.5321 0.7011 0.4662 0.0301  -0.1034 0.0681  874 TRP A CA  
2488 C C   . TRP A 352 ? 0.5346 0.6999 0.4796 0.0198  -0.1157 0.0743  874 TRP A C   
2489 O O   . TRP A 352 ? 0.5164 0.6647 0.4720 0.0125  -0.1230 0.0695  874 TRP A O   
2490 C CB  . TRP A 352 ? 0.4925 0.6669 0.4582 0.0249  -0.0924 0.0744  874 TRP A CB  
2491 C CG  . TRP A 352 ? 0.4718 0.6680 0.4580 0.0211  -0.0863 0.0915  874 TRP A CG  
2492 C CD1 . TRP A 352 ? 0.4644 0.6801 0.4514 0.0256  -0.0766 0.0998  874 TRP A CD1 
2493 C CD2 . TRP A 352 ? 0.4599 0.6604 0.4704 0.0116  -0.0901 0.1039  874 TRP A CD2 
2494 N NE1 . TRP A 352 ? 0.4566 0.6865 0.4661 0.0186  -0.0752 0.1162  874 TRP A NE1 
2495 C CE2 . TRP A 352 ? 0.4550 0.6750 0.4786 0.0107  -0.0830 0.1185  874 TRP A CE2 
2496 C CE3 . TRP A 352 ? 0.4628 0.6532 0.4860 0.0041  -0.0989 0.1052  874 TRP A CE3 
2497 C CZ2 . TRP A 352 ? 0.4466 0.6733 0.4940 0.0030  -0.0848 0.1331  874 TRP A CZ2 
2498 C CZ3 . TRP A 352 ? 0.4690 0.6687 0.5163 -0.0024 -0.0996 0.1201  874 TRP A CZ3 
2499 C CH2 . TRP A 352 ? 0.4519 0.6680 0.5104 -0.0026 -0.0926 0.1332  874 TRP A CH2 
2500 N N   . ARG A 353 ? 0.5521 0.7351 0.4948 0.0194  -0.1180 0.0861  875 ARG A N   
2501 C CA  . ARG A 353 ? 0.5566 0.7393 0.5076 0.0106  -0.1303 0.0936  875 ARG A CA  
2502 C C   . ARG A 353 ? 0.5841 0.7460 0.5090 0.0101  -0.1460 0.0812  875 ARG A C   
2503 O O   . ARG A 353 ? 0.5770 0.7317 0.5146 0.0001  -0.1575 0.0847  875 ARG A O   
2504 C CB  . ARG A 353 ? 0.5705 0.7772 0.5185 0.0119  -0.1299 0.1083  875 ARG A CB  
2505 C CG  . ARG A 353 ? 0.5539 0.7810 0.5284 0.0105  -0.1174 0.1234  875 ARG A CG  
2506 C CD  . ARG A 353 ? 0.5734 0.8253 0.5407 0.0131  -0.1171 0.1381  875 ARG A CD  
2507 N NE  . ARG A 353 ? 0.6145 0.8734 0.5439 0.0256  -0.1155 0.1314  875 ARG A NE  
2508 C CZ  . ARG A 353 ? 0.6173 0.8996 0.5327 0.0314  -0.1136 0.1425  875 ARG A CZ  
2509 N NH1 . ARG A 353 ? 0.6142 0.9155 0.5516 0.0245  -0.1136 0.1616  875 ARG A NH1 
2510 N NH2 . ARG A 353 ? 0.6382 0.9254 0.5169 0.0451  -0.1110 0.1348  875 ARG A NH2 
2511 N N   . GLU A 354 ? 0.6206 0.7728 0.5089 0.0211  -0.1469 0.0676  876 GLU A N   
2512 C CA  . GLU A 354 ? 0.6729 0.8001 0.5305 0.0218  -0.1631 0.0539  876 GLU A CA  
2513 C C   . GLU A 354 ? 0.6472 0.7493 0.5143 0.0163  -0.1675 0.0432  876 GLU A C   
2514 O O   . GLU A 354 ? 0.6589 0.7390 0.5124 0.0113  -0.1838 0.0354  876 GLU A O   
2515 C CB  . GLU A 354 ? 0.7257 0.8500 0.5377 0.0384  -0.1615 0.0429  876 GLU A CB  
2516 C CG  . GLU A 354 ? 0.7975 0.8996 0.5702 0.0403  -0.1804 0.0318  876 GLU A CG  
2517 C CD  . GLU A 354 ? 0.8371 0.9543 0.6038 0.0361  -0.1894 0.0433  876 GLU A CD  
2518 O OE1 . GLU A 354 ? 0.8419 0.9890 0.6244 0.0375  -0.1780 0.0583  876 GLU A OE1 
2519 O OE2 . GLU A 354 ? 0.8719 0.9708 0.6182 0.0308  -0.2088 0.0382  876 GLU A OE2 
2520 N N   . ASN A 355 ? 0.6187 0.7242 0.5094 0.0164  -0.1540 0.0437  877 ASN A N   
2521 C CA  . ASN A 355 ? 0.6034 0.6877 0.5031 0.0122  -0.1565 0.0344  877 ASN A CA  
2522 C C   . ASN A 355 ? 0.5647 0.6540 0.5063 0.0000  -0.1545 0.0449  877 ASN A C   
2523 O O   . ASN A 355 ? 0.5590 0.6389 0.5142 -0.0018 -0.1500 0.0405  877 ASN A O   
2524 C CB  . ASN A 355 ? 0.5931 0.6740 0.4823 0.0234  -0.1435 0.0246  877 ASN A CB  
2525 C CG  . ASN A 355 ? 0.6330 0.7065 0.4788 0.0381  -0.1452 0.0131  877 ASN A CG  
2526 O OD1 . ASN A 355 ? 0.6672 0.7145 0.4877 0.0410  -0.1564 -0.0005 877 ASN A OD1 
2527 N ND2 . ASN A 355 ? 0.6281 0.7243 0.4644 0.0479  -0.1345 0.0190  877 ASN A ND2 
2528 N N   . ILE A 356 ? 0.5564 0.6607 0.5172 -0.0072 -0.1576 0.0591  878 ILE A N   
2529 C CA  . ILE A 356 ? 0.5396 0.6480 0.5378 -0.0176 -0.1577 0.0699  878 ILE A CA  
2530 C C   . ILE A 356 ? 0.5503 0.6565 0.5515 -0.0273 -0.1755 0.0766  878 ILE A C   
2531 O O   . ILE A 356 ? 0.5749 0.6766 0.5488 -0.0265 -0.1875 0.0732  878 ILE A O   
2532 C CB  . ILE A 356 ? 0.5203 0.6494 0.5454 -0.0173 -0.1442 0.0834  878 ILE A CB  
2533 C CG1 . ILE A 356 ? 0.5287 0.6748 0.5454 -0.0158 -0.1464 0.0930  878 ILE A CG1 
2534 C CG2 . ILE A 356 ? 0.4973 0.6271 0.5245 -0.0107 -0.1285 0.0780  878 ILE A CG2 
2535 C CD1 . ILE A 356 ? 0.5104 0.6744 0.5524 -0.0160 -0.1350 0.1070  878 ILE A CD1 
2536 N N   . THR A 357 ? 0.5332 0.6431 0.5669 -0.0360 -0.1773 0.0868  879 THR A N   
2537 C CA  . THR A 357 ? 0.5392 0.6497 0.5808 -0.0464 -0.1946 0.0957  879 THR A CA  
2538 C C   . THR A 357 ? 0.5520 0.6814 0.5977 -0.0479 -0.1976 0.1091  879 THR A C   
2539 O O   . THR A 357 ? 0.5190 0.6632 0.5726 -0.0423 -0.1846 0.1151  879 THR A O   
2540 C CB  . THR A 357 ? 0.5134 0.6266 0.5911 -0.0544 -0.1947 0.1054  879 THR A CB  
2541 O OG1 . THR A 357 ? 0.4806 0.6108 0.5878 -0.0510 -0.1785 0.1161  879 THR A OG1 
2542 C CG2 . THR A 357 ? 0.5130 0.6077 0.5869 -0.0545 -0.1943 0.0937  879 THR A CG2 
2543 N N   . VAL A 358 ? 0.6076 0.7357 0.6487 -0.0564 -0.2162 0.1147  880 VAL A N   
2544 C CA  . VAL A 358 ? 0.6206 0.7643 0.6583 -0.0583 -0.2230 0.1261  880 VAL A CA  
2545 C C   . VAL A 358 ? 0.5839 0.7510 0.6607 -0.0596 -0.2126 0.1452  880 VAL A C   
2546 O O   . VAL A 358 ? 0.5626 0.7443 0.6373 -0.0554 -0.2072 0.1523  880 VAL A O   
2547 C CB  . VAL A 358 ? 0.6737 0.8086 0.6963 -0.0685 -0.2478 0.1276  880 VAL A CB  
2548 C CG1 . VAL A 358 ? 0.6985 0.8488 0.7106 -0.0690 -0.2546 0.1375  880 VAL A CG1 
2549 C CG2 . VAL A 358 ? 0.7124 0.8184 0.6944 -0.0665 -0.2591 0.1076  880 VAL A CG2 
2550 N N   . PRO A 359 ? 0.5634 0.7342 0.6753 -0.0641 -0.2093 0.1539  881 PRO A N   
2551 C CA  . PRO A 359 ? 0.5439 0.7342 0.6901 -0.0627 -0.1987 0.1709  881 PRO A CA  
2552 C C   . PRO A 359 ? 0.5298 0.7232 0.6770 -0.0528 -0.1796 0.1680  881 PRO A C   
2553 O O   . PRO A 359 ? 0.5322 0.7396 0.6914 -0.0507 -0.1746 0.1800  881 PRO A O   
2554 C CB  . PRO A 359 ? 0.5274 0.7191 0.7063 -0.0666 -0.1972 0.1782  881 PRO A CB  
2555 C CG  . PRO A 359 ? 0.5389 0.7148 0.7030 -0.0738 -0.2114 0.1688  881 PRO A CG  
2556 C CD  . PRO A 359 ? 0.5511 0.7097 0.6732 -0.0695 -0.2140 0.1498  881 PRO A CD  
2557 N N   . LEU A 360 ? 0.5151 0.6954 0.6504 -0.0475 -0.1700 0.1533  882 LEU A N   
2558 C CA  . LEU A 360 ? 0.4894 0.6717 0.6256 -0.0398 -0.1537 0.1508  882 LEU A CA  
2559 C C   . LEU A 360 ? 0.5002 0.6896 0.6113 -0.0360 -0.1541 0.1497  882 LEU A C   
2560 O O   . LEU A 360 ? 0.4781 0.6797 0.5990 -0.0336 -0.1468 0.1596  882 LEU A O   
2561 C CB  . LEU A 360 ? 0.4840 0.6517 0.6153 -0.0358 -0.1442 0.1365  882 LEU A CB  
2562 C CG  . LEU A 360 ? 0.4745 0.6435 0.6091 -0.0293 -0.1284 0.1347  882 LEU A CG  
2563 C CD1 . LEU A 360 ? 0.4672 0.6430 0.6321 -0.0290 -0.1210 0.1481  882 LEU A CD1 
2564 C CD2 . LEU A 360 ? 0.4737 0.6289 0.6009 -0.0259 -0.1208 0.1206  882 LEU A CD2 
2565 N N   . GLN A 361 ? 0.5199 0.7016 0.5983 -0.0349 -0.1629 0.1383  883 GLN A N   
2566 C CA  . GLN A 361 ? 0.5448 0.7351 0.5958 -0.0298 -0.1640 0.1376  883 GLN A CA  
2567 C C   . GLN A 361 ? 0.5364 0.7460 0.5982 -0.0331 -0.1685 0.1554  883 GLN A C   
2568 O O   . GLN A 361 ? 0.5344 0.7580 0.5907 -0.0287 -0.1620 0.1618  883 GLN A O   
2569 C CB  . GLN A 361 ? 0.5967 0.7725 0.6098 -0.0282 -0.1764 0.1233  883 GLN A CB  
2570 C CG  . GLN A 361 ? 0.6326 0.8159 0.6111 -0.0197 -0.1762 0.1200  883 GLN A CG  
2571 C CD  . GLN A 361 ? 0.6724 0.8364 0.6099 -0.0161 -0.1889 0.1039  883 GLN A CD  
2572 O OE1 . GLN A 361 ? 0.6822 0.8268 0.6184 -0.0224 -0.2007 0.0966  883 GLN A OE1 
2573 N NE2 . GLN A 361 ? 0.7020 0.8709 0.6054 -0.0055 -0.1867 0.0988  883 GLN A NE2 
2574 N N   . THR A 362 ? 0.5278 0.7396 0.6068 -0.0411 -0.1795 0.1649  884 THR A N   
2575 C CA  . THR A 362 ? 0.5407 0.7710 0.6334 -0.0447 -0.1844 0.1831  884 THR A CA  
2576 C C   . THR A 362 ? 0.5147 0.7560 0.6388 -0.0424 -0.1707 0.1963  884 THR A C   
2577 O O   . THR A 362 ? 0.5155 0.7715 0.6405 -0.0409 -0.1685 0.2075  884 THR A O   
2578 C CB  . THR A 362 ? 0.5527 0.7836 0.6591 -0.0541 -0.2001 0.1913  884 THR A CB  
2579 O OG1 . THR A 362 ? 0.5680 0.7850 0.6430 -0.0573 -0.2154 0.1791  884 THR A OG1 
2580 C CG2 . THR A 362 ? 0.5565 0.8076 0.6775 -0.0577 -0.2059 0.2112  884 THR A CG2 
2581 N N   . ASP A 363 ? 0.5043 0.7373 0.6526 -0.0419 -0.1621 0.1949  885 ASP A N   
2582 C CA  . ASP A 363 ? 0.4919 0.7288 0.6670 -0.0388 -0.1496 0.2047  885 ASP A CA  
2583 C C   . ASP A 363 ? 0.4929 0.7322 0.6566 -0.0340 -0.1396 0.2025  885 ASP A C   
2584 O O   . ASP A 363 ? 0.4913 0.7388 0.6702 -0.0333 -0.1350 0.2153  885 ASP A O   
2585 C CB  . ASP A 363 ? 0.4865 0.7111 0.6822 -0.0374 -0.1419 0.1999  885 ASP A CB  
2586 C CG  . ASP A 363 ? 0.4932 0.7167 0.7134 -0.0330 -0.1298 0.2083  885 ASP A CG  
2587 O OD1 . ASP A 363 ? 0.4918 0.7255 0.7294 -0.0331 -0.1312 0.2241  885 ASP A OD1 
2588 O OD2 . ASP A 363 ? 0.4868 0.6977 0.7078 -0.0291 -0.1197 0.1989  885 ASP A OD2 
2589 N N   . LEU A 364 ? 0.4885 0.7211 0.6265 -0.0307 -0.1369 0.1877  886 LEU A N   
2590 C CA  . LEU A 364 ? 0.4877 0.7252 0.6162 -0.0262 -0.1272 0.1868  886 LEU A CA  
2591 C C   . LEU A 364 ? 0.4997 0.7556 0.6093 -0.0247 -0.1308 0.1947  886 LEU A C   
2592 O O   . LEU A 364 ? 0.4938 0.7613 0.6094 -0.0236 -0.1245 0.2048  886 LEU A O   
2593 C CB  . LEU A 364 ? 0.4798 0.7048 0.5908 -0.0220 -0.1213 0.1691  886 LEU A CB  
2594 C CG  . LEU A 364 ? 0.4567 0.6643 0.5827 -0.0230 -0.1172 0.1604  886 LEU A CG  
2595 C CD1 . LEU A 364 ? 0.4633 0.6600 0.5697 -0.0189 -0.1129 0.1436  886 LEU A CD1 
2596 C CD2 . LEU A 364 ? 0.4465 0.6517 0.5999 -0.0233 -0.1085 0.1687  886 LEU A CD2 
2597 N N   . ARG A 365 ? 0.5357 0.7938 0.6217 -0.0247 -0.1416 0.1904  887 ARG A N   
2598 C CA  . ARG A 365 ? 0.5820 0.8577 0.6461 -0.0221 -0.1460 0.1974  887 ARG A CA  
2599 C C   . ARG A 365 ? 0.5736 0.8670 0.6606 -0.0260 -0.1464 0.2191  887 ARG A C   
2600 O O   . ARG A 365 ? 0.5846 0.8953 0.6661 -0.0234 -0.1422 0.2291  887 ARG A O   
2601 C CB  . ARG A 365 ? 0.6489 0.9187 0.6857 -0.0230 -0.1607 0.1893  887 ARG A CB  
2602 C CG  . ARG A 365 ? 0.7055 0.9909 0.7124 -0.0190 -0.1668 0.1940  887 ARG A CG  
2603 C CD  . ARG A 365 ? 0.7438 1.0214 0.7315 -0.0233 -0.1850 0.1899  887 ARG A CD  
2604 N NE  . ARG A 365 ? 0.7537 1.0389 0.7699 -0.0332 -0.1938 0.2060  887 ARG A NE  
2605 C CZ  . ARG A 365 ? 0.7690 1.0739 0.7881 -0.0355 -0.1990 0.2229  887 ARG A CZ  
2606 N NH1 . ARG A 365 ? 0.7446 1.0556 0.7918 -0.0439 -0.2069 0.2375  887 ARG A NH1 
2607 N NH2 . ARG A 365 ? 0.7952 1.1157 0.7900 -0.0288 -0.1962 0.2266  887 ARG A NH2 
2608 N N   . LYS A 366 ? 0.5517 0.8412 0.6661 -0.0318 -0.1508 0.2272  888 LYS A N   
2609 C CA  . LYS A 366 ? 0.5582 0.8615 0.6969 -0.0353 -0.1523 0.2478  888 LYS A CA  
2610 C C   . LYS A 366 ? 0.5290 0.8375 0.6839 -0.0338 -0.1416 0.2579  888 LYS A C   
2611 O O   . LYS A 366 ? 0.5335 0.8579 0.6960 -0.0353 -0.1429 0.2749  888 LYS A O   
2612 C CB  . LYS A 366 ? 0.5723 0.8681 0.7398 -0.0394 -0.1563 0.2530  888 LYS A CB  
2613 C CG  . LYS A 366 ? 0.6079 0.9052 0.7671 -0.0441 -0.1709 0.2523  888 LYS A CG  
2614 C CD  . LYS A 366 ? 0.6684 0.9846 0.8157 -0.0464 -0.1808 0.2652  888 LYS A CD  
2615 C CE  . LYS A 366 ? 0.6806 0.9977 0.8218 -0.0527 -0.1976 0.2664  888 LYS A CE  
2616 N NZ  . LYS A 366 ? 0.6715 0.9779 0.8374 -0.0565 -0.1995 0.2649  888 LYS A NZ  
2617 N N   . PHE A 367 ? 0.5151 0.8092 0.6763 -0.0318 -0.1320 0.2482  889 PHE A N   
2618 C CA  . PHE A 367 ? 0.4992 0.7940 0.6751 -0.0318 -0.1234 0.2564  889 PHE A CA  
2619 C C   . PHE A 367 ? 0.5281 0.8423 0.6857 -0.0300 -0.1211 0.2624  889 PHE A C   
2620 O O   . PHE A 367 ? 0.5252 0.8486 0.6959 -0.0321 -0.1180 0.2772  889 PHE A O   
2621 C CB  . PHE A 367 ? 0.4720 0.7457 0.6562 -0.0304 -0.1151 0.2438  889 PHE A CB  
2622 C CG  . PHE A 367 ? 0.4497 0.7078 0.6587 -0.0309 -0.1148 0.2448  889 PHE A CG  
2623 C CD1 . PHE A 367 ? 0.4485 0.7056 0.6815 -0.0320 -0.1145 0.2601  889 PHE A CD1 
2624 C CD2 . PHE A 367 ? 0.4476 0.6926 0.6557 -0.0295 -0.1148 0.2313  889 PHE A CD2 
2625 C CE1 . PHE A 367 ? 0.4470 0.6903 0.7015 -0.0299 -0.1131 0.2613  889 PHE A CE1 
2626 C CE2 . PHE A 367 ? 0.4386 0.6727 0.6697 -0.0284 -0.1133 0.2338  889 PHE A CE2 
2627 C CZ  . PHE A 367 ? 0.4435 0.6768 0.6970 -0.0277 -0.1119 0.2485  889 PHE A CZ  
2628 N N   . ARG A 368 ? 0.5544 0.8746 0.6815 -0.0256 -0.1227 0.2514  890 ARG A N   
2629 C CA  . ARG A 368 ? 0.5543 0.8963 0.6605 -0.0214 -0.1200 0.2572  890 ARG A CA  
2630 C C   . ARG A 368 ? 0.5175 0.8629 0.6306 -0.0205 -0.1097 0.2599  890 ARG A C   
2631 O O   . ARG A 368 ? 0.5200 0.8874 0.6323 -0.0200 -0.1068 0.2747  890 ARG A O   
2632 C CB  . ARG A 368 ? 0.5912 0.9549 0.7033 -0.0242 -0.1256 0.2784  890 ARG A CB  
2633 C CG  . ARG A 368 ? 0.6353 1.0011 0.7348 -0.0250 -0.1373 0.2776  890 ARG A CG  
2634 C CD  . ARG A 368 ? 0.6722 1.0595 0.7814 -0.0285 -0.1427 0.3003  890 ARG A CD  
2635 N NE  . ARG A 368 ? 0.7034 1.1160 0.7919 -0.0237 -0.1394 0.3093  890 ARG A NE  
2636 C CZ  . ARG A 368 ? 0.7091 1.1443 0.8087 -0.0263 -0.1402 0.3320  890 ARG A CZ  
2637 N NH1 . ARG A 368 ? 0.7065 1.1397 0.8372 -0.0335 -0.1445 0.3471  890 ARG A NH1 
2638 N NH2 . ARG A 368 ? 0.7186 1.1791 0.7983 -0.0209 -0.1363 0.3404  890 ARG A NH2 
2639 N N   . THR A 369 ? 0.4815 0.8064 0.6019 -0.0208 -0.1047 0.2467  891 THR A N   
2640 C CA  . THR A 369 ? 0.4676 0.7939 0.5953 -0.0212 -0.0964 0.2488  891 THR A CA  
2641 C C   . THR A 369 ? 0.4367 0.7548 0.5465 -0.0155 -0.0903 0.2306  891 THR A C   
2642 O O   . THR A 369 ? 0.4333 0.7606 0.5427 -0.0143 -0.0837 0.2339  891 THR A O   
2643 C CB  . THR A 369 ? 0.4742 0.7835 0.6329 -0.0281 -0.0957 0.2552  891 THR A CB  
2644 O OG1 . THR A 369 ? 0.4820 0.7975 0.6489 -0.0311 -0.0908 0.2641  891 THR A OG1 
2645 C CG2 . THR A 369 ? 0.4867 0.7688 0.6497 -0.0275 -0.0943 0.2375  891 THR A CG2 
2646 N N   . TYR A 370 ? 0.4244 0.7263 0.5207 -0.0123 -0.0930 0.2128  892 TYR A N   
2647 C CA  . TYR A 370 ? 0.4259 0.7165 0.5080 -0.0072 -0.0878 0.1953  892 TYR A CA  
2648 C C   . TYR A 370 ? 0.4493 0.7538 0.4990 0.0025  -0.0861 0.1896  892 TYR A C   
2649 O O   . TYR A 370 ? 0.4803 0.7864 0.5096 0.0062  -0.0928 0.1857  892 TYR A O   
2650 C CB  . TYR A 370 ? 0.4105 0.6766 0.4932 -0.0083 -0.0920 0.1796  892 TYR A CB  
2651 C CG  . TYR A 370 ? 0.3896 0.6404 0.5016 -0.0148 -0.0914 0.1826  892 TYR A CG  
2652 C CD1 . TYR A 370 ? 0.3806 0.6195 0.5041 -0.0160 -0.0845 0.1781  892 TYR A CD1 
2653 C CD2 . TYR A 370 ? 0.3940 0.6421 0.5210 -0.0188 -0.0978 0.1899  892 TYR A CD2 
2654 C CE1 . TYR A 370 ? 0.3665 0.5893 0.5131 -0.0199 -0.0836 0.1798  892 TYR A CE1 
2655 C CE2 . TYR A 370 ? 0.3867 0.6207 0.5390 -0.0221 -0.0962 0.1926  892 TYR A CE2 
2656 C CZ  . TYR A 370 ? 0.3605 0.5808 0.5211 -0.0221 -0.0889 0.1869  892 TYR A CZ  
2657 O OH  . TYR A 370 ? 0.3355 0.5402 0.5175 -0.0234 -0.0870 0.1887  892 TYR A OH  
2658 N N   . LYS A 371 ? 0.4567 0.7706 0.5010 0.0073  -0.0774 0.1893  893 LYS A N   
2659 C CA  . LYS A 371 ? 0.4854 0.8099 0.4977 0.0195  -0.0737 0.1815  893 LYS A CA  
2660 C C   . LYS A 371 ? 0.4698 0.7696 0.4668 0.0242  -0.0742 0.1589  893 LYS A C   
2661 O O   . LYS A 371 ? 0.4577 0.7443 0.4687 0.0210  -0.0702 0.1527  893 LYS A O   
2662 C CB  . LYS A 371 ? 0.5033 0.8523 0.5190 0.0232  -0.0637 0.1934  893 LYS A CB  
2663 C CG  . LYS A 371 ? 0.5204 0.8957 0.5525 0.0179  -0.0634 0.2180  893 LYS A CG  
2664 C CD  . LYS A 371 ? 0.5582 0.9672 0.5778 0.0270  -0.0552 0.2305  893 LYS A CD  
2665 C CE  . LYS A 371 ? 0.5873 1.0222 0.6010 0.0284  -0.0579 0.2481  893 LYS A CE  
2666 N NZ  . LYS A 371 ? 0.6238 1.0919 0.6166 0.0417  -0.0492 0.2568  893 LYS A NZ  
2667 N N   . GLY A 372 ? 0.4848 0.7774 0.4518 0.0317  -0.0800 0.1471  894 GLY A N   
2668 C CA  . GLY A 372 ? 0.4854 0.7520 0.4364 0.0354  -0.0833 0.1263  894 GLY A CA  
2669 C C   . GLY A 372 ? 0.4844 0.7516 0.4186 0.0467  -0.0743 0.1168  894 GLY A C   
2670 O O   . GLY A 372 ? 0.4723 0.7171 0.3973 0.0491  -0.0760 0.1004  894 GLY A O   
2671 N N   . GLY A 373 ? 0.4944 0.7886 0.4256 0.0535  -0.0650 0.1284  895 GLY A N   
2672 C CA  . GLY A 373 ? 0.5082 0.8091 0.4269 0.0650  -0.0549 0.1233  895 GLY A CA  
2673 C C   . GLY A 373 ? 0.4854 0.7910 0.4336 0.0580  -0.0473 0.1299  895 GLY A C   
2674 O O   . GLY A 373 ? 0.4992 0.8141 0.4414 0.0663  -0.0388 0.1288  895 GLY A O   
2675 N N   . SER A 374 ? 0.4583 0.7558 0.4369 0.0432  -0.0508 0.1364  896 SER A N   
2676 C CA  . SER A 374 ? 0.4213 0.7220 0.4279 0.0346  -0.0457 0.1449  896 SER A CA  
2677 C C   . SER A 374 ? 0.4000 0.6711 0.4194 0.0275  -0.0481 0.1316  896 SER A C   
2678 O O   . SER A 374 ? 0.3931 0.6456 0.4158 0.0227  -0.0550 0.1249  896 SER A O   
2679 C CB  . SER A 374 ? 0.4094 0.7245 0.4394 0.0243  -0.0479 0.1651  896 SER A CB  
2680 O OG  . SER A 374 ? 0.3929 0.6973 0.4502 0.0130  -0.0477 0.1693  896 SER A OG  
2681 N N   . VAL A 375 ? 0.3930 0.6619 0.4202 0.0269  -0.0424 0.1291  897 VAL A N   
2682 C CA  . VAL A 375 ? 0.3875 0.6313 0.4280 0.0202  -0.0435 0.1187  897 VAL A CA  
2683 C C   . VAL A 375 ? 0.3736 0.6114 0.4407 0.0080  -0.0462 0.1287  897 VAL A C   
2684 O O   . VAL A 375 ? 0.3449 0.5617 0.4212 0.0032  -0.0496 0.1218  897 VAL A O   
2685 C CB  . VAL A 375 ? 0.3872 0.6317 0.4265 0.0235  -0.0368 0.1139  897 VAL A CB  
2686 C CG1 . VAL A 375 ? 0.3757 0.5972 0.4307 0.0155  -0.0376 0.1063  897 VAL A CG1 
2687 C CG2 . VAL A 375 ? 0.4087 0.6516 0.4208 0.0370  -0.0347 0.1009  897 VAL A CG2 
2688 N N   . ARG A 376 ? 0.3830 0.6392 0.4621 0.0036  -0.0449 0.1459  898 ARG A N   
2689 C CA  . ARG A 376 ? 0.3883 0.6367 0.4908 -0.0073 -0.0484 0.1560  898 ARG A CA  
2690 C C   . ARG A 376 ? 0.3884 0.6257 0.4946 -0.0091 -0.0542 0.1548  898 ARG A C   
2691 O O   . ARG A 376 ? 0.3666 0.5841 0.4871 -0.0143 -0.0565 0.1522  898 ARG A O   
2692 C CB  . ARG A 376 ? 0.4024 0.6750 0.5150 -0.0116 -0.0481 0.1768  898 ARG A CB  
2693 C CG  . ARG A 376 ? 0.4191 0.6806 0.5553 -0.0232 -0.0528 0.1878  898 ARG A CG  
2694 C CD  . ARG A 376 ? 0.4628 0.7489 0.6082 -0.0275 -0.0549 0.2103  898 ARG A CD  
2695 N NE  . ARG A 376 ? 0.4950 0.7769 0.6601 -0.0386 -0.0583 0.2230  898 ARG A NE  
2696 C CZ  . ARG A 376 ? 0.5219 0.8125 0.7024 -0.0465 -0.0635 0.2426  898 ARG A CZ  
2697 N NH1 . ARG A 376 ? 0.5699 0.8758 0.7495 -0.0443 -0.0650 0.2525  898 ARG A NH1 
2698 N NH2 . ARG A 376 ? 0.5342 0.8161 0.7307 -0.0573 -0.0683 0.2526  898 ARG A NH2 
2699 N N   . ASP A 377 ? 0.3857 0.6366 0.4783 -0.0041 -0.0566 0.1573  899 ASP A N   
2700 C CA  . ASP A 377 ? 0.3954 0.6406 0.4931 -0.0067 -0.0632 0.1599  899 ASP A CA  
2701 C C   . ASP A 377 ? 0.3661 0.5892 0.4607 -0.0059 -0.0664 0.1445  899 ASP A C   
2702 O O   . ASP A 377 ? 0.3402 0.5538 0.4491 -0.0102 -0.0705 0.1473  899 ASP A O   
2703 C CB  . ASP A 377 ? 0.4228 0.6899 0.5062 -0.0025 -0.0659 0.1687  899 ASP A CB  
2704 C CG  . ASP A 377 ? 0.4298 0.7168 0.5274 -0.0073 -0.0657 0.1898  899 ASP A CG  
2705 O OD1 . ASP A 377 ? 0.4428 0.7277 0.5584 -0.0135 -0.0634 0.1973  899 ASP A OD1 
2706 O OD2 . ASP A 377 ? 0.4657 0.7697 0.5562 -0.0054 -0.0688 0.1994  899 ASP A OD2 
2707 N N   . LEU A 378 ? 0.3581 0.5739 0.4356 -0.0002 -0.0647 0.1297  900 LEU A N   
2708 C CA  . LEU A 378 ? 0.3562 0.5511 0.4332 -0.0007 -0.0680 0.1164  900 LEU A CA  
2709 C C   . LEU A 378 ? 0.3407 0.5201 0.4388 -0.0058 -0.0646 0.1151  900 LEU A C   
2710 O O   . LEU A 378 ? 0.3313 0.4983 0.4401 -0.0083 -0.0676 0.1127  900 LEU A O   
2711 C CB  . LEU A 378 ? 0.3682 0.5570 0.4222 0.0064  -0.0673 0.1015  900 LEU A CB  
2712 C CG  . LEU A 378 ? 0.3659 0.5331 0.4201 0.0051  -0.0712 0.0886  900 LEU A CG  
2713 C CD1 . LEU A 378 ? 0.3699 0.5327 0.4282 0.0009  -0.0807 0.0909  900 LEU A CD1 
2714 C CD2 . LEU A 378 ? 0.3816 0.5418 0.4119 0.0126  -0.0711 0.0747  900 LEU A CD2 
2715 N N   . LEU A 379 ? 0.3315 0.5124 0.4350 -0.0069 -0.0588 0.1173  901 LEU A N   
2716 C CA  . LEU A 379 ? 0.3183 0.4829 0.4382 -0.0112 -0.0561 0.1158  901 LEU A CA  
2717 C C   . LEU A 379 ? 0.3087 0.4702 0.4470 -0.0157 -0.0588 0.1273  901 LEU A C   
2718 O O   . LEU A 379 ? 0.3081 0.4536 0.4577 -0.0165 -0.0583 0.1245  901 LEU A O   
2719 C CB  . LEU A 379 ? 0.3118 0.4781 0.4317 -0.0124 -0.0512 0.1162  901 LEU A CB  
2720 C CG  . LEU A 379 ? 0.3139 0.4813 0.4182 -0.0072 -0.0476 0.1048  901 LEU A CG  
2721 C CD1 . LEU A 379 ? 0.3197 0.4938 0.4268 -0.0094 -0.0437 0.1094  901 LEU A CD1 
2722 C CD2 . LEU A 379 ? 0.3107 0.4586 0.4136 -0.0057 -0.0473 0.0908  901 LEU A CD2 
2723 N N   . ARG A 380 ? 0.3224 0.4997 0.4631 -0.0176 -0.0613 0.1407  902 ARG A N   
2724 C CA  . ARG A 380 ? 0.3342 0.5090 0.4921 -0.0215 -0.0645 0.1531  902 ARG A CA  
2725 C C   . ARG A 380 ? 0.3212 0.4925 0.4833 -0.0198 -0.0685 0.1520  902 ARG A C   
2726 O O   . ARG A 380 ? 0.3079 0.4679 0.4859 -0.0206 -0.0691 0.1559  902 ARG A O   
2727 C CB  . ARG A 380 ? 0.3629 0.5583 0.5222 -0.0243 -0.0666 0.1693  902 ARG A CB  
2728 C CG  . ARG A 380 ? 0.4064 0.5980 0.5846 -0.0290 -0.0703 0.1838  902 ARG A CG  
2729 C CD  . ARG A 380 ? 0.4518 0.6644 0.6330 -0.0330 -0.0723 0.2015  902 ARG A CD  
2730 N NE  . ARG A 380 ? 0.4798 0.7180 0.6464 -0.0292 -0.0731 0.2056  902 ARG A NE  
2731 C CZ  . ARG A 380 ? 0.4978 0.7470 0.6658 -0.0290 -0.0778 0.2151  902 ARG A CZ  
2732 N NH1 . ARG A 380 ? 0.4826 0.7213 0.6684 -0.0322 -0.0818 0.2226  902 ARG A NH1 
2733 N NH2 . ARG A 380 ? 0.5137 0.7847 0.6639 -0.0247 -0.0784 0.2173  902 ARG A NH2 
2734 N N   . ALA A 381 ? 0.3175 0.4982 0.4648 -0.0171 -0.0718 0.1473  903 ALA A N   
2735 C CA  . ALA A 381 ? 0.3274 0.5052 0.4784 -0.0170 -0.0774 0.1465  903 ALA A CA  
2736 C C   . ALA A 381 ? 0.3165 0.4765 0.4768 -0.0162 -0.0748 0.1373  903 ALA A C   
2737 O O   . ALA A 381 ? 0.3110 0.4671 0.4868 -0.0166 -0.0765 0.1424  903 ALA A O   
2738 C CB  . ALA A 381 ? 0.3388 0.5256 0.4684 -0.0148 -0.0832 0.1413  903 ALA A CB  
2739 N N   . MET A 382 ? 0.3159 0.4669 0.4678 -0.0144 -0.0701 0.1253  904 MET A N   
2740 C CA  . MET A 382 ? 0.3309 0.4663 0.4914 -0.0133 -0.0666 0.1177  904 MET A CA  
2741 C C   . MET A 382 ? 0.3304 0.4553 0.5084 -0.0130 -0.0620 0.1234  904 MET A C   
2742 O O   . MET A 382 ? 0.3163 0.4344 0.5071 -0.0109 -0.0609 0.1246  904 MET A O   
2743 C CB  . MET A 382 ? 0.3306 0.4589 0.4782 -0.0116 -0.0624 0.1048  904 MET A CB  
2744 C CG  . MET A 382 ? 0.3511 0.4839 0.4797 -0.0101 -0.0670 0.0969  904 MET A CG  
2745 S SD  . MET A 382 ? 0.3542 0.4819 0.4665 -0.0068 -0.0616 0.0842  904 MET A SD  
2746 C CE  . MET A 382 ? 0.3288 0.4398 0.4554 -0.0076 -0.0565 0.0786  904 MET A CE  
2747 N N   . ARG A 383 ? 0.3479 0.4712 0.5258 -0.0146 -0.0597 0.1272  905 ARG A N   
2748 C CA  . ARG A 383 ? 0.3764 0.4854 0.5672 -0.0144 -0.0571 0.1320  905 ARG A CA  
2749 C C   . ARG A 383 ? 0.3609 0.4712 0.5673 -0.0130 -0.0598 0.1437  905 ARG A C   
2750 O O   . ARG A 383 ? 0.3429 0.4394 0.5602 -0.0087 -0.0567 0.1440  905 ARG A O   
2751 C CB  . ARG A 383 ? 0.4074 0.5163 0.5955 -0.0188 -0.0574 0.1369  905 ARG A CB  
2752 C CG  . ARG A 383 ? 0.4702 0.5565 0.6644 -0.0190 -0.0554 0.1360  905 ARG A CG  
2753 C CD  . ARG A 383 ? 0.5343 0.6128 0.7418 -0.0195 -0.0587 0.1482  905 ARG A CD  
2754 N NE  . ARG A 383 ? 0.6378 0.6889 0.8469 -0.0179 -0.0572 0.1441  905 ARG A NE  
2755 C CZ  . ARG A 383 ? 0.6753 0.7083 0.8874 -0.0100 -0.0529 0.1379  905 ARG A CZ  
2756 N NH1 . ARG A 383 ? 0.7382 0.7446 0.9471 -0.0080 -0.0523 0.1334  905 ARG A NH1 
2757 N NH2 . ARG A 383 ? 0.6744 0.7158 0.8923 -0.0039 -0.0497 0.1370  905 ARG A NH2 
2758 N N   . ASN A 384 ? 0.3466 0.4741 0.5534 -0.0157 -0.0653 0.1537  906 ASN A N   
2759 C CA  . ASN A 384 ? 0.3584 0.4902 0.5803 -0.0149 -0.0687 0.1663  906 ASN A CA  
2760 C C   . ASN A 384 ? 0.3411 0.4732 0.5715 -0.0112 -0.0689 0.1648  906 ASN A C   
2761 O O   . ASN A 384 ? 0.3381 0.4630 0.5840 -0.0069 -0.0667 0.1706  906 ASN A O   
2762 C CB  . ASN A 384 ? 0.3666 0.5189 0.5847 -0.0190 -0.0750 0.1775  906 ASN A CB  
2763 C CG  . ASN A 384 ? 0.3758 0.5300 0.5946 -0.0228 -0.0753 0.1865  906 ASN A CG  
2764 O OD1 . ASN A 384 ? 0.3823 0.5550 0.5932 -0.0257 -0.0783 0.1933  906 ASN A OD1 
2765 N ND2 . ASN A 384 ? 0.3787 0.5138 0.6063 -0.0226 -0.0728 0.1871  906 ASN A ND2 
2766 N N   . LYS A 385 ? 0.3392 0.4790 0.5594 -0.0125 -0.0717 0.1574  907 LYS A N   
2767 C CA  . LYS A 385 ? 0.3433 0.4850 0.5725 -0.0109 -0.0734 0.1573  907 LYS A CA  
2768 C C   . LYS A 385 ? 0.3458 0.4732 0.5842 -0.0053 -0.0652 0.1519  907 LYS A C   
2769 O O   . LYS A 385 ? 0.3406 0.4704 0.5948 -0.0018 -0.0643 0.1582  907 LYS A O   
2770 C CB  . LYS A 385 ? 0.3395 0.4879 0.5535 -0.0145 -0.0797 0.1494  907 LYS A CB  
2771 C CG  . LYS A 385 ? 0.3489 0.5113 0.5506 -0.0185 -0.0887 0.1540  907 LYS A CG  
2772 C CD  . LYS A 385 ? 0.3536 0.5279 0.5702 -0.0201 -0.0946 0.1698  907 LYS A CD  
2773 C CE  . LYS A 385 ? 0.3537 0.5356 0.5686 -0.0207 -0.0944 0.1791  907 LYS A CE  
2774 N NZ  . LYS A 385 ? 0.3568 0.5467 0.5910 -0.0210 -0.0975 0.1956  907 LYS A NZ  
2775 N N   . LYS A 386 ? 0.3608 0.4749 0.5896 -0.0040 -0.0592 0.1414  908 LYS A N   
2776 C CA  . LYS A 386 ? 0.3860 0.4848 0.6207 0.0024  -0.0510 0.1364  908 LYS A CA  
2777 C C   . LYS A 386 ? 0.4033 0.4921 0.6510 0.0084  -0.0475 0.1448  908 LYS A C   
2778 O O   . LYS A 386 ? 0.3954 0.4790 0.6539 0.0163  -0.0420 0.1467  908 LYS A O   
2779 C CB  . LYS A 386 ? 0.3931 0.4795 0.6127 0.0016  -0.0468 0.1236  908 LYS A CB  
2780 C CG  . LYS A 386 ? 0.4151 0.4854 0.6367 0.0084  -0.0387 0.1172  908 LYS A CG  
2781 C CD  . LYS A 386 ? 0.4471 0.5049 0.6538 0.0065  -0.0362 0.1064  908 LYS A CD  
2782 C CE  . LYS A 386 ? 0.4811 0.5242 0.6858 0.0130  -0.0286 0.0983  908 LYS A CE  
2783 N NZ  . LYS A 386 ? 0.5037 0.5295 0.7133 0.0205  -0.0246 0.1012  908 LYS A NZ  
2784 N N   . HIS A 387 ? 0.4423 0.5282 0.6884 0.0054  -0.0505 0.1503  909 HIS A N   
2785 C CA  . HIS A 387 ? 0.5023 0.5743 0.7582 0.0103  -0.0489 0.1580  909 HIS A CA  
2786 C C   . HIS A 387 ? 0.5071 0.5894 0.7812 0.0150  -0.0502 0.1713  909 HIS A C   
2787 O O   . HIS A 387 ? 0.5074 0.5778 0.7917 0.0242  -0.0455 0.1754  909 HIS A O   
2788 C CB  . HIS A 387 ? 0.5438 0.6140 0.7945 0.0033  -0.0541 0.1630  909 HIS A CB  
2789 C CG  . HIS A 387 ? 0.6024 0.6556 0.8619 0.0065  -0.0549 0.1715  909 HIS A CG  
2790 N ND1 . HIS A 387 ? 0.6370 0.6987 0.9103 0.0071  -0.0590 0.1863  909 HIS A ND1 
2791 C CD2 . HIS A 387 ? 0.6613 0.6877 0.9162 0.0088  -0.0535 0.1673  909 HIS A CD2 
2792 C CE1 . HIS A 387 ? 0.6818 0.7219 0.9596 0.0103  -0.0596 0.1910  909 HIS A CE1 
2793 N NE2 . HIS A 387 ? 0.6799 0.6971 0.9457 0.0112  -0.0568 0.1792  909 HIS A NE2 
2794 N N   . HIS A 388 ? 0.5196 0.6239 0.7967 0.0091  -0.0569 0.1783  910 HIS A N   
2795 C CA  . HIS A 388 ? 0.5355 0.6533 0.8300 0.0111  -0.0604 0.1932  910 HIS A CA  
2796 C C   . HIS A 388 ? 0.5172 0.6487 0.8205 0.0127  -0.0606 0.1943  910 HIS A C   
2797 O O   . HIS A 388 ? 0.5043 0.6524 0.8207 0.0114  -0.0661 0.2069  910 HIS A O   
2798 C CB  . HIS A 388 ? 0.5546 0.6885 0.8460 0.0026  -0.0695 0.2022  910 HIS A CB  
2799 C CG  . HIS A 388 ? 0.5871 0.7120 0.8779 0.0011  -0.0705 0.2082  910 HIS A CG  
2800 N ND1 . HIS A 388 ? 0.6209 0.7370 0.9270 0.0065  -0.0698 0.2195  910 HIS A ND1 
2801 C CD2 . HIS A 388 ? 0.6288 0.7530 0.9068 -0.0054 -0.0727 0.2059  910 HIS A CD2 
2802 C CE1 . HIS A 388 ? 0.6447 0.7530 0.9472 0.0022  -0.0726 0.2238  910 HIS A CE1 
2803 N NE2 . HIS A 388 ? 0.6469 0.7616 0.9333 -0.0053 -0.0743 0.2165  910 HIS A NE2 
2804 N N   . TYR A 389 ? 0.4968 0.6220 0.7938 0.0148  -0.0554 0.1827  911 TYR A N   
2805 C CA  . TYR A 389 ? 0.4908 0.6296 0.7933 0.0129  -0.0577 0.1829  911 TYR A CA  
2806 C C   . TYR A 389 ? 0.5091 0.6614 0.8359 0.0184  -0.0573 0.1985  911 TYR A C   
2807 O O   . TYR A 389 ? 0.4880 0.6584 0.8225 0.0121  -0.0661 0.2070  911 TYR A O   
2808 C CB  . TYR A 389 ? 0.4838 0.6121 0.7778 0.0157  -0.0506 0.1695  911 TYR A CB  
2809 C CG  . TYR A 389 ? 0.4755 0.6166 0.7744 0.0120  -0.0543 0.1699  911 TYR A CG  
2810 C CD1 . TYR A 389 ? 0.4792 0.6296 0.7982 0.0182  -0.0499 0.1795  911 TYR A CD1 
2811 C CD2 . TYR A 389 ? 0.4769 0.6206 0.7605 0.0026  -0.0624 0.1616  911 TYR A CD2 
2812 C CE1 . TYR A 389 ? 0.4675 0.6305 0.7933 0.0133  -0.0547 0.1822  911 TYR A CE1 
2813 C CE2 . TYR A 389 ? 0.4611 0.6133 0.7490 -0.0019 -0.0677 0.1624  911 TYR A CE2 
2814 C CZ  . TYR A 389 ? 0.4562 0.6186 0.7663 0.0025  -0.0644 0.1734  911 TYR A CZ  
2815 O OH  . TYR A 389 ? 0.4398 0.6117 0.7567 -0.0033 -0.0708 0.1766  911 TYR A OH  
2816 N N   . ARG A 390 ? 0.5469 0.6899 0.8848 0.0304  -0.0476 0.2026  912 ARG A N   
2817 C CA  . ARG A 390 ? 0.5950 0.7522 0.9577 0.0385  -0.0452 0.2188  912 ARG A CA  
2818 C C   . ARG A 390 ? 0.5682 0.7414 0.9421 0.0328  -0.0552 0.2341  912 ARG A C   
2819 O O   . ARG A 390 ? 0.5185 0.7131 0.9094 0.0305  -0.0606 0.2473  912 ARG A O   
2820 C CB  . ARG A 390 ? 0.6643 0.8048 1.0327 0.0552  -0.0325 0.2197  912 ARG A CB  
2821 C CG  . ARG A 390 ? 0.7305 0.8513 1.0840 0.0619  -0.0225 0.2039  912 ARG A CG  
2822 C CD  . ARG A 390 ? 0.7903 0.9214 1.1557 0.0721  -0.0133 0.2075  912 ARG A CD  
2823 N NE  . ARG A 390 ? 0.8502 1.0068 1.2259 0.0620  -0.0201 0.2137  912 ARG A NE  
2824 C CZ  . ARG A 390 ? 0.8670 1.0322 1.2460 0.0633  -0.0157 0.2121  912 ARG A CZ  
2825 N NH1 . ARG A 390 ? 0.8575 1.0438 1.2464 0.0521  -0.0249 0.2191  912 ARG A NH1 
2826 N NH2 . ARG A 390 ? 0.8662 1.0184 1.2380 0.0753  -0.0032 0.2040  912 ARG A NH2 
2827 N N   . GLU A 391 ? 0.5629 0.7267 0.9272 0.0296  -0.0586 0.2331  913 GLU A N   
2828 C CA  . GLU A 391 ? 0.5709 0.7485 0.9437 0.0246  -0.0676 0.2476  913 GLU A CA  
2829 C C   . GLU A 391 ? 0.5332 0.7290 0.8974 0.0108  -0.0805 0.2484  913 GLU A C   
2830 O O   . GLU A 391 ? 0.5400 0.7499 0.9106 0.0063  -0.0890 0.2611  913 GLU A O   
2831 C CB  . GLU A 391 ? 0.6302 0.7913 0.9953 0.0255  -0.0669 0.2471  913 GLU A CB  
2832 C CG  . GLU A 391 ? 0.6901 0.8290 1.0623 0.0394  -0.0568 0.2476  913 GLU A CG  
2833 C CD  . GLU A 391 ? 0.7656 0.8768 1.1183 0.0395  -0.0528 0.2326  913 GLU A CD  
2834 O OE1 . GLU A 391 ? 0.7809 0.8904 1.1210 0.0295  -0.0587 0.2296  913 GLU A OE1 
2835 O OE2 . GLU A 391 ? 0.8236 0.9153 1.1735 0.0501  -0.0437 0.2245  913 GLU A OE2 
2836 N N   . LEU A 392 ? 0.5184 0.7125 0.8668 0.0048  -0.0826 0.2351  914 LEU A N   
2837 C CA  . LEU A 392 ? 0.5224 0.7285 0.8573 -0.0069 -0.0954 0.2332  914 LEU A CA  
2838 C C   . LEU A 392 ? 0.4979 0.7231 0.8495 -0.0110 -0.1044 0.2460  914 LEU A C   
2839 O O   . LEU A 392 ? 0.4943 0.7239 0.8650 -0.0056 -0.0993 0.2520  914 LEU A O   
2840 C CB  . LEU A 392 ? 0.5220 0.7175 0.8341 -0.0108 -0.0950 0.2144  914 LEU A CB  
2841 C CG  . LEU A 392 ? 0.5333 0.7120 0.8266 -0.0089 -0.0878 0.2008  914 LEU A CG  
2842 C CD1 . LEU A 392 ? 0.5405 0.7110 0.8159 -0.0114 -0.0870 0.1843  914 LEU A CD1 
2843 C CD2 . LEU A 392 ? 0.5300 0.7129 0.8110 -0.0130 -0.0927 0.2036  914 LEU A CD2 
2844 N N   . PRO A 393 ? 0.4977 0.7349 0.8417 -0.0206 -0.1183 0.2509  915 PRO A N   
2845 C CA  . PRO A 393 ? 0.4958 0.7503 0.8538 -0.0271 -0.1300 0.2629  915 PRO A CA  
2846 C C   . PRO A 393 ? 0.4817 0.7338 0.8410 -0.0300 -0.1311 0.2563  915 PRO A C   
2847 O O   . PRO A 393 ? 0.4565 0.6940 0.7944 -0.0318 -0.1296 0.2391  915 PRO A O   
2848 C CB  . PRO A 393 ? 0.5107 0.7706 0.8479 -0.0373 -0.1452 0.2622  915 PRO A CB  
2849 C CG  . PRO A 393 ? 0.5200 0.7755 0.8471 -0.0333 -0.1395 0.2611  915 PRO A CG  
2850 C CD  . PRO A 393 ? 0.5078 0.7456 0.8327 -0.0249 -0.1240 0.2493  915 PRO A CD  
2851 N N   . ALA A 394 ? 0.4732 0.7411 0.8587 -0.0306 -0.1339 0.2714  916 ALA A N   
2852 C CA  . ALA A 394 ? 0.4953 0.7642 0.8879 -0.0330 -0.1341 0.2692  916 ALA A CA  
2853 C C   . ALA A 394 ? 0.5097 0.7652 0.8749 -0.0433 -0.1446 0.2525  916 ALA A C   
2854 O O   . ALA A 394 ? 0.4991 0.7437 0.8583 -0.0413 -0.1382 0.2412  916 ALA A O   
2855 C CB  . ALA A 394 ? 0.4861 0.7795 0.9093 -0.0370 -0.1422 0.2915  916 ALA A CB  
2856 N N   . GLU A 395 ? 0.5592 0.8153 0.9072 -0.0534 -0.1609 0.2515  917 GLU A N   
2857 C CA  . GLU A 395 ? 0.5834 0.8253 0.9034 -0.0627 -0.1735 0.2365  917 GLU A CA  
2858 C C   . GLU A 395 ? 0.5520 0.7737 0.8415 -0.0574 -0.1649 0.2148  917 GLU A C   
2859 O O   . GLU A 395 ? 0.5240 0.7312 0.7920 -0.0612 -0.1704 0.2005  917 GLU A O   
2860 C CB  . GLU A 395 ? 0.6385 0.8861 0.9471 -0.0740 -0.1947 0.2424  917 GLU A CB  
2861 C CG  . GLU A 395 ? 0.6792 0.9294 0.9724 -0.0715 -0.1953 0.2426  917 GLU A CG  
2862 C CD  . GLU A 395 ? 0.7391 1.0008 1.0293 -0.0817 -0.2152 0.2545  917 GLU A CD  
2863 O OE1 . GLU A 395 ? 0.7811 1.0448 1.0541 -0.0805 -0.2175 0.2539  917 GLU A OE1 
2864 O OE2 . GLU A 395 ? 0.7426 1.0124 1.0479 -0.0911 -0.2289 0.2655  917 GLU A OE2 
2865 N N   . VAL A 396 ? 0.5300 0.7508 0.8181 -0.0488 -0.1523 0.2136  918 VAL A N   
2866 C CA  . VAL A 396 ? 0.5051 0.7101 0.7709 -0.0432 -0.1420 0.1964  918 VAL A CA  
2867 C C   . VAL A 396 ? 0.4845 0.6811 0.7604 -0.0375 -0.1292 0.1902  918 VAL A C   
2868 O O   . VAL A 396 ? 0.4737 0.6569 0.7320 -0.0375 -0.1271 0.1752  918 VAL A O   
2869 C CB  . VAL A 396 ? 0.5001 0.7074 0.7644 -0.0374 -0.1338 0.1995  918 VAL A CB  
2870 C CG1 . VAL A 396 ? 0.5007 0.6936 0.7463 -0.0323 -0.1232 0.1840  918 VAL A CG1 
2871 C CG2 . VAL A 396 ? 0.5234 0.7405 0.7757 -0.0425 -0.1459 0.2059  918 VAL A CG2 
2872 N N   . ARG A 397 ? 0.4758 0.6805 0.7791 -0.0315 -0.1204 0.2021  919 ARG A N   
2873 C CA  . ARG A 397 ? 0.4696 0.6681 0.7826 -0.0249 -0.1080 0.1979  919 ARG A CA  
2874 C C   . ARG A 397 ? 0.4530 0.6501 0.7635 -0.0317 -0.1153 0.1936  919 ARG A C   
2875 O O   . ARG A 397 ? 0.4551 0.6401 0.7557 -0.0293 -0.1086 0.1811  919 ARG A O   
2876 C CB  . ARG A 397 ? 0.4753 0.6850 0.8178 -0.0161 -0.0986 0.2134  919 ARG A CB  
2877 C CG  . ARG A 397 ? 0.4841 0.6904 0.8296 -0.0079 -0.0905 0.2172  919 ARG A CG  
2878 C CD  . ARG A 397 ? 0.4972 0.7068 0.8662 0.0049  -0.0777 0.2274  919 ARG A CD  
2879 N NE  . ARG A 397 ? 0.4982 0.7297 0.8940 0.0050  -0.0810 0.2455  919 ARG A NE  
2880 C CZ  . ARG A 397 ? 0.4852 0.7342 0.8994 0.0039  -0.0874 0.2634  919 ARG A CZ  
2881 N NH1 . ARG A 397 ? 0.4942 0.7412 0.9022 0.0022  -0.0919 0.2658  919 ARG A NH1 
2882 N NH2 . ARG A 397 ? 0.4775 0.7482 0.9177 0.0040  -0.0899 0.2807  919 ARG A NH2 
2883 N N   . GLU A 398 ? 0.4587 0.6674 0.7777 -0.0411 -0.1302 0.2041  920 GLU A N   
2884 C CA  . GLU A 398 ? 0.4803 0.6866 0.7988 -0.0492 -0.1395 0.2020  920 GLU A CA  
2885 C C   . GLU A 398 ? 0.4733 0.6593 0.7581 -0.0543 -0.1474 0.1826  920 GLU A C   
2886 O O   . GLU A 398 ? 0.4859 0.6627 0.7664 -0.0565 -0.1480 0.1752  920 GLU A O   
2887 C CB  . GLU A 398 ? 0.5080 0.7314 0.8460 -0.0595 -0.1556 0.2202  920 GLU A CB  
2888 C CG  . GLU A 398 ? 0.5305 0.7533 0.8751 -0.0683 -0.1650 0.2223  920 GLU A CG  
2889 C CD  . GLU A 398 ? 0.5691 0.8058 0.9281 -0.0820 -0.1859 0.2393  920 GLU A CD  
2890 O OE1 . GLU A 398 ? 0.5837 0.8121 0.9362 -0.0935 -0.2011 0.2371  920 GLU A OE1 
2891 O OE2 . GLU A 398 ? 0.5607 0.8159 0.9377 -0.0818 -0.1880 0.2556  920 GLU A OE2 
2892 N N   . THR A 399 ? 0.4537 0.6335 0.7146 -0.0553 -0.1530 0.1751  921 THR A N   
2893 C CA  . THR A 399 ? 0.4625 0.6236 0.6899 -0.0572 -0.1588 0.1567  921 THR A CA  
2894 C C   . THR A 399 ? 0.4634 0.6129 0.6814 -0.0485 -0.1426 0.1427  921 THR A C   
2895 O O   . THR A 399 ? 0.4477 0.5832 0.6503 -0.0494 -0.1444 0.1302  921 THR A O   
2896 C CB  . THR A 399 ? 0.4855 0.6451 0.6877 -0.0589 -0.1687 0.1530  921 THR A CB  
2897 O OG1 . THR A 399 ? 0.5061 0.6472 0.6753 -0.0602 -0.1766 0.1362  921 THR A OG1 
2898 C CG2 . THR A 399 ? 0.4858 0.6510 0.6853 -0.0507 -0.1558 0.1532  921 THR A CG2 
2899 N N   . LEU A 400 ? 0.4430 0.5975 0.6705 -0.0404 -0.1278 0.1454  922 LEU A N   
2900 C CA  . LEU A 400 ? 0.4179 0.5623 0.6394 -0.0330 -0.1131 0.1343  922 LEU A CA  
2901 C C   . LEU A 400 ? 0.4065 0.5478 0.6414 -0.0315 -0.1066 0.1335  922 LEU A C   
2902 O O   . LEU A 400 ? 0.4085 0.5383 0.6314 -0.0288 -0.1005 0.1213  922 LEU A O   
2903 C CB  . LEU A 400 ? 0.4046 0.5526 0.6339 -0.0260 -0.1014 0.1390  922 LEU A CB  
2904 C CG  . LEU A 400 ? 0.4112 0.5629 0.6272 -0.0264 -0.1046 0.1400  922 LEU A CG  
2905 C CD1 . LEU A 400 ? 0.4129 0.5674 0.6426 -0.0207 -0.0947 0.1479  922 LEU A CD1 
2906 C CD2 . LEU A 400 ? 0.4235 0.5663 0.6114 -0.0257 -0.1045 0.1256  922 LEU A CD2 
2907 N N   . GLY A 401 ? 0.4153 0.5689 0.6757 -0.0328 -0.1079 0.1477  923 GLY A N   
2908 C CA  . GLY A 401 ? 0.4119 0.5670 0.6877 -0.0298 -0.0999 0.1501  923 GLY A CA  
2909 C C   . GLY A 401 ? 0.4227 0.5771 0.7067 -0.0182 -0.0824 0.1504  923 GLY A C   
2910 O O   . GLY A 401 ? 0.4254 0.5773 0.7049 -0.0140 -0.0783 0.1498  923 GLY A O   
2911 N N   . THR A 402 ? 0.4266 0.5813 0.7204 -0.0129 -0.0728 0.1510  924 THR A N   
2912 C CA  . THR A 402 ? 0.4206 0.5728 0.7211 -0.0007 -0.0570 0.1517  924 THR A CA  
2913 C C   . THR A 402 ? 0.3919 0.5249 0.6705 0.0035  -0.0491 0.1354  924 THR A C   
2914 O O   . THR A 402 ? 0.3490 0.4727 0.6093 -0.0016 -0.0530 0.1233  924 THR A O   
2915 C CB  . THR A 402 ? 0.4331 0.5959 0.7530 0.0051  -0.0490 0.1609  924 THR A CB  
2916 O OG1 . THR A 402 ? 0.4599 0.6121 0.7743 0.0170  -0.0337 0.1538  924 THR A OG1 
2917 C CG2 . THR A 402 ? 0.4819 0.6471 0.8013 -0.0037 -0.0566 0.1595  924 THR A CG2 
2918 N N   . LEU A 403 ? 0.3848 0.5119 0.6661 0.0131  -0.0386 0.1362  925 LEU A N   
2919 C CA  . LEU A 403 ? 0.3892 0.4982 0.6533 0.0173  -0.0313 0.1235  925 LEU A CA  
2920 C C   . LEU A 403 ? 0.3731 0.4765 0.6373 0.0248  -0.0207 0.1192  925 LEU A C   
2921 O O   . LEU A 403 ? 0.3629 0.4754 0.6433 0.0323  -0.0147 0.1289  925 LEU A O   
2922 C CB  . LEU A 403 ? 0.4036 0.5057 0.6696 0.0233  -0.0275 0.1272  925 LEU A CB  
2923 C CG  . LEU A 403 ? 0.4155 0.5197 0.6762 0.0164  -0.0361 0.1292  925 LEU A CG  
2924 C CD1 . LEU A 403 ? 0.4463 0.5459 0.7153 0.0229  -0.0327 0.1372  925 LEU A CD1 
2925 C CD2 . LEU A 403 ? 0.4228 0.5167 0.6620 0.0111  -0.0380 0.1166  925 LEU A CD2 
2926 N N   . PRO A 404 ? 0.3724 0.4622 0.6186 0.0238  -0.0180 0.1056  926 PRO A N   
2927 C CA  . PRO A 404 ? 0.3624 0.4443 0.5904 0.0163  -0.0240 0.0953  926 PRO A CA  
2928 C C   . PRO A 404 ? 0.3521 0.4387 0.5731 0.0080  -0.0321 0.0906  926 PRO A C   
2929 O O   . PRO A 404 ? 0.3541 0.4394 0.5627 0.0025  -0.0389 0.0858  926 PRO A O   
2930 C CB  . PRO A 404 ? 0.3660 0.4311 0.5804 0.0209  -0.0160 0.0849  926 PRO A CB  
2931 C CG  . PRO A 404 ? 0.3666 0.4317 0.5877 0.0289  -0.0073 0.0862  926 PRO A CG  
2932 C CD  . PRO A 404 ? 0.3698 0.4509 0.6120 0.0322  -0.0072 0.1003  926 PRO A CD  
2933 N N   . ASP A 405 ? 0.3462 0.4379 0.5748 0.0078  -0.0315 0.0927  927 ASP A N   
2934 C CA  . ASP A 405 ? 0.3485 0.4386 0.5681 0.0011  -0.0383 0.0861  927 ASP A CA  
2935 C C   . ASP A 405 ? 0.3288 0.4227 0.5440 -0.0072 -0.0521 0.0874  927 ASP A C   
2936 O O   . ASP A 405 ? 0.3142 0.4005 0.5110 -0.0102 -0.0568 0.0775  927 ASP A O   
2937 C CB  . ASP A 405 ? 0.3628 0.4583 0.5939 0.0021  -0.0352 0.0906  927 ASP A CB  
2938 C CG  . ASP A 405 ? 0.3870 0.4752 0.6137 0.0104  -0.0221 0.0850  927 ASP A CG  
2939 O OD1 . ASP A 405 ? 0.4040 0.4810 0.6188 0.0146  -0.0165 0.0775  927 ASP A OD1 
2940 O OD2 . ASP A 405 ? 0.4049 0.4986 0.6396 0.0122  -0.0183 0.0889  927 ASP A OD2 
2941 N N   . ASP A 406 ? 0.3314 0.4370 0.5621 -0.0102 -0.0586 0.0996  928 ASP A N   
2942 C CA  . ASP A 406 ? 0.3402 0.4481 0.5651 -0.0185 -0.0735 0.1010  928 ASP A CA  
2943 C C   . ASP A 406 ? 0.3384 0.4438 0.5483 -0.0184 -0.0762 0.0969  928 ASP A C   
2944 O O   . ASP A 406 ? 0.3380 0.4385 0.5299 -0.0224 -0.0854 0.0901  928 ASP A O   
2945 C CB  . ASP A 406 ? 0.3454 0.4680 0.5924 -0.0228 -0.0809 0.1171  928 ASP A CB  
2946 C CG  . ASP A 406 ? 0.3354 0.4632 0.5969 -0.0255 -0.0820 0.1233  928 ASP A CG  
2947 O OD1 . ASP A 406 ? 0.3374 0.4557 0.5896 -0.0254 -0.0795 0.1143  928 ASP A OD1 
2948 O OD2 . ASP A 406 ? 0.3628 0.5061 0.6466 -0.0278 -0.0854 0.1389  928 ASP A OD2 
2949 N N   . PHE A 407 ? 0.3286 0.4374 0.5457 -0.0131 -0.0681 0.1016  929 PHE A N   
2950 C CA  . PHE A 407 ? 0.3170 0.4255 0.5233 -0.0128 -0.0692 0.1003  929 PHE A CA  
2951 C C   . PHE A 407 ? 0.3150 0.4146 0.4981 -0.0126 -0.0683 0.0872  929 PHE A C   
2952 O O   . PHE A 407 ? 0.3151 0.4164 0.4835 -0.0149 -0.0751 0.0845  929 PHE A O   
2953 C CB  . PHE A 407 ? 0.3076 0.4165 0.5257 -0.0067 -0.0597 0.1066  929 PHE A CB  
2954 C CG  . PHE A 407 ? 0.3082 0.4181 0.5190 -0.0070 -0.0609 0.1082  929 PHE A CG  
2955 C CD1 . PHE A 407 ? 0.2938 0.3960 0.4895 -0.0063 -0.0569 0.0999  929 PHE A CD1 
2956 C CD2 . PHE A 407 ? 0.3130 0.4331 0.5337 -0.0083 -0.0660 0.1201  929 PHE A CD2 
2957 C CE1 . PHE A 407 ? 0.2986 0.4043 0.4899 -0.0072 -0.0582 0.1039  929 PHE A CE1 
2958 C CE2 . PHE A 407 ? 0.3070 0.4293 0.5223 -0.0089 -0.0670 0.1233  929 PHE A CE2 
2959 C CZ  . PHE A 407 ? 0.3023 0.4177 0.5032 -0.0085 -0.0631 0.1156  929 PHE A CZ  
2960 N N   . VAL A 408 ? 0.3093 0.4004 0.4889 -0.0092 -0.0597 0.0795  930 VAL A N   
2961 C CA  . VAL A 408 ? 0.3152 0.4001 0.4750 -0.0086 -0.0580 0.0687  930 VAL A CA  
2962 C C   . VAL A 408 ? 0.3195 0.4013 0.4643 -0.0111 -0.0665 0.0614  930 VAL A C   
2963 O O   . VAL A 408 ? 0.3111 0.3928 0.4382 -0.0101 -0.0692 0.0561  930 VAL A O   
2964 C CB  . VAL A 408 ? 0.3069 0.3833 0.4665 -0.0050 -0.0478 0.0630  930 VAL A CB  
2965 C CG1 . VAL A 408 ? 0.3098 0.3815 0.4727 -0.0046 -0.0460 0.0591  930 VAL A CG1 
2966 C CG2 . VAL A 408 ? 0.3044 0.3786 0.4480 -0.0045 -0.0457 0.0562  930 VAL A CG2 
2967 N N   . CYS A 409 ? 0.3392 0.4186 0.4913 -0.0140 -0.0712 0.0624  931 CYS A N   
2968 C CA  . CYS A 409 ? 0.3537 0.4258 0.4921 -0.0171 -0.0814 0.0557  931 CYS A CA  
2969 C C   . CYS A 409 ? 0.3597 0.4335 0.4869 -0.0200 -0.0934 0.0572  931 CYS A C   
2970 O O   . CYS A 409 ? 0.3738 0.4385 0.4800 -0.0197 -0.1008 0.0485  931 CYS A O   
2971 C CB  . CYS A 409 ? 0.3669 0.4366 0.5189 -0.0210 -0.0847 0.0592  931 CYS A CB  
2972 S SG  . CYS A 409 ? 0.3910 0.4556 0.5471 -0.0169 -0.0722 0.0539  931 CYS A SG  
2973 N N   . TYR A 410 ? 0.3567 0.4413 0.4965 -0.0220 -0.0955 0.0681  932 TYR A N   
2974 C CA  . TYR A 410 ? 0.3559 0.4440 0.4844 -0.0246 -0.1065 0.0705  932 TYR A CA  
2975 C C   . TYR A 410 ? 0.3564 0.4422 0.4593 -0.0191 -0.1043 0.0614  932 TYR A C   
2976 O O   . TYR A 410 ? 0.3604 0.4403 0.4413 -0.0188 -0.1139 0.0553  932 TYR A O   
2977 C CB  . TYR A 410 ? 0.3700 0.4724 0.5176 -0.0261 -0.1060 0.0847  932 TYR A CB  
2978 C CG  . TYR A 410 ? 0.3797 0.4877 0.5164 -0.0291 -0.1174 0.0888  932 TYR A CG  
2979 C CD1 . TYR A 410 ? 0.3850 0.4971 0.5050 -0.0250 -0.1150 0.0864  932 TYR A CD1 
2980 C CD2 . TYR A 410 ? 0.3984 0.5089 0.5415 -0.0363 -0.1312 0.0961  932 TYR A CD2 
2981 C CE1 . TYR A 410 ? 0.4100 0.5281 0.5179 -0.0268 -0.1249 0.0902  932 TYR A CE1 
2982 C CE2 . TYR A 410 ? 0.4232 0.5380 0.5540 -0.0392 -0.1426 0.0995  932 TYR A CE2 
2983 C CZ  . TYR A 410 ? 0.4224 0.5408 0.5344 -0.0338 -0.1389 0.0960  932 TYR A CZ  
2984 O OH  . TYR A 410 ? 0.4203 0.5439 0.5176 -0.0355 -0.1493 0.0993  932 TYR A OH  
2985 N N   . PHE A 411 ? 0.3503 0.4403 0.4555 -0.0145 -0.0920 0.0607  933 PHE A N   
2986 C CA  . PHE A 411 ? 0.3513 0.4449 0.4373 -0.0092 -0.0882 0.0561  933 PHE A CA  
2987 C C   . PHE A 411 ? 0.3486 0.4328 0.4172 -0.0044 -0.0854 0.0438  933 PHE A C   
2988 O O   . PHE A 411 ? 0.3452 0.4289 0.3909 0.0006  -0.0880 0.0379  933 PHE A O   
2989 C CB  . PHE A 411 ? 0.3474 0.4509 0.4459 -0.0080 -0.0784 0.0639  933 PHE A CB  
2990 C CG  . PHE A 411 ? 0.3507 0.4641 0.4627 -0.0110 -0.0815 0.0763  933 PHE A CG  
2991 C CD1 . PHE A 411 ? 0.3704 0.4933 0.4707 -0.0109 -0.0877 0.0806  933 PHE A CD1 
2992 C CD2 . PHE A 411 ? 0.3488 0.4622 0.4841 -0.0129 -0.0781 0.0841  933 PHE A CD2 
2993 C CE1 . PHE A 411 ? 0.3787 0.5114 0.4920 -0.0139 -0.0911 0.0930  933 PHE A CE1 
2994 C CE2 . PHE A 411 ? 0.3592 0.4815 0.5077 -0.0148 -0.0810 0.0963  933 PHE A CE2 
2995 C CZ  . PHE A 411 ? 0.3691 0.5014 0.5074 -0.0159 -0.0878 0.1011  933 PHE A CZ  
2996 N N   . THR A 412 ? 0.3385 0.4155 0.4170 -0.0050 -0.0797 0.0404  934 THR A N   
2997 C CA  . THR A 412 ? 0.3491 0.4175 0.4135 -0.0005 -0.0766 0.0298  934 THR A CA  
2998 C C   . THR A 412 ? 0.3695 0.4240 0.4172 -0.0002 -0.0874 0.0214  934 THR A C   
2999 O O   . THR A 412 ? 0.3814 0.4295 0.4089 0.0062  -0.0872 0.0124  934 THR A O   
3000 C CB  . THR A 412 ? 0.3398 0.4045 0.4184 -0.0013 -0.0679 0.0287  934 THR A CB  
3001 O OG1 . THR A 412 ? 0.3370 0.3969 0.4314 -0.0061 -0.0710 0.0319  934 THR A OG1 
3002 C CG2 . THR A 412 ? 0.3369 0.4101 0.4262 -0.0011 -0.0588 0.0347  934 THR A CG2 
3003 N N   . SER A 413 ? 0.3898 0.4393 0.4459 -0.0068 -0.0975 0.0251  935 SER A N   
3004 C CA  . SER A 413 ? 0.4120 0.4457 0.4514 -0.0083 -0.1111 0.0182  935 SER A CA  
3005 C C   . SER A 413 ? 0.4424 0.4746 0.4553 -0.0038 -0.1187 0.0141  935 SER A C   
3006 O O   . SER A 413 ? 0.4526 0.4685 0.4410 0.0000  -0.1270 0.0040  935 SER A O   
3007 C CB  . SER A 413 ? 0.4148 0.4460 0.4725 -0.0183 -0.1213 0.0260  935 SER A CB  
3008 O OG  . SER A 413 ? 0.4158 0.4577 0.4800 -0.0223 -0.1270 0.0353  935 SER A OG  
3009 N N   . ARG A 414 ? 0.4577 0.5056 0.4741 -0.0036 -0.1160 0.0219  936 ARG A N   
3010 C CA  . ARG A 414 ? 0.4868 0.5360 0.4772 0.0016  -0.1221 0.0192  936 ARG A CA  
3011 C C   . ARG A 414 ? 0.4734 0.5300 0.4462 0.0131  -0.1110 0.0142  936 ARG A C   
3012 O O   . ARG A 414 ? 0.4894 0.5412 0.4331 0.0214  -0.1150 0.0071  936 ARG A O   
3013 C CB  . ARG A 414 ? 0.4913 0.5552 0.4927 -0.0037 -0.1260 0.0313  936 ARG A CB  
3014 C CG  . ARG A 414 ? 0.5345 0.5902 0.5414 -0.0133 -0.1420 0.0351  936 ARG A CG  
3015 C CD  . ARG A 414 ? 0.5394 0.6121 0.5679 -0.0198 -0.1440 0.0503  936 ARG A CD  
3016 N NE  . ARG A 414 ? 0.5485 0.6202 0.6033 -0.0294 -0.1499 0.0584  936 ARG A NE  
3017 C CZ  . ARG A 414 ? 0.5908 0.6562 0.6452 -0.0378 -0.1667 0.0617  936 ARG A CZ  
3018 N NH1 . ARG A 414 ? 0.6576 0.7137 0.6838 -0.0380 -0.1805 0.0562  936 ARG A NH1 
3019 N NH2 . ARG A 414 ? 0.5882 0.6570 0.6702 -0.0459 -0.1700 0.0715  936 ARG A NH2 
3020 N N   . PHE A 415 ? 0.4528 0.5212 0.4426 0.0140  -0.0976 0.0186  937 PHE A N   
3021 C CA  . PHE A 415 ? 0.4560 0.5349 0.4340 0.0235  -0.0870 0.0169  937 PHE A CA  
3022 C C   . PHE A 415 ? 0.4300 0.5037 0.4164 0.0247  -0.0788 0.0122  937 PHE A C   
3023 O O   . PHE A 415 ? 0.4181 0.5010 0.4242 0.0212  -0.0703 0.0185  937 PHE A O   
3024 C CB  . PHE A 415 ? 0.4430 0.5441 0.4330 0.0224  -0.0802 0.0295  937 PHE A CB  
3025 C CG  . PHE A 415 ? 0.4561 0.5635 0.4412 0.0201  -0.0883 0.0358  937 PHE A CG  
3026 C CD1 . PHE A 415 ? 0.4846 0.5968 0.4422 0.0284  -0.0915 0.0333  937 PHE A CD1 
3027 C CD2 . PHE A 415 ? 0.4396 0.5485 0.4469 0.0105  -0.0927 0.0446  937 PHE A CD2 
3028 C CE1 . PHE A 415 ? 0.5025 0.6203 0.4541 0.0260  -0.0998 0.0392  937 PHE A CE1 
3029 C CE2 . PHE A 415 ? 0.4578 0.5732 0.4615 0.0080  -0.1009 0.0513  937 PHE A CE2 
3030 C CZ  . PHE A 415 ? 0.4905 0.6102 0.4661 0.0151  -0.1049 0.0485  937 PHE A CZ  
3031 N N   . PRO A 416 ? 0.4345 0.4915 0.4046 0.0296  -0.0825 0.0009  938 PRO A N   
3032 C CA  . PRO A 416 ? 0.4287 0.4787 0.4077 0.0294  -0.0767 -0.0033 938 PRO A CA  
3033 C C   . PRO A 416 ? 0.4096 0.4733 0.3886 0.0359  -0.0643 -0.0018 938 PRO A C   
3034 O O   . PRO A 416 ? 0.3881 0.4491 0.3780 0.0342  -0.0590 -0.0030 938 PRO A O   
3035 C CB  . PRO A 416 ? 0.4445 0.4715 0.4038 0.0331  -0.0863 -0.0150 938 PRO A CB  
3036 C CG  . PRO A 416 ? 0.4720 0.4954 0.4046 0.0397  -0.0940 -0.0190 938 PRO A CG  
3037 C CD  . PRO A 416 ? 0.4636 0.5042 0.4063 0.0345  -0.0941 -0.0084 938 PRO A CD  
3038 N N   . HIS A 417 ? 0.4156 0.4951 0.3830 0.0431  -0.0602 0.0020  939 HIS A N   
3039 C CA  . HIS A 417 ? 0.4145 0.5121 0.3858 0.0476  -0.0491 0.0075  939 HIS A CA  
3040 C C   . HIS A 417 ? 0.3873 0.5026 0.3795 0.0399  -0.0446 0.0208  939 HIS A C   
3041 O O   . HIS A 417 ? 0.3707 0.5015 0.3687 0.0412  -0.0371 0.0274  939 HIS A O   
3042 C CB  . HIS A 417 ? 0.4459 0.5536 0.3922 0.0619  -0.0461 0.0057  939 HIS A CB  
3043 C CG  . HIS A 417 ? 0.4768 0.5675 0.4022 0.0722  -0.0479 -0.0070 939 HIS A CG  
3044 N ND1 . HIS A 417 ? 0.4788 0.5742 0.4040 0.0791  -0.0399 -0.0083 939 HIS A ND1 
3045 C CD2 . HIS A 417 ? 0.5095 0.5770 0.4134 0.0767  -0.0577 -0.0186 939 HIS A CD2 
3046 C CE1 . HIS A 417 ? 0.5051 0.5806 0.4098 0.0883  -0.0440 -0.0203 939 HIS A CE1 
3047 N NE2 . HIS A 417 ? 0.5218 0.5787 0.4126 0.0868  -0.0552 -0.0272 939 HIS A NE2 
3048 N N   . LEU A 418 ? 0.3755 0.4883 0.3798 0.0315  -0.0496 0.0255  940 LEU A N   
3049 C CA  . LEU A 418 ? 0.3616 0.4889 0.3838 0.0252  -0.0463 0.0383  940 LEU A CA  
3050 C C   . LEU A 418 ? 0.3325 0.4598 0.3716 0.0201  -0.0400 0.0412  940 LEU A C   
3051 O O   . LEU A 418 ? 0.3126 0.4546 0.3574 0.0191  -0.0355 0.0501  940 LEU A O   
3052 C CB  . LEU A 418 ? 0.3618 0.4845 0.3955 0.0179  -0.0525 0.0428  940 LEU A CB  
3053 C CG  . LEU A 418 ? 0.3583 0.4934 0.4090 0.0123  -0.0505 0.0562  940 LEU A CG  
3054 C CD1 . LEU A 418 ? 0.3631 0.5191 0.4056 0.0163  -0.0480 0.0651  940 LEU A CD1 
3055 C CD2 . LEU A 418 ? 0.3680 0.4984 0.4287 0.0071  -0.0569 0.0603  940 LEU A CD2 
3056 N N   . LEU A 419 ? 0.3257 0.4369 0.3717 0.0169  -0.0404 0.0343  941 LEU A N   
3057 C CA  . LEU A 419 ? 0.3226 0.4307 0.3824 0.0120  -0.0355 0.0360  941 LEU A CA  
3058 C C   . LEU A 419 ? 0.3230 0.4392 0.3766 0.0159  -0.0304 0.0354  941 LEU A C   
3059 O O   . LEU A 419 ? 0.3170 0.4431 0.3786 0.0124  -0.0274 0.0435  941 LEU A O   
3060 C CB  . LEU A 419 ? 0.3110 0.4018 0.3786 0.0088  -0.0364 0.0296  941 LEU A CB  
3061 C CG  . LEU A 419 ? 0.3129 0.3981 0.3918 0.0046  -0.0316 0.0304  941 LEU A CG  
3062 C CD1 . LEU A 419 ? 0.3161 0.4066 0.4048 0.0000  -0.0307 0.0399  941 LEU A CD1 
3063 C CD2 . LEU A 419 ? 0.3165 0.3877 0.4035 0.0027  -0.0317 0.0262  941 LEU A CD2 
3064 N N   . ALA A 420 ? 0.3379 0.4498 0.3779 0.0230  -0.0302 0.0267  942 ALA A N   
3065 C CA  . ALA A 420 ? 0.3339 0.4548 0.3681 0.0283  -0.0250 0.0266  942 ALA A CA  
3066 C C   . ALA A 420 ? 0.3282 0.4727 0.3621 0.0306  -0.0215 0.0380  942 ALA A C   
3067 O O   . ALA A 420 ? 0.3261 0.4818 0.3686 0.0276  -0.0179 0.0452  942 ALA A O   
3068 C CB  . ALA A 420 ? 0.3487 0.4614 0.3650 0.0381  -0.0260 0.0162  942 ALA A CB  
3069 N N   . HIS A 421 ? 0.3265 0.4794 0.3509 0.0352  -0.0234 0.0408  943 HIS A N   
3070 C CA  . HIS A 421 ? 0.3338 0.5119 0.3581 0.0378  -0.0201 0.0536  943 HIS A CA  
3071 C C   . HIS A 421 ? 0.3121 0.4977 0.3572 0.0259  -0.0208 0.0665  943 HIS A C   
3072 O O   . HIS A 421 ? 0.3118 0.5166 0.3640 0.0243  -0.0177 0.0783  943 HIS A O   
3073 C CB  . HIS A 421 ? 0.3655 0.5488 0.3735 0.0452  -0.0227 0.0532  943 HIS A CB  
3074 C CG  . HIS A 421 ? 0.3614 0.5719 0.3713 0.0467  -0.0198 0.0684  943 HIS A CG  
3075 N ND1 . HIS A 421 ? 0.3834 0.6162 0.3812 0.0584  -0.0135 0.0738  943 HIS A ND1 
3076 C CD2 . HIS A 421 ? 0.3622 0.5822 0.3853 0.0384  -0.0221 0.0807  943 HIS A CD2 
3077 C CE1 . HIS A 421 ? 0.3822 0.6391 0.3864 0.0567  -0.0119 0.0897  943 HIS A CE1 
3078 N NE2 . HIS A 421 ? 0.3753 0.6239 0.3948 0.0441  -0.0176 0.0939  943 HIS A NE2 
3079 N N   . THR A 422 ? 0.2986 0.4689 0.3537 0.0178  -0.0253 0.0652  944 THR A N   
3080 C CA  . THR A 422 ? 0.2786 0.4508 0.3515 0.0075  -0.0269 0.0762  944 THR A CA  
3081 C C   . THR A 422 ? 0.2782 0.4440 0.3604 0.0013  -0.0255 0.0765  944 THR A C   
3082 O O   . THR A 422 ? 0.2750 0.4494 0.3680 -0.0057 -0.0265 0.0881  944 THR A O   
3083 C CB  . THR A 422 ? 0.2694 0.4266 0.3496 0.0027  -0.0314 0.0748  944 THR A CB  
3084 O OG1 . THR A 422 ? 0.2566 0.4218 0.3276 0.0075  -0.0339 0.0761  944 THR A OG1 
3085 C CG2 . THR A 422 ? 0.2702 0.4259 0.3668 -0.0065 -0.0334 0.0856  944 THR A CG2 
3086 N N   . TYR A 423 ? 0.2844 0.4358 0.3619 0.0036  -0.0240 0.0645  945 TYR A N   
3087 C CA  . TYR A 423 ? 0.2930 0.4382 0.3763 -0.0014 -0.0230 0.0636  945 TYR A CA  
3088 C C   . TYR A 423 ? 0.3169 0.4840 0.4007 -0.0006 -0.0205 0.0731  945 TYR A C   
3089 O O   . TYR A 423 ? 0.3028 0.4712 0.3962 -0.0090 -0.0225 0.0804  945 TYR A O   
3090 C CB  . TYR A 423 ? 0.2843 0.4121 0.3617 0.0019  -0.0217 0.0498  945 TYR A CB  
3091 C CG  . TYR A 423 ? 0.2712 0.3888 0.3539 -0.0039 -0.0214 0.0479  945 TYR A CG  
3092 C CD1 . TYR A 423 ? 0.2730 0.3768 0.3640 -0.0116 -0.0240 0.0497  945 TYR A CD1 
3093 C CD2 . TYR A 423 ? 0.2735 0.3947 0.3516 -0.0010 -0.0188 0.0446  945 TYR A CD2 
3094 C CE1 . TYR A 423 ? 0.2815 0.3738 0.3737 -0.0165 -0.0245 0.0473  945 TYR A CE1 
3095 C CE2 . TYR A 423 ? 0.2755 0.3875 0.3570 -0.0068 -0.0194 0.0433  945 TYR A CE2 
3096 C CZ  . TYR A 423 ? 0.2847 0.3817 0.3723 -0.0146 -0.0225 0.0441  945 TYR A CZ  
3097 O OH  . TYR A 423 ? 0.2948 0.3803 0.3823 -0.0198 -0.0238 0.0418  945 TYR A OH  
3098 N N   . ARG A 424 ? 0.3551 0.5391 0.4281 0.0098  -0.0167 0.0735  946 ARG A N   
3099 C CA  . ARG A 424 ? 0.3821 0.5914 0.4563 0.0129  -0.0130 0.0843  946 ARG A CA  
3100 C C   . ARG A 424 ? 0.3704 0.6005 0.4562 0.0064  -0.0147 0.1024  946 ARG A C   
3101 O O   . ARG A 424 ? 0.3784 0.6205 0.4755 -0.0008 -0.0159 0.1140  946 ARG A O   
3102 C CB  . ARG A 424 ? 0.4179 0.6396 0.4752 0.0287  -0.0075 0.0800  946 ARG A CB  
3103 C CG  . ARG A 424 ? 0.4570 0.6592 0.5036 0.0350  -0.0066 0.0640  946 ARG A CG  
3104 C CD  . ARG A 424 ? 0.5187 0.7345 0.5515 0.0500  -0.0008 0.0627  946 ARG A CD  
3105 N NE  . ARG A 424 ? 0.5807 0.7876 0.5929 0.0622  -0.0011 0.0522  946 ARG A NE  
3106 C CZ  . ARG A 424 ? 0.6400 0.8348 0.6361 0.0736  0.0000  0.0403  946 ARG A CZ  
3107 N NH1 . ARG A 424 ? 0.6214 0.8131 0.6208 0.0750  0.0024  0.0377  946 ARG A NH1 
3108 N NH2 . ARG A 424 ? 0.7034 0.8873 0.6789 0.0836  -0.0023 0.0310  946 ARG A NH2 
3109 N N   . ALA A 425 ? 0.3688 0.6032 0.4522 0.0081  -0.0158 0.1058  947 ALA A N   
3110 C CA  . ALA A 425 ? 0.3625 0.6184 0.4568 0.0024  -0.0175 0.1245  947 ALA A CA  
3111 C C   . ALA A 425 ? 0.3648 0.6085 0.4766 -0.0135 -0.0244 0.1319  947 ALA A C   
3112 O O   . ALA A 425 ? 0.3852 0.6468 0.5093 -0.0210 -0.0268 0.1490  947 ALA A O   
3113 C CB  . ALA A 425 ? 0.3691 0.6291 0.4563 0.0073  -0.0179 0.1255  947 ALA A CB  
3114 N N   . MET A 426 ? 0.3798 0.5928 0.4924 -0.0184 -0.0280 0.1197  948 MET A N   
3115 C CA  . MET A 426 ? 0.4030 0.5994 0.5284 -0.0316 -0.0350 0.1250  948 MET A CA  
3116 C C   . MET A 426 ? 0.4161 0.6047 0.5453 -0.0389 -0.0376 0.1245  948 MET A C   
3117 O O   . MET A 426 ? 0.4042 0.5735 0.5400 -0.0493 -0.0445 0.1262  948 MET A O   
3118 C CB  . MET A 426 ? 0.3939 0.5621 0.5185 -0.0323 -0.0373 0.1141  948 MET A CB  
3119 C CG  . MET A 426 ? 0.4090 0.5845 0.5336 -0.0287 -0.0374 0.1183  948 MET A CG  
3120 S SD  . MET A 426 ? 0.3744 0.5703 0.5120 -0.0365 -0.0421 0.1410  948 MET A SD  
3121 C CE  . MET A 426 ? 0.3946 0.5581 0.5432 -0.0482 -0.0499 0.1410  948 MET A CE  
3122 N N   . GLU A 427 ? 0.4404 0.6441 0.5647 -0.0331 -0.0329 0.1232  949 GLU A N   
3123 C CA  . GLU A 427 ? 0.4791 0.6811 0.6076 -0.0401 -0.0358 0.1255  949 GLU A CA  
3124 C C   . GLU A 427 ? 0.4507 0.6689 0.5940 -0.0525 -0.0428 0.1463  949 GLU A C   
3125 O O   . GLU A 427 ? 0.4409 0.6510 0.5894 -0.0629 -0.0493 0.1498  949 GLU A O   
3126 C CB  . GLU A 427 ? 0.5322 0.7499 0.6532 -0.0298 -0.0287 0.1212  949 GLU A CB  
3127 C CG  . GLU A 427 ? 0.6057 0.8158 0.7283 -0.0355 -0.0312 0.1187  949 GLU A CG  
3128 C CD  . GLU A 427 ? 0.6685 0.8793 0.7803 -0.0237 -0.0242 0.1067  949 GLU A CD  
3129 O OE1 . GLU A 427 ? 0.7484 0.9342 0.8537 -0.0237 -0.0245 0.0922  949 GLU A OE1 
3130 O OE2 . GLU A 427 ? 0.6895 0.9257 0.7990 -0.0138 -0.0182 0.1125  949 GLU A OE2 
3131 N N   . LEU A 428 ? 0.4502 0.6909 0.5998 -0.0518 -0.0422 0.1607  950 LEU A N   
3132 C CA  . LEU A 428 ? 0.4564 0.7116 0.6224 -0.0651 -0.0503 0.1827  950 LEU A CA  
3133 C C   . LEU A 428 ? 0.4375 0.6588 0.6087 -0.0795 -0.0619 0.1813  950 LEU A C   
3134 O O   . LEU A 428 ? 0.4561 0.6796 0.6390 -0.0933 -0.0716 0.1961  950 LEU A O   
3135 C CB  . LEU A 428 ? 0.4908 0.7726 0.6615 -0.0612 -0.0475 0.1973  950 LEU A CB  
3136 C CG  . LEU A 428 ? 0.5153 0.8417 0.6870 -0.0513 -0.0392 0.2117  950 LEU A CG  
3137 C CD1 . LEU A 428 ? 0.5158 0.8655 0.7024 -0.0605 -0.0430 0.2303  950 LEU A CD1 
3138 C CD2 . LEU A 428 ? 0.5354 0.8645 0.6882 -0.0329 -0.0282 0.1947  950 LEU A CD2 
3139 N N   . CYS A 429 ? 0.4263 0.6159 0.5885 -0.0758 -0.0613 0.1640  951 CYS A N   
3140 C CA  . CYS A 429 ? 0.4182 0.5721 0.5816 -0.0855 -0.0707 0.1599  951 CYS A CA  
3141 C C   . CYS A 429 ? 0.4109 0.5349 0.5629 -0.0848 -0.0711 0.1418  951 CYS A C   
3142 O O   . CYS A 429 ? 0.4109 0.5020 0.5577 -0.0863 -0.0749 0.1322  951 CYS A O   
3143 C CB  . CYS A 429 ? 0.4268 0.5677 0.5892 -0.0805 -0.0691 0.1555  951 CYS A CB  
3144 S SG  . CYS A 429 ? 0.4076 0.5813 0.5810 -0.0801 -0.0684 0.1756  951 CYS A SG  
3145 N N   . SER A 430 ? 0.4198 0.5555 0.5674 -0.0818 -0.0670 0.1379  952 SER A N   
3146 C CA  . SER A 430 ? 0.4126 0.5234 0.5483 -0.0794 -0.0659 0.1206  952 SER A CA  
3147 C C   . SER A 430 ? 0.4327 0.5158 0.5663 -0.0919 -0.0774 0.1204  952 SER A C   
3148 O O   . SER A 430 ? 0.4296 0.4854 0.5514 -0.0893 -0.0771 0.1054  952 SER A O   
3149 C CB  . SER A 430 ? 0.3988 0.5299 0.5306 -0.0725 -0.0587 0.1172  952 SER A CB  
3150 O OG  . SER A 430 ? 0.3756 0.5255 0.5154 -0.0812 -0.0639 0.1312  952 SER A OG  
3151 N N   . HIS A 431 ? 0.4806 0.5703 0.6249 -0.1052 -0.0882 0.1376  953 HIS A N   
3152 C CA  . HIS A 431 ? 0.5264 0.5865 0.6673 -0.1189 -0.1024 0.1386  953 HIS A CA  
3153 C C   . HIS A 431 ? 0.5062 0.5313 0.6433 -0.1213 -0.1090 0.1345  953 HIS A C   
3154 O O   . HIS A 431 ? 0.5119 0.5028 0.6398 -0.1288 -0.1198 0.1295  953 HIS A O   
3155 C CB  . HIS A 431 ? 0.5827 0.6654 0.7382 -0.1340 -0.1133 0.1609  953 HIS A CB  
3156 C CG  . HIS A 431 ? 0.6463 0.7606 0.8054 -0.1322 -0.1082 0.1659  953 HIS A CG  
3157 N ND1 . HIS A 431 ? 0.6979 0.7992 0.8460 -0.1325 -0.1092 0.1547  953 HIS A ND1 
3158 C CD2 . HIS A 431 ? 0.6665 0.8252 0.8382 -0.1284 -0.1013 0.1808  953 HIS A CD2 
3159 C CE1 . HIS A 431 ? 0.6915 0.8276 0.8468 -0.1296 -0.1037 0.1630  953 HIS A CE1 
3160 N NE2 . HIS A 431 ? 0.6895 0.8606 0.8587 -0.1263 -0.0985 0.1786  953 HIS A NE2 
3161 N N   . GLU A 432 ? 0.4801 0.5131 0.6232 -0.1142 -0.1030 0.1368  954 GLU A N   
3162 C CA  . GLU A 432 ? 0.4914 0.4946 0.6332 -0.1149 -0.1083 0.1349  954 GLU A CA  
3163 C C   . GLU A 432 ? 0.4827 0.4515 0.6078 -0.1043 -0.1032 0.1135  954 GLU A C   
3164 O O   . GLU A 432 ? 0.4496 0.4263 0.5688 -0.0929 -0.0916 0.1016  954 GLU A O   
3165 C CB  . GLU A 432 ? 0.4738 0.4989 0.6275 -0.1101 -0.1029 0.1447  954 GLU A CB  
3166 C CG  . GLU A 432 ? 0.4710 0.5308 0.6414 -0.1198 -0.1077 0.1682  954 GLU A CG  
3167 C CD  . GLU A 432 ? 0.4564 0.5423 0.6360 -0.1132 -0.1009 0.1774  954 GLU A CD  
3168 O OE1 . GLU A 432 ? 0.4341 0.5534 0.6263 -0.1186 -0.1024 0.1970  954 GLU A OE1 
3169 O OE2 . GLU A 432 ? 0.4543 0.5291 0.6285 -0.1027 -0.0942 0.1663  954 GLU A OE2 
3170 N N   . ARG A 433 ? 0.5156 0.4463 0.6334 -0.1078 -0.1123 0.1097  955 ARG A N   
3171 C CA  . ARG A 433 ? 0.5417 0.4378 0.6423 -0.0971 -0.1082 0.0909  955 ARG A CA  
3172 C C   . ARG A 433 ? 0.5046 0.4082 0.6070 -0.0814 -0.0941 0.0831  955 ARG A C   
3173 O O   . ARG A 433 ? 0.5017 0.3960 0.5934 -0.0707 -0.0856 0.0688  955 ARG A O   
3174 C CB  . ARG A 433 ? 0.5923 0.4455 0.6841 -0.1027 -0.1215 0.0902  955 ARG A CB  
3175 C CG  . ARG A 433 ? 0.6463 0.4622 0.7186 -0.0895 -0.1169 0.0717  955 ARG A CG  
3176 C CD  . ARG A 433 ? 0.6851 0.4824 0.7376 -0.0904 -0.1195 0.0593  955 ARG A CD  
3177 N NE  . ARG A 433 ? 0.7390 0.5261 0.7893 -0.1081 -0.1368 0.0677  955 ARG A NE  
3178 C CZ  . ARG A 433 ? 0.7879 0.5311 0.8211 -0.1136 -0.1511 0.0630  955 ARG A CZ  
3179 N NH1 . ARG A 433 ? 0.8139 0.5505 0.8471 -0.1318 -0.1684 0.0725  955 ARG A NH1 
3180 N NH2 . ARG A 433 ? 0.8389 0.5447 0.8545 -0.1007 -0.1484 0.0494  955 ARG A NH2 
3181 N N   . LEU A 434 ? 0.4752 0.3970 0.5919 -0.0806 -0.0923 0.0939  956 LEU A N   
3182 C CA  . LEU A 434 ? 0.4529 0.3867 0.5734 -0.0678 -0.0806 0.0892  956 LEU A CA  
3183 C C   . LEU A 434 ? 0.4397 0.3952 0.5568 -0.0605 -0.0698 0.0805  956 LEU A C   
3184 O O   . LEU A 434 ? 0.4163 0.3692 0.5305 -0.0497 -0.0613 0.0710  956 LEU A O   
3185 C CB  . LEU A 434 ? 0.4481 0.4058 0.5843 -0.0705 -0.0816 0.1045  956 LEU A CB  
3186 C CG  . LEU A 434 ? 0.4413 0.4014 0.5841 -0.0612 -0.0760 0.1052  956 LEU A CG  
3187 C CD1 . LEU A 434 ? 0.4185 0.4168 0.5714 -0.0615 -0.0725 0.1157  956 LEU A CD1 
3188 C CD2 . LEU A 434 ? 0.4289 0.3766 0.5644 -0.0480 -0.0666 0.0903  956 LEU A CD2 
3189 N N   . PHE A 435 ? 0.4441 0.4213 0.5625 -0.0665 -0.0708 0.0849  957 PHE A N   
3190 C CA  . PHE A 435 ? 0.4337 0.4328 0.5497 -0.0598 -0.0617 0.0788  957 PHE A CA  
3191 C C   . PHE A 435 ? 0.4424 0.4316 0.5469 -0.0590 -0.0600 0.0677  957 PHE A C   
3192 O O   . PHE A 435 ? 0.4180 0.4257 0.5212 -0.0550 -0.0540 0.0644  957 PHE A O   
3193 C CB  . PHE A 435 ? 0.4155 0.4500 0.5405 -0.0632 -0.0613 0.0916  957 PHE A CB  
3194 C CG  . PHE A 435 ? 0.4132 0.4628 0.5470 -0.0608 -0.0600 0.1005  957 PHE A CG  
3195 C CD1 . PHE A 435 ? 0.4146 0.4714 0.5466 -0.0506 -0.0525 0.0939  957 PHE A CD1 
3196 C CD2 . PHE A 435 ? 0.4346 0.4912 0.5785 -0.0694 -0.0673 0.1165  957 PHE A CD2 
3197 C CE1 . PHE A 435 ? 0.4097 0.4800 0.5484 -0.0487 -0.0522 0.1021  957 PHE A CE1 
3198 C CE2 . PHE A 435 ? 0.4335 0.5049 0.5850 -0.0670 -0.0662 0.1254  957 PHE A CE2 
3199 C CZ  . PHE A 435 ? 0.4258 0.5039 0.5739 -0.0564 -0.0586 0.1177  957 PHE A CZ  
3200 N N   . GLN A 436 ? 0.4830 0.4422 0.5777 -0.0617 -0.0652 0.0614  958 GLN A N   
3201 C CA  . GLN A 436 ? 0.5004 0.4512 0.5829 -0.0609 -0.0639 0.0514  958 GLN A CA  
3202 C C   . GLN A 436 ? 0.4745 0.4195 0.5498 -0.0483 -0.0532 0.0380  958 GLN A C   
3203 O O   . GLN A 436 ? 0.4709 0.4170 0.5386 -0.0466 -0.0503 0.0312  958 GLN A O   
3204 C CB  . GLN A 436 ? 0.5621 0.4840 0.6338 -0.0697 -0.0752 0.0502  958 GLN A CB  
3205 C CG  . GLN A 436 ? 0.6324 0.5172 0.6911 -0.0633 -0.0760 0.0400  958 GLN A CG  
3206 C CD  . GLN A 436 ? 0.6874 0.5508 0.7267 -0.0598 -0.0752 0.0268  958 GLN A CD  
3207 O OE1 . GLN A 436 ? 0.7083 0.5817 0.7443 -0.0509 -0.0648 0.0190  958 GLN A OE1 
3208 N NE2 . GLN A 436 ? 0.7108 0.5433 0.7359 -0.0668 -0.0871 0.0246  958 GLN A NE2 
3209 N N   . PRO A 437 ? 0.4561 0.3975 0.5354 -0.0397 -0.0476 0.0359  959 PRO A N   
3210 C CA  . PRO A 437 ? 0.4291 0.3752 0.5065 -0.0292 -0.0376 0.0272  959 PRO A CA  
3211 C C   . PRO A 437 ? 0.3791 0.3538 0.4631 -0.0280 -0.0331 0.0289  959 PRO A C   
3212 O O   . PRO A 437 ? 0.3510 0.3293 0.4327 -0.0217 -0.0269 0.0223  959 PRO A O   
3213 C CB  . PRO A 437 ? 0.4422 0.3810 0.5254 -0.0218 -0.0343 0.0280  959 PRO A CB  
3214 C CG  . PRO A 437 ? 0.4601 0.3785 0.5418 -0.0266 -0.0422 0.0325  959 PRO A CG  
3215 C CD  . PRO A 437 ? 0.4665 0.3964 0.5513 -0.0390 -0.0506 0.0410  959 PRO A CD  
3216 N N   . TYR A 438 ? 0.3558 0.3497 0.4470 -0.0335 -0.0366 0.0383  960 TYR A N   
3217 C CA  . TYR A 438 ? 0.3289 0.3479 0.4237 -0.0305 -0.0328 0.0400  960 TYR A CA  
3218 C C   . TYR A 438 ? 0.3137 0.3487 0.4068 -0.0344 -0.0341 0.0435  960 TYR A C   
3219 O O   . TYR A 438 ? 0.2855 0.3363 0.3775 -0.0295 -0.0300 0.0417  960 TYR A O   
3220 C CB  . TYR A 438 ? 0.3153 0.3481 0.4184 -0.0301 -0.0337 0.0485  960 TYR A CB  
3221 C CG  . TYR A 438 ? 0.3131 0.3326 0.4205 -0.0269 -0.0334 0.0481  960 TYR A CG  
3222 C CD1 . TYR A 438 ? 0.3032 0.3191 0.4108 -0.0194 -0.0282 0.0413  960 TYR A CD1 
3223 C CD2 . TYR A 438 ? 0.3267 0.3384 0.4394 -0.0315 -0.0386 0.0560  960 TYR A CD2 
3224 C CE1 . TYR A 438 ? 0.3026 0.3094 0.4159 -0.0157 -0.0275 0.0428  960 TYR A CE1 
3225 C CE2 . TYR A 438 ? 0.3265 0.3265 0.4437 -0.0273 -0.0378 0.0564  960 TYR A CE2 
3226 C CZ  . TYR A 438 ? 0.3071 0.3058 0.4249 -0.0190 -0.0319 0.0499  960 TYR A CZ  
3227 O OH  . TYR A 438 ? 0.2944 0.2846 0.4184 -0.0144 -0.0309 0.0521  960 TYR A OH  
3228 N N   . TYR A 439 ? 0.3286 0.3595 0.4214 -0.0431 -0.0405 0.0490  961 TYR A N   
3229 C CA  . TYR A 439 ? 0.3485 0.3968 0.4416 -0.0470 -0.0419 0.0542  961 TYR A CA  
3230 C C   . TYR A 439 ? 0.3778 0.4091 0.4645 -0.0545 -0.0479 0.0520  961 TYR A C   
3231 O O   . TYR A 439 ? 0.3942 0.3999 0.4757 -0.0576 -0.0524 0.0482  961 TYR A O   
3232 C CB  . TYR A 439 ? 0.3416 0.4131 0.4446 -0.0523 -0.0455 0.0696  961 TYR A CB  
3233 C CG  . TYR A 439 ? 0.3322 0.4217 0.4395 -0.0455 -0.0409 0.0735  961 TYR A CG  
3234 C CD1 . TYR A 439 ? 0.3291 0.4109 0.4406 -0.0462 -0.0427 0.0762  961 TYR A CD1 
3235 C CD2 . TYR A 439 ? 0.3222 0.4357 0.4281 -0.0379 -0.0351 0.0749  961 TYR A CD2 
3236 C CE1 . TYR A 439 ? 0.3214 0.4200 0.4357 -0.0406 -0.0395 0.0804  961 TYR A CE1 
3237 C CE2 . TYR A 439 ? 0.3169 0.4449 0.4231 -0.0313 -0.0318 0.0777  961 TYR A CE2 
3238 C CZ  . TYR A 439 ? 0.3174 0.4385 0.4279 -0.0332 -0.0343 0.0807  961 TYR A CZ  
3239 O OH  . TYR A 439 ? 0.3019 0.4371 0.4114 -0.0271 -0.0319 0.0837  961 TYR A OH  
3240 N N   . PHE A 440 ? 0.4062 0.4509 0.4923 -0.0570 -0.0485 0.0546  962 PHE A N   
3241 C CA  . PHE A 440 ? 0.4685 0.4993 0.5483 -0.0657 -0.0560 0.0542  962 PHE A CA  
3242 C C   . PHE A 440 ? 0.5115 0.5599 0.6004 -0.0771 -0.0646 0.0699  962 PHE A C   
3243 O O   . PHE A 440 ? 0.4702 0.5486 0.5692 -0.0751 -0.0612 0.0802  962 PHE A O   
3244 C CB  . PHE A 440 ? 0.4641 0.4926 0.5352 -0.0606 -0.0513 0.0445  962 PHE A CB  
3245 C CG  . PHE A 440 ? 0.4811 0.4984 0.5449 -0.0698 -0.0597 0.0450  962 PHE A CG  
3246 C CD1 . PHE A 440 ? 0.5139 0.4992 0.5638 -0.0721 -0.0643 0.0361  962 PHE A CD1 
3247 C CD2 . PHE A 440 ? 0.4699 0.5087 0.5398 -0.0759 -0.0633 0.0551  962 PHE A CD2 
3248 C CE1 . PHE A 440 ? 0.5343 0.5069 0.5744 -0.0810 -0.0736 0.0360  962 PHE A CE1 
3249 C CE2 . PHE A 440 ? 0.4834 0.5122 0.5467 -0.0857 -0.0727 0.0566  962 PHE A CE2 
3250 C CZ  . PHE A 440 ? 0.5133 0.5078 0.5606 -0.0888 -0.0784 0.0465  962 PHE A CZ  
3251 N N   . HIS A 441 ? 0.6170 0.6454 0.7009 -0.0885 -0.0759 0.0718  963 HIS A N   
3252 C CA  . HIS A 441 ? 0.7138 0.7529 0.8054 -0.1029 -0.0877 0.0871  963 HIS A CA  
3253 C C   . HIS A 441 ? 0.7475 0.7611 0.8379 -0.1145 -0.1009 0.0917  963 HIS A C   
3254 O O   . HIS A 441 ? 0.7658 0.7755 0.8612 -0.1125 -0.0999 0.0940  963 HIS A O   
3255 C CB  . HIS A 441 ? 0.7404 0.8216 0.8494 -0.1029 -0.0844 0.1042  963 HIS A CB  
3256 C CG  . HIS A 441 ? 0.7802 0.8841 0.8928 -0.1045 -0.0842 0.1106  963 HIS A CG  
3257 N ND1 . HIS A 441 ? 0.7666 0.9098 0.8918 -0.0994 -0.0778 0.1235  963 HIS A ND1 
3258 C CD2 . HIS A 441 ? 0.7733 0.8667 0.8779 -0.1096 -0.0894 0.1063  963 HIS A CD2 
3259 C CE1 . HIS A 441 ? 0.7589 0.9153 0.8855 -0.1012 -0.0788 0.1273  963 HIS A CE1 
3260 N NE2 . HIS A 441 ? 0.7507 0.8776 0.8652 -0.1082 -0.0863 0.1173  963 HIS A NE2 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   523 ?   ?   ?   A . n 
A 1 2   GLY 2   524 ?   ?   ?   A . n 
A 1 3   HIS 3   525 ?   ?   ?   A . n 
A 1 4   ASN 4   526 ?   ?   ?   A . n 
A 1 5   HIS 5   527 ?   ?   ?   A . n 
A 1 6   ARG 6   528 ?   ?   ?   A . n 
A 1 7   HIS 7   529 ?   ?   ?   A . n 
A 1 8   LYS 8   530 ?   ?   ?   A . n 
A 1 9   HIS 9   531 ?   ?   ?   A . n 
A 1 10  HIS 10  532 ?   ?   ?   A . n 
A 1 11  HIS 11  533 ?   ?   ?   A . n 
A 1 12  HIS 12  534 ?   ?   ?   A . n 
A 1 13  HIS 13  535 ?   ?   ?   A . n 
A 1 14  HIS 14  536 ?   ?   ?   A . n 
A 1 15  HIS 15  537 ?   ?   ?   A . n 
A 1 16  HIS 16  538 ?   ?   ?   A . n 
A 1 17  GLU 17  539 ?   ?   ?   A . n 
A 1 18  ASN 18  540 ?   ?   ?   A . n 
A 1 19  LEU 19  541 ?   ?   ?   A . n 
A 1 20  TYR 20  542 ?   ?   ?   A . n 
A 1 21  PHE 21  543 ?   ?   ?   A . n 
A 1 22  GLN 22  544 ?   ?   ?   A . n 
A 1 23  GLY 23  545 ?   ?   ?   A . n 
A 1 24  PRO 24  546 ?   ?   ?   A . n 
A 1 25  GLY 25  547 ?   ?   ?   A . n 
A 1 26  SER 26  548 ?   ?   ?   A . n 
A 1 27  SER 27  549 ?   ?   ?   A . n 
A 1 28  PRO 28  550 ?   ?   ?   A . n 
A 1 29  SER 29  551 ?   ?   ?   A . n 
A 1 30  LEU 30  552 ?   ?   ?   A . n 
A 1 31  GLU 31  553 ?   ?   ?   A . n 
A 1 32  GLN 32  554 ?   ?   ?   A . n 
A 1 33  ASP 33  555 ?   ?   ?   A . n 
A 1 34  ASP 34  556 ?   ?   ?   A . n 
A 1 35  GLY 35  557 ?   ?   ?   A . n 
A 1 36  ASP 36  558 ?   ?   ?   A . n 
A 1 37  GLU 37  559 ?   ?   ?   A . n 
A 1 38  GLU 38  560 ?   ?   ?   A . n 
A 1 39  THR 39  561 561 THR THR A . n 
A 1 40  SER 40  562 562 SER SER A . n 
A 1 41  VAL 41  563 563 VAL VAL A . n 
A 1 42  VAL 42  564 564 VAL VAL A . n 
A 1 43  ILE 43  565 565 ILE ILE A . n 
A 1 44  VAL 44  566 566 VAL VAL A . n 
A 1 45  GLY 45  567 567 GLY GLY A . n 
A 1 46  LYS 46  568 568 LYS LYS A . n 
A 1 47  ILE 47  569 569 ILE ILE A . n 
A 1 48  SER 48  570 570 SER SER A . n 
A 1 49  PHE 49  571 571 PHE PHE A . n 
A 1 50  CYS 50  572 572 CYS CYS A . n 
A 1 51  PRO 51  573 573 PRO PRO A . n 
A 1 52  LYS 52  574 574 LYS LYS A . n 
A 1 53  ASP 53  575 575 ASP ASP A . n 
A 1 54  VAL 54  576 576 VAL VAL A . n 
A 1 55  LEU 55  577 577 LEU LEU A . n 
A 1 56  GLY 56  578 578 GLY GLY A . n 
A 1 57  HIS 57  579 579 HIS HIS A . n 
A 1 58  GLY 58  580 580 GLY GLY A . n 
A 1 59  ALA 59  581 581 ALA ALA A . n 
A 1 60  GLU 60  582 582 GLU GLU A . n 
A 1 61  GLY 61  583 583 GLY GLY A . n 
A 1 62  THR 62  584 584 THR THR A . n 
A 1 63  ILE 63  585 585 ILE ILE A . n 
A 1 64  VAL 64  586 586 VAL VAL A . n 
A 1 65  TYR 65  587 587 TYR TYR A . n 
A 1 66  ARG 66  588 588 ARG ARG A . n 
A 1 67  GLY 67  589 589 GLY GLY A . n 
A 1 68  MET 68  590 590 MET MET A . n 
A 1 69  PHE 69  591 591 PHE PHE A . n 
A 1 70  ASP 70  592 592 ASP ASP A . n 
A 1 71  ASN 71  593 593 ASN ASN A . n 
A 1 72  ARG 72  594 594 ARG ARG A . n 
A 1 73  ASP 73  595 595 ASP ASP A . n 
A 1 74  VAL 74  596 596 VAL VAL A . n 
A 1 75  ALA 75  597 597 ALA ALA A . n 
A 1 76  VAL 76  598 598 VAL VAL A . n 
A 1 77  LYS 77  599 599 LYS LYS A . n 
A 1 78  ARG 78  600 600 ARG ARG A . n 
A 1 79  ILE 79  601 601 ILE ILE A . n 
A 1 80  LEU 80  602 602 LEU LEU A . n 
A 1 81  PRO 81  603 603 PRO PRO A . n 
A 1 82  GLU 82  604 604 GLU GLU A . n 
A 1 83  CYS 83  605 605 CYS CYS A . n 
A 1 84  PHE 84  606 606 PHE PHE A . n 
A 1 85  SER 85  607 607 SER SER A . n 
A 1 86  PHE 86  608 608 PHE PHE A . n 
A 1 87  ALA 87  609 609 ALA ALA A . n 
A 1 88  ASP 88  610 610 ASP ASP A . n 
A 1 89  ARG 89  611 611 ARG ARG A . n 
A 1 90  GLU 90  612 612 GLU GLU A . n 
A 1 91  VAL 91  613 613 VAL VAL A . n 
A 1 92  GLN 92  614 614 GLN GLN A . n 
A 1 93  LEU 93  615 615 LEU LEU A . n 
A 1 94  LEU 94  616 616 LEU LEU A . n 
A 1 95  ARG 95  617 617 ARG ARG A . n 
A 1 96  GLU 96  618 618 GLU GLU A . n 
A 1 97  SER 97  619 619 SER SER A . n 
A 1 98  ASP 98  620 620 ASP ASP A . n 
A 1 99  GLU 99  621 621 GLU GLU A . n 
A 1 100 HIS 100 622 622 HIS HIS A . n 
A 1 101 PRO 101 623 623 PRO PRO A . n 
A 1 102 ASN 102 624 624 ASN ASN A . n 
A 1 103 VAL 103 625 625 VAL VAL A . n 
A 1 104 ILE 104 626 626 ILE ILE A . n 
A 1 105 ARG 105 627 627 ARG ARG A . n 
A 1 106 TYR 106 628 628 TYR TYR A . n 
A 1 107 PHE 107 629 629 PHE PHE A . n 
A 1 108 CYS 108 630 630 CYS CYS A . n 
A 1 109 THR 109 631 631 THR THR A . n 
A 1 110 GLU 110 632 632 GLU GLU A . n 
A 1 111 LYS 111 633 633 LYS LYS A . n 
A 1 112 ASP 112 634 634 ASP ASP A . n 
A 1 113 ARG 113 635 635 ARG ARG A . n 
A 1 114 GLN 114 636 636 GLN GLN A . n 
A 1 115 PHE 115 637 637 PHE PHE A . n 
A 1 116 GLN 116 638 638 GLN GLN A . n 
A 1 117 TYR 117 639 639 TYR TYR A . n 
A 1 118 ILE 118 640 640 ILE ILE A . n 
A 1 119 ALA 119 641 641 ALA ALA A . n 
A 1 120 ILE 120 642 642 ILE ILE A . n 
A 1 121 GLU 121 643 643 GLU GLU A . n 
A 1 122 LEU 122 644 644 LEU LEU A . n 
A 1 123 CYS 123 645 645 CYS CYS A . n 
A 1 124 ALA 124 646 646 ALA ALA A . n 
A 1 125 ALA 125 647 647 ALA ALA A . n 
A 1 126 THR 126 648 648 THR THR A . n 
A 1 127 LEU 127 649 649 LEU LEU A . n 
A 1 128 GLN 128 650 650 GLN GLN A . n 
A 1 129 GLU 129 651 651 GLU GLU A . n 
A 1 130 TYR 130 652 652 TYR TYR A . n 
A 1 131 VAL 131 653 653 VAL VAL A . n 
A 1 132 GLU 132 654 654 GLU GLU A . n 
A 1 133 GLN 133 655 655 GLN GLN A . n 
A 1 134 LYS 134 656 656 LYS LYS A . n 
A 1 135 ASP 135 657 657 ASP ASP A . n 
A 1 136 PHE 136 658 658 PHE PHE A . n 
A 1 137 ALA 137 659 659 ALA ALA A . n 
A 1 138 HIS 138 660 660 HIS HIS A . n 
A 1 139 LEU 139 661 661 LEU LEU A . n 
A 1 140 GLY 140 662 662 GLY GLY A . n 
A 1 141 LEU 141 663 663 LEU LEU A . n 
A 1 142 GLU 142 664 664 GLU GLU A . n 
A 1 143 PRO 143 665 665 PRO PRO A . n 
A 1 144 ILE 144 666 666 ILE ILE A . n 
A 1 145 THR 145 667 667 THR THR A . n 
A 1 146 LEU 146 668 668 LEU LEU A . n 
A 1 147 LEU 147 669 669 LEU LEU A . n 
A 1 148 GLN 148 670 670 GLN GLN A . n 
A 1 149 GLN 149 671 671 GLN GLN A . n 
A 1 150 THR 150 672 672 THR THR A . n 
A 1 151 THR 151 673 673 THR THR A . n 
A 1 152 SER 152 674 674 SER SER A . n 
A 1 153 GLY 153 675 675 GLY GLY A . n 
A 1 154 LEU 154 676 676 LEU LEU A . n 
A 1 155 ALA 155 677 677 ALA ALA A . n 
A 1 156 HIS 156 678 678 HIS HIS A . n 
A 1 157 LEU 157 679 679 LEU LEU A . n 
A 1 158 HIS 158 680 680 HIS HIS A . n 
A 1 159 SER 159 681 681 SER SER A . n 
A 1 160 LEU 160 682 682 LEU LEU A . n 
A 1 161 ASN 161 683 683 ASN ASN A . n 
A 1 162 ILE 162 684 684 ILE ILE A . n 
A 1 163 VAL 163 685 685 VAL VAL A . n 
A 1 164 HIS 164 686 686 HIS HIS A . n 
A 1 165 ARG 165 687 687 ARG ARG A . n 
A 1 166 ASP 166 688 688 ASP ASP A . n 
A 1 167 LEU 167 689 689 LEU LEU A . n 
A 1 168 LYS 168 690 690 LYS LYS A . n 
A 1 169 PRO 169 691 691 PRO PRO A . n 
A 1 170 HIS 170 692 692 HIS HIS A . n 
A 1 171 ASN 171 693 693 ASN ASN A . n 
A 1 172 ILE 172 694 694 ILE ILE A . n 
A 1 173 LEU 173 695 695 LEU LEU A . n 
A 1 174 ILE 174 696 696 ILE ILE A . n 
A 1 175 SER 175 697 697 SER SER A . n 
A 1 176 MET 176 698 698 MET MET A . n 
A 1 177 PRO 177 699 699 PRO PRO A . n 
A 1 178 ASN 178 700 700 ASN ASN A . n 
A 1 179 ALA 179 701 701 ALA ALA A . n 
A 1 180 HIS 180 702 702 HIS HIS A . n 
A 1 181 GLY 181 703 703 GLY GLY A . n 
A 1 182 LYS 182 704 704 LYS LYS A . n 
A 1 183 ILE 183 705 705 ILE ILE A . n 
A 1 184 LYS 184 706 706 LYS LYS A . n 
A 1 185 ALA 185 707 707 ALA ALA A . n 
A 1 186 MET 186 708 708 MET MET A . n 
A 1 187 ILE 187 709 709 ILE ILE A . n 
A 1 188 SER 188 710 710 SER SER A . n 
A 1 189 ASP 189 711 711 ASP ASP A . n 
A 1 190 PHE 190 712 712 PHE PHE A . n 
A 1 191 GLY 191 713 713 GLY GLY A . n 
A 1 192 LEU 192 714 714 LEU LEU A . n 
A 1 193 CYS 193 715 715 CYS CYS A . n 
A 1 194 LYS 194 716 716 LYS LYS A . n 
A 1 195 LYS 195 717 717 LYS LYS A . n 
A 1 196 LEU 196 718 718 LEU LEU A . n 
A 1 197 ALA 197 719 719 ALA ALA A . n 
A 1 198 VAL 198 720 720 VAL VAL A . n 
A 1 199 GLY 199 721 721 GLY GLY A . n 
A 1 200 ARG 200 722 722 ARG ARG A . n 
A 1 201 HIS 201 723 723 HIS HIS A . n 
A 1 202 SER 202 724 724 SER SER A . n 
A 1 203 PHE 203 725 725 PHE PHE A . n 
A 1 204 SER 204 726 726 SER SER A . n 
A 1 205 ARG 205 727 727 ARG ARG A . n 
A 1 206 ARG 206 728 728 ARG ARG A . n 
A 1 207 SER 207 729 729 SER SER A . n 
A 1 208 GLY 208 730 730 GLY GLY A . n 
A 1 209 VAL 209 731 731 VAL VAL A . n 
A 1 210 PRO 210 732 732 PRO PRO A . n 
A 1 211 GLY 211 733 733 GLY GLY A . n 
A 1 212 THR 212 734 734 THR THR A . n 
A 1 213 GLU 213 735 735 GLU GLU A . n 
A 1 214 GLY 214 736 736 GLY GLY A . n 
A 1 215 TRP 215 737 737 TRP TRP A . n 
A 1 216 ILE 216 738 738 ILE ILE A . n 
A 1 217 ALA 217 739 739 ALA ALA A . n 
A 1 218 PRO 218 740 740 PRO PRO A . n 
A 1 219 GLU 219 741 741 GLU GLU A . n 
A 1 220 MET 220 742 742 MET MET A . n 
A 1 221 LEU 221 743 743 LEU LEU A . n 
A 1 222 SER 222 744 744 SER SER A . n 
A 1 223 GLU 223 745 745 GLU GLU A . n 
A 1 224 ASP 224 746 746 ASP ASP A . n 
A 1 225 CYS 225 747 747 CYS CYS A . n 
A 1 226 LYS 226 748 748 LYS LYS A . n 
A 1 227 GLU 227 749 749 GLU GLU A . n 
A 1 228 ASN 228 750 750 ASN ASN A . n 
A 1 229 PRO 229 751 751 PRO PRO A . n 
A 1 230 THR 230 752 752 THR THR A . n 
A 1 231 TYR 231 753 753 TYR TYR A . n 
A 1 232 THR 232 754 754 THR THR A . n 
A 1 233 VAL 233 755 755 VAL VAL A . n 
A 1 234 ASP 234 756 756 ASP ASP A . n 
A 1 235 ILE 235 757 757 ILE ILE A . n 
A 1 236 PHE 236 758 758 PHE PHE A . n 
A 1 237 SER 237 759 759 SER SER A . n 
A 1 238 ALA 238 760 760 ALA ALA A . n 
A 1 239 GLY 239 761 761 GLY GLY A . n 
A 1 240 CYS 240 762 762 CYS CYS A . n 
A 1 241 VAL 241 763 763 VAL VAL A . n 
A 1 242 PHE 242 764 764 PHE PHE A . n 
A 1 243 TYR 243 765 765 TYR TYR A . n 
A 1 244 TYR 244 766 766 TYR TYR A . n 
A 1 245 VAL 245 767 767 VAL VAL A . n 
A 1 246 ILE 246 768 768 ILE ILE A . n 
A 1 247 SER 247 769 769 SER SER A . n 
A 1 248 GLU 248 770 770 GLU GLU A . n 
A 1 249 GLY 249 771 771 GLY GLY A . n 
A 1 250 SER 250 772 772 SER SER A . n 
A 1 251 HIS 251 773 773 HIS HIS A . n 
A 1 252 PRO 252 774 774 PRO PRO A . n 
A 1 253 PHE 253 775 775 PHE PHE A . n 
A 1 254 GLY 254 776 776 GLY GLY A . n 
A 1 255 LYS 255 777 777 LYS LYS A . n 
A 1 256 SER 256 778 778 SER SER A . n 
A 1 257 LEU 257 779 779 LEU LEU A . n 
A 1 258 GLN 258 780 780 GLN GLN A . n 
A 1 259 ARG 259 781 781 ARG ARG A . n 
A 1 260 GLN 260 782 782 GLN GLN A . n 
A 1 261 ALA 261 783 783 ALA ALA A . n 
A 1 262 ASN 262 784 784 ASN ASN A . n 
A 1 263 ILE 263 785 785 ILE ILE A . n 
A 1 264 LEU 264 786 786 LEU LEU A . n 
A 1 265 LEU 265 787 787 LEU LEU A . n 
A 1 266 GLY 266 788 788 GLY GLY A . n 
A 1 267 ALA 267 789 789 ALA ALA A . n 
A 1 268 CYS 268 790 790 CYS CYS A . n 
A 1 269 SER 269 791 791 SER SER A . n 
A 1 270 LEU 270 792 792 LEU LEU A . n 
A 1 271 ASP 271 793 793 ASP ASP A . n 
A 1 272 CYS 272 794 794 CYS CYS A . n 
A 1 273 LEU 273 795 795 LEU LEU A . n 
A 1 274 HIS 274 796 796 HIS HIS A . n 
A 1 275 PRO 275 797 797 PRO PRO A . n 
A 1 276 GLU 276 798 798 GLU GLU A . n 
A 1 277 LYS 277 799 799 LYS LYS A . n 
A 1 278 HIS 278 800 800 HIS HIS A . n 
A 1 279 GLU 279 801 801 GLU GLU A . n 
A 1 280 ASP 280 802 802 ASP ASP A . n 
A 1 281 VAL 281 803 803 VAL VAL A . n 
A 1 282 ILE 282 804 804 ILE ILE A . n 
A 1 283 ALA 283 805 805 ALA ALA A . n 
A 1 284 ARG 284 806 806 ARG ARG A . n 
A 1 285 GLU 285 807 807 GLU GLU A . n 
A 1 286 LEU 286 808 808 LEU LEU A . n 
A 1 287 ILE 287 809 809 ILE ILE A . n 
A 1 288 GLU 288 810 810 GLU GLU A . n 
A 1 289 LYS 289 811 811 LYS LYS A . n 
A 1 290 MET 290 812 812 MET MET A . n 
A 1 291 ILE 291 813 813 ILE ILE A . n 
A 1 292 ALA 292 814 814 ALA ALA A . n 
A 1 293 MET 293 815 815 MET MET A . n 
A 1 294 ASP 294 816 816 ASP ASP A . n 
A 1 295 PRO 295 817 817 PRO PRO A . n 
A 1 296 GLN 296 818 818 GLN GLN A . n 
A 1 297 LYS 297 819 819 LYS LYS A . n 
A 1 298 ARG 298 820 820 ARG ARG A . n 
A 1 299 PRO 299 821 821 PRO PRO A . n 
A 1 300 SER 300 822 822 SER SER A . n 
A 1 301 ALA 301 823 823 ALA ALA A . n 
A 1 302 LYS 302 824 824 LYS LYS A . n 
A 1 303 HIS 303 825 825 HIS HIS A . n 
A 1 304 VAL 304 826 826 VAL VAL A . n 
A 1 305 LEU 305 827 827 LEU LEU A . n 
A 1 306 LYS 306 828 828 LYS LYS A . n 
A 1 307 HIS 307 829 829 HIS HIS A . n 
A 1 308 PRO 308 830 830 PRO PRO A . n 
A 1 309 PHE 309 831 831 PHE PHE A . n 
A 1 310 PHE 310 832 832 PHE PHE A . n 
A 1 311 TRP 311 833 833 TRP TRP A . n 
A 1 312 SER 312 834 834 SER SER A . n 
A 1 313 LEU 313 835 835 LEU LEU A . n 
A 1 314 GLU 314 836 836 GLU GLU A . n 
A 1 315 LYS 315 837 837 LYS LYS A . n 
A 1 316 GLN 316 838 838 GLN GLN A . n 
A 1 317 LEU 317 839 839 LEU LEU A . n 
A 1 318 GLN 318 840 840 GLN GLN A . n 
A 1 319 PHE 319 841 841 PHE PHE A . n 
A 1 320 PHE 320 842 842 PHE PHE A . n 
A 1 321 GLN 321 843 843 GLN GLN A . n 
A 1 322 ASP 322 844 844 ASP ASP A . n 
A 1 323 VAL 323 845 845 VAL VAL A . n 
A 1 324 SER 324 846 846 SER SER A . n 
A 1 325 ASP 325 847 847 ASP ASP A . n 
A 1 326 ARG 326 848 848 ARG ARG A . n 
A 1 327 ILE 327 849 849 ILE ILE A . n 
A 1 328 GLU 328 850 850 GLU GLU A . n 
A 1 329 LYS 329 851 851 LYS LYS A . n 
A 1 330 GLU 330 852 852 GLU GLU A . n 
A 1 331 SER 331 853 853 SER SER A . n 
A 1 332 LEU 332 854 854 LEU LEU A . n 
A 1 333 ASP 333 855 855 ASP ASP A . n 
A 1 334 GLY 334 856 856 GLY GLY A . n 
A 1 335 PRO 335 857 857 PRO PRO A . n 
A 1 336 ILE 336 858 858 ILE ILE A . n 
A 1 337 VAL 337 859 859 VAL VAL A . n 
A 1 338 LYS 338 860 860 LYS LYS A . n 
A 1 339 GLN 339 861 861 GLN GLN A . n 
A 1 340 LEU 340 862 862 LEU LEU A . n 
A 1 341 GLU 341 863 863 GLU GLU A . n 
A 1 342 ARG 342 864 864 ARG ARG A . n 
A 1 343 GLY 343 865 865 GLY GLY A . n 
A 1 344 GLY 344 866 866 GLY GLY A . n 
A 1 345 ARG 345 867 867 ARG ARG A . n 
A 1 346 ALA 346 868 868 ALA ALA A . n 
A 1 347 VAL 347 869 869 VAL VAL A . n 
A 1 348 VAL 348 870 870 VAL VAL A . n 
A 1 349 LYS 349 871 871 LYS LYS A . n 
A 1 350 MET 350 872 872 MET MET A . n 
A 1 351 ASP 351 873 873 ASP ASP A . n 
A 1 352 TRP 352 874 874 TRP TRP A . n 
A 1 353 ARG 353 875 875 ARG ARG A . n 
A 1 354 GLU 354 876 876 GLU GLU A . n 
A 1 355 ASN 355 877 877 ASN ASN A . n 
A 1 356 ILE 356 878 878 ILE ILE A . n 
A 1 357 THR 357 879 879 THR THR A . n 
A 1 358 VAL 358 880 880 VAL VAL A . n 
A 1 359 PRO 359 881 881 PRO PRO A . n 
A 1 360 LEU 360 882 882 LEU LEU A . n 
A 1 361 GLN 361 883 883 GLN GLN A . n 
A 1 362 THR 362 884 884 THR THR A . n 
A 1 363 ASP 363 885 885 ASP ASP A . n 
A 1 364 LEU 364 886 886 LEU LEU A . n 
A 1 365 ARG 365 887 887 ARG ARG A . n 
A 1 366 LYS 366 888 888 LYS LYS A . n 
A 1 367 PHE 367 889 889 PHE PHE A . n 
A 1 368 ARG 368 890 890 ARG ARG A . n 
A 1 369 THR 369 891 891 THR THR A . n 
A 1 370 TYR 370 892 892 TYR TYR A . n 
A 1 371 LYS 371 893 893 LYS LYS A . n 
A 1 372 GLY 372 894 894 GLY GLY A . n 
A 1 373 GLY 373 895 895 GLY GLY A . n 
A 1 374 SER 374 896 896 SER SER A . n 
A 1 375 VAL 375 897 897 VAL VAL A . n 
A 1 376 ARG 376 898 898 ARG ARG A . n 
A 1 377 ASP 377 899 899 ASP ASP A . n 
A 1 378 LEU 378 900 900 LEU LEU A . n 
A 1 379 LEU 379 901 901 LEU LEU A . n 
A 1 380 ARG 380 902 902 ARG ARG A . n 
A 1 381 ALA 381 903 903 ALA ALA A . n 
A 1 382 MET 382 904 904 MET MET A . n 
A 1 383 ARG 383 905 905 ARG ARG A . n 
A 1 384 ASN 384 906 906 ASN ASN A . n 
A 1 385 LYS 385 907 907 LYS LYS A . n 
A 1 386 LYS 386 908 908 LYS LYS A . n 
A 1 387 HIS 387 909 909 HIS HIS A . n 
A 1 388 HIS 388 910 910 HIS HIS A . n 
A 1 389 TYR 389 911 911 TYR TYR A . n 
A 1 390 ARG 390 912 912 ARG ARG A . n 
A 1 391 GLU 391 913 913 GLU GLU A . n 
A 1 392 LEU 392 914 914 LEU LEU A . n 
A 1 393 PRO 393 915 915 PRO PRO A . n 
A 1 394 ALA 394 916 916 ALA ALA A . n 
A 1 395 GLU 395 917 917 GLU GLU A . n 
A 1 396 VAL 396 918 918 VAL VAL A . n 
A 1 397 ARG 397 919 919 ARG ARG A . n 
A 1 398 GLU 398 920 920 GLU GLU A . n 
A 1 399 THR 399 921 921 THR THR A . n 
A 1 400 LEU 400 922 922 LEU LEU A . n 
A 1 401 GLY 401 923 923 GLY GLY A . n 
A 1 402 THR 402 924 924 THR THR A . n 
A 1 403 LEU 403 925 925 LEU LEU A . n 
A 1 404 PRO 404 926 926 PRO PRO A . n 
A 1 405 ASP 405 927 927 ASP ASP A . n 
A 1 406 ASP 406 928 928 ASP ASP A . n 
A 1 407 PHE 407 929 929 PHE PHE A . n 
A 1 408 VAL 408 930 930 VAL VAL A . n 
A 1 409 CYS 409 931 931 CYS CYS A . n 
A 1 410 TYR 410 932 932 TYR TYR A . n 
A 1 411 PHE 411 933 933 PHE PHE A . n 
A 1 412 THR 412 934 934 THR THR A . n 
A 1 413 SER 413 935 935 SER SER A . n 
A 1 414 ARG 414 936 936 ARG ARG A . n 
A 1 415 PHE 415 937 937 PHE PHE A . n 
A 1 416 PRO 416 938 938 PRO PRO A . n 
A 1 417 HIS 417 939 939 HIS HIS A . n 
A 1 418 LEU 418 940 940 LEU LEU A . n 
A 1 419 LEU 419 941 941 LEU LEU A . n 
A 1 420 ALA 420 942 942 ALA ALA A . n 
A 1 421 HIS 421 943 943 HIS HIS A . n 
A 1 422 THR 422 944 944 THR THR A . n 
A 1 423 TYR 423 945 945 TYR TYR A . n 
A 1 424 ARG 424 946 946 ARG ARG A . n 
A 1 425 ALA 425 947 947 ALA ALA A . n 
A 1 426 MET 426 948 948 MET MET A . n 
A 1 427 GLU 427 949 949 GLU GLU A . n 
A 1 428 LEU 428 950 950 LEU LEU A . n 
A 1 429 CYS 429 951 951 CYS CYS A . n 
A 1 430 SER 430 952 952 SER SER A . n 
A 1 431 HIS 431 953 953 HIS HIS A . n 
A 1 432 GLU 432 954 954 GLU GLU A . n 
A 1 433 ARG 433 955 955 ARG ARG A . n 
A 1 434 LEU 434 956 956 LEU LEU A . n 
A 1 435 PHE 435 957 957 PHE PHE A . n 
A 1 436 GLN 436 958 958 GLN GLN A . n 
A 1 437 PRO 437 959 959 PRO PRO A . n 
A 1 438 TYR 438 960 960 TYR TYR A . n 
A 1 439 TYR 439 961 961 TYR TYR A . n 
A 1 440 PHE 440 962 962 PHE PHE A . n 
A 1 441 HIS 441 963 963 HIS HIS A . n 
A 1 442 GLU 442 964 ?   ?   ?   A . n 
A 1 443 PRO 443 965 ?   ?   ?   A . n 
A 1 444 PRO 444 966 ?   ?   ?   A . n 
A 1 445 GLU 445 967 ?   ?   ?   A . n 
A 1 446 PRO 446 968 ?   ?   ?   A . n 
A 1 447 GLN 447 969 ?   ?   ?   A . n 
A 1 448 PRO 448 970 ?   ?   ?   A . n 
A 1 449 PRO 449 971 ?   ?   ?   A . n 
A 1 450 VAL 450 972 ?   ?   ?   A . n 
A 1 451 THR 451 973 ?   ?   ?   A . n 
A 1 452 PRO 452 974 ?   ?   ?   A . n 
A 1 453 ASP 453 975 ?   ?   ?   A . n 
A 1 454 ALA 454 976 ?   ?   ?   A . n 
A 1 455 LEU 455 977 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 3E4 1  1001 1  3E4 UNL A . 
C 3 SO4 1  1002 1  SO4 SO4 A . 
D 3 SO4 1  1003 2  SO4 SO4 A . 
E 3 SO4 1  1004 3  SO4 SO4 A . 
F 3 SO4 1  1005 4  SO4 SO4 A . 
G 3 SO4 1  1006 5  SO4 SO4 A . 
H 4 EDO 1  1007 1  EDO EDO A . 
I 5 EPE 1  1008 1  EPE EPE A . 
J 6 HOH 1  1101 6  HOH HOH A . 
J 6 HOH 2  1102 71 HOH HOH A . 
J 6 HOH 3  1103 42 HOH HOH A . 
J 6 HOH 4  1104 22 HOH HOH A . 
J 6 HOH 5  1105 16 HOH HOH A . 
J 6 HOH 6  1106 27 HOH HOH A . 
J 6 HOH 7  1107 69 HOH HOH A . 
J 6 HOH 8  1108 43 HOH HOH A . 
J 6 HOH 9  1109 18 HOH HOH A . 
J 6 HOH 10 1110 35 HOH HOH A . 
J 6 HOH 11 1111 30 HOH HOH A . 
J 6 HOH 12 1112 2  HOH HOH A . 
J 6 HOH 13 1113 54 HOH HOH A . 
J 6 HOH 14 1114 5  HOH HOH A . 
J 6 HOH 15 1115 51 HOH HOH A . 
J 6 HOH 16 1116 1  HOH HOH A . 
J 6 HOH 17 1117 3  HOH HOH A . 
J 6 HOH 18 1118 4  HOH HOH A . 
J 6 HOH 19 1119 7  HOH HOH A . 
J 6 HOH 20 1120 8  HOH HOH A . 
J 6 HOH 21 1121 9  HOH HOH A . 
J 6 HOH 22 1122 10 HOH HOH A . 
J 6 HOH 23 1123 11 HOH HOH A . 
J 6 HOH 24 1124 12 HOH HOH A . 
J 6 HOH 25 1125 13 HOH HOH A . 
J 6 HOH 26 1126 14 HOH HOH A . 
J 6 HOH 27 1127 15 HOH HOH A . 
J 6 HOH 28 1128 17 HOH HOH A . 
J 6 HOH 29 1129 19 HOH HOH A . 
J 6 HOH 30 1130 20 HOH HOH A . 
J 6 HOH 31 1131 21 HOH HOH A . 
J 6 HOH 32 1132 23 HOH HOH A . 
J 6 HOH 33 1133 24 HOH HOH A . 
J 6 HOH 34 1134 25 HOH HOH A . 
J 6 HOH 35 1135 26 HOH HOH A . 
J 6 HOH 36 1136 28 HOH HOH A . 
J 6 HOH 37 1137 29 HOH HOH A . 
J 6 HOH 38 1138 31 HOH HOH A . 
J 6 HOH 39 1139 32 HOH HOH A . 
J 6 HOH 40 1140 33 HOH HOH A . 
J 6 HOH 41 1141 34 HOH HOH A . 
J 6 HOH 42 1142 36 HOH HOH A . 
J 6 HOH 43 1143 37 HOH HOH A . 
J 6 HOH 44 1144 38 HOH HOH A . 
J 6 HOH 45 1145 39 HOH HOH A . 
J 6 HOH 46 1146 40 HOH HOH A . 
J 6 HOH 47 1147 41 HOH HOH A . 
J 6 HOH 48 1148 44 HOH HOH A . 
J 6 HOH 49 1149 45 HOH HOH A . 
J 6 HOH 50 1150 46 HOH HOH A . 
J 6 HOH 51 1151 47 HOH HOH A . 
J 6 HOH 52 1152 48 HOH HOH A . 
J 6 HOH 53 1153 49 HOH HOH A . 
J 6 HOH 54 1154 50 HOH HOH A . 
J 6 HOH 55 1155 52 HOH HOH A . 
J 6 HOH 56 1156 53 HOH HOH A . 
J 6 HOH 57 1157 55 HOH HOH A . 
J 6 HOH 58 1158 56 HOH HOH A . 
J 6 HOH 59 1159 57 HOH HOH A . 
J 6 HOH 60 1160 58 HOH HOH A . 
J 6 HOH 61 1161 59 HOH HOH A . 
J 6 HOH 62 1162 60 HOH HOH A . 
J 6 HOH 63 1163 61 HOH HOH A . 
J 6 HOH 64 1164 62 HOH HOH A . 
J 6 HOH 65 1165 63 HOH HOH A . 
J 6 HOH 66 1166 64 HOH HOH A . 
J 6 HOH 67 1167 65 HOH HOH A . 
J 6 HOH 68 1168 66 HOH HOH A . 
J 6 HOH 69 1169 67 HOH HOH A . 
J 6 HOH 70 1170 68 HOH HOH A . 
J 6 HOH 71 1171 70 HOH HOH A . 
J 6 HOH 72 1172 72 HOH HOH A . 
J 6 HOH 73 1173 73 HOH HOH A . 
J 6 HOH 74 1174 74 HOH HOH A . 
J 6 HOH 75 1175 75 HOH HOH A . 
J 6 HOH 76 1176 76 HOH HOH A . 
J 6 HOH 77 1177 77 HOH HOH A . 
J 6 HOH 78 1178 78 HOH HOH A . 
J 6 HOH 79 1179 79 HOH HOH A . 
J 6 HOH 80 1180 80 HOH HOH A . 
J 6 HOH 81 1181 81 HOH HOH A . 
J 6 HOH 82 1182 82 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1310  ? 
1 MORE         -45   ? 
1 'SSA (A^2)'  21070 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2014-10-08 
2 'Structure model' 1 1 2015-01-28 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         1.4610 
_pdbx_refine_tls.origin_y         -11.9650 
_pdbx_refine_tls.origin_z         -20.1030 
_pdbx_refine_tls.T[1][1]          0.0043 
_pdbx_refine_tls.T[1][1]_esd      ? 
_pdbx_refine_tls.T[1][2]          0.0053 
_pdbx_refine_tls.T[1][2]_esd      ? 
_pdbx_refine_tls.T[1][3]          -0.0065 
_pdbx_refine_tls.T[1][3]_esd      ? 
_pdbx_refine_tls.T[2][2]          0.0382 
_pdbx_refine_tls.T[2][2]_esd      ? 
_pdbx_refine_tls.T[2][3]          -0.0082 
_pdbx_refine_tls.T[2][3]_esd      ? 
_pdbx_refine_tls.T[3][3]          0.0661 
_pdbx_refine_tls.T[3][3]_esd      ? 
_pdbx_refine_tls.L[1][1]          1.3754 
_pdbx_refine_tls.L[1][1]_esd      ? 
_pdbx_refine_tls.L[1][2]          -0.3669 
_pdbx_refine_tls.L[1][2]_esd      ? 
_pdbx_refine_tls.L[1][3]          0.6694 
_pdbx_refine_tls.L[1][3]_esd      ? 
_pdbx_refine_tls.L[2][2]          1.2458 
_pdbx_refine_tls.L[2][2]_esd      ? 
_pdbx_refine_tls.L[2][3]          -1.2323 
_pdbx_refine_tls.L[2][3]_esd      ? 
_pdbx_refine_tls.L[3][3]          1.7871 
_pdbx_refine_tls.L[3][3]_esd      ? 
_pdbx_refine_tls.S[1][1]          0.0380 
_pdbx_refine_tls.S[1][1]_esd      ? 
_pdbx_refine_tls.S[1][2]          0.0650 
_pdbx_refine_tls.S[1][2]_esd      ? 
_pdbx_refine_tls.S[1][3]          0.0190 
_pdbx_refine_tls.S[1][3]_esd      ? 
_pdbx_refine_tls.S[2][1]          0.0229 
_pdbx_refine_tls.S[2][1]_esd      ? 
_pdbx_refine_tls.S[2][2]          -0.0501 
_pdbx_refine_tls.S[2][2]_esd      ? 
_pdbx_refine_tls.S[2][3]          0.0852 
_pdbx_refine_tls.S[2][3]_esd      ? 
_pdbx_refine_tls.S[3][1]          -0.0121 
_pdbx_refine_tls.S[3][1]_esd      ? 
_pdbx_refine_tls.S[3][2]          0.1609 
_pdbx_refine_tls.S[3][2]_esd      ? 
_pdbx_refine_tls.S[3][3]          0.0121 
_pdbx_refine_tls.S[3][3]_esd      ? 
# 
_pdbx_refine_tls_group.id                  1 
_pdbx_refine_tls_group.pdbx_refine_id      'X-RAY DIFFRACTION' 
_pdbx_refine_tls_group.refine_tls_id       1 
_pdbx_refine_tls_group.beg_label_asym_id   ? 
_pdbx_refine_tls_group.beg_label_seq_id    ? 
_pdbx_refine_tls_group.beg_auth_asym_id    A 
_pdbx_refine_tls_group.beg_auth_seq_id     561 
_pdbx_refine_tls_group.end_label_asym_id   ? 
_pdbx_refine_tls_group.end_label_seq_id    ? 
_pdbx_refine_tls_group.end_auth_asym_id    A 
_pdbx_refine_tls_group.end_auth_seq_id     963 
_pdbx_refine_tls_group.selection           ? 
_pdbx_refine_tls_group.selection_details   ? 
# 
_software.citation_id            ? 
_software.classification         refinement 
_software.compiler_name          ? 
_software.compiler_version       ? 
_software.contact_author         ? 
_software.contact_author_email   ? 
_software.date                   ? 
_software.description            ? 
_software.dependencies           ? 
_software.hardware               ? 
_software.language               ? 
_software.location               ? 
_software.mods                   ? 
_software.name                   REFMAC 
_software.os                     ? 
_software.os_version             ? 
_software.type                   ? 
_software.version                5.8.0049 
_software.pdbx_ordinal           1 
# 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.entry_id             4U6R 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     'SER TO THR CONFLICT AT THIS POSITION IN UNP ENTRY O75460' 
_pdbx_entry_details.source_details       ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ARG A 687 ? ? 74.35 -6.96  
2 1 ASP A 711 ? ? 66.91 71.23  
3 1 MET A 872 ? ? 73.64 -54.35 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 523 ? A MET 1   
2  1 Y 1 A GLY 524 ? A GLY 2   
3  1 Y 1 A HIS 525 ? A HIS 3   
4  1 Y 1 A ASN 526 ? A ASN 4   
5  1 Y 1 A HIS 527 ? A HIS 5   
6  1 Y 1 A ARG 528 ? A ARG 6   
7  1 Y 1 A HIS 529 ? A HIS 7   
8  1 Y 1 A LYS 530 ? A LYS 8   
9  1 Y 1 A HIS 531 ? A HIS 9   
10 1 Y 1 A HIS 532 ? A HIS 10  
11 1 Y 1 A HIS 533 ? A HIS 11  
12 1 Y 1 A HIS 534 ? A HIS 12  
13 1 Y 1 A HIS 535 ? A HIS 13  
14 1 Y 1 A HIS 536 ? A HIS 14  
15 1 Y 1 A HIS 537 ? A HIS 15  
16 1 Y 1 A HIS 538 ? A HIS 16  
17 1 Y 1 A GLU 539 ? A GLU 17  
18 1 Y 1 A ASN 540 ? A ASN 18  
19 1 Y 1 A LEU 541 ? A LEU 19  
20 1 Y 1 A TYR 542 ? A TYR 20  
21 1 Y 1 A PHE 543 ? A PHE 21  
22 1 Y 1 A GLN 544 ? A GLN 22  
23 1 Y 1 A GLY 545 ? A GLY 23  
24 1 Y 1 A PRO 546 ? A PRO 24  
25 1 Y 1 A GLY 547 ? A GLY 25  
26 1 Y 1 A SER 548 ? A SER 26  
27 1 Y 1 A SER 549 ? A SER 27  
28 1 Y 1 A PRO 550 ? A PRO 28  
29 1 Y 1 A SER 551 ? A SER 29  
30 1 Y 1 A LEU 552 ? A LEU 30  
31 1 Y 1 A GLU 553 ? A GLU 31  
32 1 Y 1 A GLN 554 ? A GLN 32  
33 1 Y 1 A ASP 555 ? A ASP 33  
34 1 Y 1 A ASP 556 ? A ASP 34  
35 1 Y 1 A GLY 557 ? A GLY 35  
36 1 Y 1 A ASP 558 ? A ASP 36  
37 1 Y 1 A GLU 559 ? A GLU 37  
38 1 Y 1 A GLU 560 ? A GLU 38  
39 1 Y 1 A GLU 964 ? A GLU 442 
40 1 Y 1 A PRO 965 ? A PRO 443 
41 1 Y 1 A PRO 966 ? A PRO 444 
42 1 Y 1 A GLU 967 ? A GLU 445 
43 1 Y 1 A PRO 968 ? A PRO 446 
44 1 Y 1 A GLN 969 ? A GLN 447 
45 1 Y 1 A PRO 970 ? A PRO 448 
46 1 Y 1 A PRO 971 ? A PRO 449 
47 1 Y 1 A VAL 972 ? A VAL 450 
48 1 Y 1 A THR 973 ? A THR 451 
49 1 Y 1 A PRO 974 ? A PRO 452 
50 1 Y 1 A ASP 975 ? A ASP 453 
51 1 Y 1 A ALA 976 ? A ALA 454 
52 1 Y 1 A LEU 977 ? A LEU 455 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 
'N-{4-[(3-{2-[(trans-4-aminocyclohexyl)amino]pyrimidin-4-yl}pyridin-2-yl)oxy]-3-methylnaphthalen-1-yl}-2-chlorobenzenesulfonamide' 
3E4 
3 'SULFATE ION' SO4 
4 1,2-ETHANEDIOL EDO 
5 '4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID' EPE 
6 water HOH 
#