data_4U7B
# 
_entry.id   4U7B 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4U7B         
WWPDB D_1000202932 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB 'contain same protein' 3HOS unspecified 
PDB 'contain same protein' 3HOT unspecified 
PDB 'contain same protein' 2F7T unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4U7B 
_pdbx_database_status.recvd_initial_deposition_date   2014-07-30 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
_audit_author.name           'Richardson, J.M.' 
_audit_author.pdbx_ordinal   1 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nucleic Acids Res.' 
_citation.journal_id_ASTM           NARHAD 
_citation.journal_id_CSD            0389 
_citation.journal_id_ISSN           1362-4962 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            43 
_citation.language                  ? 
_citation.page_first                2424 
_citation.page_last                 2432 
_citation.title                     'Structural role of the flanking DNA in mariner transposon excision.' 
_citation.year                      2015 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1093/nar/gkv096 
_citation.pdbx_database_id_PubMed   25662605 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Dornan, J.'       1 
primary 'Grey, H.'         2 
primary 'Richardson, J.M.' 3 
# 
_cell.length_a           96.471 
_cell.length_b           340.090 
_cell.length_c           160.360 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           4U7B 
_cell.Z_PDB              24 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4U7B 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn 'DNA (25-MER)'             7768.030  3 ?       ? ?                    ? 
2 polymer     syn 'DNA (31-MER)'             9479.146  3 ?       ? ?                    ? 
3 polymer     man 'Mariner Mos1 transposase' 40515.961 3 3.1.-.- ? 'UNP residues 4-345' ? 
4 non-polymer syn 'SULFATE ION'              96.063    3 ?       ? ?                    ? 
5 water       nat water                      18.015    2 ?       ? ?                    ? 
# 
_entity_name_com.entity_id   3 
_entity_name_com.name        'Transposable element Mos1 transposase, Mos transposase' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no 
;(DG)(DG)(DT)(DG)(DT)(DA)(DC)(DA)(DA)(DG)(DT)(DA)(DT)(DG)(DA)(DA)(DA)(DT)(DG)(DT)
(DC)(DG)(DT)(DT)(DT)
;
GGTGTACAAGTATGAAATGTCGTTT C,E,H ? 
2 polydeoxyribonucleotide no no 
;(DA)(DA)(DA)(DC)(DG)(DA)(DC)(DA)(DT)(DT)(DT)(DC)(DA)(DT)(DA)(DC)(DT)(DT)(DG)(DT)
(DA)(DC)(DA)(DC)(DC)(DT)(DG)(DA)(DT)(DA)(DG)
;
AAACGACATTTCATACTTGTACACCTGATAG D,F,I ? 
3 'polypeptide(L)'        no no 
;FVPNKEQTRTVLIFCFHLKKTAAESHRMLVEAFGEQVPTVKTCERWFQRFKSGDFDVDDKEHGKPPKRYEDAELQALLDE
DDAQTQKQLAEQLEVSQQAVSNRLREMGKIQKVGRWVPHELNERQMERRKNTCEILLSRYKRKSFLHRIVTGDEKWIFFV
NPKRKKSYVDPGQPATSTARPNRFGKKTMLCVWWDQSGVIYYELLKPGETVNAARYQQQLINLNRALQRKRPEYQKRQHR
VIFLHANAPSHTARAVRDTLETLNWEVLPHAAYSPDLAPSDYHLFASMGHALAEQRFDSYESVKKWLDEWFAAKDDEFYW
RGIHKLPERWEKCVASDGKYFE
;
;FVPNKEQTRTVLIFCFHLKKTAAESHRMLVEAFGEQVPTVKTCERWFQRFKSGDFDVDDKEHGKPPKRYEDAELQALLDE
DDAQTQKQLAEQLEVSQQAVSNRLREMGKIQKVGRWVPHELNERQMERRKNTCEILLSRYKRKSFLHRIVTGDEKWIFFV
NPKRKKSYVDPGQPATSTARPNRFGKKTMLCVWWDQSGVIYYELLKPGETVNAARYQQQLINLNRALQRKRPEYQKRQHR
VIFLHANAPSHTARAVRDTLETLNWEVLPHAAYSPDLAPSDYHLFASMGHALAEQRFDSYESVKKWLDEWFAAKDDEFYW
RGIHKLPERWEKCVASDGKYFE
;
A,B,G ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DG  n 
1 2   DG  n 
1 3   DT  n 
1 4   DG  n 
1 5   DT  n 
1 6   DA  n 
1 7   DC  n 
1 8   DA  n 
1 9   DA  n 
1 10  DG  n 
1 11  DT  n 
1 12  DA  n 
1 13  DT  n 
1 14  DG  n 
1 15  DA  n 
1 16  DA  n 
1 17  DA  n 
1 18  DT  n 
1 19  DG  n 
1 20  DT  n 
1 21  DC  n 
1 22  DG  n 
1 23  DT  n 
1 24  DT  n 
1 25  DT  n 
2 1   DA  n 
2 2   DA  n 
2 3   DA  n 
2 4   DC  n 
2 5   DG  n 
2 6   DA  n 
2 7   DC  n 
2 8   DA  n 
2 9   DT  n 
2 10  DT  n 
2 11  DT  n 
2 12  DC  n 
2 13  DA  n 
2 14  DT  n 
2 15  DA  n 
2 16  DC  n 
2 17  DT  n 
2 18  DT  n 
2 19  DG  n 
2 20  DT  n 
2 21  DA  n 
2 22  DC  n 
2 23  DA  n 
2 24  DC  n 
2 25  DC  n 
2 26  DT  n 
2 27  DG  n 
2 28  DA  n 
2 29  DT  n 
2 30  DA  n 
2 31  DG  n 
3 1   PHE n 
3 2   VAL n 
3 3   PRO n 
3 4   ASN n 
3 5   LYS n 
3 6   GLU n 
3 7   GLN n 
3 8   THR n 
3 9   ARG n 
3 10  THR n 
3 11  VAL n 
3 12  LEU n 
3 13  ILE n 
3 14  PHE n 
3 15  CYS n 
3 16  PHE n 
3 17  HIS n 
3 18  LEU n 
3 19  LYS n 
3 20  LYS n 
3 21  THR n 
3 22  ALA n 
3 23  ALA n 
3 24  GLU n 
3 25  SER n 
3 26  HIS n 
3 27  ARG n 
3 28  MET n 
3 29  LEU n 
3 30  VAL n 
3 31  GLU n 
3 32  ALA n 
3 33  PHE n 
3 34  GLY n 
3 35  GLU n 
3 36  GLN n 
3 37  VAL n 
3 38  PRO n 
3 39  THR n 
3 40  VAL n 
3 41  LYS n 
3 42  THR n 
3 43  CYS n 
3 44  GLU n 
3 45  ARG n 
3 46  TRP n 
3 47  PHE n 
3 48  GLN n 
3 49  ARG n 
3 50  PHE n 
3 51  LYS n 
3 52  SER n 
3 53  GLY n 
3 54  ASP n 
3 55  PHE n 
3 56  ASP n 
3 57  VAL n 
3 58  ASP n 
3 59  ASP n 
3 60  LYS n 
3 61  GLU n 
3 62  HIS n 
3 63  GLY n 
3 64  LYS n 
3 65  PRO n 
3 66  PRO n 
3 67  LYS n 
3 68  ARG n 
3 69  TYR n 
3 70  GLU n 
3 71  ASP n 
3 72  ALA n 
3 73  GLU n 
3 74  LEU n 
3 75  GLN n 
3 76  ALA n 
3 77  LEU n 
3 78  LEU n 
3 79  ASP n 
3 80  GLU n 
3 81  ASP n 
3 82  ASP n 
3 83  ALA n 
3 84  GLN n 
3 85  THR n 
3 86  GLN n 
3 87  LYS n 
3 88  GLN n 
3 89  LEU n 
3 90  ALA n 
3 91  GLU n 
3 92  GLN n 
3 93  LEU n 
3 94  GLU n 
3 95  VAL n 
3 96  SER n 
3 97  GLN n 
3 98  GLN n 
3 99  ALA n 
3 100 VAL n 
3 101 SER n 
3 102 ASN n 
3 103 ARG n 
3 104 LEU n 
3 105 ARG n 
3 106 GLU n 
3 107 MET n 
3 108 GLY n 
3 109 LYS n 
3 110 ILE n 
3 111 GLN n 
3 112 LYS n 
3 113 VAL n 
3 114 GLY n 
3 115 ARG n 
3 116 TRP n 
3 117 VAL n 
3 118 PRO n 
3 119 HIS n 
3 120 GLU n 
3 121 LEU n 
3 122 ASN n 
3 123 GLU n 
3 124 ARG n 
3 125 GLN n 
3 126 MET n 
3 127 GLU n 
3 128 ARG n 
3 129 ARG n 
3 130 LYS n 
3 131 ASN n 
3 132 THR n 
3 133 CYS n 
3 134 GLU n 
3 135 ILE n 
3 136 LEU n 
3 137 LEU n 
3 138 SER n 
3 139 ARG n 
3 140 TYR n 
3 141 LYS n 
3 142 ARG n 
3 143 LYS n 
3 144 SER n 
3 145 PHE n 
3 146 LEU n 
3 147 HIS n 
3 148 ARG n 
3 149 ILE n 
3 150 VAL n 
3 151 THR n 
3 152 GLY n 
3 153 ASP n 
3 154 GLU n 
3 155 LYS n 
3 156 TRP n 
3 157 ILE n 
3 158 PHE n 
3 159 PHE n 
3 160 VAL n 
3 161 ASN n 
3 162 PRO n 
3 163 LYS n 
3 164 ARG n 
3 165 LYS n 
3 166 LYS n 
3 167 SER n 
3 168 TYR n 
3 169 VAL n 
3 170 ASP n 
3 171 PRO n 
3 172 GLY n 
3 173 GLN n 
3 174 PRO n 
3 175 ALA n 
3 176 THR n 
3 177 SER n 
3 178 THR n 
3 179 ALA n 
3 180 ARG n 
3 181 PRO n 
3 182 ASN n 
3 183 ARG n 
3 184 PHE n 
3 185 GLY n 
3 186 LYS n 
3 187 LYS n 
3 188 THR n 
3 189 MET n 
3 190 LEU n 
3 191 CYS n 
3 192 VAL n 
3 193 TRP n 
3 194 TRP n 
3 195 ASP n 
3 196 GLN n 
3 197 SER n 
3 198 GLY n 
3 199 VAL n 
3 200 ILE n 
3 201 TYR n 
3 202 TYR n 
3 203 GLU n 
3 204 LEU n 
3 205 LEU n 
3 206 LYS n 
3 207 PRO n 
3 208 GLY n 
3 209 GLU n 
3 210 THR n 
3 211 VAL n 
3 212 ASN n 
3 213 ALA n 
3 214 ALA n 
3 215 ARG n 
3 216 TYR n 
3 217 GLN n 
3 218 GLN n 
3 219 GLN n 
3 220 LEU n 
3 221 ILE n 
3 222 ASN n 
3 223 LEU n 
3 224 ASN n 
3 225 ARG n 
3 226 ALA n 
3 227 LEU n 
3 228 GLN n 
3 229 ARG n 
3 230 LYS n 
3 231 ARG n 
3 232 PRO n 
3 233 GLU n 
3 234 TYR n 
3 235 GLN n 
3 236 LYS n 
3 237 ARG n 
3 238 GLN n 
3 239 HIS n 
3 240 ARG n 
3 241 VAL n 
3 242 ILE n 
3 243 PHE n 
3 244 LEU n 
3 245 HIS n 
3 246 ALA n 
3 247 ASN n 
3 248 ALA n 
3 249 PRO n 
3 250 SER n 
3 251 HIS n 
3 252 THR n 
3 253 ALA n 
3 254 ARG n 
3 255 ALA n 
3 256 VAL n 
3 257 ARG n 
3 258 ASP n 
3 259 THR n 
3 260 LEU n 
3 261 GLU n 
3 262 THR n 
3 263 LEU n 
3 264 ASN n 
3 265 TRP n 
3 266 GLU n 
3 267 VAL n 
3 268 LEU n 
3 269 PRO n 
3 270 HIS n 
3 271 ALA n 
3 272 ALA n 
3 273 TYR n 
3 274 SER n 
3 275 PRO n 
3 276 ASP n 
3 277 LEU n 
3 278 ALA n 
3 279 PRO n 
3 280 SER n 
3 281 ASP n 
3 282 TYR n 
3 283 HIS n 
3 284 LEU n 
3 285 PHE n 
3 286 ALA n 
3 287 SER n 
3 288 MET n 
3 289 GLY n 
3 290 HIS n 
3 291 ALA n 
3 292 LEU n 
3 293 ALA n 
3 294 GLU n 
3 295 GLN n 
3 296 ARG n 
3 297 PHE n 
3 298 ASP n 
3 299 SER n 
3 300 TYR n 
3 301 GLU n 
3 302 SER n 
3 303 VAL n 
3 304 LYS n 
3 305 LYS n 
3 306 TRP n 
3 307 LEU n 
3 308 ASP n 
3 309 GLU n 
3 310 TRP n 
3 311 PHE n 
3 312 ALA n 
3 313 ALA n 
3 314 LYS n 
3 315 ASP n 
3 316 ASP n 
3 317 GLU n 
3 318 PHE n 
3 319 TYR n 
3 320 TRP n 
3 321 ARG n 
3 322 GLY n 
3 323 ILE n 
3 324 HIS n 
3 325 LYS n 
3 326 LEU n 
3 327 PRO n 
3 328 GLU n 
3 329 ARG n 
3 330 TRP n 
3 331 GLU n 
3 332 LYS n 
3 333 CYS n 
3 334 VAL n 
3 335 ALA n 
3 336 SER n 
3 337 ASP n 
3 338 GLY n 
3 339 LYS n 
3 340 TYR n 
3 341 PHE n 
3 342 GLU n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   342 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 marinerT 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Drosophila mauritiana' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     7226 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
1 1 sample 1 25 'Drosophila mauritiana' ? 7226 ? 
2 1 sample 1 31 'Drosophila mauritiana' ? 7226 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 PDB 4U7B        4U7B   1 ? 1 ? 
2 PDB 4U7B        4U7B   2 ? 1 ? 
3 UNP MOS1T_DROMA Q7JQ07 3 
;FVPNKEQTRTVLIFCFHLKKTAAESHRMLVEAFGEQVPTVKKCERWFQRFKSGDFDVDDKEHGKPPKRYEDAELQALLDE
DDAQTQKQLAEQLEVSQQAVSNRLREMGKIQKVGRWVPHELNERQMERRKNTCEILLSRYKRKSFLHRIVTGDEKWIFFV
SPKRKKSYVDPGQPATSTARPNRFGKKTMLCVWWDQSGVIYYELLKRGETVNTARYQQQLINLNRALQRKRPEYQKRQHR
VIFLHDNAPSHTARAVRDTLETLNWEVLPHAAYSPDLAPSDYHLFASMGHALAEQRFDSYESVKKWLDEWFAAKDDEFYW
RGIHKLPERWEKCVASDGKYLE
;
4 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4U7B C 1 ? 25  ? 4U7B   4  ? 28  ? 4  28  
2 2 4U7B D 1 ? 31  ? 4U7B   29 ? 59  ? 29 59  
3 1 4U7B E 1 ? 25  ? 4U7B   4  ? 28  ? 4  28  
4 2 4U7B F 1 ? 31  ? 4U7B   29 ? 59  ? 29 59  
5 1 4U7B H 1 ? 25  ? 4U7B   4  ? 28  ? 4  28  
6 2 4U7B I 1 ? 31  ? 4U7B   29 ? 59  ? 29 59  
7 3 4U7B A 1 ? 342 ? Q7JQ07 4  ? 345 ? 4  345 
8 3 4U7B B 1 ? 342 ? Q7JQ07 4  ? 345 ? 4  345 
9 3 4U7B G 1 ? 342 ? Q7JQ07 4  ? 345 ? 4  345 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
7 4U7B THR A 42  ? UNP Q7JQ07 LYS 45  conflict 45  1  
7 4U7B ASN A 161 ? UNP Q7JQ07 SER 164 conflict 164 2  
7 4U7B PRO A 207 ? UNP Q7JQ07 ARG 210 conflict 210 3  
7 4U7B ALA A 213 ? UNP Q7JQ07 THR 216 conflict 216 4  
7 4U7B ALA A 246 ? UNP Q7JQ07 ASP 249 conflict 249 5  
7 4U7B PHE A 341 ? UNP Q7JQ07 LEU 344 conflict 344 6  
8 4U7B THR B 42  ? UNP Q7JQ07 LYS 45  conflict 45  7  
8 4U7B ASN B 161 ? UNP Q7JQ07 SER 164 conflict 164 8  
8 4U7B PRO B 207 ? UNP Q7JQ07 ARG 210 conflict 210 9  
8 4U7B ALA B 213 ? UNP Q7JQ07 THR 216 conflict 216 10 
8 4U7B ALA B 246 ? UNP Q7JQ07 ASP 249 conflict 249 11 
8 4U7B PHE B 341 ? UNP Q7JQ07 LEU 344 conflict 344 12 
9 4U7B THR G 42  ? UNP Q7JQ07 LYS 45  conflict 45  13 
9 4U7B ASN G 161 ? UNP Q7JQ07 SER 164 conflict 164 14 
9 4U7B PRO G 207 ? UNP Q7JQ07 ARG 210 conflict 210 15 
9 4U7B ALA G 213 ? UNP Q7JQ07 THR 216 conflict 216 16 
9 4U7B ALA G 246 ? UNP Q7JQ07 ASP 249 conflict 249 17 
9 4U7B PHE G 341 ? UNP Q7JQ07 LEU 344 conflict 344 18 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
SO4 non-polymer         . 'SULFATE ION'                        ? 'O4 S -2'         96.063  
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4U7B 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.60 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         52.68 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            290 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '100 mM Ammonium acetate, 20 mM MgCl2, 50 mM Hepes pH 7.0, 5 % (w/v) PEG 8,000' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           77 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'PSI PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2013-05-04 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97625 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'DIAMOND BEAMLINE I03' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97625 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   I03 
_diffrn_source.pdbx_synchrotron_site       Diamond 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         4U7B 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3.09 
_reflns.d_resolution_low                 92.5 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       69135 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.7 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  8.0 
_reflns.pdbx_Rmerge_I_obs                0.134 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            8.9 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  3.09 
_reflns_shell.d_res_low                   3.27 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         3.4 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        99.7 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.442 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             8.2 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            -0.1100 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][2]                            -4.2400 
_refine.aniso_B[2][3]                            0.0000 
_refine.aniso_B[3][3]                            4.3400 
_refine.B_iso_max                                243.470 
_refine.B_iso_mean                               107.4430 
_refine.B_iso_min                                54.700 
_refine.correlation_coeff_Fo_to_Fc               0.9420 
_refine.correlation_coeff_Fo_to_Fc_free          0.9270 
_refine.details                                  
'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES      : REFINED INDIVIDUALLY' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 4U7B 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            3.0900 
_refine.ls_d_res_low                             29.7500 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     48166 
_refine.ls_number_reflns_R_free                  2441 
_refine.ls_number_reflns_R_work                  45725 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    98.6300 
_refine.ls_percent_reflns_R_free                 5.1000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2301 
_refine.ls_R_factor_R_free                       0.2614 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2284 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      3HOS 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD WITH PHASES' 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  0.4240 
_refine.pdbx_solvent_vdw_probe_radii             1.2000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             22.3480 
_refine.overall_SU_ML                            0.3820 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       3.0900 
_refine_hist.d_res_low                        29.7500 
_refine_hist.pdbx_number_atoms_ligand         15 
_refine_hist.number_atoms_solvent             2 
_refine_hist.number_atoms_total               12039 
_refine_hist.pdbx_number_residues_total       1194 
_refine_hist.pdbx_B_iso_mean_ligand           169.16 
_refine_hist.pdbx_B_iso_mean_solvent          80.54 
_refine_hist.pdbx_number_atoms_protein        8575 
_refine_hist.pdbx_number_atoms_nucleic_acid   3447 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.005  0.017  12682 ? r_bond_refined_d       ? ? 
'X-RAY DIFFRACTION' ? 0.001  0.020  10215 ? r_bond_other_d         ? ? 
'X-RAY DIFFRACTION' ? 0.969  1.684  17864 ? r_angle_refined_deg    ? ? 
'X-RAY DIFFRACTION' ? 0.943  3.001  23619 ? r_angle_other_deg      ? ? 
'X-RAY DIFFRACTION' ? 5.212  5.000  1023  ? r_dihedral_angle_1_deg ? ? 
'X-RAY DIFFRACTION' ? 34.618 23.270 477   ? r_dihedral_angle_2_deg ? ? 
'X-RAY DIFFRACTION' ? 20.914 15.000 1581  ? r_dihedral_angle_3_deg ? ? 
'X-RAY DIFFRACTION' ? 16.745 15.000 84    ? r_dihedral_angle_4_deg ? ? 
'X-RAY DIFFRACTION' ? 0.059  0.200  1713  ? r_chiral_restr         ? ? 
'X-RAY DIFFRACTION' ? 0.004  0.020  11941 ? r_gen_planes_refined   ? ? 
'X-RAY DIFFRACTION' ? 0.001  0.020  3012  ? r_gen_planes_other     ? ? 
'X-RAY DIFFRACTION' ? 4.779  10.743 4101  ? r_mcbond_it            ? ? 
'X-RAY DIFFRACTION' ? 4.779  10.743 4100  ? r_mcbond_other         ? ? 
'X-RAY DIFFRACTION' ? 7.851  16.106 5121  ? r_mcangle_it           ? ? 
# 
loop_
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1  'X-RAY DIFFRACTION' 1 1 'MEDIUM POSITIONAL' A 2017 0.420  0.500  ? ? ? 
2  'X-RAY DIFFRACTION' 1 2 'MEDIUM POSITIONAL' B 2017 0.400  0.500  ? ? ? 
3  'X-RAY DIFFRACTION' 1 3 'MEDIUM POSITIONAL' G 2017 0.240  0.500  ? ? ? 
4  'X-RAY DIFFRACTION' 1 1 'LOOSE POSITIONAL'  A 3589 0.690  5.000  ? ? ? 
5  'X-RAY DIFFRACTION' 1 2 'LOOSE POSITIONAL'  B 3589 0.680  5.000  ? ? ? 
6  'X-RAY DIFFRACTION' 1 3 'LOOSE POSITIONAL'  G 3589 0.590  5.000  ? ? ? 
7  'X-RAY DIFFRACTION' 1 1 'MEDIUM THERMAL'    A 2017 9.980  2.000  ? ? ? 
8  'X-RAY DIFFRACTION' 1 2 'MEDIUM THERMAL'    B 2017 10.620 2.000  ? ? ? 
9  'X-RAY DIFFRACTION' 1 3 'MEDIUM THERMAL'    G 2017 11.030 2.000  ? ? ? 
10 'X-RAY DIFFRACTION' 1 1 'LOOSE THERMAL'     A 3589 10.750 10.000 ? ? ? 
11 'X-RAY DIFFRACTION' 1 2 'LOOSE THERMAL'     B 3589 11.750 10.000 ? ? ? 
12 'X-RAY DIFFRACTION' 1 3 'LOOSE THERMAL'     G 3589 11.360 10.000 ? ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       3.0900 
_refine_ls_shell.d_res_low                        3.1700 
_refine_ls_shell.number_reflns_all                3232 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             148 
_refine_ls_shell.number_reflns_R_work             3084 
_refine_ls_shell.percent_reflns_obs               90.8600 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.3800 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.3360 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1 1 A 
1 2 B 
1 3 G 
# 
loop_
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.selection_details 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
1 1 1 5 A 5 A 345 ? ? ? ? ? ? ? ? ? 
1 2 1 5 B 5 B 345 ? ? ? ? ? ? ? ? ? 
1 3 1 5 G 5 G 345 ? ? ? ? ? ? ? ? ? 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                     4U7B 
_struct.title                        'Crystal structure of a pre-cleavage Mos1 transpososome' 
_struct.pdbx_descriptor              'Mos transposase/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4U7B 
_struct_keywords.text            
'transposase, transposon synaptic complex, helix-turn-helix, Rnase-H like fold, DNA transposition, hydrolase-dna complex' 
_struct_keywords.pdbx_keywords   Hydrolase/DNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 1 ? 
F N N 2 ? 
G N N 3 ? 
H N N 3 ? 
I N N 3 ? 
J N N 4 ? 
K N N 4 ? 
L N N 4 ? 
M N N 5 ? 
N N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASN G 4   ? LEU G 18  ? ASN A 7   LEU A 21  1 ? 15 
HELX_P HELX_P2  AA2 THR G 21  ? PHE G 33  ? THR A 24  PHE A 36  1 ? 13 
HELX_P HELX_P3  AA3 THR G 39  ? GLY G 53  ? THR A 42  GLY A 56  1 ? 15 
HELX_P HELX_P4  AA4 GLU G 70  ? ASP G 81  ? GLU A 73  ASP A 84  1 ? 12 
HELX_P HELX_P5  AA5 THR G 85  ? LEU G 93  ? THR A 88  LEU A 96  1 ? 9  
HELX_P HELX_P6  AA6 SER G 96  ? MET G 107 ? SER A 99  MET A 110 1 ? 12 
HELX_P HELX_P7  AA7 ASN G 122 ? LYS G 143 ? ASN A 125 LYS A 146 1 ? 22 
HELX_P HELX_P8  AA8 ASN G 212 ? ARG G 231 ? ASN A 215 ARG A 234 1 ? 20 
HELX_P HELX_P9  AA9 PRO G 232 ? ARG G 237 ? PRO A 235 ARG A 240 1 ? 6  
HELX_P HELX_P10 AB1 ALA G 253 ? ASN G 264 ? ALA A 256 ASN A 267 1 ? 12 
HELX_P HELX_P11 AB2 SER G 274 ? LEU G 277 ? SER A 277 LEU A 280 5 ? 4  
HELX_P HELX_P12 AB3 ALA G 278 ? HIS G 283 ? ALA A 281 HIS A 286 1 ? 6  
HELX_P HELX_P13 AB4 HIS G 283 ? ALA G 293 ? HIS A 286 ALA A 296 1 ? 11 
HELX_P HELX_P14 AB5 SER G 299 ? LYS G 314 ? SER A 302 LYS A 317 1 ? 16 
HELX_P HELX_P15 AB6 ASP G 315 ? LYS G 325 ? ASP A 318 LYS A 328 1 ? 11 
HELX_P HELX_P16 AB7 LYS G 325 ? SER G 336 ? LYS A 328 SER A 339 1 ? 12 
HELX_P HELX_P17 AB8 ASN H 4   ? LEU H 18  ? ASN B 7   LEU B 21  1 ? 15 
HELX_P HELX_P18 AB9 THR H 21  ? GLY H 34  ? THR B 24  GLY B 37  1 ? 14 
HELX_P HELX_P19 AC1 THR H 39  ? GLY H 53  ? THR B 42  GLY B 56  1 ? 15 
HELX_P HELX_P20 AC2 GLU H 70  ? ASP H 81  ? GLU B 73  ASP B 84  1 ? 12 
HELX_P HELX_P21 AC3 THR H 85  ? LEU H 93  ? THR B 88  LEU B 96  1 ? 9  
HELX_P HELX_P22 AC4 SER H 96  ? MET H 107 ? SER B 99  MET B 110 1 ? 12 
HELX_P HELX_P23 AC5 ASN H 122 ? LYS H 143 ? ASN B 125 LYS B 146 1 ? 22 
HELX_P HELX_P24 AC6 PHE H 145 ? HIS H 147 ? PHE B 148 HIS B 150 5 ? 3  
HELX_P HELX_P25 AC7 ASN H 212 ? ARG H 231 ? ASN B 215 ARG B 234 1 ? 20 
HELX_P HELX_P26 AC8 PRO H 232 ? GLN H 235 ? PRO B 235 GLN B 238 5 ? 4  
HELX_P HELX_P27 AC9 ALA H 248 ? THR H 252 ? ALA B 251 THR B 255 5 ? 5  
HELX_P HELX_P28 AD1 ALA H 253 ? ASN H 264 ? ALA B 256 ASN B 267 1 ? 12 
HELX_P HELX_P29 AD2 SER H 274 ? LEU H 277 ? SER B 277 LEU B 280 5 ? 4  
HELX_P HELX_P30 AD3 ALA H 278 ? HIS H 283 ? ALA B 281 HIS B 286 1 ? 6  
HELX_P HELX_P31 AD4 HIS H 283 ? ALA H 293 ? HIS B 286 ALA B 296 1 ? 11 
HELX_P HELX_P32 AD5 SER H 299 ? LYS H 314 ? SER B 302 LYS B 317 1 ? 16 
HELX_P HELX_P33 AD6 ASP H 315 ? HIS H 324 ? ASP B 318 HIS B 327 1 ? 10 
HELX_P HELX_P34 AD7 LYS H 325 ? SER H 336 ? LYS B 328 SER B 339 1 ? 12 
HELX_P HELX_P35 AD8 ASN I 4   ? LEU I 18  ? ASN G 7   LEU G 21  1 ? 15 
HELX_P HELX_P36 AD9 THR I 21  ? PHE I 33  ? THR G 24  PHE G 36  1 ? 13 
HELX_P HELX_P37 AE1 THR I 39  ? GLY I 53  ? THR G 42  GLY G 56  1 ? 15 
HELX_P HELX_P38 AE2 GLU I 70  ? ASP I 81  ? GLU G 73  ASP G 84  1 ? 12 
HELX_P HELX_P39 AE3 THR I 85  ? GLU I 94  ? THR G 88  GLU G 97  1 ? 10 
HELX_P HELX_P40 AE4 SER I 96  ? MET I 107 ? SER G 99  MET G 110 1 ? 12 
HELX_P HELX_P41 AE5 ASN I 122 ? LYS I 143 ? ASN G 125 LYS G 146 1 ? 22 
HELX_P HELX_P42 AE6 PHE I 145 ? HIS I 147 ? PHE G 148 HIS G 150 5 ? 3  
HELX_P HELX_P43 AE7 ASN I 212 ? ARG I 231 ? ASN G 215 ARG G 234 1 ? 20 
HELX_P HELX_P44 AE8 PRO I 232 ? GLN I 235 ? PRO G 235 GLN G 238 5 ? 4  
HELX_P HELX_P45 AE9 ALA I 248 ? ALA I 253 ? ALA G 251 ALA G 256 1 ? 6  
HELX_P HELX_P46 AF1 ALA I 253 ? ASN I 264 ? ALA G 256 ASN G 267 1 ? 12 
HELX_P HELX_P47 AF2 SER I 274 ? LEU I 277 ? SER G 277 LEU G 280 5 ? 4  
HELX_P HELX_P48 AF3 ALA I 278 ? HIS I 283 ? ALA G 281 HIS G 286 1 ? 6  
HELX_P HELX_P49 AF4 HIS I 283 ? ALA I 293 ? HIS G 286 ALA G 296 1 ? 11 
HELX_P HELX_P50 AF5 SER I 299 ? LYS I 314 ? SER G 302 LYS G 317 1 ? 16 
HELX_P HELX_P51 AF6 ASP I 315 ? LYS I 325 ? ASP G 318 LYS G 328 1 ? 11 
HELX_P HELX_P52 AF7 LYS I 325 ? SER I 336 ? LYS G 328 SER G 339 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1   disulf ? ? G CYS 133 SG ? ? ? 1_555 G CYS 333 SG ? ? A CYS 136 A CYS 336 1_555 ? ? ? ? ? ? ?               2.086 ? 
disulf2   disulf ? ? H CYS 133 SG ? ? ? 1_555 H CYS 333 SG ? ? B CYS 136 B CYS 336 1_555 ? ? ? ? ? ? ?               2.060 ? 
disulf3   disulf ? ? I CYS 133 SG ? ? ? 1_555 I CYS 333 SG ? ? G CYS 136 G CYS 336 1_555 ? ? ? ? ? ? ?               2.095 ? 
hydrog1   hydrog ? ? A DG  1   N1 ? ? ? 1_555 B DC  25  N3 ? ? C DG  4   D DC  53  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog2   hydrog ? ? A DG  1   N2 ? ? ? 1_555 B DC  25  O2 ? ? C DG  4   D DC  53  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog3   hydrog ? ? A DG  1   O6 ? ? ? 1_555 B DC  25  N4 ? ? C DG  4   D DC  53  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog4   hydrog ? ? A DG  2   N1 ? ? ? 1_555 B DC  24  N3 ? ? C DG  5   D DC  52  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog5   hydrog ? ? A DT  3   N3 ? ? ? 1_555 B DA  23  N1 ? ? C DT  6   D DA  51  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog6   hydrog ? ? A DT  3   O4 ? ? ? 1_555 B DA  23  N6 ? ? C DT  6   D DA  51  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog7   hydrog ? ? A DG  4   N1 ? ? ? 1_555 B DC  22  N3 ? ? C DG  7   D DC  50  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog8   hydrog ? ? A DG  4   N2 ? ? ? 1_555 B DC  22  O2 ? ? C DG  7   D DC  50  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog9   hydrog ? ? A DG  4   O6 ? ? ? 1_555 B DC  22  N4 ? ? C DG  7   D DC  50  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog10  hydrog ? ? A DT  5   N3 ? ? ? 1_555 B DA  21  N1 ? ? C DT  8   D DA  49  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog11  hydrog ? ? A DT  5   O4 ? ? ? 1_555 B DA  21  N6 ? ? C DT  8   D DA  49  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog12  hydrog ? ? A DA  6   N1 ? ? ? 1_555 B DT  20  N3 ? ? C DA  9   D DT  48  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog13  hydrog ? ? A DA  6   N6 ? ? ? 1_555 B DT  20  O4 ? ? C DA  9   D DT  48  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog14  hydrog ? ? A DC  7   N3 ? ? ? 1_555 B DG  19  N1 ? ? C DC  10  D DG  47  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog15  hydrog ? ? A DC  7   N4 ? ? ? 1_555 B DG  19  O6 ? ? C DC  10  D DG  47  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog16  hydrog ? ? A DC  7   O2 ? ? ? 1_555 B DG  19  N2 ? ? C DC  10  D DG  47  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog17  hydrog ? ? A DA  8   N6 ? ? ? 1_555 B DT  17  O4 ? ? C DA  11  D DT  45  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog18  hydrog ? ? A DA  8   N1 ? ? ? 1_555 B DT  18  N3 ? ? C DA  11  D DT  46  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog19  hydrog ? ? A DA  8   N6 ? ? ? 1_555 B DT  18  O4 ? ? C DA  11  D DT  46  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog20  hydrog ? ? A DA  9   N1 ? ? ? 1_555 B DT  17  N3 ? ? C DA  12  D DT  45  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog21  hydrog ? ? A DA  9   N6 ? ? ? 1_555 B DT  17  O4 ? ? C DA  12  D DT  45  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog22  hydrog ? ? A DG  10  N1 ? ? ? 1_555 B DC  16  N3 ? ? C DG  13  D DC  44  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog23  hydrog ? ? A DG  10  N2 ? ? ? 1_555 B DC  16  O2 ? ? C DG  13  D DC  44  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog24  hydrog ? ? A DG  10  O6 ? ? ? 1_555 B DC  16  N4 ? ? C DG  13  D DC  44  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog25  hydrog ? ? A DT  11  N3 ? ? ? 1_555 B DA  15  N1 ? ? C DT  14  D DA  43  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog26  hydrog ? ? A DT  11  O4 ? ? ? 1_555 B DA  15  N6 ? ? C DT  14  D DA  43  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog27  hydrog ? ? A DA  12  N1 ? ? ? 1_555 B DT  14  N3 ? ? C DA  15  D DT  42  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog28  hydrog ? ? A DT  13  N3 ? ? ? 1_555 B DA  13  N1 ? ? C DT  16  D DA  41  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog29  hydrog ? ? A DT  13  O4 ? ? ? 1_555 B DA  13  N6 ? ? C DT  16  D DA  41  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog30  hydrog ? ? A DG  14  N1 ? ? ? 1_555 B DC  12  N3 ? ? C DG  17  D DC  40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog31  hydrog ? ? A DG  14  N2 ? ? ? 1_555 B DC  12  O2 ? ? C DG  17  D DC  40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog32  hydrog ? ? A DG  14  O6 ? ? ? 1_555 B DC  12  N4 ? ? C DG  17  D DC  40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog33  hydrog ? ? A DA  15  N1 ? ? ? 1_555 B DT  11  N3 ? ? C DA  18  D DT  39  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog34  hydrog ? ? A DA  15  N6 ? ? ? 1_555 B DT  11  O4 ? ? C DA  18  D DT  39  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog35  hydrog ? ? A DA  16  N1 ? ? ? 1_555 B DT  10  N3 ? ? C DA  19  D DT  38  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog36  hydrog ? ? A DA  16  N6 ? ? ? 1_555 B DT  10  O4 ? ? C DA  19  D DT  38  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog37  hydrog ? ? A DA  17  N1 ? ? ? 1_555 B DT  9   N3 ? ? C DA  20  D DT  37  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog38  hydrog ? ? A DA  17  N6 ? ? ? 1_555 B DT  9   O4 ? ? C DA  20  D DT  37  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog39  hydrog ? ? A DT  18  N3 ? ? ? 1_555 B DA  8   N1 ? ? C DT  21  D DA  36  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog40  hydrog ? ? A DT  18  O4 ? ? ? 1_555 B DA  8   N6 ? ? C DT  21  D DA  36  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog41  hydrog ? ? A DG  19  N1 ? ? ? 1_555 B DC  7   N3 ? ? C DG  22  D DC  35  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog42  hydrog ? ? A DG  19  N2 ? ? ? 1_555 B DC  7   O2 ? ? C DG  22  D DC  35  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog43  hydrog ? ? A DG  19  O6 ? ? ? 1_555 B DC  7   N4 ? ? C DG  22  D DC  35  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog44  hydrog ? ? A DT  20  N3 ? ? ? 1_555 B DA  6   N1 ? ? C DT  23  D DA  34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog45  hydrog ? ? A DT  20  O4 ? ? ? 1_555 B DA  6   N6 ? ? C DT  23  D DA  34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog46  hydrog ? ? A DC  21  N3 ? ? ? 1_555 B DG  5   N1 ? ? C DC  24  D DG  33  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog47  hydrog ? ? A DC  21  N4 ? ? ? 1_555 B DG  5   O6 ? ? C DC  24  D DG  33  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog48  hydrog ? ? A DC  21  O2 ? ? ? 1_555 B DG  5   N2 ? ? C DC  24  D DG  33  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog49  hydrog ? ? A DG  22  N1 ? ? ? 1_555 B DC  4   N3 ? ? C DG  25  D DC  32  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog50  hydrog ? ? A DG  22  N2 ? ? ? 1_555 B DC  4   O2 ? ? C DG  25  D DC  32  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog51  hydrog ? ? A DG  22  O6 ? ? ? 1_555 B DC  4   N4 ? ? C DG  25  D DC  32  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog52  hydrog ? ? A DT  23  N3 ? ? ? 1_555 B DA  3   N1 ? ? C DT  26  D DA  31  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog53  hydrog ? ? A DT  23  O4 ? ? ? 1_555 B DA  3   N6 ? ? C DT  26  D DA  31  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog54  hydrog ? ? A DT  24  N3 ? ? ? 1_555 B DA  2   N1 ? ? C DT  27  D DA  30  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog55  hydrog ? ? A DT  24  O4 ? ? ? 1_555 B DA  2   N6 ? ? C DT  27  D DA  30  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog56  hydrog ? ? A DT  25  N3 ? ? ? 1_555 B DA  1   N1 ? ? C DT  28  D DA  29  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog57  hydrog ? ? A DT  25  O4 ? ? ? 1_555 B DA  1   N6 ? ? C DT  28  D DA  29  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog58  hydrog ? ? C DG  1   N1 ? ? ? 1_555 D DC  25  N3 ? ? E DG  4   F DC  53  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog59  hydrog ? ? C DG  1   N2 ? ? ? 1_555 D DC  25  O2 ? ? E DG  4   F DC  53  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog60  hydrog ? ? C DG  1   O6 ? ? ? 1_555 D DC  25  N4 ? ? E DG  4   F DC  53  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog61  hydrog ? ? C DG  1   N2 ? ? ? 1_555 D DT  26  O2 ? ? E DG  4   F DT  54  1_555 ? ? ? ? ? ? 'DG-DT MISPAIR' ?     ? 
hydrog62  hydrog ? ? C DG  2   N1 ? ? ? 1_555 D DC  24  N3 ? ? E DG  5   F DC  52  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog63  hydrog ? ? C DG  2   N2 ? ? ? 1_555 D DC  24  O2 ? ? E DG  5   F DC  52  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog64  hydrog ? ? C DG  2   O6 ? ? ? 1_555 D DC  24  N4 ? ? E DG  5   F DC  52  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog65  hydrog ? ? C DT  3   N3 ? ? ? 1_555 D DA  23  N1 ? ? E DT  6   F DA  51  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog66  hydrog ? ? C DT  3   O4 ? ? ? 1_555 D DA  23  N6 ? ? E DT  6   F DA  51  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog67  hydrog ? ? C DG  4   N1 ? ? ? 1_555 D DC  22  N3 ? ? E DG  7   F DC  50  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog68  hydrog ? ? C DG  4   N2 ? ? ? 1_555 D DC  22  O2 ? ? E DG  7   F DC  50  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog69  hydrog ? ? C DG  4   O6 ? ? ? 1_555 D DC  22  N4 ? ? E DG  7   F DC  50  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog70  hydrog ? ? C DT  5   N3 ? ? ? 1_555 D DA  21  N1 ? ? E DT  8   F DA  49  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog71  hydrog ? ? C DT  5   O4 ? ? ? 1_555 D DA  21  N6 ? ? E DT  8   F DA  49  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog72  hydrog ? ? C DA  6   N1 ? ? ? 1_555 D DT  20  N3 ? ? E DA  9   F DT  48  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog73  hydrog ? ? C DA  6   N6 ? ? ? 1_555 D DT  20  O4 ? ? E DA  9   F DT  48  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog74  hydrog ? ? C DC  7   N3 ? ? ? 1_555 D DG  19  N1 ? ? E DC  10  F DG  47  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog75  hydrog ? ? C DC  7   N4 ? ? ? 1_555 D DG  19  O6 ? ? E DC  10  F DG  47  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog76  hydrog ? ? C DC  7   O2 ? ? ? 1_555 D DG  19  N2 ? ? E DC  10  F DG  47  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog77  hydrog ? ? C DA  8   N1 ? ? ? 1_555 D DT  18  N3 ? ? E DA  11  F DT  46  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog78  hydrog ? ? C DA  8   N6 ? ? ? 1_555 D DT  18  O4 ? ? E DA  11  F DT  46  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog79  hydrog ? ? C DA  9   N1 ? ? ? 1_555 D DT  17  N3 ? ? E DA  12  F DT  45  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog80  hydrog ? ? C DA  9   N6 ? ? ? 1_555 D DT  17  O4 ? ? E DA  12  F DT  45  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog81  hydrog ? ? C DG  10  N1 ? ? ? 1_555 D DC  16  N3 ? ? E DG  13  F DC  44  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog82  hydrog ? ? C DG  10  N2 ? ? ? 1_555 D DC  16  O2 ? ? E DG  13  F DC  44  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog83  hydrog ? ? C DG  10  O6 ? ? ? 1_555 D DC  16  N4 ? ? E DG  13  F DC  44  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog84  hydrog ? ? C DT  11  N3 ? ? ? 1_555 D DA  15  N1 ? ? E DT  14  F DA  43  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog85  hydrog ? ? C DT  11  O4 ? ? ? 1_555 D DA  15  N6 ? ? E DT  14  F DA  43  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog86  hydrog ? ? C DA  12  N1 ? ? ? 1_555 D DT  14  N3 ? ? E DA  15  F DT  42  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog87  hydrog ? ? C DA  12  N6 ? ? ? 1_555 D DT  14  O4 ? ? E DA  15  F DT  42  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog88  hydrog ? ? C DT  13  N3 ? ? ? 1_555 D DA  13  N1 ? ? E DT  16  F DA  41  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog89  hydrog ? ? C DT  13  O4 ? ? ? 1_555 D DA  13  N6 ? ? E DT  16  F DA  41  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog90  hydrog ? ? C DG  14  N1 ? ? ? 1_555 D DC  12  N3 ? ? E DG  17  F DC  40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog91  hydrog ? ? C DG  14  N2 ? ? ? 1_555 D DC  12  O2 ? ? E DG  17  F DC  40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog92  hydrog ? ? C DG  14  O6 ? ? ? 1_555 D DC  12  N4 ? ? E DG  17  F DC  40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog93  hydrog ? ? C DA  15  N1 ? ? ? 1_555 D DT  11  N3 ? ? E DA  18  F DT  39  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog94  hydrog ? ? C DA  15  N6 ? ? ? 1_555 D DT  11  O4 ? ? E DA  18  F DT  39  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog95  hydrog ? ? C DA  16  N1 ? ? ? 1_555 D DT  10  N3 ? ? E DA  19  F DT  38  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog96  hydrog ? ? C DA  16  N6 ? ? ? 1_555 D DT  10  O4 ? ? E DA  19  F DT  38  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog97  hydrog ? ? C DA  17  N1 ? ? ? 1_555 D DT  9   N3 ? ? E DA  20  F DT  37  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog98  hydrog ? ? C DA  17  N6 ? ? ? 1_555 D DT  9   O4 ? ? E DA  20  F DT  37  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog99  hydrog ? ? C DT  18  N3 ? ? ? 1_555 D DA  8   N1 ? ? E DT  21  F DA  36  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog100 hydrog ? ? C DT  18  O4 ? ? ? 1_555 D DA  8   N6 ? ? E DT  21  F DA  36  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog101 hydrog ? ? C DG  19  N1 ? ? ? 1_555 D DC  7   N3 ? ? E DG  22  F DC  35  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog102 hydrog ? ? C DG  19  N2 ? ? ? 1_555 D DC  7   O2 ? ? E DG  22  F DC  35  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog103 hydrog ? ? C DG  19  O6 ? ? ? 1_555 D DC  7   N4 ? ? E DG  22  F DC  35  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog104 hydrog ? ? C DT  20  N3 ? ? ? 1_555 D DA  6   N1 ? ? E DT  23  F DA  34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog105 hydrog ? ? C DT  20  O4 ? ? ? 1_555 D DA  6   N6 ? ? E DT  23  F DA  34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog106 hydrog ? ? C DC  21  N3 ? ? ? 1_555 D DG  5   N1 ? ? E DC  24  F DG  33  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog107 hydrog ? ? C DC  21  N4 ? ? ? 1_555 D DG  5   O6 ? ? E DC  24  F DG  33  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog108 hydrog ? ? C DC  21  O2 ? ? ? 1_555 D DG  5   N2 ? ? E DC  24  F DG  33  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog109 hydrog ? ? C DG  22  N2 ? ? ? 1_555 D DC  4   O2 ? ? E DG  25  F DC  32  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog110 hydrog ? ? C DT  23  O4 ? ? ? 1_555 D DA  2   N6 ? ? E DT  26  F DA  30  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog111 hydrog ? ? C DT  23  N3 ? ? ? 1_555 D DA  3   N1 ? ? E DT  26  F DA  31  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog112 hydrog ? ? C DT  23  O4 ? ? ? 1_555 D DA  3   N6 ? ? E DT  26  F DA  31  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog113 hydrog ? ? C DT  25  N3 ? ? ? 1_555 D DA  1   N1 ? ? E DT  28  F DA  29  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog114 hydrog ? ? C DT  25  O4 ? ? ? 1_555 D DA  1   N6 ? ? E DT  28  F DA  29  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog115 hydrog ? ? E DG  1   N1 ? ? ? 1_555 F DC  25  N3 ? ? H DG  4   I DC  53  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog116 hydrog ? ? E DG  1   N2 ? ? ? 1_555 F DC  25  O2 ? ? H DG  4   I DC  53  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog117 hydrog ? ? E DG  1   O6 ? ? ? 1_555 F DC  25  N4 ? ? H DG  4   I DC  53  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog118 hydrog ? ? E DG  2   N1 ? ? ? 1_555 F DC  24  N3 ? ? H DG  5   I DC  52  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog119 hydrog ? ? E DG  2   N2 ? ? ? 1_555 F DC  24  O2 ? ? H DG  5   I DC  52  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog120 hydrog ? ? E DG  2   O6 ? ? ? 1_555 F DC  24  N4 ? ? H DG  5   I DC  52  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog121 hydrog ? ? E DT  3   N3 ? ? ? 1_555 F DA  23  N1 ? ? H DT  6   I DA  51  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog122 hydrog ? ? E DT  3   O4 ? ? ? 1_555 F DA  23  N6 ? ? H DT  6   I DA  51  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog123 hydrog ? ? E DG  4   N1 ? ? ? 1_555 F DC  22  N3 ? ? H DG  7   I DC  50  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog124 hydrog ? ? E DG  4   N2 ? ? ? 1_555 F DC  22  O2 ? ? H DG  7   I DC  50  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog125 hydrog ? ? E DG  4   O6 ? ? ? 1_555 F DC  22  N4 ? ? H DG  7   I DC  50  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog126 hydrog ? ? E DT  5   N3 ? ? ? 1_555 F DA  21  N1 ? ? H DT  8   I DA  49  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog127 hydrog ? ? E DT  5   O4 ? ? ? 1_555 F DA  21  N6 ? ? H DT  8   I DA  49  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog128 hydrog ? ? E DA  6   N1 ? ? ? 1_555 F DT  20  N3 ? ? H DA  9   I DT  48  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog129 hydrog ? ? E DA  6   N6 ? ? ? 1_555 F DT  20  O4 ? ? H DA  9   I DT  48  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog130 hydrog ? ? E DC  7   N3 ? ? ? 1_555 F DG  19  N1 ? ? H DC  10  I DG  47  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog131 hydrog ? ? E DC  7   N4 ? ? ? 1_555 F DG  19  O6 ? ? H DC  10  I DG  47  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog132 hydrog ? ? E DC  7   O2 ? ? ? 1_555 F DG  19  N2 ? ? H DC  10  I DG  47  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog133 hydrog ? ? E DA  8   N1 ? ? ? 1_555 F DT  18  N3 ? ? H DA  11  I DT  46  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog134 hydrog ? ? E DA  8   N6 ? ? ? 1_555 F DT  18  O4 ? ? H DA  11  I DT  46  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog135 hydrog ? ? E DA  9   N1 ? ? ? 1_555 F DT  17  N3 ? ? H DA  12  I DT  45  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog136 hydrog ? ? E DA  9   N6 ? ? ? 1_555 F DT  17  O4 ? ? H DA  12  I DT  45  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog137 hydrog ? ? E DG  10  N1 ? ? ? 1_555 F DC  16  N3 ? ? H DG  13  I DC  44  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog138 hydrog ? ? E DG  10  N2 ? ? ? 1_555 F DC  16  O2 ? ? H DG  13  I DC  44  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog139 hydrog ? ? E DG  10  O6 ? ? ? 1_555 F DC  16  N4 ? ? H DG  13  I DC  44  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog140 hydrog ? ? E DT  11  N3 ? ? ? 1_555 F DA  15  N1 ? ? H DT  14  I DA  43  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog141 hydrog ? ? E DT  11  O4 ? ? ? 1_555 F DA  15  N6 ? ? H DT  14  I DA  43  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog142 hydrog ? ? E DA  12  N1 ? ? ? 1_555 F DT  14  N3 ? ? H DA  15  I DT  42  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog143 hydrog ? ? E DA  12  N6 ? ? ? 1_555 F DT  14  O4 ? ? H DA  15  I DT  42  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog144 hydrog ? ? E DT  13  N3 ? ? ? 1_555 F DA  13  N1 ? ? H DT  16  I DA  41  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog145 hydrog ? ? E DT  13  O4 ? ? ? 1_555 F DA  13  N6 ? ? H DT  16  I DA  41  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog146 hydrog ? ? E DG  14  N1 ? ? ? 1_555 F DC  12  N3 ? ? H DG  17  I DC  40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog147 hydrog ? ? E DG  14  N2 ? ? ? 1_555 F DC  12  O2 ? ? H DG  17  I DC  40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog148 hydrog ? ? E DG  14  O6 ? ? ? 1_555 F DC  12  N4 ? ? H DG  17  I DC  40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog149 hydrog ? ? E DA  15  N1 ? ? ? 1_555 F DT  11  N3 ? ? H DA  18  I DT  39  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog150 hydrog ? ? E DA  15  N6 ? ? ? 1_555 F DT  11  O4 ? ? H DA  18  I DT  39  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog151 hydrog ? ? E DA  16  N1 ? ? ? 1_555 F DT  10  N3 ? ? H DA  19  I DT  38  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog152 hydrog ? ? E DA  16  N6 ? ? ? 1_555 F DT  10  O4 ? ? H DA  19  I DT  38  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog153 hydrog ? ? E DA  17  N1 ? ? ? 1_555 F DT  9   N3 ? ? H DA  20  I DT  37  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog154 hydrog ? ? E DA  17  N6 ? ? ? 1_555 F DT  9   O4 ? ? H DA  20  I DT  37  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog155 hydrog ? ? E DT  18  N3 ? ? ? 1_555 F DA  8   N1 ? ? H DT  21  I DA  36  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog156 hydrog ? ? E DT  18  O4 ? ? ? 1_555 F DA  8   N6 ? ? H DT  21  I DA  36  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog157 hydrog ? ? E DG  19  N1 ? ? ? 1_555 F DC  7   N3 ? ? H DG  22  I DC  35  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog158 hydrog ? ? E DG  19  N2 ? ? ? 1_555 F DC  7   O2 ? ? H DG  22  I DC  35  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog159 hydrog ? ? E DG  19  O6 ? ? ? 1_555 F DC  7   N4 ? ? H DG  22  I DC  35  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog160 hydrog ? ? E DT  20  N3 ? ? ? 1_555 F DA  6   N1 ? ? H DT  23  I DA  34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog161 hydrog ? ? E DT  20  O4 ? ? ? 1_555 F DA  6   N6 ? ? H DT  23  I DA  34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog162 hydrog ? ? E DC  21  N3 ? ? ? 1_555 F DG  5   N1 ? ? H DC  24  I DG  33  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog163 hydrog ? ? E DC  21  N4 ? ? ? 1_555 F DG  5   O6 ? ? H DC  24  I DG  33  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog164 hydrog ? ? E DC  21  O2 ? ? ? 1_555 F DG  5   N2 ? ? H DC  24  I DG  33  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog165 hydrog ? ? E DG  22  N1 ? ? ? 1_555 F DC  4   N3 ? ? H DG  25  I DC  32  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog166 hydrog ? ? E DG  22  N2 ? ? ? 1_555 F DC  4   O2 ? ? H DG  25  I DC  32  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog167 hydrog ? ? E DG  22  O6 ? ? ? 1_555 F DC  4   N4 ? ? H DG  25  I DC  32  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog168 hydrog ? ? E DT  23  N3 ? ? ? 1_555 F DA  3   N1 ? ? H DT  26  I DA  31  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog169 hydrog ? ? E DT  23  O4 ? ? ? 1_555 F DA  3   N6 ? ? H DT  26  I DA  31  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog170 hydrog ? ? E DT  24  N3 ? ? ? 1_555 F DA  2   N1 ? ? H DT  27  I DA  30  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog171 hydrog ? ? E DT  24  O4 ? ? ? 1_555 F DA  2   N6 ? ? H DT  27  I DA  30  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog172 hydrog ? ? E DT  25  N3 ? ? ? 1_555 F DA  1   N1 ? ? H DT  28  I DA  29  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog173 hydrog ? ? E DT  25  O4 ? ? ? 1_555 F DA  1   N6 ? ? H DT  28  I DA  29  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 2 ? 
AA3 ? 5 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
AA6 ? 5 ? 
AA7 ? 2 ? 
AA8 ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? parallel      
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? parallel      
AA3 4 5 ? parallel      
AA4 1 2 ? anti-parallel 
AA5 1 2 ? parallel      
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? parallel      
AA6 4 5 ? parallel      
AA7 1 2 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA8 3 4 ? parallel      
AA8 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ILE G 110 ? VAL G 113 ? ILE A 113 VAL A 116 
AA1 2 LYS H 166 ? VAL H 169 ? LYS B 169 VAL B 172 
AA2 1 TRP G 116 ? VAL G 117 ? TRP A 119 VAL A 120 
AA2 2 THR H 178 ? ALA H 179 ? THR B 181 ALA B 182 
AA3 1 GLY G 198 ? LEU G 204 ? GLY A 201 LEU A 207 
AA3 2 LYS G 187 ? ASP G 195 ? LYS A 190 ASP A 198 
AA3 3 ILE G 149 ? PHE G 158 ? ILE A 152 PHE A 161 
AA3 4 ILE G 242 ? LEU G 244 ? ILE A 245 LEU A 247 
AA3 5 GLU G 266 ? VAL G 267 ? GLU A 269 VAL A 270 
AA4 1 LYS G 166 ? VAL G 169 ? LYS A 169 VAL A 172 
AA4 2 ILE H 110 ? VAL H 113 ? ILE B 113 VAL B 116 
AA5 1 THR G 178 ? ALA G 179 ? THR A 181 ALA A 182 
AA5 2 TRP H 116 ? VAL H 117 ? TRP B 119 VAL B 120 
AA6 1 GLY H 198 ? GLU H 203 ? GLY B 201 GLU B 206 
AA6 2 CYS H 191 ? ASP H 195 ? CYS B 194 ASP B 198 
AA6 3 ILE H 149 ? GLU H 154 ? ILE B 152 GLU B 157 
AA6 4 ILE H 242 ? LEU H 244 ? ILE B 245 LEU B 247 
AA6 5 GLU H 266 ? VAL H 267 ? GLU B 269 VAL B 270 
AA7 1 ILE H 157 ? PHE H 158 ? ILE B 160 PHE B 161 
AA7 2 LYS H 187 ? THR H 188 ? LYS B 190 THR B 191 
AA8 1 GLY I 198 ? LEU I 204 ? GLY G 201 LEU G 207 
AA8 2 LEU I 190 ? ASP I 195 ? LEU G 193 ASP G 198 
AA8 3 ILE I 149 ? LYS I 155 ? ILE G 152 LYS G 158 
AA8 4 ILE I 242 ? LEU I 244 ? ILE G 245 LEU G 247 
AA8 5 GLU I 266 ? VAL I 267 ? GLU G 269 VAL G 270 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ILE G 110 ? N ILE A 113 O VAL H 169 ? O VAL B 172 
AA2 1 2 N VAL G 117 ? N VAL A 120 O THR H 178 ? O THR B 181 
AA3 1 2 O GLY G 198 ? O GLY A 201 N ASP G 195 ? N ASP A 198 
AA3 2 3 O LEU G 190 ? O LEU A 193 N LYS G 155 ? N LYS A 158 
AA3 3 4 N VAL G 150 ? N VAL A 153 O ILE G 242 ? O ILE A 245 
AA3 4 5 N PHE G 243 ? N PHE A 246 O GLU G 266 ? O GLU A 269 
AA4 1 2 N VAL G 169 ? N VAL A 172 O ILE H 110 ? O ILE B 113 
AA5 1 2 N THR G 178 ? N THR A 181 O VAL H 117 ? O VAL B 120 
AA6 1 2 O GLY H 198 ? O GLY B 201 N ASP H 195 ? N ASP B 198 
AA6 2 3 O TRP H 194 ? O TRP B 197 N THR H 151 ? N THR B 154 
AA6 3 4 N VAL H 150 ? N VAL B 153 O ILE H 242 ? O ILE B 245 
AA6 4 5 N PHE H 243 ? N PHE B 246 O GLU H 266 ? O GLU B 269 
AA7 1 2 N ILE H 157 ? N ILE B 160 O THR H 188 ? O THR B 191 
AA8 1 2 O GLU I 203 ? O GLU G 206 N CYS I 191 ? N CYS G 194 
AA8 2 3 O TRP I 194 ? O TRP G 197 N THR I 151 ? N THR G 154 
AA8 3 4 N VAL I 150 ? N VAL G 153 O ILE I 242 ? O ILE G 245 
AA8 4 5 N PHE I 243 ? N PHE G 246 O GLU I 266 ? O GLU G 269 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software C SO4 101 ? 3 'binding site for residue SO4 C 101' 
AC2 Software D SO4 101 ? 5 'binding site for residue SO4 D 101' 
AC3 Software E SO4 101 ? 2 'binding site for residue SO4 E 101' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 3 DG A 10 ? DG C 13 . ? 1_555 ? 
2  AC1 3 DT A 11 ? DT C 14 . ? 1_555 ? 
3  AC1 3 DT B 17 ? DT D 45 . ? 1_555 ? 
4  AC2 5 DA A 8  ? DA C 11 . ? 1_555 ? 
5  AC2 5 DA A 9  ? DA C 12 . ? 1_555 ? 
6  AC2 5 DT B 18 ? DT D 46 . ? 1_555 ? 
7  AC2 5 DG B 19 ? DG D 47 . ? 1_555 ? 
8  AC2 5 DT B 20 ? DT D 48 . ? 1_555 ? 
9  AC3 2 DG C 10 ? DG E 13 . ? 1_555 ? 
10 AC3 2 DT C 11 ? DT E 14 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4U7B 
_atom_sites.fract_transf_matrix[1][1]   0.010366 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.002940 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006236 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     O OP3   . DG  A 1 1   ? 64.273  -37.152  7.842   1.00 120.67 ? 4   DG  C OP3   1 
ATOM   2     P P     . DG  A 1 1   ? 64.310  -36.266  6.647   1.00 127.93 ? 4   DG  C P     1 
ATOM   3     O OP1   . DG  A 1 1   ? 65.651  -35.623  6.603   1.00 116.20 ? 4   DG  C OP1   1 
ATOM   4     O OP2   . DG  A 1 1   ? 63.817  -37.003  5.452   1.00 123.18 ? 4   DG  C OP2   1 
ATOM   5     O "O5'" . DG  A 1 1   ? 63.198  -35.179  6.989   1.00 128.94 ? 4   DG  C "O5'" 1 
ATOM   6     C "C5'" . DG  A 1 1   ? 63.527  -33.788  7.168   1.00 122.19 ? 4   DG  C "C5'" 1 
ATOM   7     C "C4'" . DG  A 1 1   ? 62.431  -32.911  6.608   1.00 114.20 ? 4   DG  C "C4'" 1 
ATOM   8     O "O4'" . DG  A 1 1   ? 62.370  -33.062  5.173   1.00 110.04 ? 4   DG  C "O4'" 1 
ATOM   9     C "C3'" . DG  A 1 1   ? 61.024  -33.225  7.107   1.00 106.34 ? 4   DG  C "C3'" 1 
ATOM   10    O "O3'" . DG  A 1 1   ? 60.754  -32.488  8.309   1.00 107.53 ? 4   DG  C "O3'" 1 
ATOM   11    C "C2'" . DG  A 1 1   ? 60.145  -32.768  5.955   1.00 105.34 ? 4   DG  C "C2'" 1 
ATOM   12    C "C1'" . DG  A 1 1   ? 61.030  -32.923  4.713   1.00 108.75 ? 4   DG  C "C1'" 1 
ATOM   13    N N9    . DG  A 1 1   ? 60.756  -34.045  3.816   1.00 114.73 ? 4   DG  C N9    1 
ATOM   14    C C8    . DG  A 1 1   ? 61.354  -34.271  2.599   1.00 115.99 ? 4   DG  C C8    1 
ATOM   15    N N7    . DG  A 1 1   ? 60.937  -35.364  2.019   1.00 118.85 ? 4   DG  C N7    1 
ATOM   16    C C5    . DG  A 1 1   ? 60.020  -35.899  2.911   1.00 120.07 ? 4   DG  C C5    1 
ATOM   17    C C6    . DG  A 1 1   ? 59.243  -37.084  2.830   1.00 123.66 ? 4   DG  C C6    1 
ATOM   18    O O6    . DG  A 1 1   ? 59.210  -37.924  1.923   1.00 126.48 ? 4   DG  C O6    1 
ATOM   19    N N1    . DG  A 1 1   ? 58.424  -37.235  3.944   1.00 125.50 ? 4   DG  C N1    1 
ATOM   20    C C2    . DG  A 1 1   ? 58.376  -36.372  5.010   1.00 123.37 ? 4   DG  C C2    1 
ATOM   21    N N2    . DG  A 1 1   ? 57.536  -36.699  6.000   1.00 126.27 ? 4   DG  C N2    1 
ATOM   22    N N3    . DG  A 1 1   ? 59.103  -35.271  5.103   1.00 120.90 ? 4   DG  C N3    1 
ATOM   23    C C4    . DG  A 1 1   ? 59.894  -35.096  4.025   1.00 117.69 ? 4   DG  C C4    1 
ATOM   24    P P     . DG  A 1 2   ? 60.846  -33.200  9.752   1.00 113.47 ? 5   DG  C P     1 
ATOM   25    O OP1   . DG  A 1 2   ? 61.216  -32.177  10.756  1.00 111.04 ? 5   DG  C OP1   1 
ATOM   26    O OP2   . DG  A 1 2   ? 61.664  -34.435  9.618   1.00 120.09 ? 5   DG  C OP2   1 
ATOM   27    O "O5'" . DG  A 1 2   ? 59.336  -33.606  10.051  1.00 111.14 ? 5   DG  C "O5'" 1 
ATOM   28    C "C5'" . DG  A 1 2   ? 58.623  -34.468  9.146   1.00 110.08 ? 5   DG  C "C5'" 1 
ATOM   29    C "C4'" . DG  A 1 2   ? 57.625  -35.318  9.895   1.00 105.97 ? 5   DG  C "C4'" 1 
ATOM   30    O "O4'" . DG  A 1 2   ? 57.282  -36.456  9.077   1.00 104.95 ? 5   DG  C "O4'" 1 
ATOM   31    C "C3'" . DG  A 1 2   ? 58.126  -35.911  11.208  1.00 102.02 ? 5   DG  C "C3'" 1 
ATOM   32    O "O3'" . DG  A 1 2   ? 56.996  -36.004  12.090  1.00 99.83  ? 5   DG  C "O3'" 1 
ATOM   33    C "C2'" . DG  A 1 2   ? 58.796  -37.196  10.752  1.00 99.15  ? 5   DG  C "C2'" 1 
ATOM   34    C "C1'" . DG  A 1 2   ? 57.972  -37.615  9.535   1.00 101.51 ? 5   DG  C "C1'" 1 
ATOM   35    N N9    . DG  A 1 2   ? 58.728  -38.162  8.410   1.00 98.18  ? 5   DG  C N9    1 
ATOM   36    C C8    . DG  A 1 2   ? 60.033  -37.891  8.071   1.00 99.61  ? 5   DG  C C8    1 
ATOM   37    N N7    . DG  A 1 2   ? 60.430  -38.536  7.008   1.00 101.69 ? 5   DG  C N7    1 
ATOM   38    C C5    . DG  A 1 2   ? 59.325  -39.283  6.625   1.00 96.45  ? 5   DG  C C5    1 
ATOM   39    C C6    . DG  A 1 2   ? 59.153  -40.180  5.536   1.00 95.84  ? 5   DG  C C6    1 
ATOM   40    O O6    . DG  A 1 2   ? 59.971  -40.502  4.667   1.00 99.38  ? 5   DG  C O6    1 
ATOM   41    N N1    . DG  A 1 2   ? 57.870  -40.718  5.514   1.00 90.78  ? 5   DG  C N1    1 
ATOM   42    C C2    . DG  A 1 2   ? 56.878  -40.428  6.419   1.00 89.79  ? 5   DG  C C2    1 
ATOM   43    N N2    . DG  A 1 2   ? 55.704  -41.047  6.230   1.00 89.21  ? 5   DG  C N2    1 
ATOM   44    N N3    . DG  A 1 2   ? 57.025  -39.595  7.436   1.00 90.42  ? 5   DG  C N3    1 
ATOM   45    C C4    . DG  A 1 2   ? 58.267  -39.067  7.481   1.00 93.54  ? 5   DG  C C4    1 
ATOM   46    P P     . DT  A 1 3   ? 56.879  -37.167  13.180  1.00 101.94 ? 6   DT  C P     1 
ATOM   47    O OP1   . DT  A 1 3   ? 55.837  -36.775  14.165  1.00 93.39  ? 6   DT  C OP1   1 
ATOM   48    O OP2   . DT  A 1 3   ? 58.248  -37.515  13.647  1.00 94.96  ? 6   DT  C OP2   1 
ATOM   49    O "O5'" . DT  A 1 3   ? 56.244  -38.355  12.337  1.00 103.06 ? 6   DT  C "O5'" 1 
ATOM   50    C "C5'" . DT  A 1 3   ? 55.020  -38.139  11.609  1.00 103.15 ? 6   DT  C "C5'" 1 
ATOM   51    C "C4'" . DT  A 1 3   ? 54.240  -39.427  11.482  1.00 96.94  ? 6   DT  C "C4'" 1 
ATOM   52    O "O4'" . DT  A 1 3   ? 54.807  -40.258  10.442  1.00 91.00  ? 6   DT  C "O4'" 1 
ATOM   53    C "C3'" . DT  A 1 3   ? 54.226  -40.300  12.732  1.00 90.76  ? 6   DT  C "C3'" 1 
ATOM   54    O "O3'" . DT  A 1 3   ? 52.981  -40.995  12.700  1.00 89.41  ? 6   DT  C "O3'" 1 
ATOM   55    C "C2'" . DT  A 1 3   ? 55.415  -41.217  12.513  1.00 86.83  ? 6   DT  C "C2'" 1 
ATOM   56    C "C1'" . DT  A 1 3   ? 55.340  -41.451  11.008  1.00 87.67  ? 6   DT  C "C1'" 1 
ATOM   57    N N1    . DT  A 1 3   ? 56.599  -41.759  10.297  1.00 82.91  ? 6   DT  C N1    1 
ATOM   58    C C2    . DT  A 1 3   ? 56.494  -42.499  9.141   1.00 80.15  ? 6   DT  C C2    1 
ATOM   59    O O2    . DT  A 1 3   ? 55.432  -42.927  8.720   1.00 81.26  ? 6   DT  C O2    1 
ATOM   60    N N3    . DT  A 1 3   ? 57.684  -42.732  8.498   1.00 78.50  ? 6   DT  C N3    1 
ATOM   61    C C4    . DT  A 1 3   ? 58.939  -42.295  8.881   1.00 82.37  ? 6   DT  C C4    1 
ATOM   62    O O4    . DT  A 1 3   ? 59.921  -42.585  8.203   1.00 83.69  ? 6   DT  C O4    1 
ATOM   63    C C5    . DT  A 1 3   ? 58.974  -41.514  10.098  1.00 84.06  ? 6   DT  C C5    1 
ATOM   64    C C7    . DT  A 1 3   ? 60.290  -41.000  10.593  1.00 83.66  ? 6   DT  C C7    1 
ATOM   65    C C6    . DT  A 1 3   ? 57.817  -41.281  10.733  1.00 82.74  ? 6   DT  C C6    1 
ATOM   66    P P     . DG  A 1 4   ? 52.368  -41.631  14.019  1.00 93.32  ? 7   DG  C P     1 
ATOM   67    O OP1   . DG  A 1 4   ? 51.094  -40.929  14.314  1.00 96.82  ? 7   DG  C OP1   1 
ATOM   68    O OP2   . DG  A 1 4   ? 53.437  -41.694  15.050  1.00 92.68  ? 7   DG  C OP2   1 
ATOM   69    O "O5'" . DG  A 1 4   ? 51.965  -43.090  13.530  1.00 95.01  ? 7   DG  C "O5'" 1 
ATOM   70    C "C5'" . DG  A 1 4   ? 51.156  -43.254  12.345  1.00 94.07  ? 7   DG  C "C5'" 1 
ATOM   71    C "C4'" . DG  A 1 4   ? 51.496  -44.557  11.662  1.00 88.57  ? 7   DG  C "C4'" 1 
ATOM   72    O "O4'" . DG  A 1 4   ? 52.828  -44.483  11.112  1.00 85.42  ? 7   DG  C "O4'" 1 
ATOM   73    C "C3'" . DG  A 1 4   ? 51.484  -45.765  12.602  1.00 87.13  ? 7   DG  C "C3'" 1 
ATOM   74    O "O3'" . DG  A 1 4   ? 50.444  -46.672  12.236  1.00 82.47  ? 7   DG  C "O3'" 1 
ATOM   75    C "C2'" . DG  A 1 4   ? 52.877  -46.361  12.484  1.00 83.52  ? 7   DG  C "C2'" 1 
ATOM   76    C "C1'" . DG  A 1 4   ? 53.415  -45.759  11.204  1.00 82.74  ? 7   DG  C "C1'" 1 
ATOM   77    N N9    . DG  A 1 4   ? 54.863  -45.594  11.203  1.00 79.62  ? 7   DG  C N9    1 
ATOM   78    C C8    . DG  A 1 4   ? 55.633  -44.946  12.138  1.00 78.64  ? 7   DG  C C8    1 
ATOM   79    N N7    . DG  A 1 4   ? 56.910  -44.997  11.874  1.00 76.96  ? 7   DG  C N7    1 
ATOM   80    C C5    . DG  A 1 4   ? 56.988  -45.734  10.701  1.00 76.00  ? 7   DG  C C5    1 
ATOM   81    C C6    . DG  A 1 4   ? 58.115  -46.119  9.929   1.00 80.31  ? 7   DG  C C6    1 
ATOM   82    O O6    . DG  A 1 4   ? 59.310  -45.880  10.137  1.00 84.28  ? 7   DG  C O6    1 
ATOM   83    N N1    . DG  A 1 4   ? 57.742  -46.860  8.813   1.00 79.95  ? 7   DG  C N1    1 
ATOM   84    C C2    . DG  A 1 4   ? 56.451  -47.196  8.484   1.00 80.65  ? 7   DG  C C2    1 
ATOM   85    N N2    . DG  A 1 4   ? 56.293  -47.922  7.368   1.00 82.78  ? 7   DG  C N2    1 
ATOM   86    N N3    . DG  A 1 4   ? 55.392  -46.836  9.190   1.00 78.06  ? 7   DG  C N3    1 
ATOM   87    C C4    . DG  A 1 4   ? 55.733  -46.116  10.279  1.00 75.86  ? 7   DG  C C4    1 
ATOM   88    P P     . DT  A 1 5   ? 50.190  -47.983  13.107  1.00 75.50  ? 8   DT  C P     1 
ATOM   89    O OP1   . DT  A 1 5   ? 48.741  -48.293  13.042  1.00 69.86  ? 8   DT  C OP1   1 
ATOM   90    O OP2   . DT  A 1 5   ? 50.853  -47.805  14.434  1.00 66.97  ? 8   DT  C OP2   1 
ATOM   91    O "O5'" . DT  A 1 5   ? 50.974  -49.077  12.261  1.00 77.64  ? 8   DT  C "O5'" 1 
ATOM   92    C "C5'" . DT  A 1 5   ? 50.965  -48.989  10.827  1.00 78.27  ? 8   DT  C "C5'" 1 
ATOM   93    C "C4'" . DT  A 1 5   ? 51.532  -50.243  10.205  1.00 77.15  ? 8   DT  C "C4'" 1 
ATOM   94    O "O4'" . DT  A 1 5   ? 52.939  -50.050  9.920   1.00 70.83  ? 8   DT  C "O4'" 1 
ATOM   95    C "C3'" . DT  A 1 5   ? 51.452  -51.494  11.077  1.00 77.53  ? 8   DT  C "C3'" 1 
ATOM   96    O "O3'" . DT  A 1 5   ? 51.229  -52.608  10.203  1.00 84.29  ? 8   DT  C "O3'" 1 
ATOM   97    C "C2'" . DT  A 1 5   ? 52.800  -51.494  11.771  1.00 73.74  ? 8   DT  C "C2'" 1 
ATOM   98    C "C1'" . DT  A 1 5   ? 53.706  -50.976  10.662  1.00 69.36  ? 8   DT  C "C1'" 1 
ATOM   99    N N1    . DT  A 1 5   ? 54.943  -50.303  11.091  1.00 66.41  ? 8   DT  C N1    1 
ATOM   100   C C2    . DT  A 1 5   ? 56.021  -50.368  10.239  1.00 69.90  ? 8   DT  C C2    1 
ATOM   101   O O2    . DT  A 1 5   ? 55.981  -50.925  9.155   1.00 80.33  ? 8   DT  C O2    1 
ATOM   102   N N3    . DT  A 1 5   ? 57.156  -49.755  10.705  1.00 70.07  ? 8   DT  C N3    1 
ATOM   103   C C4    . DT  A 1 5   ? 57.315  -49.099  11.910  1.00 71.05  ? 8   DT  C C4    1 
ATOM   104   O O4    . DT  A 1 5   ? 58.396  -48.590  12.193  1.00 80.84  ? 8   DT  C O4    1 
ATOM   105   C C5    . DT  A 1 5   ? 56.146  -49.071  12.755  1.00 66.89  ? 8   DT  C C5    1 
ATOM   106   C C7    . DT  A 1 5   ? 56.223  -48.370  14.074  1.00 67.45  ? 8   DT  C C7    1 
ATOM   107   C C6    . DT  A 1 5   ? 55.033  -49.669  12.311  1.00 66.39  ? 8   DT  C C6    1 
ATOM   108   P P     . DA  A 1 6   ? 51.065  -54.096  10.770  1.00 79.92  ? 9   DA  C P     1 
ATOM   109   O OP1   . DA  A 1 6   ? 49.918  -54.725  10.063  1.00 76.70  ? 9   DA  C OP1   1 
ATOM   110   O OP2   . DA  A 1 6   ? 51.072  -54.048  12.258  1.00 74.53  ? 9   DA  C OP2   1 
ATOM   111   O "O5'" . DA  A 1 6   ? 52.422  -54.773  10.291  1.00 76.72  ? 9   DA  C "O5'" 1 
ATOM   112   C "C5'" . DA  A 1 6   ? 52.794  -54.761  8.906   1.00 80.74  ? 9   DA  C "C5'" 1 
ATOM   113   C "C4'" . DA  A 1 6   ? 54.186  -55.325  8.758   1.00 85.54  ? 9   DA  C "C4'" 1 
ATOM   114   O "O4'" . DA  A 1 6   ? 55.130  -54.426  9.391   1.00 85.78  ? 9   DA  C "O4'" 1 
ATOM   115   C "C3'" . DA  A 1 6   ? 54.401  -56.689  9.423   1.00 89.04  ? 9   DA  C "C3'" 1 
ATOM   116   O "O3'" . DA  A 1 6   ? 55.300  -57.466  8.622   1.00 101.77 ? 9   DA  C "O3'" 1 
ATOM   117   C "C2'" . DA  A 1 6   ? 55.056  -56.323  10.742  1.00 84.74  ? 9   DA  C "C2'" 1 
ATOM   118   C "C1'" . DA  A 1 6   ? 55.928  -55.168  10.294  1.00 83.25  ? 9   DA  C "C1'" 1 
ATOM   119   N N9    . DA  A 1 6   ? 56.393  -54.266  11.345  1.00 78.69  ? 9   DA  C N9    1 
ATOM   120   C C8    . DA  A 1 6   ? 55.760  -53.877  12.500  1.00 79.51  ? 9   DA  C C8    1 
ATOM   121   N N7    . DA  A 1 6   ? 56.476  -53.071  13.247  1.00 78.94  ? 9   DA  C N7    1 
ATOM   122   C C5    . DA  A 1 6   ? 57.663  -52.929  12.542  1.00 78.30  ? 9   DA  C C5    1 
ATOM   123   C C6    . DA  A 1 6   ? 58.835  -52.194  12.798  1.00 83.74  ? 9   DA  C C6    1 
ATOM   124   N N6    . DA  A 1 6   ? 59.014  -51.438  13.884  1.00 83.16  ? 9   DA  C N6    1 
ATOM   125   N N1    . DA  A 1 6   ? 59.830  -52.261  11.886  1.00 82.99  ? 9   DA  C N1    1 
ATOM   126   C C2    . DA  A 1 6   ? 59.652  -53.022  10.797  1.00 81.99  ? 9   DA  C C2    1 
ATOM   127   N N3    . DA  A 1 6   ? 58.595  -53.752  10.444  1.00 76.30  ? 9   DA  C N3    1 
ATOM   128   C C4    . DA  A 1 6   ? 57.625  -53.661  11.370  1.00 75.16  ? 9   DA  C C4    1 
ATOM   129   P P     . DC  A 1 7   ? 55.263  -59.075  8.645   1.00 102.73 ? 10  DC  C P     1 
ATOM   130   O OP1   . DC  A 1 7   ? 53.919  -59.514  8.180   1.00 91.60  ? 10  DC  C OP1   1 
ATOM   131   O OP2   . DC  A 1 7   ? 55.782  -59.536  9.964   1.00 90.27  ? 10  DC  C OP2   1 
ATOM   132   O "O5'" . DC  A 1 7   ? 56.313  -59.455  7.510   1.00 93.92  ? 10  DC  C "O5'" 1 
ATOM   133   C "C5'" . DC  A 1 7   ? 57.494  -60.214  7.819   1.00 98.71  ? 10  DC  C "C5'" 1 
ATOM   134   C "C4'" . DC  A 1 7   ? 58.705  -59.313  7.857   1.00 96.17  ? 10  DC  C "C4'" 1 
ATOM   135   O "O4'" . DC  A 1 7   ? 58.473  -58.205  8.742   1.00 91.33  ? 10  DC  C "O4'" 1 
ATOM   136   C "C3'" . DC  A 1 7   ? 59.966  -59.967  8.404   1.00 101.83 ? 10  DC  C "C3'" 1 
ATOM   137   O "O3'" . DC  A 1 7   ? 60.636  -60.700  7.377   1.00 112.07 ? 10  DC  C "O3'" 1 
ATOM   138   C "C2'" . DC  A 1 7   ? 60.776  -58.778  8.889   1.00 96.29  ? 10  DC  C "C2'" 1 
ATOM   139   C "C1'" . DC  A 1 7   ? 59.732  -57.704  9.181   1.00 92.23  ? 10  DC  C "C1'" 1 
ATOM   140   N N1    . DC  A 1 7   ? 59.603  -57.332  10.598  1.00 88.27  ? 10  DC  C N1    1 
ATOM   141   C C2    . DC  A 1 7   ? 60.636  -56.607  11.200  1.00 87.15  ? 10  DC  C C2    1 
ATOM   142   O O2    . DC  A 1 7   ? 61.641  -56.324  10.531  1.00 86.03  ? 10  DC  C O2    1 
ATOM   143   N N3    . DC  A 1 7   ? 60.513  -56.234  12.495  1.00 87.44  ? 10  DC  C N3    1 
ATOM   144   C C4    . DC  A 1 7   ? 59.414  -56.556  13.180  1.00 89.59  ? 10  DC  C C4    1 
ATOM   145   N N4    . DC  A 1 7   ? 59.335  -56.168  14.454  1.00 94.37  ? 10  DC  C N4    1 
ATOM   146   C C5    . DC  A 1 7   ? 58.346  -57.292  12.589  1.00 87.58  ? 10  DC  C C5    1 
ATOM   147   C C6    . DC  A 1 7   ? 58.480  -57.653  11.308  1.00 87.38  ? 10  DC  C C6    1 
ATOM   148   P P     . DA  A 1 8   ? 61.743  -61.774  7.770   1.00 118.81 ? 11  DA  C P     1 
ATOM   149   O OP1   . DA  A 1 8   ? 62.403  -62.219  6.514   1.00 112.95 ? 11  DA  C OP1   1 
ATOM   150   O OP2   . DA  A 1 8   ? 61.114  -62.775  8.677   1.00 116.42 ? 11  DA  C OP2   1 
ATOM   151   O "O5'" . DA  A 1 8   ? 62.770  -60.920  8.637   1.00 109.48 ? 11  DA  C "O5'" 1 
ATOM   152   C "C5'" . DA  A 1 8   ? 63.853  -60.202  8.019   1.00 109.54 ? 11  DA  C "C5'" 1 
ATOM   153   C "C4'" . DA  A 1 8   ? 64.948  -59.992  9.035   1.00 111.75 ? 11  DA  C "C4'" 1 
ATOM   154   O "O4'" . DA  A 1 8   ? 64.447  -59.141  10.094  1.00 112.51 ? 11  DA  C "O4'" 1 
ATOM   155   C "C3'" . DA  A 1 8   ? 65.415  -61.284  9.709   1.00 116.49 ? 11  DA  C "C3'" 1 
ATOM   156   O "O3'" . DA  A 1 8   ? 66.840  -61.348  9.812   1.00 123.48 ? 11  DA  C "O3'" 1 
ATOM   157   C "C2'" . DA  A 1 8   ? 64.755  -61.236  11.074  1.00 113.34 ? 11  DA  C "C2'" 1 
ATOM   158   C "C1'" . DA  A 1 8   ? 64.685  -59.749  11.348  1.00 107.28 ? 11  DA  C "C1'" 1 
ATOM   159   N N9    . DA  A 1 8   ? 63.599  -59.371  12.251  1.00 101.39 ? 11  DA  C N9    1 
ATOM   160   C C8    . DA  A 1 8   ? 62.277  -59.739  12.188  1.00 100.61 ? 11  DA  C C8    1 
ATOM   161   N N7    . DA  A 1 8   ? 61.550  -59.267  13.170  1.00 96.89  ? 11  DA  C N7    1 
ATOM   162   C C5    . DA  A 1 8   ? 62.455  -58.548  13.939  1.00 93.02  ? 11  DA  C C5    1 
ATOM   163   C C6    . DA  A 1 8   ? 62.309  -57.804  15.122  1.00 91.13  ? 11  DA  C C6    1 
ATOM   164   N N6    . DA  A 1 8   ? 61.150  -57.658  15.766  1.00 89.92  ? 11  DA  C N6    1 
ATOM   165   N N1    . DA  A 1 8   ? 63.412  -57.212  15.632  1.00 88.68  ? 11  DA  C N1    1 
ATOM   166   C C2    . DA  A 1 8   ? 64.577  -57.363  14.988  1.00 86.96  ? 11  DA  C C2    1 
ATOM   167   N N3    . DA  A 1 8   ? 64.838  -58.032  13.866  1.00 86.84  ? 11  DA  C N3    1 
ATOM   168   C C4    . DA  A 1 8   ? 63.722  -58.608  13.387  1.00 92.84  ? 11  DA  C C4    1 
ATOM   169   P P     . DA  A 1 9   ? 67.546  -62.691  10.331  1.00 123.76 ? 12  DA  C P     1 
ATOM   170   O OP1   . DA  A 1 9   ? 68.696  -62.975  9.437   1.00 127.30 ? 12  DA  C OP1   1 
ATOM   171   O OP2   . DA  A 1 9   ? 66.497  -63.724  10.541  1.00 116.24 ? 12  DA  C OP2   1 
ATOM   172   O "O5'" . DA  A 1 9   ? 68.118  -62.262  11.752  1.00 113.34 ? 12  DA  C "O5'" 1 
ATOM   173   C "C5'" . DA  A 1 9   ? 68.998  -61.135  11.865  1.00 111.64 ? 12  DA  C "C5'" 1 
ATOM   174   C "C4'" . DA  A 1 9   ? 69.135  -60.745  13.316  1.00 113.62 ? 12  DA  C "C4'" 1 
ATOM   175   O "O4'" . DA  A 1 9   ? 67.840  -60.374  13.844  1.00 111.65 ? 12  DA  C "O4'" 1 
ATOM   176   C "C3'" . DA  A 1 9   ? 69.667  -61.857  14.226  1.00 117.00 ? 12  DA  C "C3'" 1 
ATOM   177   O "O3'" . DA  A 1 9   ? 70.793  -61.358  14.956  1.00 124.69 ? 12  DA  C "O3'" 1 
ATOM   178   C "C2'" . DA  A 1 9   ? 68.477  -62.213  15.103  1.00 115.17 ? 12  DA  C "C2'" 1 
ATOM   179   C "C1'" . DA  A 1 9   ? 67.704  -60.914  15.143  1.00 105.90 ? 12  DA  C "C1'" 1 
ATOM   180   N N9    . DA  A 1 9   ? 66.276  -61.047  15.427  1.00 98.11  ? 12  DA  C N9    1 
ATOM   181   C C8    . DA  A 1 9   ? 65.351  -61.819  14.766  1.00 96.57  ? 12  DA  C C8    1 
ATOM   182   N N7    . DA  A 1 9   ? 64.136  -61.714  15.247  1.00 93.18  ? 12  DA  C N7    1 
ATOM   183   C C5    . DA  A 1 9   ? 64.266  -60.807  16.289  1.00 92.55  ? 12  DA  C C5    1 
ATOM   184   C C6    . DA  A 1 9   ? 63.338  -60.270  17.200  1.00 89.45  ? 12  DA  C C6    1 
ATOM   185   N N6    . DA  A 1 9   ? 62.041  -60.585  17.206  1.00 90.75  ? 12  DA  C N6    1 
ATOM   186   N N1    . DA  A 1 9   ? 63.794  -59.388  18.116  1.00 88.45  ? 12  DA  C N1    1 
ATOM   187   C C2    . DA  A 1 9   ? 65.096  -59.072  18.110  1.00 94.65  ? 12  DA  C C2    1 
ATOM   188   N N3    . DA  A 1 9   ? 66.065  -59.510  17.307  1.00 100.71 ? 12  DA  C N3    1 
ATOM   189   C C4    . DA  A 1 9   ? 65.579  -60.385  16.409  1.00 97.34  ? 12  DA  C C4    1 
ATOM   190   P P     . DG  A 1 10  ? 71.727  -62.346  15.810  1.00 129.11 ? 13  DG  C P     1 
ATOM   191   O OP1   . DG  A 1 10  ? 73.092  -62.306  15.224  1.00 130.34 ? 13  DG  C OP1   1 
ATOM   192   O OP2   . DG  A 1 10  ? 71.026  -63.651  15.948  1.00 124.42 ? 13  DG  C OP2   1 
ATOM   193   O "O5'" . DG  A 1 10  ? 71.738  -61.642  17.239  1.00 120.08 ? 13  DG  C "O5'" 1 
ATOM   194   C "C5'" . DG  A 1 10  ? 70.481  -61.351  17.857  1.00 116.13 ? 13  DG  C "C5'" 1 
ATOM   195   C "C4'" . DG  A 1 10  ? 70.638  -60.500  19.093  1.00 117.20 ? 13  DG  C "C4'" 1 
ATOM   196   O "O4'" . DG  A 1 10  ? 69.319  -60.029  19.445  1.00 115.52 ? 13  DG  C "O4'" 1 
ATOM   197   C "C3'" . DG  A 1 10  ? 71.108  -61.265  20.324  1.00 118.30 ? 13  DG  C "C3'" 1 
ATOM   198   O "O3'" . DG  A 1 10  ? 71.619  -60.376  21.328  1.00 122.54 ? 13  DG  C "O3'" 1 
ATOM   199   C "C2'" . DG  A 1 10  ? 69.823  -61.929  20.776  1.00 117.04 ? 13  DG  C "C2'" 1 
ATOM   200   C "C1'" . DG  A 1 10  ? 68.767  -60.871  20.455  1.00 110.18 ? 13  DG  C "C1'" 1 
ATOM   201   N N9    . DG  A 1 10  ? 67.513  -61.425  19.952  1.00 98.99  ? 13  DG  C N9    1 
ATOM   202   C C8    . DG  A 1 10  ? 67.333  -62.193  18.827  1.00 93.89  ? 13  DG  C C8    1 
ATOM   203   N N7    . DG  A 1 10  ? 66.095  -62.568  18.656  1.00 90.20  ? 13  DG  C N7    1 
ATOM   204   C C5    . DG  A 1 10  ? 65.418  -62.022  19.737  1.00 90.40  ? 13  DG  C C5    1 
ATOM   205   C C6    . DG  A 1 10  ? 64.045  -62.087  20.090  1.00 94.40  ? 13  DG  C C6    1 
ATOM   206   O O6    . DG  A 1 10  ? 63.123  -62.663  19.499  1.00 98.53  ? 13  DG  C O6    1 
ATOM   207   N N1    . DG  A 1 10  ? 63.785  -61.388  21.264  1.00 93.14  ? 13  DG  C N1    1 
ATOM   208   C C2    . DG  A 1 10  ? 64.724  -60.714  22.006  1.00 91.54  ? 13  DG  C C2    1 
ATOM   209   N N2    . DG  A 1 10  ? 64.277  -60.102  23.113  1.00 92.62  ? 13  DG  C N2    1 
ATOM   210   N N3    . DG  A 1 10  ? 66.008  -60.649  21.690  1.00 86.77  ? 13  DG  C N3    1 
ATOM   211   C C4    . DG  A 1 10  ? 66.280  -61.316  20.549  1.00 90.36  ? 13  DG  C C4    1 
ATOM   212   P P     . DT  A 1 11  ? 72.400  -60.954  22.616  1.00 129.80 ? 14  DT  C P     1 
ATOM   213   O OP1   . DT  A 1 11  ? 73.707  -60.258  22.714  1.00 128.71 ? 14  DT  C OP1   1 
ATOM   214   O OP2   . DT  A 1 11  ? 72.375  -62.437  22.547  1.00 135.30 ? 14  DT  C OP2   1 
ATOM   215   O "O5'" . DT  A 1 11  ? 71.477  -60.500  23.835  1.00 119.70 ? 14  DT  C "O5'" 1 
ATOM   216   C "C5'" . DT  A 1 11  ? 70.120  -60.964  23.911  1.00 111.44 ? 14  DT  C "C5'" 1 
ATOM   217   C "C4'" . DT  A 1 11  ? 69.468  -60.587  25.219  1.00 111.50 ? 14  DT  C "C4'" 1 
ATOM   218   O "O4'" . DT  A 1 11  ? 68.036  -60.661  25.027  1.00 112.88 ? 14  DT  C "O4'" 1 
ATOM   219   C "C3'" . DT  A 1 11  ? 69.762  -61.532  26.380  1.00 111.86 ? 14  DT  C "C3'" 1 
ATOM   220   O "O3'" . DT  A 1 11  ? 69.619  -60.861  27.637  1.00 116.58 ? 14  DT  C "O3'" 1 
ATOM   221   C "C2'" . DT  A 1 11  ? 68.701  -62.603  26.208  1.00 110.37 ? 14  DT  C "C2'" 1 
ATOM   222   C "C1'" . DT  A 1 11  ? 67.507  -61.812  25.680  1.00 104.19 ? 14  DT  C "C1'" 1 
ATOM   223   N N1    . DT  A 1 11  ? 66.662  -62.542  24.707  1.00 93.50  ? 14  DT  C N1    1 
ATOM   224   C C2    . DT  A 1 11  ? 65.303  -62.605  24.933  1.00 88.88  ? 14  DT  C C2    1 
ATOM   225   O O2    . DT  A 1 11  ? 64.761  -62.081  25.893  1.00 87.55  ? 14  DT  C O2    1 
ATOM   226   N N3    . DT  A 1 11  ? 64.597  -63.307  23.986  1.00 84.01  ? 14  DT  C N3    1 
ATOM   227   C C4    . DT  A 1 11  ? 65.105  -63.939  22.865  1.00 83.83  ? 14  DT  C C4    1 
ATOM   228   O O4    . DT  A 1 11  ? 64.347  -64.532  22.100  1.00 79.37  ? 14  DT  C O4    1 
ATOM   229   C C5    . DT  A 1 11  ? 66.537  -63.833  22.692  1.00 81.67  ? 14  DT  C C5    1 
ATOM   230   C C7    . DT  A 1 11  ? 67.176  -64.486  21.507  1.00 79.11  ? 14  DT  C C7    1 
ATOM   231   C C6    . DT  A 1 11  ? 67.233  -63.148  23.608  1.00 85.40  ? 14  DT  C C6    1 
ATOM   232   P P     . DA  A 1 12  ? 69.816  -61.665  29.012  1.00 127.55 ? 15  DA  C P     1 
ATOM   233   O OP1   . DA  A 1 12  ? 70.223  -60.694  30.058  1.00 129.06 ? 15  DA  C OP1   1 
ATOM   234   O OP2   . DA  A 1 12  ? 70.668  -62.853  28.736  1.00 126.44 ? 15  DA  C OP2   1 
ATOM   235   O "O5'" . DA  A 1 12  ? 68.340  -62.144  29.372  1.00 121.37 ? 15  DA  C "O5'" 1 
ATOM   236   C "C5'" . DA  A 1 12  ? 67.336  -61.187  29.752  1.00 120.26 ? 15  DA  C "C5'" 1 
ATOM   237   C "C4'" . DA  A 1 12  ? 66.047  -61.885  30.118  1.00 117.59 ? 15  DA  C "C4'" 1 
ATOM   238   O "O4'" . DA  A 1 12  ? 65.528  -62.601  28.972  1.00 113.46 ? 15  DA  C "O4'" 1 
ATOM   239   C "C3'" . DA  A 1 12  ? 66.160  -62.914  31.244  1.00 112.66 ? 15  DA  C "C3'" 1 
ATOM   240   O "O3'" . DA  A 1 12  ? 65.032  -62.744  32.113  1.00 115.86 ? 15  DA  C "O3'" 1 
ATOM   241   C "C2'" . DA  A 1 12  ? 66.189  -64.240  30.503  1.00 110.61 ? 15  DA  C "C2'" 1 
ATOM   242   C "C1'" . DA  A 1 12  ? 65.288  -63.957  29.316  1.00 105.86 ? 15  DA  C "C1'" 1 
ATOM   243   N N9    . DA  A 1 12  ? 65.525  -64.770  28.120  1.00 99.17  ? 15  DA  C N9    1 
ATOM   244   C C8    . DA  A 1 12  ? 66.721  -65.150  27.560  1.00 94.27  ? 15  DA  C C8    1 
ATOM   245   N N7    . DA  A 1 12  ? 66.591  -65.861  26.466  1.00 86.12  ? 15  DA  C N7    1 
ATOM   246   C C5    . DA  A 1 12  ? 65.217  -65.948  26.287  1.00 85.53  ? 15  DA  C C5    1 
ATOM   247   C C6    . DA  A 1 12  ? 64.429  -66.566  25.300  1.00 87.26  ? 15  DA  C C6    1 
ATOM   248   N N6    . DA  A 1 12  ? 64.932  -67.248  24.269  1.00 89.35  ? 15  DA  C N6    1 
ATOM   249   N N1    . DA  A 1 12  ? 63.086  -66.464  25.413  1.00 88.31  ? 15  DA  C N1    1 
ATOM   250   C C2    . DA  A 1 12  ? 62.579  -65.780  26.450  1.00 92.87  ? 15  DA  C C2    1 
ATOM   251   N N3    . DA  A 1 12  ? 63.217  -65.155  27.439  1.00 89.39  ? 15  DA  C N3    1 
ATOM   252   C C4    . DA  A 1 12  ? 64.549  -65.277  27.296  1.00 90.28  ? 15  DA  C C4    1 
ATOM   253   P P     . DT  A 1 13  ? 64.783  -63.741  33.344  1.00 118.76 ? 16  DT  C P     1 
ATOM   254   O OP1   . DT  A 1 13  ? 64.204  -62.959  34.466  1.00 108.85 ? 16  DT  C OP1   1 
ATOM   255   O OP2   . DT  A 1 13  ? 66.031  -64.521  33.564  1.00 114.62 ? 16  DT  C OP2   1 
ATOM   256   O "O5'" . DT  A 1 13  ? 63.601  -64.664  32.804  1.00 111.19 ? 16  DT  C "O5'" 1 
ATOM   257   C "C5'" . DT  A 1 13  ? 62.431  -64.061  32.219  1.00 105.38 ? 16  DT  C "C5'" 1 
ATOM   258   C "C4'" . DT  A 1 13  ? 61.298  -65.055  32.095  1.00 103.90 ? 16  DT  C "C4'" 1 
ATOM   259   O "O4'" . DT  A 1 13  ? 61.418  -65.806  30.862  1.00 104.31 ? 16  DT  C "O4'" 1 
ATOM   260   C "C3'" . DT  A 1 13  ? 61.189  -66.098  33.207  1.00 97.32  ? 16  DT  C "C3'" 1 
ATOM   261   O "O3'" . DT  A 1 13  ? 59.791  -66.308  33.447  1.00 96.97  ? 16  DT  C "O3'" 1 
ATOM   262   C "C2'" . DT  A 1 13  ? 61.873  -67.315  32.604  1.00 95.19  ? 16  DT  C "C2'" 1 
ATOM   263   C "C1'" . DT  A 1 13  ? 61.478  -67.201  31.136  1.00 91.39  ? 16  DT  C "C1'" 1 
ATOM   264   N N1    . DT  A 1 13  ? 62.382  -67.815  30.129  1.00 80.58  ? 16  DT  C N1    1 
ATOM   265   C C2    . DT  A 1 13  ? 61.806  -68.441  29.044  1.00 77.58  ? 16  DT  C C2    1 
ATOM   266   O O2    . DT  A 1 13  ? 60.599  -68.562  28.905  1.00 75.69  ? 16  DT  C O2    1 
ATOM   267   N N3    . DT  A 1 13  ? 62.702  -68.944  28.131  1.00 71.00  ? 16  DT  C N3    1 
ATOM   268   C C4    . DT  A 1 13  ? 64.082  -68.863  28.183  1.00 73.31  ? 16  DT  C C4    1 
ATOM   269   O O4    . DT  A 1 13  ? 64.759  -69.358  27.285  1.00 72.56  ? 16  DT  C O4    1 
ATOM   270   C C5    . DT  A 1 13  ? 64.616  -68.178  29.340  1.00 72.14  ? 16  DT  C C5    1 
ATOM   271   C C7    . DT  A 1 13  ? 66.100  -68.045  29.484  1.00 69.76  ? 16  DT  C C7    1 
ATOM   272   C C6    . DT  A 1 13  ? 63.751  -67.684  30.237  1.00 73.36  ? 16  DT  C C6    1 
ATOM   273   P P     . DG  A 1 14  ? 59.252  -66.675  34.911  1.00 96.56  ? 17  DG  C P     1 
ATOM   274   O OP1   . DG  A 1 14  ? 57.983  -65.938  35.142  1.00 93.97  ? 17  DG  C OP1   1 
ATOM   275   O OP2   . DG  A 1 14  ? 60.385  -66.544  35.864  1.00 90.27  ? 17  DG  C OP2   1 
ATOM   276   O "O5'" . DG  A 1 14  ? 58.824  -68.204  34.777  1.00 97.21  ? 17  DG  C "O5'" 1 
ATOM   277   C "C5'" . DG  A 1 14  ? 58.332  -68.759  33.537  1.00 94.03  ? 17  DG  C "C5'" 1 
ATOM   278   C "C4'" . DG  A 1 14  ? 58.722  -70.216  33.422  1.00 91.13  ? 17  DG  C "C4'" 1 
ATOM   279   O "O4'" . DG  A 1 14  ? 59.872  -70.373  32.547  1.00 85.27  ? 17  DG  C "O4'" 1 
ATOM   280   C "C3'" . DG  A 1 14  ? 59.108  -70.892  34.744  1.00 92.15  ? 17  DG  C "C3'" 1 
ATOM   281   O "O3'" . DG  A 1 14  ? 58.481  -72.175  34.817  1.00 103.26 ? 17  DG  C "O3'" 1 
ATOM   282   C "C2'" . DG  A 1 14  ? 60.614  -71.042  34.635  1.00 84.52  ? 17  DG  C "C2'" 1 
ATOM   283   C "C1'" . DG  A 1 14  ? 60.733  -71.316  33.155  1.00 80.32  ? 17  DG  C "C1'" 1 
ATOM   284   N N9    . DG  A 1 14  ? 62.061  -71.195  32.561  1.00 73.02  ? 17  DG  C N9    1 
ATOM   285   C C8    . DG  A 1 14  ? 63.221  -70.792  33.179  1.00 72.94  ? 17  DG  C C8    1 
ATOM   286   N N7    . DG  A 1 14  ? 64.265  -70.852  32.397  1.00 69.43  ? 17  DG  C N7    1 
ATOM   287   C C5    . DG  A 1 14  ? 63.769  -71.347  31.199  1.00 65.00  ? 17  DG  C C5    1 
ATOM   288   C C6    . DG  A 1 14  ? 64.435  -71.637  29.979  1.00 67.64  ? 17  DG  C C6    1 
ATOM   289   O O6    . DG  A 1 14  ? 65.634  -71.499  29.702  1.00 70.00  ? 17  DG  C O6    1 
ATOM   290   N N1    . DG  A 1 14  ? 63.556  -72.139  29.024  1.00 66.47  ? 17  DG  C N1    1 
ATOM   291   C C2    . DG  A 1 14  ? 62.208  -72.333  29.214  1.00 70.75  ? 17  DG  C C2    1 
ATOM   292   N N2    . DG  A 1 14  ? 61.526  -72.829  28.168  1.00 72.73  ? 17  DG  C N2    1 
ATOM   293   N N3    . DG  A 1 14  ? 61.576  -72.069  30.349  1.00 64.01  ? 17  DG  C N3    1 
ATOM   294   C C4    . DG  A 1 14  ? 62.413  -71.581  31.290  1.00 65.61  ? 17  DG  C C4    1 
ATOM   295   P P     . DA  A 1 15  ? 57.922  -72.722  36.206  1.00 113.64 ? 18  DA  C P     1 
ATOM   296   O OP1   . DA  A 1 15  ? 56.901  -71.763  36.707  1.00 105.85 ? 18  DA  C OP1   1 
ATOM   297   O OP2   . DA  A 1 15  ? 59.088  -73.092  37.054  1.00 110.01 ? 18  DA  C OP2   1 
ATOM   298   O "O5'" . DA  A 1 15  ? 57.122  -74.029  35.772  1.00 111.32 ? 18  DA  C "O5'" 1 
ATOM   299   C "C5'" . DA  A 1 15  ? 56.060  -73.947  34.801  1.00 109.66 ? 18  DA  C "C5'" 1 
ATOM   300   C "C4'" . DA  A 1 15  ? 56.388  -74.801  33.598  1.00 105.46 ? 18  DA  C "C4'" 1 
ATOM   301   O "O4'" . DA  A 1 15  ? 57.690  -74.434  33.075  1.00 100.08 ? 18  DA  C "O4'" 1 
ATOM   302   C "C3'" . DA  A 1 15  ? 56.453  -76.303  33.890  1.00 106.39 ? 18  DA  C "C3'" 1 
ATOM   303   O "O3'" . DA  A 1 15  ? 55.698  -77.041  32.920  1.00 111.42 ? 18  DA  C "O3'" 1 
ATOM   304   C "C2'" . DA  A 1 15  ? 57.940  -76.610  33.848  1.00 99.87  ? 18  DA  C "C2'" 1 
ATOM   305   C "C1'" . DA  A 1 15  ? 58.445  -75.606  32.835  1.00 90.46  ? 18  DA  C "C1'" 1 
ATOM   306   N N9    . DA  A 1 15  ? 59.863  -75.275  32.974  1.00 78.39  ? 18  DA  C N9    1 
ATOM   307   C C8    . DA  A 1 15  ? 60.534  -74.917  34.118  1.00 76.71  ? 18  DA  C C8    1 
ATOM   308   N N7    . DA  A 1 15  ? 61.814  -74.699  33.934  1.00 72.91  ? 18  DA  C N7    1 
ATOM   309   C C5    . DA  A 1 15  ? 62.002  -74.938  32.580  1.00 70.81  ? 18  DA  C C5    1 
ATOM   310   C C6    . DA  A 1 15  ? 63.143  -74.875  31.756  1.00 68.24  ? 18  DA  C C6    1 
ATOM   311   N N6    . DA  A 1 15  ? 64.357  -74.540  32.198  1.00 67.40  ? 18  DA  C N6    1 
ATOM   312   N N1    . DA  A 1 15  ? 62.990  -75.172  30.446  1.00 66.59  ? 18  DA  C N1    1 
ATOM   313   C C2    . DA  A 1 15  ? 61.767  -75.499  30.002  1.00 72.54  ? 18  DA  C C2    1 
ATOM   314   N N3    . DA  A 1 15  ? 60.618  -75.581  30.676  1.00 72.19  ? 18  DA  C N3    1 
ATOM   315   C C4    . DA  A 1 15  ? 60.808  -75.292  31.975  1.00 73.25  ? 18  DA  C C4    1 
ATOM   316   P P     . DA  A 1 16  ? 55.472  -78.623  33.098  1.00 107.79 ? 19  DA  C P     1 
ATOM   317   O OP1   . DA  A 1 16  ? 54.731  -79.116  31.912  1.00 99.60  ? 19  DA  C OP1   1 
ATOM   318   O OP2   . DA  A 1 16  ? 54.930  -78.868  34.459  1.00 104.84 ? 19  DA  C OP2   1 
ATOM   319   O "O5'" . DA  A 1 16  ? 56.953  -79.198  33.047  1.00 103.07 ? 19  DA  C "O5'" 1 
ATOM   320   C "C5'" . DA  A 1 16  ? 57.228  -80.420  32.359  1.00 107.47 ? 19  DA  C "C5'" 1 
ATOM   321   C "C4'" . DA  A 1 16  ? 57.457  -80.169  30.887  1.00 101.91 ? 19  DA  C "C4'" 1 
ATOM   322   O "O4'" . DA  A 1 16  ? 58.384  -79.074  30.726  1.00 91.25  ? 19  DA  C "O4'" 1 
ATOM   323   C "C3'" . DA  A 1 16  ? 58.105  -81.358  30.187  1.00 106.78 ? 19  DA  C "C3'" 1 
ATOM   324   O "O3'" . DA  A 1 16  ? 57.711  -81.537  28.826  1.00 114.25 ? 19  DA  C "O3'" 1 
ATOM   325   C "C2'" . DA  A 1 16  ? 59.587  -81.073  30.331  1.00 99.41  ? 19  DA  C "C2'" 1 
ATOM   326   C "C1'" . DA  A 1 16  ? 59.672  -79.559  30.364  1.00 87.89  ? 19  DA  C "C1'" 1 
ATOM   327   N N9    . DA  A 1 16  ? 60.631  -79.070  31.351  1.00 80.28  ? 19  DA  C N9    1 
ATOM   328   C C8    . DA  A 1 16  ? 60.409  -78.759  32.670  1.00 80.58  ? 19  DA  C C8    1 
ATOM   329   N N7    . DA  A 1 16  ? 61.481  -78.343  33.302  1.00 79.75  ? 19  DA  C N7    1 
ATOM   330   C C5    . DA  A 1 16  ? 62.477  -78.396  32.338  1.00 75.20  ? 19  DA  C C5    1 
ATOM   331   C C6    . DA  A 1 16  ? 63.846  -78.075  32.373  1.00 74.82  ? 19  DA  C C6    1 
ATOM   332   N N6    . DA  A 1 16  ? 64.473  -77.631  33.464  1.00 76.11  ? 19  DA  C N6    1 
ATOM   333   N N1    . DA  A 1 16  ? 64.559  -78.236  31.236  1.00 76.81  ? 19  DA  C N1    1 
ATOM   334   C C2    . DA  A 1 16  ? 63.928  -78.682  30.141  1.00 81.69  ? 19  DA  C C2    1 
ATOM   335   N N3    . DA  A 1 16  ? 62.645  -79.011  29.982  1.00 78.21  ? 19  DA  C N3    1 
ATOM   336   C C4    . DA  A 1 16  ? 61.968  -78.846  31.132  1.00 77.07  ? 19  DA  C C4    1 
ATOM   337   P P     . DA  A 1 17  ? 57.871  -82.983  28.159  1.00 116.30 ? 20  DA  C P     1 
ATOM   338   O OP1   . DA  A 1 17  ? 57.400  -82.895  26.755  1.00 116.71 ? 20  DA  C OP1   1 
ATOM   339   O OP2   . DA  A 1 17  ? 57.249  -83.976  29.072  1.00 114.89 ? 20  DA  C OP2   1 
ATOM   340   O "O5'" . DA  A 1 17  ? 59.451  -83.189  28.129  1.00 99.28  ? 20  DA  C "O5'" 1 
ATOM   341   C "C5'" . DA  A 1 17  ? 60.201  -82.706  27.006  1.00 99.43  ? 20  DA  C "C5'" 1 
ATOM   342   C "C4'" . DA  A 1 17  ? 61.686  -82.833  27.248  1.00 104.25 ? 20  DA  C "C4'" 1 
ATOM   343   O "O4'" . DA  A 1 17  ? 62.089  -82.101  28.431  1.00 100.17 ? 20  DA  C "O4'" 1 
ATOM   344   C "C3'" . DA  A 1 17  ? 62.210  -84.263  27.437  1.00 105.08 ? 20  DA  C "C3'" 1 
ATOM   345   O "O3'" . DA  A 1 17  ? 63.293  -84.453  26.515  1.00 110.93 ? 20  DA  C "O3'" 1 
ATOM   346   C "C2'" . DA  A 1 17  ? 62.675  -84.274  28.884  1.00 102.24 ? 20  DA  C "C2'" 1 
ATOM   347   C "C1'" . DA  A 1 17  ? 63.129  -82.842  29.032  1.00 95.30  ? 20  DA  C "C1'" 1 
ATOM   348   N N9    . DA  A 1 17  ? 63.305  -82.356  30.399  1.00 90.79  ? 20  DA  C N9    1 
ATOM   349   C C8    . DA  A 1 17  ? 62.361  -82.281  31.392  1.00 91.45  ? 20  DA  C C8    1 
ATOM   350   N N7    . DA  A 1 17  ? 62.815  -81.787  32.518  1.00 85.91  ? 20  DA  C N7    1 
ATOM   351   C C5    . DA  A 1 17  ? 64.149  -81.520  32.250  1.00 85.14  ? 20  DA  C C5    1 
ATOM   352   C C6    . DA  A 1 17  ? 65.184  -80.989  33.040  1.00 91.21  ? 20  DA  C C6    1 
ATOM   353   N N6    . DA  A 1 17  ? 65.024  -80.615  34.312  1.00 91.56  ? 20  DA  C N6    1 
ATOM   354   N N1    . DA  A 1 17  ? 66.403  -80.852  32.471  1.00 91.81  ? 20  DA  C N1    1 
ATOM   355   C C2    . DA  A 1 17  ? 66.560  -81.228  31.194  1.00 90.11  ? 20  DA  C C2    1 
ATOM   356   N N3    . DA  A 1 17  ? 65.664  -81.741  30.351  1.00 88.33  ? 20  DA  C N3    1 
ATOM   357   C C4    . DA  A 1 17  ? 64.466  -81.868  30.949  1.00 86.01  ? 20  DA  C C4    1 
ATOM   358   P P     . DT  A 1 18  ? 63.994  -85.887  26.324  1.00 114.67 ? 21  DT  C P     1 
ATOM   359   O OP1   . DT  A 1 18  ? 63.991  -86.207  24.873  1.00 111.86 ? 21  DT  C OP1   1 
ATOM   360   O OP2   . DT  A 1 18  ? 63.384  -86.840  27.290  1.00 121.32 ? 21  DT  C OP2   1 
ATOM   361   O "O5'" . DT  A 1 18  ? 65.508  -85.608  26.736  1.00 102.66 ? 21  DT  C "O5'" 1 
ATOM   362   C "C5'" . DT  A 1 18  ? 65.821  -84.526  27.630  1.00 105.92 ? 21  DT  C "C5'" 1 
ATOM   363   C "C4'" . DT  A 1 18  ? 67.264  -84.564  28.077  1.00 107.93 ? 21  DT  C "C4'" 1 
ATOM   364   O "O4'" . DT  A 1 18  ? 67.351  -83.933  29.379  1.00 108.35 ? 21  DT  C "O4'" 1 
ATOM   365   C "C3'" . DT  A 1 18  ? 67.854  -85.957  28.265  1.00 105.93 ? 21  DT  C "C3'" 1 
ATOM   366   O "O3'" . DT  A 1 18  ? 69.267  -85.920  28.053  1.00 102.42 ? 21  DT  C "O3'" 1 
ATOM   367   C "C2'" . DT  A 1 18  ? 67.512  -86.258  29.709  1.00 107.85 ? 21  DT  C "C2'" 1 
ATOM   368   C "C1'" . DT  A 1 18  ? 67.689  -84.896  30.365  1.00 100.56 ? 21  DT  C "C1'" 1 
ATOM   369   N N1    . DT  A 1 18  ? 66.837  -84.659  31.551  1.00 97.02  ? 21  DT  C N1    1 
ATOM   370   C C2    . DT  A 1 18  ? 67.429  -84.114  32.669  1.00 98.23  ? 21  DT  C C2    1 
ATOM   371   O O2    . DT  A 1 18  ? 68.607  -83.801  32.714  1.00 98.81  ? 21  DT  C O2    1 
ATOM   372   N N3    . DT  A 1 18  ? 66.585  -83.949  33.741  1.00 96.88  ? 21  DT  C N3    1 
ATOM   373   C C4    . DT  A 1 18  ? 65.239  -84.265  33.802  1.00 92.86  ? 21  DT  C C4    1 
ATOM   374   O O4    . DT  A 1 18  ? 64.607  -84.055  34.834  1.00 92.30  ? 21  DT  C O4    1 
ATOM   375   C C5    . DT  A 1 18  ? 64.683  -84.831  32.593  1.00 89.03  ? 21  DT  C C5    1 
ATOM   376   C C7    . DT  A 1 18  ? 63.235  -85.208  32.568  1.00 83.30  ? 21  DT  C C7    1 
ATOM   377   C C6    . DT  A 1 18  ? 65.500  -85.003  31.544  1.00 93.19  ? 21  DT  C C6    1 
ATOM   378   P P     . DG  A 1 19  ? 70.118  -87.272  28.058  1.00 110.49 ? 22  DG  C P     1 
ATOM   379   O OP1   . DG  A 1 19  ? 70.940  -87.310  26.818  1.00 103.92 ? 22  DG  C OP1   1 
ATOM   380   O OP2   . DG  A 1 19  ? 69.195  -88.404  28.355  1.00 105.56 ? 22  DG  C OP2   1 
ATOM   381   O "O5'" . DG  A 1 19  ? 71.124  -87.034  29.268  1.00 100.36 ? 22  DG  C "O5'" 1 
ATOM   382   C "C5'" . DG  A 1 19  ? 72.452  -86.546  29.004  1.00 102.59 ? 22  DG  C "C5'" 1 
ATOM   383   C "C4'" . DG  A 1 19  ? 73.186  -86.258  30.293  1.00 102.57 ? 22  DG  C "C4'" 1 
ATOM   384   O "O4'" . DG  A 1 19  ? 72.273  -85.738  31.289  1.00 98.13  ? 22  DG  C "O4'" 1 
ATOM   385   C "C3'" . DG  A 1 19  ? 73.854  -87.471  30.934  1.00 102.67 ? 22  DG  C "C3'" 1 
ATOM   386   O "O3'" . DG  A 1 19  ? 75.122  -87.069  31.449  1.00 112.98 ? 22  DG  C "O3'" 1 
ATOM   387   C "C2'" . DG  A 1 19  ? 72.863  -87.880  32.008  1.00 100.71 ? 22  DG  C "C2'" 1 
ATOM   388   C "C1'" . DG  A 1 19  ? 72.307  -86.541  32.458  1.00 93.03  ? 22  DG  C "C1'" 1 
ATOM   389   N N9    . DG  A 1 19  ? 70.950  -86.596  32.990  1.00 90.67  ? 22  DG  C N9    1 
ATOM   390   C C8    . DG  A 1 19  ? 69.811  -86.889  32.279  1.00 92.70  ? 22  DG  C C8    1 
ATOM   391   N N7    . DG  A 1 19  ? 68.729  -86.860  33.008  1.00 90.91  ? 22  DG  C N7    1 
ATOM   392   C C5    . DG  A 1 19  ? 69.175  -86.506  34.274  1.00 84.46  ? 22  DG  C C5    1 
ATOM   393   C C6    . DG  A 1 19  ? 68.454  -86.309  35.480  1.00 84.09  ? 22  DG  C C6    1 
ATOM   394   O O6    . DG  A 1 19  ? 67.237  -86.417  35.677  1.00 86.64  ? 22  DG  C O6    1 
ATOM   395   N N1    . DG  A 1 19  ? 69.299  -85.968  36.532  1.00 79.70  ? 22  DG  C N1    1 
ATOM   396   C C2    . DG  A 1 19  ? 70.663  -85.833  36.437  1.00 82.44  ? 22  DG  C C2    1 
ATOM   397   N N2    . DG  A 1 19  ? 71.303  -85.493  37.566  1.00 82.73  ? 22  DG  C N2    1 
ATOM   398   N N3    . DG  A 1 19  ? 71.349  -86.011  35.316  1.00 80.30  ? 22  DG  C N3    1 
ATOM   399   C C4    . DG  A 1 19  ? 70.545  -86.338  34.280  1.00 85.00  ? 22  DG  C C4    1 
ATOM   400   P P     . DT  A 1 20  ? 76.188  -88.162  31.904  1.00 132.43 ? 23  DT  C P     1 
ATOM   401   O OP1   . DT  A 1 20  ? 77.455  -87.916  31.162  1.00 124.14 ? 23  DT  C OP1   1 
ATOM   402   O OP2   . DT  A 1 20  ? 75.539  -89.492  31.813  1.00 141.92 ? 23  DT  C OP2   1 
ATOM   403   O "O5'" . DT  A 1 20  ? 76.400  -87.813  33.445  1.00 121.06 ? 23  DT  C "O5'" 1 
ATOM   404   C "C5'" . DT  A 1 20  ? 75.318  -87.260  34.219  1.00 109.66 ? 23  DT  C "C5'" 1 
ATOM   405   C "C4'" . DT  A 1 20  ? 75.654  -87.250  35.690  1.00 108.60 ? 23  DT  C "C4'" 1 
ATOM   406   O "O4'" . DT  A 1 20  ? 74.431  -87.136  36.455  1.00 105.81 ? 23  DT  C "O4'" 1 
ATOM   407   C "C3'" . DT  A 1 20  ? 76.360  -88.499  36.212  1.00 104.76 ? 23  DT  C "C3'" 1 
ATOM   408   O "O3'" . DT  A 1 20  ? 77.331  -88.108  37.186  1.00 111.60 ? 23  DT  C "O3'" 1 
ATOM   409   C "C2'" . DT  A 1 20  ? 75.226  -89.340  36.772  1.00 101.82 ? 23  DT  C "C2'" 1 
ATOM   410   C "C1'" . DT  A 1 20  ? 74.197  -88.310  37.224  1.00 96.35  ? 23  DT  C "C1'" 1 
ATOM   411   N N1    . DT  A 1 20  ? 72.775  -88.688  37.037  1.00 87.50  ? 23  DT  C N1    1 
ATOM   412   C C2    . DT  A 1 20  ? 71.896  -88.479  38.079  1.00 88.09  ? 23  DT  C C2    1 
ATOM   413   O O2    . DT  A 1 20  ? 72.238  -88.025  39.160  1.00 99.34  ? 23  DT  C O2    1 
ATOM   414   N N3    . DT  A 1 20  ? 70.594  -88.827  37.809  1.00 75.70  ? 23  DT  C N3    1 
ATOM   415   C C4    . DT  A 1 20  ? 70.095  -89.343  36.626  1.00 73.00  ? 23  DT  C C4    1 
ATOM   416   O O4    . DT  A 1 20  ? 68.897  -89.604  36.527  1.00 67.24  ? 23  DT  C O4    1 
ATOM   417   C C5    . DT  A 1 20  ? 71.071  -89.532  35.575  1.00 71.97  ? 23  DT  C C5    1 
ATOM   418   C C7    . DT  A 1 20  ? 70.625  -90.092  34.262  1.00 68.77  ? 23  DT  C C7    1 
ATOM   419   C C6    . DT  A 1 20  ? 72.343  -89.193  35.828  1.00 76.84  ? 23  DT  C C6    1 
ATOM   420   P P     . DC  A 1 21  ? 78.431  -89.150  37.692  1.00 129.83 ? 24  DC  C P     1 
ATOM   421   O OP1   . DC  A 1 21  ? 79.564  -88.381  38.268  1.00 128.58 ? 24  DC  C OP1   1 
ATOM   422   O OP2   . DC  A 1 21  ? 78.693  -90.116  36.593  1.00 125.75 ? 24  DC  C OP2   1 
ATOM   423   O "O5'" . DC  A 1 21  ? 77.687  -89.870  38.904  1.00 128.25 ? 24  DC  C "O5'" 1 
ATOM   424   C "C5'" . DC  A 1 21  ? 76.997  -89.092  39.907  1.00 128.41 ? 24  DC  C "C5'" 1 
ATOM   425   C "C4'" . DC  A 1 21  ? 76.264  -89.990  40.878  1.00 128.83 ? 24  DC  C "C4'" 1 
ATOM   426   O "O4'" . DC  A 1 21  ? 74.906  -90.214  40.418  1.00 119.26 ? 24  DC  C "O4'" 1 
ATOM   427   C "C3'" . DC  A 1 21  ? 76.877  -91.382  41.062  1.00 127.33 ? 24  DC  C "C3'" 1 
ATOM   428   O "O3'" . DC  A 1 21  ? 76.775  -91.809  42.427  1.00 130.64 ? 24  DC  C "O3'" 1 
ATOM   429   C "C2'" . DC  A 1 21  ? 76.016  -92.250  40.167  1.00 117.96 ? 24  DC  C "C2'" 1 
ATOM   430   C "C1'" . DC  A 1 21  ? 74.661  -91.613  40.413  1.00 109.62 ? 24  DC  C "C1'" 1 
ATOM   431   N N1    . DC  A 1 21  ? 73.594  -91.898  39.434  1.00 93.20  ? 24  DC  C N1    1 
ATOM   432   C C2    . DC  A 1 21  ? 72.264  -91.741  39.842  1.00 87.51  ? 24  DC  C C2    1 
ATOM   433   O O2    . DC  A 1 21  ? 72.032  -91.351  40.997  1.00 85.21  ? 24  DC  C O2    1 
ATOM   434   N N3    . DC  A 1 21  ? 71.267  -92.010  38.967  1.00 80.52  ? 24  DC  C N3    1 
ATOM   435   C C4    . DC  A 1 21  ? 71.558  -92.431  37.733  1.00 83.08  ? 24  DC  C C4    1 
ATOM   436   N N4    . DC  A 1 21  ? 70.543  -92.691  36.905  1.00 83.40  ? 24  DC  C N4    1 
ATOM   437   C C5    . DC  A 1 21  ? 72.905  -92.607  37.294  1.00 81.41  ? 24  DC  C C5    1 
ATOM   438   C C6    . DC  A 1 21  ? 73.882  -92.337  38.170  1.00 85.94  ? 24  DC  C C6    1 
ATOM   439   P P     . DG  A 1 22  ? 77.859  -92.819  43.028  1.00 135.90 ? 25  DG  C P     1 
ATOM   440   O OP1   . DG  A 1 22  ? 79.056  -92.032  43.420  1.00 136.29 ? 25  DG  C OP1   1 
ATOM   441   O OP2   . DG  A 1 22  ? 78.005  -93.952  42.081  1.00 139.56 ? 25  DG  C OP2   1 
ATOM   442   O "O5'" . DG  A 1 22  ? 77.165  -93.338  44.362  1.00 127.95 ? 25  DG  C "O5'" 1 
ATOM   443   C "C5'" . DG  A 1 22  ? 76.849  -92.417  45.420  1.00 127.77 ? 25  DG  C "C5'" 1 
ATOM   444   C "C4'" . DG  A 1 22  ? 75.409  -92.593  45.835  1.00 125.99 ? 25  DG  C "C4'" 1 
ATOM   445   O "O4'" . DG  A 1 22  ? 74.579  -92.656  44.649  1.00 120.54 ? 25  DG  C "O4'" 1 
ATOM   446   C "C3'" . DG  A 1 22  ? 75.130  -93.881  46.613  1.00 126.89 ? 25  DG  C "C3'" 1 
ATOM   447   O "O3'" . DG  A 1 22  ? 74.182  -93.629  47.657  1.00 133.68 ? 25  DG  C "O3'" 1 
ATOM   448   C "C2'" . DG  A 1 22  ? 74.586  -94.814  45.546  1.00 118.49 ? 25  DG  C "C2'" 1 
ATOM   449   C "C1'" . DG  A 1 22  ? 73.804  -93.843  44.686  1.00 110.62 ? 25  DG  C "C1'" 1 
ATOM   450   N N9    . DG  A 1 22  ? 73.571  -94.280  43.313  1.00 95.87  ? 25  DG  C N9    1 
ATOM   451   C C8    . DG  A 1 22  ? 74.507  -94.613  42.362  1.00 92.28  ? 25  DG  C C8    1 
ATOM   452   N N7    . DG  A 1 22  ? 73.975  -94.979  41.227  1.00 84.06  ? 25  DG  C N7    1 
ATOM   453   C C5    . DG  A 1 22  ? 72.607  -94.887  41.443  1.00 78.35  ? 25  DG  C C5    1 
ATOM   454   C C6    . DG  A 1 22  ? 71.516  -95.163  40.576  1.00 77.78  ? 25  DG  C C6    1 
ATOM   455   O O6    . DG  A 1 22  ? 71.545  -95.550  39.398  1.00 72.53  ? 25  DG  C O6    1 
ATOM   456   N N1    . DG  A 1 22  ? 70.293  -94.939  41.205  1.00 74.57  ? 25  DG  C N1    1 
ATOM   457   C C2    . DG  A 1 22  ? 70.139  -94.507  42.500  1.00 80.14  ? 25  DG  C C2    1 
ATOM   458   N N2    . DG  A 1 22  ? 68.876  -94.351  42.929  1.00 78.10  ? 25  DG  C N2    1 
ATOM   459   N N3    . DG  A 1 22  ? 71.147  -94.249  43.317  1.00 79.56  ? 25  DG  C N3    1 
ATOM   460   C C4    . DG  A 1 22  ? 72.342  -94.458  42.727  1.00 82.27  ? 25  DG  C C4    1 
ATOM   461   P P     . DT  A 1 23  ? 73.728  -94.809  48.644  1.00 135.04 ? 26  DT  C P     1 
ATOM   462   O OP1   . DT  A 1 23  ? 73.470  -94.214  49.981  1.00 126.49 ? 26  DT  C OP1   1 
ATOM   463   O OP2   . DT  A 1 23  ? 74.706  -95.922  48.508  1.00 135.56 ? 26  DT  C OP2   1 
ATOM   464   O "O5'" . DT  A 1 23  ? 72.326  -95.264  48.037  1.00 126.90 ? 26  DT  C "O5'" 1 
ATOM   465   C "C5'" . DT  A 1 23  ? 71.185  -94.384  48.085  1.00 126.12 ? 26  DT  C "C5'" 1 
ATOM   466   C "C4'" . DT  A 1 23  ? 69.935  -95.096  47.622  1.00 128.05 ? 26  DT  C "C4'" 1 
ATOM   467   O "O4'" . DT  A 1 23  ? 70.032  -95.425  46.215  1.00 124.87 ? 26  DT  C "O4'" 1 
ATOM   468   C "C3'" . DT  A 1 23  ? 69.622  -96.411  48.345  1.00 131.19 ? 26  DT  C "C3'" 1 
ATOM   469   O "O3'" . DT  A 1 23  ? 68.238  -96.422  48.716  1.00 138.09 ? 26  DT  C "O3'" 1 
ATOM   470   C "C2'" . DT  A 1 23  ? 69.940  -97.478  47.308  1.00 120.10 ? 26  DT  C "C2'" 1 
ATOM   471   C "C1'" . DT  A 1 23  ? 69.580  -96.756  46.025  1.00 112.56 ? 26  DT  C "C1'" 1 
ATOM   472   N N1    . DT  A 1 23  ? 70.193  -97.275  44.783  1.00 94.82  ? 26  DT  C N1    1 
ATOM   473   C C2    . DT  A 1 23  ? 69.353  -97.609  43.743  1.00 92.15  ? 26  DT  C C2    1 
ATOM   474   O O2    . DT  A 1 23  ? 68.135  -97.521  43.813  1.00 91.32  ? 26  DT  C O2    1 
ATOM   475   N N3    . DT  A 1 23  ? 69.992  -98.061  42.613  1.00 84.56  ? 26  DT  C N3    1 
ATOM   476   C C4    . DT  A 1 23  ? 71.354  -98.205  42.425  1.00 81.35  ? 26  DT  C C4    1 
ATOM   477   O O4    . DT  A 1 23  ? 71.782  -98.630  41.353  1.00 78.25  ? 26  DT  C O4    1 
ATOM   478   C C5    . DT  A 1 23  ? 72.176  -97.833  43.556  1.00 79.90  ? 26  DT  C C5    1 
ATOM   479   C C7    . DT  A 1 23  ? 73.662  -97.961  43.445  1.00 78.33  ? 26  DT  C C7    1 
ATOM   480   C C6    . DT  A 1 23  ? 71.563  -97.387  44.661  1.00 82.40  ? 26  DT  C C6    1 
ATOM   481   P P     . DT  A 1 24  ? 67.683  -97.490  49.778  1.00 135.61 ? 27  DT  C P     1 
ATOM   482   O OP1   . DT  A 1 24  ? 67.041  -96.743  50.894  1.00 126.03 ? 27  DT  C OP1   1 
ATOM   483   O OP2   . DT  A 1 24  ? 68.768  -98.464  50.069  1.00 127.22 ? 27  DT  C OP2   1 
ATOM   484   O "O5'" . DT  A 1 24  ? 66.533  -98.230  48.961  1.00 125.02 ? 27  DT  C "O5'" 1 
ATOM   485   C "C5'" . DT  A 1 24  ? 65.542  -97.484  48.232  1.00 113.31 ? 27  DT  C "C5'" 1 
ATOM   486   C "C4'" . DT  A 1 24  ? 65.023  -98.311  47.080  1.00 109.63 ? 27  DT  C "C4'" 1 
ATOM   487   O "O4'" . DT  A 1 24  ? 66.089  -98.594  46.140  1.00 102.22 ? 27  DT  C "O4'" 1 
ATOM   488   C "C3'" . DT  A 1 24  ? 64.434  -99.670  47.477  1.00 111.30 ? 27  DT  C "C3'" 1 
ATOM   489   O "O3'" . DT  A 1 24  ? 63.100  -99.745  46.950  1.00 121.61 ? 27  DT  C "O3'" 1 
ATOM   490   C "C2'" . DT  A 1 24  ? 65.413  -100.674 46.882  1.00 104.84 ? 27  DT  C "C2'" 1 
ATOM   491   C "C1'" . DT  A 1 24  ? 65.898  -99.913  45.668  1.00 99.05  ? 27  DT  C "C1'" 1 
ATOM   492   N N1    . DT  A 1 24  ? 67.156  -100.364 45.029  1.00 89.21  ? 27  DT  C N1    1 
ATOM   493   C C2    . DT  A 1 24  ? 67.101  -100.720 43.699  1.00 87.75  ? 27  DT  C C2    1 
ATOM   494   O O2    . DT  A 1 24  ? 66.068  -100.713 43.049  1.00 97.67  ? 27  DT  C O2    1 
ATOM   495   N N3    . DT  A 1 24  ? 68.305  -101.098 43.155  1.00 82.19  ? 27  DT  C N3    1 
ATOM   496   C C4    . DT  A 1 24  ? 69.529  -101.153 43.795  1.00 81.47  ? 27  DT  C C4    1 
ATOM   497   O O4    . DT  A 1 24  ? 70.527  -101.518 43.176  1.00 78.08  ? 27  DT  C O4    1 
ATOM   498   C C5    . DT  A 1 24  ? 69.515  -100.764 45.188  1.00 80.95  ? 27  DT  C C5    1 
ATOM   499   C C7    . DT  A 1 24  ? 70.798  -100.784 45.959  1.00 80.62  ? 27  DT  C C7    1 
ATOM   500   C C6    . DT  A 1 24  ? 68.345  -100.389 45.727  1.00 83.67  ? 27  DT  C C6    1 
ATOM   501   P P     . DT  A 1 25  ? 62.112  -100.955 47.343  1.00 129.68 ? 28  DT  C P     1 
ATOM   502   O OP1   . DT  A 1 25  ? 60.710  -100.459 47.267  1.00 117.52 ? 28  DT  C OP1   1 
ATOM   503   O OP2   . DT  A 1 25  ? 62.607  -101.566 48.608  1.00 122.37 ? 28  DT  C OP2   1 
ATOM   504   O "O5'" . DT  A 1 25  ? 62.287  -101.964 46.121  1.00 124.63 ? 28  DT  C "O5'" 1 
ATOM   505   C "C5'" . DT  A 1 25  ? 62.836  -101.515 44.864  1.00 117.62 ? 28  DT  C "C5'" 1 
ATOM   506   C "C4'" . DT  A 1 25  ? 62.325  -102.339 43.706  1.00 114.90 ? 28  DT  C "C4'" 1 
ATOM   507   O "O4'" . DT  A 1 25  ? 63.448  -102.683 42.862  1.00 110.59 ? 28  DT  C "O4'" 1 
ATOM   508   C "C3'" . DT  A 1 25  ? 61.666  -103.667 44.072  1.00 111.26 ? 28  DT  C "C3'" 1 
ATOM   509   O "O3'" . DT  A 1 25  ? 60.679  -104.019 43.098  1.00 108.51 ? 28  DT  C "O3'" 1 
ATOM   510   C "C2'" . DT  A 1 25  ? 62.833  -104.636 44.059  1.00 109.83 ? 28  DT  C "C2'" 1 
ATOM   511   C "C1'" . DT  A 1 25  ? 63.739  -104.073 42.962  1.00 102.00 ? 28  DT  C "C1'" 1 
ATOM   512   N N1    . DT  A 1 25  ? 65.196  -104.216 43.189  1.00 87.87  ? 28  DT  C N1    1 
ATOM   513   C C2    . DT  A 1 25  ? 65.986  -104.580 42.119  1.00 83.76  ? 28  DT  C C2    1 
ATOM   514   O O2    . DT  A 1 25  ? 65.540  -104.795 41.002  1.00 77.92  ? 28  DT  C O2    1 
ATOM   515   N N3    . DT  A 1 25  ? 67.327  -104.689 42.406  1.00 78.26  ? 28  DT  C N3    1 
ATOM   516   C C4    . DT  A 1 25  ? 67.939  -104.478 43.630  1.00 79.38  ? 28  DT  C C4    1 
ATOM   517   O O4    . DT  A 1 25  ? 69.158  -104.612 43.737  1.00 68.64  ? 28  DT  C O4    1 
ATOM   518   C C5    . DT  A 1 25  ? 67.048  -104.098 44.707  1.00 81.11  ? 28  DT  C C5    1 
ATOM   519   C C7    . DT  A 1 25  ? 67.622  -103.838 46.065  1.00 80.97  ? 28  DT  C C7    1 
ATOM   520   C C6    . DT  A 1 25  ? 65.741  -103.983 44.435  1.00 81.16  ? 28  DT  C C6    1 
ATOM   521   O "O5'" . DA  B 2 1   ? 74.952  -107.325 32.890  1.00 121.90 ? 29  DA  D "O5'" 1 
ATOM   522   C "C5'" . DA  B 2 1   ? 74.304  -106.527 33.899  1.00 117.01 ? 29  DA  D "C5'" 1 
ATOM   523   C "C4'" . DA  B 2 1   ? 72.853  -106.931 34.024  1.00 113.05 ? 29  DA  D "C4'" 1 
ATOM   524   O "O4'" . DA  B 2 1   ? 72.545  -107.174 35.418  1.00 104.05 ? 29  DA  D "O4'" 1 
ATOM   525   C "C3'" . DA  B 2 1   ? 71.846  -105.880 33.557  1.00 112.11 ? 29  DA  D "C3'" 1 
ATOM   526   O "O3'" . DA  B 2 1   ? 70.704  -106.501 32.955  1.00 116.60 ? 29  DA  D "O3'" 1 
ATOM   527   C "C2'" . DA  B 2 1   ? 71.449  -105.200 34.852  1.00 108.91 ? 29  DA  D "C2'" 1 
ATOM   528   C "C1'" . DA  B 2 1   ? 71.437  -106.379 35.805  1.00 95.32  ? 29  DA  D "C1'" 1 
ATOM   529   N N9    . DA  B 2 1   ? 71.604  -106.038 37.216  1.00 83.59  ? 29  DA  D N9    1 
ATOM   530   C C8    . DA  B 2 1   ? 72.784  -105.852 37.895  1.00 81.08  ? 29  DA  D C8    1 
ATOM   531   N N7    . DA  B 2 1   ? 72.624  -105.560 39.164  1.00 74.55  ? 29  DA  D N7    1 
ATOM   532   C C5    . DA  B 2 1   ? 71.247  -105.555 39.334  1.00 71.51  ? 29  DA  D C5    1 
ATOM   533   C C6    . DA  B 2 1   ? 70.432  -105.315 40.456  1.00 74.38  ? 29  DA  D C6    1 
ATOM   534   N N6    . DA  B 2 1   ? 70.911  -105.015 41.666  1.00 76.52  ? 29  DA  D N6    1 
ATOM   535   N N1    . DA  B 2 1   ? 69.092  -105.390 40.289  1.00 70.03  ? 29  DA  D N1    1 
ATOM   536   C C2    . DA  B 2 1   ? 68.613  -105.688 39.072  1.00 71.67  ? 29  DA  D C2    1 
ATOM   537   N N3    . DA  B 2 1   ? 69.278  -105.936 37.941  1.00 72.36  ? 29  DA  D N3    1 
ATOM   538   C C4    . DA  B 2 1   ? 70.605  -105.851 38.143  1.00 74.45  ? 29  DA  D C4    1 
ATOM   539   P P     . DA  B 2 2   ? 69.797  -105.674 31.926  1.00 121.26 ? 30  DA  D P     1 
ATOM   540   O OP1   . DA  B 2 2   ? 69.853  -106.356 30.609  1.00 110.96 ? 30  DA  D OP1   1 
ATOM   541   O OP2   . DA  B 2 2   ? 70.170  -104.241 32.041  1.00 127.66 ? 30  DA  D OP2   1 
ATOM   542   O "O5'" . DA  B 2 2   ? 68.314  -105.853 32.481  1.00 112.22 ? 30  DA  D "O5'" 1 
ATOM   543   C "C5'" . DA  B 2 2   ? 68.041  -105.867 33.891  1.00 118.39 ? 30  DA  D "C5'" 1 
ATOM   544   C "C4'" . DA  B 2 2   ? 66.781  -105.095 34.203  1.00 121.42 ? 30  DA  D "C4'" 1 
ATOM   545   O "O4'" . DA  B 2 2   ? 66.864  -104.599 35.560  1.00 121.31 ? 30  DA  D "O4'" 1 
ATOM   546   C "C3'" . DA  B 2 2   ? 66.521  -103.862 33.338  1.00 118.09 ? 30  DA  D "C3'" 1 
ATOM   547   O "O3'" . DA  B 2 2   ? 65.102  -103.673 33.232  1.00 119.46 ? 30  DA  D "O3'" 1 
ATOM   548   C "C2'" . DA  B 2 2   ? 67.230  -102.765 34.110  1.00 117.32 ? 30  DA  D "C2'" 1 
ATOM   549   C "C1'" . DA  B 2 2   ? 67.002  -103.181 35.561  1.00 113.14 ? 30  DA  D "C1'" 1 
ATOM   550   N N9    . DA  B 2 2   ? 68.073  -102.837 36.498  1.00 99.51  ? 30  DA  D N9    1 
ATOM   551   C C8    . DA  B 2 2   ? 69.421  -102.719 36.253  1.00 92.56  ? 30  DA  D C8    1 
ATOM   552   N N7    . DA  B 2 2   ? 70.126  -102.414 37.316  1.00 85.42  ? 30  DA  D N7    1 
ATOM   553   C C5    . DA  B 2 2   ? 69.181  -102.323 38.328  1.00 86.10  ? 30  DA  D C5    1 
ATOM   554   C C6    . DA  B 2 2   ? 69.288  -102.032 39.703  1.00 84.83  ? 30  DA  D C6    1 
ATOM   555   N N6    . DA  B 2 2   ? 70.443  -101.757 40.314  1.00 80.25  ? 30  DA  D N6    1 
ATOM   556   N N1    . DA  B 2 2   ? 68.152  -102.026 40.434  1.00 86.23  ? 30  DA  D N1    1 
ATOM   557   C C2    . DA  B 2 2   ? 66.991  -102.299 39.820  1.00 92.75  ? 30  DA  D C2    1 
ATOM   558   N N3    . DA  B 2 2   ? 66.764  -102.593 38.539  1.00 90.90  ? 30  DA  D N3    1 
ATOM   559   C C4    . DA  B 2 2   ? 67.913  -102.585 37.839  1.00 90.65  ? 30  DA  D C4    1 
ATOM   560   P P     . DA  B 2 3   ? 64.501  -102.382 32.505  1.00 121.82 ? 31  DA  D P     1 
ATOM   561   O OP1   . DA  B 2 3   ? 63.184  -102.741 31.917  1.00 111.52 ? 31  DA  D OP1   1 
ATOM   562   O OP2   . DA  B 2 3   ? 65.558  -101.808 31.636  1.00 121.76 ? 31  DA  D OP2   1 
ATOM   563   O "O5'" . DA  B 2 3   ? 64.198  -101.411 33.728  1.00 110.88 ? 31  DA  D "O5'" 1 
ATOM   564   C "C5'" . DA  B 2 3   ? 63.029  -101.629 34.529  1.00 108.49 ? 31  DA  D "C5'" 1 
ATOM   565   C "C4'" . DA  B 2 3   ? 63.081  -100.773 35.772  1.00 109.08 ? 31  DA  D "C4'" 1 
ATOM   566   O "O4'" . DA  B 2 3   ? 64.419  -100.776 36.323  1.00 105.54 ? 31  DA  D "O4'" 1 
ATOM   567   C "C3'" . DA  B 2 3   ? 62.706  -99.302  35.559  1.00 109.30 ? 31  DA  D "C3'" 1 
ATOM   568   O "O3'" . DA  B 2 3   ? 61.516  -99.043  36.321  1.00 111.16 ? 31  DA  D "O3'" 1 
ATOM   569   C "C2'" . DA  B 2 3   ? 63.964  -98.540  35.963  1.00 107.13 ? 31  DA  D "C2'" 1 
ATOM   570   C "C1'" . DA  B 2 3   ? 64.651  -99.511  36.903  1.00 100.57 ? 31  DA  D "C1'" 1 
ATOM   571   N N9    . DA  B 2 3   ? 66.099  -99.350  37.072  1.00 93.92  ? 31  DA  D N9    1 
ATOM   572   C C8    . DA  B 2 3   ? 67.085  -99.449  36.120  1.00 91.08  ? 31  DA  D C8    1 
ATOM   573   N N7    . DA  B 2 3   ? 68.296  -99.271  36.592  1.00 81.71  ? 31  DA  D N7    1 
ATOM   574   C C5    . DA  B 2 3   ? 68.096  -99.049  37.948  1.00 82.77  ? 31  DA  D C5    1 
ATOM   575   C C6    . DA  B 2 3   ? 68.987  -98.793  39.008  1.00 82.57  ? 31  DA  D C6    1 
ATOM   576   N N6    . DA  B 2 3   ? 70.312  -98.718  38.861  1.00 81.10  ? 31  DA  D N6    1 
ATOM   577   N N1    . DA  B 2 3   ? 68.462  -98.617  40.242  1.00 81.14  ? 31  DA  D N1    1 
ATOM   578   C C2    . DA  B 2 3   ? 67.130  -98.697  40.391  1.00 82.01  ? 31  DA  D C2    1 
ATOM   579   N N3    . DA  B 2 3   ? 66.192  -98.934  39.474  1.00 84.81  ? 31  DA  D N3    1 
ATOM   580   C C4    . DA  B 2 3   ? 66.747  -99.101  38.259  1.00 87.99  ? 31  DA  D C4    1 
ATOM   581   P P     . DC  B 2 4   ? 60.711  -97.657  36.175  1.00 112.23 ? 32  DC  D P     1 
ATOM   582   O OP1   . DC  B 2 4   ? 59.268  -97.962  35.993  1.00 106.26 ? 32  DC  D OP1   1 
ATOM   583   O OP2   . DC  B 2 4   ? 61.415  -96.820  35.166  1.00 109.10 ? 32  DC  D OP2   1 
ATOM   584   O "O5'" . DC  B 2 4   ? 60.852  -97.037  37.636  1.00 107.87 ? 32  DC  D "O5'" 1 
ATOM   585   C "C5'" . DC  B 2 4   ? 62.146  -96.996  38.256  1.00 103.91 ? 32  DC  D "C5'" 1 
ATOM   586   C "C4'" . DC  B 2 4   ? 62.047  -96.728  39.738  1.00 105.46 ? 32  DC  D "C4'" 1 
ATOM   587   O "O4'" . DC  B 2 4   ? 63.370  -96.880  40.304  1.00 102.98 ? 32  DC  D "O4'" 1 
ATOM   588   C "C3'" . DC  B 2 4   ? 61.633  -95.309  40.098  1.00 106.30 ? 32  DC  D "C3'" 1 
ATOM   589   O "O3'" . DC  B 2 4   ? 61.085  -95.289  41.421  1.00 115.05 ? 32  DC  D "O3'" 1 
ATOM   590   C "C2'" . DC  B 2 4   ? 62.955  -94.572  40.014  1.00 104.03 ? 32  DC  D "C2'" 1 
ATOM   591   C "C1'" . DC  B 2 4   ? 63.939  -95.601  40.564  1.00 95.38  ? 32  DC  D "C1'" 1 
ATOM   592   N N1    . DC  B 2 4   ? 65.280  -95.573  39.950  1.00 87.81  ? 32  DC  D N1    1 
ATOM   593   C C2    . DC  B 2 4   ? 66.398  -95.352  40.765  1.00 88.34  ? 32  DC  D C2    1 
ATOM   594   O O2    . DC  B 2 4   ? 66.228  -95.174  41.982  1.00 94.16  ? 32  DC  D O2    1 
ATOM   595   N N3    . DC  B 2 4   ? 67.633  -95.335  40.204  1.00 80.36  ? 32  DC  D N3    1 
ATOM   596   C C4    . DC  B 2 4   ? 67.771  -95.535  38.889  1.00 80.73  ? 32  DC  D C4    1 
ATOM   597   N N4    . DC  B 2 4   ? 69.004  -95.515  38.373  1.00 76.15  ? 32  DC  D N4    1 
ATOM   598   C C5    . DC  B 2 4   ? 66.648  -95.755  38.039  1.00 79.70  ? 32  DC  D C5    1 
ATOM   599   C C6    . DC  B 2 4   ? 65.435  -95.772  38.606  1.00 83.07  ? 32  DC  D C6    1 
ATOM   600   P P     . DG  B 2 5   ? 60.383  -93.963  41.993  1.00 130.14 ? 33  DG  D P     1 
ATOM   601   O OP1   . DG  B 2 5   ? 58.989  -94.307  42.379  1.00 121.75 ? 33  DG  D OP1   1 
ATOM   602   O OP2   . DG  B 2 5   ? 60.624  -92.856  41.025  1.00 131.46 ? 33  DG  D OP2   1 
ATOM   603   O "O5'" . DG  B 2 5   ? 61.194  -93.678  43.338  1.00 124.12 ? 33  DG  D "O5'" 1 
ATOM   604   C "C5'" . DG  B 2 5   ? 62.633  -93.792  43.380  1.00 122.56 ? 33  DG  D "C5'" 1 
ATOM   605   C "C4'" . DG  B 2 5   ? 63.243  -92.775  44.316  1.00 121.21 ? 33  DG  D "C4'" 1 
ATOM   606   O "O4'" . DG  B 2 5   ? 64.581  -92.471  43.858  1.00 115.73 ? 33  DG  D "O4'" 1 
ATOM   607   C "C3'" . DG  B 2 5   ? 62.542  -91.423  44.354  1.00 121.51 ? 33  DG  D "C3'" 1 
ATOM   608   O "O3'" . DG  B 2 5   ? 62.880  -90.775  45.591  1.00 131.55 ? 33  DG  D "O3'" 1 
ATOM   609   C "C2'" . DG  B 2 5   ? 63.126  -90.743  43.129  1.00 115.38 ? 33  DG  D "C2'" 1 
ATOM   610   C "C1'" . DG  B 2 5   ? 64.577  -91.238  43.138  1.00 108.46 ? 33  DG  D "C1'" 1 
ATOM   611   N N9    . DG  B 2 5   ? 65.172  -91.486  41.826  1.00 96.78  ? 33  DG  D N9    1 
ATOM   612   C C8    . DG  B 2 5   ? 64.511  -91.765  40.653  1.00 95.07  ? 33  DG  D C8    1 
ATOM   613   N N7    . DG  B 2 5   ? 65.317  -91.949  39.641  1.00 87.89  ? 33  DG  D N7    1 
ATOM   614   C C5    . DG  B 2 5   ? 66.586  -91.784  40.178  1.00 83.79  ? 33  DG  D C5    1 
ATOM   615   C C6    . DG  B 2 5   ? 67.864  -91.869  39.561  1.00 84.51  ? 33  DG  D C6    1 
ATOM   616   O O6    . DG  B 2 5   ? 68.135  -92.116  38.380  1.00 85.74  ? 33  DG  D O6    1 
ATOM   617   N N1    . DG  B 2 5   ? 68.888  -91.627  40.471  1.00 81.19  ? 33  DG  D N1    1 
ATOM   618   C C2    . DG  B 2 5   ? 68.709  -91.341  41.804  1.00 83.78  ? 33  DG  D C2    1 
ATOM   619   N N2    . DG  B 2 5   ? 69.826  -91.138  42.521  1.00 85.48  ? 33  DG  D N2    1 
ATOM   620   N N3    . DG  B 2 5   ? 67.524  -91.266  42.393  1.00 78.55  ? 33  DG  D N3    1 
ATOM   621   C C4    . DG  B 2 5   ? 66.515  -91.496  41.526  1.00 84.47  ? 33  DG  D C4    1 
ATOM   622   P P     . DA  B 2 6   ? 61.899  -89.678  46.251  1.00 142.85 ? 34  DA  D P     1 
ATOM   623   O OP1   . DA  B 2 6   ? 61.533  -90.139  47.616  1.00 138.77 ? 34  DA  D OP1   1 
ATOM   624   O OP2   . DA  B 2 6   ? 60.826  -89.357  45.271  1.00 138.43 ? 34  DA  D OP2   1 
ATOM   625   O "O5'" . DA  B 2 6   ? 62.852  -88.413  46.425  1.00 142.50 ? 34  DA  D "O5'" 1 
ATOM   626   C "C5'" . DA  B 2 6   ? 63.720  -87.998  45.354  1.00 140.64 ? 34  DA  D "C5'" 1 
ATOM   627   C "C4'" . DA  B 2 6   ? 65.031  -87.478  45.894  1.00 136.43 ? 34  DA  D "C4'" 1 
ATOM   628   O "O4'" . DA  B 2 6   ? 66.109  -87.979  45.071  1.00 125.75 ? 34  DA  D "O4'" 1 
ATOM   629   C "C3'" . DA  B 2 6   ? 65.159  -85.959  45.846  1.00 137.95 ? 34  DA  D "C3'" 1 
ATOM   630   O "O3'" . DA  B 2 6   ? 66.025  -85.452  46.865  1.00 150.18 ? 34  DA  D "O3'" 1 
ATOM   631   C "C2'" . DA  B 2 6   ? 65.739  -85.710  44.467  1.00 131.44 ? 34  DA  D "C2'" 1 
ATOM   632   C "C1'" . DA  B 2 6   ? 66.539  -86.974  44.159  1.00 119.00 ? 34  DA  D "C1'" 1 
ATOM   633   N N9    . DA  B 2 6   ? 66.320  -87.466  42.797  1.00 101.54 ? 34  DA  D N9    1 
ATOM   634   C C8    . DA  B 2 6   ? 65.117  -87.639  42.156  1.00 93.35  ? 34  DA  D C8    1 
ATOM   635   N N7    . DA  B 2 6   ? 65.233  -88.046  40.916  1.00 88.56  ? 34  DA  D N7    1 
ATOM   636   C C5    . DA  B 2 6   ? 66.604  -88.138  40.722  1.00 86.08  ? 34  DA  D C5    1 
ATOM   637   C C6    . DA  B 2 6   ? 67.380  -88.514  39.610  1.00 85.00  ? 34  DA  D C6    1 
ATOM   638   N N6    . DA  B 2 6   ? 66.860  -88.895  38.439  1.00 82.49  ? 34  DA  D N6    1 
ATOM   639   N N1    . DA  B 2 6   ? 68.726  -88.497  39.746  1.00 82.07  ? 34  DA  D N1    1 
ATOM   640   C C2    . DA  B 2 6   ? 69.246  -88.120  40.924  1.00 85.53  ? 34  DA  D C2    1 
ATOM   641   N N3    . DA  B 2 6   ? 68.620  -87.737  42.038  1.00 87.51  ? 34  DA  D N3    1 
ATOM   642   C C4    . DA  B 2 6   ? 67.286  -87.770  41.868  1.00 88.98  ? 34  DA  D C4    1 
ATOM   643   P P     . DC  B 2 7   ? 66.146  -83.870  47.095  1.00 155.56 ? 35  DC  D P     1 
ATOM   644   O OP1   . DC  B 2 7   ? 66.672  -83.645  48.466  1.00 156.11 ? 35  DC  D OP1   1 
ATOM   645   O OP2   . DC  B 2 7   ? 64.861  -83.242  46.679  1.00 136.07 ? 35  DC  D OP2   1 
ATOM   646   O "O5'" . DC  B 2 7   ? 67.296  -83.447  46.075  1.00 149.12 ? 35  DC  D "O5'" 1 
ATOM   647   C "C5'" . DC  B 2 7   ? 68.657  -83.875  46.276  1.00 137.33 ? 35  DC  D "C5'" 1 
ATOM   648   C "C4'" . DC  B 2 7   ? 69.471  -83.644  45.024  1.00 137.96 ? 35  DC  D "C4'" 1 
ATOM   649   O "O4'" . DC  B 2 7   ? 68.935  -84.422  43.933  1.00 133.97 ? 35  DC  D "O4'" 1 
ATOM   650   C "C3'" . DC  B 2 7   ? 69.509  -82.197  44.519  1.00 139.16 ? 35  DC  D "C3'" 1 
ATOM   651   O "O3'" . DC  B 2 7   ? 70.744  -81.577  44.910  1.00 147.80 ? 35  DC  D "O3'" 1 
ATOM   652   C "C2'" . DC  B 2 7   ? 69.353  -82.320  43.008  1.00 133.89 ? 35  DC  D "C2'" 1 
ATOM   653   C "C1'" . DC  B 2 7   ? 69.366  -83.814  42.732  1.00 123.18 ? 35  DC  D "C1'" 1 
ATOM   654   N N1    . DC  B 2 7   ? 68.465  -84.242  41.646  1.00 107.55 ? 35  DC  D N1    1 
ATOM   655   C C2    . DC  B 2 7   ? 69.020  -84.723  40.454  1.00 99.79  ? 35  DC  D C2    1 
ATOM   656   O O2    . DC  B 2 7   ? 70.255  -84.789  40.349  1.00 96.12  ? 35  DC  D O2    1 
ATOM   657   N N3    . DC  B 2 7   ? 68.198  -85.111  39.450  1.00 90.13  ? 35  DC  D N3    1 
ATOM   658   C C4    . DC  B 2 7   ? 66.874  -85.025  39.602  1.00 91.45  ? 35  DC  D C4    1 
ATOM   659   N N4    . DC  B 2 7   ? 66.101  -85.420  38.588  1.00 91.46  ? 35  DC  D N4    1 
ATOM   660   C C5    . DC  B 2 7   ? 66.283  -84.529  40.801  1.00 93.17  ? 35  DC  D C5    1 
ATOM   661   C C6    . DC  B 2 7   ? 67.107  -84.148  41.786  1.00 100.04 ? 35  DC  D C6    1 
ATOM   662   P P     . DA  B 2 8   ? 71.275  -80.242  44.181  1.00 151.98 ? 36  DA  D P     1 
ATOM   663   O OP1   . DA  B 2 8   ? 71.925  -79.389  45.209  1.00 158.84 ? 36  DA  D OP1   1 
ATOM   664   O OP2   . DA  B 2 8   ? 70.172  -79.683  43.351  1.00 143.12 ? 36  DA  D OP2   1 
ATOM   665   O "O5'" . DA  B 2 8   ? 72.439  -80.788  43.239  1.00 139.18 ? 36  DA  D "O5'" 1 
ATOM   666   C "C5'" . DA  B 2 8   ? 73.109  -79.924  42.303  1.00 131.24 ? 36  DA  D "C5'" 1 
ATOM   667   C "C4'" . DA  B 2 8   ? 73.131  -80.559  40.931  1.00 127.89 ? 36  DA  D "C4'" 1 
ATOM   668   O "O4'" . DA  B 2 8   ? 71.875  -81.217  40.676  1.00 120.42 ? 36  DA  D "O4'" 1 
ATOM   669   C "C3'" . DA  B 2 8   ? 73.315  -79.579  39.772  1.00 127.81 ? 36  DA  D "C3'" 1 
ATOM   670   O "O3'" . DA  B 2 8   ? 74.667  -79.590  39.311  1.00 133.82 ? 36  DA  D "O3'" 1 
ATOM   671   C "C2'" . DA  B 2 8   ? 72.363  -80.076  38.692  1.00 119.50 ? 36  DA  D "C2'" 1 
ATOM   672   C "C1'" . DA  B 2 8   ? 71.728  -81.326  39.275  1.00 110.34 ? 36  DA  D "C1'" 1 
ATOM   673   N N9    . DA  B 2 8   ? 70.305  -81.470  38.982  1.00 99.14  ? 36  DA  D N9    1 
ATOM   674   C C8    . DA  B 2 8   ? 69.234  -81.190  39.797  1.00 96.64  ? 36  DA  D C8    1 
ATOM   675   N N7    . DA  B 2 8   ? 68.070  -81.433  39.243  1.00 87.62  ? 36  DA  D N7    1 
ATOM   676   C C5    . DA  B 2 8   ? 68.396  -81.902  37.978  1.00 87.91  ? 36  DA  D C5    1 
ATOM   677   C C6    . DA  B 2 8   ? 67.606  -82.332  36.898  1.00 85.63  ? 36  DA  D C6    1 
ATOM   678   N N6    . DA  B 2 8   ? 66.271  -82.360  36.923  1.00 82.14  ? 36  DA  D N6    1 
ATOM   679   N N1    . DA  B 2 8   ? 68.242  -82.738  35.776  1.00 85.56  ? 36  DA  D N1    1 
ATOM   680   C C2    . DA  B 2 8   ? 69.584  -82.710  35.752  1.00 86.87  ? 36  DA  D C2    1 
ATOM   681   N N3    . DA  B 2 8   ? 70.435  -82.327  36.705  1.00 85.69  ? 36  DA  D N3    1 
ATOM   682   C C4    . DA  B 2 8   ? 69.769  -81.931  37.804  1.00 92.20  ? 36  DA  D C4    1 
ATOM   683   P P     . DT  B 2 9   ? 75.193  -78.402  38.384  1.00 142.09 ? 37  DT  D P     1 
ATOM   684   O OP1   . DT  B 2 9   ? 76.670  -78.541  38.247  1.00 132.94 ? 37  DT  D OP1   1 
ATOM   685   O OP2   . DT  B 2 9   ? 74.613  -77.133  38.894  1.00 141.26 ? 37  DT  D OP2   1 
ATOM   686   O "O5'" . DT  B 2 9   ? 74.520  -78.719  36.976  1.00 128.40 ? 37  DT  D "O5'" 1 
ATOM   687   C "C5'" . DT  B 2 9   ? 75.080  -79.725  36.118  1.00 120.58 ? 37  DT  D "C5'" 1 
ATOM   688   C "C4'" . DT  B 2 9   ? 74.287  -79.821  34.837  1.00 114.73 ? 37  DT  D "C4'" 1 
ATOM   689   O "O4'" . DT  B 2 9   ? 72.891  -80.041  35.131  1.00 107.37 ? 37  DT  D "O4'" 1 
ATOM   690   C "C3'" . DT  B 2 9   ? 74.338  -78.577  33.943  1.00 111.31 ? 37  DT  D "C3'" 1 
ATOM   691   O "O3'" . DT  B 2 9   ? 75.033  -78.909  32.735  1.00 118.78 ? 37  DT  D "O3'" 1 
ATOM   692   C "C2'" . DT  B 2 9   ? 72.875  -78.215  33.719  1.00 103.76 ? 37  DT  D "C2'" 1 
ATOM   693   C "C1'" . DT  B 2 9   ? 72.161  -79.506  34.054  1.00 96.04  ? 37  DT  D "C1'" 1 
ATOM   694   N N1    . DT  B 2 9   ? 70.757  -79.370  34.478  1.00 89.89  ? 37  DT  D N1    1 
ATOM   695   C C2    . DT  B 2 9   ? 69.777  -79.844  33.634  1.00 89.69  ? 37  DT  D C2    1 
ATOM   696   O O2    . DT  B 2 9   ? 70.020  -80.359  32.554  1.00 97.91  ? 37  DT  D O2    1 
ATOM   697   N N3    . DT  B 2 9   ? 68.495  -79.689  34.100  1.00 83.90  ? 37  DT  D N3    1 
ATOM   698   C C4    . DT  B 2 9   ? 68.106  -79.121  35.298  1.00 84.81  ? 37  DT  D C4    1 
ATOM   699   O O4    . DT  B 2 9   ? 66.914  -79.046  35.581  1.00 83.97  ? 37  DT  D O4    1 
ATOM   700   C C5    . DT  B 2 9   ? 69.186  -78.648  36.136  1.00 83.13  ? 37  DT  D C5    1 
ATOM   701   C C7    . DT  B 2 9   ? 68.859  -78.022  37.455  1.00 83.72  ? 37  DT  D C7    1 
ATOM   702   C C6    . DT  B 2 9   ? 70.441  -78.799  35.692  1.00 84.22  ? 37  DT  D C6    1 
ATOM   703   P P     . DT  B 2 10  ? 75.195  -77.827  31.573  1.00 119.87 ? 38  DT  D P     1 
ATOM   704   O OP1   . DT  B 2 10  ? 76.412  -78.170  30.789  1.00 112.88 ? 38  DT  D OP1   1 
ATOM   705   O OP2   . DT  B 2 10  ? 75.068  -76.480  32.185  1.00 127.27 ? 38  DT  D OP2   1 
ATOM   706   O "O5'" . DT  B 2 10  ? 73.915  -78.088  30.664  1.00 104.66 ? 38  DT  D "O5'" 1 
ATOM   707   C "C5'" . DT  B 2 10  ? 74.042  -78.768  29.407  1.00 97.89  ? 38  DT  D "C5'" 1 
ATOM   708   C "C4'" . DT  B 2 10  ? 72.677  -79.099  28.850  1.00 98.39  ? 38  DT  D "C4'" 1 
ATOM   709   O "O4'" . DT  B 2 10  ? 71.657  -78.959  29.870  1.00 96.54  ? 38  DT  D "O4'" 1 
ATOM   710   C "C3'" . DT  B 2 10  ? 72.223  -78.225  27.676  1.00 98.27  ? 38  DT  D "C3'" 1 
ATOM   711   O "O3'" . DT  B 2 10  ? 71.955  -79.077  26.561  1.00 104.89 ? 38  DT  D "O3'" 1 
ATOM   712   C "C2'" . DT  B 2 10  ? 70.970  -77.534  28.196  1.00 98.29  ? 38  DT  D "C2'" 1 
ATOM   713   C "C1'" . DT  B 2 10  ? 70.477  -78.527  29.223  1.00 91.38  ? 38  DT  D "C1'" 1 
ATOM   714   N N1    . DT  B 2 10  ? 69.543  -78.004  30.253  1.00 84.43  ? 38  DT  D N1    1 
ATOM   715   C C2    . DT  B 2 10  ? 68.200  -78.296  30.127  1.00 88.13  ? 38  DT  D C2    1 
ATOM   716   O O2    . DT  B 2 10  ? 67.740  -78.946  29.201  1.00 94.93  ? 38  DT  D O2    1 
ATOM   717   N N3    . DT  B 2 10  ? 67.409  -77.790  31.128  1.00 84.67  ? 38  DT  D N3    1 
ATOM   718   C C4    . DT  B 2 10  ? 67.815  -77.037  32.213  1.00 85.07  ? 38  DT  D C4    1 
ATOM   719   O O4    . DT  B 2 10  ? 66.985  -76.650  33.033  1.00 83.80  ? 38  DT  D O4    1 
ATOM   720   C C5    . DT  B 2 10  ? 69.235  -76.774  32.286  1.00 81.59  ? 38  DT  D C5    1 
ATOM   721   C C7    . DT  B 2 10  ? 69.768  -75.979  33.437  1.00 82.02  ? 38  DT  D C7    1 
ATOM   722   C C6    . DT  B 2 10  ? 70.018  -77.266  31.316  1.00 78.19  ? 38  DT  D C6    1 
ATOM   723   P P     . DT  B 2 11  ? 71.744  -78.463  25.099  1.00 112.58 ? 39  DT  D P     1 
ATOM   724   O OP1   . DT  B 2 11  ? 72.726  -79.106  24.185  1.00 112.52 ? 39  DT  D OP1   1 
ATOM   725   O OP2   . DT  B 2 11  ? 71.723  -76.980  25.225  1.00 118.61 ? 39  DT  D OP2   1 
ATOM   726   O "O5'" . DT  B 2 11  ? 70.286  -78.975  24.705  1.00 99.82  ? 39  DT  D "O5'" 1 
ATOM   727   C "C5'" . DT  B 2 11  ? 69.168  -78.626  25.535  1.00 95.79  ? 39  DT  D "C5'" 1 
ATOM   728   C "C4'" . DT  B 2 11  ? 67.858  -79.044  24.910  1.00 95.10  ? 39  DT  D "C4'" 1 
ATOM   729   O "O4'" . DT  B 2 11  ? 66.799  -78.862  25.878  1.00 97.29  ? 39  DT  D "O4'" 1 
ATOM   730   C "C3'" . DT  B 2 11  ? 67.431  -78.217  23.708  1.00 89.80  ? 39  DT  D "C3'" 1 
ATOM   731   O "O3'" . DT  B 2 11  ? 66.552  -78.979  22.883  1.00 91.03  ? 39  DT  D "O3'" 1 
ATOM   732   C "C2'" . DT  B 2 11  ? 66.693  -77.054  24.346  1.00 94.29  ? 39  DT  D "C2'" 1 
ATOM   733   C "C1'" . DT  B 2 11  ? 66.092  -77.651  25.618  1.00 87.61  ? 39  DT  D "C1'" 1 
ATOM   734   N N1    . DT  B 2 11  ? 66.201  -76.796  26.823  1.00 78.95  ? 39  DT  D N1    1 
ATOM   735   C C2    . DT  B 2 11  ? 65.083  -76.612  27.609  1.00 80.89  ? 39  DT  D C2    1 
ATOM   736   O O2    . DT  B 2 11  ? 63.997  -77.111  27.354  1.00 85.96  ? 39  DT  D O2    1 
ATOM   737   N N3    . DT  B 2 11  ? 65.282  -75.813  28.709  1.00 76.01  ? 39  DT  D N3    1 
ATOM   738   C C4    . DT  B 2 11  ? 66.461  -75.201  29.094  1.00 74.95  ? 39  DT  D C4    1 
ATOM   739   O O4    . DT  B 2 11  ? 66.490  -74.513  30.112  1.00 72.51  ? 39  DT  D O4    1 
ATOM   740   C C5    . DT  B 2 11  ? 67.592  -75.440  28.225  1.00 73.27  ? 39  DT  D C5    1 
ATOM   741   C C7    . DT  B 2 11  ? 68.911  -74.818  28.561  1.00 72.94  ? 39  DT  D C7    1 
ATOM   742   C C6    . DT  B 2 11  ? 67.408  -76.217  27.151  1.00 71.76  ? 39  DT  D C6    1 
ATOM   743   P P     . DC  B 2 12  ? 66.208  -78.471  21.413  1.00 105.18 ? 40  DC  D P     1 
ATOM   744   O OP1   . DC  B 2 12  ? 65.562  -79.583  20.663  1.00 101.91 ? 40  DC  D OP1   1 
ATOM   745   O OP2   . DC  B 2 12  ? 67.427  -77.818  20.865  1.00 102.60 ? 40  DC  D OP2   1 
ATOM   746   O "O5'" . DC  B 2 12  ? 65.055  -77.403  21.667  1.00 104.42 ? 40  DC  D "O5'" 1 
ATOM   747   C "C5'" . DC  B 2 12  ? 63.810  -77.793  22.277  1.00 106.16 ? 40  DC  D "C5'" 1 
ATOM   748   C "C4'" . DC  B 2 12  ? 62.884  -76.604  22.395  1.00 108.45 ? 40  DC  D "C4'" 1 
ATOM   749   O "O4'" . DC  B 2 12  ? 63.164  -75.891  23.627  1.00 105.88 ? 40  DC  D "O4'" 1 
ATOM   750   C "C3'" . DC  B 2 12  ? 63.019  -75.572  21.274  1.00 108.27 ? 40  DC  D "C3'" 1 
ATOM   751   O "O3'" . DC  B 2 12  ? 61.745  -75.012  20.946  1.00 110.29 ? 40  DC  D "O3'" 1 
ATOM   752   C "C2'" . DC  B 2 12  ? 63.913  -74.512  21.888  1.00 105.39 ? 40  DC  D "C2'" 1 
ATOM   753   C "C1'" . DC  B 2 12  ? 63.432  -74.529  23.329  1.00 98.66  ? 40  DC  D "C1'" 1 
ATOM   754   N N1    . DC  B 2 12  ? 64.366  -74.012  24.344  1.00 87.96  ? 40  DC  D N1    1 
ATOM   755   C C2    . DC  B 2 12  ? 63.863  -73.701  25.612  1.00 86.19  ? 40  DC  D C2    1 
ATOM   756   O O2    . DC  B 2 12  ? 62.657  -73.890  25.844  1.00 79.28  ? 40  DC  D O2    1 
ATOM   757   N N3    . DC  B 2 12  ? 64.702  -73.208  26.554  1.00 83.31  ? 40  DC  D N3    1 
ATOM   758   C C4    . DC  B 2 12  ? 65.994  -73.022  26.266  1.00 85.58  ? 40  DC  D C4    1 
ATOM   759   N N4    . DC  B 2 12  ? 66.785  -72.536  27.224  1.00 89.30  ? 40  DC  D N4    1 
ATOM   760   C C5    . DC  B 2 12  ? 66.531  -73.326  24.980  1.00 83.88  ? 40  DC  D C5    1 
ATOM   761   C C6    . DC  B 2 12  ? 65.689  -73.811  24.057  1.00 85.63  ? 40  DC  D C6    1 
ATOM   762   P P     . DA  B 2 13  ? 61.272  -74.939  19.426  1.00 115.89 ? 41  DA  D P     1 
ATOM   763   O OP1   . DA  B 2 13  ? 61.982  -76.005  18.674  1.00 122.23 ? 41  DA  D OP1   1 
ATOM   764   O OP2   . DA  B 2 13  ? 61.396  -73.535  18.972  1.00 116.43 ? 41  DA  D OP2   1 
ATOM   765   O "O5'" . DA  B 2 13  ? 59.735  -75.344  19.525  1.00 106.47 ? 41  DA  D "O5'" 1 
ATOM   766   C "C5'" . DA  B 2 13  ? 58.693  -74.403  19.226  1.00 103.13 ? 41  DA  D "C5'" 1 
ATOM   767   C "C4'" . DA  B 2 13  ? 58.044  -73.902  20.496  1.00 103.34 ? 41  DA  D "C4'" 1 
ATOM   768   O "O4'" . DA  B 2 13  ? 59.031  -73.646  21.525  1.00 97.88  ? 41  DA  D "O4'" 1 
ATOM   769   C "C3'" . DA  B 2 13  ? 57.269  -72.596  20.324  1.00 97.68  ? 41  DA  D "C3'" 1 
ATOM   770   O "O3'" . DA  B 2 13  ? 56.022  -72.702  21.000  1.00 100.60 ? 41  DA  D "O3'" 1 
ATOM   771   C "C2'" . DA  B 2 13  ? 58.168  -71.551  20.958  1.00 92.57  ? 41  DA  D "C2'" 1 
ATOM   772   C "C1'" . DA  B 2 13  ? 58.855  -72.338  22.053  1.00 88.48  ? 41  DA  D "C1'" 1 
ATOM   773   N N9    . DA  B 2 13  ? 60.174  -71.834  22.430  1.00 82.45  ? 41  DA  D N9    1 
ATOM   774   C C8    . DA  B 2 13  ? 61.292  -71.756  21.634  1.00 82.99  ? 41  DA  D C8    1 
ATOM   775   N N7    . DA  B 2 13  ? 62.350  -71.292  22.253  1.00 79.30  ? 41  DA  D N7    1 
ATOM   776   C C5    . DA  B 2 13  ? 61.905  -71.061  23.546  1.00 73.13  ? 41  DA  D C5    1 
ATOM   777   C C6    . DA  B 2 13  ? 62.550  -70.567  24.693  1.00 75.38  ? 41  DA  D C6    1 
ATOM   778   N N6    . DA  B 2 13  ? 63.835  -70.205  24.719  1.00 76.33  ? 41  DA  D N6    1 
ATOM   779   N N1    . DA  B 2 13  ? 61.818  -70.449  25.823  1.00 73.96  ? 41  DA  D N1    1 
ATOM   780   C C2    . DA  B 2 13  ? 60.530  -70.819  25.794  1.00 77.35  ? 41  DA  D C2    1 
ATOM   781   N N3    . DA  B 2 13  ? 59.812  -71.297  24.777  1.00 71.44  ? 41  DA  D N3    1 
ATOM   782   C C4    . DA  B 2 13  ? 60.566  -71.389  23.669  1.00 73.20  ? 41  DA  D C4    1 
ATOM   783   P P     . DT  B 2 14  ? 54.919  -71.606  20.747  1.00 106.15 ? 42  DT  D P     1 
ATOM   784   O OP1   . DT  B 2 14  ? 53.608  -72.145  21.198  1.00 100.15 ? 42  DT  D OP1   1 
ATOM   785   O OP2   . DT  B 2 14  ? 55.085  -71.119  19.354  1.00 104.44 ? 42  DT  D OP2   1 
ATOM   786   O "O5'" . DT  B 2 14  ? 55.348  -70.454  21.758  1.00 103.90 ? 42  DT  D "O5'" 1 
ATOM   787   C "C5'" . DT  B 2 14  ? 54.862  -70.440  23.111  1.00 93.68  ? 42  DT  D "C5'" 1 
ATOM   788   C "C4'" . DT  B 2 14  ? 55.431  -69.248  23.842  1.00 87.07  ? 42  DT  D "C4'" 1 
ATOM   789   O "O4'" . DT  B 2 14  ? 56.863  -69.382  23.922  1.00 81.65  ? 42  DT  D "O4'" 1 
ATOM   790   C "C3'" . DT  B 2 14  ? 55.215  -67.902  23.152  1.00 87.36  ? 42  DT  D "C3'" 1 
ATOM   791   O "O3'" . DT  B 2 14  ? 53.911  -67.299  23.316  1.00 88.10  ? 42  DT  D "O3'" 1 
ATOM   792   C "C2'" . DT  B 2 14  ? 56.398  -67.079  23.637  1.00 89.04  ? 42  DT  D "C2'" 1 
ATOM   793   C "C1'" . DT  B 2 14  ? 57.412  -68.099  24.166  1.00 80.46  ? 42  DT  D "C1'" 1 
ATOM   794   N N1    . DT  B 2 14  ? 58.756  -68.045  23.535  1.00 75.02  ? 42  DT  D N1    1 
ATOM   795   C C2    . DT  B 2 14  ? 59.835  -67.719  24.328  1.00 74.39  ? 42  DT  D C2    1 
ATOM   796   O O2    . DT  B 2 14  ? 59.738  -67.481  25.520  1.00 80.11  ? 42  DT  D O2    1 
ATOM   797   N N3    . DT  B 2 14  ? 61.041  -67.688  23.672  1.00 69.71  ? 42  DT  D N3    1 
ATOM   798   C C4    . DT  B 2 14  ? 61.269  -67.941  22.334  1.00 68.80  ? 42  DT  D C4    1 
ATOM   799   O O4    . DT  B 2 14  ? 62.411  -67.882  21.886  1.00 67.26  ? 42  DT  D O4    1 
ATOM   800   C C5    . DT  B 2 14  ? 60.093  -68.261  21.558  1.00 70.49  ? 42  DT  D C5    1 
ATOM   801   C C7    . DT  B 2 14  ? 60.244  -68.544  20.097  1.00 75.11  ? 42  DT  D C7    1 
ATOM   802   C C6    . DT  B 2 14  ? 58.910  -68.294  22.188  1.00 70.65  ? 42  DT  D C6    1 
ATOM   803   P P     . DA  B 2 15  ? 53.292  -66.960  24.771  1.00 95.06  ? 43  DA  D P     1 
ATOM   804   O OP1   . DA  B 2 15  ? 53.961  -67.800  25.787  1.00 100.56 ? 43  DA  D OP1   1 
ATOM   805   O OP2   . DA  B 2 15  ? 51.806  -66.959  24.666  1.00 91.71  ? 43  DA  D OP2   1 
ATOM   806   O "O5'" . DA  B 2 15  ? 53.793  -65.480  25.059  1.00 99.70  ? 43  DA  D "O5'" 1 
ATOM   807   C "C5'" . DA  B 2 15  ? 54.087  -65.078  26.409  1.00 101.28 ? 43  DA  D "C5'" 1 
ATOM   808   C "C4'" . DA  B 2 15  ? 54.995  -63.871  26.404  1.00 101.07 ? 43  DA  D "C4'" 1 
ATOM   809   O "O4'" . DA  B 2 15  ? 56.274  -64.226  25.823  1.00 93.53  ? 43  DA  D "O4'" 1 
ATOM   810   C "C3'" . DA  B 2 15  ? 54.468  -62.677  25.597  1.00 98.73  ? 43  DA  D "C3'" 1 
ATOM   811   O "O3'" . DA  B 2 15  ? 54.487  -61.491  26.399  1.00 102.20 ? 43  DA  D "O3'" 1 
ATOM   812   C "C2'" . DA  B 2 15  ? 55.435  -62.570  24.432  1.00 91.23  ? 43  DA  D "C2'" 1 
ATOM   813   C "C1'" . DA  B 2 15  ? 56.701  -63.142  25.036  1.00 86.91  ? 43  DA  D "C1'" 1 
ATOM   814   N N9    . DA  B 2 15  ? 57.676  -63.629  24.064  1.00 81.31  ? 43  DA  D N9    1 
ATOM   815   C C8    . DA  B 2 15  ? 57.452  -64.170  22.821  1.00 78.83  ? 43  DA  D C8    1 
ATOM   816   N N7    . DA  B 2 15  ? 58.550  -64.454  22.163  1.00 75.01  ? 43  DA  D N7    1 
ATOM   817   C C5    . DA  B 2 15  ? 59.565  -64.047  23.018  1.00 72.86  ? 43  DA  D C5    1 
ATOM   818   C C6    . DA  B 2 15  ? 60.964  -64.063  22.899  1.00 72.17  ? 43  DA  D C6    1 
ATOM   819   N N6    . DA  B 2 15  ? 61.608  -64.532  21.829  1.00 73.94  ? 43  DA  D N6    1 
ATOM   820   N N1    . DA  B 2 15  ? 61.690  -63.586  23.936  1.00 71.53  ? 43  DA  D N1    1 
ATOM   821   C C2    . DA  B 2 15  ? 61.040  -63.115  25.010  1.00 74.78  ? 43  DA  D C2    1 
ATOM   822   N N3    . DA  B 2 15  ? 59.728  -63.041  25.236  1.00 72.19  ? 43  DA  D N3    1 
ATOM   823   C C4    . DA  B 2 15  ? 59.040  -63.530  24.190  1.00 75.41  ? 43  DA  D C4    1 
ATOM   824   P P     . DC  B 2 16  ? 53.614  -60.216  25.983  1.00 96.19  ? 44  DC  D P     1 
ATOM   825   O OP1   . DC  B 2 16  ? 52.517  -60.061  26.980  1.00 83.56  ? 44  DC  D OP1   1 
ATOM   826   O OP2   . DC  B 2 16  ? 53.274  -60.331  24.540  1.00 97.02  ? 44  DC  D OP2   1 
ATOM   827   O "O5'" . DC  B 2 16  ? 54.667  -59.035  26.128  1.00 88.33  ? 44  DC  D "O5'" 1 
ATOM   828   C "C5'" . DC  B 2 16  ? 55.548  -58.713  25.043  1.00 93.08  ? 44  DC  D "C5'" 1 
ATOM   829   C "C4'" . DC  B 2 16  ? 56.981  -58.804  25.505  1.00 95.00  ? 44  DC  D "C4'" 1 
ATOM   830   O "O4'" . DC  B 2 16  ? 57.571  -60.032  25.031  1.00 99.54  ? 44  DC  D "O4'" 1 
ATOM   831   C "C3'" . DC  B 2 16  ? 57.890  -57.707  24.969  1.00 99.17  ? 44  DC  D "C3'" 1 
ATOM   832   O "O3'" . DC  B 2 16  ? 57.759  -56.523  25.770  1.00 104.41 ? 44  DC  D "O3'" 1 
ATOM   833   C "C2'" . DC  B 2 16  ? 59.259  -58.358  25.045  1.00 96.53  ? 44  DC  D "C2'" 1 
ATOM   834   C "C1'" . DC  B 2 16  ? 58.967  -59.841  24.805  1.00 92.94  ? 44  DC  D "C1'" 1 
ATOM   835   N N1    . DC  B 2 16  ? 59.287  -60.352  23.455  1.00 83.11  ? 44  DC  D N1    1 
ATOM   836   C C2    . DC  B 2 16  ? 60.629  -60.418  23.057  1.00 82.55  ? 44  DC  D C2    1 
ATOM   837   O O2    . DC  B 2 16  ? 61.510  -60.027  23.842  1.00 79.68  ? 44  DC  D O2    1 
ATOM   838   N N3    . DC  B 2 16  ? 60.932  -60.902  21.830  1.00 78.82  ? 44  DC  D N3    1 
ATOM   839   C C4    . DC  B 2 16  ? 59.957  -61.318  21.018  1.00 77.52  ? 44  DC  D C4    1 
ATOM   840   N N4    . DC  B 2 16  ? 60.302  -61.786  19.816  1.00 80.54  ? 44  DC  D N4    1 
ATOM   841   C C5    . DC  B 2 16  ? 58.584  -61.265  21.398  1.00 73.21  ? 44  DC  D C5    1 
ATOM   842   C C6    . DC  B 2 16  ? 58.297  -60.783  22.614  1.00 75.21  ? 44  DC  D C6    1 
ATOM   843   P P     . DT  B 2 17  ? 58.489  -55.167  25.338  1.00 96.69  ? 45  DT  D P     1 
ATOM   844   O OP1   . DT  B 2 17  ? 57.816  -54.039  26.018  1.00 91.91  ? 45  DT  D OP1   1 
ATOM   845   O OP2   . DT  B 2 17  ? 58.641  -55.166  23.866  1.00 97.22  ? 45  DT  D OP2   1 
ATOM   846   O "O5'" . DT  B 2 17  ? 59.931  -55.316  25.991  1.00 93.49  ? 45  DT  D "O5'" 1 
ATOM   847   C "C5'" . DT  B 2 17  ? 60.973  -54.404  25.640  1.00 90.76  ? 45  DT  D "C5'" 1 
ATOM   848   C "C4'" . DT  B 2 17  ? 62.112  -55.155  24.997  1.00 89.38  ? 45  DT  D "C4'" 1 
ATOM   849   O "O4'" . DT  B 2 17  ? 61.627  -56.256  24.213  1.00 86.70  ? 45  DT  D "O4'" 1 
ATOM   850   C "C3'" . DT  B 2 17  ? 62.919  -54.348  23.996  1.00 95.67  ? 45  DT  D "C3'" 1 
ATOM   851   O "O3'" . DT  B 2 17  ? 63.756  -53.419  24.682  1.00 102.85 ? 45  DT  D "O3'" 1 
ATOM   852   C "C2'" . DT  B 2 17  ? 63.625  -55.436  23.205  1.00 90.18  ? 45  DT  D "C2'" 1 
ATOM   853   C "C1'" . DT  B 2 17  ? 62.674  -56.635  23.317  1.00 87.00  ? 45  DT  D "C1'" 1 
ATOM   854   N N1    . DT  B 2 17  ? 62.061  -57.100  22.049  1.00 77.91  ? 45  DT  D N1    1 
ATOM   855   C C2    . DT  B 2 17  ? 62.903  -57.487  21.032  1.00 74.27  ? 45  DT  D C2    1 
ATOM   856   O O2    . DT  B 2 17  ? 64.120  -57.431  21.114  1.00 72.67  ? 45  DT  D O2    1 
ATOM   857   N N3    . DT  B 2 17  ? 62.266  -57.934  19.901  1.00 72.27  ? 45  DT  D N3    1 
ATOM   858   C C4    . DT  B 2 17  ? 60.904  -58.043  19.698  1.00 71.70  ? 45  DT  D C4    1 
ATOM   859   O O4    . DT  B 2 17  ? 60.477  -58.467  18.628  1.00 73.63  ? 45  DT  D O4    1 
ATOM   860   C C5    . DT  B 2 17  ? 60.081  -57.635  20.813  1.00 71.03  ? 45  DT  D C5    1 
ATOM   861   C C7    . DT  B 2 17  ? 58.592  -57.716  20.684  1.00 70.98  ? 45  DT  D C7    1 
ATOM   862   C C6    . DT  B 2 17  ? 60.692  -57.193  21.918  1.00 72.03  ? 45  DT  D C6    1 
ATOM   863   P P     . DT  B 2 18  ? 63.670  -51.874  24.310  1.00 106.19 ? 46  DT  D P     1 
ATOM   864   O OP1   . DT  B 2 18  ? 64.251  -51.103  25.439  1.00 105.32 ? 46  DT  D OP1   1 
ATOM   865   O OP2   . DT  B 2 18  ? 62.281  -51.581  23.863  1.00 99.86  ? 46  DT  D OP2   1 
ATOM   866   O "O5'" . DT  B 2 18  ? 64.651  -51.783  23.058  1.00 104.28 ? 46  DT  D "O5'" 1 
ATOM   867   C "C5'" . DT  B 2 18  ? 66.039  -52.142  23.201  1.00 103.84 ? 46  DT  D "C5'" 1 
ATOM   868   C "C4'" . DT  B 2 18  ? 66.568  -52.725  21.912  1.00 104.61 ? 46  DT  D "C4'" 1 
ATOM   869   O "O4'" . DT  B 2 18  ? 65.614  -53.662  21.374  1.00 98.50  ? 46  DT  D "O4'" 1 
ATOM   870   C "C3'" . DT  B 2 18  ? 66.825  -51.699  20.804  1.00 108.06 ? 46  DT  D "C3'" 1 
ATOM   871   O "O3'" . DT  B 2 18  ? 68.223  -51.618  20.514  1.00 112.41 ? 46  DT  D "O3'" 1 
ATOM   872   C "C2'" . DT  B 2 18  ? 66.043  -52.218  19.607  1.00 103.81 ? 46  DT  D "C2'" 1 
ATOM   873   C "C1'" . DT  B 2 18  ? 65.736  -53.654  19.970  1.00 97.54  ? 46  DT  D "C1'" 1 
ATOM   874   N N1    . DT  B 2 18  ? 64.478  -54.164  19.408  1.00 94.45  ? 46  DT  D N1    1 
ATOM   875   C C2    . DT  B 2 18  ? 64.520  -54.854  18.217  1.00 92.68  ? 46  DT  D C2    1 
ATOM   876   O O2    . DT  B 2 18  ? 65.553  -55.060  17.601  1.00 92.02  ? 46  DT  D O2    1 
ATOM   877   N N3    . DT  B 2 18  ? 63.301  -55.300  17.772  1.00 93.07  ? 46  DT  D N3    1 
ATOM   878   C C4    . DT  B 2 18  ? 62.074  -55.125  18.384  1.00 94.77  ? 46  DT  D C4    1 
ATOM   879   O O4    . DT  B 2 18  ? 61.063  -55.585  17.864  1.00 94.89  ? 46  DT  D O4    1 
ATOM   880   C C5    . DT  B 2 18  ? 62.105  -54.391  19.630  1.00 95.74  ? 46  DT  D C5    1 
ATOM   881   C C7    . DT  B 2 18  ? 60.824  -54.148  20.364  1.00 95.59  ? 46  DT  D C7    1 
ATOM   882   C C6    . DT  B 2 18  ? 63.289  -53.951  20.072  1.00 94.91  ? 46  DT  D C6    1 
ATOM   883   P P     . DG  B 2 19  ? 68.775  -50.438  19.596  1.00 117.36 ? 47  DG  D P     1 
ATOM   884   O OP1   . DG  B 2 19  ? 70.207  -50.230  19.928  1.00 119.36 ? 47  DG  D OP1   1 
ATOM   885   O OP2   . DG  B 2 19  ? 67.821  -49.301  19.681  1.00 115.80 ? 47  DG  D OP2   1 
ATOM   886   O "O5'" . DG  B 2 19  ? 68.706  -51.063  18.134  1.00 113.60 ? 47  DG  D "O5'" 1 
ATOM   887   C "C5'" . DG  B 2 19  ? 69.522  -52.191  17.786  1.00 112.90 ? 47  DG  D "C5'" 1 
ATOM   888   C "C4'" . DG  B 2 19  ? 69.210  -52.639  16.378  1.00 114.66 ? 47  DG  D "C4'" 1 
ATOM   889   O "O4'" . DG  B 2 19  ? 67.866  -53.174  16.316  1.00 114.27 ? 47  DG  D "O4'" 1 
ATOM   890   C "C3'" . DG  B 2 19  ? 69.283  -51.529  15.325  1.00 112.70 ? 47  DG  D "C3'" 1 
ATOM   891   O "O3'" . DG  B 2 19  ? 70.236  -51.897  14.323  1.00 120.22 ? 47  DG  D "O3'" 1 
ATOM   892   C "C2'" . DG  B 2 19  ? 67.859  -51.418  14.797  1.00 111.76 ? 47  DG  D "C2'" 1 
ATOM   893   C "C1'" . DG  B 2 19  ? 67.282  -52.788  15.088  1.00 110.06 ? 47  DG  D "C1'" 1 
ATOM   894   N N9    . DG  B 2 19  ? 65.830  -52.827  15.248  1.00 104.27 ? 47  DG  D N9    1 
ATOM   895   C C8    . DG  B 2 19  ? 65.085  -52.193  16.214  1.00 102.75 ? 47  DG  D C8    1 
ATOM   896   N N7    . DG  B 2 19  ? 63.804  -52.417  16.102  1.00 98.30  ? 47  DG  D N7    1 
ATOM   897   C C5    . DG  B 2 19  ? 63.696  -53.251  14.997  1.00 97.18  ? 47  DG  D C5    1 
ATOM   898   C C6    . DG  B 2 19  ? 62.549  -53.827  14.388  1.00 98.88  ? 47  DG  D C6    1 
ATOM   899   O O6    . DG  B 2 19  ? 61.362  -53.712  14.716  1.00 102.88 ? 47  DG  D O6    1 
ATOM   900   N N1    . DG  B 2 19  ? 62.891  -54.605  13.286  1.00 95.88  ? 47  DG  D N1    1 
ATOM   901   C C2    . DG  B 2 19  ? 64.170  -54.805  12.827  1.00 98.07  ? 47  DG  D C2    1 
ATOM   902   N N2    . DG  B 2 19  ? 64.295  -55.594  11.749  1.00 98.30  ? 47  DG  D N2    1 
ATOM   903   N N3    . DG  B 2 19  ? 65.247  -54.271  13.383  1.00 95.15  ? 47  DG  D N3    1 
ATOM   904   C C4    . DG  B 2 19  ? 64.937  -53.512  14.457  1.00 96.09  ? 47  DG  D C4    1 
ATOM   905   P P     . DT  B 2 20  ? 70.616  -50.875  13.155  1.00 122.26 ? 48  DT  D P     1 
ATOM   906   O OP1   . DT  B 2 20  ? 71.924  -51.290  12.590  1.00 123.54 ? 48  DT  D OP1   1 
ATOM   907   O OP2   . DT  B 2 20  ? 70.445  -49.496  13.679  1.00 117.71 ? 48  DT  D OP2   1 
ATOM   908   O "O5'" . DT  B 2 20  ? 69.517  -51.187  12.045  1.00 120.05 ? 48  DT  D "O5'" 1 
ATOM   909   C "C5'" . DT  B 2 20  ? 69.241  -52.549  11.666  1.00 120.12 ? 48  DT  D "C5'" 1 
ATOM   910   C "C4'" . DT  B 2 20  ? 68.073  -52.622  10.710  1.00 117.79 ? 48  DT  D "C4'" 1 
ATOM   911   O "O4'" . DT  B 2 20  ? 66.820  -52.565  11.432  1.00 114.60 ? 48  DT  D "O4'" 1 
ATOM   912   C "C3'" . DT  B 2 20  ? 68.011  -51.512  9.654   1.00 114.26 ? 48  DT  D "C3'" 1 
ATOM   913   O "O3'" . DT  B 2 20  ? 68.026  -52.146  8.371   1.00 115.07 ? 48  DT  D "O3'" 1 
ATOM   914   C "C2'" . DT  B 2 20  ? 66.719  -50.772  9.971   1.00 109.53 ? 48  DT  D "C2'" 1 
ATOM   915   C "C1'" . DT  B 2 20  ? 65.894  -51.851  10.639  1.00 106.07 ? 48  DT  D "C1'" 1 
ATOM   916   N N1    . DT  B 2 20  ? 64.794  -51.397  11.519  1.00 96.63  ? 48  DT  D N1    1 
ATOM   917   C C2    . DT  B 2 20  ? 63.533  -51.900  11.286  1.00 92.54  ? 48  DT  D C2    1 
ATOM   918   O O2    . DT  B 2 20  ? 63.282  -52.682  10.384  1.00 96.56  ? 48  DT  D O2    1 
ATOM   919   N N3    . DT  B 2 20  ? 62.566  -51.447  12.151  1.00 87.00  ? 48  DT  D N3    1 
ATOM   920   C C4    . DT  B 2 20  ? 62.734  -50.566  13.201  1.00 86.62  ? 48  DT  D C4    1 
ATOM   921   O O4    . DT  B 2 20  ? 61.771  -50.256  13.897  1.00 79.86  ? 48  DT  D O4    1 
ATOM   922   C C5    . DT  B 2 20  ? 64.084  -50.080  13.390  1.00 91.12  ? 48  DT  D C5    1 
ATOM   923   C C7    . DT  B 2 20  ? 64.362  -49.121  14.505  1.00 91.04  ? 48  DT  D C7    1 
ATOM   924   C C6    . DT  B 2 20  ? 65.034  -50.518  12.553  1.00 94.22  ? 48  DT  D C6    1 
ATOM   925   P P     . DA  B 2 21  ? 67.995  -51.278  7.031   1.00 116.04 ? 49  DA  D P     1 
ATOM   926   O OP1   . DA  B 2 21  ? 69.076  -51.768  6.140   1.00 110.91 ? 49  DA  D OP1   1 
ATOM   927   O OP2   . DA  B 2 21  ? 67.939  -49.842  7.408   1.00 113.51 ? 49  DA  D OP2   1 
ATOM   928   O "O5'" . DA  B 2 21  ? 66.625  -51.731  6.359   1.00 109.56 ? 49  DA  D "O5'" 1 
ATOM   929   C "C5'" . DA  B 2 21  ? 66.202  -53.105  6.450   1.00 105.85 ? 49  DA  D "C5'" 1 
ATOM   930   C "C4'" . DA  B 2 21  ? 64.971  -53.348  5.608   1.00 101.73 ? 49  DA  D "C4'" 1 
ATOM   931   O "O4'" . DA  B 2 21  ? 63.782  -53.102  6.394   1.00 101.07 ? 49  DA  D "O4'" 1 
ATOM   932   C "C3'" . DA  B 2 21  ? 64.832  -52.464  4.372   1.00 96.42  ? 49  DA  D "C3'" 1 
ATOM   933   O "O3'" . DA  B 2 21  ? 64.167  -53.229  3.364   1.00 94.33  ? 49  DA  D "O3'" 1 
ATOM   934   C "C2'" . DA  B 2 21  ? 64.013  -51.293  4.884   1.00 98.07  ? 49  DA  D "C2'" 1 
ATOM   935   C "C1'" . DA  B 2 21  ? 63.109  -51.934  5.933   1.00 97.35  ? 49  DA  D "C1'" 1 
ATOM   936   N N9    . DA  B 2 21  ? 62.834  -51.091  7.097   1.00 93.40  ? 49  DA  D N9    1 
ATOM   937   C C8    . DA  B 2 21  ? 63.728  -50.322  7.800   1.00 95.03  ? 49  DA  D C8    1 
ATOM   938   N N7    . DA  B 2 21  ? 63.192  -49.675  8.806   1.00 91.12  ? 49  DA  D N7    1 
ATOM   939   C C5    . DA  B 2 21  ? 61.858  -50.050  8.769   1.00 86.41  ? 49  DA  D C5    1 
ATOM   940   C C6    . DA  B 2 21  ? 60.759  -49.708  9.574   1.00 88.87  ? 49  DA  D C6    1 
ATOM   941   N N6    . DA  B 2 21  ? 60.837  -48.875  10.615  1.00 88.24  ? 49  DA  D N6    1 
ATOM   942   N N1    . DA  B 2 21  ? 59.561  -50.250  9.265   1.00 90.05  ? 49  DA  D N1    1 
ATOM   943   C C2    . DA  B 2 21  ? 59.484  -51.079  8.214   1.00 91.69  ? 49  DA  D C2    1 
ATOM   944   N N3    . DA  B 2 21  ? 60.447  -51.479  7.385   1.00 89.07  ? 49  DA  D N3    1 
ATOM   945   C C4    . DA  B 2 21  ? 61.622  -50.921  7.721   1.00 86.47  ? 49  DA  D C4    1 
ATOM   946   P P     . DC  B 2 22  ? 63.854  -52.596  1.935   1.00 93.63  ? 50  DC  D P     1 
ATOM   947   O OP1   . DC  B 2 22  ? 63.448  -53.701  1.026   1.00 91.57  ? 50  DC  D OP1   1 
ATOM   948   O OP2   . DC  B 2 22  ? 64.986  -51.708  1.560   1.00 85.26  ? 50  DC  D OP2   1 
ATOM   949   O "O5'" . DC  B 2 22  ? 62.557  -51.717  2.222   1.00 95.42  ? 50  DC  D "O5'" 1 
ATOM   950   C "C5'" . DC  B 2 22  ? 61.321  -52.335  2.638   1.00 94.53  ? 50  DC  D "C5'" 1 
ATOM   951   C "C4'" . DC  B 2 22  ? 60.211  -51.312  2.691   1.00 89.81  ? 50  DC  D "C4'" 1 
ATOM   952   O "O4'" . DC  B 2 22  ? 60.174  -50.680  3.994   1.00 88.71  ? 50  DC  D "O4'" 1 
ATOM   953   C "C3'" . DC  B 2 22  ? 60.349  -50.170  1.679   1.00 90.44  ? 50  DC  D "C3'" 1 
ATOM   954   O "O3'" . DC  B 2 22  ? 59.083  -49.816  1.134   1.00 86.43  ? 50  DC  D "O3'" 1 
ATOM   955   C "C2'" . DC  B 2 22  ? 60.818  -49.005  2.527   1.00 91.96  ? 50  DC  D "C2'" 1 
ATOM   956   C "C1'" . DC  B 2 22  ? 60.039  -49.286  3.791   1.00 86.65  ? 50  DC  D "C1'" 1 
ATOM   957   N N1    . DC  B 2 22  ? 60.481  -48.594  5.007   1.00 80.82  ? 50  DC  D N1    1 
ATOM   958   C C2    . DC  B 2 22  ? 59.528  -48.314  5.984   1.00 78.59  ? 50  DC  D C2    1 
ATOM   959   O O2    . DC  B 2 22  ? 58.359  -48.680  5.800   1.00 82.09  ? 50  DC  D O2    1 
ATOM   960   N N3    . DC  B 2 22  ? 59.902  -47.658  7.105   1.00 80.04  ? 50  DC  D N3    1 
ATOM   961   C C4    . DC  B 2 22  ? 61.172  -47.288  7.268   1.00 82.82  ? 50  DC  D C4    1 
ATOM   962   N N4    . DC  B 2 22  ? 61.498  -46.654  8.394   1.00 90.21  ? 50  DC  D N4    1 
ATOM   963   C C5    . DC  B 2 22  ? 62.167  -47.560  6.286   1.00 82.49  ? 50  DC  D C5    1 
ATOM   964   C C6    . DC  B 2 22  ? 61.781  -48.204  5.178   1.00 83.39  ? 50  DC  D C6    1 
ATOM   965   P P     . DA  B 2 23  ? 58.478  -50.657  -0.046  1.00 88.39  ? 51  DA  D P     1 
ATOM   966   O OP1   . DA  B 2 23  ? 59.106  -51.999  -0.024  1.00 100.22 ? 51  DA  D OP1   1 
ATOM   967   O OP2   . DA  B 2 23  ? 58.539  -49.834  -1.277  1.00 84.43  ? 51  DA  D OP2   1 
ATOM   968   O "O5'" . DA  B 2 23  ? 56.963  -50.828  0.398   1.00 89.24  ? 51  DA  D "O5'" 1 
ATOM   969   C "C5'" . DA  B 2 23  ? 55.958  -50.025  -0.222  1.00 87.54  ? 51  DA  D "C5'" 1 
ATOM   970   C "C4'" . DA  B 2 23  ? 54.905  -49.607  0.776   1.00 86.59  ? 51  DA  D "C4'" 1 
ATOM   971   O "O4'" . DA  B 2 23  ? 55.515  -49.174  2.018   1.00 82.92  ? 51  DA  D "O4'" 1 
ATOM   972   C "C3'" . DA  B 2 23  ? 54.073  -48.429  0.275   1.00 86.16  ? 51  DA  D "C3'" 1 
ATOM   973   O "O3'" . DA  B 2 23  ? 52.692  -48.628  0.552   1.00 86.62  ? 51  DA  D "O3'" 1 
ATOM   974   C "C2'" . DA  B 2 23  ? 54.668  -47.239  0.998   1.00 88.14  ? 51  DA  D "C2'" 1 
ATOM   975   C "C1'" . DA  B 2 23  ? 55.122  -47.842  2.315   1.00 84.55  ? 51  DA  D "C1'" 1 
ATOM   976   N N9    . DA  B 2 23  ? 56.275  -47.146  2.880   1.00 80.23  ? 51  DA  D N9    1 
ATOM   977   C C8    . DA  B 2 23  ? 57.535  -47.046  2.344   1.00 82.12  ? 51  DA  D C8    1 
ATOM   978   N N7    . DA  B 2 23  ? 58.361  -46.330  3.067   1.00 81.39  ? 51  DA  D N7    1 
ATOM   979   C C5    . DA  B 2 23  ? 57.586  -45.910  4.139   1.00 78.08  ? 51  DA  D C5    1 
ATOM   980   C C6    . DA  B 2 23  ? 57.876  -45.116  5.261   1.00 76.67  ? 51  DA  D C6    1 
ATOM   981   N N6    . DA  B 2 23  ? 59.075  -44.579  5.496   1.00 78.99  ? 51  DA  D N6    1 
ATOM   982   N N1    . DA  B 2 23  ? 56.881  -44.891  6.145   1.00 77.11  ? 51  DA  D N1    1 
ATOM   983   C C2    . DA  B 2 23  ? 55.676  -45.427  5.905   1.00 78.94  ? 51  DA  D C2    1 
ATOM   984   N N3    . DA  B 2 23  ? 55.283  -46.193  4.889   1.00 76.72  ? 51  DA  D N3    1 
ATOM   985   C C4    . DA  B 2 23  ? 56.296  -46.398  4.031   1.00 77.04  ? 51  DA  D C4    1 
ATOM   986   P P     . DC  B 2 24  ? 51.613  -47.847  -0.300  1.00 92.20  ? 52  DC  D P     1 
ATOM   987   O OP1   . DC  B 2 24  ? 50.345  -48.620  -0.260  1.00 96.09  ? 52  DC  D OP1   1 
ATOM   988   O OP2   . DC  B 2 24  ? 52.214  -47.494  -1.609  1.00 91.70  ? 52  DC  D OP2   1 
ATOM   989   O "O5'" . DC  B 2 24  ? 51.461  -46.492  0.517   1.00 96.59  ? 52  DC  D "O5'" 1 
ATOM   990   C "C5'" . DC  B 2 24  ? 51.451  -46.473  1.959   1.00 94.76  ? 52  DC  D "C5'" 1 
ATOM   991   C "C4'" . DC  B 2 24  ? 51.466  -45.039  2.434   1.00 91.74  ? 52  DC  D "C4'" 1 
ATOM   992   O "O4'" . DC  B 2 24  ? 52.788  -44.662  2.904   1.00 80.71  ? 52  DC  D "O4'" 1 
ATOM   993   C "C3'" . DC  B 2 24  ? 51.100  -44.015  1.353   1.00 89.98  ? 52  DC  D "C3'" 1 
ATOM   994   O "O3'" . DC  B 2 24  ? 50.210  -43.086  1.986   1.00 97.87  ? 52  DC  D "O3'" 1 
ATOM   995   C "C2'" . DC  B 2 24  ? 52.457  -43.489  0.927   1.00 82.05  ? 52  DC  D "C2'" 1 
ATOM   996   C "C1'" . DC  B 2 24  ? 53.150  -43.450  2.270   1.00 75.27  ? 52  DC  D "C1'" 1 
ATOM   997   N N1    . DC  B 2 24  ? 54.617  -43.347  2.264   1.00 68.94  ? 52  DC  D N1    1 
ATOM   998   C C2    . DC  B 2 24  ? 55.250  -42.927  3.434   1.00 71.01  ? 52  DC  D C2    1 
ATOM   999   O O2    . DC  B 2 24  ? 54.559  -42.697  4.438   1.00 78.04  ? 52  DC  D O2    1 
ATOM   1000  N N3    . DC  B 2 24  ? 56.595  -42.792  3.449   1.00 68.62  ? 52  DC  D N3    1 
ATOM   1001  C C4    . DC  B 2 24  ? 57.301  -43.048  2.346   1.00 71.11  ? 52  DC  D C4    1 
ATOM   1002  N N4    . DC  B 2 24  ? 58.627  -42.906  2.406   1.00 74.30  ? 52  DC  D N4    1 
ATOM   1003  C C5    . DC  B 2 24  ? 56.679  -43.457  1.131   1.00 69.63  ? 52  DC  D C5    1 
ATOM   1004  C C6    . DC  B 2 24  ? 55.347  -43.587  1.133   1.00 68.15  ? 52  DC  D C6    1 
ATOM   1005  P P     . DC  B 2 25  ? 49.758  -41.712  1.293   1.00 93.51  ? 53  DC  D P     1 
ATOM   1006  O OP1   . DC  B 2 25  ? 48.287  -41.768  1.108   1.00 87.89  ? 53  DC  D OP1   1 
ATOM   1007  O OP2   . DC  B 2 25  ? 50.636  -41.427  0.123   1.00 81.14  ? 53  DC  D OP2   1 
ATOM   1008  O "O5'" . DC  B 2 25  ? 50.093  -40.658  2.437   1.00 88.61  ? 53  DC  D "O5'" 1 
ATOM   1009  C "C5'" . DC  B 2 25  ? 50.183  -41.058  3.823   1.00 85.31  ? 53  DC  D "C5'" 1 
ATOM   1010  C "C4'" . DC  B 2 25  ? 50.797  -39.936  4.626   1.00 84.37  ? 53  DC  D "C4'" 1 
ATOM   1011  O "O4'" . DC  B 2 25  ? 52.241  -40.035  4.555   1.00 82.78  ? 53  DC  D "O4'" 1 
ATOM   1012  C "C3'" . DC  B 2 25  ? 50.435  -38.548  4.092   1.00 83.88  ? 53  DC  D "C3'" 1 
ATOM   1013  O "O3'" . DC  B 2 25  ? 50.126  -37.595  5.112   1.00 85.71  ? 53  DC  D "O3'" 1 
ATOM   1014  C "C2'" . DC  B 2 25  ? 51.667  -38.132  3.317   1.00 82.46  ? 53  DC  D "C2'" 1 
ATOM   1015  C "C1'" . DC  B 2 25  ? 52.787  -38.825  4.065   1.00 78.88  ? 53  DC  D "C1'" 1 
ATOM   1016  N N1    . DC  B 2 25  ? 53.931  -39.150  3.199   1.00 76.91  ? 53  DC  D N1    1 
ATOM   1017  C C2    . DC  B 2 25  ? 55.205  -38.719  3.577   1.00 78.08  ? 53  DC  D C2    1 
ATOM   1018  O O2    . DC  B 2 25  ? 55.341  -38.131  4.659   1.00 81.97  ? 53  DC  D O2    1 
ATOM   1019  N N3    . DC  B 2 25  ? 56.257  -38.968  2.763   1.00 77.18  ? 53  DC  D N3    1 
ATOM   1020  C C4    . DC  B 2 25  ? 56.066  -39.605  1.605   1.00 79.57  ? 53  DC  D C4    1 
ATOM   1021  N N4    . DC  B 2 25  ? 57.133  -39.841  0.838   1.00 84.26  ? 53  DC  D N4    1 
ATOM   1022  C C5    . DC  B 2 25  ? 54.774  -40.038  1.187   1.00 77.29  ? 53  DC  D C5    1 
ATOM   1023  C C6    . DC  B 2 25  ? 53.743  -39.781  2.001   1.00 76.45  ? 53  DC  D C6    1 
ATOM   1024  P P     . DT  B 2 26  ? 49.366  -36.237  4.723   1.00 83.92  ? 54  DT  D P     1 
ATOM   1025  O OP1   . DT  B 2 26  ? 48.605  -35.796  5.916   1.00 82.09  ? 54  DT  D OP1   1 
ATOM   1026  O OP2   . DT  B 2 26  ? 48.689  -36.419  3.400   1.00 70.79  ? 54  DT  D OP2   1 
ATOM   1027  O "O5'" . DT  B 2 26  ? 50.556  -35.213  4.472   1.00 82.75  ? 54  DT  D "O5'" 1 
ATOM   1028  C "C5'" . DT  B 2 26  ? 51.285  -34.640  5.569   1.00 85.90  ? 54  DT  D "C5'" 1 
ATOM   1029  C "C4'" . DT  B 2 26  ? 52.285  -33.636  5.047   1.00 83.00  ? 54  DT  D "C4'" 1 
ATOM   1030  O "O4'" . DT  B 2 26  ? 53.463  -34.344  4.607   1.00 80.53  ? 54  DT  D "O4'" 1 
ATOM   1031  C "C3'" . DT  B 2 26  ? 51.829  -32.835  3.828   1.00 83.46  ? 54  DT  D "C3'" 1 
ATOM   1032  O "O3'" . DT  B 2 26  ? 51.046  -31.677  4.165   1.00 78.52  ? 54  DT  D "O3'" 1 
ATOM   1033  C "C2'" . DT  B 2 26  ? 53.145  -32.482  3.158   1.00 88.10  ? 54  DT  D "C2'" 1 
ATOM   1034  C "C1'" . DT  B 2 26  ? 54.103  -33.604  3.576   1.00 86.53  ? 54  DT  D "C1'" 1 
ATOM   1035  N N1    . DT  B 2 26  ? 54.444  -34.538  2.492   1.00 85.35  ? 54  DT  D N1    1 
ATOM   1036  C C2    . DT  B 2 26  ? 53.415  -35.134  1.797   1.00 91.78  ? 54  DT  D C2    1 
ATOM   1037  O O2    . DT  B 2 26  ? 52.238  -34.938  2.050   1.00 103.41 ? 54  DT  D O2    1 
ATOM   1038  N N3    . DT  B 2 26  ? 53.814  -35.977  0.792   1.00 87.07  ? 54  DT  D N3    1 
ATOM   1039  C C4    . DT  B 2 26  ? 55.109  -36.274  0.421   1.00 85.89  ? 54  DT  D C4    1 
ATOM   1040  O O4    . DT  B 2 26  ? 55.315  -37.050  -0.507  1.00 91.01  ? 54  DT  D O4    1 
ATOM   1041  C C5    . DT  B 2 26  ? 56.138  -35.605  1.183   1.00 84.93  ? 54  DT  D C5    1 
ATOM   1042  C C7    . DT  B 2 26  ? 57.571  -35.862  0.845   1.00 87.79  ? 54  DT  D C7    1 
ATOM   1043  C C6    . DT  B 2 26  ? 55.760  -34.782  2.168   1.00 80.37  ? 54  DT  D C6    1 
ATOM   1044  P P     . DG  B 2 27  ? 50.269  -30.851  3.010   1.00 77.57  ? 55  DG  D P     1 
ATOM   1045  O OP1   . DG  B 2 27  ? 49.323  -29.929  3.677   1.00 84.50  ? 55  DG  D OP1   1 
ATOM   1046  O OP2   . DG  B 2 27  ? 49.766  -31.796  1.984   1.00 79.86  ? 55  DG  D OP2   1 
ATOM   1047  O "O5'" . DG  B 2 27  ? 51.428  -30.007  2.326   1.00 74.56  ? 55  DG  D "O5'" 1 
ATOM   1048  C "C5'" . DG  B 2 27  ? 52.141  -29.039  3.109   1.00 80.13  ? 55  DG  D "C5'" 1 
ATOM   1049  C "C4'" . DG  B 2 27  ? 53.314  -28.494  2.331   1.00 81.02  ? 55  DG  D "C4'" 1 
ATOM   1050  O "O4'" . DG  B 2 27  ? 54.297  -29.537  2.146   1.00 75.49  ? 55  DG  D "O4'" 1 
ATOM   1051  C "C3'" . DG  B 2 27  ? 52.988  -27.985  0.929   1.00 82.16  ? 55  DG  D "C3'" 1 
ATOM   1052  O "O3'" . DG  B 2 27  ? 52.655  -26.590  0.939   1.00 81.05  ? 55  DG  D "O3'" 1 
ATOM   1053  C "C2'" . DG  B 2 27  ? 54.303  -28.179  0.200   1.00 83.73  ? 55  DG  D "C2'" 1 
ATOM   1054  C "C1'" . DG  B 2 27  ? 54.901  -29.411  0.868   1.00 81.94  ? 55  DG  D "C1'" 1 
ATOM   1055  N N9    . DG  B 2 27  ? 54.662  -30.642  0.124   1.00 83.67  ? 55  DG  D N9    1 
ATOM   1056  C C8    . DG  B 2 27  ? 53.479  -31.072  -0.426  1.00 85.04  ? 55  DG  D C8    1 
ATOM   1057  N N7    . DG  B 2 27  ? 53.595  -32.200  -1.071  1.00 86.30  ? 55  DG  D N7    1 
ATOM   1058  C C5    . DG  B 2 27  ? 54.937  -32.529  -0.948  1.00 87.74  ? 55  DG  D C5    1 
ATOM   1059  C C6    . DG  B 2 27  ? 55.659  -33.646  -1.441  1.00 90.74  ? 55  DG  D C6    1 
ATOM   1060  O O6    . DG  B 2 27  ? 55.243  -34.601  -2.109  1.00 90.57  ? 55  DG  D O6    1 
ATOM   1061  N N1    . DG  B 2 27  ? 57.004  -33.579  -1.091  1.00 92.11  ? 55  DG  D N1    1 
ATOM   1062  C C2    . DG  B 2 27  ? 57.579  -32.575  -0.351  1.00 91.48  ? 55  DG  D C2    1 
ATOM   1063  N N2    . DG  B 2 27  ? 58.895  -32.691  -0.113  1.00 96.52  ? 55  DG  D N2    1 
ATOM   1064  N N3    . DG  B 2 27  ? 56.917  -31.533  0.117   1.00 89.20  ? 55  DG  D N3    1 
ATOM   1065  C C4    . DG  B 2 27  ? 55.611  -31.572  -0.221  1.00 86.35  ? 55  DG  D C4    1 
ATOM   1066  P P     . DA  B 2 28  ? 51.145  -26.083  0.707   1.00 82.72  ? 56  DA  D P     1 
ATOM   1067  O OP1   . DA  B 2 28  ? 51.217  -24.755  0.053   1.00 90.93  ? 56  DA  D OP1   1 
ATOM   1068  O OP2   . DA  B 2 28  ? 50.406  -26.220  1.994   1.00 73.07  ? 56  DA  D OP2   1 
ATOM   1069  O "O5'" . DA  B 2 28  ? 50.577  -27.065  -0.412  1.00 84.32  ? 56  DA  D "O5'" 1 
ATOM   1070  C "C5'" . DA  B 2 28  ? 50.550  -26.682  -1.799  1.00 83.39  ? 56  DA  D "C5'" 1 
ATOM   1071  C "C4'" . DA  B 2 28  ? 51.963  -26.538  -2.306  1.00 91.57  ? 56  DA  D "C4'" 1 
ATOM   1072  O "O4'" . DA  B 2 28  ? 52.561  -27.842  -2.425  1.00 93.66  ? 56  DA  D "O4'" 1 
ATOM   1073  C "C3'" . DA  B 2 28  ? 52.116  -25.880  -3.681  1.00 105.83 ? 56  DA  D "C3'" 1 
ATOM   1074  O "O3'" . DA  B 2 28  ? 52.673  -24.561  -3.547  1.00 125.38 ? 56  DA  D "O3'" 1 
ATOM   1075  C "C2'" . DA  B 2 28  ? 53.064  -26.805  -4.435  1.00 100.67 ? 56  DA  D "C2'" 1 
ATOM   1076  C "C1'" . DA  B 2 28  ? 53.615  -27.708  -3.349  1.00 98.97  ? 56  DA  D "C1'" 1 
ATOM   1077  N N9    . DA  B 2 28  ? 54.006  -29.045  -3.790  1.00 98.62  ? 56  DA  D N9    1 
ATOM   1078  C C8    . DA  B 2 28  ? 53.295  -29.926  -4.565  1.00 96.22  ? 56  DA  D C8    1 
ATOM   1079  N N7    . DA  B 2 28  ? 53.928  -31.047  -4.807  1.00 95.77  ? 56  DA  D N7    1 
ATOM   1080  C C5    . DA  B 2 28  ? 55.139  -30.895  -4.146  1.00 97.19  ? 56  DA  D C5    1 
ATOM   1081  C C6    . DA  B 2 28  ? 56.261  -31.734  -4.020  1.00 99.38  ? 56  DA  D C6    1 
ATOM   1082  N N6    . DA  B 2 28  ? 56.343  -32.948  -4.568  1.00 104.32 ? 56  DA  D N6    1 
ATOM   1083  N N1    . DA  B 2 28  ? 57.306  -31.281  -3.293  1.00 98.47  ? 56  DA  D N1    1 
ATOM   1084  C C2    . DA  B 2 28  ? 57.222  -30.064  -2.739  1.00 102.57 ? 56  DA  D C2    1 
ATOM   1085  N N3    . DA  B 2 28  ? 56.221  -29.186  -2.783  1.00 103.34 ? 56  DA  D N3    1 
ATOM   1086  C C4    . DA  B 2 28  ? 55.199  -29.668  -3.513  1.00 99.18  ? 56  DA  D C4    1 
ATOM   1087  P P     . DT  B 2 29  ? 51.990  -23.292  -4.270  1.00 134.53 ? 57  DT  D P     1 
ATOM   1088  O OP1   . DT  B 2 29  ? 52.483  -22.059  -3.595  1.00 137.97 ? 57  DT  D OP1   1 
ATOM   1089  O OP2   . DT  B 2 29  ? 50.524  -23.540  -4.370  1.00 121.66 ? 57  DT  D OP2   1 
ATOM   1090  O "O5'" . DT  B 2 29  ? 52.622  -23.324  -5.732  1.00 135.29 ? 57  DT  D "O5'" 1 
ATOM   1091  C "C5'" . DT  B 2 29  ? 54.039  -23.144  -5.938  1.00 143.05 ? 57  DT  D "C5'" 1 
ATOM   1092  C "C4'" . DT  B 2 29  ? 54.457  -23.749  -7.258  1.00 150.84 ? 57  DT  D "C4'" 1 
ATOM   1093  O "O4'" . DT  B 2 29  ? 53.878  -25.073  -7.384  1.00 156.02 ? 57  DT  D "O4'" 1 
ATOM   1094  C "C3'" . DT  B 2 29  ? 54.006  -22.969  -8.497  1.00 156.63 ? 57  DT  D "C3'" 1 
ATOM   1095  O "O3'" . DT  B 2 29  ? 55.054  -22.903  -9.475  1.00 159.87 ? 57  DT  D "O3'" 1 
ATOM   1096  C "C2'" . DT  B 2 29  ? 52.812  -23.763  -8.999  1.00 158.42 ? 57  DT  D "C2'" 1 
ATOM   1097  C "C1'" . DT  B 2 29  ? 53.194  -25.182  -8.620  1.00 153.94 ? 57  DT  D "C1'" 1 
ATOM   1098  N N1    . DT  B 2 29  ? 52.064  -26.126  -8.444  1.00 147.77 ? 57  DT  D N1    1 
ATOM   1099  C C2    . DT  B 2 29  ? 51.720  -26.912  -9.520  1.00 147.12 ? 57  DT  D C2    1 
ATOM   1100  O O2    . DT  B 2 29  ? 52.294  -26.858  -10.595 1.00 144.92 ? 57  DT  D O2    1 
ATOM   1101  N N3    . DT  B 2 29  ? 50.673  -27.772  -9.291  1.00 145.17 ? 57  DT  D N3    1 
ATOM   1102  C C4    . DT  B 2 29  ? 49.955  -27.919  -8.119  1.00 140.72 ? 57  DT  D C4    1 
ATOM   1103  O O4    . DT  B 2 29  ? 49.038  -28.733  -8.062  1.00 142.30 ? 57  DT  D O4    1 
ATOM   1104  C C5    . DT  B 2 29  ? 50.370  -27.065  -7.031  1.00 142.58 ? 57  DT  D C5    1 
ATOM   1105  C C7    . DT  B 2 29  ? 49.646  -27.154  -5.724  1.00 143.17 ? 57  DT  D C7    1 
ATOM   1106  C C6    . DT  B 2 29  ? 51.389  -26.220  -7.245  1.00 145.10 ? 57  DT  D C6    1 
ATOM   1107  P P     . DA  B 2 30  ? 55.471  -21.494  -10.126 1.00 164.07 ? 58  DA  D P     1 
ATOM   1108  O OP1   . DA  B 2 30  ? 56.533  -21.748  -11.134 1.00 159.67 ? 58  DA  D OP1   1 
ATOM   1109  O OP2   . DA  B 2 30  ? 55.733  -20.538  -9.022  1.00 170.59 ? 58  DA  D OP2   1 
ATOM   1110  O "O5'" . DA  B 2 30  ? 54.138  -21.028  -10.863 1.00 168.30 ? 58  DA  D "O5'" 1 
ATOM   1111  C "C5'" . DA  B 2 30  ? 53.992  -21.148  -12.291 1.00 183.98 ? 58  DA  D "C5'" 1 
ATOM   1112  C "C4'" . DA  B 2 30  ? 52.551  -20.926  -12.693 1.00 197.82 ? 58  DA  D "C4'" 1 
ATOM   1113  O "O4'" . DA  B 2 30  ? 51.671  -21.458  -11.671 1.00 203.12 ? 58  DA  D "O4'" 1 
ATOM   1114  C "C3'" . DA  B 2 30  ? 52.142  -19.462  -12.885 1.00 209.33 ? 58  DA  D "C3'" 1 
ATOM   1115  O "O3'" . DA  B 2 30  ? 51.330  -19.323  -14.061 1.00 219.25 ? 58  DA  D "O3'" 1 
ATOM   1116  C "C2'" . DA  B 2 30  ? 51.356  -19.150  -11.624 1.00 208.64 ? 58  DA  D "C2'" 1 
ATOM   1117  C "C1'" . DA  B 2 30  ? 50.691  -20.485  -11.350 1.00 204.64 ? 58  DA  D "C1'" 1 
ATOM   1118  N N9    . DA  B 2 30  ? 50.265  -20.707  -9.967  1.00 200.50 ? 58  DA  D N9    1 
ATOM   1119  C C8    . DA  B 2 30  ? 50.914  -20.347  -8.812  1.00 197.16 ? 58  DA  D C8    1 
ATOM   1120  N N7    . DA  B 2 30  ? 50.272  -20.682  -7.719  1.00 199.58 ? 58  DA  D N7    1 
ATOM   1121  C C5    . DA  B 2 30  ? 49.121  -21.302  -8.185  1.00 198.17 ? 58  DA  D C5    1 
ATOM   1122  C C6    . DA  B 2 30  ? 48.024  -21.884  -7.523  1.00 193.62 ? 58  DA  D C6    1 
ATOM   1123  N N6    . DA  B 2 30  ? 47.904  -21.938  -6.194  1.00 193.98 ? 58  DA  D N6    1 
ATOM   1124  N N1    . DA  B 2 30  ? 47.042  -22.416  -8.282  1.00 188.94 ? 58  DA  D N1    1 
ATOM   1125  C C2    . DA  B 2 30  ? 47.162  -22.363  -9.615  1.00 191.26 ? 58  DA  D C2    1 
ATOM   1126  N N3    . DA  B 2 30  ? 48.143  -21.844  -10.353 1.00 195.60 ? 58  DA  D N3    1 
ATOM   1127  C C4    . DA  B 2 30  ? 49.103  -21.323  -9.568  1.00 199.28 ? 58  DA  D C4    1 
ATOM   1128  P P     . DG  B 2 31  ? 50.951  -17.867  -14.635 1.00 218.76 ? 59  DG  D P     1 
ATOM   1129  O OP1   . DG  B 2 31  ? 50.722  -17.997  -16.098 1.00 219.28 ? 59  DG  D OP1   1 
ATOM   1130  O OP2   . DG  B 2 31  ? 51.956  -16.894  -14.136 1.00 219.15 ? 59  DG  D OP2   1 
ATOM   1131  O "O5'" . DG  B 2 31  ? 49.555  -17.549  -13.932 1.00 216.61 ? 59  DG  D "O5'" 1 
ATOM   1132  C "C5'" . DG  B 2 31  ? 48.337  -18.200  -14.352 1.00 214.49 ? 59  DG  D "C5'" 1 
ATOM   1133  C "C4'" . DG  B 2 31  ? 47.137  -17.592  -13.660 1.00 213.67 ? 59  DG  D "C4'" 1 
ATOM   1134  O "O4'" . DG  B 2 31  ? 47.105  -18.006  -12.273 1.00 215.41 ? 59  DG  D "O4'" 1 
ATOM   1135  C "C3'" . DG  B 2 31  ? 47.090  -16.059  -13.652 1.00 212.96 ? 59  DG  D "C3'" 1 
ATOM   1136  O "O3'" . DG  B 2 31  ? 45.804  -15.585  -14.066 1.00 207.57 ? 59  DG  D "O3'" 1 
ATOM   1137  C "C2'" . DG  B 2 31  ? 47.377  -15.691  -12.206 1.00 212.74 ? 59  DG  D "C2'" 1 
ATOM   1138  C "C1'" . DG  B 2 31  ? 46.820  -16.885  -11.454 1.00 213.67 ? 59  DG  D "C1'" 1 
ATOM   1139  N N9    . DG  B 2 31  ? 47.401  -17.132  -10.136 1.00 211.70 ? 59  DG  D N9    1 
ATOM   1140  C C8    . DG  B 2 31  ? 48.731  -17.101  -9.791  1.00 209.06 ? 59  DG  D C8    1 
ATOM   1141  N N7    . DG  B 2 31  ? 48.940  -17.375  -8.532  1.00 205.60 ? 59  DG  D N7    1 
ATOM   1142  C C5    . DG  B 2 31  ? 47.672  -17.606  -8.015  1.00 208.28 ? 59  DG  D C5    1 
ATOM   1143  C C6    . DG  B 2 31  ? 47.263  -17.948  -6.699  1.00 207.57 ? 59  DG  D C6    1 
ATOM   1144  O O6    . DG  B 2 31  ? 47.963  -18.121  -5.694  1.00 204.00 ? 59  DG  D O6    1 
ATOM   1145  N N1    . DG  B 2 31  ? 45.881  -18.087  -6.613  1.00 208.70 ? 59  DG  D N1    1 
ATOM   1146  C C2    . DG  B 2 31  ? 45.004  -17.920  -7.657  1.00 207.34 ? 59  DG  D C2    1 
ATOM   1147  N N2    . DG  B 2 31  ? 43.705  -18.098  -7.375  1.00 206.34 ? 59  DG  D N2    1 
ATOM   1148  N N3    . DG  B 2 31  ? 45.372  -17.602  -8.888  1.00 206.90 ? 59  DG  D N3    1 
ATOM   1149  C C4    . DG  B 2 31  ? 46.711  -17.461  -8.993  1.00 209.65 ? 59  DG  D C4    1 
ATOM   1150  O OP3   . DG  C 1 1   ? 24.018  -54.701  -4.386  1.00 190.52 ? 4   DG  E OP3   1 
ATOM   1151  P P     . DG  C 1 1   ? 23.156  -53.762  -3.622  1.00 192.54 ? 4   DG  E P     1 
ATOM   1152  O OP1   . DG  C 1 1   ? 23.706  -53.674  -2.243  1.00 189.71 ? 4   DG  E OP1   1 
ATOM   1153  O OP2   . DG  C 1 1   ? 21.734  -54.145  -3.822  1.00 189.05 ? 4   DG  E OP2   1 
ATOM   1154  O "O5'" . DG  C 1 1   ? 23.401  -52.356  -4.332  1.00 182.24 ? 4   DG  E "O5'" 1 
ATOM   1155  C "C5'" . DG  C 1 1   ? 22.849  -52.063  -5.631  1.00 165.40 ? 4   DG  E "C5'" 1 
ATOM   1156  C "C4'" . DG  C 1 1   ? 23.861  -51.328  -6.480  1.00 151.77 ? 4   DG  E "C4'" 1 
ATOM   1157  O "O4'" . DG  C 1 1   ? 24.600  -50.387  -5.662  1.00 144.09 ? 4   DG  E "O4'" 1 
ATOM   1158  C "C3'" . DG  C 1 1   ? 24.921  -52.216  -7.127  1.00 145.95 ? 4   DG  E "C3'" 1 
ATOM   1159  O "O3'" . DG  C 1 1   ? 25.320  -51.621  -8.368  1.00 146.90 ? 4   DG  E "O3'" 1 
ATOM   1160  C "C2'" . DG  C 1 1   ? 26.040  -52.179  -6.106  1.00 144.48 ? 4   DG  E "C2'" 1 
ATOM   1161  C "C1'" . DG  C 1 1   ? 25.983  -50.722  -5.688  1.00 142.46 ? 4   DG  E "C1'" 1 
ATOM   1162  N N9    . DG  C 1 1   ? 26.544  -50.424  -4.374  1.00 140.28 ? 4   DG  E N9    1 
ATOM   1163  C C8    . DG  C 1 1   ? 26.098  -50.880  -3.157  1.00 139.63 ? 4   DG  E C8    1 
ATOM   1164  N N7    . DG  C 1 1   ? 26.799  -50.428  -2.153  1.00 139.16 ? 4   DG  E N7    1 
ATOM   1165  C C5    . DG  C 1 1   ? 27.765  -49.623  -2.743  1.00 139.85 ? 4   DG  E C5    1 
ATOM   1166  C C6    . DG  C 1 1   ? 28.809  -48.863  -2.158  1.00 142.68 ? 4   DG  E C6    1 
ATOM   1167  O O6    . DG  C 1 1   ? 29.100  -48.746  -0.962  1.00 151.71 ? 4   DG  E O6    1 
ATOM   1168  N N1    . DG  C 1 1   ? 29.557  -48.194  -3.122  1.00 137.44 ? 4   DG  E N1    1 
ATOM   1169  C C2    . DG  C 1 1   ? 29.329  -48.247  -4.475  1.00 132.89 ? 4   DG  E C2    1 
ATOM   1170  N N2    . DG  C 1 1   ? 30.159  -47.531  -5.246  1.00 129.55 ? 4   DG  E N2    1 
ATOM   1171  N N3    . DG  C 1 1   ? 28.355  -48.948  -5.032  1.00 132.59 ? 4   DG  E N3    1 
ATOM   1172  C C4    . DG  C 1 1   ? 27.618  -49.608  -4.113  1.00 136.71 ? 4   DG  E C4    1 
ATOM   1173  P P     . DG  C 1 2   ? 26.399  -52.340  -9.309  1.00 148.78 ? 5   DG  E P     1 
ATOM   1174  O OP1   . DG  C 1 2   ? 25.911  -52.259  -10.710 1.00 144.91 ? 5   DG  E OP1   1 
ATOM   1175  O OP2   . DG  C 1 2   ? 26.711  -53.667  -8.716  1.00 144.54 ? 5   DG  E OP2   1 
ATOM   1176  O "O5'" . DG  C 1 2   ? 27.686  -51.409  -9.164  1.00 144.51 ? 5   DG  E "O5'" 1 
ATOM   1177  C "C5'" . DG  C 1 2   ? 27.915  -50.267  -10.022 1.00 137.18 ? 5   DG  E "C5'" 1 
ATOM   1178  C "C4'" . DG  C 1 2   ? 29.395  -49.971  -10.126 1.00 132.53 ? 5   DG  E "C4'" 1 
ATOM   1179  O "O4'" . DG  C 1 2   ? 29.938  -49.671  -8.816  1.00 127.34 ? 5   DG  E "O4'" 1 
ATOM   1180  C "C3'" . DG  C 1 2   ? 30.246  -51.115  -10.679 1.00 124.29 ? 5   DG  E "C3'" 1 
ATOM   1181  O "O3'" . DG  C 1 2   ? 31.297  -50.613  -11.515 1.00 120.61 ? 5   DG  E "O3'" 1 
ATOM   1182  C "C2'" . DG  C 1 2   ? 30.788  -51.781  -9.428  1.00 119.70 ? 5   DG  E "C2'" 1 
ATOM   1183  C "C1'" . DG  C 1 2   ? 30.940  -50.617  -8.462  1.00 115.05 ? 5   DG  E "C1'" 1 
ATOM   1184  N N9    . DG  C 1 2   ? 30.735  -50.983  -7.065  1.00 102.32 ? 5   DG  E N9    1 
ATOM   1185  C C8    . DG  C 1 2   ? 29.593  -51.507  -6.511  1.00 99.54  ? 5   DG  E C8    1 
ATOM   1186  N N7    . DG  C 1 2   ? 29.704  -51.743  -5.233  1.00 95.76  ? 5   DG  E N7    1 
ATOM   1187  C C5    . DG  C 1 2   ? 30.999  -51.352  -4.923  1.00 89.54  ? 5   DG  E C5    1 
ATOM   1188  C C6    . DG  C 1 2   ? 31.693  -51.373  -3.686  1.00 88.86  ? 5   DG  E C6    1 
ATOM   1189  O O6    . DG  C 1 2   ? 31.285  -51.750  -2.581  1.00 84.84  ? 5   DG  E O6    1 
ATOM   1190  N N1    . DG  C 1 2   ? 32.991  -50.889  -3.820  1.00 86.14  ? 5   DG  E N1    1 
ATOM   1191  C C2    . DG  C 1 2   ? 33.549  -50.440  -4.993  1.00 86.83  ? 5   DG  E C2    1 
ATOM   1192  N N2    . DG  C 1 2   ? 34.815  -50.006  -4.921  1.00 83.93  ? 5   DG  E N2    1 
ATOM   1193  N N3    . DG  C 1 2   ? 32.912  -50.417  -6.153  1.00 89.02  ? 5   DG  E N3    1 
ATOM   1194  C C4    . DG  C 1 2   ? 31.650  -50.882  -6.044  1.00 91.57  ? 5   DG  E C4    1 
ATOM   1195  P P     . DT  C 1 3   ? 32.265  -51.625  -12.293 1.00 116.63 ? 6   DT  E P     1 
ATOM   1196  O OP1   . DT  C 1 3   ? 32.689  -50.980  -13.564 1.00 112.79 ? 6   DT  E OP1   1 
ATOM   1197  O OP2   . DT  C 1 3   ? 31.616  -52.962  -12.318 1.00 115.46 ? 6   DT  E OP2   1 
ATOM   1198  O "O5'" . DT  C 1 3   ? 33.539  -51.697  -11.343 1.00 105.91 ? 6   DT  E "O5'" 1 
ATOM   1199  C "C5'" . DT  C 1 3   ? 34.230  -50.495  -10.973 1.00 99.35  ? 6   DT  E "C5'" 1 
ATOM   1200  C "C4'" . DT  C 1 3   ? 35.518  -50.832  -10.262 1.00 95.19  ? 6   DT  E "C4'" 1 
ATOM   1201  O "O4'" . DT  C 1 3   ? 35.236  -51.195  -8.889  1.00 92.65  ? 6   DT  E "O4'" 1 
ATOM   1202  C "C3'" . DT  C 1 3   ? 36.301  -52.005  -10.853 1.00 89.12  ? 6   DT  E "C3'" 1 
ATOM   1203  O "O3'" . DT  C 1 3   ? 37.697  -51.694  -10.773 1.00 90.33  ? 6   DT  E "O3'" 1 
ATOM   1204  C "C2'" . DT  C 1 3   ? 35.921  -53.164  -9.950  1.00 85.39  ? 6   DT  E "C2'" 1 
ATOM   1205  C "C1'" . DT  C 1 3   ? 35.797  -52.468  -8.604  1.00 81.66  ? 6   DT  E "C1'" 1 
ATOM   1206  N N1    . DT  C 1 3   ? 34.937  -53.119  -7.592  1.00 72.12  ? 6   DT  E N1    1 
ATOM   1207  C C2    . DT  C 1 3   ? 35.387  -53.171  -6.290  1.00 72.31  ? 6   DT  E C2    1 
ATOM   1208  O O2    . DT  C 1 3   ? 36.477  -52.746  -5.943  1.00 74.99  ? 6   DT  E O2    1 
ATOM   1209  N N3    . DT  C 1 3   ? 34.516  -53.760  -5.407  1.00 69.52  ? 6   DT  E N3    1 
ATOM   1210  C C4    . DT  C 1 3   ? 33.263  -54.273  -5.687  1.00 70.93  ? 6   DT  E C4    1 
ATOM   1211  O O4    . DT  C 1 3   ? 32.591  -54.772  -4.786  1.00 69.59  ? 6   DT  E O4    1 
ATOM   1212  C C5    . DT  C 1 3   ? 32.849  -54.169  -7.069  1.00 69.56  ? 6   DT  E C5    1 
ATOM   1213  C C7    . DT  C 1 3   ? 31.506  -54.696  -7.467  1.00 68.69  ? 6   DT  E C7    1 
ATOM   1214  C C6    . DT  C 1 3   ? 33.693  -53.598  -7.938  1.00 68.10  ? 6   DT  E C6    1 
ATOM   1215  P P     . DG  C 1 4   ? 38.769  -52.511  -11.635 1.00 87.19  ? 7   DG  E P     1 
ATOM   1216  O OP1   . DG  C 1 4   ? 39.629  -51.533  -12.352 1.00 85.64  ? 7   DG  E OP1   1 
ATOM   1217  O OP2   . DG  C 1 4   ? 38.042  -53.545  -12.412 1.00 86.87  ? 7   DG  E OP2   1 
ATOM   1218  O "O5'" . DG  C 1 4   ? 39.664  -53.191  -10.506 1.00 80.62  ? 7   DG  E "O5'" 1 
ATOM   1219  C "C5'" . DG  C 1 4   ? 40.311  -52.392  -9.500  1.00 77.43  ? 7   DG  E "C5'" 1 
ATOM   1220  C "C4'" . DG  C 1 4   ? 40.610  -53.223  -8.275  1.00 78.49  ? 7   DG  E "C4'" 1 
ATOM   1221  O "O4'" . DG  C 1 4   ? 39.382  -53.639  -7.638  1.00 78.38  ? 7   DG  E "O4'" 1 
ATOM   1222  C "C3'" . DG  C 1 4   ? 41.401  -54.507  -8.546  1.00 78.50  ? 7   DG  E "C3'" 1 
ATOM   1223  O "O3'" . DG  C 1 4   ? 42.717  -54.382  -8.001  1.00 76.99  ? 7   DG  E "O3'" 1 
ATOM   1224  C "C2'" . DG  C 1 4   ? 40.577  -55.615  -7.896  1.00 76.01  ? 7   DG  E "C2'" 1 
ATOM   1225  C "C1'" . DG  C 1 4   ? 39.626  -54.867  -6.981  1.00 72.19  ? 7   DG  E "C1'" 1 
ATOM   1226  N N9    . DG  C 1 4   ? 38.336  -55.507  -6.743  1.00 63.37  ? 7   DG  E N9    1 
ATOM   1227  C C8    . DG  C 1 4   ? 37.336  -55.713  -7.662  1.00 62.30  ? 7   DG  E C8    1 
ATOM   1228  N N7    . DG  C 1 4   ? 36.275  -56.274  -7.148  1.00 60.60  ? 7   DG  E N7    1 
ATOM   1229  C C5    . DG  C 1 4   ? 36.594  -56.451  -5.809  1.00 58.83  ? 7   DG  E C5    1 
ATOM   1230  C C6    . DG  C 1 4   ? 35.832  -57.009  -4.748  1.00 62.19  ? 7   DG  E C6    1 
ATOM   1231  O O6    . DG  C 1 4   ? 34.688  -57.481  -4.784  1.00 65.44  ? 7   DG  E O6    1 
ATOM   1232  N N1    . DG  C 1 4   ? 36.533  -56.988  -3.548  1.00 60.44  ? 7   DG  E N1    1 
ATOM   1233  C C2    . DG  C 1 4   ? 37.806  -56.496  -3.387  1.00 65.41  ? 7   DG  E C2    1 
ATOM   1234  N N2    . DG  C 1 4   ? 38.314  -56.563  -2.146  1.00 67.03  ? 7   DG  E N2    1 
ATOM   1235  N N3    . DG  C 1 4   ? 38.524  -55.966  -4.367  1.00 60.63  ? 7   DG  E N3    1 
ATOM   1236  C C4    . DG  C 1 4   ? 37.860  -55.976  -5.541  1.00 58.02  ? 7   DG  E C4    1 
ATOM   1237  P P     . DT  C 1 5   ? 43.763  -55.552  -8.201  1.00 69.85  ? 8   DT  E P     1 
ATOM   1238  O OP1   . DT  C 1 5   ? 45.127  -54.994  -8.084  1.00 61.02  ? 8   DT  E OP1   1 
ATOM   1239  O OP2   . DT  C 1 5   ? 43.376  -56.280  -9.442  1.00 75.22  ? 8   DT  E OP2   1 
ATOM   1240  O "O5'" . DT  C 1 5   ? 43.542  -56.416  -6.885  1.00 66.36  ? 8   DT  E "O5'" 1 
ATOM   1241  C "C5'" . DT  C 1 5   ? 43.945  -55.874  -5.623  1.00 70.68  ? 8   DT  E "C5'" 1 
ATOM   1242  C "C4'" . DT  C 1 5   ? 43.665  -56.854  -4.508  1.00 76.54  ? 8   DT  E "C4'" 1 
ATOM   1243  O "O4'" . DT  C 1 5   ? 42.255  -57.167  -4.455  1.00 74.35  ? 8   DT  E "O4'" 1 
ATOM   1244  C "C3'" . DT  C 1 5   ? 44.408  -58.188  -4.629  1.00 78.48  ? 8   DT  E "C3'" 1 
ATOM   1245  O "O3'" . DT  C 1 5   ? 45.310  -58.279  -3.515  1.00 82.51  ? 8   DT  E "O3'" 1 
ATOM   1246  C "C2'" . DT  C 1 5   ? 43.302  -59.235  -4.695  1.00 74.64  ? 8   DT  E "C2'" 1 
ATOM   1247  C "C1'" . DT  C 1 5   ? 42.093  -58.526  -4.108  1.00 68.66  ? 8   DT  E "C1'" 1 
ATOM   1248  N N1    . DT  C 1 5   ? 40.775  -58.953  -4.614  1.00 63.11  ? 8   DT  E N1    1 
ATOM   1249  C C2    . DT  C 1 5   ? 39.818  -59.342  -3.702  1.00 67.06  ? 8   DT  E C2    1 
ATOM   1250  O O2    . DT  C 1 5   ? 40.023  -59.399  -2.500  1.00 76.03  ? 8   DT  E O2    1 
ATOM   1251  N N3    . DT  C 1 5   ? 38.608  -59.685  -4.255  1.00 63.72  ? 8   DT  E N3    1 
ATOM   1252  C C4    . DT  C 1 5   ? 38.264  -59.656  -5.592  1.00 62.31  ? 8   DT  E C4    1 
ATOM   1253  O O4    . DT  C 1 5   ? 37.132  -59.984  -5.940  1.00 64.38  ? 8   DT  E O4    1 
ATOM   1254  C C5    . DT  C 1 5   ? 39.313  -59.233  -6.491  1.00 59.72  ? 8   DT  E C5    1 
ATOM   1255  C C7    . DT  C 1 5   ? 39.029  -59.174  -7.959  1.00 58.06  ? 8   DT  E C7    1 
ATOM   1256  C C6    . DT  C 1 5   ? 40.497  -58.897  -5.962  1.00 59.59  ? 8   DT  E C6    1 
ATOM   1257  P P     . DA  C 1 6   ? 46.207  -59.574  -3.294  1.00 81.46  ? 9   DA  E P     1 
ATOM   1258  O OP1   . DA  C 1 6   ? 47.329  -59.213  -2.397  1.00 83.42  ? 9   DA  E OP1   1 
ATOM   1259  O OP2   . DA  C 1 6   ? 46.485  -60.173  -4.623  1.00 78.39  ? 9   DA  E OP2   1 
ATOM   1260  O "O5'" . DA  C 1 6   ? 45.253  -60.507  -2.430  1.00 81.67  ? 9   DA  E "O5'" 1 
ATOM   1261  C "C5'" . DA  C 1 6   ? 44.729  -60.041  -1.178  1.00 82.16  ? 9   DA  E "C5'" 1 
ATOM   1262  C "C4'" . DA  C 1 6   ? 43.867  -61.108  -0.544  1.00 86.42  ? 9   DA  E "C4'" 1 
ATOM   1263  O "O4'" . DA  C 1 6   ? 42.662  -61.302  -1.324  1.00 83.49  ? 9   DA  E "O4'" 1 
ATOM   1264  C "C3'" . DA  C 1 6   ? 44.516  -62.488  -0.443  1.00 82.32  ? 9   DA  E "C3'" 1 
ATOM   1265  O "O3'" . DA  C 1 6   ? 44.055  -63.127  0.750   1.00 87.37  ? 9   DA  E "O3'" 1 
ATOM   1266  C "C2'" . DA  C 1 6   ? 43.968  -63.210  -1.656  1.00 77.10  ? 9   DA  E "C2'" 1 
ATOM   1267  C "C1'" . DA  C 1 6   ? 42.550  -62.674  -1.670  1.00 73.79  ? 9   DA  E "C1'" 1 
ATOM   1268  N N9    . DA  C 1 6   ? 41.845  -62.755  -2.944  1.00 65.36  ? 9   DA  E N9    1 
ATOM   1269  C C8    . DA  C 1 6   ? 42.331  -62.621  -4.223  1.00 64.61  ? 9   DA  E C8    1 
ATOM   1270  N N7    . DA  C 1 6   ? 41.411  -62.729  -5.151  1.00 60.23  ? 9   DA  E N7    1 
ATOM   1271  C C5    . DA  C 1 6   ? 40.241  -62.946  -4.436  1.00 58.14  ? 9   DA  E C5    1 
ATOM   1272  C C6    . DA  C 1 6   ? 38.910  -63.146  -4.840  1.00 58.59  ? 9   DA  E C6    1 
ATOM   1273  N N6    . DA  C 1 6   ? 38.520  -63.161  -6.115  1.00 58.79  ? 9   DA  E N6    1 
ATOM   1274  N N1    . DA  C 1 6   ? 37.982  -63.336  -3.874  1.00 57.73  ? 9   DA  E N1    1 
ATOM   1275  C C2    . DA  C 1 6   ? 38.378  -63.327  -2.592  1.00 59.75  ? 9   DA  E C2    1 
ATOM   1276  N N3    . DA  C 1 6   ? 39.599  -63.145  -2.090  1.00 57.48  ? 9   DA  E N3    1 
ATOM   1277  C C4    . DA  C 1 6   ? 40.494  -62.960  -3.076  1.00 58.85  ? 9   DA  E C4    1 
ATOM   1278  P P     . DC  C 1 7   ? 45.046  -64.029  1.608   1.00 94.63  ? 10  DC  E P     1 
ATOM   1279  O OP1   . DC  C 1 7   ? 45.406  -63.273  2.838   1.00 90.23  ? 10  DC  E OP1   1 
ATOM   1280  O OP2   . DC  C 1 7   ? 46.122  -64.510  0.702   1.00 91.14  ? 10  DC  E OP2   1 
ATOM   1281  O "O5'" . DC  C 1 7   ? 44.122  -65.256  2.031   1.00 91.95  ? 10  DC  E "O5'" 1 
ATOM   1282  C "C5'" . DC  C 1 7   ? 43.224  -65.142  3.149   1.00 95.74  ? 10  DC  E "C5'" 1 
ATOM   1283  C "C4'" . DC  C 1 7   ? 41.893  -65.770  2.813   1.00 99.56  ? 10  DC  E "C4'" 1 
ATOM   1284  O "O4'" . DC  C 1 7   ? 41.511  -65.431  1.465   1.00 97.71  ? 10  DC  E "O4'" 1 
ATOM   1285  C "C3'" . DC  C 1 7   ? 41.884  -67.297  2.862   1.00 104.58 ? 10  DC  E "C3'" 1 
ATOM   1286  O "O3'" . DC  C 1 7   ? 41.339  -67.763  4.100   1.00 114.51 ? 10  DC  E "O3'" 1 
ATOM   1287  C "C2'" . DC  C 1 7   ? 41.012  -67.707  1.682   1.00 100.43 ? 10  DC  E "C2'" 1 
ATOM   1288  C "C1'" . DC  C 1 7   ? 40.578  -66.402  1.040   1.00 89.40  ? 10  DC  E "C1'" 1 
ATOM   1289  N N1    . DC  C 1 7   ? 40.592  -66.436  -0.428  1.00 80.27  ? 10  DC  E N1    1 
ATOM   1290  C C2    . DC  C 1 7   ? 39.392  -66.680  -1.102  1.00 78.54  ? 10  DC  E C2    1 
ATOM   1291  O O2    . DC  C 1 7   ? 38.358  -66.846  -0.441  1.00 81.57  ? 10  DC  E O2    1 
ATOM   1292  N N3    . DC  C 1 7   ? 39.388  -66.722  -2.454  1.00 75.12  ? 10  DC  E N3    1 
ATOM   1293  C C4    . DC  C 1 7   ? 40.525  -66.534  -3.129  1.00 78.81  ? 10  DC  E C4    1 
ATOM   1294  N N4    . DC  C 1 7   ? 40.476  -66.580  -4.463  1.00 80.77  ? 10  DC  E N4    1 
ATOM   1295  C C5    . DC  C 1 7   ? 41.766  -66.299  -2.466  1.00 74.16  ? 10  DC  E C5    1 
ATOM   1296  C C6    . DC  C 1 7   ? 41.755  -66.265  -1.127  1.00 75.92  ? 10  DC  E C6    1 
ATOM   1297  P P     . DA  C 1 8   ? 41.394  -69.321  4.455   1.00 119.89 ? 11  DA  E P     1 
ATOM   1298  O OP1   . DA  C 1 8   ? 41.057  -69.472  5.894   1.00 118.36 ? 11  DA  E OP1   1 
ATOM   1299  O OP2   . DA  C 1 8   ? 42.674  -69.873  3.929   1.00 113.25 ? 11  DA  E OP2   1 
ATOM   1300  O "O5'" . DA  C 1 8   ? 40.206  -69.927  3.585   1.00 115.29 ? 11  DA  E "O5'" 1 
ATOM   1301  C "C5'" . DA  C 1 8   ? 38.829  -69.747  3.968   1.00 114.02 ? 11  DA  E "C5'" 1 
ATOM   1302  C "C4'" . DA  C 1 8   ? 37.934  -70.509  3.019   1.00 111.33 ? 11  DA  E "C4'" 1 
ATOM   1303  O "O4'" . DA  C 1 8   ? 38.122  -69.990  1.684   1.00 106.08 ? 11  DA  E "O4'" 1 
ATOM   1304  C "C3'" . DA  C 1 8   ? 38.226  -72.011  2.944   1.00 110.59 ? 11  DA  E "C3'" 1 
ATOM   1305  O "O3'" . DA  C 1 8   ? 37.127  -72.792  3.418   1.00 116.32 ? 11  DA  E "O3'" 1 
ATOM   1306  C "C2'" . DA  C 1 8   ? 38.489  -72.286  1.472   1.00 103.33 ? 11  DA  E "C2'" 1 
ATOM   1307  C "C1'" . DA  C 1 8   ? 38.022  -71.041  0.749   1.00 95.25  ? 11  DA  E "C1'" 1 
ATOM   1308  N N9    . DA  C 1 8   ? 38.858  -70.697  -0.398  1.00 83.05  ? 11  DA  E N9    1 
ATOM   1309  C C8    . DA  C 1 8   ? 40.194  -70.377  -0.403  1.00 81.72  ? 11  DA  E C8    1 
ATOM   1310  N N7    . DA  C 1 8   ? 40.672  -70.125  -1.598  1.00 75.94  ? 11  DA  E N7    1 
ATOM   1311  C C5    . DA  C 1 8   ? 39.580  -70.296  -2.436  1.00 70.14  ? 11  DA  E C5    1 
ATOM   1312  C C6    . DA  C 1 8   ? 39.428  -70.172  -3.828  1.00 67.70  ? 11  DA  E C6    1 
ATOM   1313  N N6    . DA  C 1 8   ? 40.423  -69.833  -4.652  1.00 66.06  ? 11  DA  E N6    1 
ATOM   1314  N N1    . DA  C 1 8   ? 38.204  -70.408  -4.350  1.00 66.29  ? 11  DA  E N1    1 
ATOM   1315  C C2    . DA  C 1 8   ? 37.206  -70.746  -3.519  1.00 71.00  ? 11  DA  E C2    1 
ATOM   1316  N N3    . DA  C 1 8   ? 37.226  -70.892  -2.195  1.00 70.19  ? 11  DA  E N3    1 
ATOM   1317  C C4    . DA  C 1 8   ? 38.456  -70.650  -1.711  1.00 71.62  ? 11  DA  E C4    1 
ATOM   1318  P P     . DA  C 1 9   ? 37.326  -74.352  3.718   1.00 120.34 ? 12  DA  E P     1 
ATOM   1319  O OP1   . DA  C 1 9   ? 37.268  -74.544  5.190   1.00 117.31 ? 12  DA  E OP1   1 
ATOM   1320  O OP2   . DA  C 1 9   ? 38.521  -74.827  2.968   1.00 114.49 ? 12  DA  E OP2   1 
ATOM   1321  O "O5'" . DA  C 1 9   ? 36.017  -74.990  3.072   1.00 119.99 ? 12  DA  E "O5'" 1 
ATOM   1322  C "C5'" . DA  C 1 9   ? 36.087  -76.163  2.243   1.00 115.91 ? 12  DA  E "C5'" 1 
ATOM   1323  C "C4'" . DA  C 1 9   ? 35.776  -75.813  0.807   1.00 112.81 ? 12  DA  E "C4'" 1 
ATOM   1324  O "O4'" . DA  C 1 9   ? 36.753  -74.890  0.291   1.00 106.35 ? 12  DA  E "O4'" 1 
ATOM   1325  C "C3'" . DA  C 1 9   ? 35.829  -77.004  -0.145  1.00 115.07 ? 12  DA  E "C3'" 1 
ATOM   1326  O "O3'" . DA  C 1 9   ? 34.545  -77.615  -0.287  1.00 118.92 ? 12  DA  E "O3'" 1 
ATOM   1327  C "C2'" . DA  C 1 9   ? 36.317  -76.409  -1.458  1.00 108.68 ? 12  DA  E "C2'" 1 
ATOM   1328  C "C1'" . DA  C 1 9   ? 36.719  -74.980  -1.124  1.00 98.63  ? 12  DA  E "C1'" 1 
ATOM   1329  N N9    . DA  C 1 9   ? 38.026  -74.570  -1.641  1.00 82.98  ? 12  DA  E N9    1 
ATOM   1330  C C8    . DA  C 1 9   ? 39.212  -74.415  -0.964  1.00 80.57  ? 12  DA  E C8    1 
ATOM   1331  N N7    . DA  C 1 9   ? 40.199  -73.992  -1.717  1.00 72.89  ? 12  DA  E N7    1 
ATOM   1332  C C5    . DA  C 1 9   ? 39.624  -73.856  -2.973  1.00 68.12  ? 12  DA  E C5    1 
ATOM   1333  C C6    . DA  C 1 9   ? 40.147  -73.448  -4.213  1.00 65.37  ? 12  DA  E C6    1 
ATOM   1334  N N6    . DA  C 1 9   ? 41.418  -73.090  -4.398  1.00 63.97  ? 12  DA  E N6    1 
ATOM   1335  N N1    . DA  C 1 9   ? 39.308  -73.427  -5.274  1.00 66.37  ? 12  DA  E N1    1 
ATOM   1336  C C2    . DA  C 1 9   ? 38.031  -73.795  -5.089  1.00 71.13  ? 12  DA  E C2    1 
ATOM   1337  N N3    . DA  C 1 9   ? 37.423  -74.196  -3.971  1.00 71.08  ? 12  DA  E N3    1 
ATOM   1338  C C4    . DA  C 1 9   ? 38.286  -74.210  -2.940  1.00 72.64  ? 12  DA  E C4    1 
ATOM   1339  P P     . DG  C 1 10  ? 34.444  -79.111  -0.824  1.00 116.23 ? 13  DG  E P     1 
ATOM   1340  O OP1   . DG  C 1 10  ? 33.012  -79.511  -0.796  1.00 117.04 ? 13  DG  E OP1   1 
ATOM   1341  O OP2   . DG  C 1 10  ? 35.450  -79.925  -0.090  1.00 113.42 ? 13  DG  E OP2   1 
ATOM   1342  O "O5'" . DG  C 1 10  ? 34.895  -78.975  -2.346  1.00 104.09 ? 13  DG  E "O5'" 1 
ATOM   1343  C "C5'" . DG  C 1 10  ? 33.920  -78.724  -3.371  1.00 102.40 ? 13  DG  E "C5'" 1 
ATOM   1344  C "C4'" . DG  C 1 10  ? 34.605  -78.517  -4.700  1.00 104.09 ? 13  DG  E "C4'" 1 
ATOM   1345  O "O4'" . DG  C 1 10  ? 35.798  -77.738  -4.504  1.00 99.13  ? 13  DG  E "O4'" 1 
ATOM   1346  C "C3'" . DG  C 1 10  ? 35.069  -79.799  -5.394  1.00 108.48 ? 13  DG  E "C3'" 1 
ATOM   1347  O "O3'" . DG  C 1 10  ? 34.128  -80.211  -6.396  1.00 118.03 ? 13  DG  E "O3'" 1 
ATOM   1348  C "C2'" . DG  C 1 10  ? 36.430  -79.437  -5.978  1.00 103.24 ? 13  DG  E "C2'" 1 
ATOM   1349  C "C1'" . DG  C 1 10  ? 36.645  -77.978  -5.608  1.00 94.75  ? 13  DG  E "C1'" 1 
ATOM   1350  N N9    . DG  C 1 10  ? 38.006  -77.643  -5.205  1.00 84.09  ? 13  DG  E N9    1 
ATOM   1351  C C8    . DG  C 1 10  ? 38.535  -77.730  -3.939  1.00 80.47  ? 13  DG  E C8    1 
ATOM   1352  N N7    . DG  C 1 10  ? 39.780  -77.345  -3.877  1.00 74.79  ? 13  DG  E N7    1 
ATOM   1353  C C5    . DG  C 1 10  ? 40.092  -76.978  -5.179  1.00 72.66  ? 13  DG  E C5    1 
ATOM   1354  C C6    . DG  C 1 10  ? 41.300  -76.480  -5.727  1.00 73.35  ? 13  DG  E C6    1 
ATOM   1355  O O6    . DG  C 1 10  ? 42.372  -76.256  -5.151  1.00 76.20  ? 13  DG  E O6    1 
ATOM   1356  N N1    . DG  C 1 10  ? 41.180  -76.229  -7.091  1.00 71.72  ? 13  DG  E N1    1 
ATOM   1357  C C2    . DG  C 1 10  ? 40.044  -76.436  -7.834  1.00 75.25  ? 13  DG  E C2    1 
ATOM   1358  N N2    . DG  C 1 10  ? 40.129  -76.142  -9.142  1.00 71.62  ? 13  DG  E N2    1 
ATOM   1359  N N3    . DG  C 1 10  ? 38.909  -76.906  -7.334  1.00 74.43  ? 13  DG  E N3    1 
ATOM   1360  C C4    . DG  C 1 10  ? 39.005  -77.150  -6.010  1.00 74.68  ? 13  DG  E C4    1 
ATOM   1361  P P     . DT  C 1 11  ? 34.229  -81.678  -7.053  1.00 122.87 ? 14  DT  E P     1 
ATOM   1362  O OP1   . DT  C 1 11  ? 32.999  -81.914  -7.854  1.00 115.50 ? 14  DT  E OP1   1 
ATOM   1363  O OP2   . DT  C 1 11  ? 34.614  -82.643  -5.987  1.00 113.72 ? 14  DT  E OP2   1 
ATOM   1364  O "O5'" . DT  C 1 11  ? 35.427  -81.520  -8.087  1.00 114.34 ? 14  DT  E "O5'" 1 
ATOM   1365  C "C5'" . DT  C 1 11  ? 35.343  -80.559  -9.151  1.00 111.83 ? 14  DT  E "C5'" 1 
ATOM   1366  C "C4'" . DT  C 1 11  ? 36.643  -80.528  -9.918  1.00 115.39 ? 14  DT  E "C4'" 1 
ATOM   1367  O "O4'" . DT  C 1 11  ? 37.669  -79.841  -9.175  1.00 113.54 ? 14  DT  E "O4'" 1 
ATOM   1368  C "C3'" . DT  C 1 11  ? 37.232  -81.901  -10.226 1.00 115.30 ? 14  DT  E "C3'" 1 
ATOM   1369  O "O3'" . DT  C 1 11  ? 36.663  -82.343  -11.465 1.00 121.46 ? 14  DT  E "O3'" 1 
ATOM   1370  C "C2'" . DT  C 1 11  ? 38.739  -81.661  -10.213 1.00 109.07 ? 14  DT  E "C2'" 1 
ATOM   1371  C "C1'" . DT  C 1 11  ? 38.920  -80.228  -9.723  1.00 101.24 ? 14  DT  E "C1'" 1 
ATOM   1372  N N1    . DT  C 1 11  ? 39.950  -80.050  -8.677  1.00 86.19  ? 14  DT  E N1    1 
ATOM   1373  C C2    . DT  C 1 11  ? 41.201  -79.590  -9.034  1.00 78.60  ? 14  DT  E C2    1 
ATOM   1374  O O2    . DT  C 1 11  ? 41.520  -79.339  -10.186 1.00 69.90  ? 14  DT  E O2    1 
ATOM   1375  N N3    . DT  C 1 11  ? 42.073  -79.435  -7.983  1.00 75.42  ? 14  DT  E N3    1 
ATOM   1376  C C4    . DT  C 1 11  ? 41.827  -79.696  -6.647  1.00 76.04  ? 14  DT  E C4    1 
ATOM   1377  O O4    . DT  C 1 11  ? 42.714  -79.523  -5.815  1.00 73.50  ? 14  DT  E O4    1 
ATOM   1378  C C5    . DT  C 1 11  ? 40.496  -80.173  -6.347  1.00 77.65  ? 14  DT  E C5    1 
ATOM   1379  C C7    . DT  C 1 11  ? 40.141  -80.489  -4.928  1.00 79.41  ? 14  DT  E C7    1 
ATOM   1380  C C6    . DT  C 1 11  ? 39.636  -80.321  -7.362  1.00 79.65  ? 14  DT  E C6    1 
ATOM   1381  P P     . DA  C 1 12  ? 37.377  -83.464  -12.346 1.00 123.44 ? 15  DA  E P     1 
ATOM   1382  O OP1   . DA  C 1 12  ? 36.319  -84.222  -13.059 1.00 127.88 ? 15  DA  E OP1   1 
ATOM   1383  O OP2   . DA  C 1 12  ? 38.347  -84.188  -11.488 1.00 119.12 ? 15  DA  E OP2   1 
ATOM   1384  O "O5'" . DA  C 1 12  ? 38.180  -82.607  -13.422 1.00 115.19 ? 15  DA  E "O5'" 1 
ATOM   1385  C "C5'" . DA  C 1 12  ? 39.009  -83.253  -14.397 1.00 106.73 ? 15  DA  E "C5'" 1 
ATOM   1386  C "C4'" . DA  C 1 12  ? 40.412  -82.699  -14.335 1.00 105.87 ? 15  DA  E "C4'" 1 
ATOM   1387  O "O4'" . DA  C 1 12  ? 40.744  -82.297  -12.983 1.00 101.19 ? 15  DA  E "O4'" 1 
ATOM   1388  C "C3'" . DA  C 1 12  ? 41.503  -83.685  -14.760 1.00 106.81 ? 15  DA  E "C3'" 1 
ATOM   1389  O "O3'" . DA  C 1 12  ? 42.375  -83.042  -15.688 1.00 107.00 ? 15  DA  E "O3'" 1 
ATOM   1390  C "C2'" . DA  C 1 12  ? 42.212  -84.026  -13.459 1.00 103.26 ? 15  DA  E "C2'" 1 
ATOM   1391  C "C1'" . DA  C 1 12  ? 42.063  -82.730  -12.698 1.00 97.07  ? 15  DA  E "C1'" 1 
ATOM   1392  N N9    . DA  C 1 12  ? 42.202  -82.822  -11.246 1.00 85.77  ? 15  DA  E N9    1 
ATOM   1393  C C8    . DA  C 1 12  ? 41.334  -83.393  -10.348 1.00 81.00  ? 15  DA  E C8    1 
ATOM   1394  N N7    . DA  C 1 12  ? 41.717  -83.282  -9.099  1.00 73.03  ? 15  DA  E N7    1 
ATOM   1395  C C5    . DA  C 1 12  ? 42.918  -82.593  -9.180  1.00 68.65  ? 15  DA  E C5    1 
ATOM   1396  C C6    . DA  C 1 12  ? 43.826  -82.165  -8.200  1.00 69.44  ? 15  DA  E C6    1 
ATOM   1397  N N6    . DA  C 1 12  ? 43.659  -82.383  -6.894  1.00 70.82  ? 15  DA  E N6    1 
ATOM   1398  N N1    . DA  C 1 12  ? 44.929  -81.499  -8.612  1.00 70.89  ? 15  DA  E N1    1 
ATOM   1399  C C2    . DA  C 1 12  ? 45.096  -81.285  -9.925  1.00 73.36  ? 15  DA  E C2    1 
ATOM   1400  N N3    . DA  C 1 12  ? 44.310  -81.639  -10.942 1.00 74.21  ? 15  DA  E N3    1 
ATOM   1401  C C4    . DA  C 1 12  ? 43.227  -82.299  -10.495 1.00 73.84  ? 15  DA  E C4    1 
ATOM   1402  P P     . DT  C 1 13  ? 43.294  -83.914  -16.650 1.00 113.86 ? 16  DT  E P     1 
ATOM   1403  O OP1   . DT  C 1 13  ? 42.908  -83.619  -18.055 1.00 118.98 ? 16  DT  E OP1   1 
ATOM   1404  O OP2   . DT  C 1 13  ? 43.282  -85.316  -16.147 1.00 114.75 ? 16  DT  E OP2   1 
ATOM   1405  O "O5'" . DT  C 1 13  ? 44.741  -83.311  -16.397 1.00 96.28  ? 16  DT  E "O5'" 1 
ATOM   1406  C "C5'" . DT  C 1 13  ? 45.266  -83.326  -15.073 1.00 88.42  ? 16  DT  E "C5'" 1 
ATOM   1407  C "C4'" . DT  C 1 13  ? 46.671  -82.784  -15.079 1.00 88.07  ? 16  DT  E "C4'" 1 
ATOM   1408  O "O4'" . DT  C 1 13  ? 47.024  -82.458  -13.719 1.00 92.18  ? 16  DT  E "O4'" 1 
ATOM   1409  C "C3'" . DT  C 1 13  ? 47.721  -83.783  -15.547 1.00 89.10  ? 16  DT  E "C3'" 1 
ATOM   1410  O "O3'" . DT  C 1 13  ? 48.814  -83.105  -16.181 1.00 95.87  ? 16  DT  E "O3'" 1 
ATOM   1411  C "C2'" . DT  C 1 13  ? 48.090  -84.501  -14.260 1.00 90.71  ? 16  DT  E "C2'" 1 
ATOM   1412  C "C1'" . DT  C 1 13  ? 47.908  -83.433  -13.183 1.00 83.11  ? 16  DT  E "C1'" 1 
ATOM   1413  N N1    . DT  C 1 13  ? 47.342  -83.889  -11.890 1.00 73.64  ? 16  DT  E N1    1 
ATOM   1414  C C2    . DT  C 1 13  ? 48.060  -83.632  -10.740 1.00 75.98  ? 16  DT  E C2    1 
ATOM   1415  O O2    . DT  C 1 13  ? 49.152  -83.084  -10.741 1.00 78.07  ? 16  DT  E O2    1 
ATOM   1416  N N3    . DT  C 1 13  ? 47.456  -84.057  -9.581  1.00 70.56  ? 16  DT  E N3    1 
ATOM   1417  C C4    . DT  C 1 13  ? 46.232  -84.691  -9.462  1.00 72.59  ? 16  DT  E C4    1 
ATOM   1418  O O4    . DT  C 1 13  ? 45.820  -85.023  -8.352  1.00 73.51  ? 16  DT  E O4    1 
ATOM   1419  C C5    . DT  C 1 13  ? 45.531  -84.919  -10.707 1.00 67.03  ? 16  DT  E C5    1 
ATOM   1420  C C7    . DT  C 1 13  ? 44.197  -85.596  -10.672 1.00 64.84  ? 16  DT  E C7    1 
ATOM   1421  C C6    . DT  C 1 13  ? 46.108  -84.503  -11.841 1.00 64.79  ? 16  DT  E C6    1 
ATOM   1422  P P     . DG  C 1 14  ? 49.757  -83.883  -17.229 1.00 105.06 ? 17  DG  E P     1 
ATOM   1423  O OP1   . DG  C 1 14  ? 50.659  -82.902  -17.888 1.00 101.58 ? 17  DG  E OP1   1 
ATOM   1424  O OP2   . DG  C 1 14  ? 48.898  -84.769  -18.059 1.00 103.14 ? 17  DG  E OP2   1 
ATOM   1425  O "O5'" . DG  C 1 14  ? 50.702  -84.737  -16.278 1.00 104.24 ? 17  DG  E "O5'" 1 
ATOM   1426  C "C5'" . DG  C 1 14  ? 51.663  -84.082  -15.431 1.00 102.49 ? 17  DG  E "C5'" 1 
ATOM   1427  C "C4'" . DG  C 1 14  ? 52.265  -85.089  -14.480 1.00 101.86 ? 17  DG  E "C4'" 1 
ATOM   1428  O "O4'" . DG  C 1 14  ? 51.323  -85.375  -13.415 1.00 96.07  ? 17  DG  E "O4'" 1 
ATOM   1429  C "C3'" . DG  C 1 14  ? 52.586  -86.435  -15.136 1.00 99.44  ? 17  DG  E "C3'" 1 
ATOM   1430  O "O3'" . DG  C 1 14  ? 53.890  -86.892  -14.770 1.00 101.44 ? 17  DG  E "O3'" 1 
ATOM   1431  C "C2'" . DG  C 1 14  ? 51.466  -87.337  -14.653 1.00 95.33  ? 17  DG  E "C2'" 1 
ATOM   1432  C "C1'" . DG  C 1 14  ? 51.220  -86.775  -13.268 1.00 88.45  ? 17  DG  E "C1'" 1 
ATOM   1433  N N9    . DG  C 1 14  ? 49.925  -87.085  -12.667 1.00 79.07  ? 17  DG  E N9    1 
ATOM   1434  C C8    . DG  C 1 14  ? 48.804  -87.577  -13.292 1.00 78.30  ? 17  DG  E C8    1 
ATOM   1435  N N7    . DG  C 1 14  ? 47.814  -87.797  -12.469 1.00 75.82  ? 17  DG  E N7    1 
ATOM   1436  C C5    . DG  C 1 14  ? 48.317  -87.444  -11.225 1.00 72.14  ? 17  DG  E C5    1 
ATOM   1437  C C6    . DG  C 1 14  ? 47.705  -87.473  -9.944  1.00 74.66  ? 17  DG  E C6    1 
ATOM   1438  O O6    . DG  C 1 14  ? 46.557  -87.823  -9.646  1.00 75.93  ? 17  DG  E O6    1 
ATOM   1439  N N1    . DG  C 1 14  ? 48.575  -87.029  -8.950  1.00 74.28  ? 17  DG  E N1    1 
ATOM   1440  C C2    . DG  C 1 14  ? 49.867  -86.611  -9.163  1.00 77.36  ? 17  DG  E C2    1 
ATOM   1441  N N2    . DG  C 1 14  ? 50.552  -86.219  -8.077  1.00 77.22  ? 17  DG  E N2    1 
ATOM   1442  N N3    . DG  C 1 14  ? 50.451  -86.586  -10.352 1.00 73.86  ? 17  DG  E N3    1 
ATOM   1443  C C4    . DG  C 1 14  ? 49.623  -87.013  -11.329 1.00 73.29  ? 17  DG  E C4    1 
ATOM   1444  P P     . DA  C 1 15  ? 54.837  -87.497  -15.896 1.00 111.34 ? 18  DA  E P     1 
ATOM   1445  O OP1   . DA  C 1 15  ? 55.110  -86.439  -16.901 1.00 104.87 ? 18  DA  E OP1   1 
ATOM   1446  O OP2   . DA  C 1 15  ? 54.243  -88.786  -16.331 1.00 121.78 ? 18  DA  E OP2   1 
ATOM   1447  O "O5'" . DA  C 1 15  ? 56.199  -87.790  -15.125 1.00 110.06 ? 18  DA  E "O5'" 1 
ATOM   1448  C "C5'" . DA  C 1 15  ? 56.884  -86.774  -14.374 1.00 100.10 ? 18  DA  E "C5'" 1 
ATOM   1449  C "C4'" . DA  C 1 15  ? 56.800  -87.104  -12.904 1.00 96.29  ? 18  DA  E "C4'" 1 
ATOM   1450  O "O4'" . DA  C 1 15  ? 55.415  -87.323  -12.575 1.00 91.92  ? 18  DA  E "O4'" 1 
ATOM   1451  C "C3'" . DA  C 1 15  ? 57.542  -88.378  -12.484 1.00 96.92  ? 18  DA  E "C3'" 1 
ATOM   1452  O "O3'" . DA  C 1 15  ? 58.685  -88.014  -11.700 1.00 100.42 ? 18  DA  E "O3'" 1 
ATOM   1453  C "C2'" . DA  C 1 15  ? 56.508  -89.199  -11.724 1.00 91.23  ? 18  DA  E "C2'" 1 
ATOM   1454  C "C1'" . DA  C 1 15  ? 55.333  -88.268  -11.531 1.00 87.04  ? 18  DA  E "C1'" 1 
ATOM   1455  N N9    . DA  C 1 15  ? 54.013  -88.888  -11.602 1.00 77.59  ? 18  DA  E N9    1 
ATOM   1456  C C8    . DA  C 1 15  ? 53.359  -89.351  -12.718 1.00 77.71  ? 18  DA  E C8    1 
ATOM   1457  N N7    . DA  C 1 15  ? 52.154  -89.807  -12.472 1.00 74.37  ? 18  DA  E N7    1 
ATOM   1458  C C5    . DA  C 1 15  ? 51.996  -89.614  -11.107 1.00 69.96  ? 18  DA  E C5    1 
ATOM   1459  C C6    . DA  C 1 15  ? 50.933  -89.889  -10.228 1.00 70.87  ? 18  DA  E C6    1 
ATOM   1460  N N6    . DA  C 1 15  ? 49.780  -90.443  -10.612 1.00 72.54  ? 18  DA  E N6    1 
ATOM   1461  N N1    . DA  C 1 15  ? 51.099  -89.580  -8.923  1.00 67.98  ? 18  DA  E N1    1 
ATOM   1462  C C2    . DA  C 1 15  ? 52.255  -89.021  -8.540  1.00 68.65  ? 18  DA  E C2    1 
ATOM   1463  N N3    . DA  C 1 15  ? 53.327  -88.713  -9.272  1.00 66.19  ? 18  DA  E N3    1 
ATOM   1464  C C4    . DA  C 1 15  ? 53.131  -89.043  -10.560 1.00 69.30  ? 18  DA  E C4    1 
ATOM   1465  P P     . DA  C 1 16  ? 59.479  -89.103  -10.826 1.00 102.79 ? 19  DA  E P     1 
ATOM   1466  O OP1   . DA  C 1 16  ? 60.915  -89.062  -11.221 1.00 99.59  ? 19  DA  E OP1   1 
ATOM   1467  O OP2   . DA  C 1 16  ? 58.730  -90.384  -10.855 1.00 107.26 ? 19  DA  E OP2   1 
ATOM   1468  O "O5'" . DA  C 1 16  ? 59.369  -88.523  -9.351  1.00 96.90  ? 19  DA  E "O5'" 1 
ATOM   1469  C "C5'" . DA  C 1 16  ? 59.653  -89.355  -8.226  1.00 90.96  ? 19  DA  E "C5'" 1 
ATOM   1470  C "C4'" . DA  C 1 16  ? 58.391  -89.593  -7.434  1.00 87.38  ? 19  DA  E "C4'" 1 
ATOM   1471  O "O4'" . DA  C 1 16  ? 57.297  -89.909  -8.312  1.00 82.66  ? 19  DA  E "O4'" 1 
ATOM   1472  C "C3'" . DA  C 1 16  ? 58.488  -90.777  -6.478  1.00 91.96  ? 19  DA  E "C3'" 1 
ATOM   1473  O "O3'" . DA  C 1 16  ? 58.794  -90.334  -5.158  1.00 97.81  ? 19  DA  E "O3'" 1 
ATOM   1474  C "C2'" . DA  C 1 16  ? 57.136  -91.468  -6.583  1.00 90.12  ? 19  DA  E "C2'" 1 
ATOM   1475  C "C1'" . DA  C 1 16  ? 56.341  -90.609  -7.538  1.00 84.48  ? 19  DA  E "C1'" 1 
ATOM   1476  N N9    . DA  C 1 16  ? 55.448  -91.321  -8.454  1.00 83.27  ? 19  DA  E N9    1 
ATOM   1477  C C8    . DA  C 1 16  ? 55.640  -91.585  -9.788  1.00 83.36  ? 19  DA  E C8    1 
ATOM   1478  N N7    . DA  C 1 16  ? 54.622  -92.178  -10.362 1.00 81.35  ? 19  DA  E N7    1 
ATOM   1479  C C5    . DA  C 1 16  ? 53.696  -92.315  -9.338  1.00 75.85  ? 19  DA  E C5    1 
ATOM   1480  C C6    . DA  C 1 16  ? 52.404  -92.869  -9.299  1.00 77.28  ? 19  DA  E C6    1 
ATOM   1481  N N6    . DA  C 1 16  ? 51.805  -93.425  -10.354 1.00 77.53  ? 19  DA  E N6    1 
ATOM   1482  N N1    . DA  C 1 16  ? 51.745  -92.846  -8.119  1.00 77.99  ? 19  DA  E N1    1 
ATOM   1483  C C2    . DA  C 1 16  ? 52.350  -92.294  -7.058  1.00 82.83  ? 19  DA  E C2    1 
ATOM   1484  N N3    . DA  C 1 16  ? 53.560  -91.739  -6.972  1.00 80.36  ? 19  DA  E N3    1 
ATOM   1485  C C4    . DA  C 1 16  ? 54.189  -91.788  -8.158  1.00 77.26  ? 19  DA  E C4    1 
ATOM   1486  P P     . DA  C 1 17  ? 59.433  -91.365  -4.138  1.00 105.27 ? 20  DA  E P     1 
ATOM   1487  O OP1   . DA  C 1 17  ? 59.902  -90.612  -2.950  1.00 110.77 ? 20  DA  E OP1   1 
ATOM   1488  O OP2   . DA  C 1 17  ? 60.399  -92.211  -4.892  1.00 102.68 ? 20  DA  E OP2   1 
ATOM   1489  O "O5'" . DA  C 1 17  ? 58.161  -92.213  -3.691  1.00 96.68  ? 20  DA  E "O5'" 1 
ATOM   1490  C "C5'" . DA  C 1 17  ? 57.112  -91.576  -2.951  1.00 95.71  ? 20  DA  E "C5'" 1 
ATOM   1491  C "C4'" . DA  C 1 17  ? 55.980  -92.544  -2.711  1.00 96.74  ? 20  DA  E "C4'" 1 
ATOM   1492  O "O4'" . DA  C 1 17  ? 55.333  -92.849  -3.967  1.00 94.81  ? 20  DA  E "O4'" 1 
ATOM   1493  C "C3'" . DA  C 1 17  ? 56.393  -93.886  -2.098  1.00 95.79  ? 20  DA  E "C3'" 1 
ATOM   1494  O "O3'" . DA  C 1 17  ? 55.600  -94.130  -0.929  1.00 96.83  ? 20  DA  E "O3'" 1 
ATOM   1495  C "C2'" . DA  C 1 17  ? 56.168  -94.886  -3.220  1.00 99.20  ? 20  DA  E "C2'" 1 
ATOM   1496  C "C1'" . DA  C 1 17  ? 55.064  -94.234  -4.029  1.00 97.31  ? 20  DA  E "C1'" 1 
ATOM   1497  N N9    . DA  C 1 17  ? 55.019  -94.613  -5.441  1.00 95.87  ? 20  DA  E N9    1 
ATOM   1498  C C8    . DA  C 1 17  ? 56.039  -94.527  -6.356  1.00 95.73  ? 20  DA  E C8    1 
ATOM   1499  N N7    . DA  C 1 17  ? 55.703  -94.921  -7.561  1.00 95.30  ? 20  DA  E N7    1 
ATOM   1500  C C5    . DA  C 1 17  ? 54.371  -95.287  -7.433  1.00 89.21  ? 20  DA  E C5    1 
ATOM   1501  C C6    . DA  C 1 17  ? 53.438  -95.800  -8.352  1.00 90.99  ? 20  DA  E C6    1 
ATOM   1502  N N6    . DA  C 1 17  ? 53.714  -96.029  -9.638  1.00 88.81  ? 20  DA  E N6    1 
ATOM   1503  N N1    . DA  C 1 17  ? 52.192  -96.067  -7.901  1.00 90.35  ? 20  DA  E N1    1 
ATOM   1504  C C2    . DA  C 1 17  ? 51.914  -95.834  -6.611  1.00 93.74  ? 20  DA  E C2    1 
ATOM   1505  N N3    . DA  C 1 17  ? 52.706  -95.355  -5.651  1.00 91.27  ? 20  DA  E N3    1 
ATOM   1506  C C4    . DA  C 1 17  ? 53.936  -95.102  -6.132  1.00 90.40  ? 20  DA  E C4    1 
ATOM   1507  P P     . DT  C 1 18  ? 55.857  -95.423  -0.025  1.00 96.51  ? 21  DT  E P     1 
ATOM   1508  O OP1   . DT  C 1 18  ? 55.301  -95.173  1.336   1.00 86.00  ? 21  DT  E OP1   1 
ATOM   1509  O OP2   . DT  C 1 18  ? 57.282  -95.821  -0.191  1.00 92.45  ? 21  DT  E OP2   1 
ATOM   1510  O "O5'" . DT  C 1 18  ? 54.880  -96.493  -0.681  1.00 96.66  ? 21  DT  E "O5'" 1 
ATOM   1511  C "C5'" . DT  C 1 18  ? 53.462  -96.266  -0.681  1.00 96.65  ? 21  DT  E "C5'" 1 
ATOM   1512  C "C4'" . DT  C 1 18  ? 52.757  -97.330  -1.488  1.00 102.11 ? 21  DT  E "C4'" 1 
ATOM   1513  O "O4'" . DT  C 1 18  ? 53.142  -97.256  -2.879  1.00 103.01 ? 21  DT  E "O4'" 1 
ATOM   1514  C "C3'" . DT  C 1 18  ? 53.048  -98.770  -1.053  1.00 104.05 ? 21  DT  E "C3'" 1 
ATOM   1515  O "O3'" . DT  C 1 18  ? 51.875  -99.372  -0.500  1.00 108.06 ? 21  DT  E "O3'" 1 
ATOM   1516  C "C2'" . DT  C 1 18  ? 53.497  -99.469  -2.329  1.00 101.51 ? 21  DT  E "C2'" 1 
ATOM   1517  C "C1'" . DT  C 1 18  ? 52.962  -98.553  -3.405  1.00 98.53  ? 21  DT  E "C1'" 1 
ATOM   1518  N N1    . DT  C 1 18  ? 53.642  -98.619  -4.713  1.00 91.25  ? 21  DT  E N1    1 
ATOM   1519  C C2    . DT  C 1 18  ? 52.906  -99.042  -5.800  1.00 90.55  ? 21  DT  E C2    1 
ATOM   1520  O O2    . DT  C 1 18  ? 51.733  -99.371  -5.724  1.00 95.03  ? 21  DT  E O2    1 
ATOM   1521  N N3    . DT  C 1 18  ? 53.598  -99.064  -6.986  1.00 82.70  ? 21  DT  E N3    1 
ATOM   1522  C C4    . DT  C 1 18  ? 54.920  -98.715  -7.188  1.00 80.31  ? 21  DT  E C4    1 
ATOM   1523  O O4    . DT  C 1 18  ? 55.405  -98.786  -8.314  1.00 72.68  ? 21  DT  E O4    1 
ATOM   1524  C C5    . DT  C 1 18  ? 55.631  -98.280  -6.005  1.00 83.63  ? 21  DT  E C5    1 
ATOM   1525  C C7    . DT  C 1 18  ? 57.069  -97.883  -6.126  1.00 86.03  ? 21  DT  E C7    1 
ATOM   1526  C C6    . DT  C 1 18  ? 54.964  -98.253  -4.843  1.00 84.30  ? 21  DT  E C6    1 
ATOM   1527  P P     . DG  C 1 19  ? 51.955  -100.841 0.122   1.00 106.56 ? 22  DG  E P     1 
ATOM   1528  O OP1   . DG  C 1 19  ? 51.003  -100.920 1.262   1.00 99.33  ? 22  DG  E OP1   1 
ATOM   1529  O OP2   . DG  C 1 19  ? 53.392  -101.165 0.338   1.00 95.01  ? 22  DG  E OP2   1 
ATOM   1530  O "O5'" . DG  C 1 19  ? 51.327  -101.732 -1.038  1.00 106.13 ? 22  DG  E "O5'" 1 
ATOM   1531  C "C5'" . DG  C 1 19  ? 49.959  -101.536 -1.439  1.00 103.99 ? 22  DG  E "C5'" 1 
ATOM   1532  C "C4'" . DG  C 1 19  ? 49.671  -102.317 -2.698  1.00 107.28 ? 22  DG  E "C4'" 1 
ATOM   1533  O "O4'" . DG  C 1 19  ? 50.589  -101.922 -3.743  1.00 103.80 ? 22  DG  E "O4'" 1 
ATOM   1534  C "C3'" . DG  C 1 19  ? 49.815  -103.835 -2.549  1.00 108.77 ? 22  DG  E "C3'" 1 
ATOM   1535  O "O3'" . DG  C 1 19  ? 48.562  -104.466 -2.837  1.00 120.05 ? 22  DG  E "O3'" 1 
ATOM   1536  C "C2'" . DG  C 1 19  ? 50.909  -104.214 -3.536  1.00 102.02 ? 22  DG  E "C2'" 1 
ATOM   1537  C "C1'" . DG  C 1 19  ? 50.906  -103.060 -4.518  1.00 94.95  ? 22  DG  E "C1'" 1 
ATOM   1538  N N9    . DG  C 1 19  ? 52.182  -102.811 -5.181  1.00 85.40  ? 22  DG  E N9    1 
ATOM   1539  C C8    . DG  C 1 19  ? 53.350  -102.379 -4.598  1.00 81.87  ? 22  DG  E C8    1 
ATOM   1540  N N7    . DG  C 1 19  ? 54.326  -102.235 -5.453  1.00 73.35  ? 22  DG  E N7    1 
ATOM   1541  C C5    . DG  C 1 19  ? 53.771  -102.597 -6.672  1.00 72.23  ? 22  DG  E C5    1 
ATOM   1542  C C6    . DG  C 1 19  ? 54.349  -102.641 -7.968  1.00 74.00  ? 22  DG  E C6    1 
ATOM   1543  O O6    . DG  C 1 19  ? 55.506  -102.361 -8.307  1.00 73.91  ? 22  DG  E O6    1 
ATOM   1544  N N1    . DG  C 1 19  ? 53.431  -103.065 -8.924  1.00 73.46  ? 22  DG  E N1    1 
ATOM   1545  C C2    . DG  C 1 19  ? 52.126  -103.407 -8.666  1.00 77.29  ? 22  DG  E C2    1 
ATOM   1546  N N2    . DG  C 1 19  ? 51.395  -103.790 -9.723  1.00 79.86  ? 22  DG  E N2    1 
ATOM   1547  N N3    . DG  C 1 19  ? 51.572  -103.358 -7.465  1.00 75.25  ? 22  DG  E N3    1 
ATOM   1548  C C4    . DG  C 1 19  ? 52.448  -102.952 -6.522  1.00 75.38  ? 22  DG  E C4    1 
ATOM   1549  P P     . DT  C 1 20  ? 48.326  -106.010 -2.477  1.00 121.92 ? 23  DT  E P     1 
ATOM   1550  O OP1   . DT  C 1 20  ? 46.917  -106.165 -2.024  1.00 115.40 ? 23  DT  E OP1   1 
ATOM   1551  O OP2   . DT  C 1 20  ? 49.430  -106.447 -1.582  1.00 118.24 ? 23  DT  E OP2   1 
ATOM   1552  O "O5'" . DT  C 1 20  ? 48.493  -106.731 -3.891  1.00 120.99 ? 23  DT  E "O5'" 1 
ATOM   1553  C "C5'" . DT  C 1 20  ? 48.081  -106.092 -5.124  1.00 123.79 ? 23  DT  E "C5'" 1 
ATOM   1554  C "C4'" . DT  C 1 20  ? 48.431  -106.944 -6.324  1.00 124.22 ? 23  DT  E "C4'" 1 
ATOM   1555  O "O4'" . DT  C 1 20  ? 49.673  -106.479 -6.919  1.00 115.47 ? 23  DT  E "O4'" 1 
ATOM   1556  C "C3'" . DT  C 1 20  ? 48.650  -108.432 -6.028  1.00 124.42 ? 23  DT  E "C3'" 1 
ATOM   1557  O "O3'" . DT  C 1 20  ? 48.184  -109.245 -7.117  1.00 130.95 ? 23  DT  E "O3'" 1 
ATOM   1558  C "C2'" . DT  C 1 20  ? 50.158  -108.516 -5.897  1.00 116.19 ? 23  DT  E "C2'" 1 
ATOM   1559  C "C1'" . DT  C 1 20  ? 50.570  -107.577 -7.017  1.00 104.27 ? 23  DT  E "C1'" 1 
ATOM   1560  N N1    . DT  C 1 20  ? 51.953  -107.057 -6.960  1.00 92.08  ? 23  DT  E N1    1 
ATOM   1561  C C2    . DT  C 1 20  ? 52.610  -106.828 -8.150  1.00 87.98  ? 23  DT  E C2    1 
ATOM   1562  O O2    . DT  C 1 20  ? 52.099  -107.016 -9.242  1.00 88.74  ? 23  DT  E O2    1 
ATOM   1563  N N3    . DT  C 1 20  ? 53.893  -106.357 -8.015  1.00 81.60  ? 23  DT  E N3    1 
ATOM   1564  C C4    . DT  C 1 20  ? 54.568  -106.101 -6.836  1.00 82.06  ? 23  DT  E C4    1 
ATOM   1565  O O4    . DT  C 1 20  ? 55.721  -105.679 -6.871  1.00 79.66  ? 23  DT  E O4    1 
ATOM   1566  C C5    . DT  C 1 20  ? 53.822  -106.372 -5.625  1.00 83.10  ? 23  DT  E C5    1 
ATOM   1567  C C7    . DT  C 1 20  ? 54.474  -106.127 -4.301  1.00 80.40  ? 23  DT  E C7    1 
ATOM   1568  C C6    . DT  C 1 20  ? 52.571  -106.835 -5.747  1.00 86.47  ? 23  DT  E C6    1 
ATOM   1569  P P     . DC  C 1 21  ? 47.741  -110.776 -6.876  1.00 128.95 ? 24  DC  E P     1 
ATOM   1570  O OP1   . DC  C 1 21  ? 46.408  -110.978 -7.504  1.00 126.45 ? 24  DC  E OP1   1 
ATOM   1571  O OP2   . DC  C 1 21  ? 47.952  -111.107 -5.440  1.00 118.09 ? 24  DC  E OP2   1 
ATOM   1572  O "O5'" . DC  C 1 21  ? 48.779  -111.606 -7.752  1.00 125.70 ? 24  DC  E "O5'" 1 
ATOM   1573  C "C5'" . DC  C 1 21  ? 50.141  -111.182 -7.892  1.00 122.32 ? 24  DC  E "C5'" 1 
ATOM   1574  C "C4'" . DC  C 1 21  ? 50.672  -111.598 -9.240  1.00 121.65 ? 24  DC  E "C4'" 1 
ATOM   1575  O "O4'" . DC  C 1 21  ? 51.759  -110.720 -9.612  1.00 114.39 ? 24  DC  E "O4'" 1 
ATOM   1576  C "C3'" . DC  C 1 21  ? 51.222  -113.022 -9.275  1.00 126.59 ? 24  DC  E "C3'" 1 
ATOM   1577  O "O3'" . DC  C 1 21  ? 50.824  -113.725 -10.458 1.00 134.56 ? 24  DC  E "O3'" 1 
ATOM   1578  C "C2'" . DC  C 1 21  ? 52.727  -112.844 -9.185  1.00 123.84 ? 24  DC  E "C2'" 1 
ATOM   1579  C "C1'" . DC  C 1 21  ? 53.004  -111.394 -9.563  1.00 112.94 ? 24  DC  E "C1'" 1 
ATOM   1580  N N1    . DC  C 1 21  ? 53.881  -110.683 -8.610  1.00 102.66 ? 24  DC  E N1    1 
ATOM   1581  C C2    . DC  C 1 21  ? 54.955  -109.933 -9.110  1.00 96.21  ? 24  DC  E C2    1 
ATOM   1582  O O2    . DC  C 1 21  ? 55.113  -109.855 -10.338 1.00 89.24  ? 24  DC  E O2    1 
ATOM   1583  N N3    . DC  C 1 21  ? 55.785  -109.306 -8.243  1.00 90.27  ? 24  DC  E N3    1 
ATOM   1584  C C4    . DC  C 1 21  ? 55.577  -109.411 -6.927  1.00 96.03  ? 24  DC  E C4    1 
ATOM   1585  N N4    . DC  C 1 21  ? 56.417  -108.771 -6.108  1.00 96.34  ? 24  DC  E N4    1 
ATOM   1586  C C5    . DC  C 1 21  ? 54.500  -110.178 -6.392  1.00 92.78  ? 24  DC  E C5    1 
ATOM   1587  C C6    . DC  C 1 21  ? 53.688  -110.796 -7.261  1.00 95.12  ? 24  DC  E C6    1 
ATOM   1588  P P     . DG  C 1 22  ? 51.116  -115.298 -10.602 1.00 128.09 ? 25  DG  E P     1 
ATOM   1589  O OP1   . DG  C 1 22  ? 50.026  -115.883 -11.422 1.00 126.08 ? 25  DG  E OP1   1 
ATOM   1590  O OP2   . DG  C 1 22  ? 51.395  -115.848 -9.250  1.00 123.07 ? 25  DG  E OP2   1 
ATOM   1591  O "O5'" . DG  C 1 22  ? 52.476  -115.338 -11.435 1.00 124.00 ? 25  DG  E "O5'" 1 
ATOM   1592  C "C5'" . DG  C 1 22  ? 52.538  -114.816 -12.779 1.00 127.93 ? 25  DG  E "C5'" 1 
ATOM   1593  C "C4'" . DG  C 1 22  ? 53.971  -114.653 -13.231 1.00 135.24 ? 25  DG  E "C4'" 1 
ATOM   1594  O "O4'" . DG  C 1 22  ? 54.689  -113.861 -12.256 1.00 136.60 ? 25  DG  E "O4'" 1 
ATOM   1595  C "C3'" . DG  C 1 22  ? 54.777  -115.945 -13.377 1.00 142.82 ? 25  DG  E "C3'" 1 
ATOM   1596  O "O3'" . DG  C 1 22  ? 55.754  -115.795 -14.420 1.00 148.29 ? 25  DG  E "O3'" 1 
ATOM   1597  C "C2'" . DG  C 1 22  ? 55.438  -116.077 -12.019 1.00 139.84 ? 25  DG  E "C2'" 1 
ATOM   1598  C "C1'" . DG  C 1 22  ? 55.750  -114.625 -11.702 1.00 132.88 ? 25  DG  E "C1'" 1 
ATOM   1599  N N9    . DG  C 1 22  ? 55.830  -114.307 -10.283 1.00 127.81 ? 25  DG  E N9    1 
ATOM   1600  C C8    . DG  C 1 22  ? 55.021  -114.775 -9.275  1.00 127.64 ? 25  DG  E C8    1 
ATOM   1601  N N7    . DG  C 1 22  ? 55.339  -114.300 -8.102  1.00 126.75 ? 25  DG  E N7    1 
ATOM   1602  C C5    . DG  C 1 22  ? 56.425  -113.472 -8.349  1.00 117.33 ? 25  DG  E C5    1 
ATOM   1603  C C6    . DG  C 1 22  ? 57.203  -112.687 -7.461  1.00 112.83 ? 25  DG  E C6    1 
ATOM   1604  O O6    . DG  C 1 22  ? 57.081  -112.560 -6.237  1.00 106.16 ? 25  DG  E O6    1 
ATOM   1605  N N1    . DG  C 1 22  ? 58.214  -112.004 -8.133  1.00 115.15 ? 25  DG  E N1    1 
ATOM   1606  C C2    . DG  C 1 22  ? 58.446  -112.067 -9.485  1.00 113.43 ? 25  DG  E C2    1 
ATOM   1607  N N2    . DG  C 1 22  ? 59.472  -111.334 -9.945  1.00 107.66 ? 25  DG  E N2    1 
ATOM   1608  N N3    . DG  C 1 22  ? 57.725  -112.793 -10.325 1.00 111.17 ? 25  DG  E N3    1 
ATOM   1609  C C4    . DG  C 1 22  ? 56.738  -113.464 -9.692  1.00 118.55 ? 25  DG  E C4    1 
ATOM   1610  P P     . DT  C 1 23  ? 56.784  -116.985 -14.761 1.00 152.13 ? 26  DT  E P     1 
ATOM   1611  O OP1   . DT  C 1 23  ? 57.029  -116.975 -16.227 1.00 151.92 ? 26  DT  E OP1   1 
ATOM   1612  O OP2   . DT  C 1 23  ? 56.297  -118.225 -14.102 1.00 154.10 ? 26  DT  E OP2   1 
ATOM   1613  O "O5'" . DT  C 1 23  ? 58.123  -116.531 -14.032 1.00 134.52 ? 26  DT  E "O5'" 1 
ATOM   1614  C "C5'" . DT  C 1 23  ? 59.300  -116.197 -14.786 1.00 133.36 ? 26  DT  E "C5'" 1 
ATOM   1615  C "C4'" . DT  C 1 23  ? 60.147  -115.226 -13.999 1.00 140.45 ? 26  DT  E "C4'" 1 
ATOM   1616  O "O4'" . DT  C 1 23  ? 59.564  -115.021 -12.697 1.00 142.18 ? 26  DT  E "O4'" 1 
ATOM   1617  C "C3'" . DT  C 1 23  ? 61.574  -115.689 -13.719 1.00 146.66 ? 26  DT  E "C3'" 1 
ATOM   1618  O "O3'" . DT  C 1 23  ? 62.462  -115.247 -14.753 1.00 153.28 ? 26  DT  E "O3'" 1 
ATOM   1619  C "C2'" . DT  C 1 23  ? 61.903  -115.055 -12.375 1.00 143.34 ? 26  DT  E "C2'" 1 
ATOM   1620  C "C1'" . DT  C 1 23  ? 60.577  -114.508 -11.848 1.00 137.22 ? 26  DT  E "C1'" 1 
ATOM   1621  N N1    . DT  C 1 23  ? 60.243  -114.873 -10.451 1.00 124.91 ? 26  DT  E N1    1 
ATOM   1622  C C2    . DT  C 1 23  ? 61.047  -114.372 -9.449  1.00 119.80 ? 26  DT  E C2    1 
ATOM   1623  O O2    . DT  C 1 23  ? 62.021  -113.669 -9.664  1.00 108.38 ? 26  DT  E O2    1 
ATOM   1624  N N3    . DT  C 1 23  ? 60.667  -114.730 -8.178  1.00 120.71 ? 26  DT  E N3    1 
ATOM   1625  C C4    . DT  C 1 23  ? 59.585  -115.512 -7.818  1.00 118.86 ? 26  DT  E C4    1 
ATOM   1626  O O4    . DT  C 1 23  ? 59.366  -115.747 -6.632  1.00 117.99 ? 26  DT  E O4    1 
ATOM   1627  C C5    . DT  C 1 23  ? 58.782  -115.998 -8.919  1.00 113.28 ? 26  DT  E C5    1 
ATOM   1628  C C7    . DT  C 1 23  ? 57.591  -116.853 -8.625  1.00 111.47 ? 26  DT  E C7    1 
ATOM   1629  C C6    . DT  C 1 23  ? 59.147  -115.659 -10.163 1.00 114.73 ? 26  DT  E C6    1 
ATOM   1630  P P     . DT  C 1 24  ? 63.722  -116.145 -15.175 1.00 160.15 ? 27  DT  E P     1 
ATOM   1631  O OP1   . DT  C 1 24  ? 64.263  -115.613 -16.452 1.00 155.13 ? 27  DT  E OP1   1 
ATOM   1632  O OP2   . DT  C 1 24  ? 63.325  -117.574 -15.082 1.00 159.23 ? 27  DT  E OP2   1 
ATOM   1633  O "O5'" . DT  C 1 24  ? 64.789  -115.826 -14.037 1.00 161.65 ? 27  DT  E "O5'" 1 
ATOM   1634  C "C5'" . DT  C 1 24  ? 65.451  -114.551 -13.992 1.00 164.07 ? 27  DT  E "C5'" 1 
ATOM   1635  C "C4'" . DT  C 1 24  ? 65.990  -114.297 -12.604 1.00 169.78 ? 27  DT  E "C4'" 1 
ATOM   1636  O "O4'" . DT  C 1 24  ? 64.998  -114.650 -11.619 1.00 169.60 ? 27  DT  E "O4'" 1 
ATOM   1637  C "C3'" . DT  C 1 24  ? 67.246  -115.097 -12.245 1.00 176.07 ? 27  DT  E "C3'" 1 
ATOM   1638  O "O3'" . DT  C 1 24  ? 68.357  -114.193 -12.257 1.00 191.96 ? 27  DT  E "O3'" 1 
ATOM   1639  C "C2'" . DT  C 1 24  ? 66.933  -115.719 -10.888 1.00 169.67 ? 27  DT  E "C2'" 1 
ATOM   1640  C "C1'" . DT  C 1 24  ? 65.671  -115.010 -10.432 1.00 164.34 ? 27  DT  E "C1'" 1 
ATOM   1641  N N1    . DT  C 1 24  ? 64.746  -115.825 -9.618  1.00 153.00 ? 27  DT  E N1    1 
ATOM   1642  C C2    . DT  C 1 24  ? 64.616  -115.533 -8.278  1.00 148.65 ? 27  DT  E C2    1 
ATOM   1643  O O2    . DT  C 1 24  ? 65.242  -114.644 -7.725  1.00 146.62 ? 27  DT  E O2    1 
ATOM   1644  N N3    . DT  C 1 24  ? 63.724  -116.331 -7.603  1.00 143.10 ? 27  DT  E N3    1 
ATOM   1645  C C4    . DT  C 1 24  ? 62.964  -117.362 -8.126  1.00 144.54 ? 27  DT  E C4    1 
ATOM   1646  O O4    . DT  C 1 24  ? 62.204  -117.991 -7.396  1.00 144.03 ? 27  DT  E O4    1 
ATOM   1647  C C5    . DT  C 1 24  ? 63.147  -117.607 -9.539  1.00 147.78 ? 27  DT  E C5    1 
ATOM   1648  C C7    . DT  C 1 24  ? 62.367  -118.704 -10.194 1.00 149.10 ? 27  DT  E C7    1 
ATOM   1649  C C6    . DT  C 1 24  ? 64.019  -116.838 -10.204 1.00 145.73 ? 27  DT  E C6    1 
ATOM   1650  P P     . DT  C 1 25  ? 69.791  -114.645 -11.712 1.00 212.08 ? 28  DT  E P     1 
ATOM   1651  O OP1   . DT  C 1 25  ? 70.823  -114.046 -12.597 1.00 214.22 ? 28  DT  E OP1   1 
ATOM   1652  O OP2   . DT  C 1 25  ? 69.766  -116.117 -11.501 1.00 207.86 ? 28  DT  E OP2   1 
ATOM   1653  O "O5'" . DT  C 1 25  ? 69.877  -113.903 -10.304 1.00 202.38 ? 28  DT  E "O5'" 1 
ATOM   1654  C "C5'" . DT  C 1 25  ? 70.996  -114.099 -9.420  1.00 189.12 ? 28  DT  E "C5'" 1 
ATOM   1655  C "C4'" . DT  C 1 25  ? 70.661  -113.594 -8.035  1.00 177.66 ? 28  DT  E "C4'" 1 
ATOM   1656  O "O4'" . DT  C 1 25  ? 69.379  -114.129 -7.621  1.00 176.98 ? 28  DT  E "O4'" 1 
ATOM   1657  C "C3'" . DT  C 1 25  ? 71.659  -114.001 -6.949  1.00 176.59 ? 28  DT  E "C3'" 1 
ATOM   1658  O "O3'" . DT  C 1 25  ? 71.896  -112.914 -6.048  1.00 167.67 ? 28  DT  E "O3'" 1 
ATOM   1659  C "C2'" . DT  C 1 25  ? 70.982  -115.177 -6.266  1.00 176.44 ? 28  DT  E "C2'" 1 
ATOM   1660  C "C1'" . DT  C 1 25  ? 69.512  -114.817 -6.384  1.00 171.84 ? 28  DT  E "C1'" 1 
ATOM   1661  N N1    . DT  C 1 25  ? 68.572  -115.964 -6.393  1.00 157.90 ? 28  DT  E N1    1 
ATOM   1662  C C2    . DT  C 1 25  ? 67.886  -116.252 -5.232  1.00 152.72 ? 28  DT  E C2    1 
ATOM   1663  O O2    . DT  C 1 25  ? 68.029  -115.619 -4.198  1.00 148.94 ? 28  DT  E O2    1 
ATOM   1664  N N3    . DT  C 1 25  ? 67.024  -117.318 -5.325  1.00 144.96 ? 28  DT  E N3    1 
ATOM   1665  C C4    . DT  C 1 25  ? 66.784  -118.102 -6.438  1.00 141.64 ? 28  DT  E C4    1 
ATOM   1666  O O4    . DT  C 1 25  ? 65.980  -119.028 -6.372  1.00 139.16 ? 28  DT  E O4    1 
ATOM   1667  C C5    . DT  C 1 25  ? 67.536  -117.742 -7.620  1.00 141.18 ? 28  DT  E C5    1 
ATOM   1668  C C7    . DT  C 1 25  ? 67.344  -118.539 -8.872  1.00 142.65 ? 28  DT  E C7    1 
ATOM   1669  C C6    . DT  C 1 25  ? 68.379  -116.704 -7.540  1.00 143.65 ? 28  DT  E C6    1 
ATOM   1670  O "O5'" . DA  D 2 1   ? 59.860  -119.338 4.678   1.00 140.25 ? 29  DA  F "O5'" 1 
ATOM   1671  C "C5'" . DA  D 2 1   ? 60.260  -118.324 3.736   1.00 141.21 ? 29  DA  F "C5'" 1 
ATOM   1672  C "C4'" . DA  D 2 1   ? 61.719  -118.490 3.374   1.00 142.44 ? 29  DA  F "C4'" 1 
ATOM   1673  O "O4'" . DA  D 2 1   ? 61.833  -119.221 2.137   1.00 144.56 ? 29  DA  F "O4'" 1 
ATOM   1674  C "C3'" . DA  D 2 1   ? 62.471  -117.189 3.116   1.00 141.93 ? 29  DA  F "C3'" 1 
ATOM   1675  O "O3'" . DA  D 2 1   ? 62.976  -116.602 4.322   1.00 134.22 ? 29  DA  F "O3'" 1 
ATOM   1676  C "C2'" . DA  D 2 1   ? 63.590  -117.617 2.181   1.00 136.47 ? 29  DA  F "C2'" 1 
ATOM   1677  C "C1'" . DA  D 2 1   ? 63.080  -118.904 1.530   1.00 136.65 ? 29  DA  F "C1'" 1 
ATOM   1678  N N9    . DA  D 2 1   ? 62.877  -118.834 0.081   1.00 128.64 ? 29  DA  F N9    1 
ATOM   1679  C C8    . DA  D 2 1   ? 61.753  -119.155 -0.642  1.00 122.88 ? 29  DA  F C8    1 
ATOM   1680  N N7    . DA  D 2 1   ? 61.900  -119.013 -1.937  1.00 121.72 ? 29  DA  F N7    1 
ATOM   1681  C C5    . DA  D 2 1   ? 63.211  -118.577 -2.078  1.00 122.59 ? 29  DA  F C5    1 
ATOM   1682  C C6    . DA  D 2 1   ? 63.985  -118.245 -3.207  1.00 122.54 ? 29  DA  F C6    1 
ATOM   1683  N N6    . DA  D 2 1   ? 63.528  -118.300 -4.461  1.00 128.46 ? 29  DA  F N6    1 
ATOM   1684  N N1    . DA  D 2 1   ? 65.259  -117.843 -3.001  1.00 112.72 ? 29  DA  F N1    1 
ATOM   1685  C C2    . DA  D 2 1   ? 65.717  -117.784 -1.743  1.00 114.00 ? 29  DA  F C2    1 
ATOM   1686  N N3    . DA  D 2 1   ? 65.088  -118.070 -0.603  1.00 118.49 ? 29  DA  F N3    1 
ATOM   1687  C C4    . DA  D 2 1   ? 63.825  -118.465 -0.843  1.00 122.22 ? 29  DA  F C4    1 
ATOM   1688  P P     . DA  D 2 2   ? 63.138  -115.012 4.418   1.00 116.08 ? 30  DA  F P     1 
ATOM   1689  O OP1   . DA  D 2 2   ? 63.800  -114.689 5.707   1.00 106.36 ? 30  DA  F OP1   1 
ATOM   1690  O OP2   . DA  D 2 2   ? 61.824  -114.407 4.086   1.00 111.43 ? 30  DA  F OP2   1 
ATOM   1691  O "O5'" . DA  D 2 2   ? 64.133  -114.690 3.217   1.00 116.17 ? 30  DA  F "O5'" 1 
ATOM   1692  C "C5'" . DA  D 2 2   ? 65.493  -114.277 3.438   1.00 116.88 ? 30  DA  F "C5'" 1 
ATOM   1693  C "C4'" . DA  D 2 2   ? 65.956  -113.465 2.252   1.00 122.32 ? 30  DA  F "C4'" 1 
ATOM   1694  O "O4'" . DA  D 2 2   ? 65.497  -114.110 1.036   1.00 124.21 ? 30  DA  F "O4'" 1 
ATOM   1695  C "C3'" . DA  D 2 2   ? 65.391  -112.043 2.211   1.00 127.61 ? 30  DA  F "C3'" 1 
ATOM   1696  O "O3'" . DA  D 2 2   ? 66.358  -111.112 1.712   1.00 128.45 ? 30  DA  F "O3'" 1 
ATOM   1697  C "C2'" . DA  D 2 2   ? 64.207  -112.172 1.272   1.00 128.26 ? 30  DA  F "C2'" 1 
ATOM   1698  C "C1'" . DA  D 2 2   ? 64.726  -113.190 0.277   1.00 124.05 ? 30  DA  F "C1'" 1 
ATOM   1699  N N9    . DA  D 2 2   ? 63.683  -113.933 -0.429  1.00 119.05 ? 30  DA  F N9    1 
ATOM   1700  C C8    . DA  D 2 2   ? 62.486  -114.399 0.062   1.00 117.41 ? 30  DA  F C8    1 
ATOM   1701  N N7    . DA  D 2 2   ? 61.748  -115.006 -0.835  1.00 114.46 ? 30  DA  F N7    1 
ATOM   1702  C C5    . DA  D 2 2   ? 62.501  -114.924 -1.998  1.00 116.09 ? 30  DA  F C5    1 
ATOM   1703  C C6    . DA  D 2 2   ? 62.273  -115.383 -3.308  1.00 118.37 ? 30  DA  F C6    1 
ATOM   1704  N N6    . DA  D 2 2   ? 61.173  -116.042 -3.680  1.00 119.19 ? 30  DA  F N6    1 
ATOM   1705  N N1    . DA  D 2 2   ? 63.226  -115.137 -4.235  1.00 115.66 ? 30  DA  F N1    1 
ATOM   1706  C C2    . DA  D 2 2   ? 64.331  -114.476 -3.860  1.00 113.45 ? 30  DA  F C2    1 
ATOM   1707  N N3    . DA  D 2 2   ? 64.660  -113.998 -2.660  1.00 107.56 ? 30  DA  F N3    1 
ATOM   1708  C C4    . DA  D 2 2   ? 63.692  -114.259 -1.764  1.00 114.05 ? 30  DA  F C4    1 
ATOM   1709  P P     . DA  D 2 3   ? 66.046  -109.539 1.715   1.00 119.91 ? 31  DA  F P     1 
ATOM   1710  O OP1   . DA  D 2 3   ? 67.084  -108.872 2.536   1.00 124.88 ? 31  DA  F OP1   1 
ATOM   1711  O OP2   . DA  D 2 3   ? 64.609  -109.351 2.056   1.00 119.61 ? 31  DA  F OP2   1 
ATOM   1712  O "O5'" . DA  D 2 3   ? 66.288  -109.124 0.196   1.00 113.44 ? 31  DA  F "O5'" 1 
ATOM   1713  C "C5'" . DA  D 2 3   ? 66.201  -110.106 -0.848  1.00 118.18 ? 31  DA  F "C5'" 1 
ATOM   1714  C "C4'" . DA  D 2 3   ? 66.646  -109.545 -2.178  1.00 122.00 ? 31  DA  F "C4'" 1 
ATOM   1715  O "O4'" . DA  D 2 3   ? 66.025  -110.327 -3.223  1.00 123.70 ? 31  DA  F "O4'" 1 
ATOM   1716  C "C3'" . DA  D 2 3   ? 66.240  -108.101 -2.465  1.00 122.40 ? 31  DA  F "C3'" 1 
ATOM   1717  O "O3'" . DA  D 2 3   ? 67.182  -107.484 -3.354  1.00 122.63 ? 31  DA  F "O3'" 1 
ATOM   1718  C "C2'" . DA  D 2 3   ? 64.861  -108.264 -3.076  1.00 123.89 ? 31  DA  F "C2'" 1 
ATOM   1719  C "C1'" . DA  D 2 3   ? 64.940  -109.610 -3.796  1.00 119.79 ? 31  DA  F "C1'" 1 
ATOM   1720  N N9    . DA  D 2 3   ? 63.736  -110.432 -3.671  1.00 115.03 ? 31  DA  F N9    1 
ATOM   1721  C C8    . DA  D 2 3   ? 62.902  -110.552 -2.585  1.00 115.36 ? 31  DA  F C8    1 
ATOM   1722  N N7    . DA  D 2 3   ? 61.882  -111.350 -2.787  1.00 114.54 ? 31  DA  F N7    1 
ATOM   1723  C C5    . DA  D 2 3   ? 62.053  -111.785 -4.094  1.00 117.14 ? 31  DA  F C5    1 
ATOM   1724  C C6    . DA  D 2 3   ? 61.306  -112.656 -4.907  1.00 115.94 ? 31  DA  F C6    1 
ATOM   1725  N N6    . DA  D 2 3   ? 60.192  -113.272 -4.504  1.00 113.20 ? 31  DA  F N6    1 
ATOM   1726  N N1    . DA  D 2 3   ? 61.751  -112.881 -6.163  1.00 117.54 ? 31  DA  F N1    1 
ATOM   1727  C C2    . DA  D 2 3   ? 62.869  -112.261 -6.568  1.00 122.80 ? 31  DA  F C2    1 
ATOM   1728  N N3    . DA  D 2 3   ? 63.657  -111.422 -5.896  1.00 119.14 ? 31  DA  F N3    1 
ATOM   1729  C C4    . DA  D 2 3   ? 63.190  -111.226 -4.651  1.00 116.69 ? 31  DA  F C4    1 
ATOM   1730  P P     . DC  D 2 4   ? 66.886  -106.034 -3.991  1.00 123.12 ? 32  DC  F P     1 
ATOM   1731  O OP1   . DC  D 2 4   ? 68.187  -105.345 -4.204  1.00 123.29 ? 32  DC  F OP1   1 
ATOM   1732  O OP2   . DC  D 2 4   ? 65.831  -105.372 -3.177  1.00 122.73 ? 32  DC  F OP2   1 
ATOM   1733  O "O5'" . DC  D 2 4   ? 66.319  -106.394 -5.435  1.00 112.93 ? 32  DC  F "O5'" 1 
ATOM   1734  C "C5'" . DC  D 2 4   ? 67.224  -106.754 -6.493  1.00 108.13 ? 32  DC  F "C5'" 1 
ATOM   1735  C "C4'" . DC  D 2 4   ? 66.494  -107.489 -7.591  1.00 107.34 ? 32  DC  F "C4'" 1 
ATOM   1736  O "O4'" . DC  D 2 4   ? 65.378  -108.229 -7.049  1.00 107.39 ? 32  DC  F "O4'" 1 
ATOM   1737  C "C3'" . DC  D 2 4   ? 65.905  -106.589 -8.678  1.00 106.64 ? 32  DC  F "C3'" 1 
ATOM   1738  O "O3'" . DC  D 2 4   ? 66.653  -106.685 -9.893  1.00 117.59 ? 32  DC  F "O3'" 1 
ATOM   1739  C "C2'" . DC  D 2 4   ? 64.491  -107.114 -8.881  1.00 106.27 ? 32  DC  F "C2'" 1 
ATOM   1740  C "C1'" . DC  D 2 4   ? 64.452  -108.411 -8.099  1.00 106.02 ? 32  DC  F "C1'" 1 
ATOM   1741  N N1    . DC  D 2 4   ? 63.137  -108.718 -7.508  1.00 102.10 ? 32  DC  F N1    1 
ATOM   1742  C C2    . DC  D 2 4   ? 62.163  -109.336 -8.303  1.00 103.62 ? 32  DC  F C2    1 
ATOM   1743  O O2    . DC  D 2 4   ? 62.439  -109.620 -9.479  1.00 105.50 ? 32  DC  F O2    1 
ATOM   1744  N N3    . DC  D 2 4   ? 60.950  -109.612 -7.768  1.00 101.48 ? 32  DC  F N3    1 
ATOM   1745  C C4    . DC  D 2 4   ? 60.693  -109.288 -6.498  1.00 98.81  ? 32  DC  F C4    1 
ATOM   1746  N N4    . DC  D 2 4   ? 59.484  -109.575 -6.009  1.00 96.51  ? 32  DC  F N4    1 
ATOM   1747  C C5    . DC  D 2 4   ? 61.664  -108.654 -5.671  1.00 101.42 ? 32  DC  F C5    1 
ATOM   1748  C C6    . DC  D 2 4   ? 62.859  -108.385 -6.213  1.00 102.69 ? 32  DC  F C6    1 
ATOM   1749  P P     . DG  D 2 5   ? 66.383  -105.643 -11.082 1.00 129.25 ? 33  DG  F P     1 
ATOM   1750  O OP1   . DG  D 2 5   ? 67.662  -104.953 -11.396 1.00 125.64 ? 33  DG  F OP1   1 
ATOM   1751  O OP2   . DG  D 2 5   ? 65.168  -104.856 -10.743 1.00 130.82 ? 33  DG  F OP2   1 
ATOM   1752  O "O5'" . DG  D 2 5   ? 66.035  -106.574 -12.325 1.00 125.70 ? 33  DG  F "O5'" 1 
ATOM   1753  C "C5'" . DG  D 2 5   ? 65.345  -106.038 -13.466 1.00 113.81 ? 33  DG  F "C5'" 1 
ATOM   1754  C "C4'" . DG  D 2 5   ? 64.013  -106.730 -13.635 1.00 109.54 ? 33  DG  F "C4'" 1 
ATOM   1755  O "O4'" . DG  D 2 5   ? 63.410  -107.001 -12.352 1.00 106.65 ? 33  DG  F "O4'" 1 
ATOM   1756  C "C3'" . DG  D 2 5   ? 62.974  -105.926 -14.417 1.00 109.33 ? 33  DG  F "C3'" 1 
ATOM   1757  O "O3'" . DG  D 2 5   ? 62.747  -106.544 -15.682 1.00 120.46 ? 33  DG  F "O3'" 1 
ATOM   1758  C "C2'" . DG  D 2 5   ? 61.722  -105.977 -13.556 1.00 106.30 ? 33  DG  F "C2'" 1 
ATOM   1759  C "C1'" . DG  D 2 5   ? 62.015  -107.070 -12.560 1.00 103.92 ? 33  DG  F "C1'" 1 
ATOM   1760  N N9    . DG  D 2 5   ? 61.355  -106.925 -11.267 1.00 99.54  ? 33  DG  F N9    1 
ATOM   1761  C C8    . DG  D 2 5   ? 61.820  -106.241 -10.170 1.00 99.51  ? 33  DG  F C8    1 
ATOM   1762  N N7    . DG  D 2 5   ? 61.017  -106.314 -9.143  1.00 96.71  ? 33  DG  F N7    1 
ATOM   1763  C C5    . DG  D 2 5   ? 59.954  -107.084 -9.592  1.00 94.50  ? 33  DG  F C5    1 
ATOM   1764  C C6    . DG  D 2 5   ? 58.776  -107.503 -8.922  1.00 96.28  ? 33  DG  F C6    1 
ATOM   1765  O O6    . DG  D 2 5   ? 58.422  -107.262 -7.762  1.00 98.29  ? 33  DG  F O6    1 
ATOM   1766  N N1    . DG  D 2 5   ? 57.964  -108.274 -9.748  1.00 94.06  ? 33  DG  F N1    1 
ATOM   1767  C C2    . DG  D 2 5   ? 58.248  -108.600 -11.053 1.00 97.93  ? 33  DG  F C2    1 
ATOM   1768  N N2    . DG  D 2 5   ? 57.340  -109.354 -11.688 1.00 98.24  ? 33  DG  F N2    1 
ATOM   1769  N N3    . DG  D 2 5   ? 59.347  -108.220 -11.687 1.00 95.14  ? 33  DG  F N3    1 
ATOM   1770  C C4    . DG  D 2 5   ? 60.149  -107.471 -10.901 1.00 95.19  ? 33  DG  F C4    1 
ATOM   1771  P P     . DA  D 2 6   ? 63.023  -105.736 -17.026 1.00 134.83 ? 34  DA  F P     1 
ATOM   1772  O OP1   . DA  D 2 6   ? 63.671  -106.661 -17.991 1.00 138.71 ? 34  DA  F OP1   1 
ATOM   1773  O OP2   . DA  D 2 6   ? 63.700  -104.463 -16.670 1.00 136.03 ? 34  DA  F OP2   1 
ATOM   1774  O "O5'" . DA  D 2 6   ? 61.553  -105.414 -17.548 1.00 130.73 ? 34  DA  F "O5'" 1 
ATOM   1775  C "C5'" . DA  D 2 6   ? 60.566  -104.823 -16.680 1.00 128.24 ? 34  DA  F "C5'" 1 
ATOM   1776  C "C4'" . DA  D 2 6   ? 59.296  -105.643 -16.703 1.00 125.16 ? 34  DA  F "C4'" 1 
ATOM   1777  O "O4'" . DA  D 2 6   ? 58.984  -106.132 -15.377 1.00 121.03 ? 34  DA  F "O4'" 1 
ATOM   1778  C "C3'" . DA  D 2 6   ? 58.064  -104.870 -17.164 1.00 125.23 ? 34  DA  F "C3'" 1 
ATOM   1779  O "O3'" . DA  D 2 6   ? 57.238  -105.699 -17.982 1.00 128.31 ? 34  DA  F "O3'" 1 
ATOM   1780  C "C2'" . DA  D 2 6   ? 57.380  -104.484 -15.865 1.00 123.67 ? 34  DA  F "C2'" 1 
ATOM   1781  C "C1'" . DA  D 2 6   ? 57.713  -105.649 -14.952 1.00 117.06 ? 34  DA  F "C1'" 1 
ATOM   1782  N N9    . DA  D 2 6   ? 57.818  -105.307 -13.532 1.00 105.47 ? 34  DA  F N9    1 
ATOM   1783  C C8    . DA  D 2 6   ? 58.864  -104.668 -12.913 1.00 100.82 ? 34  DA  F C8    1 
ATOM   1784  N N7    . DA  D 2 6   ? 58.702  -104.519 -11.621 1.00 95.29  ? 34  DA  F N7    1 
ATOM   1785  C C5    . DA  D 2 6   ? 57.465  -105.096 -11.371 1.00 87.88  ? 34  DA  F C5    1 
ATOM   1786  C C6    . DA  D 2 6   ? 56.717  -105.255 -10.192 1.00 84.11  ? 34  DA  F C6    1 
ATOM   1787  N N6    . DA  D 2 6   ? 57.126  -104.829 -8.995  1.00 83.71  ? 34  DA  F N6    1 
ATOM   1788  N N1    . DA  D 2 6   ? 55.517  -105.872 -10.285 1.00 82.64  ? 34  DA  F N1    1 
ATOM   1789  C C2    . DA  D 2 6   ? 55.109  -106.299 -11.488 1.00 89.04  ? 34  DA  F C2    1 
ATOM   1790  N N3    . DA  D 2 6   ? 55.723  -106.205 -12.669 1.00 90.81  ? 34  DA  F N3    1 
ATOM   1791  C C4    . DA  D 2 6   ? 56.909  -105.586 -12.540 1.00 93.05  ? 34  DA  F C4    1 
ATOM   1792  P P     . DC  D 2 7   ? 56.143  -105.033 -18.920 1.00 134.21 ? 35  DC  F P     1 
ATOM   1793  O OP1   . DC  D 2 7   ? 55.833  -105.987 -20.011 1.00 135.34 ? 35  DC  F OP1   1 
ATOM   1794  O OP2   . DC  D 2 7   ? 56.600  -103.659 -19.252 1.00 136.54 ? 35  DC  F OP2   1 
ATOM   1795  O "O5'" . DC  D 2 7   ? 54.870  -104.934 -17.967 1.00 129.44 ? 35  DC  F "O5'" 1 
ATOM   1796  C "C5'" . DC  D 2 7   ? 54.332  -106.107 -17.331 1.00 125.72 ? 35  DC  F "C5'" 1 
ATOM   1797  C "C4'" . DC  D 2 7   ? 53.116  -105.754 -16.508 1.00 128.23 ? 35  DC  F "C4'" 1 
ATOM   1798  O "O4'" . DC  D 2 7   ? 53.526  -105.397 -15.164 1.00 130.23 ? 35  DC  F "O4'" 1 
ATOM   1799  C "C3'" . DC  D 2 7   ? 52.296  -104.568 -17.021 1.00 128.18 ? 35  DC  F "C3'" 1 
ATOM   1800  O "O3'" . DC  D 2 7   ? 50.906  -104.829 -16.805 1.00 131.77 ? 35  DC  F "O3'" 1 
ATOM   1801  C "C2'" . DC  D 2 7   ? 52.793  -103.418 -16.166 1.00 127.57 ? 35  DC  F "C2'" 1 
ATOM   1802  C "C1'" . DC  D 2 7   ? 52.997  -104.120 -14.836 1.00 122.37 ? 35  DC  F "C1'" 1 
ATOM   1803  N N1    . DC  D 2 7   ? 53.921  -103.471 -13.888 1.00 109.71 ? 35  DC  F N1    1 
ATOM   1804  C C2    . DC  D 2 7   ? 53.677  -103.609 -12.516 1.00 105.35 ? 35  DC  F C2    1 
ATOM   1805  O O2    . DC  D 2 7   ? 52.698  -104.276 -12.144 1.00 102.20 ? 35  DC  F O2    1 
ATOM   1806  N N3    . DC  D 2 7   ? 54.516  -103.020 -11.632 1.00 96.67  ? 35  DC  F N3    1 
ATOM   1807  C C4    . DC  D 2 7   ? 55.566  -102.321 -12.073 1.00 95.92  ? 35  DC  F C4    1 
ATOM   1808  N N4    . DC  D 2 7   ? 56.370  -101.761 -11.166 1.00 91.57  ? 35  DC  F N4    1 
ATOM   1809  C C5    . DC  D 2 7   ? 55.837  -102.164 -13.464 1.00 96.31  ? 35  DC  F C5    1 
ATOM   1810  C C6    . DC  D 2 7   ? 54.996  -102.748 -14.328 1.00 99.29  ? 35  DC  F C6    1 
ATOM   1811  P P     . DA  D 2 8   ? 49.798  -103.755 -17.239 1.00 139.21 ? 36  DA  F P     1 
ATOM   1812  O OP1   . DA  D 2 8   ? 48.812  -104.442 -18.108 1.00 141.21 ? 36  DA  F OP1   1 
ATOM   1813  O OP2   . DA  D 2 8   ? 50.495  -102.541 -17.741 1.00 136.63 ? 36  DA  F OP2   1 
ATOM   1814  O "O5'" . DA  D 2 8   ? 49.062  -103.431 -15.863 1.00 127.04 ? 36  DA  F "O5'" 1 
ATOM   1815  C "C5'" . DA  D 2 8   ? 48.283  -104.447 -15.205 1.00 124.09 ? 36  DA  F "C5'" 1 
ATOM   1816  C "C4'" . DA  D 2 8   ? 47.904  -104.007 -13.811 1.00 123.02 ? 36  DA  F "C4'" 1 
ATOM   1817  O "O4'" . DA  D 2 8   ? 49.080  -103.546 -13.103 1.00 119.11 ? 36  DA  F "O4'" 1 
ATOM   1818  C "C3'" . DA  D 2 8   ? 46.905  -102.850 -13.754 1.00 124.44 ? 36  DA  F "C3'" 1 
ATOM   1819  O "O3'" . DA  D 2 8   ? 46.002  -103.043 -12.659 1.00 124.90 ? 36  DA  F "O3'" 1 
ATOM   1820  C "C2'" . DA  D 2 8   ? 47.793  -101.642 -13.519 1.00 120.90 ? 36  DA  F "C2'" 1 
ATOM   1821  C "C1'" . DA  D 2 8   ? 48.840  -102.239 -12.599 1.00 112.66 ? 36  DA  F "C1'" 1 
ATOM   1822  N N9    . DA  D 2 8   ? 50.120  -101.532 -12.543 1.00 98.22  ? 36  DA  F N9    1 
ATOM   1823  C C8    . DA  D 2 8   ? 50.970  -101.210 -13.574 1.00 91.22  ? 36  DA  F C8    1 
ATOM   1824  N N7    . DA  D 2 8   ? 52.056  -100.585 -13.186 1.00 84.30  ? 36  DA  F N7    1 
ATOM   1825  C C5    . DA  D 2 8   ? 51.914  -100.493 -11.809 1.00 81.33  ? 36  DA  F C5    1 
ATOM   1826  C C6    . DA  D 2 8   ? 52.732  -99.939  -10.808 1.00 79.50  ? 36  DA  F C6    1 
ATOM   1827  N N6    . DA  D 2 8   ? 53.902  -99.345  -11.052 1.00 76.57  ? 36  DA  F N6    1 
ATOM   1828  N N1    . DA  D 2 8   ? 52.297  -100.011 -9.530  1.00 80.95  ? 36  DA  F N1    1 
ATOM   1829  C C2    . DA  D 2 8   ? 51.121  -100.605 -9.285  1.00 83.78  ? 36  DA  F C2    1 
ATOM   1830  N N3    . DA  D 2 8   ? 50.265  -101.164 -10.139 1.00 82.01  ? 36  DA  F N3    1 
ATOM   1831  C C4    . DA  D 2 8   ? 50.725  -101.071 -11.399 1.00 85.32  ? 36  DA  F C4    1 
ATOM   1832  P P     . DT  D 2 9   ? 44.647  -102.196 -12.569 1.00 119.21 ? 37  DT  F P     1 
ATOM   1833  O OP1   . DT  D 2 9   ? 43.529  -103.147 -12.339 1.00 120.49 ? 37  DT  F OP1   1 
ATOM   1834  O OP2   . DT  D 2 9   ? 44.603  -101.281 -13.739 1.00 109.57 ? 37  DT  F OP2   1 
ATOM   1835  O "O5'" . DT  D 2 9   ? 44.826  -101.357 -11.224 1.00 119.30 ? 37  DT  F "O5'" 1 
ATOM   1836  C "C5'" . DT  D 2 9   ? 46.002  -101.512 -10.402 1.00 120.44 ? 37  DT  F "C5'" 1 
ATOM   1837  C "C4'" . DT  D 2 9   ? 45.794  -100.960 -9.009  1.00 116.60 ? 37  DT  F "C4'" 1 
ATOM   1838  O "O4'" . DT  D 2 9   ? 47.037  -100.378 -8.550  1.00 111.53 ? 37  DT  F "O4'" 1 
ATOM   1839  C "C3'" . DT  D 2 9   ? 44.761  -99.846  -8.868  1.00 112.08 ? 37  DT  F "C3'" 1 
ATOM   1840  O "O3'" . DT  D 2 9   ? 44.223  -99.860  -7.540  1.00 113.34 ? 37  DT  F "O3'" 1 
ATOM   1841  C "C2'" . DT  D 2 9   ? 45.580  -98.598  -9.145  1.00 106.70 ? 37  DT  F "C2'" 1 
ATOM   1842  C "C1'" . DT  D 2 9   ? 46.963  -98.956  -8.600  1.00 98.67  ? 37  DT  F "C1'" 1 
ATOM   1843  N N1    . DT  D 2 9   ? 48.106  -98.469  -9.405  1.00 83.73  ? 37  DT  F N1    1 
ATOM   1844  C C2    . DT  D 2 9   ? 49.236  -98.051  -8.738  1.00 82.14  ? 37  DT  F C2    1 
ATOM   1845  O O2    . DT  D 2 9   ? 49.340  -98.072  -7.522  1.00 79.53  ? 37  DT  F O2    1 
ATOM   1846  N N3    . DT  D 2 9   ? 50.251  -97.608  -9.552  1.00 80.60  ? 37  DT  F N3    1 
ATOM   1847  C C4    . DT  D 2 9   ? 50.248  -97.552  -10.934 1.00 78.82  ? 37  DT  F C4    1 
ATOM   1848  O O4    . DT  D 2 9   ? 51.236  -97.132  -11.532 1.00 74.29  ? 37  DT  F O4    1 
ATOM   1849  C C5    . DT  D 2 9   ? 49.029  -98.006  -11.567 1.00 78.78  ? 37  DT  F C5    1 
ATOM   1850  C C7    . DT  D 2 9   ? 48.932  -97.977  -13.060 1.00 81.30  ? 37  DT  F C7    1 
ATOM   1851  C C6    . DT  D 2 9   ? 48.033  -98.435  -10.782 1.00 77.57  ? 37  DT  F C6    1 
ATOM   1852  P P     . DT  D 2 10  ? 43.211  -98.713  -7.067  1.00 111.45 ? 38  DT  F P     1 
ATOM   1853  O OP1   . DT  D 2 10  ? 42.232  -99.311  -6.121  1.00 111.60 ? 38  DT  F OP1   1 
ATOM   1854  O OP2   . DT  D 2 10  ? 42.725  -98.003  -8.278  1.00 110.05 ? 38  DT  F OP2   1 
ATOM   1855  O "O5'" . DT  D 2 10  ? 44.146  -97.760  -6.201  1.00 111.22 ? 38  DT  F "O5'" 1 
ATOM   1856  C "C5'" . DT  D 2 10  ? 44.595  -98.185  -4.902  1.00 108.93 ? 38  DT  F "C5'" 1 
ATOM   1857  C "C4'" . DT  D 2 10  ? 45.616  -97.217  -4.350  1.00 106.28 ? 38  DT  F "C4'" 1 
ATOM   1858  O "O4'" . DT  D 2 10  ? 46.596  -96.877  -5.361  1.00 99.40  ? 38  DT  F "O4'" 1 
ATOM   1859  C "C3'" . DT  D 2 10  ? 45.046  -95.888  -3.843  1.00 100.85 ? 38  DT  F "C3'" 1 
ATOM   1860  O "O3'" . DT  D 2 10  ? 45.568  -95.687  -2.523  1.00 103.30 ? 38  DT  F "O3'" 1 
ATOM   1861  C "C2'" . DT  D 2 10  ? 45.520  -94.880  -4.880  1.00 95.67  ? 38  DT  F "C2'" 1 
ATOM   1862  C "C1'" . DT  D 2 10  ? 46.847  -95.486  -5.297  1.00 89.96  ? 38  DT  F "C1'" 1 
ATOM   1863  N N1    . DT  D 2 10  ? 47.404  -95.062  -6.605  1.00 82.06  ? 38  DT  F N1    1 
ATOM   1864  C C2    . DT  D 2 10  ? 48.707  -94.610  -6.639  1.00 81.11  ? 38  DT  F C2    1 
ATOM   1865  O O2    . DT  D 2 10  ? 49.406  -94.513  -5.643  1.00 85.30  ? 38  DT  F O2    1 
ATOM   1866  N N3    . DT  D 2 10  ? 49.161  -94.265  -7.890  1.00 76.10  ? 38  DT  F N3    1 
ATOM   1867  C C4    . DT  D 2 10  ? 48.461  -94.332  -9.081  1.00 78.72  ? 38  DT  F C4    1 
ATOM   1868  O O4    . DT  D 2 10  ? 49.001  -93.983  -10.130 1.00 74.49  ? 38  DT  F O4    1 
ATOM   1869  C C5    . DT  D 2 10  ? 47.103  -94.824  -8.971  1.00 76.99  ? 38  DT  F C5    1 
ATOM   1870  C C7    . DT  D 2 10  ? 46.268  -94.935  -10.207 1.00 78.12  ? 38  DT  F C7    1 
ATOM   1871  C C6    . DT  D 2 10  ? 46.652  -95.166  -7.756  1.00 76.13  ? 38  DT  F C6    1 
ATOM   1872  P P     . DT  D 2 11  ? 44.907  -94.627  -1.518  1.00 105.09 ? 39  DT  F P     1 
ATOM   1873  O OP1   . DT  D 2 11  ? 44.573  -95.328  -0.251  1.00 104.72 ? 39  DT  F OP1   1 
ATOM   1874  O OP2   . DT  D 2 11  ? 43.843  -93.892  -2.253  1.00 103.39 ? 39  DT  F OP2   1 
ATOM   1875  O "O5'" . DT  D 2 11  ? 46.127  -93.649  -1.215  1.00 100.00 ? 39  DT  F "O5'" 1 
ATOM   1876  C "C5'" . DT  D 2 11  ? 46.958  -93.204  -2.301  1.00 98.88  ? 39  DT  F "C5'" 1 
ATOM   1877  C "C4'" . DT  D 2 11  ? 48.211  -92.531  -1.797  1.00 98.68  ? 39  DT  F "C4'" 1 
ATOM   1878  O "O4'" . DT  D 2 11  ? 49.105  -92.311  -2.910  1.00 95.10  ? 39  DT  F "O4'" 1 
ATOM   1879  C "C3'" . DT  D 2 11  ? 47.983  -91.153  -1.191  1.00 97.90  ? 39  DT  F "C3'" 1 
ATOM   1880  O "O3'" . DT  D 2 11  ? 48.983  -90.862  -0.212  1.00 98.04  ? 39  DT  F "O3'" 1 
ATOM   1881  C "C2'" . DT  D 2 11  ? 48.089  -90.231  -2.391  1.00 95.42  ? 39  DT  F "C2'" 1 
ATOM   1882  C "C1'" . DT  D 2 11  ? 49.065  -90.949  -3.318  1.00 85.15  ? 39  DT  F "C1'" 1 
ATOM   1883  N N1    . DT  D 2 11  ? 48.705  -90.915  -4.750  1.00 73.88  ? 39  DT  F N1    1 
ATOM   1884  C C2    . DT  D 2 11  ? 49.682  -90.557  -5.651  1.00 74.82  ? 39  DT  F C2    1 
ATOM   1885  O O2    . DT  D 2 11  ? 50.819  -90.265  -5.319  1.00 79.70  ? 39  DT  F O2    1 
ATOM   1886  N N3    . DT  D 2 11  ? 49.278  -90.552  -6.964  1.00 72.23  ? 39  DT  F N3    1 
ATOM   1887  C C4    . DT  D 2 11  ? 48.024  -90.870  -7.452  1.00 75.34  ? 39  DT  F C4    1 
ATOM   1888  O O4    . DT  D 2 11  ? 47.809  -90.827  -8.662  1.00 77.43  ? 39  DT  F O4    1 
ATOM   1889  C C5    . DT  D 2 11  ? 47.049  -91.241  -6.450  1.00 72.43  ? 39  DT  F C5    1 
ATOM   1890  C C7    . DT  D 2 11  ? 45.662  -91.596  -6.885  1.00 74.51  ? 39  DT  F C7    1 
ATOM   1891  C C6    . DT  D 2 11  ? 47.434  -91.247  -5.168  1.00 68.11  ? 39  DT  F C6    1 
ATOM   1892  P P     . DC  D 2 12  ? 48.699  -89.760  0.900   1.00 97.82  ? 40  DC  F P     1 
ATOM   1893  O OP1   . DC  D 2 12  ? 49.561  -90.054  2.072   1.00 99.58  ? 40  DC  F OP1   1 
ATOM   1894  O OP2   . DC  D 2 12  ? 47.223  -89.648  1.076   1.00 89.61  ? 40  DC  F OP2   1 
ATOM   1895  O "O5'" . DC  D 2 12  ? 49.263  -88.434  0.225   1.00 103.97 ? 40  DC  F "O5'" 1 
ATOM   1896  C "C5'" . DC  D 2 12  ? 50.634  -88.336  -0.212  1.00 105.66 ? 40  DC  F "C5'" 1 
ATOM   1897  C "C4'" . DC  D 2 12  ? 50.822  -87.066  -1.009  1.00 108.37 ? 40  DC  F "C4'" 1 
ATOM   1898  O "O4'" . DC  D 2 12  ? 50.338  -87.274  -2.361  1.00 103.89 ? 40  DC  F "O4'" 1 
ATOM   1899  C "C3'" . DC  D 2 12  ? 50.038  -85.870  -0.462  1.00 111.37 ? 40  DC  F "C3'" 1 
ATOM   1900  O "O3'" . DC  D 2 12  ? 50.779  -84.644  -0.555  1.00 117.08 ? 40  DC  F "O3'" 1 
ATOM   1901  C "C2'" . DC  D 2 12  ? 48.795  -85.851  -1.332  1.00 103.78 ? 40  DC  F "C2'" 1 
ATOM   1902  C "C1'" . DC  D 2 12  ? 49.380  -86.273  -2.667  1.00 98.04  ? 40  DC  F "C1'" 1 
ATOM   1903  N N1    . DC  D 2 12  ? 48.442  -86.817  -3.669  1.00 86.32  ? 40  DC  F N1    1 
ATOM   1904  C C2    . DC  D 2 12  ? 48.839  -86.830  -5.011  1.00 81.93  ? 40  DC  F C2    1 
ATOM   1905  O O2    . DC  D 2 12  ? 49.973  -86.421  -5.305  1.00 79.87  ? 40  DC  F O2    1 
ATOM   1906  N N3    . DC  D 2 12  ? 47.985  -87.298  -5.951  1.00 78.07  ? 40  DC  F N3    1 
ATOM   1907  C C4    . DC  D 2 12  ? 46.775  -87.738  -5.593  1.00 82.62  ? 40  DC  F C4    1 
ATOM   1908  N N4    . DC  D 2 12  ? 45.966  -88.194  -6.552  1.00 84.24  ? 40  DC  F N4    1 
ATOM   1909  C C5    . DC  D 2 12  ? 46.340  -87.726  -4.233  1.00 79.92  ? 40  DC  F C5    1 
ATOM   1910  C C6    . DC  D 2 12  ? 47.194  -87.254  -3.314  1.00 81.87  ? 40  DC  F C6    1 
ATOM   1911  P P     . DA  D 2 13  ? 50.606  -83.517  0.582   1.00 113.06 ? 41  DA  F P     1 
ATOM   1912  O OP1   . DA  D 2 13  ? 51.308  -83.977  1.808   1.00 108.49 ? 41  DA  F OP1   1 
ATOM   1913  O OP2   . DA  D 2 13  ? 49.165  -83.155  0.655   1.00 107.09 ? 41  DA  F OP2   1 
ATOM   1914  O "O5'" . DA  D 2 13  ? 51.432  -82.288  -0.002  1.00 106.44 ? 41  DA  F "O5'" 1 
ATOM   1915  C "C5'" . DA  D 2 13  ? 52.833  -82.400  -0.312  1.00 104.71 ? 41  DA  F "C5'" 1 
ATOM   1916  C "C4'" . DA  D 2 13  ? 53.095  -81.845  -1.693  1.00 106.95 ? 41  DA  F "C4'" 1 
ATOM   1917  O "O4'" . DA  D 2 13  ? 52.225  -82.507  -2.647  1.00 111.09 ? 41  DA  F "O4'" 1 
ATOM   1918  C "C3'" . DA  D 2 13  ? 52.811  -80.349  -1.845  1.00 103.74 ? 41  DA  F "C3'" 1 
ATOM   1919  O "O3'" . DA  D 2 13  ? 53.744  -79.754  -2.755  1.00 105.41 ? 41  DA  F "O3'" 1 
ATOM   1920  C "C2'" . DA  D 2 13  ? 51.400  -80.332  -2.401  1.00 101.43 ? 41  DA  F "C2'" 1 
ATOM   1921  C "C1'" . DA  D 2 13  ? 51.433  -81.540  -3.322  1.00 98.46  ? 41  DA  F "C1'" 1 
ATOM   1922  N N9    . DA  D 2 13  ? 50.125  -82.134  -3.590  1.00 88.75  ? 41  DA  F N9    1 
ATOM   1923  C C8    . DA  D 2 13  ? 49.127  -82.409  -2.687  1.00 86.77  ? 41  DA  F C8    1 
ATOM   1924  N N7    . DA  D 2 13  ? 48.051  -82.924  -3.230  1.00 85.81  ? 41  DA  F N7    1 
ATOM   1925  C C5    . DA  D 2 13  ? 48.362  -82.997  -4.581  1.00 79.56  ? 41  DA  F C5    1 
ATOM   1926  C C6    . DA  D 2 13  ? 47.639  -83.462  -5.693  1.00 78.68  ? 41  DA  F C6    1 
ATOM   1927  N N6    . DA  D 2 13  ? 46.403  -83.964  -5.615  1.00 74.83  ? 41  DA  F N6    1 
ATOM   1928  N N1    . DA  D 2 13  ? 48.237  -83.395  -6.904  1.00 77.10  ? 41  DA  F N1    1 
ATOM   1929  C C2    . DA  D 2 13  ? 49.480  -82.900  -6.978  1.00 78.05  ? 41  DA  F C2    1 
ATOM   1930  N N3    . DA  D 2 13  ? 50.263  -82.438  -6.002  1.00 75.44  ? 41  DA  F N3    1 
ATOM   1931  C C4    . DA  D 2 13  ? 49.635  -82.512  -4.816  1.00 77.99  ? 41  DA  F C4    1 
ATOM   1932  P P     . DT  D 2 14  ? 53.824  -78.156  -2.913  1.00 101.20 ? 42  DT  F P     1 
ATOM   1933  O OP1   . DT  D 2 14  ? 55.238  -77.731  -2.725  1.00 94.13  ? 42  DT  F OP1   1 
ATOM   1934  O OP2   . DT  D 2 14  ? 52.736  -77.556  -2.087  1.00 88.35  ? 42  DT  F OP2   1 
ATOM   1935  O "O5'" . DT  D 2 14  ? 53.536  -77.941  -4.461  1.00 87.72  ? 42  DT  F "O5'" 1 
ATOM   1936  C "C5'" . DT  D 2 14  ? 52.248  -78.263  -4.981  1.00 85.95  ? 42  DT  F "C5'" 1 
ATOM   1937  C "C4'" . DT  D 2 14  ? 52.332  -78.479  -6.469  1.00 86.41  ? 42  DT  F "C4'" 1 
ATOM   1938  O "O4'" . DT  D 2 14  ? 51.335  -79.446  -6.864  1.00 85.89  ? 42  DT  F "O4'" 1 
ATOM   1939  C "C3'" . DT  D 2 14  ? 52.043  -77.228  -7.287  1.00 86.13  ? 42  DT  F "C3'" 1 
ATOM   1940  O "O3'" . DT  D 2 14  ? 52.857  -77.228  -8.462  1.00 90.47  ? 42  DT  F "O3'" 1 
ATOM   1941  C "C2'" . DT  D 2 14  ? 50.548  -77.318  -7.542  1.00 84.79  ? 42  DT  F "C2'" 1 
ATOM   1942  C "C1'" . DT  D 2 14  ? 50.249  -78.813  -7.525  1.00 75.89  ? 42  DT  F "C1'" 1 
ATOM   1943  N N1    . DT  D 2 14  ? 49.011  -79.204  -6.825  1.00 68.72  ? 42  DT  F N1    1 
ATOM   1944  C C2    . DT  D 2 14  ? 47.950  -79.645  -7.584  1.00 74.77  ? 42  DT  F C2    1 
ATOM   1945  O O2    . DT  D 2 14  ? 47.978  -79.695  -8.803  1.00 76.19  ? 42  DT  F O2    1 
ATOM   1946  N N3    . DT  D 2 14  ? 46.844  -80.020  -6.859  1.00 74.37  ? 42  DT  F N3    1 
ATOM   1947  C C4    . DT  D 2 14  ? 46.703  -80.006  -5.484  1.00 71.01  ? 42  DT  F C4    1 
ATOM   1948  O O4    . DT  D 2 14  ? 45.644  -80.362  -4.972  1.00 70.77  ? 42  DT  F O4    1 
ATOM   1949  C C5    . DT  D 2 14  ? 47.859  -79.543  -4.752  1.00 68.73  ? 42  DT  F C5    1 
ATOM   1950  C C7    . DT  D 2 14  ? 47.794  -79.484  -3.258  1.00 72.32  ? 42  DT  F C7    1 
ATOM   1951  C C6    . DT  D 2 14  ? 48.940  -79.171  -5.449  1.00 65.23  ? 42  DT  F C6    1 
ATOM   1952  P P     . DA  D 2 15  ? 53.240  -75.851  -9.149  1.00 96.84  ? 43  DA  F P     1 
ATOM   1953  O OP1   . DA  D 2 15  ? 54.288  -76.107  -10.176 1.00 99.07  ? 43  DA  F OP1   1 
ATOM   1954  O OP2   . DA  D 2 15  ? 53.491  -74.857  -8.073  1.00 105.41 ? 43  DA  F OP2   1 
ATOM   1955  O "O5'" . DA  D 2 15  ? 51.896  -75.464  -9.903  1.00 89.86  ? 43  DA  F "O5'" 1 
ATOM   1956  C "C5'" . DA  D 2 15  ? 51.785  -75.655  -11.319 1.00 89.57  ? 43  DA  F "C5'" 1 
ATOM   1957  C "C4'" . DA  D 2 15  ? 50.364  -75.377  -11.743 1.00 90.77  ? 43  DA  F "C4'" 1 
ATOM   1958  O "O4'" . DA  D 2 15  ? 49.466  -76.084  -10.869 1.00 82.55  ? 43  DA  F "O4'" 1 
ATOM   1959  C "C3'" . DA  D 2 15  ? 49.957  -73.905  -11.655 1.00 91.63  ? 43  DA  F "C3'" 1 
ATOM   1960  O "O3'" . DA  D 2 15  ? 49.940  -73.364  -12.980 1.00 100.35 ? 43  DA  F "O3'" 1 
ATOM   1961  C "C2'" . DA  D 2 15  ? 48.606  -73.920  -10.951 1.00 81.47  ? 43  DA  F "C2'" 1 
ATOM   1962  C "C1'" . DA  D 2 15  ? 48.245  -75.389  -10.842 1.00 76.74  ? 43  DA  F "C1'" 1 
ATOM   1963  N N9    . DA  D 2 15  ? 47.571  -75.752  -9.604  1.00 71.41  ? 43  DA  F N9    1 
ATOM   1964  C C8    . DA  D 2 15  ? 47.968  -75.471  -8.321  1.00 72.07  ? 43  DA  F C8    1 
ATOM   1965  N N7    . DA  D 2 15  ? 47.164  -75.949  -7.402  1.00 70.08  ? 43  DA  F N7    1 
ATOM   1966  C C5    . DA  D 2 15  ? 46.178  -76.600  -8.129  1.00 67.97  ? 43  DA  F C5    1 
ATOM   1967  C C6    . DA  D 2 15  ? 45.032  -77.311  -7.739  1.00 69.96  ? 43  DA  F C6    1 
ATOM   1968  N N6    . DA  D 2 15  ? 44.675  -77.490  -6.467  1.00 75.12  ? 43  DA  F N6    1 
ATOM   1969  N N1    . DA  D 2 15  ? 44.254  -77.836  -8.712  1.00 69.66  ? 43  DA  F N1    1 
ATOM   1970  C C2    . DA  D 2 15  ? 44.615  -77.650  -9.991  1.00 71.78  ? 43  DA  F C2    1 
ATOM   1971  N N3    . DA  D 2 15  ? 45.669  -76.998  -10.482 1.00 68.77  ? 43  DA  F N3    1 
ATOM   1972  C C4    . DA  D 2 15  ? 46.420  -76.493  -9.487  1.00 68.75  ? 43  DA  F C4    1 
ATOM   1973  P P     . DC  D 2 16  ? 49.355  -71.911  -13.253 1.00 92.96  ? 44  DC  F P     1 
ATOM   1974  O OP1   . DC  D 2 16  ? 50.142  -71.302  -14.356 1.00 94.36  ? 44  DC  F OP1   1 
ATOM   1975  O OP2   . DC  D 2 16  ? 49.263  -71.205  -11.946 1.00 98.29  ? 44  DC  F OP2   1 
ATOM   1976  O "O5'" . DC  D 2 16  ? 47.916  -72.242  -13.845 1.00 77.48  ? 44  DC  F "O5'" 1 
ATOM   1977  C "C5'" . DC  D 2 16  ? 46.734  -71.686  -13.270 1.00 74.18  ? 44  DC  F "C5'" 1 
ATOM   1978  C "C4'" . DC  D 2 16  ? 45.649  -72.731  -13.221 1.00 70.28  ? 44  DC  F "C4'" 1 
ATOM   1979  O "O4'" . DC  D 2 16  ? 45.776  -73.517  -12.026 1.00 68.34  ? 44  DC  F "O4'" 1 
ATOM   1980  C "C3'" . DC  D 2 16  ? 44.243  -72.164  -13.138 1.00 73.55  ? 44  DC  F "C3'" 1 
ATOM   1981  O "O3'" . DC  D 2 16  ? 43.783  -71.809  -14.437 1.00 82.25  ? 44  DC  F "O3'" 1 
ATOM   1982  C "C2'" . DC  D 2 16  ? 43.458  -73.297  -12.503 1.00 69.90  ? 44  DC  F "C2'" 1 
ATOM   1983  C "C1'" . DC  D 2 16  ? 44.508  -74.091  -11.727 1.00 67.50  ? 44  DC  F "C1'" 1 
ATOM   1984  N N1    . DC  D 2 16  ? 44.338  -74.079  -10.270 1.00 64.80  ? 44  DC  F N1    1 
ATOM   1985  C C2    . DC  D 2 16  ? 43.215  -74.701  -9.712  1.00 69.66  ? 44  DC  F C2    1 
ATOM   1986  O O2    . DC  D 2 16  ? 42.384  -75.231  -10.466 1.00 69.26  ? 44  DC  F O2    1 
ATOM   1987  N N3    . DC  D 2 16  ? 43.064  -74.709  -8.367  1.00 70.40  ? 44  DC  F N3    1 
ATOM   1988  C C4    . DC  D 2 16  ? 43.982  -74.126  -7.590  1.00 74.01  ? 44  DC  F C4    1 
ATOM   1989  N N4    . DC  D 2 16  ? 43.793  -74.153  -6.270  1.00 79.80  ? 44  DC  F N4    1 
ATOM   1990  C C5    . DC  D 2 16  ? 45.137  -73.493  -8.133  1.00 70.61  ? 44  DC  F C5    1 
ATOM   1991  C C6    . DC  D 2 16  ? 45.276  -73.495  -9.464  1.00 67.28  ? 44  DC  F C6    1 
ATOM   1992  P P     . DT  D 2 17  ? 42.701  -70.667  -14.573 1.00 88.12  ? 45  DT  F P     1 
ATOM   1993  O OP1   . DT  D 2 17  ? 42.363  -70.523  -16.017 1.00 87.80  ? 45  DT  F OP1   1 
ATOM   1994  O OP2   . DT  D 2 17  ? 43.197  -69.488  -13.815 1.00 93.72  ? 45  DT  F OP2   1 
ATOM   1995  O "O5'" . DT  D 2 17  ? 41.466  -71.270  -13.773 1.00 69.63  ? 45  DT  F "O5'" 1 
ATOM   1996  C "C5'" . DT  D 2 17  ? 40.281  -71.667  -14.476 1.00 70.64  ? 45  DT  F "C5'" 1 
ATOM   1997  C "C4'" . DT  D 2 17  ? 39.460  -72.559  -13.581 1.00 71.28  ? 45  DT  F "C4'" 1 
ATOM   1998  O "O4'" . DT  D 2 17  ? 40.257  -72.898  -12.431 1.00 68.45  ? 45  DT  F "O4'" 1 
ATOM   1999  C "C3'" . DT  D 2 17  ? 38.213  -71.909  -12.998 1.00 74.75  ? 45  DT  F "C3'" 1 
ATOM   2000  O "O3'" . DT  D 2 17  ? 37.095  -72.029  -13.877 1.00 83.74  ? 45  DT  F "O3'" 1 
ATOM   2001  C "C2'" . DT  D 2 17  ? 38.006  -72.667  -11.696 1.00 70.73  ? 45  DT  F "C2'" 1 
ATOM   2002  C "C1'" . DT  D 2 17  ? 39.396  -73.181  -11.334 1.00 66.52  ? 45  DT  F "C1'" 1 
ATOM   2003  N N1    . DT  D 2 17  ? 40.013  -72.620  -10.121 1.00 65.16  ? 45  DT  F N1    1 
ATOM   2004  C C2    . DT  D 2 17  ? 39.438  -72.910  -8.904  1.00 66.85  ? 45  DT  F C2    1 
ATOM   2005  O O2    . DT  D 2 17  ? 38.407  -73.554  -8.791  1.00 62.66  ? 45  DT  F O2    1 
ATOM   2006  N N3    . DT  D 2 17  ? 40.109  -72.399  -7.817  1.00 70.55  ? 45  DT  F N3    1 
ATOM   2007  C C4    . DT  D 2 17  ? 41.271  -71.647  -7.831  1.00 72.46  ? 45  DT  F C4    1 
ATOM   2008  O O4    . DT  D 2 17  ? 41.757  -71.251  -6.774  1.00 72.93  ? 45  DT  F O4    1 
ATOM   2009  C C5    . DT  D 2 17  ? 41.823  -71.389  -9.142  1.00 73.24  ? 45  DT  F C5    1 
ATOM   2010  C C7    . DT  D 2 17  ? 43.080  -70.585  -9.257  1.00 74.73  ? 45  DT  F C7    1 
ATOM   2011  C C6    . DT  D 2 17  ? 41.179  -71.888  -10.206 1.00 69.54  ? 45  DT  F C6    1 
ATOM   2012  P P     . DT  D 2 18  ? 36.100  -70.797  -14.039 1.00 96.16  ? 46  DT  F P     1 
ATOM   2013  O OP1   . DT  D 2 18  ? 34.770  -71.306  -14.474 1.00 87.40  ? 46  DT  F OP1   1 
ATOM   2014  O OP2   . DT  D 2 18  ? 36.800  -69.742  -14.825 1.00 94.87  ? 46  DT  F OP2   1 
ATOM   2015  O "O5'" . DT  D 2 18  ? 35.911  -70.298  -12.544 1.00 88.78  ? 46  DT  F "O5'" 1 
ATOM   2016  C "C5'" . DT  D 2 18  ? 34.641  -69.793  -12.131 1.00 92.96  ? 46  DT  F "C5'" 1 
ATOM   2017  C "C4'" . DT  D 2 18  ? 33.838  -70.897  -11.488 1.00 88.80  ? 46  DT  F "C4'" 1 
ATOM   2018  O "O4'" . DT  D 2 18  ? 34.700  -71.651  -10.610 1.00 84.67  ? 46  DT  F "O4'" 1 
ATOM   2019  C "C3'" . DT  D 2 18  ? 32.702  -70.373  -10.615 1.00 90.74  ? 46  DT  F "C3'" 1 
ATOM   2020  O "O3'" . DT  D 2 18  ? 31.530  -71.179  -10.700 1.00 95.25  ? 46  DT  F "O3'" 1 
ATOM   2021  C "C2'" . DT  D 2 18  ? 33.303  -70.318  -9.220  1.00 86.87  ? 46  DT  F "C2'" 1 
ATOM   2022  C "C1'" . DT  D 2 18  ? 34.475  -71.285  -9.248  1.00 81.11  ? 46  DT  F "C1'" 1 
ATOM   2023  N N1    . DT  D 2 18  ? 35.744  -70.751  -8.689  1.00 68.53  ? 46  DT  F N1    1 
ATOM   2024  C C2    . DT  D 2 18  ? 35.910  -70.805  -7.323  1.00 66.45  ? 46  DT  F C2    1 
ATOM   2025  O O2    . DT  D 2 18  ? 35.060  -71.244  -6.565  1.00 68.72  ? 46  DT  F O2    1 
ATOM   2026  N N3    . DT  D 2 18  ? 37.116  -70.322  -6.873  1.00 62.58  ? 46  DT  F N3    1 
ATOM   2027  C C4    . DT  D 2 18  ? 38.147  -69.807  -7.638  1.00 62.40  ? 46  DT  F C4    1 
ATOM   2028  O O4    . DT  D 2 18  ? 39.177  -69.415  -7.093  1.00 59.75  ? 46  DT  F O4    1 
ATOM   2029  C C5    . DT  D 2 18  ? 37.904  -69.779  -9.062  1.00 61.24  ? 46  DT  F C5    1 
ATOM   2030  C C7    . DT  D 2 18  ? 38.963  -69.235  -9.969  1.00 58.29  ? 46  DT  F C7    1 
ATOM   2031  C C6    . DT  D 2 18  ? 36.726  -70.237  -9.509  1.00 62.82  ? 46  DT  F C6    1 
ATOM   2032  P P     . DG  D 2 19  ? 30.158  -70.597  -10.159 1.00 103.43 ? 47  DG  F P     1 
ATOM   2033  O OP1   . DG  D 2 19  ? 29.062  -71.513  -10.572 1.00 110.16 ? 47  DG  F OP1   1 
ATOM   2034  O OP2   . DG  D 2 19  ? 30.092  -69.164  -10.544 1.00 105.78 ? 47  DG  F OP2   1 
ATOM   2035  O "O5'" . DG  D 2 19  ? 30.328  -70.726  -8.583  1.00 94.91  ? 47  DG  F "O5'" 1 
ATOM   2036  C "C5'" . DG  D 2 19  ? 30.343  -69.547  -7.777  1.00 101.80 ? 47  DG  F "C5'" 1 
ATOM   2037  C "C4'" . DG  D 2 19  ? 30.556  -69.900  -6.326  1.00 102.73 ? 47  DG  F "C4'" 1 
ATOM   2038  O "O4'" . DG  D 2 19  ? 31.980  -69.948  -6.053  1.00 102.44 ? 47  DG  F "O4'" 1 
ATOM   2039  C "C3'" . DG  D 2 19  ? 29.986  -68.849  -5.376  1.00 102.39 ? 47  DG  F "C3'" 1 
ATOM   2040  O "O3'" . DG  D 2 19  ? 29.497  -69.420  -4.158  1.00 105.82 ? 47  DG  F "O3'" 1 
ATOM   2041  C "C2'" . DG  D 2 19  ? 31.172  -67.933  -5.155  1.00 99.25  ? 47  DG  F "C2'" 1 
ATOM   2042  C "C1'" . DG  D 2 19  ? 32.337  -68.906  -5.149  1.00 93.33  ? 47  DG  F "C1'" 1 
ATOM   2043  N N9    . DG  D 2 19  ? 33.607  -68.326  -5.587  1.00 83.28  ? 47  DG  F N9    1 
ATOM   2044  C C8    . DG  D 2 19  ? 33.949  -67.904  -6.851  1.00 80.59  ? 47  DG  F C8    1 
ATOM   2045  N N7    . DG  D 2 19  ? 35.157  -67.411  -6.918  1.00 71.79  ? 47  DG  F N7    1 
ATOM   2046  C C5    . DG  D 2 19  ? 35.635  -67.498  -5.618  1.00 72.19  ? 47  DG  F C5    1 
ATOM   2047  C C6    . DG  D 2 19  ? 36.888  -67.111  -5.069  1.00 72.73  ? 47  DG  F C6    1 
ATOM   2048  O O6    . DG  D 2 19  ? 37.859  -66.604  -5.645  1.00 69.06  ? 47  DG  F O6    1 
ATOM   2049  N N1    . DG  D 2 19  ? 36.953  -67.378  -3.704  1.00 71.52  ? 47  DG  F N1    1 
ATOM   2050  C C2    . DG  D 2 19  ? 35.942  -67.941  -2.961  1.00 73.52  ? 47  DG  F C2    1 
ATOM   2051  N N2    . DG  D 2 19  ? 36.193  -68.118  -1.655  1.00 74.62  ? 47  DG  F N2    1 
ATOM   2052  N N3    . DG  D 2 19  ? 34.770  -68.301  -3.459  1.00 69.14  ? 47  DG  F N3    1 
ATOM   2053  C C4    . DG  D 2 19  ? 34.688  -68.055  -4.783  1.00 73.24  ? 47  DG  F C4    1 
ATOM   2054  P P     . DT  D 2 20  ? 28.372  -68.646  -3.303  1.00 112.97 ? 48  DT  F P     1 
ATOM   2055  O OP1   . DT  D 2 20  ? 28.489  -69.078  -1.881  1.00 105.29 ? 48  DT  F OP1   1 
ATOM   2056  O OP2   . DT  D 2 20  ? 27.072  -68.783  -4.010  1.00 105.68 ? 48  DT  F OP2   1 
ATOM   2057  O "O5'" . DT  D 2 20  ? 28.814  -67.119  -3.431  1.00 123.28 ? 48  DT  F "O5'" 1 
ATOM   2058  C "C5'" . DT  D 2 20  ? 29.020  -66.279  -2.270  1.00 115.95 ? 48  DT  F "C5'" 1 
ATOM   2059  C "C4'" . DT  D 2 20  ? 30.431  -66.429  -1.750  1.00 102.49 ? 48  DT  F "C4'" 1 
ATOM   2060  O "O4'" . DT  D 2 20  ? 31.374  -66.270  -2.820  1.00 95.62  ? 48  DT  F "O4'" 1 
ATOM   2061  C "C3'" . DT  D 2 20  ? 30.853  -65.382  -0.730  1.00 96.85  ? 48  DT  F "C3'" 1 
ATOM   2062  O "O3'" . DT  D 2 20  ? 30.434  -65.828  0.558   1.00 105.16 ? 48  DT  F "O3'" 1 
ATOM   2063  C "C2'" . DT  D 2 20  ? 32.363  -65.282  -0.919  1.00 90.56  ? 48  DT  F "C2'" 1 
ATOM   2064  C "C1'" . DT  D 2 20  ? 32.636  -65.995  -2.242  1.00 86.11  ? 48  DT  F "C1'" 1 
ATOM   2065  N N1    . DT  D 2 20  ? 33.465  -65.303  -3.263  1.00 72.19  ? 48  DT  F N1    1 
ATOM   2066  C C2    . DT  D 2 20  ? 34.760  -64.968  -2.936  1.00 69.62  ? 48  DT  F C2    1 
ATOM   2067  O O2    . DT  D 2 20  ? 35.234  -65.144  -1.826  1.00 78.64  ? 48  DT  F O2    1 
ATOM   2068  N N3    . DT  D 2 20  ? 35.482  -64.405  -3.960  1.00 63.43  ? 48  DT  F N3    1 
ATOM   2069  C C4    . DT  D 2 20  ? 35.051  -64.163  -5.251  1.00 63.40  ? 48  DT  F C4    1 
ATOM   2070  O O4    . DT  D 2 20  ? 35.814  -63.646  -6.064  1.00 61.71  ? 48  DT  F O4    1 
ATOM   2071  C C5    . DT  D 2 20  ? 33.686  -64.547  -5.526  1.00 62.63  ? 48  DT  F C5    1 
ATOM   2072  C C7    . DT  D 2 20  ? 33.129  -64.318  -6.896  1.00 61.98  ? 48  DT  F C7    1 
ATOM   2073  C C6    . DT  D 2 20  ? 32.975  -65.100  -4.535  1.00 64.80  ? 48  DT  F C6    1 
ATOM   2074  P P     . DA  D 2 21  ? 29.759  -64.794  1.555   1.00 109.92 ? 49  DA  F P     1 
ATOM   2075  O OP1   . DA  D 2 21  ? 29.215  -65.552  2.711   1.00 109.87 ? 49  DA  F OP1   1 
ATOM   2076  O OP2   . DA  D 2 21  ? 28.856  -63.923  0.758   1.00 106.16 ? 49  DA  F OP2   1 
ATOM   2077  O "O5'" . DA  D 2 21  ? 31.027  -63.999  2.100   1.00 109.02 ? 49  DA  F "O5'" 1 
ATOM   2078  C "C5'" . DA  D 2 21  ? 32.102  -64.742  2.709   1.00 106.56 ? 49  DA  F "C5'" 1 
ATOM   2079  C "C4'" . DA  D 2 21  ? 33.249  -63.834  3.087   1.00 100.68 ? 49  DA  F "C4'" 1 
ATOM   2080  O "O4'" . DA  D 2 21  ? 34.029  -63.498  1.918   1.00 93.57  ? 49  DA  F "O4'" 1 
ATOM   2081  C "C3'" . DA  D 2 21  ? 32.842  -62.508  3.724   1.00 95.73  ? 49  DA  F "C3'" 1 
ATOM   2082  O "O3'" . DA  D 2 21  ? 33.724  -62.274  4.825   1.00 96.32  ? 49  DA  F "O3'" 1 
ATOM   2083  C "C2'" . DA  D 2 21  ? 32.958  -61.516  2.580   1.00 90.22  ? 49  DA  F "C2'" 1 
ATOM   2084  C "C1'" . DA  D 2 21  ? 34.090  -62.092  1.745   1.00 87.16  ? 49  DA  F "C1'" 1 
ATOM   2085  N N9    . DA  D 2 21  ? 34.010  -61.824  0.308   1.00 80.87  ? 49  DA  F N9    1 
ATOM   2086  C C8    . DA  D 2 21  ? 32.923  -61.977  -0.518  1.00 76.56  ? 49  DA  F C8    1 
ATOM   2087  N N7    . DA  D 2 21  ? 33.167  -61.684  -1.773  1.00 69.93  ? 49  DA  F N7    1 
ATOM   2088  C C5    . DA  D 2 21  ? 34.506  -61.320  -1.776  1.00 68.87  ? 49  DA  F C5    1 
ATOM   2089  C C6    . DA  D 2 21  ? 35.368  -60.895  -2.802  1.00 69.46  ? 49  DA  F C6    1 
ATOM   2090  N N6    . DA  D 2 21  ? 34.991  -60.764  -4.077  1.00 66.09  ? 49  DA  F N6    1 
ATOM   2091  N N1    . DA  D 2 21  ? 36.646  -60.603  -2.470  1.00 70.95  ? 49  DA  F N1    1 
ATOM   2092  C C2    . DA  D 2 21  ? 37.023  -60.736  -1.189  1.00 73.77  ? 49  DA  F C2    1 
ATOM   2093  N N3    . DA  D 2 21  ? 36.304  -61.127  -0.135  1.00 71.03  ? 49  DA  F N3    1 
ATOM   2094  C C4    . DA  D 2 21  ? 35.040  -61.405  -0.501  1.00 72.07  ? 49  DA  F C4    1 
ATOM   2095  P P     . DC  D 2 22  ? 33.413  -61.118  5.872   1.00 99.80  ? 50  DC  F P     1 
ATOM   2096  O OP1   . DC  D 2 22  ? 34.094  -61.460  7.153   1.00 92.34  ? 50  DC  F OP1   1 
ATOM   2097  O OP2   . DC  D 2 22  ? 31.950  -60.857  5.851   1.00 93.43  ? 50  DC  F OP2   1 
ATOM   2098  O "O5'" . DC  D 2 22  ? 34.194  -59.881  5.248   1.00 93.58  ? 50  DC  F "O5'" 1 
ATOM   2099  C "C5'" . DC  D 2 22  ? 35.566  -60.034  4.841   1.00 90.37  ? 50  DC  F "C5'" 1 
ATOM   2100  C "C4'" . DC  D 2 22  ? 36.023  -58.822  4.065   1.00 87.96  ? 50  DC  F "C4'" 1 
ATOM   2101  O "O4'" . DC  D 2 22  ? 35.725  -58.972  2.651   1.00 82.38  ? 50  DC  F "O4'" 1 
ATOM   2102  C "C3'" . DC  D 2 22  ? 35.365  -57.507  4.493   1.00 86.92  ? 50  DC  F "C3'" 1 
ATOM   2103  O "O3'" . DC  D 2 22  ? 36.362  -56.489  4.492   1.00 91.58  ? 50  DC  F "O3'" 1 
ATOM   2104  C "C2'" . DC  D 2 22  ? 34.396  -57.223  3.363   1.00 82.69  ? 50  DC  F "C2'" 1 
ATOM   2105  C "C1'" . DC  D 2 22  ? 35.230  -57.728  2.207   1.00 74.49  ? 50  DC  F "C1'" 1 
ATOM   2106  N N1    . DC  D 2 22  ? 34.556  -57.918  0.914   1.00 65.94  ? 50  DC  F N1    1 
ATOM   2107  C C2    . DC  D 2 22  ? 35.318  -57.780  -0.251  1.00 68.37  ? 50  DC  F C2    1 
ATOM   2108  O O2    . DC  D 2 22  ? 36.534  -57.555  -0.148  1.00 74.29  ? 50  DC  F O2    1 
ATOM   2109  N N3    . DC  D 2 22  ? 34.716  -57.907  -1.456  1.00 61.41  ? 50  DC  F N3    1 
ATOM   2110  C C4    . DC  D 2 22  ? 33.402  -58.132  -1.523  1.00 61.79  ? 50  DC  F C4    1 
ATOM   2111  N N4    . DC  D 2 22  ? 32.848  -58.241  -2.732  1.00 63.47  ? 50  DC  F N4    1 
ATOM   2112  C C5    . DC  D 2 22  ? 32.597  -58.254  -0.352  1.00 61.40  ? 50  DC  F C5    1 
ATOM   2113  C C6    . DC  D 2 22  ? 33.207  -58.128  0.835   1.00 62.02  ? 50  DC  F C6    1 
ATOM   2114  P P     . DA  D 2 23  ? 36.549  -55.552  5.748   1.00 91.59  ? 51  DA  F P     1 
ATOM   2115  O OP1   . DA  D 2 23  ? 37.301  -56.311  6.779   1.00 84.57  ? 51  DA  F OP1   1 
ATOM   2116  O OP2   . DA  D 2 23  ? 35.224  -54.976  6.082   1.00 92.92  ? 51  DA  F OP2   1 
ATOM   2117  O "O5'" . DA  D 2 23  ? 37.528  -54.439  5.173   1.00 92.08  ? 51  DA  F "O5'" 1 
ATOM   2118  C "C5'" . DA  D 2 23  ? 38.893  -54.786  4.867   1.00 93.86  ? 51  DA  F "C5'" 1 
ATOM   2119  C "C4'" . DA  D 2 23  ? 39.379  -54.012  3.664   1.00 92.60  ? 51  DA  F "C4'" 1 
ATOM   2120  O "O4'" . DA  D 2 23  ? 38.636  -54.414  2.490   1.00 86.77  ? 51  DA  F "O4'" 1 
ATOM   2121  C "C3'" . DA  D 2 23  ? 39.215  -52.496  3.779   1.00 90.83  ? 51  DA  F "C3'" 1 
ATOM   2122  O "O3'" . DA  D 2 23  ? 40.409  -51.831  3.360   1.00 93.63  ? 51  DA  F "O3'" 1 
ATOM   2123  C "C2'" . DA  D 2 23  ? 38.037  -52.191  2.873   1.00 88.28  ? 51  DA  F "C2'" 1 
ATOM   2124  C "C1'" . DA  D 2 23  ? 38.145  -53.272  1.817   1.00 81.72  ? 51  DA  F "C1'" 1 
ATOM   2125  N N9    . DA  D 2 23  ? 36.868  -53.630  1.203   1.00 76.34  ? 51  DA  F N9    1 
ATOM   2126  C C8    . DA  D 2 23  ? 35.693  -53.968  1.829   1.00 74.23  ? 51  DA  F C8    1 
ATOM   2127  N N7    . DA  D 2 23  ? 34.711  -54.234  1.001   1.00 68.36  ? 51  DA  F N7    1 
ATOM   2128  C C5    . DA  D 2 23  ? 35.277  -54.057  -0.254  1.00 66.46  ? 51  DA  F C5    1 
ATOM   2129  C C6    . DA  D 2 23  ? 34.753  -54.178  -1.551  1.00 68.60  ? 51  DA  F C6    1 
ATOM   2130  N N6    . DA  D 2 23  ? 33.492  -54.530  -1.808  1.00 71.42  ? 51  DA  F N6    1 
ATOM   2131  N N1    . DA  D 2 23  ? 35.581  -53.928  -2.590  1.00 70.63  ? 51  DA  F N1    1 
ATOM   2132  C C2    . DA  D 2 23  ? 36.847  -53.571  -2.329  1.00 74.82  ? 51  DA  F C2    1 
ATOM   2133  N N3    . DA  D 2 23  ? 37.454  -53.421  -1.152  1.00 71.49  ? 51  DA  F N3    1 
ATOM   2134  C C4    . DA  D 2 23  ? 36.604  -53.681  -0.144  1.00 70.04  ? 51  DA  F C4    1 
ATOM   2135  P P     . DC  D 2 24  ? 40.595  -50.276  3.647   1.00 92.68  ? 52  DC  F P     1 
ATOM   2136  O OP1   . DC  D 2 24  ? 42.050  -49.994  3.727   1.00 90.60  ? 52  DC  F OP1   1 
ATOM   2137  O OP2   . DC  D 2 24  ? 39.706  -49.898  4.771   1.00 88.18  ? 52  DC  F OP2   1 
ATOM   2138  O "O5'" . DC  D 2 24  ? 40.020  -49.620  2.321   1.00 86.99  ? 52  DC  F "O5'" 1 
ATOM   2139  C "C5'" . DC  D 2 24  ? 40.674  -49.854  1.069   1.00 91.09  ? 52  DC  F "C5'" 1 
ATOM   2140  C "C4'" . DC  D 2 24  ? 39.894  -49.171  -0.028  1.00 94.01  ? 52  DC  F "C4'" 1 
ATOM   2141  O "O4'" . DC  D 2 24  ? 38.686  -49.927  -0.293  1.00 92.94  ? 52  DC  F "O4'" 1 
ATOM   2142  C "C3'" . DC  D 2 24  ? 39.441  -47.742  0.309   1.00 95.29  ? 52  DC  F "C3'" 1 
ATOM   2143  O "O3'" . DC  D 2 24  ? 39.852  -46.856  -0.741  1.00 99.67  ? 52  DC  F "O3'" 1 
ATOM   2144  C "C2'" . DC  D 2 24  ? 37.936  -47.874  0.464   1.00 92.09  ? 52  DC  F "C2'" 1 
ATOM   2145  C "C1'" . DC  D 2 24  ? 37.642  -49.004  -0.495  1.00 88.01  ? 52  DC  F "C1'" 1 
ATOM   2146  N N1    . DC  D 2 24  ? 36.357  -49.700  -0.311  1.00 82.47  ? 52  DC  F N1    1 
ATOM   2147  C C2    . DC  D 2 24  ? 35.726  -50.232  -1.439  1.00 81.44  ? 52  DC  F C2    1 
ATOM   2148  O O2    . DC  D 2 24  ? 36.290  -50.141  -2.541  1.00 82.12  ? 52  DC  F O2    1 
ATOM   2149  N N3    . DC  D 2 24  ? 34.523  -50.838  -1.301  1.00 75.04  ? 52  DC  F N3    1 
ATOM   2150  C C4    . DC  D 2 24  ? 33.952  -50.918  -0.097  1.00 78.99  ? 52  DC  F C4    1 
ATOM   2151  N N4    . DC  D 2 24  ? 32.770  -51.531  -0.004  1.00 81.40  ? 52  DC  F N4    1 
ATOM   2152  C C5    . DC  D 2 24  ? 34.570  -50.376  1.068   1.00 78.15  ? 52  DC  F C5    1 
ATOM   2153  C C6    . DC  D 2 24  ? 35.757  -49.773  0.915   1.00 79.02  ? 52  DC  F C6    1 
ATOM   2154  P P     . DC  D 2 25  ? 39.314  -45.342  -0.824  1.00 100.95 ? 53  DC  F P     1 
ATOM   2155  O OP1   . DC  D 2 25  ? 40.471  -44.475  -1.156  1.00 99.87  ? 53  DC  F OP1   1 
ATOM   2156  O OP2   . DC  D 2 25  ? 38.496  -45.049  0.384   1.00 92.12  ? 53  DC  F OP2   1 
ATOM   2157  O "O5'" . DC  D 2 25  ? 38.377  -45.379  -2.110  1.00 88.77  ? 53  DC  F "O5'" 1 
ATOM   2158  C "C5'" . DC  D 2 25  ? 38.919  -45.835  -3.360  1.00 84.88  ? 53  DC  F "C5'" 1 
ATOM   2159  C "C4'" . DC  D 2 25  ? 37.829  -45.889  -4.401  1.00 83.85  ? 53  DC  F "C4'" 1 
ATOM   2160  O "O4'" . DC  D 2 25  ? 36.791  -46.785  -3.953  1.00 80.29  ? 53  DC  F "O4'" 1 
ATOM   2161  C "C3'" . DC  D 2 25  ? 37.154  -44.544  -4.665  1.00 84.84  ? 53  DC  F "C3'" 1 
ATOM   2162  O "O3'" . DC  D 2 25  ? 37.212  -44.210  -6.051  1.00 89.92  ? 53  DC  F "O3'" 1 
ATOM   2163  C "C2'" . DC  D 2 25  ? 35.726  -44.735  -4.182  1.00 82.87  ? 53  DC  F "C2'" 1 
ATOM   2164  C "C1'" . DC  D 2 25  ? 35.527  -46.232  -4.244  1.00 76.92  ? 53  DC  F "C1'" 1 
ATOM   2165  N N1    . DC  D 2 25  ? 34.586  -46.738  -3.240  1.00 73.97  ? 53  DC  F N1    1 
ATOM   2166  C C2    . DC  D 2 25  ? 33.320  -47.174  -3.641  1.00 72.59  ? 53  DC  F C2    1 
ATOM   2167  O O2    . DC  D 2 25  ? 33.017  -47.113  -4.841  1.00 75.16  ? 53  DC  F O2    1 
ATOM   2168  N N3    . DC  D 2 25  ? 32.457  -47.643  -2.711  1.00 72.12  ? 53  DC  F N3    1 
ATOM   2169  C C4    . DC  D 2 25  ? 32.819  -47.681  -1.425  1.00 78.15  ? 53  DC  F C4    1 
ATOM   2170  N N4    . DC  D 2 25  ? 31.937  -48.146  -0.538  1.00 83.83  ? 53  DC  F N4    1 
ATOM   2171  C C5    . DC  D 2 25  ? 34.101  -47.240  -0.991  1.00 77.60  ? 53  DC  F C5    1 
ATOM   2172  C C6    . DC  D 2 25  ? 34.946  -46.781  -1.922  1.00 76.65  ? 53  DC  F C6    1 
ATOM   2173  P P     . DT  D 2 26  ? 37.107  -42.684  -6.488  1.00 97.93  ? 54  DT  F P     1 
ATOM   2174  O OP1   . DT  D 2 26  ? 38.416  -42.271  -7.044  1.00 100.61 ? 54  DT  F OP1   1 
ATOM   2175  O OP2   . DT  D 2 26  ? 36.541  -41.920  -5.347  1.00 96.81  ? 54  DT  F OP2   1 
ATOM   2176  O "O5'" . DT  D 2 26  ? 36.069  -42.738  -7.695  1.00 95.38  ? 54  DT  F "O5'" 1 
ATOM   2177  C "C5'" . DT  D 2 26  ? 34.918  -43.608  -7.672  1.00 93.50  ? 54  DT  F "C5'" 1 
ATOM   2178  C "C4'" . DT  D 2 26  ? 33.638  -42.809  -7.585  1.00 88.04  ? 54  DT  F "C4'" 1 
ATOM   2179  O "O4'" . DT  D 2 26  ? 32.698  -43.472  -6.701  1.00 83.86  ? 54  DT  F "O4'" 1 
ATOM   2180  C "C3'" . DT  D 2 26  ? 33.797  -41.390  -7.036  1.00 87.36  ? 54  DT  F "C3'" 1 
ATOM   2181  O "O3'" . DT  D 2 26  ? 32.978  -40.471  -7.753  1.00 84.91  ? 54  DT  F "O3'" 1 
ATOM   2182  C "C2'" . DT  D 2 26  ? 33.317  -41.515  -5.605  1.00 86.03  ? 54  DT  F "C2'" 1 
ATOM   2183  C "C1'" . DT  D 2 26  ? 32.210  -42.534  -5.760  1.00 81.73  ? 54  DT  F "C1'" 1 
ATOM   2184  N N1    . DT  D 2 26  ? 31.835  -43.262  -4.533  1.00 76.73  ? 54  DT  F N1    1 
ATOM   2185  C C2    . DT  D 2 26  ? 30.687  -44.019  -4.570  1.00 75.02  ? 54  DT  F C2    1 
ATOM   2186  O O2    . DT  D 2 26  ? 29.998  -44.134  -5.569  1.00 78.17  ? 54  DT  F O2    1 
ATOM   2187  N N3    . DT  D 2 26  ? 30.380  -44.652  -3.392  1.00 76.16  ? 54  DT  F N3    1 
ATOM   2188  C C4    . DT  D 2 26  ? 31.088  -44.594  -2.205  1.00 77.25  ? 54  DT  F C4    1 
ATOM   2189  O O4    . DT  D 2 26  ? 30.688  -45.216  -1.224  1.00 83.43  ? 54  DT  F O4    1 
ATOM   2190  C C5    . DT  D 2 26  ? 32.276  -43.773  -2.236  1.00 74.23  ? 54  DT  F C5    1 
ATOM   2191  C C7    . DT  D 2 26  ? 33.107  -43.647  -0.998  1.00 77.07  ? 54  DT  F C7    1 
ATOM   2192  C C6    . DT  D 2 26  ? 32.580  -43.149  -3.380  1.00 72.86  ? 54  DT  F C6    1 
ATOM   2193  P P     . DG  D 2 27  ? 33.216  -38.911  -7.582  1.00 77.65  ? 55  DG  F P     1 
ATOM   2194  O OP1   . DG  D 2 27  ? 33.580  -38.366  -8.915  1.00 73.99  ? 55  DG  F OP1   1 
ATOM   2195  O OP2   . DG  D 2 27  ? 34.117  -38.700  -6.420  1.00 70.06  ? 55  DG  F OP2   1 
ATOM   2196  O "O5'" . DG  D 2 27  ? 31.772  -38.390  -7.168  1.00 78.58  ? 55  DG  F "O5'" 1 
ATOM   2197  C "C5'" . DG  D 2 27  ? 30.730  -38.304  -8.155  1.00 81.27  ? 55  DG  F "C5'" 1 
ATOM   2198  C "C4'" . DG  D 2 27  ? 29.384  -38.157  -7.485  1.00 81.56  ? 55  DG  F "C4'" 1 
ATOM   2199  O "O4'" . DG  D 2 27  ? 29.131  -39.326  -6.680  1.00 80.16  ? 55  DG  F "O4'" 1 
ATOM   2200  C "C3'" . DG  D 2 27  ? 29.253  -36.977  -6.527  1.00 84.16  ? 55  DG  F "C3'" 1 
ATOM   2201  O "O3'" . DG  D 2 27  ? 28.777  -35.810  -7.206  1.00 87.84  ? 55  DG  F "O3'" 1 
ATOM   2202  C "C2'" . DG  D 2 27  ? 28.212  -37.468  -5.539  1.00 83.41  ? 55  DG  F "C2'" 1 
ATOM   2203  C "C1'" . DG  D 2 27  ? 28.428  -38.975  -5.501  1.00 79.47  ? 55  DG  F "C1'" 1 
ATOM   2204  N N9    . DG  D 2 27  ? 29.215  -39.425  -4.361  1.00 81.98  ? 55  DG  F N9    1 
ATOM   2205  C C8    . DG  D 2 27  ? 30.413  -38.914  -3.925  1.00 87.20  ? 55  DG  F C8    1 
ATOM   2206  N N7    . DG  D 2 27  ? 30.868  -39.515  -2.859  1.00 87.80  ? 55  DG  F N7    1 
ATOM   2207  C C5    . DG  D 2 27  ? 29.912  -40.479  -2.573  1.00 84.81  ? 55  DG  F C5    1 
ATOM   2208  C C6    . DG  D 2 27  ? 29.858  -41.441  -1.530  1.00 86.18  ? 55  DG  F C6    1 
ATOM   2209  O O6    . DG  D 2 27  ? 30.670  -41.636  -0.616  1.00 90.10  ? 55  DG  F O6    1 
ATOM   2210  N N1    . DG  D 2 27  ? 28.710  -42.224  -1.615  1.00 80.62  ? 55  DG  F N1    1 
ATOM   2211  C C2    . DG  D 2 27  ? 27.742  -42.101  -2.582  1.00 82.10  ? 55  DG  F C2    1 
ATOM   2212  N N2    . DG  D 2 27  ? 26.707  -42.946  -2.494  1.00 89.35  ? 55  DG  F N2    1 
ATOM   2213  N N3    . DG  D 2 27  ? 27.784  -41.214  -3.562  1.00 81.99  ? 55  DG  F N3    1 
ATOM   2214  C C4    . DG  D 2 27  ? 28.885  -40.437  -3.492  1.00 83.45  ? 55  DG  F C4    1 
ATOM   2215  P P     . DA  D 2 28  ? 29.775  -34.619  -7.608  1.00 90.42  ? 56  DA  F P     1 
ATOM   2216  O OP1   . DA  D 2 28  ? 28.981  -33.368  -7.660  1.00 98.03  ? 56  DA  F OP1   1 
ATOM   2217  O OP2   . DA  D 2 28  ? 30.554  -35.038  -8.798  1.00 87.41  ? 56  DA  F OP2   1 
ATOM   2218  O "O5'" . DA  D 2 28  ? 30.764  -34.520  -6.366  1.00 95.08  ? 56  DA  F "O5'" 1 
ATOM   2219  C "C5'" . DA  D 2 28  ? 30.558  -33.537  -5.341  1.00 97.78  ? 56  DA  F "C5'" 1 
ATOM   2220  C "C4'" . DA  D 2 28  ? 29.222  -33.767  -4.679  1.00 99.80  ? 56  DA  F "C4'" 1 
ATOM   2221  O "O4'" . DA  D 2 28  ? 29.292  -34.956  -3.865  1.00 103.69 ? 56  DA  F "O4'" 1 
ATOM   2222  C "C3'" . DA  D 2 28  ? 28.749  -32.643  -3.751  1.00 108.55 ? 56  DA  F "C3'" 1 
ATOM   2223  O "O3'" . DA  D 2 28  ? 27.592  -32.016  -4.329  1.00 121.65 ? 56  DA  F "O3'" 1 
ATOM   2224  C "C2'" . DA  D 2 28  ? 28.439  -33.349  -2.437  1.00 107.26 ? 56  DA  F "C2'" 1 
ATOM   2225  C "C1'" . DA  D 2 28  ? 28.325  -34.803  -2.857  1.00 105.44 ? 56  DA  F "C1'" 1 
ATOM   2226  N N9    . DA  D 2 28  ? 28.577  -35.805  -1.821  1.00 100.74 ? 56  DA  F N9    1 
ATOM   2227  C C8    . DA  D 2 28  ? 29.558  -35.830  -0.860  1.00 97.64  ? 56  DA  F C8    1 
ATOM   2228  N N7    . DA  D 2 28  ? 29.490  -36.870  -0.064  1.00 92.64  ? 56  DA  F N7    1 
ATOM   2229  C C5    . DA  D 2 28  ? 28.392  -37.578  -0.533  1.00 95.21  ? 56  DA  F C5    1 
ATOM   2230  C C6    . DA  D 2 28  ? 27.791  -38.778  -0.116  1.00 101.98 ? 56  DA  F C6    1 
ATOM   2231  N N6    . DA  D 2 28  ? 28.231  -39.511  0.908   1.00 108.38 ? 56  DA  F N6    1 
ATOM   2232  N N1    . DA  D 2 28  ? 26.705  -39.207  -0.798  1.00 104.20 ? 56  DA  F N1    1 
ATOM   2233  C C2    . DA  D 2 28  ? 26.263  -38.472  -1.827  1.00 99.73  ? 56  DA  F C2    1 
ATOM   2234  N N3    . DA  D 2 28  ? 26.745  -37.332  -2.315  1.00 96.24  ? 56  DA  F N3    1 
ATOM   2235  C C4    . DA  D 2 28  ? 27.821  -36.933  -1.615  1.00 96.99  ? 56  DA  F C4    1 
ATOM   2236  P P     . DT  D 2 29  ? 27.301  -30.446  -4.109  1.00 123.48 ? 57  DT  F P     1 
ATOM   2237  O OP1   . DT  D 2 29  ? 26.257  -30.034  -5.085  1.00 122.37 ? 57  DT  F OP1   1 
ATOM   2238  O OP2   . DT  D 2 29  ? 28.606  -29.731  -4.088  1.00 112.15 ? 57  DT  F OP2   1 
ATOM   2239  O "O5'" . DT  D 2 29  ? 26.667  -30.401  -2.646  1.00 124.71 ? 57  DT  F "O5'" 1 
ATOM   2240  C "C5'" . DT  D 2 29  ? 25.241  -30.471  -2.422  1.00 129.01 ? 57  DT  F "C5'" 1 
ATOM   2241  C "C4'" . DT  D 2 29  ? 24.911  -30.030  -1.013  1.00 136.01 ? 57  DT  F "C4'" 1 
ATOM   2242  O "O4'" . DT  D 2 29  ? 25.688  -30.813  -0.078  1.00 133.92 ? 57  DT  F "O4'" 1 
ATOM   2243  C "C3'" . DT  D 2 29  ? 25.213  -28.556  -0.726  1.00 139.22 ? 57  DT  F "C3'" 1 
ATOM   2244  O "O3'" . DT  D 2 29  ? 24.026  -27.735  -0.817  1.00 136.25 ? 57  DT  F "O3'" 1 
ATOM   2245  C "C2'" . DT  D 2 29  ? 25.974  -28.553  0.595   1.00 140.27 ? 57  DT  F "C2'" 1 
ATOM   2246  C "C1'" . DT  D 2 29  ? 26.377  -30.000  0.857   1.00 137.01 ? 57  DT  F "C1'" 1 
ATOM   2247  N N1    . DT  D 2 29  ? 27.821  -30.308  0.742   1.00 139.62 ? 57  DT  F N1    1 
ATOM   2248  C C2    . DT  D 2 29  ? 28.407  -31.049  1.745   1.00 140.50 ? 57  DT  F C2    1 
ATOM   2249  O O2    . DT  D 2 29  ? 27.798  -31.441  2.726   1.00 143.68 ? 57  DT  F O2    1 
ATOM   2250  N N3    . DT  D 2 29  ? 29.743  -31.310  1.559   1.00 142.10 ? 57  DT  F N3    1 
ATOM   2251  C C4    . DT  D 2 29  ? 30.530  -30.916  0.493   1.00 143.05 ? 57  DT  F C4    1 
ATOM   2252  O O4    . DT  D 2 29  ? 31.718  -31.227  0.464   1.00 137.59 ? 57  DT  F O4    1 
ATOM   2253  C C5    . DT  D 2 29  ? 29.849  -30.148  -0.526  1.00 145.09 ? 57  DT  F C5    1 
ATOM   2254  C C7    . DT  D 2 29  ? 30.623  -29.673  -1.716  1.00 140.84 ? 57  DT  F C7    1 
ATOM   2255  C C6    . DT  D 2 29  ? 28.546  -29.891  -0.355  1.00 144.58 ? 57  DT  F C6    1 
ATOM   2256  P P     . DA  D 2 30  ? 22.917  -27.661  0.366   1.00 128.04 ? 58  DA  F P     1 
ATOM   2257  O OP1   . DA  D 2 30  ? 23.224  -28.699  1.383   1.00 134.30 ? 58  DA  F OP1   1 
ATOM   2258  O OP2   . DA  D 2 30  ? 21.578  -27.647  -0.270  1.00 127.49 ? 58  DA  F OP2   1 
ATOM   2259  O "O5'" . DA  D 2 30  ? 23.132  -26.198  0.964   1.00 152.56 ? 58  DA  F "O5'" 1 
ATOM   2260  C "C5'" . DA  D 2 30  ? 23.654  -25.973  2.291   1.00 166.11 ? 58  DA  F "C5'" 1 
ATOM   2261  C "C4'" . DA  D 2 30  ? 24.630  -24.818  2.288   1.00 171.72 ? 58  DA  F "C4'" 1 
ATOM   2262  O "O4'" . DA  D 2 30  ? 25.782  -25.143  1.469   1.00 173.79 ? 58  DA  F "O4'" 1 
ATOM   2263  C "C3'" . DA  D 2 30  ? 24.080  -23.506  1.727   1.00 176.23 ? 58  DA  F "C3'" 1 
ATOM   2264  O "O3'" . DA  D 2 30  ? 24.632  -22.392  2.443   1.00 189.68 ? 58  DA  F "O3'" 1 
ATOM   2265  C "C2'" . DA  D 2 30  ? 24.588  -23.509  0.299   1.00 173.87 ? 58  DA  F "C2'" 1 
ATOM   2266  C "C1'" . DA  D 2 30  ? 25.957  -24.142  0.476   1.00 175.92 ? 58  DA  F "C1'" 1 
ATOM   2267  N N9    . DA  D 2 30  ? 26.534  -24.777  -0.712  1.00 183.68 ? 58  DA  F N9    1 
ATOM   2268  C C8    . DA  D 2 30  ? 25.880  -25.359  -1.770  1.00 184.87 ? 58  DA  F C8    1 
ATOM   2269  N N7    . DA  D 2 30  ? 26.684  -25.847  -2.685  1.00 180.04 ? 58  DA  F N7    1 
ATOM   2270  C C5    . DA  D 2 30  ? 27.953  -25.567  -2.197  1.00 180.42 ? 58  DA  F C5    1 
ATOM   2271  C C6    . DA  D 2 30  ? 29.239  -25.827  -2.702  1.00 177.27 ? 58  DA  F C6    1 
ATOM   2272  N N6    . DA  D 2 30  ? 29.468  -26.453  -3.859  1.00 176.23 ? 58  DA  F N6    1 
ATOM   2273  N N1    . DA  D 2 30  ? 30.297  -25.416  -1.968  1.00 176.40 ? 58  DA  F N1    1 
ATOM   2274  C C2    . DA  D 2 30  ? 30.067  -24.788  -0.808  1.00 175.47 ? 58  DA  F C2    1 
ATOM   2275  N N3    . DA  D 2 30  ? 28.906  -24.487  -0.228  1.00 177.96 ? 58  DA  F N3    1 
ATOM   2276  C C4    . DA  D 2 30  ? 27.876  -24.909  -0.983  1.00 182.97 ? 58  DA  F C4    1 
ATOM   2277  P P     . DG  D 2 31  ? 23.751  -21.079  2.725   1.00 200.55 ? 59  DG  F P     1 
ATOM   2278  O OP1   . DG  D 2 31  ? 23.602  -20.932  4.197   1.00 198.61 ? 59  DG  F OP1   1 
ATOM   2279  O OP2   . DG  D 2 31  ? 22.543  -21.134  1.863   1.00 201.16 ? 59  DG  F OP2   1 
ATOM   2280  O "O5'" . DG  D 2 31  ? 24.678  -19.899  2.189   1.00 196.18 ? 59  DG  F "O5'" 1 
ATOM   2281  C "C5'" . DG  D 2 31  ? 25.882  -19.517  2.882   1.00 191.68 ? 59  DG  F "C5'" 1 
ATOM   2282  C "C4'" . DG  D 2 31  ? 26.824  -18.814  1.932   1.00 190.90 ? 59  DG  F "C4'" 1 
ATOM   2283  O "O4'" . DG  D 2 31  ? 27.203  -19.728  0.875   1.00 194.73 ? 59  DG  F "O4'" 1 
ATOM   2284  C "C3'" . DG  D 2 31  ? 26.240  -17.575  1.245   1.00 188.31 ? 59  DG  F "C3'" 1 
ATOM   2285  O "O3'" . DG  D 2 31  ? 27.145  -16.467  1.292   1.00 180.52 ? 59  DG  F "O3'" 1 
ATOM   2286  C "C2'" . DG  D 2 31  ? 26.002  -18.023  -0.186  1.00 190.70 ? 59  DG  F "C2'" 1 
ATOM   2287  C "C1'" . DG  D 2 31  ? 27.052  -19.101  -0.387  1.00 195.06 ? 59  DG  F "C1'" 1 
ATOM   2288  N N9    . DG  D 2 31  ? 26.691  -20.131  -1.359  1.00 194.89 ? 59  DG  F N9    1 
ATOM   2289  C C8    . DG  D 2 31  ? 25.493  -20.798  -1.447  1.00 192.21 ? 59  DG  F C8    1 
ATOM   2290  N N7    . DG  D 2 31  ? 25.460  -21.667  -2.421  1.00 190.40 ? 59  DG  F N7    1 
ATOM   2291  C C5    . DG  D 2 31  ? 26.710  -21.564  -3.016  1.00 190.25 ? 59  DG  F C5    1 
ATOM   2292  C C6    . DG  D 2 31  ? 27.260  -22.259  -4.125  1.00 188.83 ? 59  DG  F C6    1 
ATOM   2293  O O6    . DG  D 2 31  ? 26.734  -23.132  -4.827  1.00 181.77 ? 59  DG  F O6    1 
ATOM   2294  N N1    . DG  D 2 31  ? 28.562  -21.847  -4.392  1.00 193.62 ? 59  DG  F N1    1 
ATOM   2295  C C2    . DG  D 2 31  ? 29.248  -20.889  -3.684  1.00 196.26 ? 59  DG  F C2    1 
ATOM   2296  N N2    . DG  D 2 31  ? 30.499  -20.630  -4.096  1.00 194.12 ? 59  DG  F N2    1 
ATOM   2297  N N3    . DG  D 2 31  ? 28.747  -20.235  -2.649  1.00 199.88 ? 59  DG  F N3    1 
ATOM   2298  C C4    . DG  D 2 31  ? 27.483  -20.621  -2.372  1.00 195.41 ? 59  DG  F C4    1 
ATOM   2299  O OP3   . DG  E 1 1   ? 6.556   -10.180  63.756  1.00 162.43 ? 4   DG  H OP3   1 
ATOM   2300  P P     . DG  E 1 1   ? 7.155   -10.350  62.404  1.00 163.88 ? 4   DG  H P     1 
ATOM   2301  O OP1   . DG  E 1 1   ? 7.597   -9.013   61.924  1.00 160.27 ? 4   DG  H OP1   1 
ATOM   2302  O OP2   . DG  E 1 1   ? 6.185   -11.130  61.596  1.00 159.34 ? 4   DG  H OP2   1 
ATOM   2303  O "O5'" . DG  E 1 1   ? 8.462   -11.223  62.672  1.00 154.39 ? 4   DG  H "O5'" 1 
ATOM   2304  C "C5'" . DG  E 1 1   ? 8.451   -12.660  62.557  1.00 141.74 ? 4   DG  H "C5'" 1 
ATOM   2305  C "C4'" . DG  E 1 1   ? 8.804   -13.086  61.150  1.00 131.36 ? 4   DG  H "C4'" 1 
ATOM   2306  O "O4'" . DG  E 1 1   ? 7.594   -13.251  60.380  1.00 124.59 ? 4   DG  H "O4'" 1 
ATOM   2307  C "C3'" . DG  E 1 1   ? 9.670   -12.098  60.362  1.00 127.77 ? 4   DG  H "C3'" 1 
ATOM   2308  O "O3'" . DG  E 1 1   ? 11.001  -12.577  60.145  1.00 128.23 ? 4   DG  H "O3'" 1 
ATOM   2309  C "C2'" . DG  E 1 1   ? 8.962   -11.955  59.024  1.00 127.33 ? 4   DG  H "C2'" 1 
ATOM   2310  C "C1'" . DG  E 1 1   ? 7.930   -13.059  59.026  1.00 124.20 ? 4   DG  H "C1'" 1 
ATOM   2311  N N9    . DG  E 1 1   ? 6.715   -12.724  58.293  1.00 120.47 ? 4   DG  H N9    1 
ATOM   2312  C C8    . DG  E 1 1   ? 5.644   -11.984  58.736  1.00 115.10 ? 4   DG  H C8    1 
ATOM   2313  N N7    . DG  E 1 1   ? 4.709   -11.849  57.837  1.00 112.49 ? 4   DG  H N7    1 
ATOM   2314  C C5    . DG  E 1 1   ? 5.196   -12.529  56.730  1.00 114.63 ? 4   DG  H C5    1 
ATOM   2315  C C6    . DG  E 1 1   ? 4.623   -12.727  55.449  1.00 114.21 ? 4   DG  H C6    1 
ATOM   2316  O O6    . DG  E 1 1   ? 3.535   -12.327  55.023  1.00 110.83 ? 4   DG  H O6    1 
ATOM   2317  N N1    . DG  E 1 1   ? 5.458   -13.476  54.625  1.00 117.21 ? 4   DG  H N1    1 
ATOM   2318  C C2    . DG  E 1 1   ? 6.687   -13.971  54.987  1.00 119.94 ? 4   DG  H C2    1 
ATOM   2319  N N2    . DG  E 1 1   ? 7.341   -14.675  54.053  1.00 116.16 ? 4   DG  H N2    1 
ATOM   2320  N N3    . DG  E 1 1   ? 7.230   -13.798  56.180  1.00 119.47 ? 4   DG  H N3    1 
ATOM   2321  C C4    . DG  E 1 1   ? 6.437   -13.069  56.994  1.00 118.62 ? 4   DG  H C4    1 
ATOM   2322  P P     . DG  E 1 2   ? 12.084  -11.635  59.420  1.00 131.48 ? 5   DG  H P     1 
ATOM   2323  O OP1   . DG  E 1 2   ? 13.439  -12.101  59.811  1.00 133.50 ? 5   DG  H OP1   1 
ATOM   2324  O OP2   . DG  E 1 2   ? 11.700  -10.221  59.666  1.00 129.16 ? 5   DG  H OP2   1 
ATOM   2325  O "O5'" . DG  E 1 2   ? 11.880  -11.953  57.870  1.00 126.84 ? 5   DG  H "O5'" 1 
ATOM   2326  C "C5'" . DG  E 1 2   ? 12.111  -13.273  57.333  1.00 129.73 ? 5   DG  H "C5'" 1 
ATOM   2327  C "C4'" . DG  E 1 2   ? 12.177  -13.240  55.822  1.00 127.92 ? 5   DG  H "C4'" 1 
ATOM   2328  O "O4'" . DG  E 1 2   ? 10.847  -13.072  55.272  1.00 124.81 ? 5   DG  H "O4'" 1 
ATOM   2329  C "C3'" . DG  E 1 2   ? 13.017  -12.111  55.225  1.00 125.13 ? 5   DG  H "C3'" 1 
ATOM   2330  O "O3'" . DG  E 1 2   ? 13.662  -12.567  54.028  1.00 130.54 ? 5   DG  H "O3'" 1 
ATOM   2331  C "C2'" . DG  E 1 2   ? 11.983  -11.041  54.937  1.00 124.25 ? 5   DG  H "C2'" 1 
ATOM   2332  C "C1'" . DG  E 1 2   ? 10.779  -11.869  54.516  1.00 119.27 ? 5   DG  H "C1'" 1 
ATOM   2333  N N9    . DG  E 1 2   ? 9.486   -11.244  54.781  1.00 109.80 ? 5   DG  H N9    1 
ATOM   2334  C C8    . DG  E 1 2   ? 9.027   -10.759  55.982  1.00 103.79 ? 5   DG  H C8    1 
ATOM   2335  N N7    . DG  E 1 2   ? 7.825   -10.256  55.907  1.00 94.58  ? 5   DG  H N7    1 
ATOM   2336  C C5    . DG  E 1 2   ? 7.470   -10.415  54.575  1.00 92.43  ? 5   DG  H C5    1 
ATOM   2337  C C6    . DG  E 1 2   ? 6.279   -10.060  53.895  1.00 95.44  ? 5   DG  H C6    1 
ATOM   2338  O O6    . DG  E 1 2   ? 5.266   -9.515   54.348  1.00 100.04 ? 5   DG  H O6    1 
ATOM   2339  N N1    . DG  E 1 2   ? 6.340   -10.398  52.546  1.00 91.54  ? 5   DG  H N1    1 
ATOM   2340  C C2    . DG  E 1 2   ? 7.407   -11.007  51.932  1.00 92.84  ? 5   DG  H C2    1 
ATOM   2341  N N2    . DG  E 1 2   ? 7.275   -11.257  50.621  1.00 94.74  ? 5   DG  H N2    1 
ATOM   2342  N N3    . DG  E 1 2   ? 8.520   -11.351  52.558  1.00 94.04  ? 5   DG  H N3    1 
ATOM   2343  C C4    . DG  E 1 2   ? 8.485   -11.023  53.867  1.00 96.76  ? 5   DG  H C4    1 
ATOM   2344  P P     . DT  E 1 3   ? 14.854  -11.720  53.359  1.00 129.00 ? 6   DT  H P     1 
ATOM   2345  O OP1   . DT  E 1 3   ? 16.085  -12.548  53.377  1.00 133.58 ? 6   DT  H OP1   1 
ATOM   2346  O OP2   . DT  E 1 3   ? 14.866  -10.366  53.976  1.00 122.16 ? 6   DT  H OP2   1 
ATOM   2347  O "O5'" . DT  E 1 3   ? 14.382  -11.593  51.845  1.00 118.38 ? 6   DT  H "O5'" 1 
ATOM   2348  C "C5'" . DT  E 1 3   ? 13.309  -10.698  51.544  1.00 111.37 ? 6   DT  H "C5'" 1 
ATOM   2349  C "C4'" . DT  E 1 3   ? 12.878  -10.813  50.102  1.00 107.14 ? 6   DT  H "C4'" 1 
ATOM   2350  O "O4'" . DT  E 1 3   ? 11.456  -10.580  50.042  1.00 103.41 ? 6   DT  H "O4'" 1 
ATOM   2351  C "C3'" . DT  E 1 3   ? 13.470  -9.748   49.193  1.00 103.63 ? 6   DT  H "C3'" 1 
ATOM   2352  O "O3'" . DT  E 1 3   ? 13.349  -10.185  47.836  1.00 108.18 ? 6   DT  H "O3'" 1 
ATOM   2353  C "C2'" . DT  E 1 3   ? 12.576  -8.559   49.483  1.00 104.17 ? 6   DT  H "C2'" 1 
ATOM   2354  C "C1'" . DT  E 1 3   ? 11.212  -9.208   49.736  1.00 98.50  ? 6   DT  H "C1'" 1 
ATOM   2355  N N1    . DT  E 1 3   ? 10.412  -8.630   50.843  1.00 87.61  ? 6   DT  H N1    1 
ATOM   2356  C C2    . DT  E 1 3   ? 9.105   -8.282   50.584  1.00 87.15  ? 6   DT  H C2    1 
ATOM   2357  O O2    . DT  E 1 3   ? 8.584   -8.409   49.487  1.00 95.43  ? 6   DT  H O2    1 
ATOM   2358  N N3    . DT  E 1 3   ? 8.424   -7.774   51.663  1.00 83.50  ? 6   DT  H N3    1 
ATOM   2359  C C4    . DT  E 1 3   ? 8.908   -7.590   52.944  1.00 84.05  ? 6   DT  H C4    1 
ATOM   2360  O O4    . DT  E 1 3   ? 8.179   -7.121   53.813  1.00 87.46  ? 6   DT  H O4    1 
ATOM   2361  C C5    . DT  E 1 3   ? 10.284  -7.976   53.144  1.00 83.36  ? 6   DT  H C5    1 
ATOM   2362  C C7    . DT  E 1 3   ? 10.894  -7.805   54.499  1.00 86.05  ? 6   DT  H C7    1 
ATOM   2363  C C6    . DT  E 1 3   ? 10.957  -8.475   52.099  1.00 82.76  ? 6   DT  H C6    1 
ATOM   2364  P P     . DG  E 1 4   ? 13.991  -9.330   46.641  1.00 118.21 ? 7   DG  H P     1 
ATOM   2365  O OP1   . DG  E 1 4   ? 14.038  -10.197  45.432  1.00 115.19 ? 7   DG  H OP1   1 
ATOM   2366  O OP2   . DG  E 1 4   ? 15.238  -8.691   47.141  1.00 111.48 ? 7   DG  H OP2   1 
ATOM   2367  O "O5'" . DG  E 1 4   ? 12.892  -8.208   46.372  1.00 111.32 ? 7   DG  H "O5'" 1 
ATOM   2368  C "C5'" . DG  E 1 4   ? 11.620  -8.552   45.791  1.00 103.90 ? 7   DG  H "C5'" 1 
ATOM   2369  C "C4'" . DG  E 1 4   ? 10.791  -7.310   45.561  1.00 97.53  ? 7   DG  H "C4'" 1 
ATOM   2370  O "O4'" . DG  E 1 4   ? 10.159  -6.915   46.801  1.00 90.36  ? 7   DG  H "O4'" 1 
ATOM   2371  C "C3'" . DG  E 1 4   ? 11.572  -6.088   45.065  1.00 93.50  ? 7   DG  H "C3'" 1 
ATOM   2372  O "O3'" . DG  E 1 4   ? 10.927  -5.547   43.903  1.00 93.75  ? 7   DG  H "O3'" 1 
ATOM   2373  C "C2'" . DG  E 1 4   ? 11.606  -5.164   46.271  1.00 87.41  ? 7   DG  H "C2'" 1 
ATOM   2374  C "C1'" . DG  E 1 4   ? 10.330  -5.526   47.001  1.00 82.89  ? 7   DG  H "C1'" 1 
ATOM   2375  N N9    . DG  E 1 4   ? 10.352  -5.285   48.439  1.00 75.80  ? 7   DG  H N9    1 
ATOM   2376  C C8    . DG  E 1 4   ? 11.383  -5.537   49.311  1.00 74.83  ? 7   DG  H C8    1 
ATOM   2377  N N7    . DG  E 1 4   ? 11.100  -5.222   50.545  1.00 71.53  ? 7   DG  H N7    1 
ATOM   2378  C C5    . DG  E 1 4   ? 9.802   -4.734   50.485  1.00 67.56  ? 7   DG  H C5    1 
ATOM   2379  C C6    . DG  E 1 4   ? 8.959   -4.241   51.513  1.00 68.42  ? 7   DG  H C6    1 
ATOM   2380  O O6    . DG  E 1 4   ? 9.201   -4.132   52.722  1.00 70.31  ? 7   DG  H O6    1 
ATOM   2381  N N1    . DG  E 1 4   ? 7.720   -3.851   51.015  1.00 66.67  ? 7   DG  H N1    1 
ATOM   2382  C C2    . DG  E 1 4   ? 7.342   -3.922   49.696  1.00 70.34  ? 7   DG  H C2    1 
ATOM   2383  N N2    . DG  E 1 4   ? 6.102   -3.496   49.408  1.00 71.15  ? 7   DG  H N2    1 
ATOM   2384  N N3    . DG  E 1 4   ? 8.118   -4.384   48.729  1.00 68.63  ? 7   DG  H N3    1 
ATOM   2385  C C4    . DG  E 1 4   ? 9.326   -4.768   49.192  1.00 69.65  ? 7   DG  H C4    1 
ATOM   2386  P P     . DT  E 1 5   ? 11.435  -4.175   43.250  1.00 92.47  ? 8   DT  H P     1 
ATOM   2387  O OP1   . DT  E 1 5   ? 11.254  -4.264   41.776  1.00 80.54  ? 8   DT  H OP1   1 
ATOM   2388  O OP2   . DT  E 1 5   ? 12.790  -3.884   43.795  1.00 93.07  ? 8   DT  H OP2   1 
ATOM   2389  O "O5'" . DT  E 1 5   ? 10.352  -3.137   43.789  1.00 86.50  ? 8   DT  H "O5'" 1 
ATOM   2390  C "C5'" . DT  E 1 5   ? 8.955   -3.429   43.606  1.00 89.36  ? 8   DT  H "C5'" 1 
ATOM   2391  C "C4'" . DT  E 1 5   ? 8.082   -2.244   43.948  1.00 90.77  ? 8   DT  H "C4'" 1 
ATOM   2392  O "O4'" . DT  E 1 5   ? 7.942   -2.121   45.385  1.00 89.35  ? 8   DT  H "O4'" 1 
ATOM   2393  C "C3'" . DT  E 1 5   ? 8.572   -0.882   43.452  1.00 92.37  ? 8   DT  H "C3'" 1 
ATOM   2394  O "O3'" . DT  E 1 5   ? 7.417   -0.173   42.982  1.00 99.78  ? 8   DT  H "O3'" 1 
ATOM   2395  C "C2'" . DT  E 1 5   ? 9.219   -0.279   44.687  1.00 89.32  ? 8   DT  H "C2'" 1 
ATOM   2396  C "C1'" . DT  E 1 5   ? 8.343   -0.824   45.805  1.00 82.91  ? 8   DT  H "C1'" 1 
ATOM   2397  N N1    . DT  E 1 5   ? 8.984   -0.960   47.130  1.00 71.33  ? 8   DT  H N1    1 
ATOM   2398  C C2    . DT  E 1 5   ? 8.232   -0.652   48.242  1.00 69.74  ? 8   DT  H C2    1 
ATOM   2399  O O2    . DT  E 1 5   ? 7.084   -0.243   48.178  1.00 74.02  ? 8   DT  H O2    1 
ATOM   2400  N N3    . DT  E 1 5   ? 8.880   -0.831   49.438  1.00 64.94  ? 8   DT  H N3    1 
ATOM   2401  C C4    . DT  E 1 5   ? 10.172  -1.284   49.628  1.00 66.11  ? 8   DT  H C4    1 
ATOM   2402  O O4    . DT  E 1 5   ? 10.623  -1.387   50.766  1.00 65.50  ? 8   DT  H O4    1 
ATOM   2403  C C5    . DT  E 1 5   ? 10.899  -1.596   48.420  1.00 66.92  ? 8   DT  H C5    1 
ATOM   2404  C C7    . DT  E 1 5   ? 12.306  -2.094   48.528  1.00 68.74  ? 8   DT  H C7    1 
ATOM   2405  C C6    . DT  E 1 5   ? 10.274  -1.429   47.247  1.00 67.24  ? 8   DT  H C6    1 
ATOM   2406  P P     . DA  E 1 6   ? 7.521   1.323    42.420  1.00 95.57  ? 9   DA  H P     1 
ATOM   2407  O OP1   . DA  E 1 6   ? 6.571   1.446    41.285  1.00 91.84  ? 9   DA  H OP1   1 
ATOM   2408  O OP2   . DA  E 1 6   ? 8.957   1.657    42.228  1.00 92.87  ? 9   DA  H OP2   1 
ATOM   2409  O "O5'" . DA  E 1 6   ? 6.915   2.180    43.613  1.00 88.86  ? 9   DA  H "O5'" 1 
ATOM   2410  C "C5'" . DA  E 1 6   ? 5.605   1.873    44.110  1.00 95.67  ? 9   DA  H "C5'" 1 
ATOM   2411  C "C4'" . DA  E 1 6   ? 5.266   2.798    45.254  1.00 101.61 ? 9   DA  H "C4'" 1 
ATOM   2412  O "O4'" . DA  E 1 6   ? 6.102   2.491    46.395  1.00 102.46 ? 9   DA  H "O4'" 1 
ATOM   2413  C "C3'" . DA  E 1 6   ? 5.504   4.278    44.960  1.00 101.19 ? 9   DA  H "C3'" 1 
ATOM   2414  O "O3'" . DA  E 1 6   ? 4.505   5.034    45.645  1.00 109.87 ? 9   DA  H "O3'" 1 
ATOM   2415  C "C2'" . DA  E 1 6   ? 6.878   4.525    45.551  1.00 93.44  ? 9   DA  H "C2'" 1 
ATOM   2416  C "C1'" . DA  E 1 6   ? 6.805   3.659    46.790  1.00 88.52  ? 9   DA  H "C1'" 1 
ATOM   2417  N N9    . DA  E 1 6   ? 8.087   3.244    47.354  1.00 81.78  ? 9   DA  H N9    1 
ATOM   2418  C C8    . DA  E 1 6   ? 9.248   2.889    46.711  1.00 80.48  ? 9   DA  H C8    1 
ATOM   2419  N N7    . DA  E 1 6   ? 10.220  2.552    47.525  1.00 73.07  ? 9   DA  H N7    1 
ATOM   2420  C C5    . DA  E 1 6   ? 9.661   2.696    48.787  1.00 70.23  ? 9   DA  H C5    1 
ATOM   2421  C C6    . DA  E 1 6   ? 10.180  2.500    50.077  1.00 70.54  ? 9   DA  H C6    1 
ATOM   2422  N N6    . DA  E 1 6   ? 11.427  2.096    50.319  1.00 73.95  ? 9   DA  H N6    1 
ATOM   2423  N N1    . DA  E 1 6   ? 9.358   2.727    51.126  1.00 75.53  ? 9   DA  H N1    1 
ATOM   2424  C C2    . DA  E 1 6   ? 8.102   3.125    50.883  1.00 79.55  ? 9   DA  H C2    1 
ATOM   2425  N N3    . DA  E 1 6   ? 7.500   3.343    49.715  1.00 77.41  ? 9   DA  H N3    1 
ATOM   2426  C C4    . DA  E 1 6   ? 8.348   3.118    48.696  1.00 75.21  ? 9   DA  H C4    1 
ATOM   2427  P P     . DC  E 1 7   ? 4.128   6.488    45.139  1.00 113.56 ? 10  DC  H P     1 
ATOM   2428  O OP1   . DC  E 1 7   ? 3.494   6.352    43.802  1.00 105.20 ? 10  DC  H OP1   1 
ATOM   2429  O OP2   . DC  E 1 7   ? 5.330   7.353    45.312  1.00 106.59 ? 10  DC  H OP2   1 
ATOM   2430  O "O5'" . DC  E 1 7   ? 3.003   6.939    46.172  1.00 110.84 ? 10  DC  H "O5'" 1 
ATOM   2431  C "C5'" . DC  E 1 7   ? 3.172   8.119    46.978  1.00 112.07 ? 10  DC  H "C5'" 1 
ATOM   2432  C "C4'" . DC  E 1 7   ? 3.600   7.743    48.376  1.00 107.92 ? 10  DC  H "C4'" 1 
ATOM   2433  O "O4'" . DC  E 1 7   ? 4.817   6.979    48.349  1.00 103.44 ? 10  DC  H "O4'" 1 
ATOM   2434  C "C3'" . DC  E 1 7   ? 3.932   8.926    49.274  1.00 114.18 ? 10  DC  H "C3'" 1 
ATOM   2435  O "O3'" . DC  E 1 7   ? 2.777   9.430    49.941  1.00 124.65 ? 10  DC  H "O3'" 1 
ATOM   2436  C "C2'" . DC  E 1 7   ? 4.915   8.344    50.276  1.00 109.02 ? 10  DC  H "C2'" 1 
ATOM   2437  C "C1'" . DC  E 1 7   ? 5.353   7.020    49.663  1.00 103.13 ? 10  DC  H "C1'" 1 
ATOM   2438  N N1    . DC  E 1 7   ? 6.810   6.860    49.574  1.00 96.36  ? 10  DC  H N1    1 
ATOM   2439  C C2    . DC  E 1 7   ? 7.531   6.626    50.751  1.00 94.11  ? 10  DC  H C2    1 
ATOM   2440  O O2    . DC  E 1 7   ? 6.918   6.565    51.827  1.00 100.16 ? 10  DC  H O2    1 
ATOM   2441  N N3    . DC  E 1 7   ? 8.872   6.465    50.684  1.00 86.84  ? 10  DC  H N3    1 
ATOM   2442  C C4    . DC  E 1 7   ? 9.492   6.526    49.503  1.00 90.26  ? 10  DC  H C4    1 
ATOM   2443  N N4    . DC  E 1 7   ? 10.815  6.368    49.482  1.00 88.65  ? 10  DC  H N4    1 
ATOM   2444  C C5    . DC  E 1 7   ? 8.783   6.770    48.291  1.00 93.49  ? 10  DC  H C5    1 
ATOM   2445  C C6    . DC  E 1 7   ? 7.456   6.931    48.371  1.00 94.63  ? 10  DC  H C6    1 
ATOM   2446  P P     . DA  E 1 8   ? 2.803   10.910   50.518  1.00 129.48 ? 11  DA  H P     1 
ATOM   2447  O OP1   . DA  E 1 8   ? 1.551   11.115   51.292  1.00 128.71 ? 11  DA  H OP1   1 
ATOM   2448  O OP2   . DA  E 1 8   ? 3.143   11.824   49.393  1.00 124.51 ? 11  DA  H OP2   1 
ATOM   2449  O "O5'" . DA  E 1 8   ? 4.044   10.887   51.520  1.00 126.42 ? 11  DA  H "O5'" 1 
ATOM   2450  C "C5'" . DA  E 1 8   ? 3.886   10.532   52.910  1.00 120.63 ? 11  DA  H "C5'" 1 
ATOM   2451  C "C4'" . DA  E 1 8   ? 5.174   10.763   53.666  1.00 122.52 ? 11  DA  H "C4'" 1 
ATOM   2452  O "O4'" . DA  E 1 8   ? 6.256   10.036   53.048  1.00 118.72 ? 11  DA  H "O4'" 1 
ATOM   2453  C "C3'" . DA  E 1 8   ? 5.641   12.221   53.722  1.00 125.43 ? 11  DA  H "C3'" 1 
ATOM   2454  O "O3'" . DA  E 1 8   ? 5.343   12.792   55.001  1.00 133.72 ? 11  DA  H "O3'" 1 
ATOM   2455  C "C2'" . DA  E 1 8   ? 7.143   12.153   53.471  1.00 116.81 ? 11  DA  H "C2'" 1 
ATOM   2456  C "C1'" . DA  E 1 8   ? 7.461   10.668   53.426  1.00 108.75 ? 11  DA  H "C1'" 1 
ATOM   2457  N N9    . DA  E 1 8   ? 8.488   10.295   52.454  1.00 100.42 ? 11  DA  H N9    1 
ATOM   2458  C C8    . DA  E 1 8   ? 8.397   10.309   51.084  1.00 97.91  ? 11  DA  H C8    1 
ATOM   2459  N N7    . DA  E 1 8   ? 9.491   9.912    50.478  1.00 90.51  ? 11  DA  H N7    1 
ATOM   2460  C C5    . DA  E 1 8   ? 10.360  9.616    51.519  1.00 87.85  ? 11  DA  H C5    1 
ATOM   2461  C C6    . DA  E 1 8   ? 11.685  9.145    51.541  1.00 87.25  ? 11  DA  H C6    1 
ATOM   2462  N N6    . DA  E 1 8   ? 12.394  8.882    50.441  1.00 84.82  ? 11  DA  H N6    1 
ATOM   2463  N N1    . DA  E 1 8   ? 12.265  8.955    52.747  1.00 86.14  ? 11  DA  H N1    1 
ATOM   2464  C C2    . DA  E 1 8   ? 11.554  9.225    53.850  1.00 85.42  ? 11  DA  H C2    1 
ATOM   2465  N N3    . DA  E 1 8   ? 10.302  9.671    53.957  1.00 87.25  ? 11  DA  H N3    1 
ATOM   2466  C C4    . DA  E 1 8   ? 9.755   9.847    52.742  1.00 90.90  ? 11  DA  H C4    1 
ATOM   2467  P P     . DA  E 1 9   ? 5.517   14.368   55.246  1.00 133.85 ? 12  DA  H P     1 
ATOM   2468  O OP1   . DA  E 1 9   ? 4.494   14.795   56.234  1.00 132.60 ? 12  DA  H OP1   1 
ATOM   2469  O OP2   . DA  E 1 9   ? 5.604   15.043   53.922  1.00 126.96 ? 12  DA  H OP2   1 
ATOM   2470  O "O5'" . DA  E 1 9   ? 6.943   14.466   55.943  1.00 122.77 ? 12  DA  H "O5'" 1 
ATOM   2471  C "C5'" . DA  E 1 9   ? 7.260   13.661   57.087  1.00 118.42 ? 12  DA  H "C5'" 1 
ATOM   2472  C "C4'" . DA  E 1 9   ? 8.756   13.645   57.284  1.00 116.52 ? 12  DA  H "C4'" 1 
ATOM   2473  O "O4'" . DA  E 1 9   ? 9.391   12.987   56.156  1.00 114.11 ? 12  DA  H "O4'" 1 
ATOM   2474  C "C3'" . DA  E 1 9   ? 9.394   15.034   57.368  1.00 114.78 ? 12  DA  H "C3'" 1 
ATOM   2475  O "O3'" . DA  E 1 9   ? 10.408  15.018   58.381  1.00 121.36 ? 12  DA  H "O3'" 1 
ATOM   2476  C "C2'" . DA  E 1 9   ? 9.986   15.217   55.983  1.00 111.79 ? 12  DA  H "C2'" 1 
ATOM   2477  C "C1'" . DA  E 1 9   ? 10.458  13.807   55.713  1.00 107.00 ? 12  DA  H "C1'" 1 
ATOM   2478  N N9    . DA  E 1 9   ? 10.737  13.493   54.312  1.00 95.63  ? 12  DA  H N9    1 
ATOM   2479  C C8    . DA  E 1 9   ? 9.966   13.770   53.210  1.00 95.05  ? 12  DA  H C8    1 
ATOM   2480  N N7    . DA  E 1 9   ? 10.503  13.382   52.079  1.00 90.73  ? 12  DA  H N7    1 
ATOM   2481  C C5    . DA  E 1 9   ? 11.714  12.822   52.460  1.00 84.96  ? 12  DA  H C5    1 
ATOM   2482  C C6    . DA  E 1 9   ? 12.757  12.230   51.722  1.00 81.90  ? 12  DA  H C6    1 
ATOM   2483  N N6    . DA  E 1 9   ? 12.738  12.094   50.396  1.00 79.74  ? 12  DA  H N6    1 
ATOM   2484  N N1    . DA  E 1 9   ? 13.829  11.769   52.406  1.00 78.25  ? 12  DA  H N1    1 
ATOM   2485  C C2    . DA  E 1 9   ? 13.845  11.904   53.740  1.00 82.20  ? 12  DA  H C2    1 
ATOM   2486  N N3    . DA  E 1 9   ? 12.926  12.443   54.544  1.00 84.96  ? 12  DA  H N3    1 
ATOM   2487  C C4    . DA  E 1 9   ? 11.872  12.884   53.833  1.00 88.11  ? 12  DA  H C4    1 
ATOM   2488  P P     . DG  E 1 10  ? 11.160  16.368   58.819  1.00 122.85 ? 13  DG  H P     1 
ATOM   2489  O OP1   . DG  E 1 10  ? 10.375  16.999   59.911  1.00 121.62 ? 13  DG  H OP1   1 
ATOM   2490  O OP2   . DG  E 1 10  ? 11.489  17.143   57.593  1.00 123.07 ? 13  DG  H OP2   1 
ATOM   2491  O "O5'" . DG  E 1 10  ? 12.524  15.829   59.440  1.00 114.32 ? 13  DG  H "O5'" 1 
ATOM   2492  C "C5'" . DG  E 1 10  ? 13.760  16.532   59.232  1.00 109.36 ? 13  DG  H "C5'" 1 
ATOM   2493  C "C4'" . DG  E 1 10  ? 14.661  15.756   58.300  1.00 102.92 ? 13  DG  H "C4'" 1 
ATOM   2494  O "O4'" . DG  E 1 10  ? 13.994  15.467   57.056  1.00 95.58  ? 13  DG  H "O4'" 1 
ATOM   2495  C "C3'" . DG  E 1 10  ? 15.930  16.501   57.896  1.00 101.49 ? 13  DG  H "C3'" 1 
ATOM   2496  O "O3'" . DG  E 1 10  ? 17.004  16.150   58.762  1.00 110.71 ? 13  DG  H "O3'" 1 
ATOM   2497  C "C2'" . DG  E 1 10  ? 16.188  16.059   56.463  1.00 95.39  ? 13  DG  H "C2'" 1 
ATOM   2498  C "C1'" . DG  E 1 10  ? 15.013  15.156   56.124  1.00 92.26  ? 13  DG  H "C1'" 1 
ATOM   2499  N N9    . DG  E 1 10  ? 14.470  15.317   54.779  1.00 85.59  ? 13  DG  H N9    1 
ATOM   2500  C C8    . DG  E 1 10  ? 13.207  15.734   54.431  1.00 87.71  ? 13  DG  H C8    1 
ATOM   2501  N N7    . DG  E 1 10  ? 13.009  15.744   53.140  1.00 83.51  ? 13  DG  H N7    1 
ATOM   2502  C C5    . DG  E 1 10  ? 14.209  15.297   52.605  1.00 76.39  ? 13  DG  H C5    1 
ATOM   2503  C C6    . DG  E 1 10  ? 14.595  15.099   51.254  1.00 76.15  ? 13  DG  H C6    1 
ATOM   2504  O O6    . DG  E 1 10  ? 13.930  15.281   50.227  1.00 76.78  ? 13  DG  H O6    1 
ATOM   2505  N N1    . DG  E 1 10  ? 15.904  14.636   51.159  1.00 74.78  ? 13  DG  H N1    1 
ATOM   2506  C C2    . DG  E 1 10  ? 16.737  14.399   52.226  1.00 76.57  ? 13  DG  H C2    1 
ATOM   2507  N N2    . DG  E 1 10  ? 17.967  13.949   51.929  1.00 75.08  ? 13  DG  H N2    1 
ATOM   2508  N N3    . DG  E 1 10  ? 16.391  14.587   53.490  1.00 72.97  ? 13  DG  H N3    1 
ATOM   2509  C C4    . DG  E 1 10  ? 15.122  15.032   53.604  1.00 75.77  ? 13  DG  H C4    1 
ATOM   2510  P P     . DT  E 1 11  ? 18.175  17.193   59.012  1.00 124.03 ? 14  DT  H P     1 
ATOM   2511  O OP1   . DT  E 1 11  ? 19.085  16.616   60.036  1.00 120.54 ? 14  DT  H OP1   1 
ATOM   2512  O OP2   . DT  E 1 11  ? 17.554  18.525   59.241  1.00 119.88 ? 14  DT  H OP2   1 
ATOM   2513  O "O5'" . DT  E 1 11  ? 18.948  17.201   57.619  1.00 108.46 ? 14  DT  H "O5'" 1 
ATOM   2514  C "C5'" . DT  E 1 11  ? 20.055  16.315   57.410  1.00 105.60 ? 14  DT  H "C5'" 1 
ATOM   2515  C "C4'" . DT  E 1 11  ? 20.564  16.430   55.993  1.00 110.13 ? 14  DT  H "C4'" 1 
ATOM   2516  O "O4'" . DT  E 1 11  ? 19.471  16.382   55.055  1.00 109.86 ? 14  DT  H "O4'" 1 
ATOM   2517  C "C3'" . DT  E 1 11  ? 21.303  17.729   55.677  1.00 112.93 ? 14  DT  H "C3'" 1 
ATOM   2518  O "O3'" . DT  E 1 11  ? 22.718  17.541   55.795  1.00 124.53 ? 14  DT  H "O3'" 1 
ATOM   2519  C "C2'" . DT  E 1 11  ? 20.891  18.052   54.246  1.00 109.94 ? 14  DT  H "C2'" 1 
ATOM   2520  C "C1'" . DT  E 1 11  ? 19.963  16.915   53.841  1.00 103.41 ? 14  DT  H "C1'" 1 
ATOM   2521  N N1    . DT  E 1 11  ? 18.806  17.303   53.005  1.00 91.93  ? 14  DT  H N1    1 
ATOM   2522  C C2    . DT  E 1 11  ? 18.905  17.165   51.636  1.00 85.43  ? 14  DT  H C2    1 
ATOM   2523  O O2    . DT  E 1 11  ? 19.909  16.753   51.077  1.00 79.33  ? 14  DT  H O2    1 
ATOM   2524  N N3    . DT  E 1 11  ? 17.778  17.530   50.941  1.00 81.60  ? 14  DT  H N3    1 
ATOM   2525  C C4    . DT  E 1 11  ? 16.593  18.012   51.466  1.00 85.57  ? 14  DT  H C4    1 
ATOM   2526  O O4    . DT  E 1 11  ? 15.669  18.311   50.714  1.00 83.96  ? 14  DT  H O4    1 
ATOM   2527  C C5    . DT  E 1 11  ? 16.558  18.129   52.908  1.00 88.80  ? 14  DT  H C5    1 
ATOM   2528  C C7    . DT  E 1 11  ? 15.318  18.650   53.566  1.00 86.76  ? 14  DT  H C7    1 
ATOM   2529  C C6    . DT  E 1 11  ? 17.652  17.773   53.595  1.00 89.00  ? 14  DT  H C6    1 
ATOM   2530  P P     . DA  E 1 12  ? 23.708  18.804   55.765  1.00 137.72 ? 15  DA  H P     1 
ATOM   2531  O OP1   . DA  E 1 12  ? 24.905  18.473   56.581  1.00 135.85 ? 15  DA  H OP1   1 
ATOM   2532  O OP2   . DA  E 1 12  ? 22.915  20.025   56.071  1.00 140.06 ? 15  DA  H OP2   1 
ATOM   2533  O "O5'" . DA  E 1 12  ? 24.173  18.863   54.243  1.00 126.08 ? 15  DA  H "O5'" 1 
ATOM   2534  C "C5'" . DA  E 1 12  ? 25.029  17.846   53.698  1.00 119.86 ? 15  DA  H "C5'" 1 
ATOM   2535  C "C4'" . DA  E 1 12  ? 25.121  18.004   52.200  1.00 117.05 ? 15  DA  H "C4'" 1 
ATOM   2536  O "O4'" . DA  E 1 12  ? 23.792  18.099   51.631  1.00 118.59 ? 15  DA  H "O4'" 1 
ATOM   2537  C "C3'" . DA  E 1 12  ? 25.861  19.256   51.733  1.00 110.98 ? 15  DA  H "C3'" 1 
ATOM   2538  O "O3'" . DA  E 1 12  ? 26.661  18.878   50.608  1.00 109.20 ? 15  DA  H "O3'" 1 
ATOM   2539  C "C2'" . DA  E 1 12  ? 24.734  20.236   51.444  1.00 107.94 ? 15  DA  H "C2'" 1 
ATOM   2540  C "C1'" . DA  E 1 12  ? 23.652  19.317   50.907  1.00 106.70 ? 15  DA  H "C1'" 1 
ATOM   2541  N N9    . DA  E 1 12  ? 22.273  19.780   51.077  1.00 93.26  ? 15  DA  H N9    1 
ATOM   2542  C C8    . DA  E 1 12  ? 21.673  20.231   52.226  1.00 86.68  ? 15  DA  H C8    1 
ATOM   2543  N N7    . DA  E 1 12  ? 20.406  20.536   52.077  1.00 81.16  ? 15  DA  H N7    1 
ATOM   2544  C C5    . DA  E 1 12  ? 20.155  20.271   50.738  1.00 79.39  ? 15  DA  H C5    1 
ATOM   2545  C C6    . DA  E 1 12  ? 18.996  20.394   49.950  1.00 82.34  ? 15  DA  H C6    1 
ATOM   2546  N N6    . DA  E 1 12  ? 17.828  20.843   50.418  1.00 82.21  ? 15  DA  H N6    1 
ATOM   2547  N N1    . DA  E 1 12  ? 19.080  20.040   48.647  1.00 79.18  ? 15  DA  H N1    1 
ATOM   2548  C C2    . DA  E 1 12  ? 20.255  19.593   48.179  1.00 82.48  ? 15  DA  H C2    1 
ATOM   2549  N N3    . DA  E 1 12  ? 21.414  19.436   48.821  1.00 83.12  ? 15  DA  H N3    1 
ATOM   2550  C C4    . DA  E 1 12  ? 21.294  19.796   50.112  1.00 84.21  ? 15  DA  H C4    1 
ATOM   2551  P P     . DT  E 1 13  ? 27.274  19.985   49.639  1.00 117.51 ? 16  DT  H P     1 
ATOM   2552  O OP1   . DT  E 1 13  ? 28.430  19.386   48.917  1.00 109.29 ? 16  DT  H OP1   1 
ATOM   2553  O OP2   . DT  E 1 13  ? 27.467  21.227   50.431  1.00 121.67 ? 16  DT  H OP2   1 
ATOM   2554  O "O5'" . DT  E 1 13  ? 26.102  20.212   48.585  1.00 114.36 ? 16  DT  H "O5'" 1 
ATOM   2555  C "C5'" . DT  E 1 13  ? 25.793  19.197   47.612  1.00 114.93 ? 16  DT  H "C5'" 1 
ATOM   2556  C "C4'" . DT  E 1 13  ? 25.299  19.825   46.330  1.00 111.02 ? 16  DT  H "C4'" 1 
ATOM   2557  O "O4'" . DT  E 1 13  ? 23.925  20.251   46.496  1.00 106.66 ? 16  DT  H "O4'" 1 
ATOM   2558  C "C3'" . DT  E 1 13  ? 26.077  21.057   45.863  1.00 104.58 ? 16  DT  H "C3'" 1 
ATOM   2559  O "O3'" . DT  E 1 13  ? 26.308  20.951   44.453  1.00 105.95 ? 16  DT  H "O3'" 1 
ATOM   2560  C "C2'" . DT  E 1 13  ? 25.158  22.215   46.218  1.00 101.76 ? 16  DT  H "C2'" 1 
ATOM   2561  C "C1'" . DT  E 1 13  ? 23.779  21.596   46.075  1.00 92.55  ? 16  DT  H "C1'" 1 
ATOM   2562  N N1    . DT  E 1 13  ? 22.690  22.196   46.877  1.00 81.00  ? 16  DT  H N1    1 
ATOM   2563  C C2    . DT  E 1 13  ? 21.490  22.443   46.247  1.00 80.27  ? 16  DT  H C2    1 
ATOM   2564  O O2    . DT  E 1 13  ? 21.306  22.239   45.058  1.00 85.71  ? 16  DT  H O2    1 
ATOM   2565  N N3    . DT  E 1 13  ? 20.509  22.954   47.063  1.00 74.20  ? 16  DT  H N3    1 
ATOM   2566  C C4    . DT  E 1 13  ? 20.605  23.223   48.416  1.00 76.15  ? 16  DT  H C4    1 
ATOM   2567  O O4    . DT  E 1 13  ? 19.639  23.684   49.019  1.00 74.52  ? 16  DT  H O4    1 
ATOM   2568  C C5    . DT  E 1 13  ? 21.886  22.923   49.014  1.00 77.83  ? 16  DT  H C5    1 
ATOM   2569  C C7    . DT  E 1 13  ? 22.082  23.181   50.475  1.00 79.52  ? 16  DT  H C7    1 
ATOM   2570  C C6    . DT  E 1 13  ? 22.848  22.420   48.227  1.00 77.82  ? 16  DT  H C6    1 
ATOM   2571  P P     . DG  E 1 14  ? 27.721  21.368   43.815  1.00 111.89 ? 17  DG  H P     1 
ATOM   2572  O OP1   . DG  E 1 14  ? 28.134  20.313   42.850  1.00 111.54 ? 17  DG  H OP1   1 
ATOM   2573  O OP2   . DG  E 1 14  ? 28.640  21.761   44.921  1.00 102.22 ? 17  DG  H OP2   1 
ATOM   2574  O "O5'" . DG  E 1 14  ? 27.336  22.627   42.920  1.00 117.17 ? 17  DG  H "O5'" 1 
ATOM   2575  C "C5'" . DG  E 1 14  ? 26.287  22.537   41.932  1.00 115.99 ? 17  DG  H "C5'" 1 
ATOM   2576  C "C4'" . DG  E 1 14  ? 25.553  23.855   41.813  1.00 114.21 ? 17  DG  H "C4'" 1 
ATOM   2577  O "O4'" . DG  E 1 14  ? 24.728  24.077   42.988  1.00 103.44 ? 17  DG  H "O4'" 1 
ATOM   2578  C "C3'" . DG  E 1 14  ? 26.465  25.083   41.689  1.00 113.40 ? 17  DG  H "C3'" 1 
ATOM   2579  O "O3'" . DG  E 1 14  ? 26.113  25.905   40.564  1.00 122.04 ? 17  DG  H "O3'" 1 
ATOM   2580  C "C2'" . DG  E 1 14  ? 26.267  25.806   43.009  1.00 104.98 ? 17  DG  H "C2'" 1 
ATOM   2581  C "C1'" . DG  E 1 14  ? 24.832  25.439   43.335  1.00 95.34  ? 17  DG  H "C1'" 1 
ATOM   2582  N N9    . DG  E 1 14  ? 24.442  25.601   44.733  1.00 83.82  ? 17  DG  H N9    1 
ATOM   2583  C C8    . DG  E 1 14  ? 25.279  25.677   45.821  1.00 82.80  ? 17  DG  H C8    1 
ATOM   2584  N N7    . DG  E 1 14  ? 24.643  25.884   46.943  1.00 81.30  ? 17  DG  H N7    1 
ATOM   2585  C C5    . DG  E 1 14  ? 23.309  25.977   46.571  1.00 73.92  ? 17  DG  H C5    1 
ATOM   2586  C C6    . DG  E 1 14  ? 22.148  26.206   47.358  1.00 71.57  ? 17  DG  H C6    1 
ATOM   2587  O O6    . DG  E 1 14  ? 22.067  26.375   48.582  1.00 72.04  ? 17  DG  H O6    1 
ATOM   2588  N N1    . DG  E 1 14  ? 20.995  26.228   46.579  1.00 66.82  ? 17  DG  H N1    1 
ATOM   2589  C C2    . DG  E 1 14  ? 20.962  26.049   45.216  1.00 72.93  ? 17  DG  H C2    1 
ATOM   2590  N N2    . DG  E 1 14  ? 19.748  26.101   44.643  1.00 74.08  ? 17  DG  H N2    1 
ATOM   2591  N N3    . DG  E 1 14  ? 22.037  25.835   44.470  1.00 68.94  ? 17  DG  H N3    1 
ATOM   2592  C C4    . DG  E 1 14  ? 23.168  25.815   45.208  1.00 73.90  ? 17  DG  H C4    1 
ATOM   2593  P P     . DA  E 1 15  ? 27.257  26.452   39.571  1.00 132.68 ? 18  DA  H P     1 
ATOM   2594  O OP1   . DA  E 1 15  ? 27.500  25.425   38.524  1.00 132.76 ? 18  DA  H OP1   1 
ATOM   2595  O OP2   . DA  E 1 15  ? 28.392  26.942   40.396  1.00 133.72 ? 18  DA  H OP2   1 
ATOM   2596  O "O5'" . DA  E 1 15  ? 26.564  27.699   38.865  1.00 124.81 ? 18  DA  H "O5'" 1 
ATOM   2597  C "C5'" . DA  E 1 15  ? 25.637  27.523   37.779  1.00 117.69 ? 18  DA  H "C5'" 1 
ATOM   2598  C "C4'" . DA  E 1 15  ? 24.233  27.813   38.255  1.00 115.54 ? 18  DA  H "C4'" 1 
ATOM   2599  O "O4'" . DA  E 1 15  ? 24.160  27.622   39.686  1.00 107.21 ? 18  DA  H "O4'" 1 
ATOM   2600  C "C3'" . DA  E 1 15  ? 23.741  29.240   37.987  1.00 116.85 ? 18  DA  H "C3'" 1 
ATOM   2601  O "O3'" . DA  E 1 15  ? 22.600  29.221   37.116  1.00 129.32 ? 18  DA  H "O3'" 1 
ATOM   2602  C "C2'" . DA  E 1 15  ? 23.389  29.784   39.363  1.00 108.30 ? 18  DA  H "C2'" 1 
ATOM   2603  C "C1'" . DA  E 1 15  ? 23.233  28.547   40.213  1.00 102.31 ? 18  DA  H "C1'" 1 
ATOM   2604  N N9    . DA  E 1 15  ? 23.539  28.734   41.631  1.00 95.21  ? 18  DA  H N9    1 
ATOM   2605  C C8    . DA  E 1 15  ? 24.776  28.732   42.227  1.00 94.19  ? 18  DA  H C8    1 
ATOM   2606  N N7    . DA  E 1 15  ? 24.736  28.907   43.527  1.00 89.86  ? 18  DA  H N7    1 
ATOM   2607  C C5    . DA  E 1 15  ? 23.382  29.038   43.804  1.00 85.14  ? 18  DA  H C5    1 
ATOM   2608  C C6    . DA  E 1 15  ? 22.678  29.247   45.005  1.00 82.03  ? 18  DA  H C6    1 
ATOM   2609  N N6    . DA  E 1 15  ? 23.268  29.374   46.196  1.00 85.20  ? 18  DA  H N6    1 
ATOM   2610  N N1    . DA  E 1 15  ? 21.330  29.324   44.939  1.00 75.31  ? 18  DA  H N1    1 
ATOM   2611  C C2    . DA  E 1 15  ? 20.739  29.197   43.741  1.00 80.93  ? 18  DA  H C2    1 
ATOM   2612  N N3    . DA  E 1 15  ? 21.294  28.999   42.544  1.00 82.67  ? 18  DA  H N3    1 
ATOM   2613  C C4    . DA  E 1 15  ? 22.633  28.930   42.646  1.00 86.81  ? 18  DA  H C4    1 
ATOM   2614  P P     . DA  E 1 16  ? 22.074  30.578   36.434  1.00 124.11 ? 19  DA  H P     1 
ATOM   2615  O OP1   . DA  E 1 16  ? 20.665  30.373   36.009  1.00 122.29 ? 19  DA  H OP1   1 
ATOM   2616  O OP2   . DA  E 1 16  ? 23.088  31.019   35.442  1.00 119.89 ? 19  DA  H OP2   1 
ATOM   2617  O "O5'" . DA  E 1 16  ? 22.038  31.596   37.654  1.00 114.39 ? 19  DA  H "O5'" 1 
ATOM   2618  C "C5'" . DA  E 1 16  ? 21.073  32.647   37.687  1.00 114.33 ? 19  DA  H "C5'" 1 
ATOM   2619  C "C4'" . DA  E 1 16  ? 19.790  32.183   38.335  1.00 113.01 ? 19  DA  H "C4'" 1 
ATOM   2620  O "O4'" . DA  E 1 16  ? 20.075  31.435   39.540  1.00 107.96 ? 19  DA  H "O4'" 1 
ATOM   2621  C "C3'" . DA  E 1 16  ? 18.916  33.351   38.770  1.00 116.08 ? 19  DA  H "C3'" 1 
ATOM   2622  O "O3'" . DA  E 1 16  ? 17.520  33.132   38.588  1.00 116.59 ? 19  DA  H "O3'" 1 
ATOM   2623  C "C2'" . DA  E 1 16  ? 19.301  33.567   40.221  1.00 112.09 ? 19  DA  H "C2'" 1 
ATOM   2624  C "C1'" . DA  E 1 16  ? 19.758  32.203   40.700  1.00 102.89 ? 19  DA  H "C1'" 1 
ATOM   2625  N N9    . DA  E 1 16  ? 20.948  32.251   41.553  1.00 89.64  ? 19  DA  H N9    1 
ATOM   2626  C C8    . DA  E 1 16  ? 22.266  32.139   41.181  1.00 88.70  ? 19  DA  H C8    1 
ATOM   2627  N N7    . DA  E 1 16  ? 23.107  32.208   42.184  1.00 83.61  ? 19  DA  H N7    1 
ATOM   2628  C C5    . DA  E 1 16  ? 22.290  32.399   43.290  1.00 82.71  ? 19  DA  H C5    1 
ATOM   2629  C C6    . DA  E 1 16  ? 22.572  32.550   44.660  1.00 83.71  ? 19  DA  H C6    1 
ATOM   2630  N N6    . DA  E 1 16  ? 23.807  32.538   45.167  1.00 83.20  ? 19  DA  H N6    1 
ATOM   2631  N N1    . DA  E 1 16  ? 21.528  32.721   45.502  1.00 82.71  ? 19  DA  H N1    1 
ATOM   2632  C C2    . DA  E 1 16  ? 20.288  32.727   44.992  1.00 85.11  ? 19  DA  H C2    1 
ATOM   2633  N N3    . DA  E 1 16  ? 19.896  32.590   43.724  1.00 81.65  ? 19  DA  H N3    1 
ATOM   2634  C C4    . DA  E 1 16  ? 20.958  32.433   42.915  1.00 82.53  ? 19  DA  H C4    1 
ATOM   2635  P P     . DA  E 1 17  ? 16.578  34.399   38.419  1.00 113.59 ? 20  DA  H P     1 
ATOM   2636  O OP1   . DA  E 1 17  ? 15.211  33.920   38.105  1.00 122.70 ? 20  DA  H OP1   1 
ATOM   2637  O OP2   . DA  E 1 17  ? 17.253  35.343   37.496  1.00 111.85 ? 20  DA  H OP2   1 
ATOM   2638  O "O5'" . DA  E 1 17  ? 16.546  35.003   39.890  1.00 103.17 ? 20  DA  H "O5'" 1 
ATOM   2639  C "C5'" . DA  E 1 17  ? 15.620  34.469   40.845  1.00 105.24 ? 20  DA  H "C5'" 1 
ATOM   2640  C "C4'" . DA  E 1 17  ? 15.845  35.092   42.202  1.00 107.16 ? 20  DA  H "C4'" 1 
ATOM   2641  O "O4'" . DA  E 1 17  ? 17.213  34.888   42.619  1.00 104.58 ? 20  DA  H "O4'" 1 
ATOM   2642  C "C3'" . DA  E 1 17  ? 15.600  36.602   42.273  1.00 104.48 ? 20  DA  H "C3'" 1 
ATOM   2643  O "O3'" . DA  E 1 17  ? 14.713  36.822   43.376  1.00 102.64 ? 20  DA  H "O3'" 1 
ATOM   2644  C "C2'" . DA  E 1 17  ? 16.996  37.182   42.446  1.00 101.91 ? 20  DA  H "C2'" 1 
ATOM   2645  C "C1'" . DA  E 1 17  ? 17.676  36.077   43.225  1.00 97.11  ? 20  DA  H "C1'" 1 
ATOM   2646  N N9    . DA  E 1 17  ? 19.135  36.044   43.197  1.00 91.20  ? 20  DA  H N9    1 
ATOM   2647  C C8    . DA  E 1 17  ? 19.957  35.964   42.101  1.00 91.52  ? 20  DA  H C8    1 
ATOM   2648  N N7    . DA  E 1 17  ? 21.233  35.896   42.400  1.00 87.82  ? 20  DA  H N7    1 
ATOM   2649  C C5    . DA  E 1 17  ? 21.250  35.913   43.788  1.00 86.46  ? 20  DA  H C5    1 
ATOM   2650  C C6    . DA  E 1 17  ? 22.301  35.871   44.722  1.00 89.09  ? 20  DA  H C6    1 
ATOM   2651  N N6    . DA  E 1 17  ? 23.590  35.799   44.382  1.00 90.60  ? 20  DA  H N6    1 
ATOM   2652  N N1    . DA  E 1 17  ? 21.979  35.910   46.034  1.00 91.10  ? 20  DA  H N1    1 
ATOM   2653  C C2    . DA  E 1 17  ? 20.684  35.987   46.374  1.00 94.01  ? 20  DA  H C2    1 
ATOM   2654  N N3    . DA  E 1 17  ? 19.608  36.038   45.588  1.00 89.50  ? 20  DA  H N3    1 
ATOM   2655  C C4    . DA  E 1 17  ? 19.964  35.998   44.292  1.00 87.46  ? 20  DA  H C4    1 
ATOM   2656  P P     . DT  E 1 18  ? 14.062  38.256   43.624  1.00 107.07 ? 21  DT  H P     1 
ATOM   2657  O OP1   . DT  E 1 18  ? 12.587  38.094   43.737  1.00 98.71  ? 21  DT  H OP1   1 
ATOM   2658  O OP2   . DT  E 1 18  ? 14.627  39.190   42.613  1.00 110.93 ? 21  DT  H OP2   1 
ATOM   2659  O "O5'" . DT  E 1 18  ? 14.616  38.638   45.067  1.00 98.09  ? 21  DT  H "O5'" 1 
ATOM   2660  C "C5'" . DT  E 1 18  ? 16.025  38.550   45.311  1.00 96.16  ? 21  DT  H "C5'" 1 
ATOM   2661  C "C4'" . DT  E 1 18  ? 16.356  38.906   46.739  1.00 98.34  ? 21  DT  H "C4'" 1 
ATOM   2662  O "O4'" . DT  E 1 18  ? 17.738  38.550   46.970  1.00 101.22 ? 21  DT  H "O4'" 1 
ATOM   2663  C "C3'" . DT  E 1 18  ? 16.273  40.394   47.052  1.00 100.12 ? 21  DT  H "C3'" 1 
ATOM   2664  O "O3'" . DT  E 1 18  ? 16.021  40.601   48.447  1.00 107.31 ? 21  DT  H "O3'" 1 
ATOM   2665  C "C2'" . DT  E 1 18  ? 17.642  40.884   46.620  1.00 97.60  ? 21  DT  H "C2'" 1 
ATOM   2666  C "C1'" . DT  E 1 18  ? 18.543  39.718   47.010  1.00 88.90  ? 21  DT  H "C1'" 1 
ATOM   2667  N N1    . DT  E 1 18  ? 19.704  39.500   46.124  1.00 82.36  ? 21  DT  H N1    1 
ATOM   2668  C C2    . DT  E 1 18  ? 20.945  39.385   46.713  1.00 88.14  ? 21  DT  H C2    1 
ATOM   2669  O O2    . DT  E 1 18  ? 21.119  39.447   47.920  1.00 94.70  ? 21  DT  H O2    1 
ATOM   2670  N N3    . DT  E 1 18  ? 21.983  39.197   45.832  1.00 84.30  ? 21  DT  H N3    1 
ATOM   2671  C C4    . DT  E 1 18  ? 21.905  39.122   44.453  1.00 83.56  ? 21  DT  H C4    1 
ATOM   2672  O O4    . DT  E 1 18  ? 22.928  38.951   43.791  1.00 79.31  ? 21  DT  H O4    1 
ATOM   2673  C C5    . DT  E 1 18  ? 20.572  39.250   43.903  1.00 80.15  ? 21  DT  H C5    1 
ATOM   2674  C C7    . DT  E 1 18  ? 20.390  39.180   42.420  1.00 80.09  ? 21  DT  H C7    1 
ATOM   2675  C C6    . DT  E 1 18  ? 19.552  39.424   44.756  1.00 76.22  ? 21  DT  H C6    1 
ATOM   2676  P P     . DG  E 1 19  ? 15.619  42.054   48.994  1.00 109.54 ? 22  DG  H P     1 
ATOM   2677  O OP1   . DG  E 1 19  ? 14.322  41.938   49.713  1.00 107.84 ? 22  DG  H OP1   1 
ATOM   2678  O OP2   . DG  E 1 19  ? 15.748  43.012   47.864  1.00 115.00 ? 22  DG  H OP2   1 
ATOM   2679  O "O5'" . DG  E 1 19  ? 16.750  42.353   50.077  1.00 106.19 ? 22  DG  H "O5'" 1 
ATOM   2680  C "C5'" . DG  E 1 19  ? 18.065  41.791   49.914  1.00 108.15 ? 22  DG  H "C5'" 1 
ATOM   2681  C "C4'" . DG  E 1 19  ? 19.053  42.360   50.906  1.00 110.91 ? 22  DG  H "C4'" 1 
ATOM   2682  O "O4'" . DG  E 1 19  ? 20.380  42.114   50.388  1.00 103.18 ? 22  DG  H "O4'" 1 
ATOM   2683  C "C3'" . DG  E 1 19  ? 18.995  43.870   51.123  1.00 113.51 ? 22  DG  H "C3'" 1 
ATOM   2684  O "O3'" . DG  E 1 19  ? 19.540  44.177   52.418  1.00 123.93 ? 22  DG  H "O3'" 1 
ATOM   2685  C "C2'" . DG  E 1 19  ? 19.834  44.381   49.966  1.00 106.26 ? 22  DG  H "C2'" 1 
ATOM   2686  C "C1'" . DG  E 1 19  ? 20.920  43.315   49.847  1.00 93.11  ? 22  DG  H "C1'" 1 
ATOM   2687  N N9    . DG  E 1 19  ? 21.352  43.035   48.484  1.00 82.24  ? 22  DG  H N9    1 
ATOM   2688  C C8    . DG  E 1 19  ? 20.557  42.878   47.374  1.00 79.89  ? 22  DG  H C8    1 
ATOM   2689  N N7    . DG  E 1 19  ? 21.238  42.645   46.285  1.00 74.83  ? 22  DG  H N7    1 
ATOM   2690  C C5    . DG  E 1 19  ? 22.561  42.637   46.702  1.00 69.52  ? 22  DG  H C5    1 
ATOM   2691  C C6    . DG  E 1 19  ? 23.755  42.436   45.963  1.00 69.00  ? 22  DG  H C6    1 
ATOM   2692  O O6    . DG  E 1 19  ? 23.884  42.210   44.754  1.00 67.34  ? 22  DG  H O6    1 
ATOM   2693  N N1    . DG  E 1 19  ? 24.882  42.529   46.774  1.00 69.63  ? 22  DG  H N1    1 
ATOM   2694  C C2    . DG  E 1 19  ? 24.862  42.774   48.127  1.00 78.58  ? 22  DG  H C2    1 
ATOM   2695  N N2    . DG  E 1 19  ? 26.057  42.817   48.741  1.00 80.16  ? 22  DG  H N2    1 
ATOM   2696  N N3    . DG  E 1 19  ? 23.754  42.963   48.828  1.00 76.00  ? 22  DG  H N3    1 
ATOM   2697  C C4    . DG  E 1 19  ? 22.649  42.881   48.056  1.00 74.32  ? 22  DG  H C4    1 
ATOM   2698  P P     . DT  E 1 20  ? 19.569  45.691   52.987  1.00 132.00 ? 23  DT  H P     1 
ATOM   2699  O OP1   . DT  E 1 20  ? 18.972  45.686   54.355  1.00 118.92 ? 23  DT  H OP1   1 
ATOM   2700  O OP2   . DT  E 1 20  ? 19.000  46.594   51.951  1.00 130.13 ? 23  DT  H OP2   1 
ATOM   2701  O "O5'" . DT  E 1 20  ? 21.132  45.989   53.111  1.00 121.70 ? 23  DT  H "O5'" 1 
ATOM   2702  C "C5'" . DT  E 1 20  ? 22.074  45.356   52.223  1.00 119.22 ? 23  DT  H "C5'" 1 
ATOM   2703  C "C4'" . DT  E 1 20  ? 23.492  45.795   52.502  1.00 125.37 ? 23  DT  H "C4'" 1 
ATOM   2704  O "O4'" . DT  E 1 20  ? 24.318  45.458   51.362  1.00 122.23 ? 23  DT  H "O4'" 1 
ATOM   2705  C "C3'" . DT  E 1 20  ? 23.688  47.294   52.711  1.00 129.38 ? 23  DT  H "C3'" 1 
ATOM   2706  O "O3'" . DT  E 1 20  ? 24.810  47.505   53.573  1.00 140.02 ? 23  DT  H "O3'" 1 
ATOM   2707  C "C2'" . DT  E 1 20  ? 23.945  47.798   51.302  1.00 124.78 ? 23  DT  H "C2'" 1 
ATOM   2708  C "C1'" . DT  E 1 20  ? 24.705  46.639   50.661  1.00 114.93 ? 23  DT  H "C1'" 1 
ATOM   2709  N N1    . DT  E 1 20  ? 24.424  46.425   49.225  1.00 100.00 ? 23  DT  H N1    1 
ATOM   2710  C C2    . DT  E 1 20  ? 25.473  46.111   48.386  1.00 94.61  ? 23  DT  H C2    1 
ATOM   2711  O O2    . DT  E 1 20  ? 26.627  46.009   48.770  1.00 95.70  ? 23  DT  H O2    1 
ATOM   2712  N N3    . DT  E 1 20  ? 25.118  45.918   47.072  1.00 82.31  ? 23  DT  H N3    1 
ATOM   2713  C C4    . DT  E 1 20  ? 23.848  46.001   46.531  1.00 80.63  ? 23  DT  H C4    1 
ATOM   2714  O O4    . DT  E 1 20  ? 23.680  45.798   45.331  1.00 74.81  ? 23  DT  H O4    1 
ATOM   2715  C C5    . DT  E 1 20  ? 22.797  46.331   47.469  1.00 81.84  ? 23  DT  H C5    1 
ATOM   2716  C C7    . DT  E 1 20  ? 21.391  46.452   46.971  1.00 79.99  ? 23  DT  H C7    1 
ATOM   2717  C C6    . DT  E 1 20  ? 23.133  46.522   48.751  1.00 87.71  ? 23  DT  H C6    1 
ATOM   2718  P P     . DC  E 1 21  ? 25.184  48.976   54.069  1.00 145.16 ? 24  DC  H P     1 
ATOM   2719  O OP1   . DC  E 1 21  ? 26.092  48.844   55.237  1.00 145.18 ? 24  DC  H OP1   1 
ATOM   2720  O OP2   . DC  E 1 21  ? 23.922  49.757   54.199  1.00 140.90 ? 24  DC  H OP2   1 
ATOM   2721  O "O5'" . DC  E 1 21  ? 26.041  49.551   52.856  1.00 138.74 ? 24  DC  H "O5'" 1 
ATOM   2722  C "C5'" . DC  E 1 21  ? 27.298  48.955   52.480  1.00 134.57 ? 24  DC  H "C5'" 1 
ATOM   2723  C "C4'" . DC  E 1 21  ? 27.950  49.766   51.384  1.00 136.38 ? 24  DC  H "C4'" 1 
ATOM   2724  O "O4'" . DC  E 1 21  ? 27.337  49.445   50.111  1.00 125.82 ? 24  DC  H "O4'" 1 
ATOM   2725  C "C3'" . DC  E 1 21  ? 27.812  51.285   51.537  1.00 141.23 ? 24  DC  H "C3'" 1 
ATOM   2726  O "O3'" . DC  E 1 21  ? 28.994  51.953   51.077  1.00 150.05 ? 24  DC  H "O3'" 1 
ATOM   2727  C "C2'" . DC  E 1 21  ? 26.639  51.610   50.633  1.00 130.37 ? 24  DC  H "C2'" 1 
ATOM   2728  C "C1'" . DC  E 1 21  ? 26.917  50.652   49.492  1.00 121.05 ? 24  DC  H "C1'" 1 
ATOM   2729  N N1    . DC  E 1 21  ? 25.796  50.341   48.587  1.00 109.96 ? 24  DC  H N1    1 
ATOM   2730  C C2    . DC  E 1 21  ? 26.089  49.757   47.350  1.00 97.04  ? 24  DC  H C2    1 
ATOM   2731  O O2    . DC  E 1 21  ? 27.272  49.507   47.071  1.00 89.27  ? 24  DC  H O2    1 
ATOM   2732  N N3    . DC  E 1 21  ? 25.079  49.476   46.493  1.00 86.43  ? 24  DC  H N3    1 
ATOM   2733  C C4    . DC  E 1 21  ? 23.819  49.765   46.831  1.00 94.73  ? 24  DC  H C4    1 
ATOM   2734  N N4    . DC  E 1 21  ? 22.853  49.471   45.955  1.00 89.15  ? 24  DC  H N4    1 
ATOM   2735  C C5    . DC  E 1 21  ? 23.492  50.365   48.083  1.00 100.70 ? 24  DC  H C5    1 
ATOM   2736  C C6    . DC  E 1 21  ? 24.502  50.638   48.921  1.00 104.26 ? 24  DC  H C6    1 
ATOM   2737  P P     . DG  E 1 22  ? 29.367  53.410   51.630  1.00 143.33 ? 25  DG  H P     1 
ATOM   2738  O OP1   . DG  E 1 22  ? 30.080  53.242   52.921  1.00 142.41 ? 25  DG  H OP1   1 
ATOM   2739  O OP2   . DG  E 1 22  ? 28.144  54.254   51.567  1.00 136.97 ? 25  DG  H OP2   1 
ATOM   2740  O "O5'" . DG  E 1 22  ? 30.420  53.938   50.558  1.00 131.52 ? 25  DG  H "O5'" 1 
ATOM   2741  C "C5'" . DG  E 1 22  ? 31.648  53.229   50.308  1.00 129.56 ? 25  DG  H "C5'" 1 
ATOM   2742  C "C4'" . DG  E 1 22  ? 31.822  53.012   48.823  1.00 135.29 ? 25  DG  H "C4'" 1 
ATOM   2743  O "O4'" . DG  E 1 22  ? 30.577  52.526   48.263  1.00 137.13 ? 25  DG  H "O4'" 1 
ATOM   2744  C "C3'" . DG  E 1 22  ? 32.180  54.268   48.024  1.00 141.19 ? 25  DG  H "C3'" 1 
ATOM   2745  O "O3'" . DG  E 1 22  ? 33.146  53.955   47.010  1.00 153.95 ? 25  DG  H "O3'" 1 
ATOM   2746  C "C2'" . DG  E 1 22  ? 30.849  54.691   47.428  1.00 134.46 ? 25  DG  H "C2'" 1 
ATOM   2747  C "C1'" . DG  E 1 22  ? 30.192  53.347   47.171  1.00 129.46 ? 25  DG  H "C1'" 1 
ATOM   2748  N N9    . DG  E 1 22  ? 28.732  53.353   47.102  1.00 115.89 ? 25  DG  H N9    1 
ATOM   2749  C C8    . DG  E 1 22  ? 27.851  53.715   48.095  1.00 110.45 ? 25  DG  H C8    1 
ATOM   2750  N N7    . DG  E 1 22  ? 26.601  53.606   47.735  1.00 101.29 ? 25  DG  H N7    1 
ATOM   2751  C C5    . DG  E 1 22  ? 26.658  53.140   46.428  1.00 97.16  ? 25  DG  H C5    1 
ATOM   2752  C C6    . DG  E 1 22  ? 25.614  52.829   45.516  1.00 95.29  ? 25  DG  H C6    1 
ATOM   2753  O O6    . DG  E 1 22  ? 24.390  52.903   45.689  1.00 89.38  ? 25  DG  H O6    1 
ATOM   2754  N N1    . DG  E 1 22  ? 26.118  52.387   44.294  1.00 89.17  ? 25  DG  H N1    1 
ATOM   2755  C C2    . DG  E 1 22  ? 27.452  52.260   43.990  1.00 87.50  ? 25  DG  H C2    1 
ATOM   2756  N N2    . DG  E 1 22  ? 27.739  51.820   42.754  1.00 85.12  ? 25  DG  H N2    1 
ATOM   2757  N N3    . DG  E 1 22  ? 28.434  52.544   44.832  1.00 84.62  ? 25  DG  H N3    1 
ATOM   2758  C C4    . DG  E 1 22  ? 27.967  52.975   46.024  1.00 98.42  ? 25  DG  H C4    1 
ATOM   2759  P P     . DT  E 1 23  ? 33.882  55.128   46.190  1.00 160.85 ? 26  DT  H P     1 
ATOM   2760  O OP1   . DT  E 1 23  ? 35.278  54.694   45.908  1.00 149.82 ? 26  DT  H OP1   1 
ATOM   2761  O OP2   . DT  E 1 23  ? 33.640  56.410   46.901  1.00 156.36 ? 26  DT  H OP2   1 
ATOM   2762  O "O5'" . DT  E 1 23  ? 33.087  55.158   44.809  1.00 145.45 ? 26  DT  H "O5'" 1 
ATOM   2763  C "C5'" . DT  E 1 23  ? 33.633  54.535   43.633  1.00 134.91 ? 26  DT  H "C5'" 1 
ATOM   2764  C "C4'" . DT  E 1 23  ? 32.568  54.391   42.571  1.00 131.89 ? 26  DT  H "C4'" 1 
ATOM   2765  O "O4'" . DT  E 1 23  ? 31.256  54.395   43.171  1.00 122.55 ? 26  DT  H "O4'" 1 
ATOM   2766  C "C3'" . DT  E 1 23  ? 32.545  55.512   41.529  1.00 130.88 ? 26  DT  H "C3'" 1 
ATOM   2767  O "O3'" . DT  E 1 23  ? 33.143  55.070   40.308  1.00 143.52 ? 26  DT  H "O3'" 1 
ATOM   2768  C "C2'" . DT  E 1 23  ? 31.068  55.827   41.338  1.00 122.49 ? 26  DT  H "C2'" 1 
ATOM   2769  C "C1'" . DT  E 1 23  ? 30.344  54.778   42.163  1.00 115.32 ? 26  DT  H "C1'" 1 
ATOM   2770  N N1    . DT  E 1 23  ? 29.110  55.257   42.814  1.00 105.63 ? 26  DT  H N1    1 
ATOM   2771  C C2    . DT  E 1 23  ? 27.934  55.180   42.101  1.00 101.64 ? 26  DT  H C2    1 
ATOM   2772  O O2    . DT  E 1 23  ? 27.869  54.735   40.965  1.00 93.91  ? 26  DT  H O2    1 
ATOM   2773  N N3    . DT  E 1 23  ? 26.827  55.641   42.774  1.00 96.27  ? 26  DT  H N3    1 
ATOM   2774  C C4    . DT  E 1 23  ? 26.784  56.161   44.055  1.00 94.60  ? 26  DT  H C4    1 
ATOM   2775  O O4    . DT  E 1 23  ? 25.714  56.533   44.530  1.00 93.20  ? 26  DT  H O4    1 
ATOM   2776  C C5    . DT  E 1 23  ? 28.054  56.212   44.743  1.00 95.61  ? 26  DT  H C5    1 
ATOM   2777  C C7    . DT  E 1 23  ? 28.104  56.760   46.135  1.00 94.60  ? 26  DT  H C7    1 
ATOM   2778  C C6    . DT  E 1 23  ? 29.139  55.765   44.096  1.00 100.28 ? 26  DT  H C6    1 
ATOM   2779  P P     . DT  E 1 24  ? 33.468  56.124   39.148  1.00 154.72 ? 27  DT  H P     1 
ATOM   2780  O OP1   . DT  E 1 24  ? 34.475  55.515   38.240  1.00 149.90 ? 27  DT  H OP1   1 
ATOM   2781  O OP2   . DT  E 1 24  ? 33.744  57.437   39.783  1.00 155.93 ? 27  DT  H OP2   1 
ATOM   2782  O "O5'" . DT  E 1 24  ? 32.090  56.232   38.358  1.00 149.74 ? 27  DT  H "O5'" 1 
ATOM   2783  C "C5'" . DT  E 1 24  ? 31.623  55.139   37.550  1.00 142.02 ? 27  DT  H "C5'" 1 
ATOM   2784  C "C4'" . DT  E 1 24  ? 30.207  55.396   37.093  1.00 139.24 ? 27  DT  H "C4'" 1 
ATOM   2785  O "O4'" . DT  E 1 24  ? 29.364  55.730   38.222  1.00 135.35 ? 27  DT  H "O4'" 1 
ATOM   2786  C "C3'" . DT  E 1 24  ? 30.052  56.547   36.092  1.00 136.57 ? 27  DT  H "C3'" 1 
ATOM   2787  O "O3'" . DT  E 1 24  ? 29.427  56.067   34.899  1.00 146.98 ? 27  DT  H "O3'" 1 
ATOM   2788  C "C2'" . DT  E 1 24  ? 29.144  57.541   36.798  1.00 131.76 ? 27  DT  H "C2'" 1 
ATOM   2789  C "C1'" . DT  E 1 24  ? 28.396  56.657   37.770  1.00 123.71 ? 27  DT  H "C1'" 1 
ATOM   2790  N N1    . DT  E 1 24  ? 27.820  57.337   38.950  1.00 107.72 ? 27  DT  H N1    1 
ATOM   2791  C C2    . DT  E 1 24  ? 26.450  57.473   39.015  1.00 102.97 ? 27  DT  H C2    1 
ATOM   2792  O O2    . DT  E 1 24  ? 25.697  57.075   38.142  1.00 104.69 ? 27  DT  H O2    1 
ATOM   2793  N N3    . DT  E 1 24  ? 25.990  58.099   40.147  1.00 99.05  ? 27  DT  H N3    1 
ATOM   2794  C C4    . DT  E 1 24  ? 26.746  58.591   41.195  1.00 103.23 ? 27  DT  H C4    1 
ATOM   2795  O O4    . DT  E 1 24  ? 26.189  59.133   42.149  1.00 98.36  ? 27  DT  H O4    1 
ATOM   2796  C C5    . DT  E 1 24  ? 28.176  58.410   41.062  1.00 101.99 ? 27  DT  H C5    1 
ATOM   2797  C C7    . DT  E 1 24  ? 29.075  58.909   42.149  1.00 100.08 ? 27  DT  H C7    1 
ATOM   2798  C C6    . DT  E 1 24  ? 28.634  57.799   39.962  1.00 101.05 ? 27  DT  H C6    1 
ATOM   2799  P P     . DT  E 1 25  ? 29.541  56.896   33.538  1.00 156.88 ? 28  DT  H P     1 
ATOM   2800  O OP1   . DT  E 1 25  ? 30.340  56.088   32.579  1.00 154.23 ? 28  DT  H OP1   1 
ATOM   2801  O OP2   . DT  E 1 25  ? 29.970  58.279   33.874  1.00 161.37 ? 28  DT  H OP2   1 
ATOM   2802  O "O5'" . DT  E 1 25  ? 28.035  56.980   33.021  1.00 144.55 ? 28  DT  H "O5'" 1 
ATOM   2803  C "C5'" . DT  E 1 25  ? 27.018  56.057   33.456  1.00 136.82 ? 28  DT  H "C5'" 1 
ATOM   2804  C "C4'" . DT  E 1 25  ? 25.674  56.744   33.513  1.00 134.47 ? 28  DT  H "C4'" 1 
ATOM   2805  O "O4'" . DT  E 1 25  ? 25.480  57.316   34.828  1.00 128.49 ? 28  DT  H "O4'" 1 
ATOM   2806  C "C3'" . DT  E 1 25  ? 25.474  57.889   32.512  1.00 134.96 ? 28  DT  H "C3'" 1 
ATOM   2807  O "O3'" . DT  E 1 25  ? 24.291  57.675   31.736  1.00 136.71 ? 28  DT  H "O3'" 1 
ATOM   2808  C "C2'" . DT  E 1 25  ? 25.348  59.131   33.382  1.00 130.05 ? 28  DT  H "C2'" 1 
ATOM   2809  C "C1'" . DT  E 1 25  ? 24.834  58.566   34.690  1.00 122.69 ? 28  DT  H "C1'" 1 
ATOM   2810  N N1    . DT  E 1 25  ? 25.142  59.364   35.891  1.00 117.36 ? 28  DT  H N1    1 
ATOM   2811  C C2    . DT  E 1 25  ? 24.106  59.748   36.716  1.00 119.60 ? 28  DT  H C2    1 
ATOM   2812  O O2    . DT  E 1 25  ? 22.937  59.483   36.489  1.00 118.91 ? 28  DT  H O2    1 
ATOM   2813  N N3    . DT  E 1 25  ? 24.491  60.469   37.820  1.00 114.58 ? 28  DT  H N3    1 
ATOM   2814  C C4    . DT  E 1 25  ? 25.779  60.829   38.175  1.00 116.76 ? 28  DT  H C4    1 
ATOM   2815  O O4    . DT  E 1 25  ? 25.972  61.479   39.199  1.00 118.22 ? 28  DT  H O4    1 
ATOM   2816  C C5    . DT  E 1 25  ? 26.816  60.384   37.269  1.00 113.38 ? 28  DT  H C5    1 
ATOM   2817  C C7    . DT  E 1 25  ? 28.241  60.725   37.573  1.00 108.34 ? 28  DT  H C7    1 
ATOM   2818  C C6    . DT  E 1 25  ? 26.450  59.681   36.189  1.00 112.61 ? 28  DT  H C6    1 
ATOM   2819  O "O5'" . DA  F 2 1   ? 18.346  61.861   46.168  1.00 124.66 ? 29  DA  I "O5'" 1 
ATOM   2820  C "C5'" . DA  F 2 1   ? 16.969  62.228   45.944  1.00 123.55 ? 29  DA  I "C5'" 1 
ATOM   2821  C "C4'" . DA  F 2 1   ? 16.662  62.231   44.464  1.00 119.74 ? 29  DA  I "C4'" 1 
ATOM   2822  O "O4'" . DA  F 2 1   ? 17.817  62.712   43.736  1.00 109.00 ? 29  DA  I "O4'" 1 
ATOM   2823  C "C3'" . DA  F 2 1   ? 16.319  60.863   43.871  1.00 122.40 ? 29  DA  I "C3'" 1 
ATOM   2824  O "O3'" . DA  F 2 1   ? 15.173  60.934   43.014  1.00 130.89 ? 29  DA  I "O3'" 1 
ATOM   2825  C "C2'" . DA  F 2 1   ? 17.572  60.473   43.108  1.00 113.73 ? 29  DA  I "C2'" 1 
ATOM   2826  C "C1'" . DA  F 2 1   ? 18.179  61.803   42.712  1.00 100.24 ? 29  DA  I "C1'" 1 
ATOM   2827  N N9    . DA  F 2 1   ? 19.639  61.775   42.635  1.00 88.64  ? 29  DA  I N9    1 
ATOM   2828  C C8    . DA  F 2 1   ? 20.533  61.970   43.662  1.00 85.89  ? 29  DA  I C8    1 
ATOM   2829  N N7    . DA  F 2 1   ? 21.788  61.872   43.295  1.00 80.30  ? 29  DA  I N7    1 
ATOM   2830  C C5    . DA  F 2 1   ? 21.718  61.583   41.939  1.00 77.50  ? 29  DA  I C5    1 
ATOM   2831  C C6    . DA  F 2 1   ? 22.710  61.356   40.969  1.00 78.19  ? 29  DA  I C6    1 
ATOM   2832  N N6    . DA  F 2 1   ? 24.019  61.382   41.231  1.00 78.83  ? 29  DA  I N6    1 
ATOM   2833  N N1    . DA  F 2 1   ? 22.306  61.090   39.705  1.00 77.12  ? 29  DA  I N1    1 
ATOM   2834  C C2    . DA  F 2 1   ? 20.990  61.059   39.446  1.00 80.93  ? 29  DA  I C2    1 
ATOM   2835  N N3    . DA  F 2 1   ? 19.962  61.259   40.274  1.00 79.11  ? 29  DA  I N3    1 
ATOM   2836  C C4    . DA  F 2 1   ? 20.400  61.518   41.519  1.00 80.98  ? 29  DA  I C4    1 
ATOM   2837  P P     . DA  F 2 2   ? 14.404  59.591   42.589  1.00 135.22 ? 30  DA  I P     1 
ATOM   2838  O OP1   . DA  F 2 2   ? 13.127  59.979   41.938  1.00 127.79 ? 30  DA  I OP1   1 
ATOM   2839  O OP2   . DA  F 2 2   ? 14.378  58.682   43.764  1.00 134.37 ? 30  DA  I OP2   1 
ATOM   2840  O "O5'" . DA  F 2 2   ? 15.370  58.957   41.492  1.00 119.76 ? 30  DA  I "O5'" 1 
ATOM   2841  C "C5'" . DA  F 2 2   ? 15.435  59.504   40.165  1.00 118.92 ? 30  DA  I "C5'" 1 
ATOM   2842  C "C4'" . DA  F 2 2   ? 16.206  58.580   39.253  1.00 120.22 ? 30  DA  I "C4'" 1 
ATOM   2843  O "O4'" . DA  F 2 2   ? 17.626  58.759   39.475  1.00 116.58 ? 30  DA  I "O4'" 1 
ATOM   2844  C "C3'" . DA  F 2 2   ? 15.928  57.089   39.454  1.00 120.32 ? 30  DA  I "C3'" 1 
ATOM   2845  O "O3'" . DA  F 2 2   ? 15.814  56.424   38.188  1.00 122.30 ? 30  DA  I "O3'" 1 
ATOM   2846  C "C2'" . DA  F 2 2   ? 17.120  56.616   40.268  1.00 118.72 ? 30  DA  I "C2'" 1 
ATOM   2847  C "C1'" . DA  F 2 2   ? 18.235  57.510   39.756  1.00 108.26 ? 30  DA  I "C1'" 1 
ATOM   2848  N N9    . DA  F 2 2   ? 19.325  57.750   40.701  1.00 96.26  ? 30  DA  I N9    1 
ATOM   2849  C C8    . DA  F 2 2   ? 19.237  58.012   42.047  1.00 89.85  ? 30  DA  I C8    1 
ATOM   2850  N N7    . DA  F 2 2   ? 20.399  58.197   42.626  1.00 82.26  ? 30  DA  I N7    1 
ATOM   2851  C C5    . DA  F 2 2   ? 21.314  58.049   41.593  1.00 83.72  ? 30  DA  I C5    1 
ATOM   2852  C C6    . DA  F 2 2   ? 22.719  58.124   41.553  1.00 85.09  ? 30  DA  I C6    1 
ATOM   2853  N N6    . DA  F 2 2   ? 23.477  58.383   42.621  1.00 89.50  ? 30  DA  I N6    1 
ATOM   2854  N N1    . DA  F 2 2   ? 23.326  57.924   40.362  1.00 81.74  ? 30  DA  I N1    1 
ATOM   2855  C C2    . DA  F 2 2   ? 22.565  57.665   39.289  1.00 85.99  ? 30  DA  I C2    1 
ATOM   2856  N N3    . DA  F 2 2   ? 21.237  57.570   39.200  1.00 85.85  ? 30  DA  I N3    1 
ATOM   2857  C C4    . DA  F 2 2   ? 20.666  57.774   40.401  1.00 88.29  ? 30  DA  I C4    1 
ATOM   2858  P P     . DA  F 2 3   ? 15.496  54.857   38.128  1.00 123.16 ? 31  DA  I P     1 
ATOM   2859  O OP1   . DA  F 2 3   ? 14.652  54.599   36.933  1.00 119.31 ? 31  DA  I OP1   1 
ATOM   2860  O OP2   . DA  F 2 3   ? 15.017  54.437   39.471  1.00 125.14 ? 31  DA  I OP2   1 
ATOM   2861  O "O5'" . DA  F 2 3   ? 16.927  54.219   37.841  1.00 115.00 ? 31  DA  I "O5'" 1 
ATOM   2862  C "C5'" . DA  F 2 3   ? 17.552  54.385   36.557  1.00 112.44 ? 31  DA  I "C5'" 1 
ATOM   2863  C "C4'" . DA  F 2 3   ? 19.005  53.980   36.627  1.00 120.37 ? 31  DA  I "C4'" 1 
ATOM   2864  O "O4'" . DA  F 2 3   ? 19.639  54.607   37.761  1.00 120.90 ? 31  DA  I "O4'" 1 
ATOM   2865  C "C3'" . DA  F 2 3   ? 19.252  52.477   36.796  1.00 123.30 ? 31  DA  I "C3'" 1 
ATOM   2866  O "O3'" . DA  F 2 3   ? 19.696  51.895   35.564  1.00 129.37 ? 31  DA  I "O3'" 1 
ATOM   2867  C "C2'" . DA  F 2 3   ? 20.327  52.387   37.871  1.00 119.21 ? 31  DA  I "C2'" 1 
ATOM   2868  C "C1'" . DA  F 2 3   ? 20.764  53.822   38.097  1.00 113.56 ? 31  DA  I "C1'" 1 
ATOM   2869  N N9    . DA  F 2 3   ? 21.138  54.133   39.477  1.00 105.29 ? 31  DA  I N9    1 
ATOM   2870  C C8    . DA  F 2 3   ? 20.301  54.313   40.552  1.00 99.84  ? 31  DA  I C8    1 
ATOM   2871  N N7    . DA  F 2 3   ? 20.929  54.586   41.670  1.00 94.73  ? 31  DA  I N7    1 
ATOM   2872  C C5    . DA  F 2 3   ? 22.270  54.581   41.310  1.00 95.80  ? 31  DA  I C5    1 
ATOM   2873  C C6    . DA  F 2 3   ? 23.448  54.799   42.048  1.00 91.92  ? 31  DA  I C6    1 
ATOM   2874  N N6    . DA  F 2 3   ? 23.460  55.076   43.353  1.00 89.44  ? 31  DA  I N6    1 
ATOM   2875  N N1    . DA  F 2 3   ? 24.626  54.724   41.388  1.00 89.13  ? 31  DA  I N1    1 
ATOM   2876  C C2    . DA  F 2 3   ? 24.610  54.449   40.076  1.00 91.74  ? 31  DA  I C2    1 
ATOM   2877  N N3    . DA  F 2 3   ? 23.568  54.221   39.275  1.00 94.44  ? 31  DA  I N3    1 
ATOM   2878  C C4    . DA  F 2 3   ? 22.414  54.302   39.962  1.00 99.51  ? 31  DA  I C4    1 
ATOM   2879  P P     . DC  F 2 4   ? 20.011  50.325   35.479  1.00 129.27 ? 32  DC  I P     1 
ATOM   2880  O OP1   . DC  F 2 4   ? 19.923  49.910   34.055  1.00 123.69 ? 32  DC  I OP1   1 
ATOM   2881  O OP2   . DC  F 2 4   ? 19.174  49.637   36.499  1.00 131.92 ? 32  DC  I OP2   1 
ATOM   2882  O "O5'" . DC  F 2 4   ? 21.551  50.244   35.885  1.00 121.11 ? 32  DC  I "O5'" 1 
ATOM   2883  C "C5'" . DC  F 2 4   ? 22.563  50.844   35.055  1.00 116.08 ? 32  DC  I "C5'" 1 
ATOM   2884  C "C4'" . DC  F 2 4   ? 23.873  50.947   35.800  1.00 116.62 ? 32  DC  I "C4'" 1 
ATOM   2885  O "O4'" . DC  F 2 4   ? 23.652  51.422   37.145  1.00 113.27 ? 32  DC  I "O4'" 1 
ATOM   2886  C "C3'" . DC  F 2 4   ? 24.645  49.631   35.937  1.00 118.50 ? 32  DC  I "C3'" 1 
ATOM   2887  O "O3'" . DC  F 2 4   ? 25.875  49.706   35.213  1.00 124.50 ? 32  DC  I "O3'" 1 
ATOM   2888  C "C2'" . DC  F 2 4   ? 24.899  49.484   37.431  1.00 113.52 ? 32  DC  I "C2'" 1 
ATOM   2889  C "C1'" . DC  F 2 4   ? 24.659  50.875   37.974  1.00 108.58 ? 32  DC  I "C1'" 1 
ATOM   2890  N N1    . DC  F 2 4   ? 24.187  50.944   39.368  1.00 101.74 ? 32  DC  I N1    1 
ATOM   2891  C C2    . DC  F 2 4   ? 25.115  51.154   40.395  1.00 97.45  ? 32  DC  I C2    1 
ATOM   2892  O O2    . DC  F 2 4   ? 26.319  51.242   40.109  1.00 92.72  ? 32  DC  I O2    1 
ATOM   2893  N N3    . DC  F 2 4   ? 24.677  51.254   41.672  1.00 98.02  ? 32  DC  I N3    1 
ATOM   2894  C C4    . DC  F 2 4   ? 23.372  51.151   41.939  1.00 102.94 ? 32  DC  I C4    1 
ATOM   2895  N N4    . DC  F 2 4   ? 22.981  51.247   43.213  1.00 108.02 ? 32  DC  I N4    1 
ATOM   2896  C C5    . DC  F 2 4   ? 22.407  50.942   40.912  1.00 99.32  ? 32  DC  I C5    1 
ATOM   2897  C C6    . DC  F 2 4   ? 22.853  50.850   39.653  1.00 101.30 ? 32  DC  I C6    1 
ATOM   2898  P P     . DG  F 2 5   ? 26.708  48.378   34.921  1.00 128.75 ? 33  DG  I P     1 
ATOM   2899  O OP1   . DG  F 2 5   ? 27.604  48.642   33.764  1.00 122.30 ? 33  DG  I OP1   1 
ATOM   2900  O OP2   . DG  F 2 5   ? 25.749  47.244   34.860  1.00 127.56 ? 33  DG  I OP2   1 
ATOM   2901  O "O5'" . DG  F 2 5   ? 27.603  48.224   36.230  1.00 127.64 ? 33  DG  I "O5'" 1 
ATOM   2902  C "C5'" . DG  F 2 5   ? 28.828  48.964   36.375  1.00 126.70 ? 33  DG  I "C5'" 1 
ATOM   2903  C "C4'" . DG  F 2 5   ? 29.465  48.672   37.714  1.00 128.36 ? 33  DG  I "C4'" 1 
ATOM   2904  O "O4'" . DG  F 2 5   ? 28.554  49.004   38.787  1.00 126.54 ? 33  DG  I "O4'" 1 
ATOM   2905  C "C3'" . DG  F 2 5   ? 29.869  47.212   37.930  1.00 124.76 ? 33  DG  I "C3'" 1 
ATOM   2906  O "O3'" . DG  F 2 5   ? 31.262  47.150   38.249  1.00 131.04 ? 33  DG  I "O3'" 1 
ATOM   2907  C "C2'" . DG  F 2 5   ? 28.991  46.743   39.080  1.00 118.48 ? 33  DG  I "C2'" 1 
ATOM   2908  C "C1'" . DG  F 2 5   ? 28.663  48.028   39.806  1.00 112.63 ? 33  DG  I "C1'" 1 
ATOM   2909  N N9    . DG  F 2 5   ? 27.413  48.039   40.559  1.00 100.56 ? 33  DG  I N9    1 
ATOM   2910  C C8    . DG  F 2 5   ? 26.146  47.857   40.058  1.00 98.19  ? 33  DG  I C8    1 
ATOM   2911  N N7    . DG  F 2 5   ? 25.214  47.971   40.966  1.00 87.95  ? 33  DG  I N7    1 
ATOM   2912  C C5    . DG  F 2 5   ? 25.905  48.265   42.133  1.00 83.95  ? 33  DG  I C5    1 
ATOM   2913  C C6    . DG  F 2 5   ? 25.427  48.503   43.450  1.00 79.17  ? 33  DG  I C6    1 
ATOM   2914  O O6    . DG  F 2 5   ? 24.259  48.501   43.858  1.00 78.00  ? 33  DG  I O6    1 
ATOM   2915  N N1    . DG  F 2 5   ? 26.470  48.761   44.333  1.00 72.47  ? 33  DG  I N1    1 
ATOM   2916  C C2    . DG  F 2 5   ? 27.803  48.785   43.997  1.00 78.77  ? 33  DG  I C2    1 
ATOM   2917  N N2    . DG  F 2 5   ? 28.661  49.052   44.993  1.00 82.17  ? 33  DG  I N2    1 
ATOM   2918  N N3    . DG  F 2 5   ? 28.261  48.570   42.772  1.00 78.33  ? 33  DG  I N3    1 
ATOM   2919  C C4    . DG  F 2 5   ? 27.264  48.318   41.898  1.00 87.41  ? 33  DG  I C4    1 
ATOM   2920  P P     . DA  F 2 6   ? 32.192  46.071   37.532  1.00 142.98 ? 34  DA  I P     1 
ATOM   2921  O OP1   . DA  F 2 6   ? 33.578  46.245   38.039  1.00 132.36 ? 34  DA  I OP1   1 
ATOM   2922  O OP2   . DA  F 2 6   ? 31.935  46.148   36.069  1.00 140.22 ? 34  DA  I OP2   1 
ATOM   2923  O "O5'" . DA  F 2 6   ? 31.591  44.696   38.070  1.00 150.05 ? 34  DA  I "O5'" 1 
ATOM   2924  C "C5'" . DA  F 2 6   ? 32.355  43.807   38.909  1.00 147.80 ? 34  DA  I "C5'" 1 
ATOM   2925  C "C4'" . DA  F 2 6   ? 32.622  44.423   40.265  1.00 144.90 ? 34  DA  I "C4'" 1 
ATOM   2926  O "O4'" . DA  F 2 6   ? 31.456  45.136   40.745  1.00 134.77 ? 34  DA  I "O4'" 1 
ATOM   2927  C "C3'" . DA  F 2 6   ? 32.981  43.411   41.353  1.00 144.67 ? 34  DA  I "C3'" 1 
ATOM   2928  O "O3'" . DA  F 2 6   ? 34.099  43.876   42.116  1.00 152.98 ? 34  DA  I "O3'" 1 
ATOM   2929  C "C2'" . DA  F 2 6   ? 31.716  43.305   42.185  1.00 135.41 ? 34  DA  I "C2'" 1 
ATOM   2930  C "C1'" . DA  F 2 6   ? 31.089  44.675   42.038  1.00 121.26 ? 34  DA  I "C1'" 1 
ATOM   2931  N N9    . DA  F 2 6   ? 29.628  44.674   42.114  1.00 100.46 ? 34  DA  I N9    1 
ATOM   2932  C C8    . DA  F 2 6   ? 28.742  44.348   41.115  1.00 90.52  ? 34  DA  I C8    1 
ATOM   2933  N N7    . DA  F 2 6   ? 27.485  44.457   41.469  1.00 81.48  ? 34  DA  I N7    1 
ATOM   2934  C C5    . DA  F 2 6   ? 27.545  44.874   42.791  1.00 80.08  ? 34  DA  I C5    1 
ATOM   2935  C C6    . DA  F 2 6   ? 26.544  45.167   43.738  1.00 76.82  ? 34  DA  I C6    1 
ATOM   2936  N N6    . DA  F 2 6   ? 25.235  45.075   43.483  1.00 71.08  ? 34  DA  I N6    1 
ATOM   2937  N N1    . DA  F 2 6   ? 26.939  45.558   44.972  1.00 75.16  ? 34  DA  I N1    1 
ATOM   2938  C C2    . DA  F 2 6   ? 28.254  45.649   45.224  1.00 82.40  ? 34  DA  I C2    1 
ATOM   2939  N N3    . DA  F 2 6   ? 29.288  45.399   44.417  1.00 84.69  ? 34  DA  I N3    1 
ATOM   2940  C C4    . DA  F 2 6   ? 28.860  45.010   43.203  1.00 87.29  ? 34  DA  I C4    1 
ATOM   2941  P P     . DC  F 2 7   ? 35.172  42.836   42.689  1.00 157.09 ? 35  DC  I P     1 
ATOM   2942  O OP1   . DC  F 2 7   ? 36.503  43.496   42.679  1.00 161.11 ? 35  DC  I OP1   1 
ATOM   2943  O OP2   . DC  F 2 7   ? 34.996  41.543   41.978  1.00 145.48 ? 35  DC  I OP2   1 
ATOM   2944  O "O5'" . DC  F 2 7   ? 34.722  42.677   44.208  1.00 147.69 ? 35  DC  I "O5'" 1 
ATOM   2945  C "C5'" . DC  F 2 7   ? 33.780  41.667   44.602  1.00 137.75 ? 35  DC  I "C5'" 1 
ATOM   2946  C "C4'" . DC  F 2 7   ? 33.067  42.094   45.864  1.00 136.32 ? 35  DC  I "C4'" 1 
ATOM   2947  O "O4'" . DC  F 2 7   ? 31.799  42.705   45.527  1.00 127.91 ? 35  DC  I "O4'" 1 
ATOM   2948  C "C3'" . DC  F 2 7   ? 32.760  40.941   46.824  1.00 139.89 ? 35  DC  I "C3'" 1 
ATOM   2949  O "O3'" . DC  F 2 7   ? 33.260  41.167   48.145  1.00 151.10 ? 35  DC  I "O3'" 1 
ATOM   2950  C "C2'" . DC  F 2 7   ? 31.246  40.846   46.830  1.00 132.36 ? 35  DC  I "C2'" 1 
ATOM   2951  C "C1'" . DC  F 2 7   ? 30.781  42.212   46.379  1.00 119.72 ? 35  DC  I "C1'" 1 
ATOM   2952  N N1    . DC  F 2 7   ? 29.535  42.132   45.605  1.00 101.20 ? 35  DC  I N1    1 
ATOM   2953  C C2    . DC  F 2 7   ? 28.319  42.429   46.233  1.00 92.18  ? 35  DC  I C2    1 
ATOM   2954  O O2    . DC  F 2 7   ? 28.330  42.807   47.415  1.00 86.80  ? 35  DC  I O2    1 
ATOM   2955  N N3    . DC  F 2 7   ? 27.167  42.315   45.532  1.00 81.89  ? 35  DC  I N3    1 
ATOM   2956  C C4    . DC  F 2 7   ? 27.199  41.913   44.257  1.00 83.89  ? 35  DC  I C4    1 
ATOM   2957  N N4    . DC  F 2 7   ? 26.042  41.825   43.597  1.00 75.89  ? 35  DC  I N4    1 
ATOM   2958  C C5    . DC  F 2 7   ? 28.422  41.586   43.601  1.00 90.05  ? 35  DC  I C5    1 
ATOM   2959  C C6    . DC  F 2 7   ? 29.553  41.694   44.309  1.00 92.76  ? 35  DC  I C6    1 
ATOM   2960  P P     . DA  F 2 8   ? 33.294  39.959   49.199  1.00 154.79 ? 36  DA  I P     1 
ATOM   2961  O OP1   . DA  F 2 8   ? 34.241  40.317   50.288  1.00 155.04 ? 36  DA  I OP1   1 
ATOM   2962  O OP2   . DA  F 2 8   ? 33.483  38.693   48.445  1.00 154.16 ? 36  DA  I OP2   1 
ATOM   2963  O "O5'" . DA  F 2 8   ? 31.816  39.962   49.792  1.00 148.36 ? 36  DA  I "O5'" 1 
ATOM   2964  C "C5'" . DA  F 2 8   ? 31.324  41.068   50.571  1.00 140.30 ? 36  DA  I "C5'" 1 
ATOM   2965  C "C4'" . DA  F 2 8   ? 29.994  40.710   51.193  1.00 137.31 ? 36  DA  I "C4'" 1 
ATOM   2966  O "O4'" . DA  F 2 8   ? 28.965  40.728   50.173  1.00 131.88 ? 36  DA  I "O4'" 1 
ATOM   2967  C "C3'" . DA  F 2 8   ? 29.935  39.318   51.827  1.00 136.29 ? 36  DA  I "C3'" 1 
ATOM   2968  O "O3'" . DA  F 2 8   ? 29.181  39.373   53.044  1.00 142.01 ? 36  DA  I "O3'" 1 
ATOM   2969  C "C2'" . DA  F 2 8   ? 29.270  38.473   50.753  1.00 130.56 ? 36  DA  I "C2'" 1 
ATOM   2970  C "C1'" . DA  F 2 8   ? 28.316  39.465   50.111  1.00 122.99 ? 36  DA  I "C1'" 1 
ATOM   2971  N N9    . DA  F 2 8   ? 27.985  39.199   48.711  1.00 105.68 ? 36  DA  I N9    1 
ATOM   2972  C C8    . DA  F 2 8   ? 28.832  38.902   47.670  1.00 99.95  ? 36  DA  I C8    1 
ATOM   2973  N N7    . DA  F 2 8   ? 28.220  38.728   46.523  1.00 89.70  ? 36  DA  I N7    1 
ATOM   2974  C C5    . DA  F 2 8   ? 26.879  38.916   46.830  1.00 89.14  ? 36  DA  I C5    1 
ATOM   2975  C C6    . DA  F 2 8   ? 25.711  38.863   46.046  1.00 88.79  ? 36  DA  I C6    1 
ATOM   2976  N N6    . DA  F 2 8   ? 25.708  38.591   44.738  1.00 86.14  ? 36  DA  I N6    1 
ATOM   2977  N N1    . DA  F 2 8   ? 24.531  39.099   46.661  1.00 87.03  ? 36  DA  I N1    1 
ATOM   2978  C C2    . DA  F 2 8   ? 24.534  39.375   47.973  1.00 90.91  ? 36  DA  I C2    1 
ATOM   2979  N N3    . DA  F 2 8   ? 25.565  39.454   48.815  1.00 91.92  ? 36  DA  I N3    1 
ATOM   2980  C C4    . DA  F 2 8   ? 26.721  39.211   48.172  1.00 93.74  ? 36  DA  I C4    1 
ATOM   2981  P P     . DT  F 2 9   ? 29.002  38.063   53.951  1.00 143.48 ? 37  DT  I P     1 
ATOM   2982  O OP1   . DT  F 2 9   ? 29.122  38.470   55.375  1.00 135.03 ? 37  DT  I OP1   1 
ATOM   2983  O OP2   . DT  F 2 9   ? 29.889  36.999   53.410  1.00 140.87 ? 37  DT  I OP2   1 
ATOM   2984  O "O5'" . DT  F 2 9   ? 27.481  37.662   53.700  1.00 134.60 ? 37  DT  I "O5'" 1 
ATOM   2985  C "C5'" . DT  F 2 9   ? 26.419  38.517   54.163  1.00 125.41 ? 37  DT  I "C5'" 1 
ATOM   2986  C "C4'" . DT  F 2 9   ? 25.102  38.109   53.545  1.00 120.60 ? 37  DT  I "C4'" 1 
ATOM   2987  O "O4'" . DT  F 2 9   ? 25.228  38.002   52.115  1.00 112.72 ? 37  DT  I "O4'" 1 
ATOM   2988  C "C3'" . DT  F 2 9   ? 24.568  36.753   54.009  1.00 118.90 ? 37  DT  I "C3'" 1 
ATOM   2989  O "O3'" . DT  F 2 9   ? 23.591  36.986   55.027  1.00 128.63 ? 37  DT  I "O3'" 1 
ATOM   2990  C "C2'" . DT  F 2 9   ? 24.024  36.104   52.740  1.00 108.38 ? 37  DT  I "C2'" 1 
ATOM   2991  C "C1'" . DT  F 2 9   ? 24.185  37.165   51.666  1.00 100.87 ? 37  DT  I "C1'" 1 
ATOM   2992  N N1    . DT  F 2 9   ? 24.551  36.661   50.328  1.00 89.13  ? 37  DT  I N1    1 
ATOM   2993  C C2    . DT  F 2 9   ? 23.544  36.447   49.409  1.00 86.73  ? 37  DT  I C2    1 
ATOM   2994  O O2    . DT  F 2 9   ? 22.362  36.632   49.656  1.00 83.77  ? 37  DT  I O2    1 
ATOM   2995  N N3    . DT  F 2 9   ? 23.974  35.997   48.184  1.00 80.48  ? 37  DT  I N3    1 
ATOM   2996  C C4    . DT  F 2 9   ? 25.279  35.753   47.795  1.00 80.23  ? 37  DT  I C4    1 
ATOM   2997  O O4    . DT  F 2 9   ? 25.513  35.354   46.656  1.00 77.00  ? 37  DT  I O4    1 
ATOM   2998  C C5    . DT  F 2 9   ? 26.282  36.003   48.806  1.00 80.85  ? 37  DT  I C5    1 
ATOM   2999  C C7    . DT  F 2 9   ? 27.722  35.764   48.475  1.00 80.28  ? 37  DT  I C7    1 
ATOM   3000  C C6    . DT  F 2 9   ? 25.874  36.440   50.005  1.00 81.41  ? 37  DT  I C6    1 
ATOM   3001  P P     . DT  F 2 10  ? 22.627  35.809   55.501  1.00 133.89 ? 38  DT  I P     1 
ATOM   3002  O OP1   . DT  F 2 10  ? 22.325  36.003   56.944  1.00 131.87 ? 38  DT  I OP1   1 
ATOM   3003  O OP2   . DT  F 2 10  ? 23.206  34.522   55.029  1.00 133.93 ? 38  DT  I OP2   1 
ATOM   3004  O "O5'" . DT  F 2 10  ? 21.290  36.117   54.697  1.00 121.64 ? 38  DT  I "O5'" 1 
ATOM   3005  C "C5'" . DT  F 2 10  ? 20.208  35.182   54.711  1.00 113.25 ? 38  DT  I "C5'" 1 
ATOM   3006  C "C4'" . DT  F 2 10  ? 19.451  35.232   53.405  1.00 105.20 ? 38  DT  I "C4'" 1 
ATOM   3007  O "O4'" . DT  F 2 10  ? 20.357  35.188   52.272  1.00 94.50  ? 38  DT  I "O4'" 1 
ATOM   3008  C "C3'" . DT  F 2 10  ? 18.480  34.065   53.221  1.00 99.15  ? 38  DT  I "C3'" 1 
ATOM   3009  O "O3'" . DT  F 2 10  ? 17.196  34.598   52.898  1.00 101.14 ? 38  DT  I "O3'" 1 
ATOM   3010  C "C2'" . DT  F 2 10  ? 19.124  33.228   52.127  1.00 95.25  ? 38  DT  I "C2'" 1 
ATOM   3011  C "C1'" . DT  F 2 10  ? 19.844  34.278   51.315  1.00 88.39  ? 38  DT  I "C1'" 1 
ATOM   3012  N N1    . DT  F 2 10  ? 20.973  33.793   50.493  1.00 79.29  ? 38  DT  I N1    1 
ATOM   3013  C C2    . DT  F 2 10  ? 20.768  33.630   49.141  1.00 81.69  ? 38  DT  I C2    1 
ATOM   3014  O O2    . DT  F 2 10  ? 19.693  33.837   48.600  1.00 90.94  ? 38  DT  I O2    1 
ATOM   3015  N N3    . DT  F 2 10  ? 21.871  33.205   48.440  1.00 76.81  ? 38  DT  I N3    1 
ATOM   3016  C C4    . DT  F 2 10  ? 23.128  32.936   48.947  1.00 74.67  ? 38  DT  I C4    1 
ATOM   3017  O O4    . DT  F 2 10  ? 24.025  32.562   48.194  1.00 70.98  ? 38  DT  I O4    1 
ATOM   3018  C C5    . DT  F 2 10  ? 23.271  33.126   50.373  1.00 75.38  ? 38  DT  I C5    1 
ATOM   3019  C C7    . DT  F 2 10  ? 24.599  32.862   51.010  1.00 77.47  ? 38  DT  I C7    1 
ATOM   3020  C C6    . DT  F 2 10  ? 22.202  33.542   51.065  1.00 75.52  ? 38  DT  I C6    1 
ATOM   3021  P P     . DT  F 2 11  ? 15.877  33.754   53.194  1.00 112.95 ? 39  DT  I P     1 
ATOM   3022  O OP1   . DT  F 2 11  ? 14.925  34.620   53.935  1.00 114.15 ? 39  DT  I OP1   1 
ATOM   3023  O OP2   . DT  F 2 11  ? 16.286  32.453   53.784  1.00 120.01 ? 39  DT  I OP2   1 
ATOM   3024  O "O5'" . DT  F 2 11  ? 15.297  33.518   51.730  1.00 109.43 ? 39  DT  I "O5'" 1 
ATOM   3025  C "C5'" . DT  F 2 11  ? 16.198  33.264   50.639  1.00 105.54 ? 39  DT  I "C5'" 1 
ATOM   3026  C "C4'" . DT  F 2 11  ? 15.437  33.035   49.356  1.00 109.38 ? 39  DT  I "C4'" 1 
ATOM   3027  O "O4'" . DT  F 2 11  ? 16.378  32.742   48.300  1.00 111.15 ? 39  DT  I "O4'" 1 
ATOM   3028  C "C3'" . DT  F 2 11  ? 14.491  31.843   49.385  1.00 109.24 ? 39  DT  I "C3'" 1 
ATOM   3029  O "O3'" . DT  F 2 11  ? 13.422  32.088   48.465  1.00 112.49 ? 39  DT  I "O3'" 1 
ATOM   3030  C "C2'" . DT  F 2 11  ? 15.395  30.694   48.978  1.00 108.59 ? 39  DT  I "C2'" 1 
ATOM   3031  C "C1'" . DT  F 2 11  ? 16.365  31.351   47.997  1.00 105.63 ? 39  DT  I "C1'" 1 
ATOM   3032  N N1    . DT  F 2 11  ? 17.764  30.872   48.043  1.00 100.90 ? 39  DT  I N1    1 
ATOM   3033  C C2    . DT  F 2 11  ? 18.410  30.637   46.849  1.00 102.72 ? 39  DT  I C2    1 
ATOM   3034  O O2    . DT  F 2 11  ? 17.875  30.779   45.761  1.00 115.26 ? 39  DT  I O2    1 
ATOM   3035  N N3    . DT  F 2 11  ? 19.713  30.222   46.973  1.00 94.73  ? 39  DT  I N3    1 
ATOM   3036  C C4    . DT  F 2 11  ? 20.421  30.036   48.145  1.00 95.09  ? 39  DT  I C4    1 
ATOM   3037  O O4    . DT  F 2 11  ? 21.590  29.661   48.100  1.00 88.16  ? 39  DT  I O4    1 
ATOM   3038  C C5    . DT  F 2 11  ? 19.685  30.311   49.361  1.00 95.68  ? 39  DT  I C5    1 
ATOM   3039  C C7    . DT  F 2 11  ? 20.368  30.132   50.680  1.00 93.40  ? 39  DT  I C7    1 
ATOM   3040  C C6    . DT  F 2 11  ? 18.414  30.717   49.249  1.00 96.64  ? 39  DT  I C6    1 
ATOM   3041  P P     . DC  F 2 12  ? 12.015  31.348   48.642  1.00 118.71 ? 40  DC  I P     1 
ATOM   3042  O OP1   . DC  F 2 12  ? 10.981  32.142   47.930  1.00 117.39 ? 40  DC  I OP1   1 
ATOM   3043  O OP2   . DC  F 2 12  ? 11.826  31.050   50.087  1.00 110.77 ? 40  DC  I OP2   1 
ATOM   3044  O "O5'" . DC  F 2 12  ? 12.240  29.995   47.829  1.00 113.13 ? 40  DC  I "O5'" 1 
ATOM   3045  C "C5'" . DC  F 2 12  ? 12.850  29.998   46.521  1.00 106.73 ? 40  DC  I "C5'" 1 
ATOM   3046  C "C4'" . DC  F 2 12  ? 13.212  28.592   46.096  1.00 109.58 ? 40  DC  I "C4'" 1 
ATOM   3047  O "O4'" . DC  F 2 12  ? 14.611  28.333   46.380  1.00 106.69 ? 40  DC  I "O4'" 1 
ATOM   3048  C "C3'" . DC  F 2 12  ? 12.423  27.474   46.790  1.00 111.58 ? 40  DC  I "C3'" 1 
ATOM   3049  O "O3'" . DC  F 2 12  ? 11.970  26.501   45.838  1.00 114.20 ? 40  DC  I "O3'" 1 
ATOM   3050  C "C2'" . DC  F 2 12  ? 13.427  26.885   47.766  1.00 104.72 ? 40  DC  I "C2'" 1 
ATOM   3051  C "C1'" . DC  F 2 12  ? 14.720  27.057   46.990  1.00 100.31 ? 40  DC  I "C1'" 1 
ATOM   3052  N N1    . DC  F 2 12  ? 15.978  27.016   47.762  1.00 87.13  ? 40  DC  I N1    1 
ATOM   3053  C C2    . DC  F 2 12  ? 17.180  26.795   47.076  1.00 85.86  ? 40  DC  I C2    1 
ATOM   3054  O O2    . DC  F 2 12  ? 17.152  26.657   45.844  1.00 84.99  ? 40  DC  I O2    1 
ATOM   3055  N N3    . DC  F 2 12  ? 18.339  26.739   47.773  1.00 80.76  ? 40  DC  I N3    1 
ATOM   3056  C C4    . DC  F 2 12  ? 18.326  26.891   49.100  1.00 86.79  ? 40  DC  I C4    1 
ATOM   3057  N N4    . DC  F 2 12  ? 19.492  26.832   49.748  1.00 89.33  ? 40  DC  I N4    1 
ATOM   3058  C C5    . DC  F 2 12  ? 17.116  27.109   49.823  1.00 83.91  ? 40  DC  I C5    1 
ATOM   3059  C C6    . DC  F 2 12  ? 15.976  27.160   49.122  1.00 82.70  ? 40  DC  I C6    1 
ATOM   3060  P P     . DA  F 2 13  ? 10.413  26.404   45.470  1.00 118.65 ? 41  DA  I P     1 
ATOM   3061  O OP1   . DA  F 2 13  ? 9.872   27.783   45.374  1.00 119.10 ? 41  DA  I OP1   1 
ATOM   3062  O OP2   . DA  F 2 13  ? 9.780   25.437   46.401  1.00 119.49 ? 41  DA  I OP2   1 
ATOM   3063  O "O5'" . DA  F 2 13  ? 10.429  25.818   43.989  1.00 117.73 ? 41  DA  I "O5'" 1 
ATOM   3064  C "C5'" . DA  F 2 13  ? 10.550  24.406   43.735  1.00 116.23 ? 41  DA  I "C5'" 1 
ATOM   3065  C "C4'" . DA  F 2 13  ? 11.633  24.150   42.712  1.00 113.88 ? 41  DA  I "C4'" 1 
ATOM   3066  O "O4'" . DA  F 2 13  ? 12.917  24.506   43.278  1.00 110.69 ? 41  DA  I "O4'" 1 
ATOM   3067  C "C3'" . DA  F 2 13  ? 11.764  22.690   42.284  1.00 112.75 ? 41  DA  I "C3'" 1 
ATOM   3068  O "O3'" . DA  F 2 13  ? 12.188  22.568   40.920  1.00 115.45 ? 41  DA  I "O3'" 1 
ATOM   3069  C "C2'" . DA  F 2 13  ? 12.796  22.150   43.255  1.00 109.66 ? 41  DA  I "C2'" 1 
ATOM   3070  C "C1'" . DA  F 2 13  ? 13.714  23.341   43.472  1.00 102.51 ? 41  DA  I "C1'" 1 
ATOM   3071  N N9    . DA  F 2 13  ? 14.273  23.400   44.821  1.00 91.26  ? 41  DA  I N9    1 
ATOM   3072  C C8    . DA  F 2 13  ? 13.591  23.536   46.006  1.00 90.14  ? 41  DA  I C8    1 
ATOM   3073  N N7    . DA  F 2 13  ? 14.367  23.546   47.063  1.00 83.38  ? 41  DA  I N7    1 
ATOM   3074  C C5    . DA  F 2 13  ? 15.645  23.409   46.539  1.00 80.94  ? 41  DA  I C5    1 
ATOM   3075  C C6    . DA  F 2 13  ? 16.913  23.349   47.145  1.00 81.57  ? 41  DA  I C6    1 
ATOM   3076  N N6    . DA  F 2 13  ? 17.106  23.427   48.465  1.00 76.43  ? 41  DA  I N6    1 
ATOM   3077  N N1    . DA  F 2 13  ? 17.989  23.209   46.337  1.00 79.12  ? 41  DA  I N1    1 
ATOM   3078  C C2    . DA  F 2 13  ? 17.790  23.134   45.012  1.00 81.82  ? 41  DA  I C2    1 
ATOM   3079  N N3    . DA  F 2 13  ? 16.647  23.174   44.327  1.00 77.28  ? 41  DA  I N3    1 
ATOM   3080  C C4    . DA  F 2 13  ? 15.601  23.312   45.159  1.00 79.61  ? 41  DA  I C4    1 
ATOM   3081  P P     . DT  F 2 14  ? 12.312  21.116   40.242  1.00 116.06 ? 42  DT  I P     1 
ATOM   3082  O OP1   . DT  F 2 14  ? 12.505  21.295   38.778  1.00 106.01 ? 42  DT  I OP1   1 
ATOM   3083  O OP2   . DT  F 2 14  ? 11.192  20.275   40.746  1.00 110.82 ? 42  DT  I OP2   1 
ATOM   3084  O "O5'" . DT  F 2 14  ? 13.670  20.555   40.856  1.00 111.97 ? 42  DT  I "O5'" 1 
ATOM   3085  C "C5'" . DT  F 2 14  ? 14.928  20.736   40.182  1.00 109.23 ? 42  DT  I "C5'" 1 
ATOM   3086  C "C4'" . DT  F 2 14  ? 16.004  19.944   40.886  1.00 107.11 ? 42  DT  I "C4'" 1 
ATOM   3087  O "O4'" . DT  F 2 14  ? 16.195  20.470   42.214  1.00 104.28 ? 42  DT  I "O4'" 1 
ATOM   3088  C "C3'" . DT  F 2 14  ? 15.686  18.466   41.109  1.00 104.48 ? 42  DT  I "C3'" 1 
ATOM   3089  O "O3'" . DT  F 2 14  ? 15.881  17.617   39.957  1.00 104.55 ? 42  DT  I "O3'" 1 
ATOM   3090  C "C2'" . DT  F 2 14  ? 16.496  18.121   42.350  1.00 100.69 ? 42  DT  I "C2'" 1 
ATOM   3091  C "C1'" . DT  F 2 14  ? 16.827  19.469   42.999  1.00 95.19  ? 42  DT  I "C1'" 1 
ATOM   3092  N N1    . DT  F 2 14  ? 16.375  19.634   44.402  1.00 83.77  ? 42  DT  I N1    1 
ATOM   3093  C C2    . DT  F 2 14  ? 17.335  19.711   45.389  1.00 84.39  ? 42  DT  I C2    1 
ATOM   3094  O O2    . DT  F 2 14  ? 18.532  19.634   45.164  1.00 85.51  ? 42  DT  I O2    1 
ATOM   3095  N N3    . DT  F 2 14  ? 16.838  19.878   46.659  1.00 82.40  ? 42  DT  I N3    1 
ATOM   3096  C C4    . DT  F 2 14  ? 15.510  19.975   47.030  1.00 82.60  ? 42  DT  I C4    1 
ATOM   3097  O O4    . DT  F 2 14  ? 15.213  20.119   48.215  1.00 84.70  ? 42  DT  I O4    1 
ATOM   3098  C C5    . DT  F 2 14  ? 14.559  19.891   45.945  1.00 78.70  ? 42  DT  I C5    1 
ATOM   3099  C C7    . DT  F 2 14  ? 13.097  19.983   46.253  1.00 76.77  ? 42  DT  I C7    1 
ATOM   3100  C C6    . DT  F 2 14  ? 15.033  19.727   44.702  1.00 77.75  ? 42  DT  I C6    1 
ATOM   3101  P P     . DA  F 2 15  ? 17.334  17.389   39.298  1.00 111.21 ? 43  DA  I P     1 
ATOM   3102  O OP1   . DA  F 2 15  ? 18.126  18.627   39.456  1.00 121.68 ? 43  DA  I OP1   1 
ATOM   3103  O OP2   . DA  F 2 15  ? 17.150  16.796   37.948  1.00 108.57 ? 43  DA  I OP2   1 
ATOM   3104  O "O5'" . DA  F 2 15  ? 17.999  16.284   40.227  1.00 110.70 ? 43  DA  I "O5'" 1 
ATOM   3105  C "C5'" . DA  F 2 15  ? 19.425  16.121   40.254  1.00 108.87 ? 43  DA  I "C5'" 1 
ATOM   3106  C "C4'" . DA  F 2 15  ? 19.827  15.356   41.493  1.00 111.41 ? 43  DA  I "C4'" 1 
ATOM   3107  O "O4'" . DA  F 2 15  ? 19.166  15.918   42.653  1.00 104.70 ? 43  DA  I "O4'" 1 
ATOM   3108  C "C3'" . DA  F 2 15  ? 19.456  13.868   41.468  1.00 109.31 ? 43  DA  I "C3'" 1 
ATOM   3109  O "O3'" . DA  F 2 15  ? 20.618  13.054   41.648  1.00 108.42 ? 43  DA  I "O3'" 1 
ATOM   3110  C "C2'" . DA  F 2 15  ? 18.469  13.708   42.613  1.00 101.17 ? 43  DA  I "C2'" 1 
ATOM   3111  C "C1'" . DA  F 2 15  ? 18.832  14.861   43.524  1.00 93.23  ? 43  DA  I "C1'" 1 
ATOM   3112  N N9    . DA  F 2 15  ? 17.755  15.319   44.398  1.00 82.42  ? 43  DA  I N9    1 
ATOM   3113  C C8    . DA  F 2 15  ? 16.405  15.350   44.141  1.00 81.58  ? 43  DA  I C8    1 
ATOM   3114  N N7    . DA  F 2 15  ? 15.688  15.806   45.139  1.00 75.70  ? 43  DA  I N7    1 
ATOM   3115  C C5    . DA  F 2 15  ? 16.625  16.084   46.123  1.00 72.29  ? 43  DA  I C5    1 
ATOM   3116  C C6    . DA  F 2 15  ? 16.502  16.584   47.431  1.00 72.07  ? 43  DA  I C6    1 
ATOM   3117  N N6    . DA  F 2 15  ? 15.334  16.912   47.990  1.00 73.47  ? 43  DA  I N6    1 
ATOM   3118  N N1    . DA  F 2 15  ? 17.634  16.740   48.155  1.00 68.37  ? 43  DA  I N1    1 
ATOM   3119  C C2    . DA  F 2 15  ? 18.805  16.405   47.593  1.00 72.73  ? 43  DA  I C2    1 
ATOM   3120  N N3    . DA  F 2 15  ? 19.047  15.921   46.373  1.00 72.48  ? 43  DA  I N3    1 
ATOM   3121  C C4    . DA  F 2 15  ? 17.902  15.784   45.682  1.00 74.66  ? 43  DA  I C4    1 
ATOM   3122  P P     . DC  F 2 16  ? 20.571  11.503   41.284  1.00 112.10 ? 44  DC  I P     1 
ATOM   3123  O OP1   . DC  F 2 16  ? 21.557  11.256   40.199  1.00 108.56 ? 44  DC  I OP1   1 
ATOM   3124  O OP2   . DC  F 2 16  ? 19.148  11.120   41.067  1.00 112.66 ? 44  DC  I OP2   1 
ATOM   3125  O "O5'" . DC  F 2 16  ? 21.108  10.822   42.622  1.00 102.25 ? 44  DC  I "O5'" 1 
ATOM   3126  C "C5'" . DC  F 2 16  ? 20.215  10.418   43.677  1.00 98.38  ? 44  DC  I "C5'" 1 
ATOM   3127  C "C4'" . DC  F 2 16  ? 20.597  11.105   44.966  1.00 96.33  ? 44  DC  I "C4'" 1 
ATOM   3128  O "O4'" . DC  F 2 16  ? 19.714  12.216   45.212  1.00 91.04  ? 44  DC  I "O4'" 1 
ATOM   3129  C "C3'" . DC  F 2 16  ? 20.474  10.251   46.222  1.00 100.12 ? 44  DC  I "C3'" 1 
ATOM   3130  O "O3'" . DC  F 2 16  ? 21.608  9.397    46.408  1.00 106.45 ? 44  DC  I "O3'" 1 
ATOM   3131  C "C2'" . DC  F 2 16  ? 20.350  11.298   47.315  1.00 91.12  ? 44  DC  I "C2'" 1 
ATOM   3132  C "C1'" . DC  F 2 16  ? 19.689  12.486   46.612  1.00 83.20  ? 44  DC  I "C1'" 1 
ATOM   3133  N N1    . DC  F 2 16  ? 18.294  12.735   47.003  1.00 71.80  ? 44  DC  I N1    1 
ATOM   3134  C C2    . DC  F 2 16  ? 18.029  13.148   48.314  1.00 73.56  ? 44  DC  I C2    1 
ATOM   3135  O O2    . DC  F 2 16  ? 18.976  13.270   49.108  1.00 74.13  ? 44  DC  I O2    1 
ATOM   3136  N N3    . DC  F 2 16  ? 16.749  13.395   48.684  1.00 69.08  ? 44  DC  I N3    1 
ATOM   3137  C C4    . DC  F 2 16  ? 15.759  13.241   47.801  1.00 70.56  ? 44  DC  I C4    1 
ATOM   3138  N N4    . DC  F 2 16  ? 14.513  13.489   48.209  1.00 70.56  ? 44  DC  I N4    1 
ATOM   3139  C C5    . DC  F 2 16  ? 16.002  12.824   46.459  1.00 68.76  ? 44  DC  I C5    1 
ATOM   3140  C C6    . DC  F 2 16  ? 17.273  12.586   46.106  1.00 69.21  ? 44  DC  I C6    1 
ATOM   3141  P P     . DT  F 2 17  ? 21.464  8.056    47.271  1.00 107.89 ? 45  DT  I P     1 
ATOM   3142  O OP1   . DT  F 2 17  ? 22.786  7.378    47.280  1.00 99.84  ? 45  DT  I OP1   1 
ATOM   3143  O OP2   . DT  F 2 17  ? 20.257  7.330    46.801  1.00 103.39 ? 45  DT  I OP2   1 
ATOM   3144  O "O5'" . DT  F 2 17  ? 21.116  8.595    48.727  1.00 93.24  ? 45  DT  I "O5'" 1 
ATOM   3145  C "C5'" . DT  F 2 17  ? 22.134  8.696    49.729  1.00 96.94  ? 45  DT  I "C5'" 1 
ATOM   3146  C "C4'" . DT  F 2 17  ? 21.532  9.256    50.994  1.00 101.34 ? 45  DT  I "C4'" 1 
ATOM   3147  O "O4'" . DT  F 2 17  ? 20.501  10.200   50.640  1.00 99.19  ? 45  DT  I "O4'" 1 
ATOM   3148  C "C3'" . DT  F 2 17  ? 20.830  8.226    51.869  1.00 106.37 ? 45  DT  I "C3'" 1 
ATOM   3149  O "O3'" . DT  F 2 17  ? 21.750  7.601    52.770  1.00 111.41 ? 45  DT  I "O3'" 1 
ATOM   3150  C "C2'" . DT  F 2 17  ? 19.779  9.052    52.592  1.00 100.95 ? 45  DT  I "C2'" 1 
ATOM   3151  C "C1'" . DT  F 2 17  ? 19.493  10.213   51.644  1.00 93.16  ? 45  DT  I "C1'" 1 
ATOM   3152  N N1    . DT  F 2 17  ? 18.182  10.182   50.967  1.00 83.20  ? 45  DT  I N1    1 
ATOM   3153  C C2    . DT  F 2 17  ? 17.072  10.599   51.669  1.00 83.52  ? 45  DT  I C2    1 
ATOM   3154  O O2    . DT  F 2 17  ? 17.113  10.949   52.838  1.00 83.09  ? 45  DT  I O2    1 
ATOM   3155  N N3    . DT  F 2 17  ? 15.900  10.578   50.951  1.00 80.64  ? 45  DT  I N3    1 
ATOM   3156  C C4    . DT  F 2 17  ? 15.735  10.191   49.633  1.00 81.18  ? 45  DT  I C4    1 
ATOM   3157  O O4    . DT  F 2 17  ? 14.618  10.216   49.124  1.00 79.61  ? 45  DT  I O4    1 
ATOM   3158  C C5    . DT  F 2 17  ? 16.943  9.773    48.957  1.00 82.79  ? 45  DT  I C5    1 
ATOM   3159  C C7    . DT  F 2 17  ? 16.862  9.335    47.529  1.00 84.31  ? 45  DT  I C7    1 
ATOM   3160  C C6    . DT  F 2 17  ? 18.090  9.793    49.648  1.00 81.22  ? 45  DT  I C6    1 
ATOM   3161  P P     . DT  F 2 18  ? 21.340  6.244    53.508  1.00 117.87 ? 46  DT  I P     1 
ATOM   3162  O OP1   . DT  F 2 18  ? 22.526  5.754    54.257  1.00 117.98 ? 46  DT  I OP1   1 
ATOM   3163  O OP2   . DT  F 2 18  ? 20.675  5.360    52.514  1.00 119.20 ? 46  DT  I OP2   1 
ATOM   3164  O "O5'" . DT  F 2 18  ? 20.220  6.715    54.537  1.00 103.37 ? 46  DT  I "O5'" 1 
ATOM   3165  C "C5'" . DT  F 2 18  ? 20.569  7.334    55.782  1.00 107.98 ? 46  DT  I "C5'" 1 
ATOM   3166  C "C4'" . DT  F 2 18  ? 19.323  7.567    56.603  1.00 114.16 ? 46  DT  I "C4'" 1 
ATOM   3167  O "O4'" . DT  F 2 18  ? 18.285  8.128    55.762  1.00 114.36 ? 46  DT  I "O4'" 1 
ATOM   3168  C "C3'" . DT  F 2 18  ? 18.719  6.309    57.229  1.00 115.07 ? 46  DT  I "C3'" 1 
ATOM   3169  O "O3'" . DT  F 2 18  ? 18.217  6.621    58.535  1.00 118.46 ? 46  DT  I "O3'" 1 
ATOM   3170  C "C2'" . DT  F 2 18  ? 17.626  5.927    56.248  1.00 113.75 ? 46  DT  I "C2'" 1 
ATOM   3171  C "C1'" . DT  F 2 18  ? 17.141  7.282    55.759  1.00 107.89 ? 46  DT  I "C1'" 1 
ATOM   3172  N N1    . DT  F 2 18  ? 16.576  7.298    54.393  1.00 96.21  ? 46  DT  I N1    1 
ATOM   3173  C C2    . DT  F 2 18  ? 15.326  7.845    54.201  1.00 86.17  ? 46  DT  I C2    1 
ATOM   3174  O O2    . DT  F 2 18  ? 14.646  8.295    55.108  1.00 84.26  ? 46  DT  I O2    1 
ATOM   3175  N N3    . DT  F 2 18  ? 14.891  7.832    52.899  1.00 80.21  ? 46  DT  I N3    1 
ATOM   3176  C C4    . DT  F 2 18  ? 15.572  7.350    51.796  1.00 82.93  ? 46  DT  I C4    1 
ATOM   3177  O O4    . DT  F 2 18  ? 15.057  7.413    50.685  1.00 82.15  ? 46  DT  I O4    1 
ATOM   3178  C C5    . DT  F 2 18  ? 16.878  6.797    52.071  1.00 85.78  ? 46  DT  I C5    1 
ATOM   3179  C C7    . DT  F 2 18  ? 17.686  6.245    50.939  1.00 87.23  ? 46  DT  I C7    1 
ATOM   3180  C C6    . DT  F 2 18  ? 17.309  6.799    53.338  1.00 89.96  ? 46  DT  I C6    1 
ATOM   3181  P P     . DG  F 2 19  ? 17.449  5.517    59.395  1.00 124.77 ? 47  DG  I P     1 
ATOM   3182  O OP1   . DG  F 2 19  ? 17.634  5.841    60.833  1.00 122.65 ? 47  DG  I OP1   1 
ATOM   3183  O OP2   . DG  F 2 19  ? 17.850  4.180    58.884  1.00 126.71 ? 47  DG  I OP2   1 
ATOM   3184  O "O5'" . DG  F 2 19  ? 15.921  5.807    59.053  1.00 121.40 ? 47  DG  I "O5'" 1 
ATOM   3185  C "C5'" . DG  F 2 19  ? 15.336  7.082    59.376  1.00 128.75 ? 47  DG  I "C5'" 1 
ATOM   3186  C "C4'" . DG  F 2 19  ? 13.828  6.988    59.388  1.00 129.95 ? 47  DG  I "C4'" 1 
ATOM   3187  O "O4'" . DG  F 2 19  ? 13.329  7.052    58.030  1.00 126.36 ? 47  DG  I "O4'" 1 
ATOM   3188  C "C3'" . DG  F 2 19  ? 13.275  5.689    59.972  1.00 130.86 ? 47  DG  I "C3'" 1 
ATOM   3189  O "O3'" . DG  F 2 19  ? 12.051  5.949    60.668  1.00 138.00 ? 47  DG  I "O3'" 1 
ATOM   3190  C "C2'" . DG  F 2 19  ? 13.056  4.832    58.741  1.00 124.82 ? 47  DG  I "C2'" 1 
ATOM   3191  C "C1'" . DG  F 2 19  ? 12.603  5.868    57.729  1.00 119.19 ? 47  DG  I "C1'" 1 
ATOM   3192  N N9    . DG  F 2 19  ? 12.866  5.520    56.337  1.00 104.70 ? 47  DG  I N9    1 
ATOM   3193  C C8    . DG  F 2 19  ? 14.012  4.964    55.819  1.00 99.68  ? 47  DG  I C8    1 
ATOM   3194  N N7    . DG  F 2 19  ? 13.948  4.768    54.530  1.00 94.09  ? 47  DG  I N7    1 
ATOM   3195  C C5    . DG  F 2 19  ? 12.685  5.222    54.176  1.00 91.42  ? 47  DG  I C5    1 
ATOM   3196  C C6    . DG  F 2 19  ? 12.044  5.262    52.910  1.00 91.65  ? 47  DG  I C6    1 
ATOM   3197  O O6    . DG  F 2 19  ? 12.481  4.892    51.813  1.00 92.07  ? 47  DG  I O6    1 
ATOM   3198  N N1    . DG  F 2 19  ? 10.762  5.798    53.002  1.00 89.30  ? 47  DG  I N1    1 
ATOM   3199  C C2    . DG  F 2 19  ? 10.172  6.238    54.162  1.00 89.72  ? 47  DG  I C2    1 
ATOM   3200  N N2    . DG  F 2 19  ? 8.928   6.727    54.046  1.00 86.69  ? 47  DG  I N2    1 
ATOM   3201  N N3    . DG  F 2 19  ? 10.758  6.204    55.349  1.00 87.86  ? 47  DG  I N3    1 
ATOM   3202  C C4    . DG  F 2 19  ? 12.004  5.687    55.281  1.00 91.67  ? 47  DG  I C4    1 
ATOM   3203  P P     . DT  F 2 20  ? 11.458  4.855    61.669  1.00 141.99 ? 48  DT  I P     1 
ATOM   3204  O OP1   . DT  F 2 20  ? 10.163  5.358    62.192  1.00 137.13 ? 48  DT  I OP1   1 
ATOM   3205  O OP2   . DT  F 2 20  ? 12.534  4.472    62.619  1.00 142.63 ? 48  DT  I OP2   1 
ATOM   3206  O "O5'" . DT  F 2 20  ? 11.191  3.615    60.707  1.00 137.18 ? 48  DT  I "O5'" 1 
ATOM   3207  C "C5'" . DT  F 2 20  ? 9.908   2.979    60.652  1.00 130.69 ? 48  DT  I "C5'" 1 
ATOM   3208  C "C4'" . DT  F 2 20  ? 8.943   3.783    59.811  1.00 121.31 ? 48  DT  I "C4'" 1 
ATOM   3209  O "O4'" . DT  F 2 20  ? 9.529   4.083    58.517  1.00 114.48 ? 48  DT  I "O4'" 1 
ATOM   3210  C "C3'" . DT  F 2 20  ? 7.646   3.032    59.518  1.00 116.20 ? 48  DT  I "C3'" 1 
ATOM   3211  O "O3'" . DT  F 2 20  ? 6.512   3.897    59.535  1.00 111.64 ? 48  DT  I "O3'" 1 
ATOM   3212  C "C2'" . DT  F 2 20  ? 7.872   2.483    58.126  1.00 113.62 ? 48  DT  I "C2'" 1 
ATOM   3213  C "C1'" . DT  F 2 20  ? 8.675   3.596    57.490  1.00 107.58 ? 48  DT  I "C1'" 1 
ATOM   3214  N N1    . DT  F 2 20  ? 9.511   3.146    56.359  1.00 96.94  ? 48  DT  I N1    1 
ATOM   3215  C C2    . DT  F 2 20  ? 8.987   3.272    55.092  1.00 93.37  ? 48  DT  I C2    1 
ATOM   3216  O O2    . DT  F 2 20  ? 7.890   3.758    54.870  1.00 97.18  ? 48  DT  I O2    1 
ATOM   3217  N N3    . DT  F 2 20  ? 9.805   2.820    54.085  1.00 85.81  ? 48  DT  I N3    1 
ATOM   3218  C C4    . DT  F 2 20  ? 11.059  2.254    54.219  1.00 83.65  ? 48  DT  I C4    1 
ATOM   3219  O O4    . DT  F 2 20  ? 11.680  1.898    53.220  1.00 76.63  ? 48  DT  I O4    1 
ATOM   3220  C C5    . DT  F 2 20  ? 11.540  2.135    55.579  1.00 83.44  ? 48  DT  I C5    1 
ATOM   3221  C C7    . DT  F 2 20  ? 12.887  1.532    55.823  1.00 81.69  ? 48  DT  I C7    1 
ATOM   3222  C C6    . DT  F 2 20  ? 10.748  2.573    56.568  1.00 87.76  ? 48  DT  I C6    1 
ATOM   3223  P P     . DA  F 2 21  ? 5.062   3.268    59.702  1.00 116.11 ? 49  DA  I P     1 
ATOM   3224  O OP1   . DA  F 2 21  ? 4.110   4.368    60.000  1.00 119.16 ? 49  DA  I OP1   1 
ATOM   3225  O OP2   . DA  F 2 21  ? 5.175   2.124    60.642  1.00 118.26 ? 49  DA  I OP2   1 
ATOM   3226  O "O5'" . DA  F 2 21  ? 4.725   2.738    58.236  1.00 113.54 ? 49  DA  I "O5'" 1 
ATOM   3227  C "C5'" . DA  F 2 21  ? 4.639   3.651    57.122  1.00 112.49 ? 49  DA  I "C5'" 1 
ATOM   3228  C "C4'" . DA  F 2 21  ? 3.543   3.259    56.156  1.00 110.41 ? 49  DA  I "C4'" 1 
ATOM   3229  O "O4'" . DA  F 2 21  ? 4.128   2.744    54.939  1.00 107.16 ? 49  DA  I "O4'" 1 
ATOM   3230  C "C3'" . DA  F 2 21  ? 2.579   2.169    56.615  1.00 105.57 ? 49  DA  I "C3'" 1 
ATOM   3231  O "O3'" . DA  F 2 21  ? 1.331   2.387    55.941  1.00 107.09 ? 49  DA  I "O3'" 1 
ATOM   3232  C "C2'" . DA  F 2 21  ? 3.295   0.899    56.188  1.00 102.39 ? 49  DA  I "C2'" 1 
ATOM   3233  C "C1'" . DA  F 2 21  ? 4.049   1.321    54.923  1.00 97.55  ? 49  DA  I "C1'" 1 
ATOM   3234  N N9    . DA  F 2 21  ? 5.412   0.803    54.794  1.00 84.62  ? 49  DA  I N9    1 
ATOM   3235  C C8    . DA  F 2 21  ? 6.320   0.531    55.788  1.00 79.21  ? 49  DA  I C8    1 
ATOM   3236  N N7    . DA  F 2 21  ? 7.475   0.098    55.345  1.00 72.04  ? 49  DA  I N7    1 
ATOM   3237  C C5    . DA  F 2 21  ? 7.321   0.092    53.966  1.00 71.90  ? 49  DA  I C5    1 
ATOM   3238  C C6    . DA  F 2 21  ? 8.187   -0.273   52.920  1.00 71.48  ? 49  DA  I C6    1 
ATOM   3239  N N6    . DA  F 2 21  ? 9.433   -0.714   53.111  1.00 68.96  ? 49  DA  I N6    1 
ATOM   3240  N N1    . DA  F 2 21  ? 7.722   -0.170   51.654  1.00 70.84  ? 49  DA  I N1    1 
ATOM   3241  C C2    . DA  F 2 21  ? 6.471   0.276    51.464  1.00 74.98  ? 49  DA  I C2    1 
ATOM   3242  N N3    . DA  F 2 21  ? 5.564   0.649    52.367  1.00 76.75  ? 49  DA  I N3    1 
ATOM   3243  C C4    . DA  F 2 21  ? 6.056   0.527    53.613  1.00 76.78  ? 49  DA  I C4    1 
ATOM   3244  P P     . DC  F 2 22  ? 0.103   1.380    56.136  1.00 104.37 ? 50  DC  I P     1 
ATOM   3245  O OP1   . DC  F 2 22  ? -1.151  2.079    55.740  1.00 96.65  ? 50  DC  I OP1   1 
ATOM   3246  O OP2   . DC  F 2 22  ? 0.215   0.777    57.490  1.00 97.81  ? 50  DC  I OP2   1 
ATOM   3247  O "O5'" . DC  F 2 22  ? 0.383   0.281    55.020  1.00 104.10 ? 50  DC  I "O5'" 1 
ATOM   3248  C "C5'" . DC  F 2 22  ? 0.580   0.650    53.643  1.00 101.67 ? 50  DC  I "C5'" 1 
ATOM   3249  C "C4'" . DC  F 2 22  ? 0.805   -0.589   52.808  1.00 99.78  ? 50  DC  I "C4'" 1 
ATOM   3250  O "O4'" . DC  F 2 22  ? 2.221   -0.902   52.750  1.00 97.54  ? 50  DC  I "O4'" 1 
ATOM   3251  C "C3'" . DC  F 2 22  ? 0.127   -1.844   53.366  1.00 97.49  ? 50  DC  I "C3'" 1 
ATOM   3252  O "O3'" . DC  F 2 22  ? -0.345  -2.692   52.320  1.00 99.76  ? 50  DC  I "O3'" 1 
ATOM   3253  C "C2'" . DC  F 2 22  ? 1.264   -2.556   54.067  1.00 95.69  ? 50  DC  I "C2'" 1 
ATOM   3254  C "C1'" . DC  F 2 22  ? 2.376   -2.267   53.080  1.00 91.83  ? 50  DC  I "C1'" 1 
ATOM   3255  N N1    . DC  F 2 22  ? 3.753   -2.487   53.548  1.00 89.17  ? 50  DC  I N1    1 
ATOM   3256  C C2    . DC  F 2 22  ? 4.748   -2.717   52.594  1.00 86.82  ? 50  DC  I C2    1 
ATOM   3257  O O2    . DC  F 2 22  ? 4.446   -2.675   51.392  1.00 89.65  ? 50  DC  I O2    1 
ATOM   3258  N N3    . DC  F 2 22  ? 6.014   -2.964   53.003  1.00 82.86  ? 50  DC  I N3    1 
ATOM   3259  C C4    . DC  F 2 22  ? 6.297   -3.003   54.307  1.00 89.00  ? 50  DC  I C4    1 
ATOM   3260  N N4    . DC  F 2 22  ? 7.558   -3.245   54.667  1.00 93.80  ? 50  DC  I N4    1 
ATOM   3261  C C5    . DC  F 2 22  ? 5.299   -2.784   55.301  1.00 89.77  ? 50  DC  I C5    1 
ATOM   3262  C C6    . DC  F 2 22  ? 4.051   -2.542   54.882  1.00 91.85  ? 50  DC  I C6    1 
ATOM   3263  P P     . DA  F 2 23  ? -1.675  -2.333   51.544  1.00 102.74 ? 51  DA  I P     1 
ATOM   3264  O OP1   . DA  F 2 23  ? -1.928  -0.885   51.714  1.00 113.61 ? 51  DA  I OP1   1 
ATOM   3265  O OP2   . DA  F 2 23  ? -2.718  -3.295   51.966  1.00 100.32 ? 51  DA  I OP2   1 
ATOM   3266  O "O5'" . DA  F 2 23  ? -1.259  -2.581   50.027  1.00 98.56  ? 51  DA  I "O5'" 1 
ATOM   3267  C "C5'" . DA  F 2 23  ? -1.621  -3.803   49.371  1.00 101.29 ? 51  DA  I "C5'" 1 
ATOM   3268  C "C4'" . DA  F 2 23  ? -0.545  -4.265   48.416  1.00 102.14 ? 51  DA  I "C4'" 1 
ATOM   3269  O "O4'" . DA  F 2 23  ? 0.761   -4.185   49.038  1.00 96.35  ? 51  DA  I "O4'" 1 
ATOM   3270  C "C3'" . DA  F 2 23  ? -0.726  -5.720   47.978  1.00 103.30 ? 51  DA  I "C3'" 1 
ATOM   3271  O "O3'" . DA  F 2 23  ? -0.593  -5.882   46.563  1.00 100.80 ? 51  DA  I "O3'" 1 
ATOM   3272  C "C2'" . DA  F 2 23  ? 0.324   -6.478   48.769  1.00 101.72 ? 51  DA  I "C2'" 1 
ATOM   3273  C "C1'" . DA  F 2 23  ? 1.414   -5.446   48.985  1.00 95.69  ? 51  DA  I "C1'" 1 
ATOM   3274  N N9    . DA  F 2 23  ? 2.145   -5.626   50.238  1.00 86.71  ? 51  DA  I N9    1 
ATOM   3275  C C8    . DA  F 2 23  ? 1.653   -5.529   51.517  1.00 84.40  ? 51  DA  I C8    1 
ATOM   3276  N N7    . DA  F 2 23  ? 2.555   -5.737   52.446  1.00 78.32  ? 51  DA  I N7    1 
ATOM   3277  C C5    . DA  F 2 23  ? 3.715   -5.996   51.732  1.00 77.62  ? 51  DA  I C5    1 
ATOM   3278  C C6    . DA  F 2 23  ? 5.026   -6.303   52.137  1.00 78.04  ? 51  DA  I C6    1 
ATOM   3279  N N6    . DA  F 2 23  ? 5.401   -6.399   53.415  1.00 78.18  ? 51  DA  I N6    1 
ATOM   3280  N N1    . DA  F 2 23  ? 5.950   -6.511   51.172  1.00 77.09  ? 51  DA  I N1    1 
ATOM   3281  C C2    . DA  F 2 23  ? 5.570   -6.420   49.890  1.00 79.22  ? 51  DA  I C2    1 
ATOM   3282  N N3    . DA  F 2 23  ? 4.369   -6.137   49.385  1.00 78.45  ? 51  DA  I N3    1 
ATOM   3283  C C4    . DA  F 2 23  ? 3.476   -5.936   50.370  1.00 80.00  ? 51  DA  I C4    1 
ATOM   3284  P P     . DC  F 2 24  ? -1.288  -7.126   45.850  1.00 100.37 ? 52  DC  I P     1 
ATOM   3285  O OP1   . DC  F 2 24  ? -1.426  -6.813   44.405  1.00 100.18 ? 52  DC  I OP1   1 
ATOM   3286  O OP2   . DC  F 2 24  ? -2.491  -7.499   46.636  1.00 89.22  ? 52  DC  I OP2   1 
ATOM   3287  O "O5'" . DC  F 2 24  ? -0.176  -8.256   45.987  1.00 106.41 ? 52  DC  I "O5'" 1 
ATOM   3288  C "C5'" . DC  F 2 24  ? 1.145   -8.029   45.461  1.00 109.69 ? 52  DC  I "C5'" 1 
ATOM   3289  C "C4'" . DC  F 2 24  ? 2.118   -9.063   45.980  1.00 110.30 ? 52  DC  I "C4'" 1 
ATOM   3290  O "O4'" . DC  F 2 24  ? 2.545   -8.732   47.323  1.00 104.44 ? 52  DC  I "O4'" 1 
ATOM   3291  C "C3'" . DC  F 2 24  ? 1.585   -10.501  46.036  1.00 109.83 ? 52  DC  I "C3'" 1 
ATOM   3292  O "O3'" . DC  F 2 24  ? 2.361   -11.314  45.144  1.00 117.38 ? 52  DC  I "O3'" 1 
ATOM   3293  C "C2'" . DC  F 2 24  ? 1.721   -10.889  47.501  1.00 104.40 ? 52  DC  I "C2'" 1 
ATOM   3294  C "C1'" . DC  F 2 24  ? 2.790   -9.940   48.003  1.00 97.51  ? 52  DC  I "C1'" 1 
ATOM   3295  N N1    . DC  F 2 24  ? 2.752   -9.673   49.451  1.00 91.95  ? 52  DC  I N1    1 
ATOM   3296  C C2    . DC  F 2 24  ? 3.942   -9.760   50.184  1.00 91.24  ? 52  DC  I C2    1 
ATOM   3297  O O2    . DC  F 2 24  ? 4.997   -10.027  49.588  1.00 89.13  ? 52  DC  I O2    1 
ATOM   3298  N N3    . DC  F 2 24  ? 3.913   -9.542   51.520  1.00 84.65  ? 52  DC  I N3    1 
ATOM   3299  C C4    . DC  F 2 24  ? 2.757   -9.257   52.124  1.00 84.62  ? 52  DC  I C4    1 
ATOM   3300  N N4    . DC  F 2 24  ? 2.775   -9.048   53.441  1.00 85.21  ? 52  DC  I N4    1 
ATOM   3301  C C5    . DC  F 2 24  ? 1.529   -9.174   51.404  1.00 86.72  ? 52  DC  I C5    1 
ATOM   3302  C C6    . DC  F 2 24  ? 1.572   -9.389   50.082  1.00 89.35  ? 52  DC  I C6    1 
ATOM   3303  P P     . DC  F 2 25  ? 2.217   -12.915  45.135  1.00 117.08 ? 53  DC  I P     1 
ATOM   3304  O OP1   . DC  F 2 25  ? 2.430   -13.370  43.735  1.00 110.41 ? 53  DC  I OP1   1 
ATOM   3305  O OP2   . DC  F 2 25  ? 0.964   -13.286  45.857  1.00 105.01 ? 53  DC  I OP2   1 
ATOM   3306  O "O5'" . DC  F 2 25  ? 3.467   -13.387  46.006  1.00 99.73  ? 53  DC  I "O5'" 1 
ATOM   3307  C "C5'" . DC  F 2 25  ? 4.788   -12.885  45.716  1.00 93.86  ? 53  DC  I "C5'" 1 
ATOM   3308  C "C4'" . DC  F 2 25  ? 5.842   -13.669  46.464  1.00 88.02  ? 53  DC  I "C4'" 1 
ATOM   3309  O "O4'" . DC  F 2 25  ? 5.891   -13.241  47.845  1.00 81.24  ? 53  DC  I "O4'" 1 
ATOM   3310  C "C3'" . DC  F 2 25  ? 5.624   -15.181  46.497  1.00 88.98  ? 53  DC  I "C3'" 1 
ATOM   3311  O "O3'" . DC  F 2 25  ? 6.857   -15.882  46.320  1.00 96.39  ? 53  DC  I "O3'" 1 
ATOM   3312  C "C2'" . DC  F 2 25  ? 5.050   -15.433  47.877  1.00 84.84  ? 53  DC  I "C2'" 1 
ATOM   3313  C "C1'" . DC  F 2 25  ? 5.667   -14.330  48.720  1.00 75.84  ? 53  DC  I "C1'" 1 
ATOM   3314  N N1    . DC  F 2 25  ? 4.787   -13.860  49.795  1.00 69.67  ? 53  DC  I N1    1 
ATOM   3315  C C2    . DC  F 2 25  ? 5.278   -13.788  51.102  1.00 69.46  ? 53  DC  I C2    1 
ATOM   3316  O O2    . DC  F 2 25  ? 6.452   -14.125  51.323  1.00 68.26  ? 53  DC  I O2    1 
ATOM   3317  N N3    . DC  F 2 25  ? 4.461   -13.357  52.092  1.00 67.08  ? 53  DC  I N3    1 
ATOM   3318  C C4    . DC  F 2 25  ? 3.201   -13.012  51.813  1.00 70.47  ? 53  DC  I C4    1 
ATOM   3319  N N4    . DC  F 2 25  ? 2.428   -12.594  52.817  1.00 74.31  ? 53  DC  I N4    1 
ATOM   3320  C C5    . DC  F 2 25  ? 2.676   -13.083  50.492  1.00 71.60  ? 53  DC  I C5    1 
ATOM   3321  C C6    . DC  F 2 25  ? 3.496   -13.504  49.522  1.00 70.54  ? 53  DC  I C6    1 
ATOM   3322  P P     . DT  F 2 26  ? 6.833   -17.436  45.986  1.00 99.79  ? 54  DT  I P     1 
ATOM   3323  O OP1   . DT  F 2 26  ? 8.133   -17.788  45.361  1.00 97.99  ? 54  DT  I OP1   1 
ATOM   3324  O OP2   . DT  F 2 26  ? 5.557   -17.738  45.283  1.00 94.85  ? 54  DT  I OP2   1 
ATOM   3325  O "O5'" . DT  F 2 26  ? 6.776   -18.100  47.428  1.00 90.39  ? 54  DT  I "O5'" 1 
ATOM   3326  C "C5'" . DT  F 2 26  ? 7.879   -17.951  48.328  1.00 91.38  ? 54  DT  I "C5'" 1 
ATOM   3327  C "C4'" . DT  F 2 26  ? 7.612   -18.723  49.597  1.00 92.34  ? 54  DT  I "C4'" 1 
ATOM   3328  O "O4'" . DT  F 2 26  ? 7.022   -17.857  50.581  1.00 94.42  ? 54  DT  I "O4'" 1 
ATOM   3329  C "C3'" . DT  F 2 26  ? 6.632   -19.888  49.463  1.00 93.30  ? 54  DT  I "C3'" 1 
ATOM   3330  O "O3'" . DT  F 2 26  ? 7.376   -21.080  49.163  1.00 94.03  ? 54  DT  I "O3'" 1 
ATOM   3331  C "C2'" . DT  F 2 26  ? 5.927   -19.921  50.814  1.00 93.49  ? 54  DT  I "C2'" 1 
ATOM   3332  C "C1'" . DT  F 2 26  ? 6.457   -18.695  51.563  1.00 90.76  ? 54  DT  I "C1'" 1 
ATOM   3333  N N1    . DT  F 2 26  ? 5.474   -17.902  52.339  1.00 88.58  ? 54  DT  I N1    1 
ATOM   3334  C C2    . DT  F 2 26  ? 4.321   -17.448  51.733  1.00 88.34  ? 54  DT  I C2    1 
ATOM   3335  O O2    . DT  F 2 26  ? 4.056   -17.654  50.560  1.00 87.60  ? 54  DT  I O2    1 
ATOM   3336  N N3    . DT  F 2 26  ? 3.483   -16.737  52.558  1.00 89.16  ? 54  DT  I N3    1 
ATOM   3337  C C4    . DT  F 2 26  ? 3.684   -16.435  53.893  1.00 99.25  ? 54  DT  I C4    1 
ATOM   3338  O O4    . DT  F 2 26  ? 2.842   -15.782  54.507  1.00 105.45 ? 54  DT  I O4    1 
ATOM   3339  C C5    . DT  F 2 26  ? 4.917   -16.938  54.461  1.00 97.99  ? 54  DT  I C5    1 
ATOM   3340  C C7    . DT  F 2 26  ? 5.222   -16.660  55.901  1.00 98.13  ? 54  DT  I C7    1 
ATOM   3341  C C6    . DT  F 2 26  ? 5.738   -17.634  53.666  1.00 90.22  ? 54  DT  I C6    1 
ATOM   3342  P P     . DG  F 2 27  ? 6.666   -22.366  48.494  1.00 84.24  ? 55  DG  I P     1 
ATOM   3343  O OP1   . DG  F 2 27  ? 7.707   -23.120  47.757  1.00 76.10  ? 55  DG  I OP1   1 
ATOM   3344  O OP2   . DG  F 2 27  ? 5.451   -21.916  47.760  1.00 82.91  ? 55  DG  I OP2   1 
ATOM   3345  O "O5'" . DG  F 2 27  ? 6.230   -23.210  49.770  1.00 77.55  ? 55  DG  I "O5'" 1 
ATOM   3346  C "C5'" . DG  F 2 27  ? 7.235   -23.774  50.624  1.00 82.67  ? 55  DG  I "C5'" 1 
ATOM   3347  C "C4'" . DG  F 2 27  ? 6.650   -24.118  51.972  1.00 89.46  ? 55  DG  I "C4'" 1 
ATOM   3348  O "O4'" . DG  F 2 27  ? 6.170   -22.908  52.599  1.00 94.51  ? 55  DG  I "O4'" 1 
ATOM   3349  C "C3'" . DG  F 2 27  ? 5.454   -25.068  51.956  1.00 92.44  ? 55  DG  I "C3'" 1 
ATOM   3350  O "O3'" . DG  F 2 27  ? 5.864   -26.447  52.026  1.00 89.26  ? 55  DG  I "O3'" 1 
ATOM   3351  C "C2'" . DG  F 2 27  ? 4.704   -24.670  53.217  1.00 92.96  ? 55  DG  I "C2'" 1 
ATOM   3352  C "C1'" . DG  F 2 27  ? 5.028   -23.187  53.398  1.00 93.66  ? 55  DG  I "C1'" 1 
ATOM   3353  N N9    . DG  F 2 27  ? 3.956   -22.286  52.984  1.00 91.64  ? 55  DG  I N9    1 
ATOM   3354  C C8    . DG  F 2 27  ? 3.282   -22.298  51.787  1.00 90.82  ? 55  DG  I C8    1 
ATOM   3355  N N7    . DG  F 2 27  ? 2.357   -21.381  51.712  1.00 89.24  ? 55  DG  I N7    1 
ATOM   3356  C C5    . DG  F 2 27  ? 2.420   -20.727  52.934  1.00 88.69  ? 55  DG  I C5    1 
ATOM   3357  C C6    . DG  F 2 27  ? 1.661   -19.636  53.433  1.00 92.81  ? 55  DG  I C6    1 
ATOM   3358  O O6    . DG  F 2 27  ? 0.748   -19.013  52.877  1.00 92.71  ? 55  DG  I O6    1 
ATOM   3359  N N1    . DG  F 2 27  ? 2.056   -19.284  54.719  1.00 95.66  ? 55  DG  I N1    1 
ATOM   3360  C C2    . DG  F 2 27  ? 3.057   -19.897  55.433  1.00 96.57  ? 55  DG  I C2    1 
ATOM   3361  N N2    . DG  F 2 27  ? 3.291   -19.412  56.662  1.00 99.50  ? 55  DG  I N2    1 
ATOM   3362  N N3    . DG  F 2 27  ? 3.774   -20.912  54.978  1.00 94.96  ? 55  DG  I N3    1 
ATOM   3363  C C4    . DG  F 2 27  ? 3.403   -21.273  53.731  1.00 90.80  ? 55  DG  I C4    1 
ATOM   3364  P P     . DA  F 2 28  ? 5.802   -27.428  50.733  1.00 86.45  ? 56  DA  I P     1 
ATOM   3365  O OP1   . DA  F 2 28  ? 5.826   -28.824  51.226  1.00 96.52  ? 56  DA  I OP1   1 
ATOM   3366  O OP2   . DA  F 2 28  ? 6.825   -26.987  49.753  1.00 84.44  ? 56  DA  I OP2   1 
ATOM   3367  O "O5'" . DA  F 2 28  ? 4.365   -27.156  50.098  1.00 88.92  ? 56  DA  I "O5'" 1 
ATOM   3368  C "C5'" . DA  F 2 28  ? 3.231   -27.999  50.380  1.00 89.20  ? 56  DA  I "C5'" 1 
ATOM   3369  C "C4'" . DA  F 2 28  ? 2.801   -27.813  51.816  1.00 94.48  ? 56  DA  I "C4'" 1 
ATOM   3370  O "O4'" . DA  F 2 28  ? 2.378   -26.450  52.015  1.00 98.09  ? 56  DA  I "O4'" 1 
ATOM   3371  C "C3'" . DA  F 2 28  ? 1.623   -28.677  52.276  1.00 102.24 ? 56  DA  I "C3'" 1 
ATOM   3372  O "O3'" . DA  F 2 28  ? 2.074   -29.770  53.091  1.00 108.11 ? 56  DA  I "O3'" 1 
ATOM   3373  C "C2'" . DA  F 2 28  ? 0.747   -27.722  53.077  1.00 103.26 ? 56  DA  I "C2'" 1 
ATOM   3374  C "C1'" . DA  F 2 28  ? 1.579   -26.453  53.174  1.00 100.80 ? 56  DA  I "C1'" 1 
ATOM   3375  N N9    . DA  F 2 28  ? 0.816   -25.206  53.205  1.00 93.77  ? 56  DA  I N9    1 
ATOM   3376  C C8    . DA  F 2 28  ? -0.038  -24.704  52.256  1.00 92.48  ? 56  DA  I C8    1 
ATOM   3377  N N7    . DA  F 2 28  ? -0.585  -23.560  52.590  1.00 96.26  ? 56  DA  I N7    1 
ATOM   3378  C C5    . DA  F 2 28  ? -0.054  -23.291  53.844  1.00 96.52  ? 56  DA  I C5    1 
ATOM   3379  C C6    . DA  F 2 28  ? -0.239  -22.224  54.741  1.00 100.56 ? 56  DA  I C6    1 
ATOM   3380  N N6    . DA  F 2 28  ? -1.039  -21.184  54.501  1.00 103.30 ? 56  DA  I N6    1 
ATOM   3381  N N1    . DA  F 2 28  ? 0.436   -22.264  55.911  1.00 103.63 ? 56  DA  I N1    1 
ATOM   3382  C C2    . DA  F 2 28  ? 1.238   -23.309  56.154  1.00 101.21 ? 56  DA  I C2    1 
ATOM   3383  N N3    . DA  F 2 28  ? 1.496   -24.368  55.388  1.00 94.13  ? 56  DA  I N3    1 
ATOM   3384  C C4    . DA  F 2 28  ? 0.809   -24.298  54.235  1.00 93.09  ? 56  DA  I C4    1 
ATOM   3385  P P     . DT  F 2 29  ? 1.593   -31.270  52.776  1.00 108.81 ? 57  DT  I P     1 
ATOM   3386  O OP1   . DT  F 2 29  ? 2.457   -32.205  53.548  1.00 110.66 ? 57  DT  I OP1   1 
ATOM   3387  O OP2   . DT  F 2 29  ? 1.459   -31.419  51.299  1.00 94.17  ? 57  DT  I OP2   1 
ATOM   3388  O "O5'" . DT  F 2 29  ? 0.142   -31.329  53.426  1.00 108.52 ? 57  DT  I "O5'" 1 
ATOM   3389  C "C5'" . DT  F 2 29  ? -0.046  -31.207  54.846  1.00 112.73 ? 57  DT  I "C5'" 1 
ATOM   3390  C "C4'" . DT  F 2 29  ? -1.514  -31.017  55.146  1.00 117.97 ? 57  DT  I "C4'" 1 
ATOM   3391  O "O4'" . DT  F 2 29  ? -2.026  -29.918  54.355  1.00 124.40 ? 57  DT  I "O4'" 1 
ATOM   3392  C "C3'" . DT  F 2 29  ? -2.392  -32.220  54.802  1.00 123.33 ? 57  DT  I "C3'" 1 
ATOM   3393  O "O3'" . DT  F 2 29  ? -3.446  -32.355  55.761  1.00 127.96 ? 57  DT  I "O3'" 1 
ATOM   3394  C "C2'" . DT  F 2 29  ? -2.921  -31.885  53.419  1.00 125.58 ? 57  DT  I "C2'" 1 
ATOM   3395  C "C1'" . DT  F 2 29  ? -3.041  -30.371  53.469  1.00 126.60 ? 57  DT  I "C1'" 1 
ATOM   3396  N N1    . DT  F 2 29  ? -2.865  -29.664  52.180  1.00 128.03 ? 57  DT  I N1    1 
ATOM   3397  C C2    . DT  F 2 29  ? -3.745  -28.647  51.886  1.00 129.14 ? 57  DT  I C2    1 
ATOM   3398  O O2    . DT  F 2 29  ? -4.662  -28.325  52.624  1.00 128.87 ? 57  DT  I O2    1 
ATOM   3399  N N3    . DT  F 2 29  ? -3.517  -28.021  50.684  1.00 129.76 ? 57  DT  I N3    1 
ATOM   3400  C C4    . DT  F 2 29  ? -2.517  -28.305  49.771  1.00 131.85 ? 57  DT  I C4    1 
ATOM   3401  O O4    . DT  F 2 29  ? -2.435  -27.657  48.731  1.00 122.64 ? 57  DT  I O4    1 
ATOM   3402  C C5    . DT  F 2 29  ? -1.627  -29.381  50.148  1.00 137.36 ? 57  DT  I C5    1 
ATOM   3403  C C7    . DT  F 2 29  ? -0.516  -29.761  49.220  1.00 140.80 ? 57  DT  I C7    1 
ATOM   3404  C C6    . DT  F 2 29  ? -1.839  -29.994  51.320  1.00 132.81 ? 57  DT  I C6    1 
ATOM   3405  P P     . DA  F 2 30  ? -3.498  -33.636  56.718  1.00 126.64 ? 58  DA  I P     1 
ATOM   3406  O OP1   . DA  F 2 30  ? -4.436  -33.341  57.830  1.00 131.42 ? 58  DA  I OP1   1 
ATOM   3407  O OP2   . DA  F 2 30  ? -2.102  -34.035  57.028  1.00 133.40 ? 58  DA  I OP2   1 
ATOM   3408  O "O5'" . DA  F 2 30  ? -4.172  -34.742  55.792  1.00 130.81 ? 58  DA  I "O5'" 1 
ATOM   3409  C "C5'" . DA  F 2 30  ? -5.526  -34.588  55.335  1.00 141.84 ? 58  DA  I "C5'" 1 
ATOM   3410  C "C4'" . DA  F 2 30  ? -5.721  -35.320  54.028  1.00 151.80 ? 58  DA  I "C4'" 1 
ATOM   3411  O "O4'" . DA  F 2 30  ? -4.857  -34.755  53.012  1.00 159.30 ? 58  DA  I "O4'" 1 
ATOM   3412  C "C3'" . DA  F 2 30  ? -5.404  -36.818  54.078  1.00 160.27 ? 58  DA  I "C3'" 1 
ATOM   3413  O "O3'" . DA  F 2 30  ? -6.481  -37.574  53.513  1.00 171.28 ? 58  DA  I "O3'" 1 
ATOM   3414  C "C2'" . DA  F 2 30  ? -4.137  -36.952  53.250  1.00 159.85 ? 58  DA  I "C2'" 1 
ATOM   3415  C "C1'" . DA  F 2 30  ? -4.278  -35.808  52.266  1.00 159.49 ? 58  DA  I "C1'" 1 
ATOM   3416  N N9    . DA  F 2 30  ? -3.032  -35.315  51.673  1.00 163.73 ? 58  DA  I N9    1 
ATOM   3417  C C8    . DA  F 2 30  ? -1.752  -35.434  52.158  1.00 165.19 ? 58  DA  I C8    1 
ATOM   3418  N N7    . DA  F 2 30  ? -0.843  -34.891  51.385  1.00 168.74 ? 58  DA  I N7    1 
ATOM   3419  C C5    . DA  F 2 30  ? -1.571  -34.380  50.320  1.00 167.26 ? 58  DA  I C5    1 
ATOM   3420  C C6    . DA  F 2 30  ? -1.189  -33.682  49.159  1.00 163.47 ? 58  DA  I C6    1 
ATOM   3421  N N6    . DA  F 2 30  ? 0.074   -33.364  48.867  1.00 159.57 ? 58  DA  I N6    1 
ATOM   3422  N N1    . DA  F 2 30  ? -2.163  -33.316  48.297  1.00 160.51 ? 58  DA  I N1    1 
ATOM   3423  C C2    . DA  F 2 30  ? -3.431  -33.634  48.589  1.00 158.98 ? 58  DA  I C2    1 
ATOM   3424  N N3    . DA  F 2 30  ? -3.914  -34.287  49.646  1.00 161.61 ? 58  DA  I N3    1 
ATOM   3425  C C4    . DA  F 2 30  ? -2.921  -34.636  50.483  1.00 165.71 ? 58  DA  I C4    1 
ATOM   3426  P P     . DG  F 2 31  ? -6.753  -39.080  53.991  1.00 166.12 ? 59  DG  I P     1 
ATOM   3427  O OP1   . DG  F 2 31  ? -7.936  -39.073  54.890  1.00 160.94 ? 59  DG  I OP1   1 
ATOM   3428  O OP2   . DG  F 2 31  ? -5.468  -39.649  54.475  1.00 168.79 ? 59  DG  I OP2   1 
ATOM   3429  O "O5'" . DG  F 2 31  ? -7.155  -39.835  52.645  1.00 176.42 ? 59  DG  I "O5'" 1 
ATOM   3430  C "C5'" . DG  F 2 31  ? -7.261  -39.165  51.368  1.00 179.78 ? 59  DG  I "C5'" 1 
ATOM   3431  C "C4'" . DG  F 2 31  ? -6.458  -39.897  50.315  1.00 185.10 ? 59  DG  I "C4'" 1 
ATOM   3432  O "O4'" . DG  F 2 31  ? -5.098  -39.399  50.320  1.00 185.49 ? 59  DG  I "O4'" 1 
ATOM   3433  C "C3'" . DG  F 2 31  ? -6.356  -41.415  50.499  1.00 186.77 ? 59  DG  I "C3'" 1 
ATOM   3434  O "O3'" . DG  F 2 31  ? -6.467  -42.109  49.251  1.00 179.98 ? 59  DG  I "O3'" 1 
ATOM   3435  C "C2'" . DG  F 2 31  ? -4.979  -41.606  51.108  1.00 186.25 ? 59  DG  I "C2'" 1 
ATOM   3436  C "C1'" . DG  F 2 31  ? -4.185  -40.477  50.470  1.00 186.01 ? 59  DG  I "C1'" 1 
ATOM   3437  N N9    . DG  F 2 31  ? -3.040  -39.994  51.238  1.00 179.63 ? 59  DG  I N9    1 
ATOM   3438  C C8    . DG  F 2 31  ? -2.797  -40.176  52.578  1.00 174.98 ? 59  DG  I C8    1 
ATOM   3439  N N7    . DG  F 2 31  ? -1.687  -39.618  52.977  1.00 174.21 ? 59  DG  I N7    1 
ATOM   3440  C C5    . DG  F 2 31  ? -1.160  -39.039  51.832  1.00 180.10 ? 59  DG  I C5    1 
ATOM   3441  C C6    . DG  F 2 31  ? 0.034   -38.295  51.644  1.00 181.96 ? 59  DG  I C6    1 
ATOM   3442  O O6    . DG  F 2 31  ? 0.895   -37.993  52.481  1.00 176.45 ? 59  DG  I O6    1 
ATOM   3443  N N1    . DG  F 2 31  ? 0.180   -37.887  50.321  1.00 183.54 ? 59  DG  I N1    1 
ATOM   3444  C C2    . DG  F 2 31  ? -0.709  -38.160  49.309  1.00 183.23 ? 59  DG  I C2    1 
ATOM   3445  N N2    . DG  F 2 31  ? -0.392  -37.680  48.097  1.00 183.14 ? 59  DG  I N2    1 
ATOM   3446  N N3    . DG  F 2 31  ? -1.825  -38.853  49.471  1.00 183.15 ? 59  DG  I N3    1 
ATOM   3447  C C4    . DG  F 2 31  ? -1.986  -39.258  50.749  1.00 181.36 ? 59  DG  I C4    1 
ATOM   3448  N N     . PHE G 3 1   ? 74.243  -92.264  10.712  1.00 146.02 ? 4   PHE A N     1 
ATOM   3449  C CA    . PHE G 3 1   ? 74.196  -90.852  11.209  1.00 139.92 ? 4   PHE A CA    1 
ATOM   3450  C C     . PHE G 3 1   ? 72.801  -90.229  11.049  1.00 135.71 ? 4   PHE A C     1 
ATOM   3451  O O     . PHE G 3 1   ? 72.668  -89.055  10.703  1.00 130.60 ? 4   PHE A O     1 
ATOM   3452  C CB    . PHE G 3 1   ? 75.279  -90.002  10.520  1.00 136.80 ? 4   PHE A CB    1 
ATOM   3453  C CG    . PHE G 3 1   ? 75.516  -90.364  9.078   1.00 133.98 ? 4   PHE A CG    1 
ATOM   3454  C CD1   . PHE G 3 1   ? 74.518  -90.180  8.124   1.00 131.34 ? 4   PHE A CD1   1 
ATOM   3455  C CD2   . PHE G 3 1   ? 76.738  -90.893  8.675   1.00 130.04 ? 4   PHE A CD2   1 
ATOM   3456  C CE1   . PHE G 3 1   ? 74.738  -90.512  6.797   1.00 131.88 ? 4   PHE A CE1   1 
ATOM   3457  C CE2   . PHE G 3 1   ? 76.961  -91.229  7.349   1.00 130.56 ? 4   PHE A CE2   1 
ATOM   3458  C CZ    . PHE G 3 1   ? 75.961  -91.038  6.408   1.00 130.91 ? 4   PHE A CZ    1 
ATOM   3459  N N     . VAL G 3 2   ? 71.766  -91.016  11.350  1.00 137.10 ? 5   VAL A N     1 
ATOM   3460  C CA    . VAL G 3 2   ? 70.368  -90.573  11.237  1.00 132.96 ? 5   VAL A CA    1 
ATOM   3461  C C     . VAL G 3 2   ? 69.621  -90.586  12.587  1.00 132.00 ? 5   VAL A C     1 
ATOM   3462  O O     . VAL G 3 2   ? 68.583  -91.236  12.720  1.00 127.78 ? 5   VAL A O     1 
ATOM   3463  C CB    . VAL G 3 2   ? 69.603  -91.446  10.215  1.00 121.67 ? 5   VAL A CB    1 
ATOM   3464  C CG1   . VAL G 3 2   ? 68.260  -90.816  9.848   1.00 119.71 ? 5   VAL A CG1   1 
ATOM   3465  C CG2   . VAL G 3 2   ? 70.452  -91.656  8.971   1.00 120.04 ? 5   VAL A CG2   1 
ATOM   3466  N N     . PRO G 3 3   ? 70.148  -89.866  13.597  1.00 124.64 ? 6   PRO A N     1 
ATOM   3467  C CA    . PRO G 3 3   ? 69.405  -89.704  14.838  1.00 116.37 ? 6   PRO A CA    1 
ATOM   3468  C C     . PRO G 3 3   ? 68.547  -88.452  14.759  1.00 112.55 ? 6   PRO A C     1 
ATOM   3469  O O     . PRO G 3 3   ? 68.764  -87.621  13.879  1.00 109.63 ? 6   PRO A O     1 
ATOM   3470  C CB    . PRO G 3 3   ? 70.511  -89.507  15.861  1.00 123.65 ? 6   PRO A CB    1 
ATOM   3471  C CG    . PRO G 3 3   ? 71.557  -88.750  15.102  1.00 127.34 ? 6   PRO A CG    1 
ATOM   3472  C CD    . PRO G 3 3   ? 71.463  -89.199  13.668  1.00 122.95 ? 6   PRO A CD    1 
ATOM   3473  N N     . ASN G 3 4   ? 67.599  -88.314  15.679  1.00 110.47 ? 7   ASN A N     1 
ATOM   3474  C CA    . ASN G 3 4   ? 66.682  -87.172  15.701  1.00 111.42 ? 7   ASN A CA    1 
ATOM   3475  C C     . ASN G 3 4   ? 65.641  -87.371  16.797  1.00 115.44 ? 7   ASN A C     1 
ATOM   3476  O O     . ASN G 3 4   ? 64.907  -88.357  16.783  1.00 126.04 ? 7   ASN A O     1 
ATOM   3477  C CB    . ASN G 3 4   ? 65.999  -87.004  14.334  1.00 112.37 ? 7   ASN A CB    1 
ATOM   3478  C CG    . ASN G 3 4   ? 64.815  -86.053  14.363  1.00 113.15 ? 7   ASN A CG    1 
ATOM   3479  O OD1   . ASN G 3 4   ? 64.150  -85.882  15.384  1.00 117.66 ? 7   ASN A OD1   1 
ATOM   3480  N ND2   . ASN G 3 4   ? 64.531  -85.444  13.219  1.00 111.06 ? 7   ASN A ND2   1 
ATOM   3481  N N     . LYS G 3 5   ? 65.582  -86.424  17.730  1.00 113.64 ? 8   LYS A N     1 
ATOM   3482  C CA    . LYS G 3 5   ? 64.667  -86.466  18.886  1.00 116.09 ? 8   LYS A CA    1 
ATOM   3483  C C     . LYS G 3 5   ? 63.301  -87.090  18.586  1.00 116.31 ? 8   LYS A C     1 
ATOM   3484  O O     . LYS G 3 5   ? 62.818  -87.941  19.332  1.00 105.00 ? 8   LYS A O     1 
ATOM   3485  C CB    . LYS G 3 5   ? 64.449  -85.055  19.447  1.00 119.77 ? 8   LYS A CB    1 
ATOM   3486  C CG    . LYS G 3 5   ? 65.718  -84.339  19.890  1.00 126.80 ? 8   LYS A CG    1 
ATOM   3487  C CD    . LYS G 3 5   ? 66.290  -83.435  18.804  1.00 131.22 ? 8   LYS A CD    1 
ATOM   3488  C CE    . LYS G 3 5   ? 67.717  -83.018  19.118  1.00 129.27 ? 8   LYS A CE    1 
ATOM   3489  N NZ    . LYS G 3 5   ? 68.281  -82.173  18.031  1.00 125.82 ? 8   LYS A NZ    1 
ATOM   3490  N N     . GLU G 3 6   ? 62.685  -86.655  17.493  1.00 120.11 ? 9   GLU A N     1 
ATOM   3491  C CA    . GLU G 3 6   ? 61.390  -87.178  17.074  1.00 119.79 ? 9   GLU A CA    1 
ATOM   3492  C C     . GLU G 3 6   ? 61.544  -88.627  16.604  1.00 112.69 ? 9   GLU A C     1 
ATOM   3493  O O     . GLU G 3 6   ? 60.795  -89.510  17.024  1.00 107.82 ? 9   GLU A O     1 
ATOM   3494  C CB    . GLU G 3 6   ? 60.813  -86.312  15.948  1.00 126.86 ? 9   GLU A CB    1 
ATOM   3495  C CG    . GLU G 3 6   ? 59.294  -86.304  15.877  1.00 132.76 ? 9   GLU A CG    1 
ATOM   3496  C CD    . GLU G 3 6   ? 58.768  -85.913  14.505  1.00 136.82 ? 9   GLU A CD    1 
ATOM   3497  O OE1   . GLU G 3 6   ? 59.480  -85.202  13.762  1.00 132.47 ? 9   GLU A OE1   1 
ATOM   3498  O OE2   . GLU G 3 6   ? 57.637  -86.322  14.168  1.00 141.38 ? 9   GLU A OE2   1 
ATOM   3499  N N     . GLN G 3 7   ? 62.530  -88.858  15.740  1.00 107.40 ? 10  GLN A N     1 
ATOM   3500  C CA    . GLN G 3 7   ? 62.797  -90.188  15.191  1.00 106.55 ? 10  GLN A CA    1 
ATOM   3501  C C     . GLN G 3 7   ? 63.152  -91.197  16.286  1.00 110.40 ? 10  GLN A C     1 
ATOM   3502  O O     . GLN G 3 7   ? 62.591  -92.292  16.331  1.00 117.67 ? 10  GLN A O     1 
ATOM   3503  C CB    . GLN G 3 7   ? 63.927  -90.127  14.157  1.00 100.40 ? 10  GLN A CB    1 
ATOM   3504  C CG    . GLN G 3 7   ? 63.588  -89.312  12.918  1.00 99.72  ? 10  GLN A CG    1 
ATOM   3505  C CD    . GLN G 3 7   ? 64.632  -89.425  11.820  1.00 99.40  ? 10  GLN A CD    1 
ATOM   3506  O OE1   . GLN G 3 7   ? 64.311  -89.355  10.636  1.00 101.07 ? 10  GLN A OE1   1 
ATOM   3507  N NE2   . GLN G 3 7   ? 65.885  -89.599  12.204  1.00 99.14  ? 10  GLN A NE2   1 
ATOM   3508  N N     . THR G 3 8   ? 64.085  -90.822  17.158  1.00 105.79 ? 11  THR A N     1 
ATOM   3509  C CA    . THR G 3 8   ? 64.487  -91.652  18.295  1.00 100.37 ? 11  THR A CA    1 
ATOM   3510  C C     . THR G 3 8   ? 63.293  -92.085  19.138  1.00 102.16 ? 11  THR A C     1 
ATOM   3511  O O     . THR G 3 8   ? 63.173  -93.252  19.488  1.00 107.99 ? 11  THR A O     1 
ATOM   3512  C CB    . THR G 3 8   ? 65.464  -90.895  19.213  1.00 102.16 ? 11  THR A CB    1 
ATOM   3513  O OG1   . THR G 3 8   ? 66.679  -90.626  18.505  1.00 102.50 ? 11  THR A OG1   1 
ATOM   3514  C CG2   . THR G 3 8   ? 65.780  -91.699  20.473  1.00 101.95 ? 11  THR A CG2   1 
ATOM   3515  N N     . ARG G 3 9   ? 62.422  -91.140  19.473  1.00 108.00 ? 12  ARG A N     1 
ATOM   3516  C CA    . ARG G 3 9   ? 61.225  -91.438  20.260  1.00 114.09 ? 12  ARG A CA    1 
ATOM   3517  C C     . ARG G 3 9   ? 60.288  -92.365  19.506  1.00 111.54 ? 12  ARG A C     1 
ATOM   3518  O O     . ARG G 3 9   ? 59.610  -93.197  20.112  1.00 116.10 ? 12  ARG A O     1 
ATOM   3519  C CB    . ARG G 3 9   ? 60.483  -90.153  20.625  1.00 126.98 ? 12  ARG A CB    1 
ATOM   3520  C CG    . ARG G 3 9   ? 61.239  -89.276  21.609  1.00 133.72 ? 12  ARG A CG    1 
ATOM   3521  C CD    . ARG G 3 9   ? 60.739  -87.843  21.579  1.00 135.37 ? 12  ARG A CD    1 
ATOM   3522  N NE    . ARG G 3 9   ? 61.612  -86.939  22.324  1.00 136.69 ? 12  ARG A NE    1 
ATOM   3523  C CZ    . ARG G 3 9   ? 61.360  -85.648  22.529  1.00 136.45 ? 12  ARG A CZ    1 
ATOM   3524  N NH1   . ARG G 3 9   ? 60.252  -85.091  22.049  1.00 143.52 ? 12  ARG A NH1   1 
ATOM   3525  N NH2   . ARG G 3 9   ? 62.215  -84.911  23.224  1.00 130.69 ? 12  ARG A NH2   1 
ATOM   3526  N N     . THR G 3 10  ? 60.245  -92.208  18.184  1.00 104.26 ? 13  THR A N     1 
ATOM   3527  C CA    . THR G 3 10  ? 59.509  -93.128  17.324  1.00 99.03  ? 13  THR A CA    1 
ATOM   3528  C C     . THR G 3 10  ? 60.074  -94.554  17.429  1.00 97.28  ? 13  THR A C     1 
ATOM   3529  O O     . THR G 3 10  ? 59.317  -95.518  17.486  1.00 96.00  ? 13  THR A O     1 
ATOM   3530  C CB    . THR G 3 10  ? 59.478  -92.619  15.866  1.00 95.05  ? 13  THR A CB    1 
ATOM   3531  O OG1   . THR G 3 10  ? 58.471  -91.608  15.758  1.00 91.34  ? 13  THR A OG1   1 
ATOM   3532  C CG2   . THR G 3 10  ? 59.166  -93.740  14.872  1.00 95.93  ? 13  THR A CG2   1 
ATOM   3533  N N     . VAL G 3 11  ? 61.395  -94.685  17.483  1.00 96.85  ? 14  VAL A N     1 
ATOM   3534  C CA    . VAL G 3 11  ? 62.017  -96.001  17.638  1.00 96.47  ? 14  VAL A CA    1 
ATOM   3535  C C     . VAL G 3 11  ? 61.640  -96.661  18.970  1.00 101.21 ? 14  VAL A C     1 
ATOM   3536  O O     . VAL G 3 11  ? 61.412  -97.867  19.024  1.00 110.86 ? 14  VAL A O     1 
ATOM   3537  C CB    . VAL G 3 11  ? 63.552  -95.932  17.478  1.00 93.68  ? 14  VAL A CB    1 
ATOM   3538  C CG1   . VAL G 3 11  ? 64.201  -97.248  17.869  1.00 93.36  ? 14  VAL A CG1   1 
ATOM   3539  C CG2   . VAL G 3 11  ? 63.913  -95.585  16.040  1.00 94.68  ? 14  VAL A CG2   1 
ATOM   3540  N N     . LEU G 3 12  ? 61.551  -95.882  20.039  1.00 101.16 ? 15  LEU A N     1 
ATOM   3541  C CA    . LEU G 3 12  ? 61.145  -96.444  21.327  1.00 102.35 ? 15  LEU A CA    1 
ATOM   3542  C C     . LEU G 3 12  ? 59.676  -96.879  21.351  1.00 109.33 ? 15  LEU A C     1 
ATOM   3543  O O     . LEU G 3 12  ? 59.318  -97.768  22.120  1.00 106.96 ? 15  LEU A O     1 
ATOM   3544  C CB    . LEU G 3 12  ? 61.445  -95.473  22.468  1.00 100.97 ? 15  LEU A CB    1 
ATOM   3545  C CG    . LEU G 3 12  ? 62.841  -95.613  23.085  1.00 98.25  ? 15  LEU A CG    1 
ATOM   3546  C CD1   . LEU G 3 12  ? 63.933  -95.720  22.035  1.00 94.20  ? 15  LEU A CD1   1 
ATOM   3547  C CD2   . LEU G 3 12  ? 63.108  -94.436  24.008  1.00 98.88  ? 15  LEU A CD2   1 
ATOM   3548  N N     . ILE G 3 13  ? 58.831  -96.267  20.518  1.00 118.99 ? 16  ILE A N     1 
ATOM   3549  C CA    . ILE G 3 13  ? 57.451  -96.745  20.338  1.00 125.41 ? 16  ILE A CA    1 
ATOM   3550  C C     . ILE G 3 13  ? 57.506  -98.144  19.736  1.00 124.39 ? 16  ILE A C     1 
ATOM   3551  O O     . ILE G 3 13  ? 56.721  -99.021  20.104  1.00 138.78 ? 16  ILE A O     1 
ATOM   3552  C CB    . ILE G 3 13  ? 56.615  -95.833  19.401  1.00 133.12 ? 16  ILE A CB    1 
ATOM   3553  C CG1   . ILE G 3 13  ? 56.430  -94.428  20.000  1.00 135.60 ? 16  ILE A CG1   1 
ATOM   3554  C CG2   . ILE G 3 13  ? 55.254  -96.459  19.090  1.00 135.31 ? 16  ILE A CG2   1 
ATOM   3555  C CD1   . ILE G 3 13  ? 55.368  -94.328  21.074  1.00 136.79 ? 16  ILE A CD1   1 
ATOM   3556  N N     . PHE G 3 14  ? 58.442  -98.333  18.808  1.00 119.09 ? 17  PHE A N     1 
ATOM   3557  C CA    . PHE G 3 14  ? 58.635  -99.604  18.107  1.00 119.21 ? 17  PHE A CA    1 
ATOM   3558  C C     . PHE G 3 14  ? 59.078  -100.714 19.056  1.00 116.68 ? 17  PHE A C     1 
ATOM   3559  O O     . PHE G 3 14  ? 58.398  -101.733 19.178  1.00 118.80 ? 17  PHE A O     1 
ATOM   3560  C CB    . PHE G 3 14  ? 59.662  -99.408  16.988  1.00 119.07 ? 17  PHE A CB    1 
ATOM   3561  C CG    . PHE G 3 14  ? 59.919  -100.627 16.156  1.00 112.55 ? 17  PHE A CG    1 
ATOM   3562  C CD1   . PHE G 3 14  ? 58.880  -101.283 15.522  1.00 111.64 ? 17  PHE A CD1   1 
ATOM   3563  C CD2   . PHE G 3 14  ? 61.213  -101.084 15.964  1.00 111.80 ? 17  PHE A CD2   1 
ATOM   3564  C CE1   . PHE G 3 14  ? 59.122  -102.392 14.734  1.00 116.49 ? 17  PHE A CE1   1 
ATOM   3565  C CE2   . PHE G 3 14  ? 61.465  -102.192 15.175  1.00 114.16 ? 17  PHE A CE2   1 
ATOM   3566  C CZ    . PHE G 3 14  ? 60.417  -102.847 14.558  1.00 117.41 ? 17  PHE A CZ    1 
ATOM   3567  N N     . CYS G 3 15  ? 60.202  -100.509 19.737  1.00 112.88 ? 18  CYS A N     1 
ATOM   3568  C CA    . CYS G 3 15  ? 60.695  -101.485 20.714  1.00 111.45 ? 18  CYS A CA    1 
ATOM   3569  C C     . CYS G 3 15  ? 59.626  -101.821 21.753  1.00 114.07 ? 18  CYS A C     1 
ATOM   3570  O O     . CYS G 3 15  ? 59.452  -102.979 22.113  1.00 123.12 ? 18  CYS A O     1 
ATOM   3571  C CB    . CYS G 3 15  ? 61.949  -100.970 21.425  1.00 109.15 ? 18  CYS A CB    1 
ATOM   3572  S SG    . CYS G 3 15  ? 63.398  -100.728 20.363  1.00 110.82 ? 18  CYS A SG    1 
ATOM   3573  N N     . PHE G 3 16  ? 58.906  -100.804 22.218  1.00 121.69 ? 19  PHE A N     1 
ATOM   3574  C CA    . PHE G 3 16  ? 57.828  -100.989 23.190  1.00 122.03 ? 19  PHE A CA    1 
ATOM   3575  C C     . PHE G 3 16  ? 56.720  -101.893 22.642  1.00 129.50 ? 19  PHE A C     1 
ATOM   3576  O O     . PHE G 3 16  ? 56.296  -102.830 23.322  1.00 130.34 ? 19  PHE A O     1 
ATOM   3577  C CB    . PHE G 3 16  ? 57.251  -99.632  23.601  1.00 115.93 ? 19  PHE A CB    1 
ATOM   3578  C CG    . PHE G 3 16  ? 56.221  -99.715  24.686  1.00 112.49 ? 19  PHE A CG    1 
ATOM   3579  C CD1   . PHE G 3 16  ? 56.593  -99.996  25.990  1.00 111.06 ? 19  PHE A CD1   1 
ATOM   3580  C CD2   . PHE G 3 16  ? 54.879  -99.500  24.406  1.00 115.48 ? 19  PHE A CD2   1 
ATOM   3581  C CE1   . PHE G 3 16  ? 55.645  -100.067 26.999  1.00 115.23 ? 19  PHE A CE1   1 
ATOM   3582  C CE2   . PHE G 3 16  ? 53.926  -99.570  25.409  1.00 118.40 ? 19  PHE A CE2   1 
ATOM   3583  C CZ    . PHE G 3 16  ? 54.309  -99.853  26.708  1.00 118.08 ? 19  PHE A CZ    1 
ATOM   3584  N N     . HIS G 3 17  ? 56.263  -101.618 21.419  1.00 130.51 ? 20  HIS A N     1 
ATOM   3585  C CA    . HIS G 3 17  ? 55.255  -102.460 20.761  1.00 132.76 ? 20  HIS A CA    1 
ATOM   3586  C C     . HIS G 3 17  ? 55.784  -103.865 20.415  1.00 135.71 ? 20  HIS A C     1 
ATOM   3587  O O     . HIS G 3 17  ? 54.995  -104.789 20.190  1.00 141.76 ? 20  HIS A O     1 
ATOM   3588  C CB    . HIS G 3 17  ? 54.675  -101.771 19.517  1.00 131.06 ? 20  HIS A CB    1 
ATOM   3589  C CG    . HIS G 3 17  ? 53.472  -100.932 19.807  1.00 136.15 ? 20  HIS A CG    1 
ATOM   3590  N ND1   . HIS G 3 17  ? 53.548  -99.576  20.039  1.00 140.01 ? 20  HIS A ND1   1 
ATOM   3591  C CD2   . HIS G 3 17  ? 52.163  -101.260 19.920  1.00 143.89 ? 20  HIS A CD2   1 
ATOM   3592  C CE1   . HIS G 3 17  ? 52.337  -99.103  20.273  1.00 145.60 ? 20  HIS A CE1   1 
ATOM   3593  N NE2   . HIS G 3 17  ? 51.478  -100.104 20.207  1.00 146.60 ? 20  HIS A NE2   1 
ATOM   3594  N N     . LEU G 3 18  ? 57.111  -104.020 20.378  1.00 129.40 ? 21  LEU A N     1 
ATOM   3595  C CA    . LEU G 3 18  ? 57.747  -105.345 20.346  1.00 124.69 ? 21  LEU A CA    1 
ATOM   3596  C C     . LEU G 3 18  ? 57.999  -105.883 21.759  1.00 121.26 ? 21  LEU A C     1 
ATOM   3597  O O     . LEU G 3 18  ? 58.873  -106.730 21.959  1.00 108.62 ? 21  LEU A O     1 
ATOM   3598  C CB    . LEU G 3 18  ? 59.074  -105.295 19.580  1.00 121.38 ? 21  LEU A CB    1 
ATOM   3599  C CG    . LEU G 3 18  ? 59.016  -104.928 18.098  1.00 124.19 ? 21  LEU A CG    1 
ATOM   3600  C CD1   . LEU G 3 18  ? 60.411  -104.997 17.493  1.00 121.11 ? 21  LEU A CD1   1 
ATOM   3601  C CD2   . LEU G 3 18  ? 58.053  -105.839 17.348  1.00 129.16 ? 21  LEU A CD2   1 
ATOM   3602  N N     . LYS G 3 19  ? 57.242  -105.370 22.730  1.00 126.68 ? 22  LYS A N     1 
ATOM   3603  C CA    . LYS G 3 19  ? 57.296  -105.799 24.135  1.00 128.75 ? 22  LYS A CA    1 
ATOM   3604  C C     . LYS G 3 19  ? 58.709  -106.127 24.651  1.00 119.39 ? 22  LYS A C     1 
ATOM   3605  O O     . LYS G 3 19  ? 58.877  -107.026 25.474  1.00 116.01 ? 22  LYS A O     1 
ATOM   3606  C CB    . LYS G 3 19  ? 56.324  -106.974 24.368  1.00 135.11 ? 22  LYS A CB    1 
ATOM   3607  C CG    . LYS G 3 19  ? 54.857  -106.632 24.094  1.00 142.72 ? 22  LYS A CG    1 
ATOM   3608  C CD    . LYS G 3 19  ? 54.006  -107.870 23.825  1.00 146.47 ? 22  LYS A CD    1 
ATOM   3609  C CE    . LYS G 3 19  ? 52.643  -107.506 23.248  1.00 147.18 ? 22  LYS A CE    1 
ATOM   3610  N NZ    . LYS G 3 19  ? 51.921  -108.692 22.706  1.00 144.98 ? 22  LYS A NZ    1 
ATOM   3611  N N     . LYS G 3 20  ? 59.707  -105.377 24.174  1.00 112.53 ? 23  LYS A N     1 
ATOM   3612  C CA    . LYS G 3 20  ? 61.077  -105.460 24.689  1.00 110.25 ? 23  LYS A CA    1 
ATOM   3613  C C     . LYS G 3 20  ? 61.201  -104.608 25.946  1.00 109.23 ? 23  LYS A C     1 
ATOM   3614  O O     . LYS G 3 20  ? 60.282  -103.859 26.286  1.00 107.19 ? 23  LYS A O     1 
ATOM   3615  C CB    . LYS G 3 20  ? 62.086  -104.970 23.651  1.00 111.15 ? 23  LYS A CB    1 
ATOM   3616  C CG    . LYS G 3 20  ? 62.155  -105.821 22.394  1.00 121.08 ? 23  LYS A CG    1 
ATOM   3617  C CD    . LYS G 3 20  ? 63.392  -105.483 21.569  1.00 126.64 ? 23  LYS A CD    1 
ATOM   3618  C CE    . LYS G 3 20  ? 63.320  -106.058 20.158  1.00 132.21 ? 23  LYS A CE    1 
ATOM   3619  N NZ    . LYS G 3 20  ? 63.334  -107.548 20.122  1.00 136.73 ? 23  LYS A NZ    1 
ATOM   3620  N N     . THR G 3 21  ? 62.336  -104.716 26.632  1.00 112.09 ? 24  THR A N     1 
ATOM   3621  C CA    . THR G 3 21  ? 62.557  -103.946 27.858  1.00 116.67 ? 24  THR A CA    1 
ATOM   3622  C C     . THR G 3 21  ? 63.245  -102.625 27.552  1.00 120.85 ? 24  THR A C     1 
ATOM   3623  O O     . THR G 3 21  ? 63.863  -102.456 26.494  1.00 117.38 ? 24  THR A O     1 
ATOM   3624  C CB    . THR G 3 21  ? 63.395  -104.711 28.907  1.00 115.72 ? 24  THR A CB    1 
ATOM   3625  O OG1   . THR G 3 21  ? 64.768  -104.754 28.505  1.00 111.27 ? 24  THR A OG1   1 
ATOM   3626  C CG2   . THR G 3 21  ? 62.868  -106.128 29.098  1.00 120.16 ? 24  THR A CG2   1 
ATOM   3627  N N     . ALA G 3 22  ? 63.129  -101.694 28.494  1.00 121.63 ? 25  ALA A N     1 
ATOM   3628  C CA    . ALA G 3 22  ? 63.707  -100.366 28.348  1.00 121.11 ? 25  ALA A CA    1 
ATOM   3629  C C     . ALA G 3 22  ? 65.217  -100.441 28.093  1.00 116.53 ? 25  ALA A C     1 
ATOM   3630  O O     . ALA G 3 22  ? 65.712  -99.917  27.092  1.00 109.55 ? 25  ALA A O     1 
ATOM   3631  C CB    . ALA G 3 22  ? 63.408  -99.532  29.584  1.00 123.82 ? 25  ALA A CB    1 
ATOM   3632  N N     . ALA G 3 23  ? 65.937  -101.117 28.986  1.00 115.91 ? 26  ALA A N     1 
ATOM   3633  C CA    . ALA G 3 23  ? 67.388  -101.280 28.842  1.00 114.26 ? 26  ALA A CA    1 
ATOM   3634  C C     . ALA G 3 23  ? 67.779  -102.089 27.598  1.00 111.56 ? 26  ALA A C     1 
ATOM   3635  O O     . ALA G 3 23  ? 68.896  -101.949 27.093  1.00 97.59  ? 26  ALA A O     1 
ATOM   3636  C CB    . ALA G 3 23  ? 67.981  -101.913 30.091  1.00 111.01 ? 26  ALA A CB    1 
ATOM   3637  N N     . GLU G 3 24  ? 66.868  -102.936 27.117  1.00 116.80 ? 27  GLU A N     1 
ATOM   3638  C CA    . GLU G 3 24  ? 67.063  -103.633 25.840  1.00 124.48 ? 27  GLU A CA    1 
ATOM   3639  C C     . GLU G 3 24  ? 67.082  -102.634 24.699  1.00 116.98 ? 27  GLU A C     1 
ATOM   3640  O O     . GLU G 3 24  ? 68.049  -102.563 23.941  1.00 111.87 ? 27  GLU A O     1 
ATOM   3641  C CB    . GLU G 3 24  ? 65.963  -104.678 25.583  1.00 136.12 ? 27  GLU A CB    1 
ATOM   3642  C CG    . GLU G 3 24  ? 66.437  -106.120 25.679  1.00 141.97 ? 27  GLU A CG    1 
ATOM   3643  C CD    . GLU G 3 24  ? 65.292  -107.113 25.765  1.00 148.53 ? 27  GLU A CD    1 
ATOM   3644  O OE1   . GLU G 3 24  ? 64.295  -106.948 25.028  1.00 155.22 ? 27  GLU A OE1   1 
ATOM   3645  O OE2   . GLU G 3 24  ? 65.394  -108.065 26.568  1.00 151.56 ? 27  GLU A OE2   1 
ATOM   3646  N N     . SER G 3 25  ? 66.002  -101.865 24.590  1.00 110.10 ? 28  SER A N     1 
ATOM   3647  C CA    . SER G 3 25  ? 65.853  -100.882 23.530  1.00 108.29 ? 28  SER A CA    1 
ATOM   3648  C C     . SER G 3 25  ? 67.074  -99.969  23.474  1.00 109.85 ? 28  SER A C     1 
ATOM   3649  O O     . SER G 3 25  ? 67.625  -99.723  22.401  1.00 107.88 ? 28  SER A O     1 
ATOM   3650  C CB    . SER G 3 25  ? 64.584  -100.059 23.753  1.00 110.22 ? 28  SER A CB    1 
ATOM   3651  O OG    . SER G 3 25  ? 63.498  -100.893 24.118  1.00 108.65 ? 28  SER A OG    1 
ATOM   3652  N N     . HIS G 3 26  ? 67.507  -99.492  24.639  1.00 109.73 ? 29  HIS A N     1 
ATOM   3653  C CA    . HIS G 3 26  ? 68.679  -98.623  24.731  1.00 111.08 ? 29  HIS A CA    1 
ATOM   3654  C C     . HIS G 3 26  ? 69.924  -99.226  24.083  1.00 111.89 ? 29  HIS A C     1 
ATOM   3655  O O     . HIS G 3 26  ? 70.659  -98.531  23.383  1.00 105.94 ? 29  HIS A O     1 
ATOM   3656  C CB    . HIS G 3 26  ? 68.986  -98.275  26.189  1.00 111.21 ? 29  HIS A CB    1 
ATOM   3657  C CG    . HIS G 3 26  ? 70.276  -97.536  26.368  1.00 116.48 ? 29  HIS A CG    1 
ATOM   3658  N ND1   . HIS G 3 26  ? 70.563  -96.368  25.694  1.00 119.61 ? 29  HIS A ND1   1 
ATOM   3659  C CD2   . HIS G 3 26  ? 71.358  -97.799  27.137  1.00 120.47 ? 29  HIS A CD2   1 
ATOM   3660  C CE1   . HIS G 3 26  ? 71.765  -95.943  26.041  1.00 117.58 ? 29  HIS A CE1   1 
ATOM   3661  N NE2   . HIS G 3 26  ? 72.267  -96.792  26.918  1.00 119.46 ? 29  HIS A NE2   1 
ATOM   3662  N N     . ARG G 3 27  ? 70.166  -100.512 24.327  1.00 121.34 ? 30  ARG A N     1 
ATOM   3663  C CA    . ARG G 3 27  ? 71.329  -101.191 23.750  1.00 123.05 ? 30  ARG A CA    1 
ATOM   3664  C C     . ARG G 3 27  ? 71.231  -101.257 22.233  1.00 117.20 ? 30  ARG A C     1 
ATOM   3665  O O     . ARG G 3 27  ? 72.207  -101.005 21.526  1.00 108.76 ? 30  ARG A O     1 
ATOM   3666  C CB    . ARG G 3 27  ? 71.479  -102.609 24.298  1.00 128.82 ? 30  ARG A CB    1 
ATOM   3667  C CG    . ARG G 3 27  ? 72.028  -102.680 25.711  1.00 133.08 ? 30  ARG A CG    1 
ATOM   3668  C CD    . ARG G 3 27  ? 72.683  -104.029 25.976  1.00 131.05 ? 30  ARG A CD    1 
ATOM   3669  N NE    . ARG G 3 27  ? 72.364  -104.538 27.304  1.00 129.60 ? 30  ARG A NE    1 
ATOM   3670  C CZ    . ARG G 3 27  ? 71.184  -105.051 27.649  1.00 135.23 ? 30  ARG A CZ    1 
ATOM   3671  N NH1   . ARG G 3 27  ? 70.185  -105.128 26.774  1.00 142.21 ? 30  ARG A NH1   1 
ATOM   3672  N NH2   . ARG G 3 27  ? 70.995  -105.488 28.883  1.00 133.83 ? 30  ARG A NH2   1 
ATOM   3673  N N     . MET G 3 28  ? 70.047  -101.608 21.744  1.00 113.15 ? 31  MET A N     1 
ATOM   3674  C CA    . MET G 3 28  ? 69.809  -101.686 20.312  1.00 114.29 ? 31  MET A CA    1 
ATOM   3675  C C     . MET G 3 28  ? 70.030  -100.306 19.698  1.00 113.49 ? 31  MET A C     1 
ATOM   3676  O O     . MET G 3 28  ? 70.570  -100.183 18.597  1.00 111.42 ? 31  MET A O     1 
ATOM   3677  C CB    . MET G 3 28  ? 68.382  -102.171 20.024  1.00 116.08 ? 31  MET A CB    1 
ATOM   3678  C CG    . MET G 3 28  ? 68.081  -103.590 20.482  1.00 112.46 ? 31  MET A CG    1 
ATOM   3679  S SD    . MET G 3 28  ? 66.321  -103.953 20.417  1.00 112.81 ? 31  MET A SD    1 
ATOM   3680  C CE    . MET G 3 28  ? 66.039  -103.944 18.645  1.00 113.91 ? 31  MET A CE    1 
ATOM   3681  N N     . LEU G 3 29  ? 69.616  -99.274  20.429  1.00 113.40 ? 32  LEU A N     1 
ATOM   3682  C CA    . LEU G 3 29  ? 69.717  -97.892  19.960  1.00 109.47 ? 32  LEU A CA    1 
ATOM   3683  C C     . LEU G 3 29  ? 71.185  -97.530  19.763  1.00 106.86 ? 32  LEU A C     1 
ATOM   3684  O O     . LEU G 3 29  ? 71.600  -97.137  18.670  1.00 104.44 ? 32  LEU A O     1 
ATOM   3685  C CB    . LEU G 3 29  ? 69.050  -96.943  20.967  1.00 103.14 ? 32  LEU A CB    1 
ATOM   3686  C CG    . LEU G 3 29  ? 68.151  -95.810  20.474  1.00 99.44  ? 32  LEU A CG    1 
ATOM   3687  C CD1   . LEU G 3 29  ? 67.237  -96.237  19.335  1.00 97.42  ? 32  LEU A CD1   1 
ATOM   3688  C CD2   . LEU G 3 29  ? 67.332  -95.306  21.655  1.00 101.93 ? 32  LEU A CD2   1 
ATOM   3689  N N     . VAL G 3 30  ? 71.971  -97.705  20.821  1.00 107.05 ? 33  VAL A N     1 
ATOM   3690  C CA    . VAL G 3 30  ? 73.403  -97.431  20.757  1.00 112.11 ? 33  VAL A CA    1 
ATOM   3691  C C     . VAL G 3 30  ? 74.094  -98.321  19.725  1.00 111.70 ? 33  VAL A C     1 
ATOM   3692  O O     . VAL G 3 30  ? 75.063  -97.904  19.102  1.00 111.18 ? 33  VAL A O     1 
ATOM   3693  C CB    . VAL G 3 30  ? 74.086  -97.545  22.146  1.00 114.89 ? 33  VAL A CB    1 
ATOM   3694  C CG1   . VAL G 3 30  ? 73.996  -98.953  22.709  1.00 118.75 ? 33  VAL A CG1   1 
ATOM   3695  C CG2   . VAL G 3 30  ? 75.538  -97.100  22.071  1.00 114.48 ? 33  VAL A CG2   1 
ATOM   3696  N N     . GLU G 3 31  ? 73.583  -99.536  19.545  1.00 119.70 ? 34  GLU A N     1 
ATOM   3697  C CA    . GLU G 3 31  ? 74.082  -100.452 18.513  1.00 126.29 ? 34  GLU A CA    1 
ATOM   3698  C C     . GLU G 3 31  ? 73.798  -99.929  17.097  1.00 126.24 ? 34  GLU A C     1 
ATOM   3699  O O     . GLU G 3 31  ? 74.634  -100.060 16.198  1.00 122.77 ? 34  GLU A O     1 
ATOM   3700  C CB    . GLU G 3 31  ? 73.474  -101.859 18.716  1.00 132.40 ? 34  GLU A CB    1 
ATOM   3701  C CG    . GLU G 3 31  ? 73.354  -102.745 17.476  1.00 135.30 ? 34  GLU A CG    1 
ATOM   3702  C CD    . GLU G 3 31  ? 74.683  -103.179 16.886  1.00 136.77 ? 34  GLU A CD    1 
ATOM   3703  O OE1   . GLU G 3 31  ? 75.742  -102.665 17.305  1.00 141.50 ? 34  GLU A OE1   1 
ATOM   3704  O OE2   . GLU G 3 31  ? 74.663  -104.038 15.981  1.00 138.54 ? 34  GLU A OE2   1 
ATOM   3705  N N     . ALA G 3 32  ? 72.621  -99.340  16.906  1.00 124.72 ? 35  ALA A N     1 
ATOM   3706  C CA    . ALA G 3 32  ? 72.174  -98.930  15.580  1.00 124.99 ? 35  ALA A CA    1 
ATOM   3707  C C     . ALA G 3 32  ? 72.930  -97.708  15.075  1.00 121.28 ? 35  ALA A C     1 
ATOM   3708  O O     . ALA G 3 32  ? 73.643  -97.774  14.072  1.00 117.33 ? 35  ALA A O     1 
ATOM   3709  C CB    . ALA G 3 32  ? 70.676  -98.649  15.596  1.00 128.13 ? 35  ALA A CB    1 
ATOM   3710  N N     . PHE G 3 33  ? 72.776  -96.600  15.792  1.00 118.90 ? 36  PHE A N     1 
ATOM   3711  C CA    . PHE G 3 33  ? 73.197  -95.291  15.300  1.00 117.22 ? 36  PHE A CA    1 
ATOM   3712  C C     . PHE G 3 33  ? 74.587  -94.914  15.792  1.00 123.70 ? 36  PHE A C     1 
ATOM   3713  O O     . PHE G 3 33  ? 75.423  -94.441  15.017  1.00 126.58 ? 36  PHE A O     1 
ATOM   3714  C CB    . PHE G 3 33  ? 72.185  -94.228  15.729  1.00 110.30 ? 36  PHE A CB    1 
ATOM   3715  C CG    . PHE G 3 33  ? 70.765  -94.553  15.349  1.00 103.14 ? 36  PHE A CG    1 
ATOM   3716  C CD1   . PHE G 3 33  ? 70.429  -94.805  14.024  1.00 98.79  ? 36  PHE A CD1   1 
ATOM   3717  C CD2   . PHE G 3 33  ? 69.763  -94.603  16.314  1.00 97.87  ? 36  PHE A CD2   1 
ATOM   3718  C CE1   . PHE G 3 33  ? 69.126  -95.104  13.671  1.00 98.00  ? 36  PHE A CE1   1 
ATOM   3719  C CE2   . PHE G 3 33  ? 68.458  -94.900  15.964  1.00 95.24  ? 36  PHE A CE2   1 
ATOM   3720  C CZ    . PHE G 3 33  ? 68.138  -95.148  14.642  1.00 95.29  ? 36  PHE A CZ    1 
ATOM   3721  N N     . GLY G 3 34  ? 74.822  -95.121  17.083  1.00 128.73 ? 37  GLY A N     1 
ATOM   3722  C CA    . GLY G 3 34  ? 76.106  -94.803  17.699  1.00 129.76 ? 37  GLY A CA    1 
ATOM   3723  C C     . GLY G 3 34  ? 75.948  -94.326  19.128  1.00 132.06 ? 37  GLY A C     1 
ATOM   3724  O O     . GLY G 3 34  ? 74.853  -94.379  19.695  1.00 127.38 ? 37  GLY A O     1 
ATOM   3725  N N     . GLU G 3 35  ? 77.048  -93.847  19.706  1.00 135.73 ? 38  GLU A N     1 
ATOM   3726  C CA    . GLU G 3 35  ? 77.060  -93.379  21.095  1.00 142.39 ? 38  GLU A CA    1 
ATOM   3727  C C     . GLU G 3 35  ? 76.240  -92.096  21.279  1.00 139.41 ? 38  GLU A C     1 
ATOM   3728  O O     . GLU G 3 35  ? 75.775  -91.793  22.382  1.00 127.67 ? 38  GLU A O     1 
ATOM   3729  C CB    . GLU G 3 35  ? 78.499  -93.148  21.563  1.00 147.67 ? 38  GLU A CB    1 
ATOM   3730  C CG    . GLU G 3 35  ? 78.670  -93.201  23.074  1.00 153.97 ? 38  GLU A CG    1 
ATOM   3731  C CD    . GLU G 3 35  ? 78.555  -94.609  23.633  1.00 152.89 ? 38  GLU A CD    1 
ATOM   3732  O OE1   . GLU G 3 35  ? 77.959  -94.770  24.720  1.00 151.81 ? 38  GLU A OE1   1 
ATOM   3733  O OE2   . GLU G 3 35  ? 79.054  -95.555  22.986  1.00 148.06 ? 38  GLU A OE2   1 
ATOM   3734  N N     . GLN G 3 36  ? 76.072  -91.353  20.188  1.00 140.89 ? 39  GLN A N     1 
ATOM   3735  C CA    . GLN G 3 36  ? 75.246  -90.151  20.174  1.00 136.48 ? 39  GLN A CA    1 
ATOM   3736  C C     . GLN G 3 36  ? 73.779  -90.562  20.188  1.00 120.84 ? 39  GLN A C     1 
ATOM   3737  O O     . GLN G 3 36  ? 73.103  -90.568  19.155  1.00 116.22 ? 39  GLN A O     1 
ATOM   3738  C CB    . GLN G 3 36  ? 75.568  -89.288  18.945  1.00 149.28 ? 39  GLN A CB    1 
ATOM   3739  C CG    . GLN G 3 36  ? 76.840  -88.449  19.075  1.00 160.63 ? 39  GLN A CG    1 
ATOM   3740  C CD    . GLN G 3 36  ? 78.087  -89.262  19.398  1.00 165.58 ? 39  GLN A CD    1 
ATOM   3741  O OE1   . GLN G 3 36  ? 78.197  -90.432  19.026  1.00 177.58 ? 39  GLN A OE1   1 
ATOM   3742  N NE2   . GLN G 3 36  ? 79.036  -88.640  20.090  1.00 161.95 ? 39  GLN A NE2   1 
ATOM   3743  N N     . VAL G 3 37  ? 73.312  -90.918  21.380  1.00 106.73 ? 40  VAL A N     1 
ATOM   3744  C CA    . VAL G 3 37  ? 71.953  -91.400  21.596  1.00 101.13 ? 40  VAL A CA    1 
ATOM   3745  C C     . VAL G 3 37  ? 71.616  -91.255  23.085  1.00 95.32  ? 40  VAL A C     1 
ATOM   3746  O O     . VAL G 3 37  ? 72.511  -91.335  23.931  1.00 96.18  ? 40  VAL A O     1 
ATOM   3747  C CB    . VAL G 3 37  ? 71.812  -92.859  21.095  1.00 103.39 ? 40  VAL A CB    1 
ATOM   3748  C CG1   . VAL G 3 37  ? 71.221  -93.794  22.149  1.00 103.99 ? 40  VAL A CG1   1 
ATOM   3749  C CG2   . VAL G 3 37  ? 70.999  -92.906  19.805  1.00 107.69 ? 40  VAL A CG2   1 
ATOM   3750  N N     . PRO G 3 38  ? 70.332  -91.040  23.416  1.00 86.68  ? 41  PRO A N     1 
ATOM   3751  C CA    . PRO G 3 38  ? 69.977  -90.760  24.811  1.00 89.34  ? 41  PRO A CA    1 
ATOM   3752  C C     . PRO G 3 38  ? 70.399  -91.857  25.803  1.00 101.19 ? 41  PRO A C     1 
ATOM   3753  O O     . PRO G 3 38  ? 70.648  -92.995  25.404  1.00 111.84 ? 41  PRO A O     1 
ATOM   3754  C CB    . PRO G 3 38  ? 68.446  -90.617  24.770  1.00 84.79  ? 41  PRO A CB    1 
ATOM   3755  C CG    . PRO G 3 38  ? 68.015  -91.215  23.482  1.00 84.87  ? 41  PRO A CG    1 
ATOM   3756  C CD    . PRO G 3 38  ? 69.155  -91.034  22.533  1.00 85.99  ? 41  PRO A CD    1 
ATOM   3757  N N     . THR G 3 39  ? 70.473  -91.510  27.086  1.00 107.59 ? 42  THR A N     1 
ATOM   3758  C CA    . THR G 3 39  ? 70.799  -92.483  28.128  1.00 109.81 ? 42  THR A CA    1 
ATOM   3759  C C     . THR G 3 39  ? 69.642  -93.455  28.336  1.00 115.38 ? 42  THR A C     1 
ATOM   3760  O O     . THR G 3 39  ? 68.524  -93.214  27.881  1.00 110.32 ? 42  THR A O     1 
ATOM   3761  C CB    . THR G 3 39  ? 71.076  -91.809  29.487  1.00 110.51 ? 42  THR A CB    1 
ATOM   3762  O OG1   . THR G 3 39  ? 69.882  -91.176  29.968  1.00 113.54 ? 42  THR A OG1   1 
ATOM   3763  C CG2   . THR G 3 39  ? 72.188  -90.789  29.369  1.00 106.51 ? 42  THR A CG2   1 
ATOM   3764  N N     . VAL G 3 40  ? 69.912  -94.547  29.044  1.00 122.57 ? 43  VAL A N     1 
ATOM   3765  C CA    . VAL G 3 40  ? 68.859  -95.494  29.411  1.00 128.11 ? 43  VAL A CA    1 
ATOM   3766  C C     . VAL G 3 40  ? 67.752  -94.823  30.243  1.00 130.65 ? 43  VAL A C     1 
ATOM   3767  O O     . VAL G 3 40  ? 66.575  -95.190  30.126  1.00 128.72 ? 43  VAL A O     1 
ATOM   3768  C CB    . VAL G 3 40  ? 69.428  -96.719  30.173  1.00 129.43 ? 43  VAL A CB    1 
ATOM   3769  C CG1   . VAL G 3 40  ? 69.944  -96.322  31.551  1.00 129.93 ? 43  VAL A CG1   1 
ATOM   3770  C CG2   . VAL G 3 40  ? 68.379  -97.823  30.287  1.00 133.55 ? 43  VAL A CG2   1 
ATOM   3771  N N     . LYS G 3 41  ? 68.124  -93.838  31.064  1.00 123.31 ? 44  LYS A N     1 
ATOM   3772  C CA    . LYS G 3 41  ? 67.165  -93.198  31.965  1.00 115.93 ? 44  LYS A CA    1 
ATOM   3773  C C     . LYS G 3 41  ? 66.012  -92.568  31.183  1.00 114.72 ? 44  LYS A C     1 
ATOM   3774  O O     . LYS G 3 41  ? 64.851  -92.680  31.579  1.00 117.86 ? 44  LYS A O     1 
ATOM   3775  C CB    . LYS G 3 41  ? 67.863  -92.173  32.871  1.00 109.75 ? 44  LYS A CB    1 
ATOM   3776  C CG    . LYS G 3 41  ? 66.963  -91.494  33.906  1.00 110.88 ? 44  LYS A CG    1 
ATOM   3777  C CD    . LYS G 3 41  ? 66.221  -92.456  34.832  1.00 111.22 ? 44  LYS A CD    1 
ATOM   3778  C CE    . LYS G 3 41  ? 65.418  -91.697  35.885  1.00 112.81 ? 44  LYS A CE    1 
ATOM   3779  N NZ    . LYS G 3 41  ? 64.472  -92.539  36.677  1.00 111.31 ? 44  LYS A NZ    1 
ATOM   3780  N N     . THR G 3 42  ? 66.324  -91.935  30.059  1.00 111.78 ? 45  THR A N     1 
ATOM   3781  C CA    . THR G 3 42  ? 65.288  -91.350  29.215  1.00 113.71 ? 45  THR A CA    1 
ATOM   3782  C C     . THR G 3 42  ? 64.359  -92.428  28.641  1.00 113.02 ? 45  THR A C     1 
ATOM   3783  O O     . THR G 3 42  ? 63.129  -92.282  28.673  1.00 107.93 ? 45  THR A O     1 
ATOM   3784  C CB    . THR G 3 42  ? 65.902  -90.486  28.097  1.00 115.31 ? 45  THR A CB    1 
ATOM   3785  O OG1   . THR G 3 42  ? 67.246  -90.910  27.853  1.00 118.91 ? 45  THR A OG1   1 
ATOM   3786  C CG2   . THR G 3 42  ? 65.932  -89.020  28.510  1.00 114.95 ? 45  THR A CG2   1 
ATOM   3787  N N     . CYS G 3 43  ? 64.948  -93.516  28.144  1.00 115.94 ? 46  CYS A N     1 
ATOM   3788  C CA    . CYS G 3 43  ? 64.175  -94.662  27.649  1.00 109.80 ? 46  CYS A CA    1 
ATOM   3789  C C     . CYS G 3 43  ? 63.247  -95.212  28.733  1.00 109.62 ? 46  CYS A C     1 
ATOM   3790  O O     . CYS G 3 43  ? 62.091  -95.546  28.461  1.00 102.52 ? 46  CYS A O     1 
ATOM   3791  C CB    . CYS G 3 43  ? 65.106  -95.765  27.148  1.00 103.13 ? 46  CYS A CB    1 
ATOM   3792  S SG    . CYS G 3 43  ? 66.291  -95.219  25.898  1.00 109.19 ? 46  CYS A SG    1 
ATOM   3793  N N     . GLU G 3 44  ? 63.752  -95.291  29.962  1.00 109.92 ? 47  GLU A N     1 
ATOM   3794  C CA    . GLU G 3 44  ? 62.926  -95.696  31.096  1.00 113.61 ? 47  GLU A CA    1 
ATOM   3795  C C     . GLU G 3 44  ? 61.725  -94.760  31.208  1.00 117.12 ? 47  GLU A C     1 
ATOM   3796  O O     . GLU G 3 44  ? 60.587  -95.211  31.397  1.00 117.23 ? 47  GLU A O     1 
ATOM   3797  C CB    . GLU G 3 44  ? 63.739  -95.685  32.396  1.00 114.64 ? 47  GLU A CB    1 
ATOM   3798  C CG    . GLU G 3 44  ? 64.821  -96.758  32.468  1.00 112.86 ? 47  GLU A CG    1 
ATOM   3799  C CD    . GLU G 3 44  ? 65.851  -96.510  33.563  1.00 109.28 ? 47  GLU A CD    1 
ATOM   3800  O OE1   . GLU G 3 44  ? 65.512  -95.868  34.584  1.00 104.58 ? 47  GLU A OE1   1 
ATOM   3801  O OE2   . GLU G 3 44  ? 67.003  -96.975  33.411  1.00 105.56 ? 47  GLU A OE2   1 
ATOM   3802  N N     . ARG G 3 45  ? 61.987  -93.460  31.067  1.00 116.11 ? 48  ARG A N     1 
ATOM   3803  C CA    . ARG G 3 45  ? 60.930  -92.453  31.115  1.00 111.58 ? 48  ARG A CA    1 
ATOM   3804  C C     . ARG G 3 45  ? 59.933  -92.674  29.986  1.00 105.82 ? 48  ARG A C     1 
ATOM   3805  O O     . ARG G 3 45  ? 58.781  -93.023  30.239  1.00 96.74  ? 48  ARG A O     1 
ATOM   3806  C CB    . ARG G 3 45  ? 61.503  -91.025  31.072  1.00 107.06 ? 48  ARG A CB    1 
ATOM   3807  C CG    . ARG G 3 45  ? 62.056  -90.542  32.406  1.00 104.75 ? 48  ARG A CG    1 
ATOM   3808  C CD    . ARG G 3 45  ? 63.088  -89.435  32.244  1.00 102.98 ? 48  ARG A CD    1 
ATOM   3809  N NE    . ARG G 3 45  ? 63.675  -89.043  33.530  1.00 101.11 ? 48  ARG A NE    1 
ATOM   3810  C CZ    . ARG G 3 45  ? 64.892  -88.509  33.698  1.00 102.31 ? 48  ARG A CZ    1 
ATOM   3811  N NH1   . ARG G 3 45  ? 65.708  -88.288  32.656  1.00 96.70  ? 48  ARG A NH1   1 
ATOM   3812  N NH2   . ARG G 3 45  ? 65.308  -88.199  34.929  1.00 97.13  ? 48  ARG A NH2   1 
ATOM   3813  N N     . TRP G 3 46  ? 60.378  -92.509  28.745  1.00 103.73 ? 49  TRP A N     1 
ATOM   3814  C CA    . TRP G 3 46  ? 59.459  -92.585  27.607  1.00 115.10 ? 49  TRP A CA    1 
ATOM   3815  C C     . TRP G 3 46  ? 58.555  -93.819  27.673  1.00 121.72 ? 49  TRP A C     1 
ATOM   3816  O O     . TRP G 3 46  ? 57.374  -93.761  27.315  1.00 123.58 ? 49  TRP A O     1 
ATOM   3817  C CB    . TRP G 3 46  ? 60.218  -92.499  26.274  1.00 117.26 ? 49  TRP A CB    1 
ATOM   3818  C CG    . TRP G 3 46  ? 60.476  -91.072  25.883  1.00 122.50 ? 49  TRP A CG    1 
ATOM   3819  C CD1   . TRP G 3 46  ? 61.652  -90.389  25.984  1.00 119.73 ? 49  TRP A CD1   1 
ATOM   3820  C CD2   . TRP G 3 46  ? 59.514  -90.142  25.373  1.00 127.45 ? 49  TRP A CD2   1 
ATOM   3821  N NE1   . TRP G 3 46  ? 61.487  -89.096  25.551  1.00 122.71 ? 49  TRP A NE1   1 
ATOM   3822  C CE2   . TRP G 3 46  ? 60.183  -88.917  25.171  1.00 128.20 ? 49  TRP A CE2   1 
ATOM   3823  C CE3   . TRP G 3 46  ? 58.150  -90.228  25.060  1.00 131.37 ? 49  TRP A CE3   1 
ATOM   3824  C CZ2   . TRP G 3 46  ? 59.538  -87.786  24.669  1.00 135.12 ? 49  TRP A CZ2   1 
ATOM   3825  C CZ3   . TRP G 3 46  ? 57.510  -89.106  24.558  1.00 139.21 ? 49  TRP A CZ3   1 
ATOM   3826  C CH2   . TRP G 3 46  ? 58.205  -87.899  24.367  1.00 140.71 ? 49  TRP A CH2   1 
ATOM   3827  N N     . PHE G 3 47  ? 59.110  -94.921  28.164  1.00 125.94 ? 50  PHE A N     1 
ATOM   3828  C CA    . PHE G 3 47  ? 58.336  -96.128  28.401  1.00 122.36 ? 50  PHE A CA    1 
ATOM   3829  C C     . PHE G 3 47  ? 57.182  -95.846  29.349  1.00 123.77 ? 50  PHE A C     1 
ATOM   3830  O O     . PHE G 3 47  ? 56.039  -96.182  29.042  1.00 131.20 ? 50  PHE A O     1 
ATOM   3831  C CB    . PHE G 3 47  ? 59.237  -97.249  28.928  1.00 125.06 ? 50  PHE A CB    1 
ATOM   3832  C CG    . PHE G 3 47  ? 59.866  -98.084  27.837  1.00 129.04 ? 50  PHE A CG    1 
ATOM   3833  C CD1   . PHE G 3 47  ? 60.416  -97.487  26.704  1.00 128.48 ? 50  PHE A CD1   1 
ATOM   3834  C CD2   . PHE G 3 47  ? 59.903  -99.468  27.940  1.00 128.04 ? 50  PHE A CD2   1 
ATOM   3835  C CE1   . PHE G 3 47  ? 60.986  -98.254  25.703  1.00 127.90 ? 50  PHE A CE1   1 
ATOM   3836  C CE2   . PHE G 3 47  ? 60.474  -100.238 26.941  1.00 128.54 ? 50  PHE A CE2   1 
ATOM   3837  C CZ    . PHE G 3 47  ? 61.015  -99.631  25.823  1.00 128.40 ? 50  PHE A CZ    1 
ATOM   3838  N N     . GLN G 3 48  ? 57.474  -95.197  30.475  1.00 123.50 ? 51  GLN A N     1 
ATOM   3839  C CA    . GLN G 3 48  ? 56.435  -94.833  31.445  1.00 124.47 ? 51  GLN A CA    1 
ATOM   3840  C C     . GLN G 3 48  ? 55.233  -94.157  30.784  1.00 125.78 ? 51  GLN A C     1 
ATOM   3841  O O     . GLN G 3 48  ? 54.089  -94.487  31.094  1.00 125.61 ? 51  GLN A O     1 
ATOM   3842  C CB    . GLN G 3 48  ? 56.999  -93.923  32.540  1.00 125.59 ? 51  GLN A CB    1 
ATOM   3843  C CG    . GLN G 3 48  ? 57.895  -94.636  33.539  1.00 128.91 ? 51  GLN A CG    1 
ATOM   3844  C CD    . GLN G 3 48  ? 58.668  -93.680  34.437  1.00 127.34 ? 51  GLN A CD    1 
ATOM   3845  O OE1   . GLN G 3 48  ? 59.884  -93.803  34.590  1.00 116.64 ? 51  GLN A OE1   1 
ATOM   3846  N NE2   . GLN G 3 48  ? 57.963  -92.724  35.039  1.00 127.55 ? 51  GLN A NE2   1 
ATOM   3847  N N     . ARG G 3 49  ? 55.494  -93.226  29.869  1.00 133.24 ? 52  ARG A N     1 
ATOM   3848  C CA    . ARG G 3 49  ? 54.419  -92.488  29.202  1.00 143.54 ? 52  ARG A CA    1 
ATOM   3849  C C     . ARG G 3 49  ? 53.633  -93.375  28.230  1.00 144.32 ? 52  ARG A C     1 
ATOM   3850  O O     . ARG G 3 49  ? 52.447  -93.131  27.979  1.00 144.29 ? 52  ARG A O     1 
ATOM   3851  C CB    . ARG G 3 49  ? 54.965  -91.254  28.471  1.00 149.34 ? 52  ARG A CB    1 
ATOM   3852  C CG    . ARG G 3 49  ? 53.915  -90.173  28.251  1.00 157.74 ? 52  ARG A CG    1 
ATOM   3853  C CD    . ARG G 3 49  ? 54.352  -89.142  27.225  1.00 160.59 ? 52  ARG A CD    1 
ATOM   3854  N NE    . ARG G 3 49  ? 55.527  -88.391  27.663  1.00 157.03 ? 52  ARG A NE    1 
ATOM   3855  C CZ    . ARG G 3 49  ? 56.056  -87.366  26.997  1.00 154.08 ? 52  ARG A CZ    1 
ATOM   3856  N NH1   . ARG G 3 49  ? 55.523  -86.947  25.849  1.00 154.86 ? 52  ARG A NH1   1 
ATOM   3857  N NH2   . ARG G 3 49  ? 57.128  -86.754  27.485  1.00 148.40 ? 52  ARG A NH2   1 
ATOM   3858  N N     . PHE G 3 50  ? 54.291  -94.402  27.690  1.00 138.90 ? 53  PHE A N     1 
ATOM   3859  C CA    . PHE G 3 50  ? 53.624  -95.352  26.799  1.00 134.85 ? 53  PHE A CA    1 
ATOM   3860  C C     . PHE G 3 50  ? 52.654  -96.258  27.559  1.00 135.63 ? 53  PHE A C     1 
ATOM   3861  O O     . PHE G 3 50  ? 51.766  -96.859  26.956  1.00 142.50 ? 53  PHE A O     1 
ATOM   3862  C CB    . PHE G 3 50  ? 54.636  -96.212  26.029  1.00 128.70 ? 53  PHE A CB    1 
ATOM   3863  C CG    . PHE G 3 50  ? 55.674  -95.424  25.266  1.00 125.52 ? 53  PHE A CG    1 
ATOM   3864  C CD1   . PHE G 3 50  ? 55.387  -94.176  24.724  1.00 130.19 ? 53  PHE A CD1   1 
ATOM   3865  C CD2   . PHE G 3 50  ? 56.941  -95.952  25.068  1.00 122.27 ? 53  PHE A CD2   1 
ATOM   3866  C CE1   . PHE G 3 50  ? 56.351  -93.468  24.023  1.00 128.82 ? 53  PHE A CE1   1 
ATOM   3867  C CE2   . PHE G 3 50  ? 57.907  -95.252  24.365  1.00 120.30 ? 53  PHE A CE2   1 
ATOM   3868  C CZ    . PHE G 3 50  ? 57.612  -94.010  23.838  1.00 122.42 ? 53  PHE A CZ    1 
ATOM   3869  N N     . LYS G 3 51  ? 52.825  -96.351  28.876  1.00 135.07 ? 54  LYS A N     1 
ATOM   3870  C CA    . LYS G 3 51  ? 51.930  -97.139  29.723  1.00 139.88 ? 54  LYS A CA    1 
ATOM   3871  C C     . LYS G 3 51  ? 50.687  -96.366  30.149  1.00 149.16 ? 54  LYS A C     1 
ATOM   3872  O O     . LYS G 3 51  ? 49.654  -96.970  30.435  1.00 152.93 ? 54  LYS A O     1 
ATOM   3873  C CB    . LYS G 3 51  ? 52.677  -97.637  30.950  1.00 137.34 ? 54  LYS A CB    1 
ATOM   3874  C CG    . LYS G 3 51  ? 53.854  -98.509  30.573  1.00 140.56 ? 54  LYS A CG    1 
ATOM   3875  C CD    . LYS G 3 51  ? 54.574  -99.060  31.784  1.00 140.50 ? 54  LYS A CD    1 
ATOM   3876  C CE    . LYS G 3 51  ? 55.719  -99.956  31.344  1.00 139.27 ? 54  LYS A CE    1 
ATOM   3877  N NZ    . LYS G 3 51  ? 56.773  -100.051 32.383  1.00 135.85 ? 54  LYS A NZ    1 
ATOM   3878  N N     . SER G 3 52  ? 50.791  -95.039  30.200  1.00 158.23 ? 55  SER A N     1 
ATOM   3879  C CA    . SER G 3 52  ? 49.626  -94.181  30.432  1.00 163.54 ? 55  SER A CA    1 
ATOM   3880  C C     . SER G 3 52  ? 48.716  -94.167  29.202  1.00 163.47 ? 55  SER A C     1 
ATOM   3881  O O     . SER G 3 52  ? 47.505  -93.964  29.321  1.00 166.20 ? 55  SER A O     1 
ATOM   3882  C CB    . SER G 3 52  ? 50.063  -92.753  30.775  1.00 166.52 ? 55  SER A CB    1 
ATOM   3883  O OG    . SER G 3 52  ? 50.571  -92.081  29.635  1.00 169.98 ? 55  SER A OG    1 
ATOM   3884  N N     . GLY G 3 53  ? 49.312  -94.377  28.028  1.00 158.23 ? 56  GLY A N     1 
ATOM   3885  C CA    . GLY G 3 53  ? 48.581  -94.413  26.766  1.00 156.23 ? 56  GLY A CA    1 
ATOM   3886  C C     . GLY G 3 53  ? 49.141  -93.444  25.744  1.00 159.12 ? 56  GLY A C     1 
ATOM   3887  O O     . GLY G 3 53  ? 49.018  -93.675  24.542  1.00 160.19 ? 56  GLY A O     1 
ATOM   3888  N N     . ASP G 3 54  ? 49.765  -92.365  26.218  1.00 163.57 ? 57  ASP A N     1 
ATOM   3889  C CA    . ASP G 3 54  ? 50.193  -91.266  25.346  1.00 165.74 ? 57  ASP A CA    1 
ATOM   3890  C C     . ASP G 3 54  ? 51.473  -91.572  24.569  1.00 156.73 ? 57  ASP A C     1 
ATOM   3891  O O     . ASP G 3 54  ? 52.520  -91.847  25.156  1.00 145.61 ? 57  ASP A O     1 
ATOM   3892  C CB    . ASP G 3 54  ? 50.375  -89.976  26.153  1.00 168.09 ? 57  ASP A CB    1 
ATOM   3893  C CG    . ASP G 3 54  ? 49.081  -89.488  26.781  1.00 171.96 ? 57  ASP A CG    1 
ATOM   3894  O OD1   . ASP G 3 54  ? 47.993  -89.776  26.235  1.00 168.16 ? 57  ASP A OD1   1 
ATOM   3895  O OD2   . ASP G 3 54  ? 49.154  -88.810  27.825  1.00 173.94 ? 57  ASP A OD2   1 
ATOM   3896  N N     . PHE G 3 55  ? 51.366  -91.503  23.243  1.00 153.26 ? 58  PHE A N     1 
ATOM   3897  C CA    . PHE G 3 55  ? 52.484  -91.738  22.335  1.00 147.94 ? 58  PHE A CA    1 
ATOM   3898  C C     . PHE G 3 55  ? 52.891  -90.444  21.616  1.00 142.03 ? 58  PHE A C     1 
ATOM   3899  O O     . PHE G 3 55  ? 53.329  -90.476  20.464  1.00 129.22 ? 58  PHE A O     1 
ATOM   3900  C CB    . PHE G 3 55  ? 52.091  -92.798  21.297  1.00 152.55 ? 58  PHE A CB    1 
ATOM   3901  C CG    . PHE G 3 55  ? 51.650  -94.111  21.891  1.00 147.54 ? 58  PHE A CG    1 
ATOM   3902  C CD1   . PHE G 3 55  ? 52.487  -94.824  22.735  1.00 143.04 ? 58  PHE A CD1   1 
ATOM   3903  C CD2   . PHE G 3 55  ? 50.404  -94.644  21.584  1.00 149.58 ? 58  PHE A CD2   1 
ATOM   3904  C CE1   . PHE G 3 55  ? 52.089  -96.033  23.276  1.00 143.34 ? 58  PHE A CE1   1 
ATOM   3905  C CE2   . PHE G 3 55  ? 50.001  -95.856  22.118  1.00 152.68 ? 58  PHE A CE2   1 
ATOM   3906  C CZ    . PHE G 3 55  ? 50.845  -96.551  22.967  1.00 150.85 ? 58  PHE A CZ    1 
ATOM   3907  N N     . ASP G 3 56  ? 52.746  -89.305  22.291  1.00 144.53 ? 59  ASP A N     1 
ATOM   3908  C CA    . ASP G 3 56  ? 53.076  -88.017  21.684  1.00 145.37 ? 59  ASP A CA    1 
ATOM   3909  C C     . ASP G 3 56  ? 54.585  -87.926  21.475  1.00 137.89 ? 59  ASP A C     1 
ATOM   3910  O O     . ASP G 3 56  ? 55.354  -87.885  22.436  1.00 120.87 ? 59  ASP A O     1 
ATOM   3911  C CB    . ASP G 3 56  ? 52.575  -86.851  22.553  1.00 154.20 ? 59  ASP A CB    1 
ATOM   3912  C CG    . ASP G 3 56  ? 52.765  -85.484  21.890  1.00 156.75 ? 59  ASP A CG    1 
ATOM   3913  O OD1   . ASP G 3 56  ? 52.700  -85.392  20.643  1.00 155.37 ? 59  ASP A OD1   1 
ATOM   3914  O OD2   . ASP G 3 56  ? 52.968  -84.494  22.625  1.00 154.00 ? 59  ASP A OD2   1 
ATOM   3915  N N     . VAL G 3 57  ? 54.992  -87.917  20.208  1.00 142.50 ? 60  VAL A N     1 
ATOM   3916  C CA    . VAL G 3 57  ? 56.412  -87.818  19.836  1.00 146.83 ? 60  VAL A CA    1 
ATOM   3917  C C     . VAL G 3 57  ? 57.014  -86.452  20.180  1.00 145.90 ? 60  VAL A C     1 
ATOM   3918  O O     . VAL G 3 57  ? 58.152  -86.372  20.641  1.00 144.21 ? 60  VAL A O     1 
ATOM   3919  C CB    . VAL G 3 57  ? 56.681  -88.123  18.329  1.00 150.19 ? 60  VAL A CB    1 
ATOM   3920  C CG1   . VAL G 3 57  ? 57.189  -89.548  18.153  1.00 148.66 ? 60  VAL A CG1   1 
ATOM   3921  C CG2   . VAL G 3 57  ? 55.464  -87.851  17.442  1.00 148.56 ? 60  VAL A CG2   1 
ATOM   3922  N N     . ASP G 3 58  ? 56.254  -85.385  19.952  1.00 143.54 ? 61  ASP A N     1 
ATOM   3923  C CA    . ASP G 3 58  ? 56.707  -84.034  20.279  1.00 134.09 ? 61  ASP A CA    1 
ATOM   3924  C C     . ASP G 3 58  ? 56.643  -83.819  21.792  1.00 126.72 ? 61  ASP A C     1 
ATOM   3925  O O     . ASP G 3 58  ? 55.996  -84.584  22.511  1.00 126.25 ? 61  ASP A O     1 
ATOM   3926  C CB    . ASP G 3 58  ? 55.857  -82.989  19.537  1.00 134.99 ? 61  ASP A CB    1 
ATOM   3927  C CG    . ASP G 3 58  ? 56.006  -83.078  18.014  1.00 134.81 ? 61  ASP A CG    1 
ATOM   3928  O OD1   . ASP G 3 58  ? 57.154  -83.157  17.528  1.00 131.02 ? 61  ASP A OD1   1 
ATOM   3929  O OD2   . ASP G 3 58  ? 54.977  -83.063  17.301  1.00 131.80 ? 61  ASP A OD2   1 
ATOM   3930  N N     . ASP G 3 59  ? 57.323  -82.784  22.275  1.00 120.86 ? 62  ASP A N     1 
ATOM   3931  C CA    . ASP G 3 59  ? 57.298  -82.453  23.699  1.00 117.59 ? 62  ASP A CA    1 
ATOM   3932  C C     . ASP G 3 59  ? 55.930  -81.891  24.089  1.00 123.70 ? 62  ASP A C     1 
ATOM   3933  O O     . ASP G 3 59  ? 55.087  -81.599  23.234  1.00 117.57 ? 62  ASP A O     1 
ATOM   3934  C CB    . ASP G 3 59  ? 58.371  -81.413  24.056  1.00 114.97 ? 62  ASP A CB    1 
ATOM   3935  C CG    . ASP G 3 59  ? 59.761  -81.805  23.587  1.00 116.87 ? 62  ASP A CG    1 
ATOM   3936  O OD1   . ASP G 3 59  ? 59.858  -82.575  22.615  1.00 123.42 ? 62  ASP A OD1   1 
ATOM   3937  O OD2   . ASP G 3 59  ? 60.759  -81.325  24.171  1.00 110.93 ? 62  ASP A OD2   1 
ATOM   3938  N N     . LYS G 3 60  ? 55.715  -81.761  25.394  1.00 130.69 ? 63  LYS A N     1 
ATOM   3939  C CA    . LYS G 3 60  ? 54.621  -80.953  25.923  1.00 138.04 ? 63  LYS A CA    1 
ATOM   3940  C C     . LYS G 3 60  ? 55.102  -79.509  25.942  1.00 135.69 ? 63  LYS A C     1 
ATOM   3941  O O     . LYS G 3 60  ? 56.285  -79.241  25.723  1.00 140.31 ? 63  LYS A O     1 
ATOM   3942  C CB    . LYS G 3 60  ? 54.206  -81.409  27.332  1.00 144.90 ? 63  LYS A CB    1 
ATOM   3943  C CG    . LYS G 3 60  ? 53.074  -82.432  27.351  1.00 149.38 ? 63  LYS A CG    1 
ATOM   3944  C CD    . LYS G 3 60  ? 53.559  -83.839  27.024  1.00 149.92 ? 63  LYS A CD    1 
ATOM   3945  C CE    . LYS G 3 60  ? 52.581  -84.613  26.148  1.00 147.54 ? 63  LYS A CE    1 
ATOM   3946  N NZ    . LYS G 3 60  ? 51.157  -84.513  26.560  1.00 145.93 ? 63  LYS A NZ    1 
ATOM   3947  N N     . GLU G 3 61  ? 54.189  -78.580  26.197  1.00 130.32 ? 64  GLU A N     1 
ATOM   3948  C CA    . GLU G 3 61  ? 54.539  -77.167  26.212  1.00 130.72 ? 64  GLU A CA    1 
ATOM   3949  C C     . GLU G 3 61  ? 55.613  -76.912  27.268  1.00 127.04 ? 64  GLU A C     1 
ATOM   3950  O O     . GLU G 3 61  ? 55.470  -77.340  28.415  1.00 119.73 ? 64  GLU A O     1 
ATOM   3951  C CB    . GLU G 3 61  ? 53.297  -76.321  26.490  1.00 135.72 ? 64  GLU A CB    1 
ATOM   3952  C CG    . GLU G 3 61  ? 53.458  -74.838  26.208  1.00 133.88 ? 64  GLU A CG    1 
ATOM   3953  C CD    . GLU G 3 61  ? 52.174  -74.083  26.468  1.00 134.95 ? 64  GLU A CD    1 
ATOM   3954  O OE1   . GLU G 3 61  ? 52.103  -73.372  27.489  1.00 139.57 ? 64  GLU A OE1   1 
ATOM   3955  O OE2   . GLU G 3 61  ? 51.225  -74.223  25.667  1.00 133.85 ? 64  GLU A OE2   1 
ATOM   3956  N N     . HIS G 3 62  ? 56.692  -76.241  26.862  1.00 127.73 ? 65  HIS A N     1 
ATOM   3957  C CA    . HIS G 3 62  ? 57.783  -75.865  27.767  1.00 127.70 ? 65  HIS A CA    1 
ATOM   3958  C C     . HIS G 3 62  ? 57.384  -74.714  28.695  1.00 125.14 ? 65  HIS A C     1 
ATOM   3959  O O     . HIS G 3 62  ? 56.288  -74.149  28.591  1.00 111.79 ? 65  HIS A O     1 
ATOM   3960  C CB    . HIS G 3 62  ? 59.010  -75.420  26.964  1.00 134.39 ? 65  HIS A CB    1 
ATOM   3961  C CG    . HIS G 3 62  ? 59.732  -76.536  26.285  1.00 142.58 ? 65  HIS A CG    1 
ATOM   3962  N ND1   . HIS G 3 62  ? 61.107  -76.633  26.277  1.00 148.09 ? 65  HIS A ND1   1 
ATOM   3963  C CD2   . HIS G 3 62  ? 59.275  -77.603  25.590  1.00 146.90 ? 65  HIS A CD2   1 
ATOM   3964  C CE1   . HIS G 3 62  ? 61.466  -77.711  25.605  1.00 147.11 ? 65  HIS A CE1   1 
ATOM   3965  N NE2   . HIS G 3 62  ? 60.374  -78.318  25.178  1.00 151.48 ? 65  HIS A NE2   1 
ATOM   3966  N N     . GLY G 3 63  ? 58.292  -74.365  29.600  1.00 122.99 ? 66  GLY A N     1 
ATOM   3967  C CA    . GLY G 3 63  ? 58.173  -73.127  30.348  1.00 126.45 ? 66  GLY A CA    1 
ATOM   3968  C C     . GLY G 3 63  ? 58.245  -71.959  29.384  1.00 131.55 ? 66  GLY A C     1 
ATOM   3969  O O     . GLY G 3 63  ? 58.953  -72.021  28.378  1.00 129.06 ? 66  GLY A O     1 
ATOM   3970  N N     . LYS G 3 64  ? 57.495  -70.903  29.685  1.00 135.47 ? 67  LYS A N     1 
ATOM   3971  C CA    . LYS G 3 64  ? 57.426  -69.720  28.834  1.00 125.52 ? 67  LYS A CA    1 
ATOM   3972  C C     . LYS G 3 64  ? 57.280  -68.477  29.709  1.00 117.78 ? 67  LYS A C     1 
ATOM   3973  O O     . LYS G 3 64  ? 56.769  -68.577  30.825  1.00 108.98 ? 67  LYS A O     1 
ATOM   3974  C CB    . LYS G 3 64  ? 56.233  -69.834  27.888  1.00 127.53 ? 67  LYS A CB    1 
ATOM   3975  C CG    . LYS G 3 64  ? 54.881  -69.782  28.589  1.00 128.83 ? 67  LYS A CG    1 
ATOM   3976  C CD    . LYS G 3 64  ? 53.773  -70.337  27.707  1.00 134.45 ? 67  LYS A CD    1 
ATOM   3977  C CE    . LYS G 3 64  ? 52.409  -69.789  28.103  1.00 140.14 ? 67  LYS A CE    1 
ATOM   3978  N NZ    . LYS G 3 64  ? 51.364  -70.105  27.089  1.00 143.94 ? 67  LYS A NZ    1 
ATOM   3979  N N     . PRO G 3 65  ? 57.705  -67.302  29.204  1.00 113.68 ? 68  PRO A N     1 
ATOM   3980  C CA    . PRO G 3 65  ? 57.630  -66.090  30.012  1.00 110.85 ? 68  PRO A CA    1 
ATOM   3981  C C     . PRO G 3 65  ? 56.187  -65.637  30.216  1.00 103.97 ? 68  PRO A C     1 
ATOM   3982  O O     . PRO G 3 65  ? 55.321  -65.967  29.400  1.00 96.88  ? 68  PRO A O     1 
ATOM   3983  C CB    . PRO G 3 65  ? 58.413  -65.051  29.188  1.00 112.90 ? 68  PRO A CB    1 
ATOM   3984  C CG    . PRO G 3 65  ? 59.012  -65.792  28.038  1.00 113.65 ? 68  PRO A CG    1 
ATOM   3985  C CD    . PRO G 3 65  ? 58.140  -66.992  27.837  1.00 114.51 ? 68  PRO A CD    1 
ATOM   3986  N N     . PRO G 3 66  ? 55.928  -64.888  31.301  1.00 99.74  ? 69  PRO A N     1 
ATOM   3987  C CA    . PRO G 3 66  ? 54.567  -64.462  31.608  1.00 98.73  ? 69  PRO A CA    1 
ATOM   3988  C C     . PRO G 3 66  ? 54.118  -63.308  30.712  1.00 103.60 ? 69  PRO A C     1 
ATOM   3989  O O     . PRO G 3 66  ? 54.937  -62.473  30.316  1.00 101.64 ? 69  PRO A O     1 
ATOM   3990  C CB    . PRO G 3 66  ? 54.665  -64.019  33.065  1.00 97.20  ? 69  PRO A CB    1 
ATOM   3991  C CG    . PRO G 3 66  ? 56.076  -63.553  33.219  1.00 98.98  ? 69  PRO A CG    1 
ATOM   3992  C CD    . PRO G 3 66  ? 56.916  -64.324  32.241  1.00 95.48  ? 69  PRO A CD    1 
ATOM   3993  N N     . LYS G 3 67  ? 52.826  -63.276  30.391  1.00 108.47 ? 70  LYS A N     1 
ATOM   3994  C CA    . LYS G 3 67  ? 52.260  -62.218  29.553  1.00 111.32 ? 70  LYS A CA    1 
ATOM   3995  C C     . LYS G 3 67  ? 52.237  -60.870  30.281  1.00 112.09 ? 70  LYS A C     1 
ATOM   3996  O O     . LYS G 3 67  ? 51.652  -60.748  31.368  1.00 103.45 ? 70  LYS A O     1 
ATOM   3997  C CB    . LYS G 3 67  ? 50.851  -62.593  29.089  1.00 111.93 ? 70  LYS A CB    1 
ATOM   3998  C CG    . LYS G 3 67  ? 50.855  -63.664  28.020  1.00 114.53 ? 70  LYS A CG    1 
ATOM   3999  C CD    . LYS G 3 67  ? 49.470  -63.924  27.464  1.00 118.69 ? 70  LYS A CD    1 
ATOM   4000  C CE    . LYS G 3 67  ? 49.561  -64.803  26.227  1.00 123.39 ? 70  LYS A CE    1 
ATOM   4001  N NZ    . LYS G 3 67  ? 48.221  -65.123  25.671  1.00 127.28 ? 70  LYS A NZ    1 
ATOM   4002  N N     . ARG G 3 68  ? 52.864  -59.868  29.656  1.00 105.71 ? 71  ARG A N     1 
ATOM   4003  C CA    . ARG G 3 68  ? 53.027  -58.536  30.243  1.00 97.10  ? 71  ARG A CA    1 
ATOM   4004  C C     . ARG G 3 68  ? 51.679  -57.818  30.336  1.00 92.13  ? 71  ARG A C     1 
ATOM   4005  O O     . ARG G 3 68  ? 51.430  -57.073  31.282  1.00 94.60  ? 71  ARG A O     1 
ATOM   4006  C CB    . ARG G 3 68  ? 54.007  -57.696  29.419  1.00 95.85  ? 71  ARG A CB    1 
ATOM   4007  C CG    . ARG G 3 68  ? 55.358  -58.344  29.132  1.00 97.14  ? 71  ARG A CG    1 
ATOM   4008  C CD    . ARG G 3 68  ? 56.481  -57.877  30.048  1.00 100.16 ? 71  ARG A CD    1 
ATOM   4009  N NE    . ARG G 3 68  ? 57.778  -58.014  29.380  1.00 106.59 ? 71  ARG A NE    1 
ATOM   4010  C CZ    . ARG G 3 68  ? 58.948  -57.618  29.885  1.00 112.51 ? 71  ARG A CZ    1 
ATOM   4011  N NH1   . ARG G 3 68  ? 59.017  -57.064  31.094  1.00 113.88 ? 71  ARG A NH1   1 
ATOM   4012  N NH2   . ARG G 3 68  ? 60.065  -57.785  29.174  1.00 110.65 ? 71  ARG A NH2   1 
ATOM   4013  N N     . TYR G 3 69  ? 50.818  -58.045  29.349  1.00 87.19  ? 72  TYR A N     1 
ATOM   4014  C CA    . TYR G 3 69  ? 49.445  -57.551  29.388  1.00 90.86  ? 72  TYR A CA    1 
ATOM   4015  C C     . TYR G 3 69  ? 48.493  -58.631  28.910  1.00 97.49  ? 72  TYR A C     1 
ATOM   4016  O O     . TYR G 3 69  ? 48.925  -59.735  28.606  1.00 105.91 ? 72  TYR A O     1 
ATOM   4017  C CB    . TYR G 3 69  ? 49.302  -56.291  28.534  1.00 90.62  ? 72  TYR A CB    1 
ATOM   4018  C CG    . TYR G 3 69  ? 49.716  -56.419  27.080  1.00 81.71  ? 72  TYR A CG    1 
ATOM   4019  C CD1   . TYR G 3 69  ? 51.049  -56.309  26.707  1.00 80.47  ? 72  TYR A CD1   1 
ATOM   4020  C CD2   . TYR G 3 69  ? 48.769  -56.587  26.076  1.00 79.08  ? 72  TYR A CD2   1 
ATOM   4021  C CE1   . TYR G 3 69  ? 51.432  -56.394  25.378  1.00 82.51  ? 72  TYR A CE1   1 
ATOM   4022  C CE2   . TYR G 3 69  ? 49.142  -56.672  24.742  1.00 78.43  ? 72  TYR A CE2   1 
ATOM   4023  C CZ    . TYR G 3 69  ? 50.474  -56.580  24.399  1.00 81.30  ? 72  TYR A CZ    1 
ATOM   4024  O OH    . TYR G 3 69  ? 50.863  -56.667  23.080  1.00 86.40  ? 72  TYR A OH    1 
ATOM   4025  N N     . GLU G 3 70  ? 47.205  -58.322  28.839  1.00 103.08 ? 73  GLU A N     1 
ATOM   4026  C CA    . GLU G 3 70  ? 46.220  -59.309  28.426  1.00 114.33 ? 73  GLU A CA    1 
ATOM   4027  C C     . GLU G 3 70  ? 45.500  -58.872  27.165  1.00 114.25 ? 73  GLU A C     1 
ATOM   4028  O O     . GLU G 3 70  ? 45.549  -57.706  26.788  1.00 118.48 ? 73  GLU A O     1 
ATOM   4029  C CB    . GLU G 3 70  ? 45.211  -59.544  29.552  1.00 126.69 ? 73  GLU A CB    1 
ATOM   4030  C CG    . GLU G 3 70  ? 44.883  -61.012  29.783  1.00 134.39 ? 73  GLU A CG    1 
ATOM   4031  C CD    . GLU G 3 70  ? 46.101  -61.825  30.185  1.00 139.49 ? 73  GLU A CD    1 
ATOM   4032  O OE1   . GLU G 3 70  ? 46.380  -62.849  29.527  1.00 141.36 ? 73  GLU A OE1   1 
ATOM   4033  O OE2   . GLU G 3 70  ? 46.793  -61.430  31.147  1.00 145.43 ? 73  GLU A OE2   1 
ATOM   4034  N N     . ASP G 3 71  ? 44.827  -59.820  26.521  1.00 113.38 ? 74  ASP A N     1 
ATOM   4035  C CA    . ASP G 3 71  ? 44.106  -59.545  25.279  1.00 115.50 ? 74  ASP A CA    1 
ATOM   4036  C C     . ASP G 3 71  ? 42.891  -58.647  25.462  1.00 114.07 ? 74  ASP A C     1 
ATOM   4037  O O     . ASP G 3 71  ? 42.501  -57.951  24.528  1.00 122.97 ? 74  ASP A O     1 
ATOM   4038  C CB    . ASP G 3 71  ? 43.664  -60.844  24.598  1.00 114.54 ? 74  ASP A CB    1 
ATOM   4039  C CG    . ASP G 3 71  ? 44.732  -61.423  23.706  1.00 112.64 ? 74  ASP A CG    1 
ATOM   4040  O OD1   . ASP G 3 71  ? 45.929  -61.227  24.000  1.00 112.59 ? 74  ASP A OD1   1 
ATOM   4041  O OD2   . ASP G 3 71  ? 44.366  -62.072  22.706  1.00 112.47 ? 74  ASP A OD2   1 
ATOM   4042  N N     . ALA G 3 72  ? 42.277  -58.676  26.639  1.00 110.46 ? 75  ALA A N     1 
ATOM   4043  C CA    . ALA G 3 72  ? 41.109  -57.836  26.896  1.00 111.45 ? 75  ALA A CA    1 
ATOM   4044  C C     . ALA G 3 72  ? 41.520  -56.470  27.450  1.00 110.20 ? 75  ALA A C     1 
ATOM   4045  O O     . ALA G 3 72  ? 40.724  -55.527  27.425  1.00 104.47 ? 75  ALA A O     1 
ATOM   4046  C CB    . ALA G 3 72  ? 40.139  -58.535  27.835  1.00 111.72 ? 75  ALA A CB    1 
ATOM   4047  N N     . GLU G 3 73  ? 42.752  -56.372  27.953  1.00 110.62 ? 76  GLU A N     1 
ATOM   4048  C CA    . GLU G 3 73  ? 43.328  -55.079  28.327  1.00 116.67 ? 76  GLU A CA    1 
ATOM   4049  C C     . GLU G 3 73  ? 43.454  -54.192  27.086  1.00 118.02 ? 76  GLU A C     1 
ATOM   4050  O O     . GLU G 3 73  ? 43.037  -53.039  27.105  1.00 128.64 ? 76  GLU A O     1 
ATOM   4051  C CB    . GLU G 3 73  ? 44.694  -55.243  29.014  1.00 119.92 ? 76  GLU A CB    1 
ATOM   4052  C CG    . GLU G 3 73  ? 44.636  -55.240  30.534  1.00 121.26 ? 76  GLU A CG    1 
ATOM   4053  C CD    . GLU G 3 73  ? 45.977  -55.555  31.182  1.00 127.24 ? 76  GLU A CD    1 
ATOM   4054  O OE1   . GLU G 3 73  ? 47.002  -54.979  30.762  1.00 122.46 ? 76  GLU A OE1   1 
ATOM   4055  O OE2   . GLU G 3 73  ? 46.008  -56.375  32.125  1.00 134.87 ? 76  GLU A OE2   1 
ATOM   4056  N N     . LEU G 3 74  ? 44.015  -54.749  26.013  1.00 116.19 ? 77  LEU A N     1 
ATOM   4057  C CA    . LEU G 3 74  ? 44.177  -54.042  24.734  1.00 110.16 ? 77  LEU A CA    1 
ATOM   4058  C C     . LEU G 3 74  ? 42.829  -53.742  24.086  1.00 104.13 ? 77  LEU A C     1 
ATOM   4059  O O     . LEU G 3 74  ? 42.648  -52.690  23.488  1.00 115.57 ? 77  LEU A O     1 
ATOM   4060  C CB    . LEU G 3 74  ? 45.024  -54.878  23.766  1.00 110.72 ? 77  LEU A CB    1 
ATOM   4061  C CG    . LEU G 3 74  ? 45.820  -54.181  22.660  1.00 112.38 ? 77  LEU A CG    1 
ATOM   4062  C CD1   . LEU G 3 74  ? 46.457  -55.243  21.780  1.00 114.88 ? 77  LEU A CD1   1 
ATOM   4063  C CD2   . LEU G 3 74  ? 44.997  -53.228  21.805  1.00 113.32 ? 77  LEU A CD2   1 
ATOM   4064  N N     . GLN G 3 75  ? 41.886  -54.669  24.196  1.00 100.25 ? 78  GLN A N     1 
ATOM   4065  C CA    . GLN G 3 75  ? 40.547  -54.466  23.629  1.00 104.21 ? 78  GLN A CA    1 
ATOM   4066  C C     . GLN G 3 75  ? 39.779  -53.336  24.318  1.00 105.02 ? 78  GLN A C     1 
ATOM   4067  O O     . GLN G 3 75  ? 38.968  -52.663  23.680  1.00 104.98 ? 78  GLN A O     1 
ATOM   4068  C CB    . GLN G 3 75  ? 39.729  -55.765  23.668  1.00 107.01 ? 78  GLN A CB    1 
ATOM   4069  C CG    . GLN G 3 75  ? 39.400  -56.337  22.295  1.00 106.93 ? 78  GLN A CG    1 
ATOM   4070  C CD    . GLN G 3 75  ? 38.262  -55.611  21.600  1.00 108.59 ? 78  GLN A CD    1 
ATOM   4071  O OE1   . GLN G 3 75  ? 37.888  -55.965  20.482  1.00 106.30 ? 78  GLN A OE1   1 
ATOM   4072  N NE2   . GLN G 3 75  ? 37.702  -54.596  22.254  1.00 107.74 ? 78  GLN A NE2   1 
ATOM   4073  N N     . ALA G 3 76  ? 40.033  -53.136  25.611  1.00 103.25 ? 79  ALA A N     1 
ATOM   4074  C CA    . ALA G 3 76  ? 39.468  -52.002  26.347  1.00 101.43 ? 79  ALA A CA    1 
ATOM   4075  C C     . ALA G 3 76  ? 39.935  -50.687  25.730  1.00 100.94 ? 79  ALA A C     1 
ATOM   4076  O O     . ALA G 3 76  ? 39.122  -49.799  25.465  1.00 106.24 ? 79  ALA A O     1 
ATOM   4077  C CB    . ALA G 3 76  ? 39.870  -52.061  27.815  1.00 103.05 ? 79  ALA A CB    1 
ATOM   4078  N N     . LEU G 3 77  ? 41.245  -50.576  25.505  1.00 93.03  ? 80  LEU A N     1 
ATOM   4079  C CA    . LEU G 3 77  ? 41.832  -49.424  24.815  1.00 88.76  ? 80  LEU A CA    1 
ATOM   4080  C C     . LEU G 3 77  ? 41.142  -49.138  23.483  1.00 90.37  ? 80  LEU A C     1 
ATOM   4081  O O     . LEU G 3 77  ? 40.876  -47.979  23.157  1.00 98.05  ? 80  LEU A O     1 
ATOM   4082  C CB    . LEU G 3 77  ? 43.336  -49.625  24.575  1.00 85.61  ? 80  LEU A CB    1 
ATOM   4083  C CG    . LEU G 3 77  ? 44.294  -49.129  25.660  1.00 87.38  ? 80  LEU A CG    1 
ATOM   4084  C CD1   . LEU G 3 77  ? 44.002  -49.757  27.011  1.00 86.89  ? 80  LEU A CD1   1 
ATOM   4085  C CD2   . LEU G 3 77  ? 45.735  -49.398  25.258  1.00 88.66  ? 80  LEU A CD2   1 
ATOM   4086  N N     . LEU G 3 78  ? 40.859  -50.185  22.713  1.00 88.61  ? 81  LEU A N     1 
ATOM   4087  C CA    . LEU G 3 78  ? 40.235  -50.002  21.406  1.00 93.09  ? 81  LEU A CA    1 
ATOM   4088  C C     . LEU G 3 78  ? 38.747  -49.687  21.534  1.00 98.04  ? 81  LEU A C     1 
ATOM   4089  O O     . LEU G 3 78  ? 38.175  -49.025  20.676  1.00 102.79 ? 81  LEU A O     1 
ATOM   4090  C CB    . LEU G 3 78  ? 40.453  -51.222  20.504  1.00 92.18  ? 81  LEU A CB    1 
ATOM   4091  C CG    . LEU G 3 78  ? 41.890  -51.685  20.217  1.00 91.32  ? 81  LEU A CG    1 
ATOM   4092  C CD1   . LEU G 3 78  ? 41.908  -52.567  18.978  1.00 93.64  ? 81  LEU A CD1   1 
ATOM   4093  C CD2   . LEU G 3 78  ? 42.862  -50.534  20.032  1.00 93.22  ? 81  LEU A CD2   1 
ATOM   4094  N N     . ASP G 3 79  ? 38.117  -50.150  22.606  1.00 106.21 ? 82  ASP A N     1 
ATOM   4095  C CA    . ASP G 3 79  ? 36.698  -49.873  22.816  1.00 112.52 ? 82  ASP A CA    1 
ATOM   4096  C C     . ASP G 3 79  ? 36.441  -48.390  23.105  1.00 112.85 ? 82  ASP A C     1 
ATOM   4097  O O     . ASP G 3 79  ? 35.459  -47.834  22.609  1.00 119.70 ? 82  ASP A O     1 
ATOM   4098  C CB    . ASP G 3 79  ? 36.120  -50.757  23.931  1.00 117.72 ? 82  ASP A CB    1 
ATOM   4099  C CG    . ASP G 3 79  ? 35.858  -52.193  23.476  1.00 115.97 ? 82  ASP A CG    1 
ATOM   4100  O OD1   . ASP G 3 79  ? 35.645  -52.418  22.265  1.00 112.86 ? 82  ASP A OD1   1 
ATOM   4101  O OD2   . ASP G 3 79  ? 35.857  -53.100  24.337  1.00 117.29 ? 82  ASP A OD2   1 
ATOM   4102  N N     . GLU G 3 80  ? 37.314  -47.749  23.885  1.00 110.57 ? 83  GLU A N     1 
ATOM   4103  C CA    . GLU G 3 80  ? 37.182  -46.302  24.125  1.00 113.47 ? 83  GLU A CA    1 
ATOM   4104  C C     . GLU G 3 80  ? 37.594  -45.497  22.888  1.00 110.76 ? 83  GLU A C     1 
ATOM   4105  O O     . GLU G 3 80  ? 36.821  -44.668  22.409  1.00 112.74 ? 83  GLU A O     1 
ATOM   4106  C CB    . GLU G 3 80  ? 37.917  -45.835  25.398  1.00 112.98 ? 83  GLU A CB    1 
ATOM   4107  C CG    . GLU G 3 80  ? 39.418  -46.085  25.466  1.00 116.69 ? 83  GLU A CG    1 
ATOM   4108  C CD    . GLU G 3 80  ? 40.002  -45.802  26.846  1.00 121.01 ? 83  GLU A CD    1 
ATOM   4109  O OE1   . GLU G 3 80  ? 41.246  -45.809  26.982  1.00 118.30 ? 83  GLU A OE1   1 
ATOM   4110  O OE2   . GLU G 3 80  ? 39.224  -45.576  27.802  1.00 121.36 ? 83  GLU A OE2   1 
ATOM   4111  N N     . ASP G 3 81  ? 38.783  -45.764  22.356  1.00 108.10 ? 84  ASP A N     1 
ATOM   4112  C CA    . ASP G 3 81  ? 39.231  -45.132  21.115  1.00 108.32 ? 84  ASP A CA    1 
ATOM   4113  C C     . ASP G 3 81  ? 39.875  -46.178  20.195  1.00 105.26 ? 84  ASP A C     1 
ATOM   4114  O O     . ASP G 3 81  ? 41.027  -46.579  20.395  1.00 100.63 ? 84  ASP A O     1 
ATOM   4115  C CB    . ASP G 3 81  ? 40.210  -43.990  21.419  1.00 113.01 ? 84  ASP A CB    1 
ATOM   4116  C CG    . ASP G 3 81  ? 40.460  -43.087  20.216  1.00 115.29 ? 84  ASP A CG    1 
ATOM   4117  O OD1   . ASP G 3 81  ? 39.628  -43.077  19.284  1.00 112.63 ? 84  ASP A OD1   1 
ATOM   4118  O OD2   . ASP G 3 81  ? 41.491  -42.376  20.207  1.00 121.35 ? 84  ASP A OD2   1 
ATOM   4119  N N     . ASP G 3 82  ? 39.126  -46.615  19.184  1.00 97.77  ? 85  ASP A N     1 
ATOM   4120  C CA    . ASP G 3 82  ? 39.586  -47.696  18.314  1.00 91.85  ? 85  ASP A CA    1 
ATOM   4121  C C     . ASP G 3 82  ? 40.598  -47.282  17.250  1.00 91.19  ? 85  ASP A C     1 
ATOM   4122  O O     . ASP G 3 82  ? 41.159  -48.146  16.582  1.00 94.77  ? 85  ASP A O     1 
ATOM   4123  C CB    . ASP G 3 82  ? 38.403  -48.445  17.672  1.00 94.66  ? 85  ASP A CB    1 
ATOM   4124  C CG    . ASP G 3 82  ? 37.595  -47.598  16.735  1.00 96.69  ? 85  ASP A CG    1 
ATOM   4125  O OD1   . ASP G 3 82  ? 38.008  -46.468  16.432  1.00 111.58 ? 85  ASP A OD1   1 
ATOM   4126  O OD2   . ASP G 3 82  ? 36.540  -48.079  16.281  1.00 102.00 ? 85  ASP A OD2   1 
ATOM   4127  N N     . ALA G 3 83  ? 40.838  -45.980  17.087  1.00 93.30  ? 86  ALA A N     1 
ATOM   4128  C CA    . ALA G 3 83  ? 41.774  -45.497  16.068  1.00 87.04  ? 86  ALA A CA    1 
ATOM   4129  C C     . ALA G 3 83  ? 42.976  -44.813  16.695  1.00 81.91  ? 86  ALA A C     1 
ATOM   4130  O O     . ALA G 3 83  ? 43.250  -43.653  16.417  1.00 88.98  ? 86  ALA A O     1 
ATOM   4131  C CB    . ALA G 3 83  ? 41.070  -44.565  15.094  1.00 83.10  ? 86  ALA A CB    1 
ATOM   4132  N N     . GLN G 3 84  ? 43.694  -45.541  17.540  1.00 75.49  ? 87  GLN A N     1 
ATOM   4133  C CA    . GLN G 3 84  ? 44.982  -45.079  18.032  1.00 76.38  ? 87  GLN A CA    1 
ATOM   4134  C C     . GLN G 3 84  ? 46.088  -45.681  17.166  1.00 77.73  ? 87  GLN A C     1 
ATOM   4135  O O     . GLN G 3 84  ? 45.815  -46.525  16.320  1.00 80.01  ? 87  GLN A O     1 
ATOM   4136  C CB    . GLN G 3 84  ? 45.169  -45.473  19.490  1.00 76.13  ? 87  GLN A CB    1 
ATOM   4137  C CG    . GLN G 3 84  ? 43.989  -45.113  20.381  1.00 76.82  ? 87  GLN A CG    1 
ATOM   4138  C CD    . GLN G 3 84  ? 44.224  -45.479  21.842  1.00 79.74  ? 87  GLN A CD    1 
ATOM   4139  O OE1   . GLN G 3 84  ? 45.345  -45.362  22.352  1.00 75.99  ? 87  GLN A OE1   1 
ATOM   4140  N NE2   . GLN G 3 84  ? 43.167  -45.928  22.523  1.00 78.74  ? 87  GLN A NE2   1 
ATOM   4141  N N     . THR G 3 85  ? 47.322  -45.219  17.344  1.00 79.82  ? 88  THR A N     1 
ATOM   4142  C CA    . THR G 3 85  ? 48.466  -45.829  16.678  1.00 86.91  ? 88  THR A CA    1 
ATOM   4143  C C     . THR G 3 85  ? 48.992  -46.935  17.565  1.00 93.35  ? 88  THR A C     1 
ATOM   4144  O O     . THR G 3 85  ? 48.600  -47.040  18.730  1.00 98.54  ? 88  THR A O     1 
ATOM   4145  C CB    . THR G 3 85  ? 49.621  -44.837  16.439  1.00 92.76  ? 88  THR A CB    1 
ATOM   4146  O OG1   . THR G 3 85  ? 49.973  -44.190  17.672  1.00 91.14  ? 88  THR A OG1   1 
ATOM   4147  C CG2   . THR G 3 85  ? 49.242  -43.805  15.380  1.00 94.59  ? 88  THR A CG2   1 
ATOM   4148  N N     . GLN G 3 86  ? 49.895  -47.751  17.028  1.00 91.77  ? 89  GLN A N     1 
ATOM   4149  C CA    . GLN G 3 86  ? 50.493  -48.807  17.826  1.00 86.54  ? 89  GLN A CA    1 
ATOM   4150  C C     . GLN G 3 86  ? 51.337  -48.225  18.944  1.00 86.39  ? 89  GLN A C     1 
ATOM   4151  O O     . GLN G 3 86  ? 51.231  -48.667  20.082  1.00 89.67  ? 89  GLN A O     1 
ATOM   4152  C CB    . GLN G 3 86  ? 51.304  -49.767  16.964  1.00 83.71  ? 89  GLN A CB    1 
ATOM   4153  C CG    . GLN G 3 86  ? 50.425  -50.776  16.239  1.00 78.90  ? 89  GLN A CG    1 
ATOM   4154  C CD    . GLN G 3 86  ? 51.198  -51.620  15.254  1.00 75.37  ? 89  GLN A CD    1 
ATOM   4155  O OE1   . GLN G 3 86  ? 52.413  -51.787  15.378  1.00 78.57  ? 89  GLN A OE1   1 
ATOM   4156  N NE2   . GLN G 3 86  ? 50.504  -52.146  14.258  1.00 71.73  ? 89  GLN A NE2   1 
ATOM   4157  N N     . LYS G 3 87  ? 52.144  -47.216  18.634  1.00 91.28  ? 90  LYS A N     1 
ATOM   4158  C CA    . LYS G 3 87  ? 52.945  -46.547  19.661  1.00 95.14  ? 90  LYS A CA    1 
ATOM   4159  C C     . LYS G 3 87  ? 52.052  -46.020  20.786  1.00 89.98  ? 90  LYS A C     1 
ATOM   4160  O O     . LYS G 3 87  ? 52.408  -46.124  21.955  1.00 83.69  ? 90  LYS A O     1 
ATOM   4161  C CB    . LYS G 3 87  ? 53.778  -45.396  19.071  1.00 106.04 ? 90  LYS A CB    1 
ATOM   4162  C CG    . LYS G 3 87  ? 54.977  -44.993  19.932  1.00 114.91 ? 90  LYS A CG    1 
ATOM   4163  C CD    . LYS G 3 87  ? 55.205  -43.481  19.982  1.00 116.51 ? 90  LYS A CD    1 
ATOM   4164  C CE    . LYS G 3 87  ? 55.493  -42.892  18.609  1.00 118.05 ? 90  LYS A CE    1 
ATOM   4165  N NZ    . LYS G 3 87  ? 56.127  -41.549  18.699  1.00 120.37 ? 90  LYS A NZ    1 
ATOM   4166  N N     . GLN G 3 88  ? 50.894  -45.466  20.423  1.00 92.06  ? 91  GLN A N     1 
ATOM   4167  C CA    . GLN G 3 88  ? 49.962  -44.875  21.401  1.00 92.75  ? 91  GLN A CA    1 
ATOM   4168  C C     . GLN G 3 88  ? 49.360  -45.919  22.327  1.00 88.22  ? 91  GLN A C     1 
ATOM   4169  O O     . GLN G 3 88  ? 49.125  -45.644  23.503  1.00 93.08  ? 91  GLN A O     1 
ATOM   4170  C CB    . GLN G 3 88  ? 48.829  -44.107  20.700  1.00 93.43  ? 91  GLN A CB    1 
ATOM   4171  C CG    . GLN G 3 88  ? 49.195  -42.697  20.262  1.00 93.23  ? 91  GLN A CG    1 
ATOM   4172  C CD    . GLN G 3 88  ? 48.207  -42.122  19.267  1.00 94.45  ? 91  GLN A CD    1 
ATOM   4173  O OE1   . GLN G 3 88  ? 48.589  -41.681  18.185  1.00 101.06 ? 91  GLN A OE1   1 
ATOM   4174  N NE2   . GLN G 3 88  ? 46.930  -42.133  19.621  1.00 94.89  ? 91  GLN A NE2   1 
ATOM   4175  N N     . LEU G 3 89  ? 49.092  -47.105  21.786  1.00 84.77  ? 92  LEU A N     1 
ATOM   4176  C CA    . LEU G 3 89  ? 48.567  -48.222  22.575  1.00 81.40  ? 92  LEU A CA    1 
ATOM   4177  C C     . LEU G 3 89  ? 49.695  -48.823  23.400  1.00 83.19  ? 92  LEU A C     1 
ATOM   4178  O O     . LEU G 3 89  ? 49.540  -49.082  24.594  1.00 86.44  ? 92  LEU A O     1 
ATOM   4179  C CB    . LEU G 3 89  ? 47.971  -49.286  21.666  1.00 75.10  ? 92  LEU A CB    1 
ATOM   4180  C CG    . LEU G 3 89  ? 46.798  -48.797  20.818  1.00 75.84  ? 92  LEU A CG    1 
ATOM   4181  C CD1   . LEU G 3 89  ? 46.701  -49.562  19.507  1.00 78.29  ? 92  LEU A CD1   1 
ATOM   4182  C CD2   . LEU G 3 89  ? 45.493  -48.878  21.591  1.00 74.16  ? 92  LEU A CD2   1 
ATOM   4183  N N     . ALA G 3 90  ? 50.832  -49.031  22.748  1.00 79.94  ? 93  ALA A N     1 
ATOM   4184  C CA    . ALA G 3 90  ? 52.034  -49.502  23.412  1.00 82.07  ? 93  ALA A CA    1 
ATOM   4185  C C     . ALA G 3 90  ? 52.338  -48.673  24.652  1.00 85.91  ? 93  ALA A C     1 
ATOM   4186  O O     . ALA G 3 90  ? 52.468  -49.219  25.749  1.00 81.37  ? 93  ALA A O     1 
ATOM   4187  C CB    . ALA G 3 90  ? 53.208  -49.458  22.446  1.00 84.03  ? 93  ALA A CB    1 
ATOM   4188  N N     . GLU G 3 91  ? 52.427  -47.355  24.463  1.00 96.39  ? 94  GLU A N     1 
ATOM   4189  C CA    . GLU G 3 91  ? 52.693  -46.397  25.545  1.00 104.19 ? 94  GLU A CA    1 
ATOM   4190  C C     . GLU G 3 91  ? 51.831  -46.690  26.775  1.00 103.31 ? 94  GLU A C     1 
ATOM   4191  O O     . GLU G 3 91  ? 52.341  -46.780  27.893  1.00 109.53 ? 94  GLU A O     1 
ATOM   4192  C CB    . GLU G 3 91  ? 52.425  -44.960  25.066  1.00 114.45 ? 94  GLU A CB    1 
ATOM   4193  C CG    . GLU G 3 91  ? 53.331  -43.902  25.685  1.00 123.40 ? 94  GLU A CG    1 
ATOM   4194  C CD    . GLU G 3 91  ? 54.581  -43.624  24.860  1.00 127.88 ? 94  GLU A CD    1 
ATOM   4195  O OE1   . GLU G 3 91  ? 54.511  -43.654  23.611  1.00 127.72 ? 94  GLU A OE1   1 
ATOM   4196  O OE2   . GLU G 3 91  ? 55.638  -43.358  25.468  1.00 132.09 ? 94  GLU A OE2   1 
ATOM   4197  N N     . GLN G 3 92  ? 50.527  -46.849  26.550  1.00 97.19  ? 95  GLN A N     1 
ATOM   4198  C CA    . GLN G 3 92  ? 49.568  -47.126  27.623  1.00 96.27  ? 95  GLN A CA    1 
ATOM   4199  C C     . GLN G 3 92  ? 49.793  -48.481  28.317  1.00 101.66 ? 95  GLN A C     1 
ATOM   4200  O O     . GLN G 3 92  ? 49.410  -48.661  29.475  1.00 100.71 ? 95  GLN A O     1 
ATOM   4201  C CB    . GLN G 3 92  ? 48.141  -47.054  27.071  1.00 93.16  ? 95  GLN A CB    1 
ATOM   4202  C CG    . GLN G 3 92  ? 47.688  -45.644  26.730  1.00 91.91  ? 95  GLN A CG    1 
ATOM   4203  C CD    . GLN G 3 92  ? 46.425  -45.611  25.888  1.00 90.40  ? 95  GLN A CD    1 
ATOM   4204  O OE1   . GLN G 3 92  ? 45.310  -45.525  26.413  1.00 88.12  ? 95  GLN A OE1   1 
ATOM   4205  N NE2   . GLN G 3 92  ? 46.595  -45.681  24.573  1.00 86.32  ? 95  GLN A NE2   1 
ATOM   4206  N N     . LEU G 3 93  ? 50.415  -49.421  27.603  1.00 106.19 ? 96  LEU A N     1 
ATOM   4207  C CA    . LEU G 3 93  ? 50.665  -50.783  28.103  1.00 103.51 ? 96  LEU A CA    1 
ATOM   4208  C C     . LEU G 3 93  ? 52.117  -50.997  28.544  1.00 101.70 ? 96  LEU A C     1 
ATOM   4209  O O     . LEU G 3 93  ? 52.534  -52.127  28.788  1.00 92.84  ? 96  LEU A O     1 
ATOM   4210  C CB    . LEU G 3 93  ? 50.292  -51.808  27.019  1.00 98.60  ? 96  LEU A CB    1 
ATOM   4211  C CG    . LEU G 3 93  ? 48.817  -52.214  26.871  1.00 92.53  ? 96  LEU A CG    1 
ATOM   4212  C CD1   . LEU G 3 93  ? 47.836  -51.118  27.267  1.00 94.02  ? 96  LEU A CD1   1 
ATOM   4213  C CD2   . LEU G 3 93  ? 48.559  -52.655  25.442  1.00 89.46  ? 96  LEU A CD2   1 
ATOM   4214  N N     . GLU G 3 94  ? 52.883  -49.912  28.635  1.00 108.87 ? 97  GLU A N     1 
ATOM   4215  C CA    . GLU G 3 94  ? 54.269  -49.964  29.106  1.00 113.37 ? 97  GLU A CA    1 
ATOM   4216  C C     . GLU G 3 94  ? 55.082  -50.989  28.319  1.00 105.80 ? 97  GLU A C     1 
ATOM   4217  O O     . GLU G 3 94  ? 56.020  -51.584  28.842  1.00 104.02 ? 97  GLU A O     1 
ATOM   4218  C CB    . GLU G 3 94  ? 54.309  -50.276  30.610  1.00 119.56 ? 97  GLU A CB    1 
ATOM   4219  C CG    . GLU G 3 94  ? 53.374  -49.405  31.443  1.00 127.98 ? 97  GLU A CG    1 
ATOM   4220  C CD    . GLU G 3 94  ? 53.261  -49.860  32.888  1.00 132.75 ? 97  GLU A CD    1 
ATOM   4221  O OE1   . GLU G 3 94  ? 54.305  -50.047  33.546  1.00 137.68 ? 97  GLU A OE1   1 
ATOM   4222  O OE2   . GLU G 3 94  ? 52.121  -50.020  33.372  1.00 134.05 ? 97  GLU A OE2   1 
ATOM   4223  N N     . VAL G 3 95  ? 54.721  -51.165  27.050  1.00 102.08 ? 98  VAL A N     1 
ATOM   4224  C CA    . VAL G 3 95  ? 55.300  -52.193  26.196  1.00 102.06 ? 98  VAL A CA    1 
ATOM   4225  C C     . VAL G 3 95  ? 55.715  -51.560  24.867  1.00 96.25  ? 98  VAL A C     1 
ATOM   4226  O O     . VAL G 3 95  ? 55.303  -50.445  24.569  1.00 94.68  ? 98  VAL A O     1 
ATOM   4227  C CB    . VAL G 3 95  ? 54.283  -53.339  25.975  1.00 103.84 ? 98  VAL A CB    1 
ATOM   4228  C CG1   . VAL G 3 95  ? 53.328  -53.024  24.831  1.00 103.27 ? 98  VAL A CG1   1 
ATOM   4229  C CG2   . VAL G 3 95  ? 54.988  -54.667  25.733  1.00 104.12 ? 98  VAL A CG2   1 
ATOM   4230  N N     . SER G 3 96  ? 56.521  -52.259  24.071  1.00 94.30  ? 99  SER A N     1 
ATOM   4231  C CA    . SER G 3 96  ? 57.004  -51.701  22.805  1.00 94.27  ? 99  SER A CA    1 
ATOM   4232  C C     . SER G 3 96  ? 55.910  -51.677  21.747  1.00 91.15  ? 99  SER A C     1 
ATOM   4233  O O     . SER G 3 96  ? 54.901  -52.380  21.854  1.00 79.36  ? 99  SER A O     1 
ATOM   4234  C CB    . SER G 3 96  ? 58.218  -52.471  22.259  1.00 96.36  ? 99  SER A CB    1 
ATOM   4235  O OG    . SER G 3 96  ? 57.828  -53.521  21.381  1.00 92.76  ? 99  SER A OG    1 
ATOM   4236  N N     . GLN G 3 97  ? 56.136  -50.855  20.725  1.00 92.41  ? 100 GLN A N     1 
ATOM   4237  C CA    . GLN G 3 97  ? 55.228  -50.757  19.591  1.00 90.90  ? 100 GLN A CA    1 
ATOM   4238  C C     . GLN G 3 97  ? 55.140  -52.110  18.900  1.00 90.31  ? 100 GLN A C     1 
ATOM   4239  O O     . GLN G 3 97  ? 54.043  -52.615  18.664  1.00 91.40  ? 100 GLN A O     1 
ATOM   4240  C CB    . GLN G 3 97  ? 55.686  -49.656  18.621  1.00 88.70  ? 100 GLN A CB    1 
ATOM   4241  C CG    . GLN G 3 97  ? 55.020  -49.694  17.253  1.00 87.23  ? 100 GLN A CG    1 
ATOM   4242  C CD    . GLN G 3 97  ? 55.748  -50.601  16.283  1.00 90.41  ? 100 GLN A CD    1 
ATOM   4243  O OE1   . GLN G 3 97  ? 56.977  -50.617  16.251  1.00 99.26  ? 100 GLN A OE1   1 
ATOM   4244  N NE2   . GLN G 3 97  ? 54.998  -51.355  15.483  1.00 86.98  ? 100 GLN A NE2   1 
ATOM   4245  N N     . GLN G 3 98  ? 56.298  -52.698  18.605  1.00 90.53  ? 101 GLN A N     1 
ATOM   4246  C CA    . GLN G 3 98  ? 56.366  -53.998  17.928  1.00 91.91  ? 101 GLN A CA    1 
ATOM   4247  C C     . GLN G 3 98  ? 55.510  -55.054  18.625  1.00 94.00  ? 101 GLN A C     1 
ATOM   4248  O O     . GLN G 3 98  ? 54.723  -55.762  17.981  1.00 88.03  ? 101 GLN A O     1 
ATOM   4249  C CB    . GLN G 3 98  ? 57.809  -54.496  17.858  1.00 88.87  ? 101 GLN A CB    1 
ATOM   4250  C CG    . GLN G 3 98  ? 58.668  -53.768  16.843  1.00 89.07  ? 101 GLN A CG    1 
ATOM   4251  C CD    . GLN G 3 98  ? 59.328  -52.521  17.390  1.00 86.68  ? 101 GLN A CD    1 
ATOM   4252  O OE1   . GLN G 3 98  ? 58.971  -52.022  18.457  1.00 82.53  ? 101 GLN A OE1   1 
ATOM   4253  N NE2   . GLN G 3 98  ? 60.299  -52.004  16.648  1.00 88.40  ? 101 GLN A NE2   1 
ATOM   4254  N N     . ALA G 3 99  ? 55.671  -55.138  19.945  1.00 92.30  ? 102 ALA A N     1 
ATOM   4255  C CA    . ALA G 3 99  ? 54.901  -56.058  20.776  1.00 91.27  ? 102 ALA A CA    1 
ATOM   4256  C C     . ALA G 3 99  ? 53.392  -55.911  20.579  1.00 88.34  ? 102 ALA A C     1 
ATOM   4257  O O     . ALA G 3 99  ? 52.647  -56.869  20.779  1.00 87.80  ? 102 ALA A O     1 
ATOM   4258  C CB    . ALA G 3 99  ? 55.259  -55.860  22.242  1.00 94.60  ? 102 ALA A CB    1 
ATOM   4259  N N     . VAL G 3 100 ? 52.943  -54.718  20.199  1.00 88.72  ? 103 VAL A N     1 
ATOM   4260  C CA    . VAL G 3 100 ? 51.532  -54.509  19.886  1.00 90.16  ? 103 VAL A CA    1 
ATOM   4261  C C     . VAL G 3 100 ? 51.190  -55.014  18.486  1.00 86.90  ? 103 VAL A C     1 
ATOM   4262  O O     . VAL G 3 100 ? 50.175  -55.676  18.311  1.00 89.07  ? 103 VAL A O     1 
ATOM   4263  C CB    . VAL G 3 100 ? 51.113  -53.034  20.038  1.00 90.70  ? 103 VAL A CB    1 
ATOM   4264  C CG1   . VAL G 3 100 ? 49.633  -52.853  19.715  1.00 90.54  ? 103 VAL A CG1   1 
ATOM   4265  C CG2   . VAL G 3 100 ? 51.402  -52.558  21.451  1.00 92.02  ? 103 VAL A CG2   1 
ATOM   4266  N N     . SER G 3 101 ? 52.025  -54.712  17.496  1.00 86.34  ? 104 SER A N     1 
ATOM   4267  C CA    . SER G 3 101 ? 51.783  -55.179  16.123  1.00 90.72  ? 104 SER A CA    1 
ATOM   4268  C C     . SER G 3 101 ? 51.336  -56.640  16.103  1.00 92.00  ? 104 SER A C     1 
ATOM   4269  O O     . SER G 3 101 ? 50.347  -56.995  15.450  1.00 87.55  ? 104 SER A O     1 
ATOM   4270  C CB    . SER G 3 101 ? 53.041  -55.033  15.259  1.00 93.40  ? 104 SER A CB    1 
ATOM   4271  O OG    . SER G 3 101 ? 52.747  -55.307  13.897  1.00 93.40  ? 104 SER A OG    1 
ATOM   4272  N N     . ASN G 3 102 ? 52.076  -57.463  16.844  1.00 92.89  ? 105 ASN A N     1 
ATOM   4273  C CA    . ASN G 3 102 ? 51.852  -58.905  16.920  1.00 89.04  ? 105 ASN A CA    1 
ATOM   4274  C C     . ASN G 3 102 ? 50.499  -59.262  17.540  1.00 87.53  ? 105 ASN A C     1 
ATOM   4275  O O     . ASN G 3 102 ? 49.639  -59.841  16.879  1.00 88.04  ? 105 ASN A O     1 
ATOM   4276  C CB    . ASN G 3 102 ? 52.984  -59.558  17.717  1.00 88.14  ? 105 ASN A CB    1 
ATOM   4277  C CG    . ASN G 3 102 ? 54.351  -59.294  17.115  1.00 90.14  ? 105 ASN A CG    1 
ATOM   4278  O OD1   . ASN G 3 102 ? 54.487  -59.128  15.900  1.00 92.67  ? 105 ASN A OD1   1 
ATOM   4279  N ND2   . ASN G 3 102 ? 55.374  -59.251  17.964  1.00 91.42  ? 105 ASN A ND2   1 
ATOM   4280  N N     . ARG G 3 103 ? 50.308  -58.897  18.802  1.00 85.10  ? 106 ARG A N     1 
ATOM   4281  C CA    . ARG G 3 103 ? 49.045  -59.147  19.508  1.00 88.30  ? 106 ARG A CA    1 
ATOM   4282  C C     . ARG G 3 103 ? 47.801  -58.755  18.738  1.00 90.25  ? 106 ARG A C     1 
ATOM   4283  O O     . ARG G 3 103 ? 46.720  -59.276  19.011  1.00 91.74  ? 106 ARG A O     1 
ATOM   4284  C CB    . ARG G 3 103 ? 49.022  -58.383  20.823  1.00 92.98  ? 106 ARG A CB    1 
ATOM   4285  C CG    . ARG G 3 103 ? 49.587  -59.167  21.981  1.00 92.82  ? 106 ARG A CG    1 
ATOM   4286  C CD    . ARG G 3 103 ? 48.566  -60.120  22.569  1.00 89.51  ? 106 ARG A CD    1 
ATOM   4287  N NE    . ARG G 3 103 ? 48.416  -59.883  23.999  1.00 88.18  ? 106 ARG A NE    1 
ATOM   4288  C CZ    . ARG G 3 103 ? 49.383  -60.048  24.901  1.00 88.01  ? 106 ARG A CZ    1 
ATOM   4289  N NH1   . ARG G 3 103 ? 49.138  -59.799  26.176  1.00 88.09  ? 106 ARG A NH1   1 
ATOM   4290  N NH2   . ARG G 3 103 ? 50.596  -60.446  24.543  1.00 87.45  ? 106 ARG A NH2   1 
ATOM   4291  N N     . LEU G 3 104 ? 47.953  -57.802  17.821  1.00 94.19  ? 107 LEU A N     1 
ATOM   4292  C CA    . LEU G 3 104 ? 46.864  -57.349  16.975  1.00 95.57  ? 107 LEU A CA    1 
ATOM   4293  C C     . LEU G 3 104 ? 46.623  -58.317  15.827  1.00 95.63  ? 107 LEU A C     1 
ATOM   4294  O O     . LEU G 3 104 ? 45.479  -58.496  15.417  1.00 95.29  ? 107 LEU A O     1 
ATOM   4295  C CB    . LEU G 3 104 ? 47.147  -55.942  16.434  1.00 102.25 ? 107 LEU A CB    1 
ATOM   4296  C CG    . LEU G 3 104 ? 47.085  -54.764  17.415  1.00 100.37 ? 107 LEU A CG    1 
ATOM   4297  C CD1   . LEU G 3 104 ? 47.613  -53.512  16.729  1.00 103.93 ? 107 LEU A CD1   1 
ATOM   4298  C CD2   . LEU G 3 104 ? 45.673  -54.531  17.932  1.00 100.39 ? 107 LEU A CD2   1 
ATOM   4299  N N     . ARG G 3 105 ? 47.691  -58.917  15.293  1.00 102.71 ? 108 ARG A N     1 
ATOM   4300  C CA    . ARG G 3 105 ? 47.558  -60.035  14.337  1.00 107.66 ? 108 ARG A CA    1 
ATOM   4301  C C     . ARG G 3 105 ? 46.959  -61.239  15.040  1.00 103.74 ? 108 ARG A C     1 
ATOM   4302  O O     . ARG G 3 105 ? 46.096  -61.927  14.499  1.00 99.03  ? 108 ARG A O     1 
ATOM   4303  C CB    . ARG G 3 105 ? 48.906  -60.504  13.814  1.00 110.94 ? 108 ARG A CB    1 
ATOM   4304  C CG    . ARG G 3 105 ? 49.697  -59.518  13.003  1.00 120.32 ? 108 ARG A CG    1 
ATOM   4305  C CD    . ARG G 3 105 ? 51.131  -60.010  12.939  1.00 129.59 ? 108 ARG A CD    1 
ATOM   4306  N NE    . ARG G 3 105 ? 51.618  -60.037  11.571  1.00 140.97 ? 108 ARG A NE    1 
ATOM   4307  C CZ    . ARG G 3 105 ? 52.621  -60.797  11.143  1.00 150.87 ? 108 ARG A CZ    1 
ATOM   4308  N NH1   . ARG G 3 105 ? 53.275  -61.608  11.974  1.00 154.35 ? 108 ARG A NH1   1 
ATOM   4309  N NH2   . ARG G 3 105 ? 52.971  -60.750  9.867   1.00 152.53 ? 108 ARG A NH2   1 
ATOM   4310  N N     . GLU G 3 106 ? 47.477  -61.499  16.238  1.00 100.06 ? 109 GLU A N     1 
ATOM   4311  C CA    . GLU G 3 106 ? 47.033  -62.602  17.067  1.00 98.37  ? 109 GLU A CA    1 
ATOM   4312  C C     . GLU G 3 106 ? 45.526  -62.513  17.264  1.00 93.34  ? 109 GLU A C     1 
ATOM   4313  O O     . GLU G 3 106 ? 44.808  -63.461  16.972  1.00 102.03 ? 109 GLU A O     1 
ATOM   4314  C CB    . GLU G 3 106 ? 47.765  -62.574  18.408  1.00 106.41 ? 109 GLU A CB    1 
ATOM   4315  C CG    . GLU G 3 106 ? 47.676  -63.863  19.198  1.00 113.72 ? 109 GLU A CG    1 
ATOM   4316  C CD    . GLU G 3 106 ? 48.466  -63.807  20.493  1.00 121.11 ? 109 GLU A CD    1 
ATOM   4317  O OE1   . GLU G 3 106 ? 49.700  -63.592  20.437  1.00 123.99 ? 109 GLU A OE1   1 
ATOM   4318  O OE2   . GLU G 3 106 ? 47.853  -63.986  21.566  1.00 121.08 ? 109 GLU A OE2   1 
ATOM   4319  N N     . MET G 3 107 ? 45.041  -61.367  17.730  1.00 88.09  ? 110 MET A N     1 
ATOM   4320  C CA    . MET G 3 107 ? 43.599  -61.110  17.758  1.00 86.82  ? 110 MET A CA    1 
ATOM   4321  C C     . MET G 3 107 ? 43.120  -60.921  16.317  1.00 86.35  ? 110 MET A C     1 
ATOM   4322  O O     . MET G 3 107 ? 43.927  -60.896  15.391  1.00 86.86  ? 110 MET A O     1 
ATOM   4323  C CB    . MET G 3 107 ? 43.287  -59.892  18.628  1.00 87.69  ? 110 MET A CB    1 
ATOM   4324  C CG    . MET G 3 107 ? 43.629  -60.113  20.096  1.00 91.18  ? 110 MET A CG    1 
ATOM   4325  S SD    . MET G 3 107 ? 44.171  -58.644  20.991  1.00 95.28  ? 110 MET A SD    1 
ATOM   4326  C CE    . MET G 3 107 ? 42.633  -57.733  21.082  1.00 95.26  ? 110 MET A CE    1 
ATOM   4327  N N     . GLY G 3 108 ? 41.820  -60.791  16.102  1.00 85.50  ? 111 GLY A N     1 
ATOM   4328  C CA    . GLY G 3 108 ? 41.308  -60.773  14.729  1.00 91.11  ? 111 GLY A CA    1 
ATOM   4329  C C     . GLY G 3 108 ? 41.562  -59.500  13.935  1.00 95.66  ? 111 GLY A C     1 
ATOM   4330  O O     . GLY G 3 108 ? 41.095  -59.382  12.805  1.00 100.37 ? 111 GLY A O     1 
ATOM   4331  N N     . LYS G 3 109 ? 42.341  -58.575  14.496  1.00 96.97  ? 112 LYS A N     1 
ATOM   4332  C CA    . LYS G 3 109 ? 42.249  -57.153  14.144  1.00 92.48  ? 112 LYS A CA    1 
ATOM   4333  C C     . LYS G 3 109 ? 42.915  -56.772  12.835  1.00 88.43  ? 112 LYS A C     1 
ATOM   4334  O O     . LYS G 3 109 ? 44.009  -57.242  12.537  1.00 85.78  ? 112 LYS A O     1 
ATOM   4335  C CB    . LYS G 3 109 ? 42.867  -56.305  15.257  1.00 93.49  ? 112 LYS A CB    1 
ATOM   4336  C CG    . LYS G 3 109 ? 42.292  -56.547  16.645  1.00 96.44  ? 112 LYS A CG    1 
ATOM   4337  C CD    . LYS G 3 109 ? 40.791  -56.313  16.684  1.00 98.70  ? 112 LYS A CD    1 
ATOM   4338  C CE    . LYS G 3 109 ? 40.277  -56.221  18.114  1.00 102.04 ? 112 LYS A CE    1 
ATOM   4339  N NZ    . LYS G 3 109 ? 38.805  -56.004  18.146  1.00 103.89 ? 112 LYS A NZ    1 
ATOM   4340  N N     . ILE G 3 110 ? 42.253  -55.900  12.073  1.00 87.86  ? 113 ILE A N     1 
ATOM   4341  C CA    . ILE G 3 110 ? 42.872  -55.252  10.908  1.00 93.74  ? 113 ILE A CA    1 
ATOM   4342  C C     . ILE G 3 110 ? 42.683  -53.732  10.909  1.00 94.80  ? 113 ILE A C     1 
ATOM   4343  O O     . ILE G 3 110 ? 41.731  -53.206  11.488  1.00 96.67  ? 113 ILE A O     1 
ATOM   4344  C CB    . ILE G 3 110 ? 42.337  -55.795  9.567   1.00 90.22  ? 113 ILE A CB    1 
ATOM   4345  C CG1   . ILE G 3 110 ? 40.820  -55.966  9.632   1.00 89.77  ? 113 ILE A CG1   1 
ATOM   4346  C CG2   . ILE G 3 110 ? 43.038  -57.092  9.201   1.00 89.96  ? 113 ILE A CG2   1 
ATOM   4347  C CD1   . ILE G 3 110 ? 40.177  -56.145  8.277   1.00 94.72  ? 113 ILE A CD1   1 
ATOM   4348  N N     . GLN G 3 111 ? 43.600  -53.042  10.237  1.00 93.62  ? 114 GLN A N     1 
ATOM   4349  C CA    . GLN G 3 111 ? 43.526  -51.598  10.076  1.00 94.53  ? 114 GLN A CA    1 
ATOM   4350  C C     . GLN G 3 111 ? 42.653  -51.284  8.880   1.00 86.94  ? 114 GLN A C     1 
ATOM   4351  O O     . GLN G 3 111 ? 42.801  -51.896  7.831   1.00 84.45  ? 114 GLN A O     1 
ATOM   4352  C CB    . GLN G 3 111 ? 44.925  -51.013  9.841   1.00 101.11 ? 114 GLN A CB    1 
ATOM   4353  C CG    . GLN G 3 111 ? 45.092  -49.589  10.350  1.00 101.87 ? 114 GLN A CG    1 
ATOM   4354  C CD    . GLN G 3 111 ? 46.233  -48.856  9.676   1.00 100.70 ? 114 GLN A CD    1 
ATOM   4355  O OE1   . GLN G 3 111 ? 46.334  -48.849  8.449   1.00 98.48  ? 114 GLN A OE1   1 
ATOM   4356  N NE2   . GLN G 3 111 ? 47.087  -48.216  10.473  1.00 100.41 ? 114 GLN A NE2   1 
ATOM   4357  N N     . LYS G 3 112 ? 41.749  -50.326  9.026   1.00 88.53  ? 115 LYS A N     1 
ATOM   4358  C CA    . LYS G 3 112 ? 40.980  -49.840  7.877   1.00 92.42  ? 115 LYS A CA    1 
ATOM   4359  C C     . LYS G 3 112 ? 40.675  -48.346  7.973   1.00 90.41  ? 115 LYS A C     1 
ATOM   4360  O O     . LYS G 3 112 ? 40.310  -47.845  9.041   1.00 84.89  ? 115 LYS A O     1 
ATOM   4361  C CB    . LYS G 3 112 ? 39.681  -50.632  7.705   1.00 91.77  ? 115 LYS A CB    1 
ATOM   4362  C CG    . LYS G 3 112 ? 39.049  -51.103  9.004   1.00 92.05  ? 115 LYS A CG    1 
ATOM   4363  C CD    . LYS G 3 112 ? 37.546  -51.334  8.878   1.00 91.68  ? 115 LYS A CD    1 
ATOM   4364  C CE    . LYS G 3 112 ? 37.130  -52.056  7.607   1.00 91.15  ? 115 LYS A CE    1 
ATOM   4365  N NZ    . LYS G 3 112 ? 35.677  -52.386  7.628   1.00 90.91  ? 115 LYS A NZ    1 
ATOM   4366  N N     . VAL G 3 113 ? 40.826  -47.653  6.843   1.00 89.82  ? 116 VAL A N     1 
ATOM   4367  C CA    . VAL G 3 113 ? 40.561  -46.217  6.768   1.00 90.60  ? 116 VAL A CA    1 
ATOM   4368  C C     . VAL G 3 113 ? 39.064  -45.966  6.828   1.00 85.29  ? 116 VAL A C     1 
ATOM   4369  O O     . VAL G 3 113 ? 38.288  -46.688  6.215   1.00 80.20  ? 116 VAL A O     1 
ATOM   4370  C CB    . VAL G 3 113 ? 41.143  -45.567  5.489   1.00 93.80  ? 116 VAL A CB    1 
ATOM   4371  C CG1   . VAL G 3 113 ? 42.635  -45.855  5.370   1.00 97.40  ? 116 VAL A CG1   1 
ATOM   4372  C CG2   . VAL G 3 113 ? 40.410  -46.041  4.245   1.00 95.64  ? 116 VAL A CG2   1 
ATOM   4373  N N     . GLY G 3 114 ? 38.667  -44.944  7.577   1.00 89.21  ? 117 GLY A N     1 
ATOM   4374  C CA    . GLY G 3 114 ? 37.257  -44.587  7.718   1.00 92.30  ? 117 GLY A CA    1 
ATOM   4375  C C     . GLY G 3 114 ? 36.684  -43.948  6.467   1.00 90.11  ? 117 GLY A C     1 
ATOM   4376  O O     . GLY G 3 114 ? 37.358  -43.829  5.441   1.00 83.31  ? 117 GLY A O     1 
ATOM   4377  N N     . ARG G 3 115 ? 35.431  -43.526  6.552   1.00 90.59  ? 118 ARG A N     1 
ATOM   4378  C CA    . ARG G 3 115 ? 34.778  -42.905  5.413   1.00 95.79  ? 118 ARG A CA    1 
ATOM   4379  C C     . ARG G 3 115 ? 34.703  -41.401  5.548   1.00 93.67  ? 118 ARG A C     1 
ATOM   4380  O O     . ARG G 3 115 ? 34.554  -40.866  6.651   1.00 93.00  ? 118 ARG A O     1 
ATOM   4381  C CB    . ARG G 3 115 ? 33.369  -43.454  5.238   1.00 103.72 ? 118 ARG A CB    1 
ATOM   4382  C CG    . ARG G 3 115 ? 33.306  -44.699  4.376   1.00 111.56 ? 118 ARG A CG    1 
ATOM   4383  C CD    . ARG G 3 115 ? 31.912  -45.292  4.403   1.00 113.84 ? 118 ARG A CD    1 
ATOM   4384  N NE    . ARG G 3 115 ? 30.960  -44.430  3.713   1.00 116.11 ? 118 ARG A NE    1 
ATOM   4385  C CZ    . ARG G 3 115 ? 30.695  -44.481  2.410   1.00 119.90 ? 118 ARG A CZ    1 
ATOM   4386  N NH1   . ARG G 3 115 ? 31.312  -45.353  1.616   1.00 114.57 ? 118 ARG A NH1   1 
ATOM   4387  N NH2   . ARG G 3 115 ? 29.802  -43.642  1.894   1.00 127.19 ? 118 ARG A NH2   1 
ATOM   4388  N N     . TRP G 3 116 ? 34.809  -40.729  4.404   1.00 89.49  ? 119 TRP A N     1 
ATOM   4389  C CA    . TRP G 3 116 ? 34.460  -39.322  4.296   1.00 81.02  ? 119 TRP A CA    1 
ATOM   4390  C C     . TRP G 3 116 ? 32.957  -39.189  4.433   1.00 76.79  ? 119 TRP A C     1 
ATOM   4391  O O     . TRP G 3 116 ? 32.205  -39.992  3.892   1.00 79.28  ? 119 TRP A O     1 
ATOM   4392  C CB    . TRP G 3 116 ? 34.868  -38.746  2.938   1.00 78.44  ? 119 TRP A CB    1 
ATOM   4393  C CG    . TRP G 3 116 ? 36.284  -38.319  2.817   1.00 74.74  ? 119 TRP A CG    1 
ATOM   4394  C CD1   . TRP G 3 116 ? 37.111  -38.578  1.780   1.00 74.57  ? 119 TRP A CD1   1 
ATOM   4395  C CD2   . TRP G 3 116 ? 37.036  -37.525  3.750   1.00 73.55  ? 119 TRP A CD2   1 
ATOM   4396  N NE1   . TRP G 3 116 ? 38.340  -38.005  2.002   1.00 78.93  ? 119 TRP A NE1   1 
ATOM   4397  C CE2   . TRP G 3 116 ? 38.319  -37.351  3.203   1.00 71.56  ? 119 TRP A CE2   1 
ATOM   4398  C CE3   . TRP G 3 116 ? 36.746  -36.942  4.991   1.00 73.03  ? 119 TRP A CE3   1 
ATOM   4399  C CZ2   . TRP G 3 116 ? 39.316  -36.634  3.849   1.00 69.71  ? 119 TRP A CZ2   1 
ATOM   4400  C CZ3   . TRP G 3 116 ? 37.736  -36.225  5.634   1.00 72.88  ? 119 TRP A CZ3   1 
ATOM   4401  C CH2   . TRP G 3 116 ? 39.008  -36.077  5.061   1.00 73.06  ? 119 TRP A CH2   1 
ATOM   4402  N N     . VAL G 3 117 ? 32.526  -38.166  5.152   1.00 74.28  ? 120 VAL A N     1 
ATOM   4403  C CA    . VAL G 3 117 ? 31.115  -37.904  5.332   1.00 75.15  ? 120 VAL A CA    1 
ATOM   4404  C C     . VAL G 3 117 ? 30.937  -36.400  5.077   1.00 81.32  ? 120 VAL A C     1 
ATOM   4405  O O     . VAL G 3 117 ? 31.687  -35.594  5.619   1.00 93.11  ? 120 VAL A O     1 
ATOM   4406  C CB    . VAL G 3 117 ? 30.668  -38.406  6.723   1.00 71.05  ? 120 VAL A CB    1 
ATOM   4407  C CG1   . VAL G 3 117 ? 30.995  -37.421  7.823   1.00 73.25  ? 120 VAL A CG1   1 
ATOM   4408  C CG2   . VAL G 3 117 ? 29.197  -38.713  6.733   1.00 71.83  ? 120 VAL A CG2   1 
ATOM   4409  N N     . PRO G 3 118 ? 29.967  -36.016  4.229   1.00 84.81  ? 121 PRO A N     1 
ATOM   4410  C CA    . PRO G 3 118 ? 30.054  -34.721  3.536   1.00 86.07  ? 121 PRO A CA    1 
ATOM   4411  C C     . PRO G 3 118 ? 30.103  -33.444  4.384   1.00 85.90  ? 121 PRO A C     1 
ATOM   4412  O O     . PRO G 3 118 ? 30.537  -32.413  3.875   1.00 88.39  ? 121 PRO A O     1 
ATOM   4413  C CB    . PRO G 3 118 ? 28.804  -34.713  2.652   1.00 87.98  ? 121 PRO A CB    1 
ATOM   4414  C CG    . PRO G 3 118 ? 27.851  -35.619  3.327   1.00 86.92  ? 121 PRO A CG    1 
ATOM   4415  C CD    . PRO G 3 118 ? 28.677  -36.683  3.984   1.00 86.34  ? 121 PRO A CD    1 
ATOM   4416  N N     . HIS G 3 119 ? 29.666  -33.482  5.637   1.00 84.36  ? 122 HIS A N     1 
ATOM   4417  C CA    . HIS G 3 119 ? 29.689  -32.274  6.464   1.00 87.18  ? 122 HIS A CA    1 
ATOM   4418  C C     . HIS G 3 119 ? 29.612  -32.603  7.948   1.00 80.97  ? 122 HIS A C     1 
ATOM   4419  O O     . HIS G 3 119 ? 29.254  -33.715  8.316   1.00 79.68  ? 122 HIS A O     1 
ATOM   4420  C CB    . HIS G 3 119 ? 28.534  -31.345  6.064   1.00 95.14  ? 122 HIS A CB    1 
ATOM   4421  C CG    . HIS G 3 119 ? 28.556  -30.022  6.760   1.00 104.47 ? 122 HIS A CG    1 
ATOM   4422  N ND1   . HIS G 3 119 ? 29.355  -28.978  6.347   1.00 105.02 ? 122 HIS A ND1   1 
ATOM   4423  C CD2   . HIS G 3 119 ? 27.885  -29.577  7.849   1.00 108.10 ? 122 HIS A CD2   1 
ATOM   4424  C CE1   . HIS G 3 119 ? 29.176  -27.947  7.153   1.00 111.31 ? 122 HIS A CE1   1 
ATOM   4425  N NE2   . HIS G 3 119 ? 28.287  -28.283  8.071   1.00 112.60 ? 122 HIS A NE2   1 
ATOM   4426  N N     . GLU G 3 120 ? 29.973  -31.647  8.799   1.00 81.99  ? 123 GLU A N     1 
ATOM   4427  C CA    . GLU G 3 120 ? 29.807  -31.823  10.234  1.00 88.70  ? 123 GLU A CA    1 
ATOM   4428  C C     . GLU G 3 120 ? 28.486  -31.217  10.718  1.00 88.20  ? 123 GLU A C     1 
ATOM   4429  O O     . GLU G 3 120 ? 28.389  -30.027  11.003  1.00 91.95  ? 123 GLU A O     1 
ATOM   4430  C CB    . GLU G 3 120 ? 30.990  -31.257  11.010  1.00 89.14  ? 123 GLU A CB    1 
ATOM   4431  C CG    . GLU G 3 120 ? 30.876  -31.553  12.496  1.00 94.98  ? 123 GLU A CG    1 
ATOM   4432  C CD    . GLU G 3 120 ? 32.211  -31.696  13.194  1.00 106.16 ? 123 GLU A CD    1 
ATOM   4433  O OE1   . GLU G 3 120 ? 33.245  -31.319  12.597  1.00 114.80 ? 123 GLU A OE1   1 
ATOM   4434  O OE2   . GLU G 3 120 ? 32.220  -32.187  14.348  1.00 106.93 ? 123 GLU A OE2   1 
ATOM   4435  N N     . LEU G 3 121 ? 27.471  -32.063  10.810  1.00 85.98  ? 124 LEU A N     1 
ATOM   4436  C CA    . LEU G 3 121 ? 26.146  -31.631  11.212  1.00 81.63  ? 124 LEU A CA    1 
ATOM   4437  C C     . LEU G 3 121 ? 26.143  -31.320  12.687  1.00 81.13  ? 124 LEU A C     1 
ATOM   4438  O O     . LEU G 3 121 ? 26.906  -31.899  13.452  1.00 88.59  ? 124 LEU A O     1 
ATOM   4439  C CB    . LEU G 3 121 ? 25.117  -32.730  10.944  1.00 79.67  ? 124 LEU A CB    1 
ATOM   4440  C CG    . LEU G 3 121 ? 25.075  -33.292  9.524   1.00 78.41  ? 124 LEU A CG    1 
ATOM   4441  C CD1   . LEU G 3 121 ? 24.072  -34.424  9.437   1.00 83.50  ? 124 LEU A CD1   1 
ATOM   4442  C CD2   . LEU G 3 121 ? 24.741  -32.218  8.510   1.00 77.28  ? 124 LEU A CD2   1 
ATOM   4443  N N     . ASN G 3 122 ? 25.279  -30.399  13.079  1.00 81.10  ? 125 ASN A N     1 
ATOM   4444  C CA    . ASN G 3 122 ? 25.011  -30.134  14.478  1.00 83.51  ? 125 ASN A CA    1 
ATOM   4445  C C     . ASN G 3 122 ? 23.606  -30.604  14.756  1.00 79.82  ? 125 ASN A C     1 
ATOM   4446  O O     . ASN G 3 122 ? 22.846  -30.878  13.830  1.00 74.94  ? 125 ASN A O     1 
ATOM   4447  C CB    . ASN G 3 122 ? 25.125  -28.642  14.784  1.00 91.00  ? 125 ASN A CB    1 
ATOM   4448  C CG    . ASN G 3 122 ? 24.057  -27.817  14.079  1.00 95.15  ? 125 ASN A CG    1 
ATOM   4449  O OD1   . ASN G 3 122 ? 23.891  -27.902  12.857  1.00 83.34  ? 125 ASN A OD1   1 
ATOM   4450  N ND2   . ASN G 3 122 ? 23.327  -27.012  14.849  1.00 100.95 ? 125 ASN A ND2   1 
ATOM   4451  N N     . GLU G 3 123 ? 23.245  -30.657  16.028  1.00 82.10  ? 126 GLU A N     1 
ATOM   4452  C CA    . GLU G 3 123 ? 21.951  -31.186  16.411  1.00 88.68  ? 126 GLU A CA    1 
ATOM   4453  C C     . GLU G 3 123 ? 20.810  -30.617  15.563  1.00 88.99  ? 126 GLU A C     1 
ATOM   4454  O O     . GLU G 3 123 ? 19.970  -31.370  15.075  1.00 91.56  ? 126 GLU A O     1 
ATOM   4455  C CB    . GLU G 3 123 ? 21.705  -30.972  17.903  1.00 99.64  ? 126 GLU A CB    1 
ATOM   4456  C CG    . GLU G 3 123 ? 22.552  -31.891  18.778  1.00 111.59 ? 126 GLU A CG    1 
ATOM   4457  C CD    . GLU G 3 123 ? 21.747  -32.550  19.886  1.00 124.70 ? 126 GLU A CD    1 
ATOM   4458  O OE1   . GLU G 3 123 ? 21.549  -31.910  20.945  1.00 130.98 ? 126 GLU A OE1   1 
ATOM   4459  O OE2   . GLU G 3 123 ? 21.312  -33.710  19.693  1.00 127.28 ? 126 GLU A OE2   1 
ATOM   4460  N N     . ARG G 3 124 ? 20.787  -29.307  15.350  1.00 91.03  ? 127 ARG A N     1 
ATOM   4461  C CA    . ARG G 3 124 ? 19.715  -28.722  14.551  1.00 88.27  ? 127 ARG A CA    1 
ATOM   4462  C C     . ARG G 3 124 ? 19.725  -29.295  13.149  1.00 80.95  ? 127 ARG A C     1 
ATOM   4463  O O     . ARG G 3 124 ? 18.702  -29.757  12.672  1.00 84.00  ? 127 ARG A O     1 
ATOM   4464  C CB    . ARG G 3 124 ? 19.806  -27.205  14.507  1.00 95.63  ? 127 ARG A CB    1 
ATOM   4465  C CG    . ARG G 3 124 ? 19.281  -26.552  15.770  1.00 101.54 ? 127 ARG A CG    1 
ATOM   4466  C CD    . ARG G 3 124 ? 19.385  -25.037  15.708  1.00 106.74 ? 127 ARG A CD    1 
ATOM   4467  N NE    . ARG G 3 124 ? 18.257  -24.361  16.355  1.00 105.86 ? 127 ARG A NE    1 
ATOM   4468  C CZ    . ARG G 3 124 ? 17.086  -24.107  15.767  1.00 106.90 ? 127 ARG A CZ    1 
ATOM   4469  N NH1   . ARG G 3 124 ? 16.136  -23.476  16.444  1.00 106.98 ? 127 ARG A NH1   1 
ATOM   4470  N NH2   . ARG G 3 124 ? 16.846  -24.480  14.510  1.00 105.23 ? 127 ARG A NH2   1 
ATOM   4471  N N     . GLN G 3 125 ? 20.880  -29.293  12.499  1.00 76.23  ? 128 GLN A N     1 
ATOM   4472  C CA    . GLN G 3 125 ? 20.978  -29.853  11.146  1.00 76.59  ? 128 GLN A CA    1 
ATOM   4473  C C     . GLN G 3 125 ? 20.585  -31.329  11.077  1.00 74.91  ? 128 GLN A C     1 
ATOM   4474  O O     . GLN G 3 125 ? 20.020  -31.774  10.075  1.00 71.86  ? 128 GLN A O     1 
ATOM   4475  C CB    . GLN G 3 125 ? 22.388  -29.681  10.598  1.00 77.02  ? 128 GLN A CB    1 
ATOM   4476  C CG    . GLN G 3 125 ? 22.648  -28.290  10.066  1.00 79.92  ? 128 GLN A CG    1 
ATOM   4477  C CD    . GLN G 3 125 ? 24.106  -28.042  9.787   1.00 81.06  ? 128 GLN A CD    1 
ATOM   4478  O OE1   . GLN G 3 125 ? 24.510  -27.853  8.642   1.00 81.56  ? 128 GLN A OE1   1 
ATOM   4479  N NE2   . GLN G 3 125 ? 24.908  -28.042  10.836  1.00 84.58  ? 128 GLN A NE2   1 
ATOM   4480  N N     . MET G 3 126 ? 20.891  -32.068  12.144  1.00 72.22  ? 129 MET A N     1 
ATOM   4481  C CA    . MET G 3 126 ? 20.520  -33.477  12.268  1.00 70.22  ? 129 MET A CA    1 
ATOM   4482  C C     . MET G 3 126 ? 19.003  -33.644  12.349  1.00 72.30  ? 129 MET A C     1 
ATOM   4483  O O     . MET G 3 126 ? 18.397  -34.202  11.429  1.00 71.59  ? 129 MET A O     1 
ATOM   4484  C CB    . MET G 3 126 ? 21.219  -34.128  13.480  1.00 69.80  ? 129 MET A CB    1 
ATOM   4485  C CG    . MET G 3 126 ? 22.565  -34.764  13.134  1.00 70.64  ? 129 MET A CG    1 
ATOM   4486  S SD    . MET G 3 126 ? 23.792  -34.826  14.459  1.00 74.53  ? 129 MET A SD    1 
ATOM   4487  C CE    . MET G 3 126 ? 22.828  -35.376  15.861  1.00 70.09  ? 129 MET A CE    1 
ATOM   4488  N N     . GLU G 3 127 ? 18.386  -33.137  13.418  1.00 74.79  ? 130 GLU A N     1 
ATOM   4489  C CA    . GLU G 3 127 ? 16.934  -33.272  13.603  1.00 79.62  ? 130 GLU A CA    1 
ATOM   4490  C C     . GLU G 3 127 ? 16.141  -32.838  12.382  1.00 78.75  ? 130 GLU A C     1 
ATOM   4491  O O     . GLU G 3 127 ? 15.077  -33.381  12.117  1.00 84.50  ? 130 GLU A O     1 
ATOM   4492  C CB    . GLU G 3 127 ? 16.446  -32.482  14.812  1.00 82.52  ? 130 GLU A CB    1 
ATOM   4493  C CG    . GLU G 3 127 ? 14.988  -32.731  15.208  1.00 92.20  ? 130 GLU A CG    1 
ATOM   4494  C CD    . GLU G 3 127 ? 14.753  -34.042  15.958  1.00 100.83 ? 130 GLU A CD    1 
ATOM   4495  O OE1   . GLU G 3 127 ? 15.548  -34.989  15.798  1.00 104.46 ? 130 GLU A OE1   1 
ATOM   4496  O OE2   . GLU G 3 127 ? 13.763  -34.135  16.720  1.00 106.70 ? 130 GLU A OE2   1 
ATOM   4497  N N     . ARG G 3 128 ? 16.651  -31.861  11.644  1.00 77.67  ? 131 ARG A N     1 
ATOM   4498  C CA    . ARG G 3 128 ? 16.008  -31.434  10.412  1.00 79.85  ? 131 ARG A CA    1 
ATOM   4499  C C     . ARG G 3 128 ? 15.862  -32.613  9.462   1.00 76.37  ? 131 ARG A C     1 
ATOM   4500  O O     . ARG G 3 128 ? 14.751  -32.935  9.038   1.00 72.33  ? 131 ARG A O     1 
ATOM   4501  C CB    . ARG G 3 128 ? 16.805  -30.309  9.751   1.00 86.51  ? 131 ARG A CB    1 
ATOM   4502  C CG    . ARG G 3 128 ? 16.115  -29.671  8.554   1.00 91.69  ? 131 ARG A CG    1 
ATOM   4503  C CD    . ARG G 3 128 ? 16.623  -28.255  8.333   1.00 99.90  ? 131 ARG A CD    1 
ATOM   4504  N NE    . ARG G 3 128 ? 16.715  -27.897  6.919   1.00 105.35 ? 131 ARG A NE    1 
ATOM   4505  C CZ    . ARG G 3 128 ? 15.676  -27.592  6.144   1.00 113.40 ? 131 ARG A CZ    1 
ATOM   4506  N NH1   . ARG G 3 128 ? 14.438  -27.601  6.633   1.00 119.55 ? 131 ARG A NH1   1 
ATOM   4507  N NH2   . ARG G 3 128 ? 15.875  -27.278  4.866   1.00 109.66 ? 131 ARG A NH2   1 
ATOM   4508  N N     . ARG G 3 129 ? 16.984  -33.258  9.150   1.00 73.87  ? 132 ARG A N     1 
ATOM   4509  C CA    . ARG G 3 129 ? 16.979  -34.470  8.336   1.00 71.54  ? 132 ARG A CA    1 
ATOM   4510  C C     . ARG G 3 129 ? 16.057  -35.536  8.924   1.00 69.94  ? 132 ARG A C     1 
ATOM   4511  O O     . ARG G 3 129 ? 15.168  -36.042  8.245   1.00 68.74  ? 132 ARG A O     1 
ATOM   4512  C CB    . ARG G 3 129 ? 18.381  -35.050  8.239   1.00 71.62  ? 132 ARG A CB    1 
ATOM   4513  C CG    . ARG G 3 129 ? 19.285  -34.327  7.272   1.00 71.05  ? 132 ARG A CG    1 
ATOM   4514  C CD    . ARG G 3 129 ? 20.739  -34.526  7.667   1.00 73.64  ? 132 ARG A CD    1 
ATOM   4515  N NE    . ARG G 3 129 ? 21.132  -35.931  7.669   1.00 73.36  ? 132 ARG A NE    1 
ATOM   4516  C CZ    . ARG G 3 129 ? 21.518  -36.609  6.594   1.00 76.53  ? 132 ARG A CZ    1 
ATOM   4517  N NH1   . ARG G 3 129 ? 21.565  -36.017  5.410   1.00 73.49  ? 132 ARG A NH1   1 
ATOM   4518  N NH2   . ARG G 3 129 ? 21.855  -37.893  6.701   1.00 81.87  ? 132 ARG A NH2   1 
ATOM   4519  N N     . LYS G 3 130 ? 16.259  -35.876  10.189  1.00 66.62  ? 133 LYS A N     1 
ATOM   4520  C CA    . LYS G 3 130 ? 15.423  -36.888  10.810  1.00 69.17  ? 133 LYS A CA    1 
ATOM   4521  C C     . LYS G 3 130 ? 13.952  -36.606  10.578  1.00 74.03  ? 133 LYS A C     1 
ATOM   4522  O O     . LYS G 3 130 ? 13.185  -37.499  10.244  1.00 78.90  ? 133 LYS A O     1 
ATOM   4523  C CB    . LYS G 3 130 ? 15.673  -36.960  12.304  1.00 70.41  ? 133 LYS A CB    1 
ATOM   4524  C CG    . LYS G 3 130 ? 14.731  -37.916  13.016  1.00 72.93  ? 133 LYS A CG    1 
ATOM   4525  C CD    . LYS G 3 130 ? 15.287  -38.311  14.370  1.00 77.50  ? 133 LYS A CD    1 
ATOM   4526  C CE    . LYS G 3 130 ? 14.248  -39.007  15.224  1.00 79.33  ? 133 LYS A CE    1 
ATOM   4527  N NZ    . LYS G 3 130 ? 14.703  -39.010  16.637  1.00 83.75  ? 133 LYS A NZ    1 
ATOM   4528  N N     . ASN G 3 131 ? 13.565  -35.352  10.766  1.00 81.12  ? 134 ASN A N     1 
ATOM   4529  C CA    . ASN G 3 131 ? 12.166  -34.962  10.692  1.00 76.59  ? 134 ASN A CA    1 
ATOM   4530  C C     . ASN G 3 131 ? 11.648  -35.038  9.268   1.00 67.41  ? 134 ASN A C     1 
ATOM   4531  O O     . ASN G 3 131 ? 10.544  -35.493  9.030   1.00 64.97  ? 134 ASN A O     1 
ATOM   4532  C CB    . ASN G 3 131 ? 11.981  -33.546  11.246  1.00 81.45  ? 134 ASN A CB    1 
ATOM   4533  C CG    . ASN G 3 131 ? 10.576  -33.299  11.740  1.00 86.60  ? 134 ASN A CG    1 
ATOM   4534  O OD1   . ASN G 3 131 ? 10.174  -33.845  12.764  1.00 93.45  ? 134 ASN A OD1   1 
ATOM   4535  N ND2   . ASN G 3 131 ? 9.820   -32.478  11.018  1.00 87.12  ? 134 ASN A ND2   1 
ATOM   4536  N N     . THR G 3 132 ? 12.445  -34.584  8.318   1.00 66.01  ? 135 THR A N     1 
ATOM   4537  C CA    . THR G 3 132 ? 12.009  -34.567  6.930   1.00 69.40  ? 135 THR A CA    1 
ATOM   4538  C C     . THR G 3 132 ? 11.840  -35.992  6.410   1.00 71.05  ? 135 THR A C     1 
ATOM   4539  O O     . THR G 3 132 ? 10.945  -36.269  5.619   1.00 70.21  ? 135 THR A O     1 
ATOM   4540  C CB    . THR G 3 132 ? 13.005  -33.805  6.042   1.00 67.87  ? 135 THR A CB    1 
ATOM   4541  O OG1   . THR G 3 132 ? 13.246  -32.515  6.606   1.00 68.08  ? 135 THR A OG1   1 
ATOM   4542  C CG2   . THR G 3 132 ? 12.464  -33.648  4.632   1.00 67.28  ? 135 THR A CG2   1 
ATOM   4543  N N     . CYS G 3 133 ? 12.709  -36.890  6.858   1.00 73.35  ? 136 CYS A N     1 
ATOM   4544  C CA    . CYS G 3 133 ? 12.579  -38.296  6.532   1.00 75.68  ? 136 CYS A CA    1 
ATOM   4545  C C     . CYS G 3 133 ? 11.288  -38.822  7.209   1.00 68.49  ? 136 CYS A C     1 
ATOM   4546  O O     . CYS G 3 133 ? 10.338  -39.193  6.525   1.00 59.15  ? 136 CYS A O     1 
ATOM   4547  C CB    . CYS G 3 133 ? 13.856  -39.070  6.941   1.00 85.96  ? 136 CYS A CB    1 
ATOM   4548  S SG    . CYS G 3 133 ? 15.403  -38.562  6.092   1.00 95.51  ? 136 CYS A SG    1 
ATOM   4549  N N     . GLU G 3 134 ? 11.226  -38.787  8.538   1.00 68.18  ? 137 GLU A N     1 
ATOM   4550  C CA    . GLU G 3 134 ? 10.009  -39.170  9.271   1.00 73.17  ? 137 GLU A CA    1 
ATOM   4551  C C     . GLU G 3 134 ? 8.716   -38.830  8.527   1.00 77.04  ? 137 GLU A C     1 
ATOM   4552  O O     . GLU G 3 134 ? 7.811   -39.655  8.421   1.00 82.34  ? 137 GLU A O     1 
ATOM   4553  C CB    . GLU G 3 134 ? 9.974   -38.509  10.652  1.00 75.29  ? 137 GLU A CB    1 
ATOM   4554  C CG    . GLU G 3 134 ? 10.746  -39.267  11.717  1.00 85.20  ? 137 GLU A CG    1 
ATOM   4555  C CD    . GLU G 3 134 ? 10.665  -38.628  13.097  1.00 94.51  ? 137 GLU A CD    1 
ATOM   4556  O OE1   . GLU G 3 134 ? 11.085  -39.271  14.094  1.00 92.37  ? 137 GLU A OE1   1 
ATOM   4557  O OE2   . GLU G 3 134 ? 10.185  -37.478  13.187  1.00 106.09 ? 137 GLU A OE2   1 
ATOM   4558  N N     . ILE G 3 135 ? 8.642   -37.609  8.015   1.00 83.60  ? 138 ILE A N     1 
ATOM   4559  C CA    . ILE G 3 135 ? 7.457   -37.123  7.321   1.00 86.28  ? 138 ILE A CA    1 
ATOM   4560  C C     . ILE G 3 135 ? 7.282   -37.779  5.959   1.00 85.47  ? 138 ILE A C     1 
ATOM   4561  O O     . ILE G 3 135 ? 6.195   -38.246  5.640   1.00 93.84  ? 138 ILE A O     1 
ATOM   4562  C CB    . ILE G 3 135 ? 7.504   -35.589  7.172   1.00 87.48  ? 138 ILE A CB    1 
ATOM   4563  C CG1   . ILE G 3 135 ? 7.229   -34.954  8.532   1.00 89.43  ? 138 ILE A CG1   1 
ATOM   4564  C CG2   . ILE G 3 135 ? 6.486   -35.103  6.150   1.00 88.20  ? 138 ILE A CG2   1 
ATOM   4565  C CD1   . ILE G 3 135 ? 7.452   -33.462  8.571   1.00 94.24  ? 138 ILE A CD1   1 
ATOM   4566  N N     . LEU G 3 136 ? 8.342   -37.797  5.161   1.00 84.25  ? 139 LEU A N     1 
ATOM   4567  C CA    . LEU G 3 136 ? 8.298   -38.408  3.832   1.00 87.10  ? 139 LEU A CA    1 
ATOM   4568  C C     . LEU G 3 136 ? 7.949   -39.904  3.887   1.00 88.89  ? 139 LEU A C     1 
ATOM   4569  O O     . LEU G 3 136 ? 7.248   -40.419  3.011   1.00 86.70  ? 139 LEU A O     1 
ATOM   4570  C CB    . LEU G 3 136 ? 9.638   -38.225  3.124   1.00 90.57  ? 139 LEU A CB    1 
ATOM   4571  C CG    . LEU G 3 136 ? 10.015  -36.794  2.739   1.00 91.79  ? 139 LEU A CG    1 
ATOM   4572  C CD1   . LEU G 3 136 ? 11.510  -36.685  2.478   1.00 93.87  ? 139 LEU A CD1   1 
ATOM   4573  C CD2   . LEU G 3 136 ? 9.234   -36.328  1.525   1.00 92.36  ? 139 LEU A CD2   1 
ATOM   4574  N N     . LEU G 3 137 ? 8.460   -40.598  4.903   1.00 88.45  ? 140 LEU A N     1 
ATOM   4575  C CA    . LEU G 3 137 ? 8.053   -41.977  5.173   1.00 87.94  ? 140 LEU A CA    1 
ATOM   4576  C C     . LEU G 3 137 ? 6.555   -42.018  5.406   1.00 93.43  ? 140 LEU A C     1 
ATOM   4577  O O     . LEU G 3 137 ? 5.821   -42.568  4.596   1.00 104.21 ? 140 LEU A O     1 
ATOM   4578  C CB    . LEU G 3 137 ? 8.781   -42.553  6.397   1.00 84.10  ? 140 LEU A CB    1 
ATOM   4579  C CG    . LEU G 3 137 ? 9.926   -43.552  6.192   1.00 81.53  ? 140 LEU A CG    1 
ATOM   4580  C CD1   . LEU G 3 137 ? 10.669  -43.371  4.882   1.00 77.10  ? 140 LEU A CD1   1 
ATOM   4581  C CD2   . LEU G 3 137 ? 10.887  -43.468  7.367   1.00 83.22  ? 140 LEU A CD2   1 
ATOM   4582  N N     . SER G 3 138 ? 6.099   -41.399  6.491   1.00 95.95  ? 141 SER A N     1 
ATOM   4583  C CA    . SER G 3 138 ? 4.684   -41.430  6.856   1.00 94.53  ? 141 SER A CA    1 
ATOM   4584  C C     . SER G 3 138 ? 3.762   -41.213  5.663   1.00 91.35  ? 141 SER A C     1 
ATOM   4585  O O     . SER G 3 138 ? 2.643   -41.719  5.651   1.00 97.03  ? 141 SER A O     1 
ATOM   4586  C CB    . SER G 3 138 ? 4.386   -40.394  7.939   1.00 96.25  ? 141 SER A CB    1 
ATOM   4587  O OG    . SER G 3 138 ? 5.108   -40.692  9.121   1.00 101.34 ? 141 SER A OG    1 
ATOM   4588  N N     . ARG G 3 139 ? 4.231   -40.477  4.660   1.00 87.48  ? 142 ARG A N     1 
ATOM   4589  C CA    . ARG G 3 139 ? 3.443   -40.268  3.460   1.00 91.93  ? 142 ARG A CA    1 
ATOM   4590  C C     . ARG G 3 139 ? 3.548   -41.464  2.521   1.00 92.19  ? 142 ARG A C     1 
ATOM   4591  O O     . ARG G 3 139 ? 2.531   -42.006  2.091   1.00 98.36  ? 142 ARG A O     1 
ATOM   4592  C CB    . ARG G 3 139 ? 3.856   -38.985  2.733   1.00 97.74  ? 142 ARG A CB    1 
ATOM   4593  C CG    . ARG G 3 139 ? 2.651   -38.215  2.212   1.00 106.34 ? 142 ARG A CG    1 
ATOM   4594  C CD    . ARG G 3 139 ? 2.782   -37.746  0.773   1.00 108.32 ? 142 ARG A CD    1 
ATOM   4595  N NE    . ARG G 3 139 ? 3.675   -36.601  0.610   1.00 107.68 ? 142 ARG A NE    1 
ATOM   4596  C CZ    . ARG G 3 139 ? 3.682   -35.792  -0.450  1.00 109.04 ? 142 ARG A CZ    1 
ATOM   4597  N NH1   . ARG G 3 139 ? 2.835   -35.985  -1.461  1.00 108.13 ? 142 ARG A NH1   1 
ATOM   4598  N NH2   . ARG G 3 139 ? 4.539   -34.776  -0.500  1.00 109.93 ? 142 ARG A NH2   1 
ATOM   4599  N N     . TYR G 3 140 ? 4.776   -41.862  2.199   1.00 91.71  ? 143 TYR A N     1 
ATOM   4600  C CA    . TYR G 3 140 ? 5.030   -43.066  1.399   1.00 92.06  ? 143 TYR A CA    1 
ATOM   4601  C C     . TYR G 3 140 ? 4.206   -44.260  1.917   1.00 90.47  ? 143 TYR A C     1 
ATOM   4602  O O     . TYR G 3 140 ? 3.350   -44.776  1.201   1.00 87.77  ? 143 TYR A O     1 
ATOM   4603  C CB    . TYR G 3 140 ? 6.532   -43.385  1.406   1.00 94.97  ? 143 TYR A CB    1 
ATOM   4604  C CG    . TYR G 3 140 ? 6.918   -44.690  0.745   1.00 96.12  ? 143 TYR A CG    1 
ATOM   4605  C CD1   . TYR G 3 140 ? 6.824   -44.847  -0.634  1.00 94.11  ? 143 TYR A CD1   1 
ATOM   4606  C CD2   . TYR G 3 140 ? 7.397   -45.764  1.498   1.00 100.12 ? 143 TYR A CD2   1 
ATOM   4607  C CE1   . TYR G 3 140 ? 7.173   -46.042  -1.243  1.00 96.94  ? 143 TYR A CE1   1 
ATOM   4608  C CE2   . TYR G 3 140 ? 7.761   -46.962  0.891   1.00 103.58 ? 143 TYR A CE2   1 
ATOM   4609  C CZ    . TYR G 3 140 ? 7.645   -47.092  -0.482  1.00 97.89  ? 143 TYR A CZ    1 
ATOM   4610  O OH    . TYR G 3 140 ? 8.000   -48.264  -1.108  1.00 90.52  ? 143 TYR A OH    1 
ATOM   4611  N N     . LYS G 3 141 ? 4.455   -44.672  3.162   1.00 89.90  ? 144 LYS A N     1 
ATOM   4612  C CA    . LYS G 3 141 ? 3.650   -45.704  3.838   1.00 93.46  ? 144 LYS A CA    1 
ATOM   4613  C C     . LYS G 3 141 ? 2.171   -45.610  3.503   1.00 92.37  ? 144 LYS A C     1 
ATOM   4614  O O     . LYS G 3 141 ? 1.529   -46.615  3.223   1.00 99.52  ? 144 LYS A O     1 
ATOM   4615  C CB    . LYS G 3 141 ? 3.799   -45.621  5.364   1.00 97.27  ? 144 LYS A CB    1 
ATOM   4616  C CG    . LYS G 3 141 ? 4.897   -46.498  5.953   1.00 101.79 ? 144 LYS A CG    1 
ATOM   4617  C CD    . LYS G 3 141 ? 6.292   -46.012  5.578   1.00 102.53 ? 144 LYS A CD    1 
ATOM   4618  C CE    . LYS G 3 141 ? 7.383   -46.760  6.333   1.00 104.38 ? 144 LYS A CE    1 
ATOM   4619  N NZ    . LYS G 3 141 ? 7.213   -46.747  7.813   1.00 106.18 ? 144 LYS A NZ    1 
ATOM   4620  N N     . ARG G 3 142 ? 1.630   -44.401  3.548   1.00 96.92  ? 145 ARG A N     1 
ATOM   4621  C CA    . ARG G 3 142 ? 0.235   -44.187  3.192   1.00 102.41 ? 145 ARG A CA    1 
ATOM   4622  C C     . ARG G 3 142 ? 0.029   -44.452  1.703   1.00 100.45 ? 145 ARG A C     1 
ATOM   4623  O O     . ARG G 3 142 ? -0.816  -45.258  1.318   1.00 99.24  ? 145 ARG A O     1 
ATOM   4624  C CB    . ARG G 3 142 ? -0.210  -42.763  3.544   1.00 106.06 ? 145 ARG A CB    1 
ATOM   4625  C CG    . ARG G 3 142 ? -1.625  -42.691  4.093   1.00 111.57 ? 145 ARG A CG    1 
ATOM   4626  C CD    . ARG G 3 142 ? -2.029  -41.260  4.420   1.00 116.27 ? 145 ARG A CD    1 
ATOM   4627  N NE    . ARG G 3 142 ? -2.442  -40.503  3.231   1.00 117.81 ? 145 ARG A NE    1 
ATOM   4628  C CZ    . ARG G 3 142 ? -3.705  -40.281  2.842   1.00 114.81 ? 145 ARG A CZ    1 
ATOM   4629  N NH1   . ARG G 3 142 ? -4.741  -40.750  3.536   1.00 111.95 ? 145 ARG A NH1   1 
ATOM   4630  N NH2   . ARG G 3 142 ? -3.939  -39.575  1.739   1.00 108.73 ? 145 ARG A NH2   1 
ATOM   4631  N N     . LYS G 3 143 ? 0.819   -43.783  0.871   1.00 102.08 ? 146 LYS A N     1 
ATOM   4632  C CA    . LYS G 3 143 ? 0.714   -43.943  -0.574  1.00 103.84 ? 146 LYS A CA    1 
ATOM   4633  C C     . LYS G 3 143 ? 2.046   -43.660  -1.261  1.00 101.72 ? 146 LYS A C     1 
ATOM   4634  O O     . LYS G 3 143 ? 2.643   -42.612  -1.041  1.00 101.77 ? 146 LYS A O     1 
ATOM   4635  C CB    . LYS G 3 143 ? -0.370  -43.016  -1.116  1.00 104.04 ? 146 LYS A CB    1 
ATOM   4636  C CG    . LYS G 3 143 ? -0.605  -43.135  -2.614  1.00 109.74 ? 146 LYS A CG    1 
ATOM   4637  C CD    . LYS G 3 143 ? -2.082  -42.961  -2.951  1.00 114.83 ? 146 LYS A CD    1 
ATOM   4638  C CE    . LYS G 3 143 ? -2.326  -42.738  -4.438  1.00 118.46 ? 146 LYS A CE    1 
ATOM   4639  N NZ    . LYS G 3 143 ? -1.566  -43.674  -5.318  1.00 121.66 ? 146 LYS A NZ    1 
ATOM   4640  N N     . SER G 3 144 ? 2.509   -44.612  -2.072  1.00 100.56 ? 147 SER A N     1 
ATOM   4641  C CA    . SER G 3 144 ? 3.732   -44.445  -2.860  1.00 97.56  ? 147 SER A CA    1 
ATOM   4642  C C     . SER G 3 144 ? 3.537   -43.355  -3.906  1.00 96.86  ? 147 SER A C     1 
ATOM   4643  O O     . SER G 3 144 ? 2.574   -43.388  -4.669  1.00 99.73  ? 147 SER A O     1 
ATOM   4644  C CB    . SER G 3 144 ? 4.127   -45.756  -3.550  1.00 98.05  ? 147 SER A CB    1 
ATOM   4645  O OG    . SER G 3 144 ? 5.163   -45.552  -4.496  1.00 92.51  ? 147 SER A OG    1 
ATOM   4646  N N     . PHE G 3 145 ? 4.455   -42.389  -3.917  1.00 96.89  ? 148 PHE A N     1 
ATOM   4647  C CA    . PHE G 3 145 ? 4.413   -41.248  -4.838  1.00 92.51  ? 148 PHE A CA    1 
ATOM   4648  C C     . PHE G 3 145 ? 5.702   -41.109  -5.659  1.00 90.25  ? 148 PHE A C     1 
ATOM   4649  O O     . PHE G 3 145 ? 5.820   -40.190  -6.466  1.00 90.48  ? 148 PHE A O     1 
ATOM   4650  C CB    . PHE G 3 145 ? 4.116   -39.940  -4.070  1.00 91.00  ? 148 PHE A CB    1 
ATOM   4651  C CG    . PHE G 3 145 ? 5.114   -39.623  -2.989  1.00 89.14  ? 148 PHE A CG    1 
ATOM   4652  C CD1   . PHE G 3 145 ? 4.968   -40.145  -1.717  1.00 93.05  ? 148 PHE A CD1   1 
ATOM   4653  C CD2   . PHE G 3 145 ? 6.199   -38.809  -3.245  1.00 89.19  ? 148 PHE A CD2   1 
ATOM   4654  C CE1   . PHE G 3 145 ? 5.888   -39.869  -0.721  1.00 96.51  ? 148 PHE A CE1   1 
ATOM   4655  C CE2   . PHE G 3 145 ? 7.125   -38.529  -2.255  1.00 91.26  ? 148 PHE A CE2   1 
ATOM   4656  C CZ    . PHE G 3 145 ? 6.970   -39.058  -0.991  1.00 94.39  ? 148 PHE A CZ    1 
ATOM   4657  N N     . LEU G 3 146 ? 6.649   -42.032  -5.478  1.00 87.99  ? 149 LEU A N     1 
ATOM   4658  C CA    . LEU G 3 146 ? 7.929   -41.992  -6.191  1.00 90.86  ? 149 LEU A CA    1 
ATOM   4659  C C     . LEU G 3 146 ? 7.736   -41.968  -7.718  1.00 96.37  ? 149 LEU A C     1 
ATOM   4660  O O     . LEU G 3 146 ? 8.568   -41.429  -8.461  1.00 92.37  ? 149 LEU A O     1 
ATOM   4661  C CB    . LEU G 3 146 ? 8.809   -43.191  -5.798  1.00 92.50  ? 149 LEU A CB    1 
ATOM   4662  C CG    . LEU G 3 146 ? 9.310   -43.371  -4.352  1.00 96.50  ? 149 LEU A CG    1 
ATOM   4663  C CD1   . LEU G 3 146 ? 9.469   -42.045  -3.619  1.00 103.09 ? 149 LEU A CD1   1 
ATOM   4664  C CD2   . LEU G 3 146 ? 8.409   -44.282  -3.539  1.00 93.93  ? 149 LEU A CD2   1 
ATOM   4665  N N     . HIS G 3 147 ? 6.637   -42.557  -8.181  1.00 102.09 ? 150 HIS A N     1 
ATOM   4666  C CA    . HIS G 3 147 ? 6.298   -42.543  -9.600  1.00 105.95 ? 150 HIS A CA    1 
ATOM   4667  C C     . HIS G 3 147 ? 6.083   -41.130  -10.141 1.00 106.04 ? 150 HIS A C     1 
ATOM   4668  O O     . HIS G 3 147 ? 6.297   -40.871  -11.324 1.00 106.86 ? 150 HIS A O     1 
ATOM   4669  C CB    . HIS G 3 147 ? 5.071   -43.422  -9.866  1.00 111.35 ? 150 HIS A CB    1 
ATOM   4670  C CG    . HIS G 3 147 ? 3.823   -42.950  -9.189  1.00 115.03 ? 150 HIS A CG    1 
ATOM   4671  N ND1   . HIS G 3 147 ? 2.857   -42.213  -9.840  1.00 115.30 ? 150 HIS A ND1   1 
ATOM   4672  C CD2   . HIS G 3 147 ? 3.376   -43.120  -7.922  1.00 116.64 ? 150 HIS A CD2   1 
ATOM   4673  C CE1   . HIS G 3 147 ? 1.869   -41.949  -9.004  1.00 115.67 ? 150 HIS A CE1   1 
ATOM   4674  N NE2   . HIS G 3 147 ? 2.161   -42.484  -7.832  1.00 118.50 ? 150 HIS A NE2   1 
ATOM   4675  N N     . ARG G 3 148 ? 5.669   -40.218  -9.270  1.00 110.98 ? 151 ARG A N     1 
ATOM   4676  C CA    . ARG G 3 148 ? 5.506   -38.811  -9.646  1.00 112.34 ? 151 ARG A CA    1 
ATOM   4677  C C     . ARG G 3 148 ? 6.797   -38.024  -9.504  1.00 105.22 ? 151 ARG A C     1 
ATOM   4678  O O     . ARG G 3 148 ? 6.947   -36.969  -10.110 1.00 102.82 ? 151 ARG A O     1 
ATOM   4679  C CB    . ARG G 3 148 ? 4.414   -38.151  -8.802  1.00 118.11 ? 151 ARG A CB    1 
ATOM   4680  C CG    . ARG G 3 148 ? 3.040   -38.218  -9.438  1.00 121.40 ? 151 ARG A CG    1 
ATOM   4681  C CD    . ARG G 3 148 ? 1.931   -38.262  -8.405  1.00 126.59 ? 151 ARG A CD    1 
ATOM   4682  N NE    . ARG G 3 148 ? 1.946   -37.157  -7.444  1.00 127.43 ? 151 ARG A NE    1 
ATOM   4683  C CZ    . ARG G 3 148 ? 1.250   -37.140  -6.306  1.00 131.40 ? 151 ARG A CZ    1 
ATOM   4684  N NH1   . ARG G 3 148 ? 0.486   -38.169  -5.958  1.00 133.41 ? 151 ARG A NH1   1 
ATOM   4685  N NH2   . ARG G 3 148 ? 1.322   -36.089  -5.499  1.00 131.72 ? 151 ARG A NH2   1 
ATOM   4686  N N     . ILE G 3 149 ? 7.722   -38.544  -8.704  1.00 107.20 ? 152 ILE A N     1 
ATOM   4687  C CA    . ILE G 3 149 ? 8.973   -37.850  -8.378  1.00 103.89 ? 152 ILE A CA    1 
ATOM   4688  C C     . ILE G 3 149 ? 9.736   -37.513  -9.658  1.00 95.88  ? 152 ILE A C     1 
ATOM   4689  O O     . ILE G 3 149 ? 9.786   -38.308  -10.596 1.00 101.52 ? 152 ILE A O     1 
ATOM   4690  C CB    . ILE G 3 149 ? 9.848   -38.703  -7.404  1.00 106.26 ? 152 ILE A CB    1 
ATOM   4691  C CG1   . ILE G 3 149 ? 10.004  -38.022  -6.049  1.00 101.03 ? 152 ILE A CG1   1 
ATOM   4692  C CG2   . ILE G 3 149 ? 11.210  -39.056  -7.997  1.00 113.94 ? 152 ILE A CG2   1 
ATOM   4693  C CD1   . ILE G 3 149 ? 10.979  -36.873  -6.062  1.00 105.93 ? 152 ILE A CD1   1 
ATOM   4694  N N     . VAL G 3 150 ? 10.296  -36.315  -9.701  1.00 91.84  ? 153 VAL A N     1 
ATOM   4695  C CA    . VAL G 3 150 ? 11.227  -35.942  -10.756 1.00 93.49  ? 153 VAL A CA    1 
ATOM   4696  C C     . VAL G 3 150 ? 12.256  -35.011  -10.133 1.00 94.12  ? 153 VAL A C     1 
ATOM   4697  O O     . VAL G 3 150 ? 11.955  -33.874  -9.774  1.00 94.44  ? 153 VAL A O     1 
ATOM   4698  C CB    . VAL G 3 150 ? 10.543  -35.314  -11.998 1.00 92.55  ? 153 VAL A CB    1 
ATOM   4699  C CG1   . VAL G 3 150 ? 9.433   -34.354  -11.615 1.00 90.20  ? 153 VAL A CG1   1 
ATOM   4700  C CG2   . VAL G 3 150 ? 11.566  -34.619  -12.887 1.00 96.51  ? 153 VAL A CG2   1 
ATOM   4701  N N     . THR G 3 151 ? 13.467  -35.533  -9.993  1.00 93.78  ? 154 THR A N     1 
ATOM   4702  C CA    . THR G 3 151 ? 14.535  -34.853  -9.302  1.00 95.69  ? 154 THR A CA    1 
ATOM   4703  C C     . THR G 3 151 ? 15.502  -34.259  -10.313 1.00 98.46  ? 154 THR A C     1 
ATOM   4704  O O     . THR G 3 151 ? 15.322  -34.419  -11.518 1.00 105.06 ? 154 THR A O     1 
ATOM   4705  C CB    . THR G 3 151 ? 15.277  -35.835  -8.380  1.00 96.07  ? 154 THR A CB    1 
ATOM   4706  O OG1   . THR G 3 151 ? 16.000  -35.110  -7.380  1.00 101.04 ? 154 THR A OG1   1 
ATOM   4707  C CG2   . THR G 3 151 ? 16.234  -36.714  -9.176  1.00 97.31  ? 154 THR A CG2   1 
ATOM   4708  N N     . GLY G 3 152 ? 16.526  -33.575  -9.815  1.00 99.41  ? 155 GLY A N     1 
ATOM   4709  C CA    . GLY G 3 152 ? 17.572  -33.042  -10.673 1.00 100.99 ? 155 GLY A CA    1 
ATOM   4710  C C     . GLY G 3 152 ? 18.525  -32.142  -9.922  1.00 103.04 ? 155 GLY A C     1 
ATOM   4711  O O     . GLY G 3 152 ? 18.122  -31.413  -9.018  1.00 108.39 ? 155 GLY A O     1 
ATOM   4712  N N     . ASP G 3 153 ? 19.794  -32.199  -10.306 1.00 104.35 ? 156 ASP A N     1 
ATOM   4713  C CA    . ASP G 3 153 ? 20.847  -31.438  -9.651  1.00 102.28 ? 156 ASP A CA    1 
ATOM   4714  C C     . ASP G 3 153 ? 21.839  -31.037  -10.736 1.00 101.32 ? 156 ASP A C     1 
ATOM   4715  O O     . ASP G 3 153 ? 21.533  -31.164  -11.922 1.00 99.58  ? 156 ASP A O     1 
ATOM   4716  C CB    . ASP G 3 153 ? 21.500  -32.299  -8.564  1.00 103.69 ? 156 ASP A CB    1 
ATOM   4717  C CG    . ASP G 3 153 ? 22.183  -31.475  -7.475  1.00 106.82 ? 156 ASP A CG    1 
ATOM   4718  O OD1   . ASP G 3 153 ? 23.166  -30.766  -7.783  1.00 106.33 ? 156 ASP A OD1   1 
ATOM   4719  O OD2   . ASP G 3 153 ? 21.755  -31.554  -6.305  1.00 107.76 ? 156 ASP A OD2   1 
ATOM   4720  N N     . GLU G 3 154 ? 23.007  -30.539  -10.338 1.00 104.95 ? 157 GLU A N     1 
ATOM   4721  C CA    . GLU G 3 154 ? 24.059  -30.148  -11.278 1.00 109.05 ? 157 GLU A CA    1 
ATOM   4722  C C     . GLU G 3 154 ? 25.436  -30.623  -10.800 1.00 101.66 ? 157 GLU A C     1 
ATOM   4723  O O     . GLU G 3 154 ? 25.678  -30.751  -9.594  1.00 97.41  ? 157 GLU A O     1 
ATOM   4724  C CB    . GLU G 3 154 ? 24.057  -28.626  -11.541 1.00 118.36 ? 157 GLU A CB    1 
ATOM   4725  C CG    . GLU G 3 154 ? 23.626  -27.731  -10.377 1.00 128.41 ? 157 GLU A CG    1 
ATOM   4726  C CD    . GLU G 3 154 ? 22.184  -27.244  -10.490 1.00 140.70 ? 157 GLU A CD    1 
ATOM   4727  O OE1   . GLU G 3 154 ? 21.386  -27.495  -9.558  1.00 143.59 ? 157 GLU A OE1   1 
ATOM   4728  O OE2   . GLU G 3 154 ? 21.846  -26.604  -11.513 1.00 149.38 ? 157 GLU A OE2   1 
ATOM   4729  N N     . LYS G 3 155 ? 26.328  -30.887  -11.754 1.00 94.57  ? 158 LYS A N     1 
ATOM   4730  C CA    . LYS G 3 155 ? 27.623  -31.487  -11.444 1.00 95.51  ? 158 LYS A CA    1 
ATOM   4731  C C     . LYS G 3 155 ? 28.703  -31.097  -12.441 1.00 88.47  ? 158 LYS A C     1 
ATOM   4732  O O     . LYS G 3 155 ? 28.496  -31.161  -13.643 1.00 84.27  ? 158 LYS A O     1 
ATOM   4733  C CB    . LYS G 3 155 ? 27.504  -33.011  -11.432 1.00 104.89 ? 158 LYS A CB    1 
ATOM   4734  C CG    . LYS G 3 155 ? 28.790  -33.731  -11.041 1.00 107.69 ? 158 LYS A CG    1 
ATOM   4735  C CD    . LYS G 3 155 ? 28.842  -35.170  -11.539 1.00 108.39 ? 158 LYS A CD    1 
ATOM   4736  C CE    . LYS G 3 155 ? 30.185  -35.512  -12.174 1.00 105.85 ? 158 LYS A CE    1 
ATOM   4737  N NZ    . LYS G 3 155 ? 31.339  -35.391  -11.241 1.00 106.07 ? 158 LYS A NZ    1 
ATOM   4738  N N     . TRP G 3 156 ? 29.865  -30.721  -11.917 1.00 89.82  ? 159 TRP A N     1 
ATOM   4739  C CA    . TRP G 3 156 ? 31.025  -30.388  -12.736 1.00 92.78  ? 159 TRP A CA    1 
ATOM   4740  C C     . TRP G 3 156 ? 31.587  -31.631  -13.411 1.00 88.12  ? 159 TRP A C     1 
ATOM   4741  O O     . TRP G 3 156 ? 31.598  -32.704  -12.827 1.00 93.88  ? 159 TRP A O     1 
ATOM   4742  C CB    . TRP G 3 156 ? 32.125  -29.754  -11.875 1.00 96.75  ? 159 TRP A CB    1 
ATOM   4743  C CG    . TRP G 3 156 ? 31.817  -28.370  -11.438 1.00 100.79 ? 159 TRP A CG    1 
ATOM   4744  C CD1   . TRP G 3 156 ? 31.552  -27.947  -10.170 1.00 104.67 ? 159 TRP A CD1   1 
ATOM   4745  C CD2   . TRP G 3 156 ? 31.738  -27.217  -12.272 1.00 105.44 ? 159 TRP A CD2   1 
ATOM   4746  N NE1   . TRP G 3 156 ? 31.313  -26.595  -10.162 1.00 106.86 ? 159 TRP A NE1   1 
ATOM   4747  C CE2   . TRP G 3 156 ? 31.421  -26.123  -11.442 1.00 107.54 ? 159 TRP A CE2   1 
ATOM   4748  C CE3   . TRP G 3 156 ? 31.904  -27.001  -13.643 1.00 110.48 ? 159 TRP A CE3   1 
ATOM   4749  C CZ2   . TRP G 3 156 ? 31.268  -24.833  -11.936 1.00 113.81 ? 159 TRP A CZ2   1 
ATOM   4750  C CZ3   . TRP G 3 156 ? 31.752  -25.720  -14.135 1.00 116.83 ? 159 TRP A CZ3   1 
ATOM   4751  C CH2   . TRP G 3 156 ? 31.437  -24.650  -13.282 1.00 118.81 ? 159 TRP A CH2   1 
ATOM   4752  N N     . ILE G 3 157 ? 32.059  -31.477  -14.639 1.00 84.82  ? 160 ILE A N     1 
ATOM   4753  C CA    . ILE G 3 157 ? 32.744  -32.551  -15.341 1.00 84.40  ? 160 ILE A CA    1 
ATOM   4754  C C     . ILE G 3 157 ? 34.065  -32.008  -15.855 1.00 84.91  ? 160 ILE A C     1 
ATOM   4755  O O     . ILE G 3 157 ? 34.108  -31.369  -16.903 1.00 91.47  ? 160 ILE A O     1 
ATOM   4756  C CB    . ILE G 3 157 ? 31.915  -33.077  -16.529 1.00 85.37  ? 160 ILE A CB    1 
ATOM   4757  C CG1   . ILE G 3 157 ? 30.545  -33.546  -16.053 1.00 86.67  ? 160 ILE A CG1   1 
ATOM   4758  C CG2   . ILE G 3 157 ? 32.642  -34.218  -17.228 1.00 85.82  ? 160 ILE A CG2   1 
ATOM   4759  C CD1   . ILE G 3 157 ? 29.661  -34.053  -17.168 1.00 88.58  ? 160 ILE A CD1   1 
ATOM   4760  N N     . PHE G 3 158 ? 35.141  -32.260  -15.120 1.00 83.67  ? 161 PHE A N     1 
ATOM   4761  C CA    . PHE G 3 158 ? 36.456  -31.782  -15.523 1.00 84.69  ? 161 PHE A CA    1 
ATOM   4762  C C     . PHE G 3 158 ? 36.830  -32.438  -16.846 1.00 85.17  ? 161 PHE A C     1 
ATOM   4763  O O     . PHE G 3 158 ? 36.365  -33.527  -17.142 1.00 88.21  ? 161 PHE A O     1 
ATOM   4764  C CB    . PHE G 3 158 ? 37.497  -32.103  -14.457 1.00 88.10  ? 161 PHE A CB    1 
ATOM   4765  C CG    . PHE G 3 158 ? 37.428  -31.211  -13.247 1.00 92.54  ? 161 PHE A CG    1 
ATOM   4766  C CD1   . PHE G 3 158 ? 36.356  -31.282  -12.368 1.00 91.35  ? 161 PHE A CD1   1 
ATOM   4767  C CD2   . PHE G 3 158 ? 38.457  -30.312  -12.972 1.00 98.59  ? 161 PHE A CD2   1 
ATOM   4768  C CE1   . PHE G 3 158 ? 36.302  -30.470  -11.251 1.00 93.97  ? 161 PHE A CE1   1 
ATOM   4769  C CE2   . PHE G 3 158 ? 38.409  -29.498  -11.852 1.00 100.45 ? 161 PHE A CE2   1 
ATOM   4770  C CZ    . PHE G 3 158 ? 37.328  -29.578  -10.991 1.00 99.27  ? 161 PHE A CZ    1 
ATOM   4771  N N     . PHE G 3 159 ? 37.640  -31.761  -17.652 1.00 91.56  ? 162 PHE A N     1 
ATOM   4772  C CA    . PHE G 3 159 ? 38.068  -32.302  -18.946 1.00 95.83  ? 162 PHE A CA    1 
ATOM   4773  C C     . PHE G 3 159 ? 39.134  -33.364  -18.739 1.00 95.77  ? 162 PHE A C     1 
ATOM   4774  O O     . PHE G 3 159 ? 39.267  -34.284  -19.541 1.00 100.35 ? 162 PHE A O     1 
ATOM   4775  C CB    . PHE G 3 159 ? 38.609  -31.196  -19.861 1.00 101.54 ? 162 PHE A CB    1 
ATOM   4776  C CG    . PHE G 3 159 ? 37.549  -30.509  -20.681 1.00 104.77 ? 162 PHE A CG    1 
ATOM   4777  C CD1   . PHE G 3 159 ? 36.412  -29.985  -20.080 1.00 106.55 ? 162 PHE A CD1   1 
ATOM   4778  C CD2   . PHE G 3 159 ? 37.697  -30.371  -22.055 1.00 107.44 ? 162 PHE A CD2   1 
ATOM   4779  C CE1   . PHE G 3 159 ? 35.440  -29.351  -20.832 1.00 109.16 ? 162 PHE A CE1   1 
ATOM   4780  C CE2   . PHE G 3 159 ? 36.730  -29.736  -22.812 1.00 109.58 ? 162 PHE A CE2   1 
ATOM   4781  C CZ    . PHE G 3 159 ? 35.598  -29.226  -22.201 1.00 111.12 ? 162 PHE A CZ    1 
ATOM   4782  N N     . VAL G 3 160 ? 39.894  -33.219  -17.660 1.00 96.59  ? 163 VAL A N     1 
ATOM   4783  C CA    . VAL G 3 160 ? 40.913  -34.188  -17.287 1.00 101.20 ? 163 VAL A CA    1 
ATOM   4784  C C     . VAL G 3 160 ? 40.637  -34.629  -15.849 1.00 104.56 ? 163 VAL A C     1 
ATOM   4785  O O     . VAL G 3 160 ? 40.568  -33.799  -14.936 1.00 102.05 ? 163 VAL A O     1 
ATOM   4786  C CB    . VAL G 3 160 ? 42.348  -33.616  -17.464 1.00 105.50 ? 163 VAL A CB    1 
ATOM   4787  C CG1   . VAL G 3 160 ? 42.432  -32.151  -17.043 1.00 110.86 ? 163 VAL A CG1   1 
ATOM   4788  C CG2   . VAL G 3 160 ? 43.382  -34.448  -16.716 1.00 106.52 ? 163 VAL A CG2   1 
ATOM   4789  N N     . ASN G 3 161 ? 40.442  -35.937  -15.673 1.00 109.64 ? 164 ASN A N     1 
ATOM   4790  C CA    . ASN G 3 161 ? 40.222  -36.541  -14.358 1.00 109.97 ? 164 ASN A CA    1 
ATOM   4791  C C     . ASN G 3 161 ? 41.358  -37.520  -14.082 1.00 108.05 ? 164 ASN A C     1 
ATOM   4792  O O     . ASN G 3 161 ? 41.214  -38.722  -14.299 1.00 113.24 ? 164 ASN A O     1 
ATOM   4793  C CB    . ASN G 3 161 ? 38.868  -37.275  -14.283 1.00 108.78 ? 164 ASN A CB    1 
ATOM   4794  C CG    . ASN G 3 161 ? 37.802  -36.653  -15.170 1.00 107.90 ? 164 ASN A CG    1 
ATOM   4795  O OD1   . ASN G 3 161 ? 37.942  -36.623  -16.394 1.00 98.58  ? 164 ASN A OD1   1 
ATOM   4796  N ND2   . ASN G 3 161 ? 36.719  -36.173  -14.558 1.00 110.69 ? 164 ASN A ND2   1 
ATOM   4797  N N     . PRO G 3 162 ? 42.505  -37.012  -13.623 1.00 105.21 ? 165 PRO A N     1 
ATOM   4798  C CA    . PRO G 3 162 ? 43.594  -37.921  -13.360 1.00 106.27 ? 165 PRO A CA    1 
ATOM   4799  C C     . PRO G 3 162 ? 43.401  -38.577  -12.004 1.00 107.50 ? 165 PRO A C     1 
ATOM   4800  O O     . PRO G 3 162 ? 42.929  -37.937  -11.063 1.00 105.88 ? 165 PRO A O     1 
ATOM   4801  C CB    . PRO G 3 162 ? 44.817  -37.008  -13.369 1.00 110.17 ? 165 PRO A CB    1 
ATOM   4802  C CG    . PRO G 3 162 ? 44.303  -35.669  -12.956 1.00 114.51 ? 165 PRO A CG    1 
ATOM   4803  C CD    . PRO G 3 162 ? 42.811  -35.649  -13.163 1.00 114.20 ? 165 PRO A CD    1 
ATOM   4804  N N     . LYS G 3 163 ? 43.749  -39.855  -11.924 1.00 110.92 ? 166 LYS A N     1 
ATOM   4805  C CA    . LYS G 3 163 ? 43.595  -40.633  -10.706 1.00 108.23 ? 166 LYS A CA    1 
ATOM   4806  C C     . LYS G 3 163 ? 44.920  -41.299  -10.378 1.00 102.79 ? 166 LYS A C     1 
ATOM   4807  O O     . LYS G 3 163 ? 45.673  -41.670  -11.273 1.00 103.48 ? 166 LYS A O     1 
ATOM   4808  C CB    . LYS G 3 163 ? 42.509  -41.680  -10.903 1.00 113.54 ? 166 LYS A CB    1 
ATOM   4809  C CG    . LYS G 3 163 ? 42.050  -42.343  -9.620  1.00 119.96 ? 166 LYS A CG    1 
ATOM   4810  C CD    . LYS G 3 163 ? 40.785  -43.147  -9.869  1.00 124.03 ? 166 LYS A CD    1 
ATOM   4811  C CE    . LYS G 3 163 ? 40.396  -43.981  -8.660  1.00 124.89 ? 166 LYS A CE    1 
ATOM   4812  N NZ    . LYS G 3 163 ? 38.985  -44.455  -8.761  1.00 126.68 ? 166 LYS A NZ    1 
ATOM   4813  N N     . ARG G 3 164 ? 45.200  -41.443  -9.090  1.00 98.17  ? 167 ARG A N     1 
ATOM   4814  C CA    . ARG G 3 164 ? 46.488  -41.961  -8.640  1.00 94.11  ? 167 ARG A CA    1 
ATOM   4815  C C     . ARG G 3 164 ? 46.643  -43.385  -9.143  1.00 94.59  ? 167 ARG A C     1 
ATOM   4816  O O     . ARG G 3 164 ? 45.700  -44.170  -9.050  1.00 89.91  ? 167 ARG A O     1 
ATOM   4817  C CB    . ARG G 3 164 ? 46.557  -41.935  -7.113  1.00 91.30  ? 167 ARG A CB    1 
ATOM   4818  C CG    . ARG G 3 164 ? 47.844  -41.375  -6.540  1.00 88.53  ? 167 ARG A CG    1 
ATOM   4819  C CD    . ARG G 3 164 ? 47.632  -41.012  -5.080  1.00 85.13  ? 167 ARG A CD    1 
ATOM   4820  N NE    . ARG G 3 164 ? 48.852  -41.150  -4.298  1.00 85.95  ? 167 ARG A NE    1 
ATOM   4821  C CZ    . ARG G 3 164 ? 48.906  -41.072  -2.970  1.00 94.65  ? 167 ARG A CZ    1 
ATOM   4822  N NH1   . ARG G 3 164 ? 47.809  -40.840  -2.255  1.00 96.17  ? 167 ARG A NH1   1 
ATOM   4823  N NH2   . ARG G 3 164 ? 50.069  -41.222  -2.348  1.00 100.09 ? 167 ARG A NH2   1 
ATOM   4824  N N     . LYS G 3 165 ? 47.822  -43.705  -9.677  1.00 100.48 ? 168 LYS A N     1 
ATOM   4825  C CA    . LYS G 3 165 ? 48.094  -45.029  -10.267 1.00 100.52 ? 168 LYS A CA    1 
ATOM   4826  C C     . LYS G 3 165 ? 48.510  -46.053  -9.216  1.00 96.99  ? 168 LYS A C     1 
ATOM   4827  O O     . LYS G 3 165 ? 49.091  -45.698  -8.190  1.00 97.90  ? 168 LYS A O     1 
ATOM   4828  C CB    . LYS G 3 165 ? 49.183  -44.923  -11.345 1.00 105.70 ? 168 LYS A CB    1 
ATOM   4829  C CG    . LYS G 3 165 ? 48.687  -44.551  -12.738 1.00 112.61 ? 168 LYS A CG    1 
ATOM   4830  C CD    . LYS G 3 165 ? 47.561  -43.528  -12.706 1.00 119.87 ? 168 LYS A CD    1 
ATOM   4831  C CE    . LYS G 3 165 ? 47.016  -43.212  -14.088 1.00 124.16 ? 168 LYS A CE    1 
ATOM   4832  N NZ    . LYS G 3 165 ? 48.063  -42.752  -15.039 1.00 126.44 ? 168 LYS A NZ    1 
ATOM   4833  N N     . LYS G 3 166 ? 48.204  -47.323  -9.477  1.00 97.17  ? 169 LYS A N     1 
ATOM   4834  C CA    . LYS G 3 166 ? 48.594  -48.428  -8.588  1.00 97.91  ? 169 LYS A CA    1 
ATOM   4835  C C     . LYS G 3 166 ? 49.333  -49.524  -9.350  1.00 93.69  ? 169 LYS A C     1 
ATOM   4836  O O     . LYS G 3 166 ? 48.728  -50.261  -10.129 1.00 95.72  ? 169 LYS A O     1 
ATOM   4837  C CB    . LYS G 3 166 ? 47.372  -49.014  -7.887  1.00 95.14  ? 169 LYS A CB    1 
ATOM   4838  C CG    . LYS G 3 166 ? 47.086  -48.354  -6.560  1.00 96.75  ? 169 LYS A CG    1 
ATOM   4839  C CD    . LYS G 3 166 ? 45.757  -48.799  -5.987  1.00 99.28  ? 169 LYS A CD    1 
ATOM   4840  C CE    . LYS G 3 166 ? 45.703  -48.506  -4.499  1.00 102.06 ? 169 LYS A CE    1 
ATOM   4841  N NZ    . LYS G 3 166 ? 44.349  -48.729  -3.933  1.00 106.00 ? 169 LYS A NZ    1 
ATOM   4842  N N     . SER G 3 167 ? 50.637  -49.627  -9.108  1.00 89.85  ? 170 SER A N     1 
ATOM   4843  C CA    . SER G 3 167 ? 51.492  -50.566  -9.821  1.00 89.01  ? 170 SER A CA    1 
ATOM   4844  C C     . SER G 3 167 ? 51.913  -51.749  -8.953  1.00 87.46  ? 170 SER A C     1 
ATOM   4845  O O     . SER G 3 167 ? 51.914  -51.656  -7.722  1.00 87.44  ? 170 SER A O     1 
ATOM   4846  C CB    . SER G 3 167 ? 52.724  -49.842  -10.396 1.00 92.65  ? 170 SER A CB    1 
ATOM   4847  O OG    . SER G 3 167 ? 52.891  -48.548  -9.846  1.00 91.67  ? 170 SER A OG    1 
ATOM   4848  N N     . TYR G 3 168 ? 52.245  -52.861  -9.623  1.00 87.88  ? 171 TYR A N     1 
ATOM   4849  C CA    . TYR G 3 168 ? 52.786  -54.082  -8.990  1.00 81.47  ? 171 TYR A CA    1 
ATOM   4850  C C     . TYR G 3 168 ? 54.281  -54.165  -9.238  1.00 80.99  ? 171 TYR A C     1 
ATOM   4851  O O     . TYR G 3 168 ? 54.710  -54.171  -10.388 1.00 83.49  ? 171 TYR A O     1 
ATOM   4852  C CB    . TYR G 3 168 ? 52.123  -55.337  -9.569  1.00 73.06  ? 171 TYR A CB    1 
ATOM   4853  C CG    . TYR G 3 168 ? 50.775  -55.639  -8.969  1.00 67.50  ? 171 TYR A CG    1 
ATOM   4854  C CD1   . TYR G 3 168 ? 50.666  -56.061  -7.650  1.00 65.56  ? 171 TYR A CD1   1 
ATOM   4855  C CD2   . TYR G 3 168 ? 49.612  -55.503  -9.714  1.00 63.87  ? 171 TYR A CD2   1 
ATOM   4856  C CE1   . TYR G 3 168 ? 49.436  -56.339  -7.087  1.00 63.73  ? 171 TYR A CE1   1 
ATOM   4857  C CE2   . TYR G 3 168 ? 48.378  -55.780  -9.159  1.00 63.99  ? 171 TYR A CE2   1 
ATOM   4858  C CZ    . TYR G 3 168 ? 48.297  -56.193  -7.843  1.00 64.46  ? 171 TYR A CZ    1 
ATOM   4859  O OH    . TYR G 3 168 ? 47.070  -56.454  -7.275  1.00 69.31  ? 171 TYR A OH    1 
ATOM   4860  N N     . VAL G 3 169 ? 55.079  -54.243  -8.181  1.00 81.71  ? 172 VAL A N     1 
ATOM   4861  C CA    . VAL G 3 169 ? 56.529  -54.242  -8.362  1.00 91.36  ? 172 VAL A CA    1 
ATOM   4862  C C     . VAL G 3 169 ? 57.274  -54.720  -7.104  1.00 91.77  ? 172 VAL A C     1 
ATOM   4863  O O     . VAL G 3 169 ? 56.685  -54.823  -6.026  1.00 94.93  ? 172 VAL A O     1 
ATOM   4864  C CB    . VAL G 3 169 ? 57.006  -52.835  -8.815  1.00 98.96  ? 172 VAL A CB    1 
ATOM   4865  C CG1   . VAL G 3 169 ? 56.840  -51.815  -7.689  1.00 100.27 ? 172 VAL A CG1   1 
ATOM   4866  C CG2   . VAL G 3 169 ? 58.437  -52.877  -9.360  1.00 101.65 ? 172 VAL A CG2   1 
ATOM   4867  N N     . ASP G 3 170 ? 58.561  -55.034  -7.261  1.00 89.72  ? 173 ASP A N     1 
ATOM   4868  C CA    . ASP G 3 170 ? 59.409  -55.485  -6.151  1.00 92.35  ? 173 ASP A CA    1 
ATOM   4869  C C     . ASP G 3 170 ? 59.501  -54.423  -5.056  1.00 89.00  ? 173 ASP A C     1 
ATOM   4870  O O     . ASP G 3 170 ? 59.522  -53.234  -5.357  1.00 99.49  ? 173 ASP A O     1 
ATOM   4871  C CB    . ASP G 3 170 ? 60.831  -55.790  -6.646  1.00 99.24  ? 173 ASP A CB    1 
ATOM   4872  C CG    . ASP G 3 170 ? 60.863  -56.761  -7.825  1.00 101.31 ? 173 ASP A CG    1 
ATOM   4873  O OD1   . ASP G 3 170 ? 60.232  -57.839  -7.744  1.00 99.96  ? 173 ASP A OD1   1 
ATOM   4874  O OD2   . ASP G 3 170 ? 61.533  -56.440  -8.829  1.00 102.02 ? 173 ASP A OD2   1 
ATOM   4875  N N     . PRO G 3 171 ? 59.559  -54.842  -3.782  1.00 85.42  ? 174 PRO A N     1 
ATOM   4876  C CA    . PRO G 3 171 ? 59.726  -53.911  -2.676  1.00 85.13  ? 174 PRO A CA    1 
ATOM   4877  C C     . PRO G 3 171 ? 60.842  -52.914  -2.896  1.00 85.12  ? 174 PRO A C     1 
ATOM   4878  O O     . PRO G 3 171 ? 61.898  -53.273  -3.396  1.00 85.30  ? 174 PRO A O     1 
ATOM   4879  C CB    . PRO G 3 171 ? 60.080  -54.829  -1.513  1.00 87.64  ? 174 PRO A CB    1 
ATOM   4880  C CG    . PRO G 3 171 ? 59.303  -56.063  -1.790  1.00 89.72  ? 174 PRO A CG    1 
ATOM   4881  C CD    . PRO G 3 171 ? 59.240  -56.192  -3.294  1.00 91.66  ? 174 PRO A CD    1 
ATOM   4882  N N     . GLY G 3 172 ? 60.588  -51.664  -2.536  1.00 92.45  ? 175 GLY A N     1 
ATOM   4883  C CA    . GLY G 3 172 ? 61.585  -50.608  -2.636  1.00 97.62  ? 175 GLY A CA    1 
ATOM   4884  C C     . GLY G 3 172 ? 61.795  -50.122  -4.054  1.00 97.42  ? 175 GLY A C     1 
ATOM   4885  O O     . GLY G 3 172 ? 62.845  -49.570  -4.365  1.00 107.71 ? 175 GLY A O     1 
ATOM   4886  N N     . GLN G 3 173 ? 60.800  -50.321  -4.913  1.00 94.90  ? 176 GLN A N     1 
ATOM   4887  C CA    . GLN G 3 173 ? 60.880  -49.871  -6.293  1.00 100.17 ? 176 GLN A CA    1 
ATOM   4888  C C     . GLN G 3 173 ? 59.863  -48.753  -6.505  1.00 96.02  ? 176 GLN A C     1 
ATOM   4889  O O     . GLN G 3 173 ? 58.805  -48.744  -5.875  1.00 92.27  ? 176 GLN A O     1 
ATOM   4890  C CB    . GLN G 3 173 ? 60.612  -51.047  -7.247  1.00 105.14 ? 176 GLN A CB    1 
ATOM   4891  C CG    . GLN G 3 173 ? 61.325  -50.991  -8.596  1.00 108.19 ? 176 GLN A CG    1 
ATOM   4892  C CD    . GLN G 3 173 ? 62.835  -51.157  -8.480  1.00 110.55 ? 176 GLN A CD    1 
ATOM   4893  O OE1   . GLN G 3 173 ? 63.381  -51.287  -7.384  1.00 107.23 ? 176 GLN A OE1   1 
ATOM   4894  N NE2   . GLN G 3 173 ? 63.514  -51.156  -9.614  1.00 113.23 ? 176 GLN A NE2   1 
ATOM   4895  N N     . PRO G 3 174 ? 60.185  -47.793  -7.382  1.00 96.02  ? 177 PRO A N     1 
ATOM   4896  C CA    . PRO G 3 174 ? 59.212  -46.744  -7.662  1.00 96.98  ? 177 PRO A CA    1 
ATOM   4897  C C     . PRO G 3 174 ? 57.969  -47.226  -8.416  1.00 94.41  ? 177 PRO A C     1 
ATOM   4898  O O     . PRO G 3 174 ? 58.072  -48.072  -9.309  1.00 91.57  ? 177 PRO A O     1 
ATOM   4899  C CB    . PRO G 3 174 ? 60.004  -45.749  -8.521  1.00 103.62 ? 177 PRO A CB    1 
ATOM   4900  C CG    . PRO G 3 174 ? 61.145  -46.531  -9.082  1.00 105.71 ? 177 PRO A CG    1 
ATOM   4901  C CD    . PRO G 3 174 ? 61.492  -47.505  -7.999  1.00 102.34 ? 177 PRO A CD    1 
ATOM   4902  N N     . ALA G 3 175 ? 56.816  -46.671  -8.041  1.00 93.98  ? 178 ALA A N     1 
ATOM   4903  C CA    . ALA G 3 175 ? 55.544  -46.891  -8.736  1.00 98.01  ? 178 ALA A CA    1 
ATOM   4904  C C     . ALA G 3 175 ? 55.289  -45.816  -9.800  1.00 100.49 ? 178 ALA A C     1 
ATOM   4905  O O     . ALA G 3 175 ? 55.906  -44.756  -9.777  1.00 103.54 ? 178 ALA A O     1 
ATOM   4906  C CB    . ALA G 3 175 ? 54.408  -46.897  -7.729  1.00 98.89  ? 178 ALA A CB    1 
ATOM   4907  N N     . THR G 3 176 ? 54.370  -46.086  -10.725 1.00 104.60 ? 179 THR A N     1 
ATOM   4908  C CA    . THR G 3 176 ? 54.032  -45.119  -11.773 1.00 108.47 ? 179 THR A CA    1 
ATOM   4909  C C     . THR G 3 176 ? 53.335  -43.908  -11.155 1.00 111.55 ? 179 THR A C     1 
ATOM   4910  O O     . THR G 3 176 ? 52.273  -44.042  -10.547 1.00 115.04 ? 179 THR A O     1 
ATOM   4911  C CB    . THR G 3 176 ? 53.133  -45.739  -12.868 1.00 111.61 ? 179 THR A CB    1 
ATOM   4912  O OG1   . THR G 3 176 ? 53.890  -46.696  -13.624 1.00 115.94 ? 179 THR A OG1   1 
ATOM   4913  C CG2   . THR G 3 176 ? 52.594  -44.665  -13.821 1.00 111.73 ? 179 THR A CG2   1 
ATOM   4914  N N     . SER G 3 177 ? 53.943  -42.733  -11.326 1.00 110.25 ? 180 SER A N     1 
ATOM   4915  C CA    . SER G 3 177 ? 53.436  -41.487  -10.753 1.00 104.03 ? 180 SER A CA    1 
ATOM   4916  C C     . SER G 3 177 ? 52.440  -40.796  -11.682 1.00 100.65 ? 180 SER A C     1 
ATOM   4917  O O     . SER G 3 177 ? 52.304  -41.164  -12.848 1.00 94.50  ? 180 SER A O     1 
ATOM   4918  C CB    . SER G 3 177 ? 54.600  -40.546  -10.461 1.00 103.51 ? 180 SER A CB    1 
ATOM   4919  O OG    . SER G 3 177 ? 55.430  -40.428  -11.600 1.00 107.27 ? 180 SER A OG    1 
ATOM   4920  N N     . THR G 3 178 ? 51.752  -39.791  -11.145 1.00 104.02 ? 181 THR A N     1 
ATOM   4921  C CA    . THR G 3 178 ? 50.752  -39.025  -11.889 1.00 105.13 ? 181 THR A CA    1 
ATOM   4922  C C     . THR G 3 178 ? 50.832  -37.525  -11.596 1.00 103.77 ? 181 THR A C     1 
ATOM   4923  O O     . THR G 3 178 ? 51.081  -37.114  -10.461 1.00 99.80  ? 181 THR A O     1 
ATOM   4924  C CB    . THR G 3 178 ? 49.324  -39.520  -11.585 1.00 107.39 ? 181 THR A CB    1 
ATOM   4925  O OG1   . THR G 3 178 ? 49.369  -40.556  -10.592 1.00 113.09 ? 181 THR A OG1   1 
ATOM   4926  C CG2   . THR G 3 178 ? 48.694  -40.071  -12.831 1.00 109.72 ? 181 THR A CG2   1 
ATOM   4927  N N     . ALA G 3 179 ? 50.618  -36.722  -12.638 1.00 102.68 ? 182 ALA A N     1 
ATOM   4928  C CA    . ALA G 3 179 ? 50.648  -35.265  -12.535 1.00 99.23  ? 182 ALA A CA    1 
ATOM   4929  C C     . ALA G 3 179 ? 49.325  -34.749  -11.995 1.00 97.29  ? 182 ALA A C     1 
ATOM   4930  O O     . ALA G 3 179 ? 48.266  -35.093  -12.511 1.00 95.45  ? 182 ALA A O     1 
ATOM   4931  C CB    . ALA G 3 179 ? 50.924  -34.643  -13.891 1.00 102.43 ? 182 ALA A CB    1 
ATOM   4932  N N     . ARG G 3 180 ? 49.397  -33.898  -10.977 1.00 99.46  ? 183 ARG A N     1 
ATOM   4933  C CA    . ARG G 3 180 ? 48.214  -33.454  -10.246 1.00 100.17 ? 183 ARG A CA    1 
ATOM   4934  C C     . ARG G 3 180 ? 47.167  -32.768  -11.125 1.00 109.33 ? 183 ARG A C     1 
ATOM   4935  O O     . ARG G 3 180 ? 47.488  -32.243  -12.195 1.00 108.69 ? 183 ARG A O     1 
ATOM   4936  C CB    . ARG G 3 180 ? 48.616  -32.533  -9.089  1.00 97.90  ? 183 ARG A CB    1 
ATOM   4937  C CG    . ARG G 3 180 ? 48.787  -33.271  -7.778  1.00 99.48  ? 183 ARG A CG    1 
ATOM   4938  C CD    . ARG G 3 180 ? 49.334  -32.383  -6.676  1.00 99.52  ? 183 ARG A CD    1 
ATOM   4939  N NE    . ARG G 3 180 ? 49.102  -32.993  -5.365  1.00 100.13 ? 183 ARG A NE    1 
ATOM   4940  C CZ    . ARG G 3 180 ? 49.925  -32.908  -4.322  1.00 104.72 ? 183 ARG A CZ    1 
ATOM   4941  N NH1   . ARG G 3 180 ? 51.067  -32.236  -4.405  1.00 110.69 ? 183 ARG A NH1   1 
ATOM   4942  N NH2   . ARG G 3 180 ? 49.605  -33.509  -3.182  1.00 102.89 ? 183 ARG A NH2   1 
ATOM   4943  N N     . PRO G 3 181 ? 45.903  -32.769  -10.666 1.00 123.01 ? 184 PRO A N     1 
ATOM   4944  C CA    . PRO G 3 181 ? 44.850  -32.123  -11.432 1.00 127.62 ? 184 PRO A CA    1 
ATOM   4945  C C     . PRO G 3 181 ? 44.884  -30.605  -11.243 1.00 137.87 ? 184 PRO A C     1 
ATOM   4946  O O     . PRO G 3 181 ? 45.075  -30.121  -10.123 1.00 141.42 ? 184 PRO A O     1 
ATOM   4947  C CB    . PRO G 3 181 ? 43.571  -32.725  -10.841 1.00 127.79 ? 184 PRO A CB    1 
ATOM   4948  C CG    . PRO G 3 181 ? 43.925  -33.115  -9.440  1.00 126.08 ? 184 PRO A CG    1 
ATOM   4949  C CD    . PRO G 3 181 ? 45.422  -33.230  -9.346  1.00 124.60 ? 184 PRO A CD    1 
ATOM   4950  N N     . ASN G 3 182 ? 44.705  -29.875  -12.342 1.00 145.41 ? 185 ASN A N     1 
ATOM   4951  C CA    . ASN G 3 182 ? 44.689  -28.412  -12.340 1.00 140.60 ? 185 ASN A CA    1 
ATOM   4952  C C     . ASN G 3 182 ? 43.316  -27.890  -11.887 1.00 143.06 ? 185 ASN A C     1 
ATOM   4953  O O     . ASN G 3 182 ? 42.353  -27.934  -12.655 1.00 142.95 ? 185 ASN A O     1 
ATOM   4954  C CB    . ASN G 3 182 ? 45.028  -27.917  -13.754 1.00 134.90 ? 185 ASN A CB    1 
ATOM   4955  C CG    . ASN G 3 182 ? 45.642  -26.539  -13.767 1.00 133.00 ? 185 ASN A CG    1 
ATOM   4956  O OD1   . ASN G 3 182 ? 46.757  -26.355  -14.250 1.00 134.24 ? 185 ASN A OD1   1 
ATOM   4957  N ND2   . ASN G 3 182 ? 44.919  -25.562  -13.249 1.00 135.01 ? 185 ASN A ND2   1 
ATOM   4958  N N     . ARG G 3 183 ? 43.225  -27.410  -10.643 1.00 147.70 ? 186 ARG A N     1 
ATOM   4959  C CA    . ARG G 3 183 ? 41.952  -26.913  -10.088 1.00 154.15 ? 186 ARG A CA    1 
ATOM   4960  C C     . ARG G 3 183 ? 41.240  -25.995  -11.061 1.00 153.20 ? 186 ARG A C     1 
ATOM   4961  O O     . ARG G 3 183 ? 40.066  -26.199  -11.385 1.00 150.46 ? 186 ARG A O     1 
ATOM   4962  C CB    . ARG G 3 183 ? 42.167  -26.131  -8.779  1.00 161.62 ? 186 ARG A CB    1 
ATOM   4963  C CG    . ARG G 3 183 ? 41.942  -26.898  -7.488  1.00 164.43 ? 186 ARG A CG    1 
ATOM   4964  C CD    . ARG G 3 183 ? 40.816  -27.915  -7.596  1.00 167.39 ? 186 ARG A CD    1 
ATOM   4965  N NE    . ARG G 3 183 ? 40.269  -28.319  -6.305  1.00 175.54 ? 186 ARG A NE    1 
ATOM   4966  C CZ    . ARG G 3 183 ? 40.931  -28.985  -5.359  1.00 177.47 ? 186 ARG A CZ    1 
ATOM   4967  N NH1   . ARG G 3 183 ? 42.208  -29.316  -5.506  1.00 174.44 ? 186 ARG A NH1   1 
ATOM   4968  N NH2   . ARG G 3 183 ? 40.308  -29.301  -4.230  1.00 180.80 ? 186 ARG A NH2   1 
ATOM   4969  N N     . PHE G 3 184 ? 41.970  -24.976  -11.505 1.00 149.92 ? 187 PHE A N     1 
ATOM   4970  C CA    . PHE G 3 184 ? 41.480  -24.018  -12.483 1.00 144.06 ? 187 PHE A CA    1 
ATOM   4971  C C     . PHE G 3 184 ? 41.854  -24.529  -13.876 1.00 127.85 ? 187 PHE A C     1 
ATOM   4972  O O     . PHE G 3 184 ? 42.714  -23.971  -14.554 1.00 128.04 ? 187 PHE A O     1 
ATOM   4973  C CB    . PHE G 3 184 ? 42.064  -22.621  -12.206 1.00 151.95 ? 187 PHE A CB    1 
ATOM   4974  C CG    . PHE G 3 184 ? 42.020  -22.220  -10.752 1.00 158.31 ? 187 PHE A CG    1 
ATOM   4975  C CD1   . PHE G 3 184 ? 40.804  -21.996  -10.112 1.00 159.33 ? 187 PHE A CD1   1 
ATOM   4976  C CD2   . PHE G 3 184 ? 43.196  -22.072  -10.019 1.00 160.53 ? 187 PHE A CD2   1 
ATOM   4977  C CE1   . PHE G 3 184 ? 40.763  -21.633  -8.775  1.00 161.58 ? 187 PHE A CE1   1 
ATOM   4978  C CE2   . PHE G 3 184 ? 43.159  -21.708  -8.683  1.00 161.55 ? 187 PHE A CE2   1 
ATOM   4979  C CZ    . PHE G 3 184 ? 41.941  -21.489  -8.060  1.00 163.08 ? 187 PHE A CZ    1 
ATOM   4980  N N     . GLY G 3 185 ? 41.222  -25.631  -14.268 1.00 114.20 ? 188 GLY A N     1 
ATOM   4981  C CA    . GLY G 3 185 ? 41.366  -26.202  -15.603 1.00 108.46 ? 188 GLY A CA    1 
ATOM   4982  C C     . GLY G 3 185 ? 39.992  -26.248  -16.236 1.00 104.82 ? 188 GLY A C     1 
ATOM   4983  O O     . GLY G 3 185 ? 39.005  -25.892  -15.589 1.00 105.27 ? 188 GLY A O     1 
ATOM   4984  N N     . LYS G 3 186 ? 39.917  -26.685  -17.491 1.00 103.81 ? 189 LYS A N     1 
ATOM   4985  C CA    . LYS G 3 186 ? 38.647  -26.678  -18.228 1.00 106.05 ? 189 LYS A CA    1 
ATOM   4986  C C     . LYS G 3 186 ? 37.634  -27.645  -17.615 1.00 104.48 ? 189 LYS A C     1 
ATOM   4987  O O     . LYS G 3 186 ? 37.959  -28.793  -17.319 1.00 103.17 ? 189 LYS A O     1 
ATOM   4988  C CB    . LYS G 3 186 ? 38.857  -27.006  -19.712 1.00 109.82 ? 189 LYS A CB    1 
ATOM   4989  C CG    . LYS G 3 186 ? 39.689  -25.974  -20.460 1.00 117.05 ? 189 LYS A CG    1 
ATOM   4990  C CD    . LYS G 3 186 ? 39.694  -26.208  -21.966 1.00 122.62 ? 189 LYS A CD    1 
ATOM   4991  C CE    . LYS G 3 186 ? 38.432  -25.668  -22.627 1.00 127.58 ? 189 LYS A CE    1 
ATOM   4992  N NZ    . LYS G 3 186 ? 38.481  -25.761  -24.113 1.00 126.93 ? 189 LYS A NZ    1 
ATOM   4993  N N     . LYS G 3 187 ? 36.412  -27.154  -17.421 1.00 102.57 ? 190 LYS A N     1 
ATOM   4994  C CA    . LYS G 3 187 ? 35.331  -27.927  -16.825 1.00 98.20  ? 190 LYS A CA    1 
ATOM   4995  C C     . LYS G 3 187 ? 34.007  -27.455  -17.403 1.00 101.11 ? 190 LYS A C     1 
ATOM   4996  O O     . LYS G 3 187 ? 33.837  -26.271  -17.679 1.00 108.22 ? 190 LYS A O     1 
ATOM   4997  C CB    . LYS G 3 187 ? 35.323  -27.732  -15.309 1.00 97.16  ? 190 LYS A CB    1 
ATOM   4998  C CG    . LYS G 3 187 ? 35.016  -26.308  -14.871 1.00 97.25  ? 190 LYS A CG    1 
ATOM   4999  C CD    . LYS G 3 187 ? 35.039  -26.135  -13.361 1.00 95.67  ? 190 LYS A CD    1 
ATOM   5000  C CE    . LYS G 3 187 ? 36.446  -25.893  -12.843 1.00 95.86  ? 190 LYS A CE    1 
ATOM   5001  N NZ    . LYS G 3 187 ? 36.405  -25.100  -11.588 1.00 98.42  ? 190 LYS A NZ    1 
ATOM   5002  N N     . THR G 3 188 ? 33.069  -28.375  -17.579 1.00 100.87 ? 191 THR A N     1 
ATOM   5003  C CA    . THR G 3 188 ? 31.731  -28.024  -18.047 1.00 103.70 ? 191 THR A CA    1 
ATOM   5004  C C     . THR G 3 188 ? 30.711  -28.464  -17.020 1.00 103.70 ? 191 THR A C     1 
ATOM   5005  O O     . THR G 3 188 ? 30.719  -29.614  -16.590 1.00 111.19 ? 191 THR A O     1 
ATOM   5006  C CB    . THR G 3 188 ? 31.405  -28.698  -19.390 1.00 105.59 ? 191 THR A CB    1 
ATOM   5007  O OG1   . THR G 3 188 ? 32.061  -29.969  -19.463 1.00 109.68 ? 191 THR A OG1   1 
ATOM   5008  C CG2   . THR G 3 188 ? 31.871  -27.838  -20.549 1.00 109.71 ? 191 THR A CG2   1 
ATOM   5009  N N     . MET G 3 189 ? 29.835  -27.550  -16.622 1.00 103.64 ? 192 MET A N     1 
ATOM   5010  C CA    . MET G 3 189 ? 28.788  -27.887  -15.667 1.00 105.26 ? 192 MET A CA    1 
ATOM   5011  C C     . MET G 3 189 ? 27.711  -28.673  -16.416 1.00 98.61  ? 192 MET A C     1 
ATOM   5012  O O     . MET G 3 189 ? 27.370  -28.352  -17.553 1.00 99.23  ? 192 MET A O     1 
ATOM   5013  C CB    . MET G 3 189 ? 28.198  -26.624  -15.022 1.00 111.90 ? 192 MET A CB    1 
ATOM   5014  C CG    . MET G 3 189 ? 27.816  -26.776  -13.553 1.00 114.12 ? 192 MET A CG    1 
ATOM   5015  S SD    . MET G 3 189 ? 26.414  -25.741  -13.073 1.00 119.56 ? 192 MET A SD    1 
ATOM   5016  C CE    . MET G 3 189 ? 26.562  -25.733  -11.287 1.00 121.20 ? 192 MET A CE    1 
ATOM   5017  N N     . LEU G 3 190 ? 27.203  -29.721  -15.788 1.00 91.55  ? 193 LEU A N     1 
ATOM   5018  C CA    . LEU G 3 190 ? 26.120  -30.498  -16.357 1.00 92.38  ? 193 LEU A CA    1 
ATOM   5019  C C     . LEU G 3 190 ? 24.915  -30.285  -15.471 1.00 99.74  ? 193 LEU A C     1 
ATOM   5020  O O     . LEU G 3 190 ? 25.015  -30.431  -14.251 1.00 100.36 ? 193 LEU A O     1 
ATOM   5021  C CB    . LEU G 3 190 ? 26.483  -31.986  -16.403 1.00 88.51  ? 193 LEU A CB    1 
ATOM   5022  C CG    . LEU G 3 190 ? 25.310  -32.968  -16.497 1.00 85.09  ? 193 LEU A CG    1 
ATOM   5023  C CD1   . LEU G 3 190 ? 24.563  -32.759  -17.803 1.00 88.21  ? 193 LEU A CD1   1 
ATOM   5024  C CD2   . LEU G 3 190 ? 25.786  -34.404  -16.366 1.00 83.03  ? 193 LEU A CD2   1 
ATOM   5025  N N     . CYS G 3 191 ? 23.788  -29.930  -16.084 1.00 103.66 ? 194 CYS A N     1 
ATOM   5026  C CA    . CYS G 3 191 ? 22.520  -29.811  -15.376 1.00 105.17 ? 194 CYS A CA    1 
ATOM   5027  C C     . CYS G 3 191 ? 21.557  -30.844  -15.938 1.00 99.34  ? 194 CYS A C     1 
ATOM   5028  O O     . CYS G 3 191 ? 21.260  -30.828  -17.129 1.00 95.48  ? 194 CYS A O     1 
ATOM   5029  C CB    . CYS G 3 191 ? 21.948  -28.405  -15.543 1.00 111.28 ? 194 CYS A CB    1 
ATOM   5030  S SG    . CYS G 3 191 ? 22.959  -27.109  -14.791 1.00 120.97 ? 194 CYS A SG    1 
ATOM   5031  N N     . VAL G 3 192 ? 21.072  -31.737  -15.082 1.00 95.99  ? 195 VAL A N     1 
ATOM   5032  C CA    . VAL G 3 192 ? 20.228  -32.834  -15.529 1.00 98.80  ? 195 VAL A CA    1 
ATOM   5033  C C     . VAL G 3 192 ? 19.099  -33.139  -14.545 1.00 101.45 ? 195 VAL A C     1 
ATOM   5034  O O     . VAL G 3 192 ? 19.298  -33.148  -13.322 1.00 96.32  ? 195 VAL A O     1 
ATOM   5035  C CB    . VAL G 3 192 ? 21.061  -34.110  -15.791 1.00 103.05 ? 195 VAL A CB    1 
ATOM   5036  C CG1   . VAL G 3 192 ? 21.897  -34.488  -14.574 1.00 105.92 ? 195 VAL A CG1   1 
ATOM   5037  C CG2   . VAL G 3 192 ? 20.165  -35.269  -16.210 1.00 105.42 ? 195 VAL A CG2   1 
ATOM   5038  N N     . TRP G 3 193 ? 17.915  -33.378  -15.112 1.00 99.44  ? 196 TRP A N     1 
ATOM   5039  C CA    . TRP G 3 193 ? 16.738  -33.803  -14.370 1.00 93.72  ? 196 TRP A CA    1 
ATOM   5040  C C     . TRP G 3 193 ? 16.261  -35.108  -14.977 1.00 90.85  ? 196 TRP A C     1 
ATOM   5041  O O     . TRP G 3 193 ? 16.392  -35.317  -16.180 1.00 93.40  ? 196 TRP A O     1 
ATOM   5042  C CB    . TRP G 3 193 ? 15.638  -32.750  -14.464 1.00 96.26  ? 196 TRP A CB    1 
ATOM   5043  C CG    . TRP G 3 193 ? 16.057  -31.404  -13.923 1.00 99.18  ? 196 TRP A CG    1 
ATOM   5044  C CD1   . TRP G 3 193 ? 15.818  -30.911  -12.671 1.00 101.55 ? 196 TRP A CD1   1 
ATOM   5045  C CD2   . TRP G 3 193 ? 16.786  -30.390  -14.617 1.00 92.16  ? 196 TRP A CD2   1 
ATOM   5046  N NE1   . TRP G 3 193 ? 16.359  -29.655  -12.545 1.00 98.72  ? 196 TRP A NE1   1 
ATOM   5047  C CE2   . TRP G 3 193 ? 16.958  -29.313  -13.726 1.00 94.24  ? 196 TRP A CE2   1 
ATOM   5048  C CE3   . TRP G 3 193 ? 17.319  -30.293  -15.902 1.00 92.77  ? 196 TRP A CE3   1 
ATOM   5049  C CZ2   . TRP G 3 193 ? 17.639  -28.154  -14.081 1.00 96.25  ? 196 TRP A CZ2   1 
ATOM   5050  C CZ3   . TRP G 3 193 ? 17.991  -29.139  -16.255 1.00 95.94  ? 196 TRP A CZ3   1 
ATOM   5051  C CH2   . TRP G 3 193 ? 18.145  -28.083  -15.348 1.00 95.42  ? 196 TRP A CH2   1 
ATOM   5052  N N     . TRP G 3 194 ? 15.712  -35.981  -14.140 1.00 87.55  ? 197 TRP A N     1 
ATOM   5053  C CA    . TRP G 3 194 ? 15.306  -37.316  -14.562 1.00 83.41  ? 197 TRP A CA    1 
ATOM   5054  C C     . TRP G 3 194 ? 14.203  -37.831  -13.656 1.00 87.01  ? 197 TRP A C     1 
ATOM   5055  O O     . TRP G 3 194 ? 13.791  -37.139  -12.734 1.00 91.56  ? 197 TRP A O     1 
ATOM   5056  C CB    . TRP G 3 194 ? 16.506  -38.263  -14.532 1.00 82.94  ? 197 TRP A CB    1 
ATOM   5057  C CG    . TRP G 3 194 ? 17.300  -38.257  -13.249 1.00 84.70  ? 197 TRP A CG    1 
ATOM   5058  C CD1   . TRP G 3 194 ? 18.152  -37.280  -12.817 1.00 88.08  ? 197 TRP A CD1   1 
ATOM   5059  C CD2   . TRP G 3 194 ? 17.350  -39.293  -12.264 1.00 78.47  ? 197 TRP A CD2   1 
ATOM   5060  N NE1   . TRP G 3 194 ? 18.710  -37.634  -11.613 1.00 84.52  ? 197 TRP A NE1   1 
ATOM   5061  C CE2   . TRP G 3 194 ? 18.238  -38.868  -11.255 1.00 81.70  ? 197 TRP A CE2   1 
ATOM   5062  C CE3   . TRP G 3 194 ? 16.722  -40.530  -12.129 1.00 74.79  ? 197 TRP A CE3   1 
ATOM   5063  C CZ2   . TRP G 3 194 ? 18.507  -39.637  -10.124 1.00 81.60  ? 197 TRP A CZ2   1 
ATOM   5064  C CZ3   . TRP G 3 194 ? 16.990  -41.291  -11.011 1.00 77.35  ? 197 TRP A CZ3   1 
ATOM   5065  C CH2   . TRP G 3 194 ? 17.876  -40.842  -10.020 1.00 79.17  ? 197 TRP A CH2   1 
ATOM   5066  N N     . ASP G 3 195 ? 13.706  -39.032  -13.935 1.00 91.29  ? 198 ASP A N     1 
ATOM   5067  C CA    . ASP G 3 195 ? 12.803  -39.724  -13.013 1.00 94.53  ? 198 ASP A CA    1 
ATOM   5068  C C     . ASP G 3 195 ? 12.945  -41.237  -13.180 1.00 96.64  ? 198 ASP A C     1 
ATOM   5069  O O     . ASP G 3 195 ? 13.758  -41.693  -13.983 1.00 98.36  ? 198 ASP A O     1 
ATOM   5070  C CB    . ASP G 3 195 ? 11.354  -39.263  -13.211 1.00 96.14  ? 198 ASP A CB    1 
ATOM   5071  C CG    . ASP G 3 195 ? 10.774  -39.684  -14.543 1.00 99.25  ? 198 ASP A CG    1 
ATOM   5072  O OD1   . ASP G 3 195 ? 11.419  -40.480  -15.257 1.00 109.63 ? 198 ASP A OD1   1 
ATOM   5073  O OD2   . ASP G 3 195 ? 9.660   -39.225  -14.879 1.00 99.61  ? 198 ASP A OD2   1 
ATOM   5074  N N     . GLN G 3 196 ? 12.148  -42.004  -12.438 1.00 100.58 ? 199 GLN A N     1 
ATOM   5075  C CA    . GLN G 3 196 ? 12.251  -43.472  -12.428 1.00 101.38 ? 199 GLN A CA    1 
ATOM   5076  C C     . GLN G 3 196 ? 12.210  -44.122  -13.812 1.00 105.97 ? 199 GLN A C     1 
ATOM   5077  O O     . GLN G 3 196 ? 12.766  -45.209  -14.002 1.00 105.94 ? 199 GLN A O     1 
ATOM   5078  C CB    . GLN G 3 196 ? 11.153  -44.075  -11.556 1.00 99.47  ? 199 GLN A CB    1 
ATOM   5079  C CG    . GLN G 3 196 ? 9.742   -43.908  -12.094 1.00 95.77  ? 199 GLN A CG    1 
ATOM   5080  C CD    . GLN G 3 196 ? 8.709   -44.557  -11.190 1.00 99.60  ? 199 GLN A CD    1 
ATOM   5081  O OE1   . GLN G 3 196 ? 8.948   -44.763  -9.998  1.00 99.55  ? 199 GLN A OE1   1 
ATOM   5082  N NE2   . GLN G 3 196 ? 7.556   -44.891  -11.753 1.00 103.86 ? 199 GLN A NE2   1 
ATOM   5083  N N     . SER G 3 197 ? 11.549  -43.457  -14.761 1.00 106.40 ? 200 SER A N     1 
ATOM   5084  C CA    . SER G 3 197 ? 11.504  -43.906  -16.152 1.00 108.02 ? 200 SER A CA    1 
ATOM   5085  C C     . SER G 3 197 ? 12.626  -43.330  -17.018 1.00 102.56 ? 200 SER A C     1 
ATOM   5086  O O     . SER G 3 197 ? 12.563  -43.424  -18.242 1.00 103.29 ? 200 SER A O     1 
ATOM   5087  C CB    . SER G 3 197 ? 10.157  -43.541  -16.781 1.00 114.13 ? 200 SER A CB    1 
ATOM   5088  O OG    . SER G 3 197 ? 9.082   -44.063  -16.024 1.00 125.87 ? 200 SER A OG    1 
ATOM   5089  N N     . GLY G 3 198 ? 13.637  -42.722  -16.403 1.00 101.89 ? 201 GLY A N     1 
ATOM   5090  C CA    . GLY G 3 198 ? 14.822  -42.269  -17.137 1.00 106.06 ? 201 GLY A CA    1 
ATOM   5091  C C     . GLY G 3 198 ? 15.008  -40.768  -17.277 1.00 104.93 ? 201 GLY A C     1 
ATOM   5092  O O     . GLY G 3 198 ? 14.173  -39.974  -16.840 1.00 103.23 ? 201 GLY A O     1 
ATOM   5093  N N     . VAL G 3 199 ? 16.129  -40.391  -17.887 1.00 102.55 ? 202 VAL A N     1 
ATOM   5094  C CA    . VAL G 3 199 ? 16.491  -38.984  -18.071 1.00 101.23 ? 202 VAL A CA    1 
ATOM   5095  C C     . VAL G 3 199 ? 15.419  -38.244  -18.863 1.00 98.83  ? 202 VAL A C     1 
ATOM   5096  O O     . VAL G 3 199 ? 14.876  -38.784  -19.818 1.00 106.65 ? 202 VAL A O     1 
ATOM   5097  C CB    . VAL G 3 199 ? 17.876  -38.833  -18.748 1.00 99.45  ? 202 VAL A CB    1 
ATOM   5098  C CG1   . VAL G 3 199 ? 17.907  -39.516  -20.115 1.00 105.71 ? 202 VAL A CG1   1 
ATOM   5099  C CG2   . VAL G 3 199 ? 18.266  -37.364  -18.861 1.00 93.17  ? 202 VAL A CG2   1 
ATOM   5100  N N     . ILE G 3 200 ? 15.110  -37.020  -18.444 1.00 96.04  ? 203 ILE A N     1 
ATOM   5101  C CA    . ILE G 3 200 ? 14.022  -36.234  -19.034 1.00 97.89  ? 203 ILE A CA    1 
ATOM   5102  C C     . ILE G 3 200 ? 14.566  -35.116  -19.913 1.00 100.28 ? 203 ILE A C     1 
ATOM   5103  O O     . ILE G 3 200 ? 14.122  -34.921  -21.043 1.00 100.20 ? 203 ILE A O     1 
ATOM   5104  C CB    . ILE G 3 200 ? 13.155  -35.563  -17.948 1.00 99.68  ? 203 ILE A CB    1 
ATOM   5105  C CG1   . ILE G 3 200 ? 12.641  -36.590  -16.930 1.00 105.63 ? 203 ILE A CG1   1 
ATOM   5106  C CG2   . ILE G 3 200 ? 12.004  -34.795  -18.587 1.00 97.61  ? 203 ILE A CG2   1 
ATOM   5107  C CD1   . ILE G 3 200 ? 11.413  -37.357  -17.366 1.00 111.58 ? 203 ILE A CD1   1 
ATOM   5108  N N     . TYR G 3 201 ? 15.509  -34.364  -19.361 1.00 104.07 ? 204 TYR A N     1 
ATOM   5109  C CA    . TYR G 3 201 ? 16.095  -33.227  -20.046 1.00 104.61 ? 204 TYR A CA    1 
ATOM   5110  C C     . TYR G 3 201 ? 17.398  -32.852  -19.357 1.00 107.93 ? 204 TYR A C     1 
ATOM   5111  O O     . TYR G 3 201 ? 17.530  -33.024  -18.139 1.00 106.10 ? 204 TYR A O     1 
ATOM   5112  C CB    . TYR G 3 201 ? 15.124  -32.048  -20.012 1.00 106.41 ? 204 TYR A CB    1 
ATOM   5113  C CG    . TYR G 3 201 ? 15.667  -30.776  -20.623 1.00 104.27 ? 204 TYR A CG    1 
ATOM   5114  C CD1   . TYR G 3 201 ? 15.635  -30.575  -21.997 1.00 103.26 ? 204 TYR A CD1   1 
ATOM   5115  C CD2   . TYR G 3 201 ? 16.208  -29.776  -19.825 1.00 102.38 ? 204 TYR A CD2   1 
ATOM   5116  C CE1   . TYR G 3 201 ? 16.128  -29.414  -22.561 1.00 103.44 ? 204 TYR A CE1   1 
ATOM   5117  C CE2   . TYR G 3 201 ? 16.706  -28.612  -20.380 1.00 105.29 ? 204 TYR A CE2   1 
ATOM   5118  C CZ    . TYR G 3 201 ? 16.662  -28.436  -21.748 1.00 104.13 ? 204 TYR A CZ    1 
ATOM   5119  O OH    . TYR G 3 201 ? 17.151  -27.281  -22.304 1.00 102.52 ? 204 TYR A OH    1 
ATOM   5120  N N     . TYR G 3 202 ? 18.359  -32.358  -20.139 1.00 109.74 ? 205 TYR A N     1 
ATOM   5121  C CA    . TYR G 3 202 ? 19.644  -31.915  -19.596 1.00 111.43 ? 205 TYR A CA    1 
ATOM   5122  C C     . TYR G 3 202 ? 20.290  -30.853  -20.480 1.00 112.00 ? 205 TYR A C     1 
ATOM   5123  O O     . TYR G 3 202 ? 20.048  -30.805  -21.684 1.00 116.75 ? 205 TYR A O     1 
ATOM   5124  C CB    . TYR G 3 202 ? 20.597  -33.110  -19.395 1.00 113.86 ? 205 TYR A CB    1 
ATOM   5125  C CG    . TYR G 3 202 ? 21.436  -33.504  -20.604 1.00 116.13 ? 205 TYR A CG    1 
ATOM   5126  C CD1   . TYR G 3 202 ? 22.672  -32.904  -20.844 1.00 115.70 ? 205 TYR A CD1   1 
ATOM   5127  C CD2   . TYR G 3 202 ? 21.009  -34.497  -21.486 1.00 115.98 ? 205 TYR A CD2   1 
ATOM   5128  C CE1   . TYR G 3 202 ? 23.444  -33.265  -21.934 1.00 116.61 ? 205 TYR A CE1   1 
ATOM   5129  C CE2   . TYR G 3 202 ? 21.776  -34.864  -22.579 1.00 115.70 ? 205 TYR A CE2   1 
ATOM   5130  C CZ    . TYR G 3 202 ? 22.993  -34.245  -22.797 1.00 119.02 ? 205 TYR A CZ    1 
ATOM   5131  O OH    . TYR G 3 202 ? 23.765  -34.600  -23.881 1.00 126.36 ? 205 TYR A OH    1 
ATOM   5132  N N     . GLU G 3 203 ? 21.103  -30.001  -19.862 1.00 114.23 ? 206 GLU A N     1 
ATOM   5133  C CA    . GLU G 3 203 ? 21.901  -29.004  -20.572 1.00 113.35 ? 206 GLU A CA    1 
ATOM   5134  C C     . GLU G 3 203 ? 23.344  -29.094  -20.100 1.00 114.05 ? 206 GLU A C     1 
ATOM   5135  O O     . GLU G 3 203 ? 23.606  -29.193  -18.896 1.00 113.76 ? 206 GLU A O     1 
ATOM   5136  C CB    . GLU G 3 203 ? 21.381  -27.593  -20.299 1.00 115.39 ? 206 GLU A CB    1 
ATOM   5137  C CG    . GLU G 3 203 ? 20.099  -27.226  -21.028 1.00 119.60 ? 206 GLU A CG    1 
ATOM   5138  C CD    . GLU G 3 203 ? 19.636  -25.803  -20.736 1.00 122.35 ? 206 GLU A CD    1 
ATOM   5139  O OE1   . GLU G 3 203 ? 20.465  -24.957  -20.326 1.00 120.65 ? 206 GLU A OE1   1 
ATOM   5140  O OE2   . GLU G 3 203 ? 18.433  -25.526  -20.921 1.00 120.91 ? 206 GLU A OE2   1 
ATOM   5141  N N     . LEU G 3 204 ? 24.276  -29.065  -21.046 1.00 113.04 ? 207 LEU A N     1 
ATOM   5142  C CA    . LEU G 3 204 ? 25.693  -29.019  -20.721 1.00 113.47 ? 207 LEU A CA    1 
ATOM   5143  C C     . LEU G 3 204 ? 26.218  -27.610  -20.987 1.00 114.04 ? 207 LEU A C     1 
ATOM   5144  O O     . LEU G 3 204 ? 26.457  -27.224  -22.133 1.00 110.32 ? 207 LEU A O     1 
ATOM   5145  C CB    . LEU G 3 204 ? 26.466  -30.056  -21.536 1.00 117.98 ? 207 LEU A CB    1 
ATOM   5146  C CG    . LEU G 3 204 ? 27.932  -30.271  -21.143 1.00 119.11 ? 207 LEU A CG    1 
ATOM   5147  C CD1   . LEU G 3 204 ? 28.048  -30.857  -19.743 1.00 117.69 ? 207 LEU A CD1   1 
ATOM   5148  C CD2   . LEU G 3 204 ? 28.632  -31.172  -22.149 1.00 120.00 ? 207 LEU A CD2   1 
ATOM   5149  N N     . LEU G 3 205 ? 26.378  -26.843  -19.913 1.00 117.84 ? 208 LEU A N     1 
ATOM   5150  C CA    . LEU G 3 205 ? 26.869  -25.470  -19.994 1.00 121.64 ? 208 LEU A CA    1 
ATOM   5151  C C     . LEU G 3 205 ? 28.305  -25.445  -20.496 1.00 130.41 ? 208 LEU A C     1 
ATOM   5152  O O     . LEU G 3 205 ? 29.056  -26.395  -20.291 1.00 136.30 ? 208 LEU A O     1 
ATOM   5153  C CB    . LEU G 3 205 ? 26.781  -24.785  -18.625 1.00 120.64 ? 208 LEU A CB    1 
ATOM   5154  C CG    . LEU G 3 205 ? 25.434  -24.150  -18.263 1.00 122.73 ? 208 LEU A CG    1 
ATOM   5155  C CD1   . LEU G 3 205 ? 24.256  -25.055  -18.588 1.00 123.87 ? 208 LEU A CD1   1 
ATOM   5156  C CD2   . LEU G 3 205 ? 25.413  -23.764  -16.792 1.00 124.54 ? 208 LEU A CD2   1 
ATOM   5157  N N     . LYS G 3 206 ? 28.686  -24.342  -21.132 1.00 138.01 ? 209 LYS A N     1 
ATOM   5158  C CA    . LYS G 3 206 ? 29.994  -24.243  -21.783 1.00 137.87 ? 209 LYS A CA    1 
ATOM   5159  C C     . LYS G 3 206 ? 31.068  -24.029  -20.713 1.00 127.93 ? 209 LYS A C     1 
ATOM   5160  O O     . LYS G 3 206 ? 30.737  -23.779  -19.550 1.00 120.90 ? 209 LYS A O     1 
ATOM   5161  C CB    . LYS G 3 206 ? 30.040  -23.102  -22.822 1.00 147.89 ? 209 LYS A CB    1 
ATOM   5162  C CG    . LYS G 3 206 ? 28.710  -22.635  -23.410 1.00 153.89 ? 209 LYS A CG    1 
ATOM   5163  C CD    . LYS G 3 206 ? 27.933  -23.721  -24.139 1.00 160.29 ? 209 LYS A CD    1 
ATOM   5164  C CE    . LYS G 3 206 ? 26.438  -23.424  -24.137 1.00 164.25 ? 209 LYS A CE    1 
ATOM   5165  N NZ    . LYS G 3 206 ? 25.765  -23.840  -25.397 1.00 166.19 ? 209 LYS A NZ    1 
ATOM   5166  N N     . PRO G 3 207 ? 32.355  -24.135  -21.097 1.00 124.47 ? 210 PRO A N     1 
ATOM   5167  C CA    . PRO G 3 207 ? 33.453  -23.919  -20.151 1.00 127.51 ? 210 PRO A CA    1 
ATOM   5168  C C     . PRO G 3 207 ? 33.372  -22.578  -19.421 1.00 131.25 ? 210 PRO A C     1 
ATOM   5169  O O     . PRO G 3 207 ? 33.438  -21.525  -20.053 1.00 136.71 ? 210 PRO A O     1 
ATOM   5170  C CB    . PRO G 3 207 ? 34.697  -23.975  -21.042 1.00 126.07 ? 210 PRO A CB    1 
ATOM   5171  C CG    . PRO G 3 207 ? 34.306  -24.872  -22.159 1.00 126.47 ? 210 PRO A CG    1 
ATOM   5172  C CD    . PRO G 3 207 ? 32.852  -24.593  -22.409 1.00 125.19 ? 210 PRO A CD    1 
ATOM   5173  N N     . GLY G 3 208 ? 33.210  -22.628  -18.101 1.00 134.65 ? 211 GLY A N     1 
ATOM   5174  C CA    . GLY G 3 208 ? 33.131  -21.420  -17.287 1.00 138.13 ? 211 GLY A CA    1 
ATOM   5175  C C     . GLY G 3 208 ? 31.720  -20.926  -17.017 1.00 142.95 ? 211 GLY A C     1 
ATOM   5176  O O     . GLY G 3 208 ? 31.498  -20.215  -16.037 1.00 147.73 ? 211 GLY A O     1 
ATOM   5177  N N     . GLU G 3 209 ? 30.762  -21.288  -17.872 1.00 145.37 ? 212 GLU A N     1 
ATOM   5178  C CA    . GLU G 3 209 ? 29.373  -20.866  -17.674 1.00 148.90 ? 212 GLU A CA    1 
ATOM   5179  C C     . GLU G 3 209 ? 28.804  -21.412  -16.371 1.00 147.14 ? 212 GLU A C     1 
ATOM   5180  O O     . GLU G 3 209 ? 29.230  -22.464  -15.894 1.00 142.25 ? 212 GLU A O     1 
ATOM   5181  C CB    . GLU G 3 209 ? 28.483  -21.294  -18.843 1.00 151.60 ? 212 GLU A CB    1 
ATOM   5182  C CG    . GLU G 3 209 ? 28.657  -20.442  -20.090 1.00 156.30 ? 212 GLU A CG    1 
ATOM   5183  C CD    . GLU G 3 209 ? 27.370  -20.283  -20.879 1.00 159.17 ? 212 GLU A CD    1 
ATOM   5184  O OE1   . GLU G 3 209 ? 26.604  -21.265  -20.991 1.00 154.64 ? 212 GLU A OE1   1 
ATOM   5185  O OE2   . GLU G 3 209 ? 27.126  -19.171  -21.394 1.00 162.87 ? 212 GLU A OE2   1 
ATOM   5186  N N     . THR G 3 210 ? 27.838  -20.684  -15.809 1.00 146.63 ? 213 THR A N     1 
ATOM   5187  C CA    . THR G 3 210 ? 27.258  -21.020  -14.506 1.00 147.27 ? 213 THR A CA    1 
ATOM   5188  C C     . THR G 3 210 ? 25.763  -20.701  -14.419 1.00 145.15 ? 213 THR A C     1 
ATOM   5189  O O     . THR G 3 210 ? 25.253  -19.820  -15.113 1.00 146.16 ? 213 THR A O     1 
ATOM   5190  C CB    . THR G 3 210 ? 28.005  -20.322  -13.342 1.00 146.27 ? 213 THR A CB    1 
ATOM   5191  O OG1   . THR G 3 210 ? 27.088  -20.030  -12.280 1.00 151.54 ? 213 THR A OG1   1 
ATOM   5192  C CG2   . THR G 3 210 ? 28.659  -19.027  -13.796 1.00 145.58 ? 213 THR A CG2   1 
ATOM   5193  N N     . VAL G 3 211 ? 25.077  -21.438  -13.549 1.00 147.18 ? 214 VAL A N     1 
ATOM   5194  C CA    . VAL G 3 211 ? 23.644  -21.281  -13.344 1.00 149.36 ? 214 VAL A CA    1 
ATOM   5195  C C     . VAL G 3 211 ? 23.374  -20.050  -12.486 1.00 149.25 ? 214 VAL A C     1 
ATOM   5196  O O     . VAL G 3 211 ? 23.825  -19.946  -11.342 1.00 139.70 ? 214 VAL A O     1 
ATOM   5197  C CB    . VAL G 3 211 ? 23.013  -22.542  -12.701 1.00 152.30 ? 214 VAL A CB    1 
ATOM   5198  C CG1   . VAL G 3 211 ? 21.614  -22.260  -12.160 1.00 150.72 ? 214 VAL A CG1   1 
ATOM   5199  C CG2   . VAL G 3 211 ? 22.972  -23.675  -13.716 1.00 155.46 ? 214 VAL A CG2   1 
ATOM   5200  N N     . ASN G 3 212 ? 22.636  -19.120  -13.077 1.00 148.76 ? 215 ASN A N     1 
ATOM   5201  C CA    . ASN G 3 212 ? 22.173  -17.923  -12.411 1.00 142.19 ? 215 ASN A CA    1 
ATOM   5202  C C     . ASN G 3 212 ? 20.641  -17.958  -12.422 1.00 135.37 ? 215 ASN A C     1 
ATOM   5203  O O     . ASN G 3 212 ? 20.040  -18.408  -13.396 1.00 125.30 ? 215 ASN A O     1 
ATOM   5204  C CB    . ASN G 3 212 ? 22.767  -16.708  -13.134 1.00 144.52 ? 215 ASN A CB    1 
ATOM   5205  C CG    . ASN G 3 212 ? 21.772  -15.590  -13.335 1.00 146.85 ? 215 ASN A CG    1 
ATOM   5206  O OD1   . ASN G 3 212 ? 21.204  -15.070  -12.377 1.00 159.78 ? 215 ASN A OD1   1 
ATOM   5207  N ND2   . ASN G 3 212 ? 21.567  -15.201  -14.587 1.00 142.45 ? 215 ASN A ND2   1 
ATOM   5208  N N     . ALA G 3 213 ? 20.022  -17.494  -11.335 1.00 130.72 ? 216 ALA A N     1 
ATOM   5209  C CA    . ALA G 3 213 ? 18.565  -17.619  -11.122 1.00 132.36 ? 216 ALA A CA    1 
ATOM   5210  C C     . ALA G 3 213 ? 17.693  -17.438  -12.376 1.00 134.11 ? 216 ALA A C     1 
ATOM   5211  O O     . ALA G 3 213 ? 16.642  -18.073  -12.494 1.00 131.57 ? 216 ALA A O     1 
ATOM   5212  C CB    . ALA G 3 213 ? 18.108  -16.659  -10.029 1.00 131.46 ? 216 ALA A CB    1 
ATOM   5213  N N     . ALA G 3 214 ? 18.121  -16.569  -13.292 1.00 135.20 ? 217 ALA A N     1 
ATOM   5214  C CA    . ALA G 3 214 ? 17.430  -16.376  -14.571 1.00 136.38 ? 217 ALA A CA    1 
ATOM   5215  C C     . ALA G 3 214 ? 17.540  -17.621  -15.444 1.00 136.58 ? 217 ALA A C     1 
ATOM   5216  O O     . ALA G 3 214 ? 16.536  -18.133  -15.948 1.00 133.90 ? 217 ALA A O     1 
ATOM   5217  C CB    . ALA G 3 214 ? 18.003  -15.173  -15.306 1.00 136.55 ? 217 ALA A CB    1 
ATOM   5218  N N     . ARG G 3 215 ? 18.773  -18.090  -15.621 1.00 134.02 ? 218 ARG A N     1 
ATOM   5219  C CA    . ARG G 3 215 ? 19.060  -19.318  -16.364 1.00 130.13 ? 218 ARG A CA    1 
ATOM   5220  C C     . ARG G 3 215 ? 18.227  -20.509  -15.863 1.00 122.10 ? 218 ARG A C     1 
ATOM   5221  O O     . ARG G 3 215 ? 17.613  -21.223  -16.663 1.00 112.47 ? 218 ARG A O     1 
ATOM   5222  C CB    . ARG G 3 215 ? 20.560  -19.627  -16.266 1.00 131.92 ? 218 ARG A CB    1 
ATOM   5223  C CG    . ARG G 3 215 ? 20.974  -21.009  -16.735 1.00 134.84 ? 218 ARG A CG    1 
ATOM   5224  C CD    . ARG G 3 215 ? 21.056  -21.101  -18.245 1.00 134.45 ? 218 ARG A CD    1 
ATOM   5225  N NE    . ARG G 3 215 ? 22.387  -20.725  -18.720 1.00 133.30 ? 218 ARG A NE    1 
ATOM   5226  C CZ    . ARG G 3 215 ? 22.908  -21.088  -19.890 1.00 131.34 ? 218 ARG A CZ    1 
ATOM   5227  N NH1   . ARG G 3 215 ? 22.220  -21.850  -20.740 1.00 133.21 ? 218 ARG A NH1   1 
ATOM   5228  N NH2   . ARG G 3 215 ? 24.132  -20.690  -20.212 1.00 127.81 ? 218 ARG A NH2   1 
ATOM   5229  N N     . TYR G 3 216 ? 18.209  -20.711  -14.545 1.00 115.53 ? 219 TYR A N     1 
ATOM   5230  C CA    . TYR G 3 216 ? 17.465  -21.821  -13.933 1.00 117.62 ? 219 TYR A CA    1 
ATOM   5231  C C     . TYR G 3 216 ? 15.978  -21.728  -14.267 1.00 125.96 ? 219 TYR A C     1 
ATOM   5232  O O     . TYR G 3 216 ? 15.325  -22.734  -14.559 1.00 123.11 ? 219 TYR A O     1 
ATOM   5233  C CB    . TYR G 3 216 ? 17.660  -21.835  -12.409 1.00 112.52 ? 219 TYR A CB    1 
ATOM   5234  C CG    . TYR G 3 216 ? 17.259  -23.137  -11.732 1.00 109.07 ? 219 TYR A CG    1 
ATOM   5235  C CD1   . TYR G 3 216 ? 17.996  -24.300  -11.926 1.00 112.58 ? 219 TYR A CD1   1 
ATOM   5236  C CD2   . TYR G 3 216 ? 16.157  -23.200  -10.888 1.00 108.15 ? 219 TYR A CD2   1 
ATOM   5237  C CE1   . TYR G 3 216 ? 17.636  -25.490  -11.312 1.00 116.13 ? 219 TYR A CE1   1 
ATOM   5238  C CE2   . TYR G 3 216 ? 15.790  -24.384  -10.265 1.00 108.25 ? 219 TYR A CE2   1 
ATOM   5239  C CZ    . TYR G 3 216 ? 16.530  -25.529  -10.482 1.00 113.69 ? 219 TYR A CZ    1 
ATOM   5240  O OH    . TYR G 3 216 ? 16.180  -26.714  -9.865  1.00 116.27 ? 219 TYR A OH    1 
ATOM   5241  N N     . GLN G 3 217 ? 15.457  -20.505  -14.225 1.00 135.97 ? 220 GLN A N     1 
ATOM   5242  C CA    . GLN G 3 217 ? 14.069  -20.238  -14.580 1.00 136.87 ? 220 GLN A CA    1 
ATOM   5243  C C     . GLN G 3 217 ? 13.800  -20.751  -15.986 1.00 131.90 ? 220 GLN A C     1 
ATOM   5244  O O     . GLN G 3 217 ? 12.926  -21.593  -16.192 1.00 124.76 ? 220 GLN A O     1 
ATOM   5245  C CB    . GLN G 3 217 ? 13.778  -18.736  -14.485 1.00 143.95 ? 220 GLN A CB    1 
ATOM   5246  C CG    . GLN G 3 217 ? 12.301  -18.381  -14.520 1.00 151.15 ? 220 GLN A CG    1 
ATOM   5247  C CD    . GLN G 3 217 ? 12.010  -16.983  -13.989 1.00 152.50 ? 220 GLN A CD    1 
ATOM   5248  O OE1   . GLN G 3 217 ? 12.851  -16.356  -13.339 1.00 147.63 ? 220 GLN A OE1   1 
ATOM   5249  N NE2   . GLN G 3 217 ? 10.808  -16.491  -14.263 1.00 153.32 ? 220 GLN A NE2   1 
ATOM   5250  N N     . GLN G 3 218 ? 14.588  -20.266  -16.941 1.00 128.81 ? 221 GLN A N     1 
ATOM   5251  C CA    . GLN G 3 218 ? 14.478  -20.708  -18.323 1.00 127.04 ? 221 GLN A CA    1 
ATOM   5252  C C     . GLN G 3 218 ? 14.532  -22.232  -18.390 1.00 120.51 ? 221 GLN A C     1 
ATOM   5253  O O     . GLN G 3 218 ? 13.675  -22.875  -19.006 1.00 114.81 ? 221 GLN A O     1 
ATOM   5254  C CB    . GLN G 3 218 ? 15.601  -20.099  -19.171 1.00 130.63 ? 221 GLN A CB    1 
ATOM   5255  C CG    . GLN G 3 218 ? 15.454  -20.315  -20.671 1.00 136.23 ? 221 GLN A CG    1 
ATOM   5256  C CD    . GLN G 3 218 ? 14.214  -19.654  -21.248 1.00 141.29 ? 221 GLN A CD    1 
ATOM   5257  O OE1   . GLN G 3 218 ? 13.088  -20.110  -21.026 1.00 141.74 ? 221 GLN A OE1   1 
ATOM   5258  N NE2   . GLN G 3 218 ? 14.415  -18.581  -22.006 1.00 145.11 ? 221 GLN A NE2   1 
ATOM   5259  N N     . GLN G 3 219 ? 15.539  -22.798  -17.731 1.00 113.64 ? 222 GLN A N     1 
ATOM   5260  C CA    . GLN G 3 219 ? 15.735  -24.240  -17.711 1.00 112.29 ? 222 GLN A CA    1 
ATOM   5261  C C     . GLN G 3 219 ? 14.467  -24.984  -17.288 1.00 113.02 ? 222 GLN A C     1 
ATOM   5262  O O     . GLN G 3 219 ? 14.104  -25.992  -17.899 1.00 114.70 ? 222 GLN A O     1 
ATOM   5263  C CB    . GLN G 3 219 ? 16.926  -24.608  -16.810 1.00 107.70 ? 222 GLN A CB    1 
ATOM   5264  C CG    . GLN G 3 219 ? 18.272  -24.392  -17.490 1.00 105.47 ? 222 GLN A CG    1 
ATOM   5265  C CD    . GLN G 3 219 ? 19.469  -24.612  -16.577 1.00 104.54 ? 222 GLN A CD    1 
ATOM   5266  O OE1   . GLN G 3 219 ? 19.343  -24.653  -15.351 1.00 100.04 ? 222 GLN A OE1   1 
ATOM   5267  N NE2   . GLN G 3 219 ? 20.648  -24.747  -17.181 1.00 102.89 ? 222 GLN A NE2   1 
ATOM   5268  N N     . LEU G 3 220 ? 13.782  -24.471  -16.270 1.00 112.61 ? 223 LEU A N     1 
ATOM   5269  C CA    . LEU G 3 220 ? 12.572  -25.119  -15.761 1.00 113.09 ? 223 LEU A CA    1 
ATOM   5270  C C     . LEU G 3 220 ? 11.447  -25.212  -16.794 1.00 117.14 ? 223 LEU A C     1 
ATOM   5271  O O     . LEU G 3 220 ? 10.676  -26.169  -16.770 1.00 120.11 ? 223 LEU A O     1 
ATOM   5272  C CB    . LEU G 3 220 ? 12.072  -24.411  -14.503 1.00 112.54 ? 223 LEU A CB    1 
ATOM   5273  C CG    . LEU G 3 220 ? 12.937  -24.648  -13.261 1.00 114.06 ? 223 LEU A CG    1 
ATOM   5274  C CD1   . LEU G 3 220 ? 12.841  -23.467  -12.309 1.00 117.11 ? 223 LEU A CD1   1 
ATOM   5275  C CD2   . LEU G 3 220 ? 12.550  -25.941  -12.555 1.00 113.15 ? 223 LEU A CD2   1 
ATOM   5276  N N     . ILE G 3 221 ? 11.351  -24.235  -17.696 1.00 118.93 ? 224 ILE A N     1 
ATOM   5277  C CA    . ILE G 3 221 ? 10.348  -24.289  -18.760 1.00 122.28 ? 224 ILE A CA    1 
ATOM   5278  C C     . ILE G 3 221 ? 10.775  -25.299  -19.807 1.00 124.23 ? 224 ILE A C     1 
ATOM   5279  O O     . ILE G 3 221 ? 9.999   -26.179  -20.189 1.00 131.98 ? 224 ILE A O     1 
ATOM   5280  C CB    . ILE G 3 221 ? 10.143  -22.931  -19.463 1.00 128.02 ? 224 ILE A CB    1 
ATOM   5281  C CG1   . ILE G 3 221 ? 9.744   -21.848  -18.453 1.00 128.92 ? 224 ILE A CG1   1 
ATOM   5282  C CG2   . ILE G 3 221 ? 9.096   -23.055  -20.569 1.00 131.25 ? 224 ILE A CG2   1 
ATOM   5283  C CD1   . ILE G 3 221 ? 10.763  -20.742  -18.322 1.00 127.61 ? 224 ILE A CD1   1 
ATOM   5284  N N     . ASN G 3 222 ? 12.012  -25.157  -20.275 1.00 122.33 ? 225 ASN A N     1 
ATOM   5285  C CA    . ASN G 3 222 ? 12.569  -26.067  -21.270 1.00 121.99 ? 225 ASN A CA    1 
ATOM   5286  C C     . ASN G 3 222 ? 12.422  -27.507  -20.802 1.00 119.12 ? 225 ASN A C     1 
ATOM   5287  O O     . ASN G 3 222 ? 12.136  -28.399  -21.602 1.00 124.28 ? 225 ASN A O     1 
ATOM   5288  C CB    . ASN G 3 222 ? 14.037  -25.730  -21.548 1.00 122.70 ? 225 ASN A CB    1 
ATOM   5289  C CG    . ASN G 3 222 ? 14.221  -24.315  -22.084 1.00 124.61 ? 225 ASN A CG    1 
ATOM   5290  O OD1   . ASN G 3 222 ? 13.306  -23.742  -22.673 1.00 124.76 ? 225 ASN A OD1   1 
ATOM   5291  N ND2   . ASN G 3 222 ? 15.402  -23.746  -21.876 1.00 123.05 ? 225 ASN A ND2   1 
ATOM   5292  N N     . LEU G 3 223 ? 12.603  -27.714  -19.498 1.00 111.24 ? 226 LEU A N     1 
ATOM   5293  C CA    . LEU G 3 223 ? 12.301  -28.988  -18.865 1.00 108.86 ? 226 LEU A CA    1 
ATOM   5294  C C     . LEU G 3 223 ? 10.829  -29.294  -19.045 1.00 111.75 ? 226 LEU A C     1 
ATOM   5295  O O     . LEU G 3 223 ? 10.471  -30.280  -19.678 1.00 119.28 ? 226 LEU A O     1 
ATOM   5296  C CB    . LEU G 3 223 ? 12.652  -28.958  -17.373 1.00 108.29 ? 226 LEU A CB    1 
ATOM   5297  C CG    . LEU G 3 223 ? 12.095  -30.073  -16.473 1.00 107.05 ? 226 LEU A CG    1 
ATOM   5298  C CD1   . LEU G 3 223 ? 12.468  -31.462  -16.974 1.00 105.66 ? 226 LEU A CD1   1 
ATOM   5299  C CD2   . LEU G 3 223 ? 12.586  -29.879  -15.049 1.00 105.36 ? 226 LEU A CD2   1 
ATOM   5300  N N     . ASN G 3 224 ? 9.980   -28.432  -18.499 1.00 120.11 ? 227 ASN A N     1 
ATOM   5301  C CA    . ASN G 3 224 ? 8.536   -28.650  -18.530 1.00 127.73 ? 227 ASN A CA    1 
ATOM   5302  C C     . ASN G 3 224 ? 8.040   -29.011  -19.923 1.00 126.74 ? 227 ASN A C     1 
ATOM   5303  O O     . ASN G 3 224 ? 7.288   -29.972  -20.087 1.00 131.61 ? 227 ASN A O     1 
ATOM   5304  C CB    . ASN G 3 224 ? 7.791   -27.414  -18.014 1.00 131.79 ? 227 ASN A CB    1 
ATOM   5305  C CG    . ASN G 3 224 ? 6.316   -27.680  -17.778 1.00 134.55 ? 227 ASN A CG    1 
ATOM   5306  O OD1   . ASN G 3 224 ? 5.895   -27.945  -16.655 1.00 137.07 ? 227 ASN A OD1   1 
ATOM   5307  N ND2   . ASN G 3 224 ? 5.526   -27.626  -18.841 1.00 136.61 ? 227 ASN A ND2   1 
ATOM   5308  N N     . ARG G 3 225 ? 8.470   -28.249  -20.923 1.00 126.63 ? 228 ARG A N     1 
ATOM   5309  C CA    . ARG G 3 225 ? 8.085   -28.531  -22.299 1.00 131.84 ? 228 ARG A CA    1 
ATOM   5310  C C     . ARG G 3 225 ? 8.592   -29.904  -22.722 1.00 130.86 ? 228 ARG A C     1 
ATOM   5311  O O     . ARG G 3 225 ? 7.829   -30.728  -23.238 1.00 129.36 ? 228 ARG A O     1 
ATOM   5312  C CB    . ARG G 3 225 ? 8.615   -27.458  -23.245 1.00 135.12 ? 228 ARG A CB    1 
ATOM   5313  C CG    . ARG G 3 225 ? 8.362   -27.778  -24.714 1.00 143.12 ? 228 ARG A CG    1 
ATOM   5314  C CD    . ARG G 3 225 ? 8.040   -26.542  -25.535 1.00 146.52 ? 228 ARG A CD    1 
ATOM   5315  N NE    . ARG G 3 225 ? 8.709   -25.351  -25.023 1.00 150.37 ? 228 ARG A NE    1 
ATOM   5316  C CZ    . ARG G 3 225 ? 10.000  -25.080  -25.178 1.00 151.63 ? 228 ARG A CZ    1 
ATOM   5317  N NH1   . ARG G 3 225 ? 10.792  -25.915  -25.838 1.00 152.21 ? 228 ARG A NH1   1 
ATOM   5318  N NH2   . ARG G 3 225 ? 10.503  -23.966  -24.667 1.00 150.98 ? 228 ARG A NH2   1 
ATOM   5319  N N     . ALA G 3 226 ? 9.878   -30.143  -22.487 1.00 125.57 ? 229 ALA A N     1 
ATOM   5320  C CA    . ALA G 3 226 ? 10.483  -31.437  -22.773 1.00 123.59 ? 229 ALA A CA    1 
ATOM   5321  C C     . ALA G 3 226 ? 9.833   -32.555  -21.955 1.00 122.99 ? 229 ALA A C     1 
ATOM   5322  O O     . ALA G 3 226 ? 9.833   -33.712  -22.373 1.00 128.51 ? 229 ALA A O     1 
ATOM   5323  C CB    . ALA G 3 226 ? 11.981  -31.390  -22.508 1.00 122.79 ? 229 ALA A CB    1 
ATOM   5324  N N     . LEU G 3 227 ? 9.279   -32.203  -20.798 1.00 124.30 ? 230 LEU A N     1 
ATOM   5325  C CA    . LEU G 3 227 ? 8.702   -33.179  -19.879 1.00 132.42 ? 230 LEU A CA    1 
ATOM   5326  C C     . LEU G 3 227 ? 7.375   -33.756  -20.373 1.00 141.34 ? 230 LEU A C     1 
ATOM   5327  O O     . LEU G 3 227 ? 7.132   -34.960  -20.243 1.00 144.69 ? 230 LEU A O     1 
ATOM   5328  C CB    . LEU G 3 227 ? 8.535   -32.553  -18.489 1.00 129.34 ? 230 LEU A CB    1 
ATOM   5329  C CG    . LEU G 3 227 ? 7.978   -33.458  -17.384 1.00 128.07 ? 230 LEU A CG    1 
ATOM   5330  C CD1   . LEU G 3 227 ? 8.660   -33.174  -16.053 1.00 129.45 ? 230 LEU A CD1   1 
ATOM   5331  C CD2   . LEU G 3 227 ? 6.468   -33.315  -17.262 1.00 129.61 ? 230 LEU A CD2   1 
ATOM   5332  N N     . GLN G 3 228 ? 6.520   -32.911  -20.938 1.00 149.88 ? 231 GLN A N     1 
ATOM   5333  C CA    . GLN G 3 228 ? 5.201   -33.369  -21.372 1.00 157.51 ? 231 GLN A CA    1 
ATOM   5334  C C     . GLN G 3 228 ? 5.239   -34.164  -22.687 1.00 160.14 ? 231 GLN A C     1 
ATOM   5335  O O     . GLN G 3 228 ? 4.341   -34.972  -22.935 1.00 158.80 ? 231 GLN A O     1 
ATOM   5336  C CB    . GLN G 3 228 ? 4.216   -32.202  -21.440 1.00 158.29 ? 231 GLN A CB    1 
ATOM   5337  C CG    . GLN G 3 228 ? 4.429   -31.238  -22.590 1.00 157.78 ? 231 GLN A CG    1 
ATOM   5338  C CD    . GLN G 3 228 ? 3.816   -29.877  -22.326 1.00 160.65 ? 231 GLN A CD    1 
ATOM   5339  O OE1   . GLN G 3 228 ? 4.338   -28.856  -22.772 1.00 161.54 ? 231 GLN A OE1   1 
ATOM   5340  N NE2   . GLN G 3 228 ? 2.706   -29.852  -21.590 1.00 161.74 ? 231 GLN A NE2   1 
ATOM   5341  N N     . ARG G 3 229 ? 6.268   -33.950  -23.513 1.00 160.56 ? 232 ARG A N     1 
ATOM   5342  C CA    . ARG G 3 229 ? 6.507   -34.815  -24.677 1.00 157.82 ? 232 ARG A CA    1 
ATOM   5343  C C     . ARG G 3 229 ? 6.954   -36.200  -24.216 1.00 161.14 ? 232 ARG A C     1 
ATOM   5344  O O     . ARG G 3 229 ? 6.328   -37.207  -24.551 1.00 169.49 ? 232 ARG A O     1 
ATOM   5345  C CB    . ARG G 3 229 ? 7.594   -34.266  -25.611 1.00 154.82 ? 232 ARG A CB    1 
ATOM   5346  C CG    . ARG G 3 229 ? 7.425   -32.843  -26.105 1.00 153.58 ? 232 ARG A CG    1 
ATOM   5347  C CD    . ARG G 3 229 ? 8.369   -32.560  -27.272 1.00 153.68 ? 232 ARG A CD    1 
ATOM   5348  N NE    . ARG G 3 229 ? 9.776   -32.465  -26.865 1.00 155.36 ? 232 ARG A NE    1 
ATOM   5349  C CZ    . ARG G 3 229 ? 10.665  -33.465  -26.860 1.00 158.95 ? 232 ARG A CZ    1 
ATOM   5350  N NH1   . ARG G 3 229 ? 10.341  -34.702  -27.237 1.00 157.74 ? 232 ARG A NH1   1 
ATOM   5351  N NH2   . ARG G 3 229 ? 11.910  -33.223  -26.464 1.00 162.42 ? 232 ARG A NH2   1 
ATOM   5352  N N     . LYS G 3 230 ? 8.045   -36.235  -23.450 1.00 157.30 ? 233 LYS A N     1 
ATOM   5353  C CA    . LYS G 3 230 ? 8.672   -37.490  -23.019 1.00 155.96 ? 233 LYS A CA    1 
ATOM   5354  C C     . LYS G 3 230 ? 7.798   -38.284  -22.056 1.00 153.37 ? 233 LYS A C     1 
ATOM   5355  O O     . LYS G 3 230 ? 7.793   -39.515  -22.101 1.00 157.67 ? 233 LYS A O     1 
ATOM   5356  C CB    . LYS G 3 230 ? 10.037  -37.226  -22.369 1.00 155.98 ? 233 LYS A CB    1 
ATOM   5357  C CG    . LYS G 3 230 ? 11.177  -37.019  -23.353 1.00 153.95 ? 233 LYS A CG    1 
ATOM   5358  C CD    . LYS G 3 230 ? 11.672  -38.341  -23.916 1.00 152.85 ? 233 LYS A CD    1 
ATOM   5359  C CE    . LYS G 3 230 ? 12.908  -38.149  -24.778 1.00 155.83 ? 233 LYS A CE    1 
ATOM   5360  N NZ    . LYS G 3 230 ? 14.163  -38.448  -24.039 1.00 157.55 ? 233 LYS A NZ    1 
ATOM   5361  N N     . ARG G 3 231 ? 7.080   -37.584  -21.180 1.00 150.93 ? 234 ARG A N     1 
ATOM   5362  C CA    . ARG G 3 231 ? 6.156   -38.228  -20.250 1.00 158.31 ? 234 ARG A CA    1 
ATOM   5363  C C     . ARG G 3 231 ? 4.717   -37.827  -20.590 1.00 169.36 ? 234 ARG A C     1 
ATOM   5364  O O     . ARG G 3 231 ? 4.233   -36.786  -20.133 1.00 158.88 ? 234 ARG A O     1 
ATOM   5365  C CB    . ARG G 3 231 ? 6.498   -37.863  -18.803 1.00 153.15 ? 234 ARG A CB    1 
ATOM   5366  C CG    . ARG G 3 231 ? 7.903   -38.258  -18.366 1.00 143.73 ? 234 ARG A CG    1 
ATOM   5367  C CD    . ARG G 3 231 ? 8.052   -39.758  -18.156 1.00 136.95 ? 234 ARG A CD    1 
ATOM   5368  N NE    . ARG G 3 231 ? 9.438   -40.118  -17.865 1.00 129.09 ? 234 ARG A NE    1 
ATOM   5369  C CZ    . ARG G 3 231 ? 10.411  -40.220  -18.772 1.00 127.44 ? 234 ARG A CZ    1 
ATOM   5370  N NH1   . ARG G 3 231 ? 10.179  -39.989  -20.060 1.00 126.58 ? 234 ARG A NH1   1 
ATOM   5371  N NH2   . ARG G 3 231 ? 11.638  -40.550  -18.387 1.00 128.23 ? 234 ARG A NH2   1 
ATOM   5372  N N     . PRO G 3 232 ? 4.035   -38.648  -21.417 1.00 186.65 ? 235 PRO A N     1 
ATOM   5373  C CA    . PRO G 3 232 ? 2.642   -38.394  -21.795 1.00 184.73 ? 235 PRO A CA    1 
ATOM   5374  C C     . PRO G 3 232 ? 1.748   -38.135  -20.585 1.00 176.55 ? 235 PRO A C     1 
ATOM   5375  O O     . PRO G 3 232 ? 0.991   -37.165  -20.569 1.00 165.86 ? 235 PRO A O     1 
ATOM   5376  C CB    . PRO G 3 232 ? 2.218   -39.695  -22.493 1.00 191.68 ? 235 PRO A CB    1 
ATOM   5377  C CG    . PRO G 3 232 ? 3.479   -40.310  -22.983 1.00 193.56 ? 235 PRO A CG    1 
ATOM   5378  C CD    . PRO G 3 232 ? 4.581   -39.851  -22.081 1.00 193.18 ? 235 PRO A CD    1 
ATOM   5379  N N     . GLU G 3 233 ? 1.880   -38.993  -19.574 1.00 175.51 ? 236 GLU A N     1 
ATOM   5380  C CA    . GLU G 3 233 ? 1.004   -39.012  -18.394 1.00 173.03 ? 236 GLU A CA    1 
ATOM   5381  C C     . GLU G 3 233 ? 0.911   -37.709  -17.582 1.00 172.01 ? 236 GLU A C     1 
ATOM   5382  O O     . GLU G 3 233 ? 0.151   -37.645  -16.614 1.00 164.49 ? 236 GLU A O     1 
ATOM   5383  C CB    . GLU G 3 233 ? 1.388   -40.184  -17.464 1.00 168.05 ? 236 GLU A CB    1 
ATOM   5384  C CG    . GLU G 3 233 ? 2.782   -40.119  -16.838 1.00 167.28 ? 236 GLU A CG    1 
ATOM   5385  C CD    . GLU G 3 233 ? 3.881   -40.689  -17.725 1.00 167.39 ? 236 GLU A CD    1 
ATOM   5386  O OE1   . GLU G 3 233 ? 3.800   -40.545  -18.962 1.00 162.59 ? 236 GLU A OE1   1 
ATOM   5387  O OE2   . GLU G 3 233 ? 4.839   -41.277  -17.183 1.00 171.41 ? 236 GLU A OE2   1 
ATOM   5388  N N     . TYR G 3 234 ? 1.666   -36.680  -17.971 1.00 174.30 ? 237 TYR A N     1 
ATOM   5389  C CA    . TYR G 3 234 ? 1.616   -35.378  -17.293 1.00 178.19 ? 237 TYR A CA    1 
ATOM   5390  C C     . TYR G 3 234 ? 0.783   -34.321  -18.002 1.00 189.79 ? 237 TYR A C     1 
ATOM   5391  O O     . TYR G 3 234 ? 0.411   -33.317  -17.391 1.00 189.87 ? 237 TYR A O     1 
ATOM   5392  C CB    . TYR G 3 234 ? 3.022   -34.823  -17.089 1.00 173.72 ? 237 TYR A CB    1 
ATOM   5393  C CG    . TYR G 3 234 ? 3.746   -35.447  -15.932 1.00 165.95 ? 237 TYR A CG    1 
ATOM   5394  C CD1   . TYR G 3 234 ? 3.167   -35.506  -14.668 1.00 158.38 ? 237 TYR A CD1   1 
ATOM   5395  C CD2   . TYR G 3 234 ? 5.013   -35.974  -16.098 1.00 164.14 ? 237 TYR A CD2   1 
ATOM   5396  C CE1   . TYR G 3 234 ? 3.829   -36.082  -13.607 1.00 153.10 ? 237 TYR A CE1   1 
ATOM   5397  C CE2   . TYR G 3 234 ? 5.689   -36.545  -15.044 1.00 159.85 ? 237 TYR A CE2   1 
ATOM   5398  C CZ    . TYR G 3 234 ? 5.094   -36.599  -13.801 1.00 155.42 ? 237 TYR A CZ    1 
ATOM   5399  O OH    . TYR G 3 234 ? 5.769   -37.171  -12.754 1.00 155.09 ? 237 TYR A OH    1 
ATOM   5400  N N     . GLN G 3 235 ? 0.515   -34.519  -19.289 1.00 200.56 ? 238 GLN A N     1 
ATOM   5401  C CA    . GLN G 3 235 ? -0.406  -33.641  -19.999 1.00 201.57 ? 238 GLN A CA    1 
ATOM   5402  C C     . GLN G 3 235 ? -1.701  -33.577  -19.187 1.00 206.57 ? 238 GLN A C     1 
ATOM   5403  O O     . GLN G 3 235 ? -2.169  -32.493  -18.828 1.00 196.75 ? 238 GLN A O     1 
ATOM   5404  C CB    . GLN G 3 235 ? -0.684  -34.167  -21.411 1.00 199.99 ? 238 GLN A CB    1 
ATOM   5405  C CG    . GLN G 3 235 ? -1.039  -33.080  -22.415 1.00 196.08 ? 238 GLN A CG    1 
ATOM   5406  C CD    . GLN G 3 235 ? 0.164   -32.528  -23.157 1.00 193.86 ? 238 GLN A CD    1 
ATOM   5407  O OE1   . GLN G 3 235 ? 1.284   -33.017  -23.013 1.00 188.16 ? 238 GLN A OE1   1 
ATOM   5408  N NE2   . GLN G 3 235 ? -0.069  -31.501  -23.966 1.00 193.80 ? 238 GLN A NE2   1 
ATOM   5409  N N     . LYS G 3 236 ? -2.245  -34.759  -18.885 1.00 215.44 ? 239 LYS A N     1 
ATOM   5410  C CA    . LYS G 3 236 ? -3.414  -34.913  -18.013 1.00 219.91 ? 239 LYS A CA    1 
ATOM   5411  C C     . LYS G 3 236 ? -3.114  -34.435  -16.594 1.00 223.54 ? 239 LYS A C     1 
ATOM   5412  O O     . LYS G 3 236 ? -3.755  -33.512  -16.086 1.00 226.07 ? 239 LYS A O     1 
ATOM   5413  C CB    . LYS G 3 236 ? -3.855  -36.387  -17.958 1.00 215.49 ? 239 LYS A CB    1 
ATOM   5414  C CG    . LYS G 3 236 ? -4.740  -36.851  -19.108 1.00 209.96 ? 239 LYS A CG    1 
ATOM   5415  C CD    . LYS G 3 236 ? -6.207  -36.505  -18.878 1.00 203.78 ? 239 LYS A CD    1 
ATOM   5416  C CE    . LYS G 3 236 ? -7.144  -37.541  -19.480 1.00 198.89 ? 239 LYS A CE    1 
ATOM   5417  N NZ    . LYS G 3 236 ? -7.025  -37.666  -20.955 1.00 196.60 ? 239 LYS A NZ    1 
ATOM   5418  N N     . ARG G 3 237 ? -2.127  -35.070  -15.969 1.00 224.95 ? 240 ARG A N     1 
ATOM   5419  C CA    . ARG G 3 237 ? -1.828  -34.859  -14.553 1.00 223.20 ? 240 ARG A CA    1 
ATOM   5420  C C     . ARG G 3 237 ? -0.800  -33.741  -14.390 1.00 224.83 ? 240 ARG A C     1 
ATOM   5421  O O     . ARG G 3 237 ? 0.337   -33.970  -13.975 1.00 231.70 ? 240 ARG A O     1 
ATOM   5422  C CB    . ARG G 3 237 ? -1.344  -36.168  -13.926 1.00 217.89 ? 240 ARG A CB    1 
ATOM   5423  C CG    . ARG G 3 237 ? -2.239  -37.345  -14.278 1.00 211.72 ? 240 ARG A CG    1 
ATOM   5424  C CD    . ARG G 3 237 ? -2.691  -38.133  -13.067 1.00 208.62 ? 240 ARG A CD    1 
ATOM   5425  N NE    . ARG G 3 237 ? -4.019  -38.691  -13.298 1.00 209.84 ? 240 ARG A NE    1 
ATOM   5426  C CZ    . ARG G 3 237 ? -4.767  -39.272  -12.365 1.00 213.03 ? 240 ARG A CZ    1 
ATOM   5427  N NH1   . ARG G 3 237 ? -4.325  -39.392  -11.118 1.00 215.69 ? 240 ARG A NH1   1 
ATOM   5428  N NH2   . ARG G 3 237 ? -5.967  -39.742  -12.686 1.00 213.17 ? 240 ARG A NH2   1 
ATOM   5429  N N     . GLN G 3 238 ? -1.238  -32.523  -14.699 1.00 215.84 ? 241 GLN A N     1 
ATOM   5430  C CA    . GLN G 3 238 ? -0.345  -31.370  -14.854 1.00 202.30 ? 241 GLN A CA    1 
ATOM   5431  C C     . GLN G 3 238 ? 0.098   -30.753  -13.515 1.00 193.69 ? 241 GLN A C     1 
ATOM   5432  O O     . GLN G 3 238 ? 1.048   -29.966  -13.471 1.00 175.40 ? 241 GLN A O     1 
ATOM   5433  C CB    . GLN G 3 238 ? -1.032  -30.318  -15.741 1.00 196.95 ? 241 GLN A CB    1 
ATOM   5434  C CG    . GLN G 3 238 ? -0.115  -29.623  -16.740 1.00 191.72 ? 241 GLN A CG    1 
ATOM   5435  C CD    . GLN G 3 238 ? 0.329   -28.241  -16.297 1.00 182.67 ? 241 GLN A CD    1 
ATOM   5436  O OE1   . GLN G 3 238 ? -0.409  -27.518  -15.626 1.00 170.44 ? 241 GLN A OE1   1 
ATOM   5437  N NE2   . GLN G 3 238 ? 1.538   -27.858  -16.693 1.00 177.25 ? 241 GLN A NE2   1 
ATOM   5438  N N     . HIS G 3 239 ? -0.590  -31.118  -12.434 1.00 191.82 ? 242 HIS A N     1 
ATOM   5439  C CA    . HIS G 3 239 ? -0.236  -30.670  -11.083 1.00 182.02 ? 242 HIS A CA    1 
ATOM   5440  C C     . HIS G 3 239 ? 0.372   -31.793  -10.216 1.00 172.67 ? 242 HIS A C     1 
ATOM   5441  O O     . HIS G 3 239 ? 0.865   -31.528  -9.116  1.00 163.08 ? 242 HIS A O     1 
ATOM   5442  C CB    . HIS G 3 239 ? -1.469  -30.059  -10.394 1.00 182.25 ? 242 HIS A CB    1 
ATOM   5443  C CG    . HIS G 3 239 ? -2.530  -31.057  -10.038 1.00 187.34 ? 242 HIS A CG    1 
ATOM   5444  N ND1   . HIS G 3 239 ? -2.617  -31.634  -8.789  1.00 187.92 ? 242 HIS A ND1   1 
ATOM   5445  C CD2   . HIS G 3 239 ? -3.547  -31.579  -10.764 1.00 185.41 ? 242 HIS A CD2   1 
ATOM   5446  C CE1   . HIS G 3 239 ? -3.640  -32.469  -8.761  1.00 186.59 ? 242 HIS A CE1   1 
ATOM   5447  N NE2   . HIS G 3 239 ? -4.221  -32.455  -9.948  1.00 185.38 ? 242 HIS A NE2   1 
ATOM   5448  N N     . ARG G 3 240 ? 0.352   -33.031  -10.719 1.00 161.65 ? 243 ARG A N     1 
ATOM   5449  C CA    . ARG G 3 240 ? 0.821   -34.201  -9.959  1.00 147.33 ? 243 ARG A CA    1 
ATOM   5450  C C     . ARG G 3 240 ? 2.341   -34.265  -9.793  1.00 129.25 ? 243 ARG A C     1 
ATOM   5451  O O     . ARG G 3 240 ? 2.835   -35.029  -8.965  1.00 126.91 ? 243 ARG A O     1 
ATOM   5452  C CB    . ARG G 3 240 ? 0.330   -35.508  -10.606 1.00 151.73 ? 243 ARG A CB    1 
ATOM   5453  C CG    . ARG G 3 240 ? -1.117  -35.875  -10.301 1.00 158.24 ? 243 ARG A CG    1 
ATOM   5454  C CD    . ARG G 3 240 ? -1.331  -36.175  -8.826  1.00 163.05 ? 243 ARG A CD    1 
ATOM   5455  N NE    . ARG G 3 240 ? -2.508  -37.011  -8.581  1.00 167.49 ? 243 ARG A NE    1 
ATOM   5456  C CZ    . ARG G 3 240 ? -2.497  -38.335  -8.402  1.00 170.86 ? 243 ARG A CZ    1 
ATOM   5457  N NH1   . ARG G 3 240 ? -3.637  -38.978  -8.187  1.00 176.09 ? 243 ARG A NH1   1 
ATOM   5458  N NH2   . ARG G 3 240 ? -1.370  -39.034  -8.430  1.00 171.43 ? 243 ARG A NH2   1 
ATOM   5459  N N     . VAL G 3 241 ? 3.074   -33.473  -10.572 1.00 112.73 ? 244 VAL A N     1 
ATOM   5460  C CA    . VAL G 3 241 ? 4.538   -33.467  -10.526 1.00 107.45 ? 244 VAL A CA    1 
ATOM   5461  C C     . VAL G 3 241 ? 5.117   -33.115  -9.153  1.00 107.92 ? 244 VAL A C     1 
ATOM   5462  O O     . VAL G 3 241 ? 4.805   -32.072  -8.580  1.00 116.16 ? 244 VAL A O     1 
ATOM   5463  C CB    . VAL G 3 241 ? 5.119   -32.484  -11.556 1.00 104.68 ? 244 VAL A CB    1 
ATOM   5464  C CG1   . VAL G 3 241 ? 6.583   -32.193  -11.269 1.00 101.34 ? 244 VAL A CG1   1 
ATOM   5465  C CG2   . VAL G 3 241 ? 4.956   -33.039  -12.959 1.00 110.46 ? 244 VAL A CG2   1 
ATOM   5466  N N     . ILE G 3 242 ? 5.978   -33.997  -8.656  1.00 103.33 ? 245 ILE A N     1 
ATOM   5467  C CA    . ILE G 3 242 ? 6.730   -33.787  -7.425  1.00 98.62  ? 245 ILE A CA    1 
ATOM   5468  C C     . ILE G 3 242 ? 8.150   -33.386  -7.830  1.00 95.16  ? 245 ILE A C     1 
ATOM   5469  O O     . ILE G 3 242 ? 8.728   -33.994  -8.717  1.00 100.26 ? 245 ILE A O     1 
ATOM   5470  C CB    . ILE G 3 242 ? 6.781   -35.085  -6.590  1.00 98.97  ? 245 ILE A CB    1 
ATOM   5471  C CG1   . ILE G 3 242 ? 5.362   -35.617  -6.300  1.00 102.64 ? 245 ILE A CG1   1 
ATOM   5472  C CG2   . ILE G 3 242 ? 7.590   -34.872  -5.318  1.00 98.61  ? 245 ILE A CG2   1 
ATOM   5473  C CD1   . ILE G 3 242 ? 4.815   -35.335  -4.913  1.00 105.76 ? 245 ILE A CD1   1 
ATOM   5474  N N     . PHE G 3 243 ? 8.728   -32.382  -7.185  1.00 96.00  ? 246 PHE A N     1 
ATOM   5475  C CA    . PHE G 3 243 ? 10.036  -31.878  -7.602  1.00 96.64  ? 246 PHE A CA    1 
ATOM   5476  C C     . PHE G 3 243 ? 11.048  -31.862  -6.459  1.00 100.71 ? 246 PHE A C     1 
ATOM   5477  O O     . PHE G 3 243 ? 10.907  -31.107  -5.492  1.00 104.77 ? 246 PHE A O     1 
ATOM   5478  C CB    . PHE G 3 243 ? 9.881   -30.483  -8.192  1.00 95.60  ? 246 PHE A CB    1 
ATOM   5479  C CG    . PHE G 3 243 ? 11.071  -30.019  -8.975  1.00 97.04  ? 246 PHE A CG    1 
ATOM   5480  C CD1   . PHE G 3 243 ? 11.494  -30.718  -10.089 1.00 101.10 ? 246 PHE A CD1   1 
ATOM   5481  C CD2   . PHE G 3 243 ? 11.748  -28.865  -8.617  1.00 99.71  ? 246 PHE A CD2   1 
ATOM   5482  C CE1   . PHE G 3 243 ? 12.583  -30.285  -10.824 1.00 103.58 ? 246 PHE A CE1   1 
ATOM   5483  C CE2   . PHE G 3 243 ? 12.834  -28.423  -9.348  1.00 100.03 ? 246 PHE A CE2   1 
ATOM   5484  C CZ    . PHE G 3 243 ? 13.254  -29.134  -10.454 1.00 102.09 ? 246 PHE A CZ    1 
ATOM   5485  N N     . LEU G 3 244 ? 12.069  -32.704  -6.588  1.00 100.21 ? 247 LEU A N     1 
ATOM   5486  C CA    . LEU G 3 244 ? 13.108  -32.847  -5.576  1.00 96.87  ? 247 LEU A CA    1 
ATOM   5487  C C     . LEU G 3 244 ? 14.366  -32.168  -6.086  1.00 97.35  ? 247 LEU A C     1 
ATOM   5488  O O     . LEU G 3 244 ? 14.989  -32.667  -7.016  1.00 100.22 ? 247 LEU A O     1 
ATOM   5489  C CB    . LEU G 3 244 ? 13.369  -34.335  -5.312  1.00 92.95  ? 247 LEU A CB    1 
ATOM   5490  C CG    . LEU G 3 244 ? 14.486  -34.755  -4.352  1.00 94.93  ? 247 LEU A CG    1 
ATOM   5491  C CD1   . LEU G 3 244 ? 14.598  -33.842  -3.141  1.00 102.29 ? 247 LEU A CD1   1 
ATOM   5492  C CD2   . LEU G 3 244 ? 14.260  -36.182  -3.888  1.00 93.96  ? 247 LEU A CD2   1 
ATOM   5493  N N     . HIS G 3 245 ? 14.737  -31.034  -5.490  1.00 98.74  ? 248 HIS A N     1 
ATOM   5494  C CA    . HIS G 3 245 ? 15.945  -30.305  -5.915  1.00 101.95 ? 248 HIS A CA    1 
ATOM   5495  C C     . HIS G 3 245 ? 16.691  -29.671  -4.745  1.00 102.09 ? 248 HIS A C     1 
ATOM   5496  O O     . HIS G 3 245 ? 16.124  -29.477  -3.669  1.00 97.94  ? 248 HIS A O     1 
ATOM   5497  C CB    . HIS G 3 245 ? 15.614  -29.264  -6.992  1.00 104.36 ? 248 HIS A CB    1 
ATOM   5498  C CG    . HIS G 3 245 ? 14.833  -28.086  -6.494  1.00 108.07 ? 248 HIS A CG    1 
ATOM   5499  N ND1   . HIS G 3 245 ? 14.950  -26.831  -7.054  1.00 110.36 ? 248 HIS A ND1   1 
ATOM   5500  C CD2   . HIS G 3 245 ? 13.930  -27.965  -5.491  1.00 108.35 ? 248 HIS A CD2   1 
ATOM   5501  C CE1   . HIS G 3 245 ? 14.150  -25.991  -6.422  1.00 108.22 ? 248 HIS A CE1   1 
ATOM   5502  N NE2   . HIS G 3 245 ? 13.522  -26.653  -5.468  1.00 108.57 ? 248 HIS A NE2   1 
ATOM   5503  N N     . ALA G 3 246 ? 17.966  -29.356  -4.975  1.00 105.43 ? 249 ALA A N     1 
ATOM   5504  C CA    . ALA G 3 246 ? 18.870  -28.913  -3.909  1.00 111.61 ? 249 ALA A CA    1 
ATOM   5505  C C     . ALA G 3 246 ? 18.487  -27.541  -3.349  1.00 122.56 ? 249 ALA A C     1 
ATOM   5506  O O     . ALA G 3 246 ? 17.963  -26.691  -4.075  1.00 129.72 ? 249 ALA A O     1 
ATOM   5507  C CB    . ALA G 3 246 ? 20.308  -28.892  -4.415  1.00 106.40 ? 249 ALA A CB    1 
ATOM   5508  N N     . ASN G 3 247 ? 18.763  -27.328  -2.061  1.00 127.38 ? 250 ASN A N     1 
ATOM   5509  C CA    . ASN G 3 247 ? 18.524  -26.034  -1.405  1.00 127.35 ? 250 ASN A CA    1 
ATOM   5510  C C     . ASN G 3 247 ? 19.623  -25.009  -1.725  1.00 125.59 ? 250 ASN A C     1 
ATOM   5511  O O     . ASN G 3 247 ? 20.277  -24.485  -0.823  1.00 129.97 ? 250 ASN A O     1 
ATOM   5512  C CB    . ASN G 3 247 ? 18.408  -26.210  0.120   1.00 124.24 ? 250 ASN A CB    1 
ATOM   5513  C CG    . ASN G 3 247 ? 17.224  -27.067  0.527   1.00 123.39 ? 250 ASN A CG    1 
ATOM   5514  O OD1   . ASN G 3 247 ? 16.616  -27.747  -0.300  1.00 121.74 ? 250 ASN A OD1   1 
ATOM   5515  N ND2   . ASN G 3 247 ? 16.890  -27.037  1.813   1.00 123.10 ? 250 ASN A ND2   1 
ATOM   5516  N N     . ALA G 3 248 ? 19.817  -24.720  -3.008  1.00 120.80 ? 251 ALA A N     1 
ATOM   5517  C CA    . ALA G 3 248 ? 20.852  -23.782  -3.441  1.00 126.62 ? 251 ALA A CA    1 
ATOM   5518  C C     . ALA G 3 248 ? 20.298  -22.356  -3.355  1.00 131.64 ? 251 ALA A C     1 
ATOM   5519  O O     . ALA G 3 248 ? 19.147  -22.167  -2.962  1.00 136.17 ? 251 ALA A O     1 
ATOM   5520  C CB    . ALA G 3 248 ? 21.308  -24.121  -4.857  1.00 127.66 ? 251 ALA A CB    1 
ATOM   5521  N N     . PRO G 3 249 ? 21.113  -21.343  -3.702  1.00 139.93 ? 252 PRO A N     1 
ATOM   5522  C CA    . PRO G 3 249 ? 20.591  -19.976  -3.693  1.00 144.99 ? 252 PRO A CA    1 
ATOM   5523  C C     . PRO G 3 249 ? 19.773  -19.652  -4.946  1.00 143.01 ? 252 PRO A C     1 
ATOM   5524  O O     . PRO G 3 249 ? 18.789  -18.908  -4.865  1.00 143.41 ? 252 PRO A O     1 
ATOM   5525  C CB    . PRO G 3 249 ? 21.856  -19.120  -3.634  1.00 148.79 ? 252 PRO A CB    1 
ATOM   5526  C CG    . PRO G 3 249 ? 22.894  -19.940  -4.314  1.00 150.72 ? 252 PRO A CG    1 
ATOM   5527  C CD    . PRO G 3 249 ? 22.538  -21.385  -4.079  1.00 148.37 ? 252 PRO A CD    1 
ATOM   5528  N N     . SER G 3 250 ? 20.182  -20.202  -6.089  1.00 130.29 ? 253 SER A N     1 
ATOM   5529  C CA    . SER G 3 250 ? 19.436  -20.044  -7.331  1.00 123.14 ? 253 SER A CA    1 
ATOM   5530  C C     . SER G 3 250 ? 18.084  -20.732  -7.203  1.00 126.43 ? 253 SER A C     1 
ATOM   5531  O O     . SER G 3 250 ? 17.097  -20.280  -7.775  1.00 122.32 ? 253 SER A O     1 
ATOM   5532  C CB    . SER G 3 250 ? 20.209  -20.650  -8.500  1.00 121.64 ? 253 SER A CB    1 
ATOM   5533  O OG    . SER G 3 250 ? 21.528  -20.982  -8.112  1.00 126.05 ? 253 SER A OG    1 
ATOM   5534  N N     . HIS G 3 251 ? 18.048  -21.817  -6.429  1.00 137.22 ? 254 HIS A N     1 
ATOM   5535  C CA    . HIS G 3 251 ? 16.830  -22.609  -6.239  1.00 143.93 ? 254 HIS A CA    1 
ATOM   5536  C C     . HIS G 3 251 ? 15.853  -21.993  -5.220  1.00 146.06 ? 254 HIS A C     1 
ATOM   5537  O O     . HIS G 3 251 ? 14.869  -22.635  -4.854  1.00 148.80 ? 254 HIS A O     1 
ATOM   5538  C CB    . HIS G 3 251 ? 17.175  -24.053  -5.812  1.00 144.59 ? 254 HIS A CB    1 
ATOM   5539  C CG    . HIS G 3 251 ? 18.058  -24.792  -6.777  1.00 143.70 ? 254 HIS A CG    1 
ATOM   5540  N ND1   . HIS G 3 251 ? 18.809  -25.887  -6.406  1.00 143.90 ? 254 HIS A ND1   1 
ATOM   5541  C CD2   . HIS G 3 251 ? 18.323  -24.587  -8.090  1.00 140.18 ? 254 HIS A CD2   1 
ATOM   5542  C CE1   . HIS G 3 251 ? 19.488  -26.332  -7.447  1.00 141.94 ? 254 HIS A CE1   1 
ATOM   5543  N NE2   . HIS G 3 251 ? 19.212  -25.560  -8.482  1.00 141.09 ? 254 HIS A NE2   1 
ATOM   5544  N N     . THR G 3 252 ? 16.117  -20.769  -4.757  1.00 151.84 ? 255 THR A N     1 
ATOM   5545  C CA    . THR G 3 252 ? 15.192  -20.077  -3.845  1.00 158.36 ? 255 THR A CA    1 
ATOM   5546  C C     . THR G 3 252 ? 14.838  -18.626  -4.230  1.00 158.22 ? 255 THR A C     1 
ATOM   5547  O O     . THR G 3 252 ? 13.871  -18.075  -3.696  1.00 155.23 ? 255 THR A O     1 
ATOM   5548  C CB    . THR G 3 252 ? 15.711  -20.114  -2.389  1.00 162.69 ? 255 THR A CB    1 
ATOM   5549  O OG1   . THR G 3 252 ? 14.763  -19.477  -1.523  1.00 170.07 ? 255 THR A OG1   1 
ATOM   5550  C CG2   . THR G 3 252 ? 17.067  -19.427  -2.261  1.00 162.08 ? 255 THR A CG2   1 
ATOM   5551  N N     . ALA G 3 253 ? 15.600  -18.015  -5.141  1.00 161.97 ? 256 ALA A N     1 
ATOM   5552  C CA    . ALA G 3 253 ? 15.311  -16.654  -5.615  1.00 167.58 ? 256 ALA A CA    1 
ATOM   5553  C C     . ALA G 3 253 ? 13.880  -16.562  -6.138  1.00 173.35 ? 256 ALA A C     1 
ATOM   5554  O O     . ALA G 3 253 ? 13.415  -17.460  -6.841  1.00 183.56 ? 256 ALA A O     1 
ATOM   5555  C CB    . ALA G 3 253 ? 16.293  -16.244  -6.702  1.00 164.35 ? 256 ALA A CB    1 
ATOM   5556  N N     . ARG G 3 254 ? 13.192  -15.474  -5.800  1.00 172.07 ? 257 ARG A N     1 
ATOM   5557  C CA    . ARG G 3 254 ? 11.750  -15.366  -6.041  1.00 173.76 ? 257 ARG A CA    1 
ATOM   5558  C C     . ARG G 3 254 ? 11.355  -15.602  -7.500  1.00 169.49 ? 257 ARG A C     1 
ATOM   5559  O O     . ARG G 3 254 ? 10.327  -16.226  -7.770  1.00 166.07 ? 257 ARG A O     1 
ATOM   5560  C CB    . ARG G 3 254 ? 11.224  -14.005  -5.581  1.00 177.45 ? 257 ARG A CB    1 
ATOM   5561  C CG    . ARG G 3 254 ? 9.717   -13.978  -5.363  1.00 180.72 ? 257 ARG A CG    1 
ATOM   5562  C CD    . ARG G 3 254 ? 9.229   -12.603  -4.937  1.00 182.42 ? 257 ARG A CD    1 
ATOM   5563  N NE    . ARG G 3 254 ? 9.894   -12.133  -3.722  1.00 184.03 ? 257 ARG A NE    1 
ATOM   5564  C CZ    . ARG G 3 254 ? 9.635   -10.976  -3.118  1.00 179.24 ? 257 ARG A CZ    1 
ATOM   5565  N NH1   . ARG G 3 254 ? 8.710   -10.152  -3.595  1.00 177.49 ? 257 ARG A NH1   1 
ATOM   5566  N NH2   . ARG G 3 254 ? 10.305  -10.645  -2.020  1.00 175.90 ? 257 ARG A NH2   1 
ATOM   5567  N N     . ALA G 3 255 ? 12.171  -15.104  -8.429  1.00 166.33 ? 258 ALA A N     1 
ATOM   5568  C CA    . ALA G 3 255 ? 11.909  -15.270  -9.865  1.00 163.64 ? 258 ALA A CA    1 
ATOM   5569  C C     . ALA G 3 255 ? 11.632  -16.734  -10.214 1.00 164.49 ? 258 ALA A C     1 
ATOM   5570  O O     . ALA G 3 255 ? 10.733  -17.035  -11.002 1.00 165.12 ? 258 ALA A O     1 
ATOM   5571  C CB    . ALA G 3 255 ? 13.074  -14.732  -10.687 1.00 157.46 ? 258 ALA A CB    1 
ATOM   5572  N N     . VAL G 3 256 ? 12.399  -17.634  -9.602  1.00 163.79 ? 259 VAL A N     1 
ATOM   5573  C CA    . VAL G 3 256 ? 12.203  -19.074  -9.758  1.00 159.11 ? 259 VAL A CA    1 
ATOM   5574  C C     . VAL G 3 256 ? 10.982  -19.536  -8.971  1.00 157.93 ? 259 VAL A C     1 
ATOM   5575  O O     . VAL G 3 256 ? 10.094  -20.194  -9.513  1.00 160.78 ? 259 VAL A O     1 
ATOM   5576  C CB    . VAL G 3 256 ? 13.435  -19.859  -9.260  1.00 154.22 ? 259 VAL A CB    1 
ATOM   5577  C CG1   . VAL G 3 256 ? 13.179  -21.362  -9.309  1.00 153.59 ? 259 VAL A CG1   1 
ATOM   5578  C CG2   . VAL G 3 256 ? 14.663  -19.487  -10.080 1.00 154.65 ? 259 VAL A CG2   1 
ATOM   5579  N N     . ARG G 3 257 ? 10.957  -19.176  -7.690  1.00 157.73 ? 260 ARG A N     1 
ATOM   5580  C CA    . ARG G 3 257 ? 9.906   -19.586  -6.754  1.00 163.50 ? 260 ARG A CA    1 
ATOM   5581  C C     . ARG G 3 257 ? 8.487   -19.351  -7.289  1.00 164.17 ? 260 ARG A C     1 
ATOM   5582  O O     . ARG G 3 257 ? 7.572   -20.125  -6.998  1.00 161.82 ? 260 ARG A O     1 
ATOM   5583  C CB    . ARG G 3 257 ? 10.100  -18.845  -5.429  1.00 168.53 ? 260 ARG A CB    1 
ATOM   5584  C CG    . ARG G 3 257 ? 9.292   -19.384  -4.265  1.00 173.69 ? 260 ARG A CG    1 
ATOM   5585  C CD    . ARG G 3 257 ? 9.700   -18.690  -2.976  1.00 176.66 ? 260 ARG A CD    1 
ATOM   5586  N NE    . ARG G 3 257 ? 9.061   -17.377  -2.838  1.00 179.03 ? 260 ARG A NE    1 
ATOM   5587  C CZ    . ARG G 3 257 ? 8.186   -17.036  -1.887  1.00 175.40 ? 260 ARG A CZ    1 
ATOM   5588  N NH1   . ARG G 3 257 ? 7.822   -17.897  -0.937  1.00 170.61 ? 260 ARG A NH1   1 
ATOM   5589  N NH2   . ARG G 3 257 ? 7.674   -15.808  -1.876  1.00 171.68 ? 260 ARG A NH2   1 
ATOM   5590  N N     . ASP G 3 258 ? 8.314   -18.281  -8.064  1.00 160.38 ? 261 ASP A N     1 
ATOM   5591  C CA    . ASP G 3 258 ? 7.056   -18.024  -8.766  1.00 154.92 ? 261 ASP A CA    1 
ATOM   5592  C C     . ASP G 3 258 ? 6.845   -19.052  -9.865  1.00 143.08 ? 261 ASP A C     1 
ATOM   5593  O O     . ASP G 3 258 ? 5.817   -19.736  -9.901  1.00 136.33 ? 261 ASP A O     1 
ATOM   5594  C CB    . ASP G 3 258 ? 7.060   -16.623  -9.382  1.00 159.62 ? 261 ASP A CB    1 
ATOM   5595  C CG    . ASP G 3 258 ? 6.932   -15.526  -8.341  1.00 163.44 ? 261 ASP A CG    1 
ATOM   5596  O OD1   . ASP G 3 258 ? 5.950   -15.544  -7.567  1.00 161.63 ? 261 ASP A OD1   1 
ATOM   5597  O OD2   . ASP G 3 258 ? 7.808   -14.638  -8.301  1.00 163.68 ? 261 ASP A OD2   1 
ATOM   5598  N N     . THR G 3 259 ? 7.839   -19.157  -10.745 1.00 129.71 ? 262 THR A N     1 
ATOM   5599  C CA    . THR G 3 259 ? 7.804   -20.072  -11.884 1.00 122.70 ? 262 THR A CA    1 
ATOM   5600  C C     . THR G 3 259 ? 7.347   -21.483  -11.516 1.00 122.56 ? 262 THR A C     1 
ATOM   5601  O O     . THR G 3 259 ? 6.651   -22.132  -12.297 1.00 124.20 ? 262 THR A O     1 
ATOM   5602  C CB    . THR G 3 259 ? 9.186   -20.168  -12.549 1.00 115.64 ? 262 THR A CB    1 
ATOM   5603  O OG1   . THR G 3 259 ? 9.775   -18.866  -12.595 1.00 112.56 ? 262 THR A OG1   1 
ATOM   5604  C CG2   . THR G 3 259 ? 9.071   -20.730  -13.962 1.00 114.56 ? 262 THR A CG2   1 
ATOM   5605  N N     . LEU G 3 260 ? 7.745   -21.955  -10.338 1.00 119.50 ? 263 LEU A N     1 
ATOM   5606  C CA    . LEU G 3 260 ? 7.325   -23.269  -9.859  1.00 125.11 ? 263 LEU A CA    1 
ATOM   5607  C C     . LEU G 3 260 ? 5.859   -23.266  -9.434  1.00 132.24 ? 263 LEU A C     1 
ATOM   5608  O O     . LEU G 3 260 ? 5.169   -24.282  -9.562  1.00 125.87 ? 263 LEU A O     1 
ATOM   5609  C CB    . LEU G 3 260 ? 8.201   -23.731  -8.690  1.00 127.99 ? 263 LEU A CB    1 
ATOM   5610  C CG    . LEU G 3 260 ? 9.714   -23.813  -8.921  1.00 125.67 ? 263 LEU A CG    1 
ATOM   5611  C CD1   . LEU G 3 260 ? 10.387  -24.420  -7.702  1.00 125.95 ? 263 LEU A CD1   1 
ATOM   5612  C CD2   . LEU G 3 260 ? 10.047  -24.626  -10.160 1.00 128.36 ? 263 LEU A CD2   1 
ATOM   5613  N N     . GLU G 3 261 ? 5.386   -22.130  -8.922  1.00 141.92 ? 264 GLU A N     1 
ATOM   5614  C CA    . GLU G 3 261 ? 3.979   -22.001  -8.550  1.00 149.50 ? 264 GLU A CA    1 
ATOM   5615  C C     . GLU G 3 261 ? 3.091   -21.898  -9.786  1.00 142.61 ? 264 GLU A C     1 
ATOM   5616  O O     . GLU G 3 261 ? 1.997   -22.466  -9.802  1.00 146.79 ? 264 GLU A O     1 
ATOM   5617  C CB    . GLU G 3 261 ? 3.746   -20.804  -7.622  1.00 153.13 ? 264 GLU A CB    1 
ATOM   5618  C CG    . GLU G 3 261 ? 2.394   -20.850  -6.916  1.00 154.59 ? 264 GLU A CG    1 
ATOM   5619  C CD    . GLU G 3 261 ? 2.373   -20.071  -5.613  1.00 152.74 ? 264 GLU A CD    1 
ATOM   5620  O OE1   . GLU G 3 261 ? 2.675   -18.859  -5.635  1.00 139.60 ? 264 GLU A OE1   1 
ATOM   5621  O OE2   . GLU G 3 261 ? 2.044   -20.674  -4.567  1.00 154.40 ? 264 GLU A OE2   1 
ATOM   5622  N N     . THR G 3 262 ? 3.567   -21.198  -10.817 1.00 133.11 ? 265 THR A N     1 
ATOM   5623  C CA    . THR G 3 262 ? 2.831   -21.093  -12.084 1.00 134.29 ? 265 THR A CA    1 
ATOM   5624  C C     . THR G 3 262 ? 2.726   -22.449  -12.801 1.00 132.93 ? 265 THR A C     1 
ATOM   5625  O O     . THR G 3 262 ? 1.685   -22.769  -13.379 1.00 128.01 ? 265 THR A O     1 
ATOM   5626  C CB    . THR G 3 262 ? 3.451   -20.044  -13.036 1.00 133.13 ? 265 THR A CB    1 
ATOM   5627  O OG1   . THR G 3 262 ? 4.830   -20.348  -13.270 1.00 130.23 ? 265 THR A OG1   1 
ATOM   5628  C CG2   . THR G 3 262 ? 3.331   -18.646  -12.446 1.00 131.63 ? 265 THR A CG2   1 
ATOM   5629  N N     . LEU G 3 263 ? 3.799   -23.238  -12.752 1.00 130.55 ? 266 LEU A N     1 
ATOM   5630  C CA    . LEU G 3 263 ? 3.767   -24.619  -13.238 1.00 124.72 ? 266 LEU A CA    1 
ATOM   5631  C C     . LEU G 3 263 ? 2.971   -25.510  -12.284 1.00 124.39 ? 266 LEU A C     1 
ATOM   5632  O O     . LEU G 3 263 ? 2.474   -26.563  -12.684 1.00 132.53 ? 266 LEU A O     1 
ATOM   5633  C CB    . LEU G 3 263 ? 5.188   -25.172  -13.394 1.00 122.51 ? 266 LEU A CB    1 
ATOM   5634  C CG    . LEU G 3 263 ? 6.084   -24.496  -14.437 1.00 121.80 ? 266 LEU A CG    1 
ATOM   5635  C CD1   . LEU G 3 263 ? 7.491   -25.063  -14.371 1.00 122.58 ? 266 LEU A CD1   1 
ATOM   5636  C CD2   . LEU G 3 263 ? 5.513   -24.656  -15.838 1.00 123.60 ? 266 LEU A CD2   1 
ATOM   5637  N N     . ASN G 3 264 ? 2.863   -25.080  -11.026 1.00 120.08 ? 267 ASN A N     1 
ATOM   5638  C CA    . ASN G 3 264 ? 2.143   -25.809  -9.985  1.00 120.76 ? 267 ASN A CA    1 
ATOM   5639  C C     . ASN G 3 264 ? 2.707   -27.215  -9.808  1.00 120.68 ? 267 ASN A C     1 
ATOM   5640  O O     . ASN G 3 264 ? 2.042   -28.215  -10.098 1.00 121.77 ? 267 ASN A O     1 
ATOM   5641  C CB    . ASN G 3 264 ? 0.634   -25.846  -10.263 1.00 123.83 ? 267 ASN A CB    1 
ATOM   5642  C CG    . ASN G 3 264 ? -0.179  -26.258  -9.041  1.00 125.91 ? 267 ASN A CG    1 
ATOM   5643  O OD1   . ASN G 3 264 ? 0.373   -26.572  -7.990  1.00 123.56 ? 267 ASN A OD1   1 
ATOM   5644  N ND2   . ASN G 3 264 ? -1.496  -26.257  -9.179  1.00 124.87 ? 267 ASN A ND2   1 
ATOM   5645  N N     . TRP G 3 265 ? 3.960   -27.261  -9.359  1.00 120.62 ? 268 TRP A N     1 
ATOM   5646  C CA    . TRP G 3 265 ? 4.640   -28.501  -8.998  1.00 116.03 ? 268 TRP A CA    1 
ATOM   5647  C C     . TRP G 3 265 ? 4.730   -28.584  -7.482  1.00 110.10 ? 268 TRP A C     1 
ATOM   5648  O O     . TRP G 3 265 ? 5.043   -27.596  -6.825  1.00 116.27 ? 268 TRP A O     1 
ATOM   5649  C CB    . TRP G 3 265 ? 6.061   -28.532  -9.573  1.00 115.25 ? 268 TRP A CB    1 
ATOM   5650  C CG    . TRP G 3 265 ? 6.162   -28.711  -11.063 1.00 116.04 ? 268 TRP A CG    1 
ATOM   5651  C CD1   . TRP G 3 265 ? 5.168   -29.078  -11.919 1.00 120.94 ? 268 TRP A CD1   1 
ATOM   5652  C CD2   . TRP G 3 265 ? 7.347   -28.580  -11.860 1.00 113.27 ? 268 TRP A CD2   1 
ATOM   5653  N NE1   . TRP G 3 265 ? 5.654   -29.161  -13.201 1.00 120.89 ? 268 TRP A NE1   1 
ATOM   5654  C CE2   . TRP G 3 265 ? 6.989   -28.862  -13.191 1.00 114.15 ? 268 TRP A CE2   1 
ATOM   5655  C CE3   . TRP G 3 265 ? 8.673   -28.243  -11.577 1.00 110.96 ? 268 TRP A CE3   1 
ATOM   5656  C CZ2   . TRP G 3 265 ? 7.907   -28.817  -14.237 1.00 113.50 ? 268 TRP A CZ2   1 
ATOM   5657  C CZ3   . TRP G 3 265 ? 9.583   -28.199  -12.616 1.00 110.27 ? 268 TRP A CZ3   1 
ATOM   5658  C CH2   . TRP G 3 265 ? 9.195   -28.484  -13.931 1.00 111.42 ? 268 TRP A CH2   1 
ATOM   5659  N N     . GLU G 3 266 ? 4.464   -29.756  -6.921  1.00 105.30 ? 269 GLU A N     1 
ATOM   5660  C CA    . GLU G 3 266 ? 4.686   -29.958  -5.505  1.00 108.69 ? 269 GLU A CA    1 
ATOM   5661  C C     . GLU G 3 266 ? 6.191   -30.043  -5.319  1.00 109.49 ? 269 GLU A C     1 
ATOM   5662  O O     . GLU G 3 266 ? 6.806   -30.968  -5.835  1.00 121.22 ? 269 GLU A O     1 
ATOM   5663  C CB    . GLU G 3 266 ? 4.002   -31.243  -5.023  1.00 114.56 ? 269 GLU A CB    1 
ATOM   5664  C CG    . GLU G 3 266 ? 4.212   -31.542  -3.541  1.00 120.90 ? 269 GLU A CG    1 
ATOM   5665  C CD    . GLU G 3 266 ? 3.258   -32.590  -2.984  1.00 124.42 ? 269 GLU A CD    1 
ATOM   5666  O OE1   . GLU G 3 266 ? 2.596   -33.302  -3.777  1.00 120.11 ? 269 GLU A OE1   1 
ATOM   5667  O OE2   . GLU G 3 266 ? 3.179   -32.699  -1.738  1.00 122.04 ? 269 GLU A OE2   1 
ATOM   5668  N N     . VAL G 3 267 ? 6.792   -29.071  -4.630  1.00 106.92 ? 270 VAL A N     1 
ATOM   5669  C CA    . VAL G 3 267 ? 8.220   -29.169  -4.275  1.00 106.84 ? 270 VAL A CA    1 
ATOM   5670  C C     . VAL G 3 267 ? 8.399   -30.034  -3.021  1.00 106.28 ? 270 VAL A C     1 
ATOM   5671  O O     . VAL G 3 267 ? 7.739   -29.812  -1.998  1.00 105.02 ? 270 VAL A O     1 
ATOM   5672  C CB    . VAL G 3 267 ? 8.895   -27.794  -4.071  1.00 105.73 ? 270 VAL A CB    1 
ATOM   5673  C CG1   . VAL G 3 267 ? 8.725   -26.936  -5.313  1.00 104.44 ? 270 VAL A CG1   1 
ATOM   5674  C CG2   . VAL G 3 267 ? 8.360   -27.082  -2.833  1.00 109.44 ? 270 VAL A CG2   1 
ATOM   5675  N N     . LEU G 3 268 ? 9.286   -31.025  -3.110  1.00 99.40  ? 271 LEU A N     1 
ATOM   5676  C CA    . LEU G 3 268 ? 9.468   -31.984  -2.029  1.00 93.98  ? 271 LEU A CA    1 
ATOM   5677  C C     . LEU G 3 268 ? 10.373  -31.349  -0.979  1.00 92.08  ? 271 LEU A C     1 
ATOM   5678  O O     . LEU G 3 268 ? 11.387  -30.736  -1.330  1.00 95.27  ? 271 LEU A O     1 
ATOM   5679  C CB    . LEU G 3 268 ? 10.106  -33.285  -2.545  1.00 97.00  ? 271 LEU A CB    1 
ATOM   5680  C CG    . LEU G 3 268 ? 9.455   -34.664  -2.297  1.00 98.28  ? 271 LEU A CG    1 
ATOM   5681  C CD1   . LEU G 3 268 ? 10.506  -35.694  -1.896  1.00 97.83  ? 271 LEU A CD1   1 
ATOM   5682  C CD2   . LEU G 3 268 ? 8.336   -34.663  -1.266  1.00 98.73  ? 271 LEU A CD2   1 
ATOM   5683  N N     . PRO G 3 269 ? 10.001  -31.469  0.308   1.00 87.50  ? 272 PRO A N     1 
ATOM   5684  C CA    . PRO G 3 269 ? 10.878  -31.090  1.404   1.00 91.01  ? 272 PRO A CA    1 
ATOM   5685  C C     . PRO G 3 269 ? 12.243  -31.745  1.316   1.00 95.58  ? 272 PRO A C     1 
ATOM   5686  O O     . PRO G 3 269 ? 12.321  -32.962  1.167   1.00 102.15 ? 272 PRO A O     1 
ATOM   5687  C CB    . PRO G 3 269 ? 10.134  -31.617  2.629   1.00 90.48  ? 272 PRO A CB    1 
ATOM   5688  C CG    . PRO G 3 269 ? 8.702   -31.474  2.269   1.00 89.15  ? 272 PRO A CG    1 
ATOM   5689  C CD    . PRO G 3 269 ? 8.621   -31.687  0.781   1.00 90.40  ? 272 PRO A CD    1 
ATOM   5690  N N     . HIS G 3 270 ? 13.304  -30.944  1.403   1.00 100.76 ? 273 HIS A N     1 
ATOM   5691  C CA    . HIS G 3 270 ? 14.664  -31.475  1.383   1.00 106.34 ? 273 HIS A CA    1 
ATOM   5692  C C     . HIS G 3 270 ? 15.533  -30.797  2.432   1.00 104.19 ? 273 HIS A C     1 
ATOM   5693  O O     . HIS G 3 270 ? 15.722  -29.580  2.404   1.00 106.18 ? 273 HIS A O     1 
ATOM   5694  C CB    . HIS G 3 270 ? 15.288  -31.318  -0.007  1.00 106.84 ? 273 HIS A CB    1 
ATOM   5695  C CG    . HIS G 3 270 ? 16.539  -32.120  -0.200  1.00 109.55 ? 273 HIS A CG    1 
ATOM   5696  N ND1   . HIS G 3 270 ? 17.631  -31.644  -0.892  1.00 113.54 ? 273 HIS A ND1   1 
ATOM   5697  C CD2   . HIS G 3 270 ? 16.874  -33.362  0.221   1.00 107.76 ? 273 HIS A CD2   1 
ATOM   5698  C CE1   . HIS G 3 270 ? 18.582  -32.560  -0.898  1.00 110.24 ? 273 HIS A CE1   1 
ATOM   5699  N NE2   . HIS G 3 270 ? 18.149  -33.611  -0.227  1.00 109.83 ? 273 HIS A NE2   1 
ATOM   5700  N N     . ALA G 3 271 ? 16.061  -31.597  3.354   1.00 99.82  ? 274 ALA A N     1 
ATOM   5701  C CA    . ALA G 3 271 ? 16.936  -31.088  4.398   1.00 98.90  ? 274 ALA A CA    1 
ATOM   5702  C C     . ALA G 3 271 ? 18.274  -30.611  3.826   1.00 96.12  ? 274 ALA A C     1 
ATOM   5703  O O     . ALA G 3 271 ? 18.676  -30.993  2.727   1.00 94.13  ? 274 ALA A O     1 
ATOM   5704  C CB    . ALA G 3 271 ? 17.155  -32.147  5.473   1.00 100.74 ? 274 ALA A CB    1 
ATOM   5705  N N     . ALA G 3 272 ? 18.943  -29.757  4.589   1.00 96.35  ? 275 ALA A N     1 
ATOM   5706  C CA    . ALA G 3 272 ? 20.217  -29.182  4.194   1.00 95.68  ? 275 ALA A CA    1 
ATOM   5707  C C     . ALA G 3 272 ? 21.331  -30.193  4.411   1.00 92.95  ? 275 ALA A C     1 
ATOM   5708  O O     . ALA G 3 272 ? 21.205  -31.076  5.258   1.00 88.66  ? 275 ALA A O     1 
ATOM   5709  C CB    . ALA G 3 272 ? 20.484  -27.926  5.010   1.00 99.61  ? 275 ALA A CB    1 
ATOM   5710  N N     . TYR G 3 273 ? 22.415  -30.046  3.647   1.00 91.54  ? 276 TYR A N     1 
ATOM   5711  C CA    . TYR G 3 273 ? 23.614  -30.894  3.760   1.00 87.76  ? 276 TYR A CA    1 
ATOM   5712  C C     . TYR G 3 273 ? 23.296  -32.379  3.643   1.00 79.85  ? 276 TYR A C     1 
ATOM   5713  O O     . TYR G 3 273 ? 23.884  -33.218  4.327   1.00 76.23  ? 276 TYR A O     1 
ATOM   5714  C CB    . TYR G 3 273 ? 24.352  -30.617  5.071   1.00 91.98  ? 276 TYR A CB    1 
ATOM   5715  C CG    . TYR G 3 273 ? 24.868  -29.211  5.166   1.00 100.75 ? 276 TYR A CG    1 
ATOM   5716  C CD1   . TYR G 3 273 ? 24.028  -28.169  5.524   1.00 104.22 ? 276 TYR A CD1   1 
ATOM   5717  C CD2   . TYR G 3 273 ? 26.196  -28.918  4.887   1.00 107.82 ? 276 TYR A CD2   1 
ATOM   5718  C CE1   . TYR G 3 273 ? 24.495  -26.869  5.607   1.00 109.96 ? 276 TYR A CE1   1 
ATOM   5719  C CE2   . TYR G 3 273 ? 26.673  -27.622  4.968   1.00 110.80 ? 276 TYR A CE2   1 
ATOM   5720  C CZ    . TYR G 3 273 ? 25.816  -26.602  5.328   1.00 110.88 ? 276 TYR A CZ    1 
ATOM   5721  O OH    . TYR G 3 273 ? 26.273  -25.312  5.415   1.00 116.75 ? 276 TYR A OH    1 
ATOM   5722  N N     . SER G 3 274 ? 22.370  -32.692  2.749   1.00 72.26  ? 277 SER A N     1 
ATOM   5723  C CA    . SER G 3 274 ? 21.862  -34.036  2.610   1.00 65.61  ? 277 SER A CA    1 
ATOM   5724  C C     . SER G 3 274 ? 21.911  -34.445  1.161   1.00 63.00  ? 277 SER A C     1 
ATOM   5725  O O     . SER G 3 274 ? 20.871  -34.670  0.553   1.00 62.99  ? 277 SER A O     1 
ATOM   5726  C CB    . SER G 3 274 ? 20.424  -34.089  3.116   1.00 69.88  ? 277 SER A CB    1 
ATOM   5727  O OG    . SER G 3 274 ? 20.365  -33.861  4.514   1.00 72.89  ? 277 SER A OG    1 
ATOM   5728  N N     . PRO G 3 275 ? 23.123  -34.528  0.590   1.00 64.89  ? 278 PRO A N     1 
ATOM   5729  C CA    . PRO G 3 275 ? 23.281  -35.106  -0.742  1.00 65.92  ? 278 PRO A CA    1 
ATOM   5730  C C     . PRO G 3 275 ? 23.115  -36.631  -0.722  1.00 66.20  ? 278 PRO A C     1 
ATOM   5731  O O     . PRO G 3 275 ? 22.907  -37.229  -1.776  1.00 63.66  ? 278 PRO A O     1 
ATOM   5732  C CB    . PRO G 3 275 ? 24.711  -34.731  -1.114  1.00 67.08  ? 278 PRO A CB    1 
ATOM   5733  C CG    . PRO G 3 275 ? 25.426  -34.681  0.188   1.00 68.06  ? 278 PRO A CG    1 
ATOM   5734  C CD    . PRO G 3 275 ? 24.423  -34.158  1.181   1.00 66.91  ? 278 PRO A CD    1 
ATOM   5735  N N     . ASP G 3 276 ? 23.204  -37.235  0.470   1.00 66.32  ? 279 ASP A N     1 
ATOM   5736  C CA    . ASP G 3 276 ? 22.907  -38.659  0.670   1.00 69.19  ? 279 ASP A CA    1 
ATOM   5737  C C     . ASP G 3 276 ? 21.407  -38.986  0.737   1.00 67.51  ? 279 ASP A C     1 
ATOM   5738  O O     . ASP G 3 276 ? 21.045  -40.121  0.993   1.00 69.13  ? 279 ASP A O     1 
ATOM   5739  C CB    . ASP G 3 276 ? 23.591  -39.182  1.943   1.00 73.25  ? 279 ASP A CB    1 
ATOM   5740  C CG    . ASP G 3 276 ? 22.936  -38.668  3.218   1.00 71.01  ? 279 ASP A CG    1 
ATOM   5741  O OD1   . ASP G 3 276 ? 22.529  -37.498  3.224   1.00 64.62  ? 279 ASP A OD1   1 
ATOM   5742  O OD2   . ASP G 3 276 ? 22.836  -39.428  4.210   1.00 75.73  ? 279 ASP A OD2   1 
ATOM   5743  N N     . LEU G 3 277 ? 20.546  -37.991  0.560   1.00 69.55  ? 280 LEU A N     1 
ATOM   5744  C CA    . LEU G 3 277 ? 19.122  -38.221  0.335   1.00 68.54  ? 280 LEU A CA    1 
ATOM   5745  C C     . LEU G 3 277 ? 18.724  -37.696  -1.033  1.00 69.73  ? 280 LEU A C     1 
ATOM   5746  O O     . LEU G 3 277 ? 17.538  -37.630  -1.347  1.00 70.92  ? 280 LEU A O     1 
ATOM   5747  C CB    . LEU G 3 277 ? 18.279  -37.514  1.404   1.00 69.89  ? 280 LEU A CB    1 
ATOM   5748  C CG    . LEU G 3 277 ? 18.189  -38.123  2.803   1.00 75.36  ? 280 LEU A CG    1 
ATOM   5749  C CD1   . LEU G 3 277 ? 17.931  -39.618  2.723   1.00 79.77  ? 280 LEU A CD1   1 
ATOM   5750  C CD2   . LEU G 3 277 ? 19.436  -37.867  3.633   1.00 79.99  ? 280 LEU A CD2   1 
ATOM   5751  N N     . ALA G 3 278 ? 19.711  -37.327  -1.844  1.00 72.59  ? 281 ALA A N     1 
ATOM   5752  C CA    . ALA G 3 278 ? 19.461  -36.716  -3.143  1.00 78.64  ? 281 ALA A CA    1 
ATOM   5753  C C     . ALA G 3 278 ? 19.838  -37.666  -4.301  1.00 82.14  ? 281 ALA A C     1 
ATOM   5754  O O     . ALA G 3 278 ? 21.013  -37.776  -4.649  1.00 81.99  ? 281 ALA A O     1 
ATOM   5755  C CB    . ALA G 3 278 ? 20.244  -35.423  -3.239  1.00 80.96  ? 281 ALA A CB    1 
ATOM   5756  N N     . PRO G 3 279 ? 18.840  -38.353  -4.900  1.00 82.10  ? 282 PRO A N     1 
ATOM   5757  C CA    . PRO G 3 279 ? 19.064  -39.341  -5.950  1.00 82.31  ? 282 PRO A CA    1 
ATOM   5758  C C     . PRO G 3 279 ? 20.070  -38.923  -6.994  1.00 84.88  ? 282 PRO A C     1 
ATOM   5759  O O     . PRO G 3 279 ? 20.952  -39.705  -7.335  1.00 95.82  ? 282 PRO A O     1 
ATOM   5760  C CB    . PRO G 3 279 ? 17.700  -39.459  -6.607  1.00 84.11  ? 282 PRO A CB    1 
ATOM   5761  C CG    . PRO G 3 279 ? 16.747  -39.221  -5.502  1.00 86.10  ? 282 PRO A CG    1 
ATOM   5762  C CD    . PRO G 3 279 ? 17.408  -38.247  -4.567  1.00 85.01  ? 282 PRO A CD    1 
ATOM   5763  N N     . SER G 3 280 ? 19.939  -37.707  -7.509  1.00 81.39  ? 283 SER A N     1 
ATOM   5764  C CA    . SER G 3 280 ? 20.872  -37.228  -8.521  1.00 82.58  ? 283 SER A CA    1 
ATOM   5765  C C     . SER G 3 280 ? 22.311  -37.405  -8.033  1.00 81.48  ? 283 SER A C     1 
ATOM   5766  O O     . SER G 3 280 ? 23.187  -37.792  -8.803  1.00 80.98  ? 283 SER A O     1 
ATOM   5767  C CB    . SER G 3 280 ? 20.599  -35.762  -8.876  1.00 85.13  ? 283 SER A CB    1 
ATOM   5768  O OG    . SER G 3 280 ? 19.218  -35.526  -9.105  1.00 84.67  ? 283 SER A OG    1 
ATOM   5769  N N     . ASP G 3 281 ? 22.544  -37.146  -6.748  1.00 84.51  ? 284 ASP A N     1 
ATOM   5770  C CA    . ASP G 3 281 ? 23.884  -37.276  -6.167  1.00 87.74  ? 284 ASP A CA    1 
ATOM   5771  C C     . ASP G 3 281 ? 24.270  -38.732  -5.914  1.00 82.45  ? 284 ASP A C     1 
ATOM   5772  O O     . ASP G 3 281 ? 25.089  -39.282  -6.637  1.00 84.97  ? 284 ASP A O     1 
ATOM   5773  C CB    . ASP G 3 281 ? 24.021  -36.455  -4.866  1.00 90.59  ? 284 ASP A CB    1 
ATOM   5774  C CG    . ASP G 3 281 ? 24.450  -35.011  -5.111  1.00 90.70  ? 284 ASP A CG    1 
ATOM   5775  O OD1   . ASP G 3 281 ? 24.567  -34.581  -6.275  1.00 93.41  ? 284 ASP A OD1   1 
ATOM   5776  O OD2   . ASP G 3 281 ? 24.675  -34.295  -4.121  1.00 94.28  ? 284 ASP A OD2   1 
ATOM   5777  N N     . TYR G 3 282 ? 23.675  -39.350  -4.901  1.00 82.38  ? 285 TYR A N     1 
ATOM   5778  C CA    . TYR G 3 282 ? 24.154  -40.641  -4.404  1.00 86.65  ? 285 TYR A CA    1 
ATOM   5779  C C     . TYR G 3 282 ? 24.028  -41.788  -5.402  1.00 84.80  ? 285 TYR A C     1 
ATOM   5780  O O     . TYR G 3 282 ? 24.739  -42.784  -5.275  1.00 81.47  ? 285 TYR A O     1 
ATOM   5781  C CB    . TYR G 3 282 ? 23.464  -41.021  -3.081  1.00 91.80  ? 285 TYR A CB    1 
ATOM   5782  C CG    . TYR G 3 282 ? 21.995  -41.365  -3.197  1.00 92.14  ? 285 TYR A CG    1 
ATOM   5783  C CD1   . TYR G 3 282 ? 21.586  -42.577  -3.730  1.00 92.37  ? 285 TYR A CD1   1 
ATOM   5784  C CD2   . TYR G 3 282 ? 21.017  -40.480  -2.757  1.00 95.41  ? 285 TYR A CD2   1 
ATOM   5785  C CE1   . TYR G 3 282 ? 20.249  -42.899  -3.828  1.00 95.42  ? 285 TYR A CE1   1 
ATOM   5786  C CE2   . TYR G 3 282 ? 19.672  -40.795  -2.854  1.00 97.86  ? 285 TYR A CE2   1 
ATOM   5787  C CZ    . TYR G 3 282 ? 19.297  -42.006  -3.393  1.00 94.89  ? 285 TYR A CZ    1 
ATOM   5788  O OH    . TYR G 3 282 ? 17.973  -42.334  -3.501  1.00 88.88  ? 285 TYR A OH    1 
ATOM   5789  N N     . HIS G 3 283 ? 23.126  -41.655  -6.372  1.00 82.65  ? 286 HIS A N     1 
ATOM   5790  C CA    . HIS G 3 283 ? 22.918  -42.690  -7.384  1.00 85.17  ? 286 HIS A CA    1 
ATOM   5791  C C     . HIS G 3 283 ? 23.449  -42.289  -8.769  1.00 82.61  ? 286 HIS A C     1 
ATOM   5792  O O     . HIS G 3 283 ? 24.435  -42.845  -9.230  1.00 83.03  ? 286 HIS A O     1 
ATOM   5793  C CB    . HIS G 3 283 ? 21.434  -43.036  -7.455  1.00 90.67  ? 286 HIS A CB    1 
ATOM   5794  C CG    . HIS G 3 283 ? 21.114  -44.177  -8.369  1.00 94.61  ? 286 HIS A CG    1 
ATOM   5795  N ND1   . HIS G 3 283 ? 21.139  -45.491  -7.954  1.00 94.37  ? 286 HIS A ND1   1 
ATOM   5796  C CD2   . HIS G 3 283 ? 20.727  -44.199  -9.666  1.00 94.15  ? 286 HIS A CD2   1 
ATOM   5797  C CE1   . HIS G 3 283 ? 20.799  -46.275  -8.961  1.00 96.92  ? 286 HIS A CE1   1 
ATOM   5798  N NE2   . HIS G 3 283 ? 20.541  -45.515  -10.011 1.00 96.67  ? 286 HIS A NE2   1 
ATOM   5799  N N     . LEU G 3 284 ? 22.813  -41.318  -9.419  1.00 81.08  ? 287 LEU A N     1 
ATOM   5800  C CA    . LEU G 3 284 ? 23.122  -40.997  -10.816 1.00 80.08  ? 287 LEU A CA    1 
ATOM   5801  C C     . LEU G 3 284 ? 24.535  -40.459  -11.054 1.00 80.96  ? 287 LEU A C     1 
ATOM   5802  O O     . LEU G 3 284 ? 25.207  -40.872  -11.996 1.00 83.24  ? 287 LEU A O     1 
ATOM   5803  C CB    . LEU G 3 284 ? 22.092  -40.022  -11.379 1.00 80.83  ? 287 LEU A CB    1 
ATOM   5804  C CG    . LEU G 3 284 ? 22.333  -39.531  -12.809 1.00 86.71  ? 287 LEU A CG    1 
ATOM   5805  C CD1   . LEU G 3 284 ? 22.568  -40.674  -13.784 1.00 87.91  ? 287 LEU A CD1   1 
ATOM   5806  C CD2   . LEU G 3 284 ? 21.150  -38.690  -13.261 1.00 92.29  ? 287 LEU A CD2   1 
ATOM   5807  N N     . PHE G 3 285 ? 24.986  -39.524  -10.230 1.00 82.44  ? 288 PHE A N     1 
ATOM   5808  C CA    . PHE G 3 285 ? 26.338  -38.996  -10.396 1.00 84.43  ? 288 PHE A CA    1 
ATOM   5809  C C     . PHE G 3 285 ? 27.370  -39.974  -9.875  1.00 85.86  ? 288 PHE A C     1 
ATOM   5810  O O     . PHE G 3 285 ? 28.473  -40.065  -10.412 1.00 87.39  ? 288 PHE A O     1 
ATOM   5811  C CB    . PHE G 3 285 ? 26.507  -37.659  -9.684  1.00 85.73  ? 288 PHE A CB    1 
ATOM   5812  C CG    . PHE G 3 285 ? 25.711  -36.541  -10.287 1.00 84.39  ? 288 PHE A CG    1 
ATOM   5813  C CD1   . PHE G 3 285 ? 25.621  -36.388  -11.663 1.00 83.53  ? 288 PHE A CD1   1 
ATOM   5814  C CD2   . PHE G 3 285 ? 25.085  -35.621  -9.474  1.00 83.60  ? 288 PHE A CD2   1 
ATOM   5815  C CE1   . PHE G 3 285 ? 24.898  -35.354  -12.211 1.00 83.67  ? 288 PHE A CE1   1 
ATOM   5816  C CE2   . PHE G 3 285 ? 24.360  -34.583  -10.015 1.00 88.56  ? 288 PHE A CE2   1 
ATOM   5817  C CZ    . PHE G 3 285 ? 24.266  -34.448  -11.386 1.00 87.87  ? 288 PHE A CZ    1 
ATOM   5818  N N     . ALA G 3 286 ? 27.009  -40.700  -8.823  1.00 85.91  ? 289 ALA A N     1 
ATOM   5819  C CA    . ALA G 3 286 ? 27.894  -41.700  -8.246  1.00 85.56  ? 289 ALA A CA    1 
ATOM   5820  C C     . ALA G 3 286 ? 28.374  -42.672  -9.308  1.00 86.40  ? 289 ALA A C     1 
ATOM   5821  O O     . ALA G 3 286 ? 29.543  -43.036  -9.333  1.00 94.48  ? 289 ALA A O     1 
ATOM   5822  C CB    . ALA G 3 286 ? 27.194  -42.441  -7.119  1.00 84.51  ? 289 ALA A CB    1 
ATOM   5823  N N     . SER G 3 287 ? 27.466  -43.074  -10.191 1.00 87.81  ? 290 SER A N     1 
ATOM   5824  C CA    . SER G 3 287 ? 27.796  -43.979  -11.278 1.00 87.40  ? 290 SER A CA    1 
ATOM   5825  C C     . SER G 3 287 ? 28.784  -43.327  -12.228 1.00 89.46  ? 290 SER A C     1 
ATOM   5826  O O     . SER G 3 287 ? 29.838  -43.897  -12.507 1.00 90.81  ? 290 SER A O     1 
ATOM   5827  C CB    . SER G 3 287 ? 26.534  -44.373  -12.036 1.00 89.87  ? 290 SER A CB    1 
ATOM   5828  O OG    . SER G 3 287 ? 26.829  -45.343  -13.018 1.00 99.46  ? 290 SER A OG    1 
ATOM   5829  N N     . MET G 3 288 ? 28.441  -42.132  -12.713 1.00 92.50  ? 291 MET A N     1 
ATOM   5830  C CA    . MET G 3 288 ? 29.323  -41.363  -13.598 1.00 90.68  ? 291 MET A CA    1 
ATOM   5831  C C     . MET G 3 288 ? 30.746  -41.334  -13.053 1.00 87.69  ? 291 MET A C     1 
ATOM   5832  O O     . MET G 3 288 ? 31.694  -41.599  -13.785 1.00 87.03  ? 291 MET A O     1 
ATOM   5833  C CB    . MET G 3 288 ? 28.809  -39.926  -13.783 1.00 94.54  ? 291 MET A CB    1 
ATOM   5834  C CG    . MET G 3 288 ? 27.695  -39.790  -14.813 1.00 98.00  ? 291 MET A CG    1 
ATOM   5835  S SD    . MET G 3 288 ? 27.141  -38.101  -15.160 1.00 92.72  ? 291 MET A SD    1 
ATOM   5836  C CE    . MET G 3 288 ? 28.699  -37.320  -15.540 1.00 93.77  ? 291 MET A CE    1 
ATOM   5837  N N     . GLY G 3 289 ? 30.882  -41.043  -11.761 1.00 89.12  ? 292 GLY A N     1 
ATOM   5838  C CA    . GLY G 3 289 ? 32.191  -40.932  -11.103 1.00 94.16  ? 292 GLY A CA    1 
ATOM   5839  C C     . GLY G 3 289 ? 33.193  -42.005  -11.493 1.00 90.40  ? 292 GLY A C     1 
ATOM   5840  O O     . GLY G 3 289 ? 34.349  -41.706  -11.806 1.00 86.27  ? 292 GLY A O     1 
ATOM   5841  N N     . HIS G 3 290 ? 32.737  -43.255  -11.478 1.00 92.72  ? 293 HIS A N     1 
ATOM   5842  C CA    . HIS G 3 290 ? 33.552  -44.393  -11.904 1.00 94.85  ? 293 HIS A CA    1 
ATOM   5843  C C     . HIS G 3 290 ? 33.788  -44.340  -13.405 1.00 91.04  ? 293 HIS A C     1 
ATOM   5844  O O     . HIS G 3 290 ? 34.920  -44.472  -13.870 1.00 92.86  ? 293 HIS A O     1 
ATOM   5845  C CB    . HIS G 3 290 ? 32.866  -45.712  -11.560 1.00 95.04  ? 293 HIS A CB    1 
ATOM   5846  C CG    . HIS G 3 290 ? 32.677  -45.932  -10.094 1.00 94.22  ? 293 HIS A CG    1 
ATOM   5847  N ND1   . HIS G 3 290 ? 33.705  -46.321  -9.264  1.00 96.22  ? 293 HIS A ND1   1 
ATOM   5848  C CD2   . HIS G 3 290 ? 31.576  -45.835  -9.311  1.00 92.86  ? 293 HIS A CD2   1 
ATOM   5849  C CE1   . HIS G 3 290 ? 33.247  -46.448  -8.031  1.00 97.76  ? 293 HIS A CE1   1 
ATOM   5850  N NE2   . HIS G 3 290 ? 31.958  -46.156  -8.032  1.00 94.87  ? 293 HIS A NE2   1 
ATOM   5851  N N     . ALA G 3 291 ? 32.708  -44.142  -14.154 1.00 85.37  ? 294 ALA A N     1 
ATOM   5852  C CA    . ALA G 3 291 ? 32.785  -44.032  -15.608 1.00 89.10  ? 294 ALA A CA    1 
ATOM   5853  C C     . ALA G 3 291 ? 33.689  -42.892  -16.079 1.00 85.91  ? 294 ALA A C     1 
ATOM   5854  O O     . ALA G 3 291 ? 34.282  -42.975  -17.155 1.00 83.91  ? 294 ALA A O     1 
ATOM   5855  C CB    . ALA G 3 291 ? 31.393  -43.861  -16.197 1.00 92.25  ? 294 ALA A CB    1 
ATOM   5856  N N     . LEU G 3 292 ? 33.783  -41.833  -15.278 1.00 87.11  ? 295 LEU A N     1 
ATOM   5857  C CA    . LEU G 3 292 ? 34.608  -40.673  -15.615 1.00 87.81  ? 295 LEU A CA    1 
ATOM   5858  C C     . LEU G 3 292 ? 36.063  -40.885  -15.252 1.00 90.87  ? 295 LEU A C     1 
ATOM   5859  O O     . LEU G 3 292 ? 36.948  -40.323  -15.894 1.00 91.63  ? 295 LEU A O     1 
ATOM   5860  C CB    . LEU G 3 292 ? 34.091  -39.425  -14.908 1.00 86.82  ? 295 LEU A CB    1 
ATOM   5861  C CG    . LEU G 3 292 ? 32.729  -38.924  -15.394 1.00 88.03  ? 295 LEU A CG    1 
ATOM   5862  C CD1   . LEU G 3 292 ? 32.158  -37.953  -14.373 1.00 92.30  ? 295 LEU A CD1   1 
ATOM   5863  C CD2   . LEU G 3 292 ? 32.826  -38.288  -16.775 1.00 85.60  ? 295 LEU A CD2   1 
ATOM   5864  N N     . ALA G 3 293 ? 36.312  -41.689  -14.222 1.00 94.60  ? 296 ALA A N     1 
ATOM   5865  C CA    . ALA G 3 293 ? 37.672  -41.912  -13.743 1.00 97.67  ? 296 ALA A CA    1 
ATOM   5866  C C     . ALA G 3 293 ? 38.629  -42.221  -14.897 1.00 98.45  ? 296 ALA A C     1 
ATOM   5867  O O     . ALA G 3 293 ? 38.320  -43.010  -15.793 1.00 93.81  ? 296 ALA A O     1 
ATOM   5868  C CB    . ALA G 3 293 ? 37.701  -43.021  -12.701 1.00 98.07  ? 296 ALA A CB    1 
ATOM   5869  N N     . GLU G 3 294 ? 39.773  -41.545  -14.881 1.00 107.80 ? 297 GLU A N     1 
ATOM   5870  C CA    . GLU G 3 294 ? 40.825  -41.708  -15.886 1.00 116.41 ? 297 GLU A CA    1 
ATOM   5871  C C     . GLU G 3 294 ? 40.391  -41.397  -17.324 1.00 114.57 ? 297 GLU A C     1 
ATOM   5872  O O     . GLU G 3 294 ? 41.157  -41.617  -18.263 1.00 114.19 ? 297 GLU A O     1 
ATOM   5873  C CB    . GLU G 3 294 ? 41.459  -43.100  -15.777 1.00 124.62 ? 297 GLU A CB    1 
ATOM   5874  C CG    . GLU G 3 294 ? 42.183  -43.307  -14.454 1.00 135.84 ? 297 GLU A CG    1 
ATOM   5875  C CD    . GLU G 3 294 ? 42.805  -44.684  -14.316 1.00 146.60 ? 297 GLU A CD    1 
ATOM   5876  O OE1   . GLU G 3 294 ? 43.978  -44.764  -13.891 1.00 150.69 ? 297 GLU A OE1   1 
ATOM   5877  O OE2   . GLU G 3 294 ? 42.124  -45.686  -14.625 1.00 152.84 ? 297 GLU A OE2   1 
ATOM   5878  N N     . GLN G 3 295 ? 39.185  -40.857  -17.492 1.00 113.54 ? 298 GLN A N     1 
ATOM   5879  C CA    . GLN G 3 295 ? 38.703  -40.456  -18.806 1.00 114.47 ? 298 GLN A CA    1 
ATOM   5880  C C     . GLN G 3 295 ? 39.245  -39.070  -19.126 1.00 113.72 ? 298 GLN A C     1 
ATOM   5881  O O     . GLN G 3 295 ? 39.321  -38.219  -18.244 1.00 116.82 ? 298 GLN A O     1 
ATOM   5882  C CB    . GLN G 3 295 ? 37.176  -40.423  -18.826 1.00 115.12 ? 298 GLN A CB    1 
ATOM   5883  C CG    . GLN G 3 295 ? 36.578  -40.424  -20.222 1.00 120.06 ? 298 GLN A CG    1 
ATOM   5884  C CD    . GLN G 3 295 ? 36.749  -41.754  -20.934 1.00 120.30 ? 298 GLN A CD    1 
ATOM   5885  O OE1   . GLN G 3 295 ? 36.944  -42.796  -20.302 1.00 117.73 ? 298 GLN A OE1   1 
ATOM   5886  N NE2   . GLN G 3 295 ? 36.671  -41.725  -22.257 1.00 118.89 ? 298 GLN A NE2   1 
ATOM   5887  N N     . ARG G 3 296 ? 39.623  -38.846  -20.381 1.00 115.65 ? 299 ARG A N     1 
ATOM   5888  C CA    . ARG G 3 296 ? 40.114  -37.536  -20.809 1.00 121.59 ? 299 ARG A CA    1 
ATOM   5889  C C     . ARG G 3 296 ? 39.277  -36.955  -21.946 1.00 122.44 ? 299 ARG A C     1 
ATOM   5890  O O     . ARG G 3 296 ? 38.839  -37.679  -22.837 1.00 131.90 ? 299 ARG A O     1 
ATOM   5891  C CB    . ARG G 3 296 ? 41.595  -37.608  -21.204 1.00 123.60 ? 299 ARG A CB    1 
ATOM   5892  C CG    . ARG G 3 296 ? 42.502  -36.903  -20.209 1.00 128.00 ? 299 ARG A CG    1 
ATOM   5893  C CD    . ARG G 3 296 ? 43.952  -36.854  -20.660 1.00 133.69 ? 299 ARG A CD    1 
ATOM   5894  N NE    . ARG G 3 296 ? 44.718  -35.896  -19.862 1.00 139.50 ? 299 ARG A NE    1 
ATOM   5895  C CZ    . ARG G 3 296 ? 46.034  -35.714  -19.948 1.00 145.88 ? 299 ARG A CZ    1 
ATOM   5896  N NH1   . ARG G 3 296 ? 46.764  -36.422  -20.803 1.00 152.88 ? 299 ARG A NH1   1 
ATOM   5897  N NH2   . ARG G 3 296 ? 46.628  -34.814  -19.171 1.00 147.86 ? 299 ARG A NH2   1 
ATOM   5898  N N     . PHE G 3 297 ? 39.050  -35.645  -21.892 1.00 119.78 ? 300 PHE A N     1 
ATOM   5899  C CA    . PHE G 3 297 ? 38.317  -34.931  -22.931 1.00 120.49 ? 300 PHE A CA    1 
ATOM   5900  C C     . PHE G 3 297 ? 39.161  -33.783  -23.467 1.00 125.83 ? 300 PHE A C     1 
ATOM   5901  O O     . PHE G 3 297 ? 40.019  -33.247  -22.763 1.00 127.11 ? 300 PHE A O     1 
ATOM   5902  C CB    . PHE G 3 297 ? 37.002  -34.378  -22.381 1.00 119.40 ? 300 PHE A CB    1 
ATOM   5903  C CG    . PHE G 3 297 ? 36.078  -35.429  -21.830 1.00 114.17 ? 300 PHE A CG    1 
ATOM   5904  C CD1   . PHE G 3 297 ? 35.634  -36.473  -22.633 1.00 112.30 ? 300 PHE A CD1   1 
ATOM   5905  C CD2   . PHE G 3 297 ? 35.631  -35.362  -20.516 1.00 108.17 ? 300 PHE A CD2   1 
ATOM   5906  C CE1   . PHE G 3 297 ? 34.778  -37.438  -22.132 1.00 109.46 ? 300 PHE A CE1   1 
ATOM   5907  C CE2   . PHE G 3 297 ? 34.773  -36.323  -20.011 1.00 107.18 ? 300 PHE A CE2   1 
ATOM   5908  C CZ    . PHE G 3 297 ? 34.347  -37.362  -20.819 1.00 109.04 ? 300 PHE A CZ    1 
ATOM   5909  N N     . ASP G 3 298 ? 38.900  -33.408  -24.715 1.00 129.67 ? 301 ASP A N     1 
ATOM   5910  C CA    . ASP G 3 298 ? 39.668  -32.363  -25.402 1.00 132.69 ? 301 ASP A CA    1 
ATOM   5911  C C     . ASP G 3 298 ? 38.818  -31.151  -25.791 1.00 128.00 ? 301 ASP A C     1 
ATOM   5912  O O     . ASP G 3 298 ? 39.317  -30.024  -25.814 1.00 128.36 ? 301 ASP A O     1 
ATOM   5913  C CB    . ASP G 3 298 ? 40.360  -32.942  -26.644 1.00 139.35 ? 301 ASP A CB    1 
ATOM   5914  C CG    . ASP G 3 298 ? 39.431  -33.809  -27.494 1.00 145.27 ? 301 ASP A CG    1 
ATOM   5915  O OD1   . ASP G 3 298 ? 38.220  -33.893  -27.186 1.00 146.65 ? 301 ASP A OD1   1 
ATOM   5916  O OD2   . ASP G 3 298 ? 39.920  -34.414  -28.471 1.00 145.97 ? 301 ASP A OD2   1 
ATOM   5917  N N     . SER G 3 299 ? 37.545  -31.384  -26.100 1.00 126.18 ? 302 SER A N     1 
ATOM   5918  C CA    . SER G 3 299 ? 36.640  -30.311  -26.493 1.00 124.56 ? 302 SER A CA    1 
ATOM   5919  C C     . SER G 3 299 ? 35.271  -30.466  -25.847 1.00 119.86 ? 302 SER A C     1 
ATOM   5920  O O     . SER G 3 299 ? 34.843  -31.576  -25.525 1.00 105.87 ? 302 SER A O     1 
ATOM   5921  C CB    . SER G 3 299 ? 36.475  -30.298  -28.011 1.00 126.55 ? 302 SER A CB    1 
ATOM   5922  O OG    . SER G 3 299 ? 35.718  -31.418  -28.444 1.00 125.35 ? 302 SER A OG    1 
ATOM   5923  N N     . TYR G 3 300 ? 34.591  -29.336  -25.673 1.00 123.71 ? 303 TYR A N     1 
ATOM   5924  C CA    . TYR G 3 300 ? 33.191  -29.312  -25.255 1.00 128.87 ? 303 TYR A CA    1 
ATOM   5925  C C     . TYR G 3 300 ? 32.373  -30.353  -26.022 1.00 127.68 ? 303 TYR A C     1 
ATOM   5926  O O     . TYR G 3 300 ? 31.472  -30.975  -25.463 1.00 120.52 ? 303 TYR A O     1 
ATOM   5927  C CB    . TYR G 3 300 ? 32.610  -27.906  -25.479 1.00 132.90 ? 303 TYR A CB    1 
ATOM   5928  C CG    . TYR G 3 300 ? 31.109  -27.787  -25.286 1.00 137.84 ? 303 TYR A CG    1 
ATOM   5929  C CD1   . TYR G 3 300 ? 30.224  -28.143  -26.304 1.00 139.28 ? 303 TYR A CD1   1 
ATOM   5930  C CD2   . TYR G 3 300 ? 30.573  -27.298  -24.095 1.00 140.80 ? 303 TYR A CD2   1 
ATOM   5931  C CE1   . TYR G 3 300 ? 28.852  -28.033  -26.135 1.00 140.92 ? 303 TYR A CE1   1 
ATOM   5932  C CE2   . TYR G 3 300 ? 29.201  -27.184  -23.918 1.00 141.36 ? 303 TYR A CE2   1 
ATOM   5933  C CZ    . TYR G 3 300 ? 28.345  -27.552  -24.941 1.00 140.41 ? 303 TYR A CZ    1 
ATOM   5934  O OH    . TYR G 3 300 ? 26.983  -27.445  -24.778 1.00 137.23 ? 303 TYR A OH    1 
ATOM   5935  N N     . GLU G 3 301 ? 32.700  -30.531  -27.301 1.00 134.89 ? 304 GLU A N     1 
ATOM   5936  C CA    . GLU G 3 301 ? 31.998  -31.476  -28.175 1.00 138.99 ? 304 GLU A CA    1 
ATOM   5937  C C     . GLU G 3 301 ? 32.113  -32.897  -27.629 1.00 137.53 ? 304 GLU A C     1 
ATOM   5938  O O     . GLU G 3 301 ? 31.106  -33.591  -27.446 1.00 131.98 ? 304 GLU A O     1 
ATOM   5939  C CB    . GLU G 3 301 ? 32.566  -31.449  -29.610 1.00 144.55 ? 304 GLU A CB    1 
ATOM   5940  C CG    . GLU G 3 301 ? 32.935  -30.081  -30.186 1.00 148.26 ? 304 GLU A CG    1 
ATOM   5941  C CD    . GLU G 3 301 ? 31.882  -29.011  -29.949 1.00 148.90 ? 304 GLU A CD    1 
ATOM   5942  O OE1   . GLU G 3 301 ? 30.676  -29.306  -30.085 1.00 144.81 ? 304 GLU A OE1   1 
ATOM   5943  O OE2   . GLU G 3 301 ? 32.268  -27.867  -29.632 1.00 148.19 ? 304 GLU A OE2   1 
ATOM   5944  N N     . SER G 3 302 ? 33.354  -33.304  -27.368 1.00 134.82 ? 305 SER A N     1 
ATOM   5945  C CA    . SER G 3 302 ? 33.685  -34.659  -26.921 1.00 126.23 ? 305 SER A CA    1 
ATOM   5946  C C     . SER G 3 302 ? 32.877  -35.099  -25.696 1.00 120.72 ? 305 SER A C     1 
ATOM   5947  O O     . SER G 3 302 ? 32.419  -36.238  -25.629 1.00 118.20 ? 305 SER A O     1 
ATOM   5948  C CB    . SER G 3 302 ? 35.182  -34.739  -26.612 1.00 125.12 ? 305 SER A CB    1 
ATOM   5949  O OG    . SER G 3 302 ? 35.579  -36.066  -26.343 1.00 128.71 ? 305 SER A OG    1 
ATOM   5950  N N     . VAL G 3 303 ? 32.703  -34.181  -24.746 1.00 117.28 ? 306 VAL A N     1 
ATOM   5951  C CA    . VAL G 3 303 ? 31.979  -34.447  -23.498 1.00 110.39 ? 306 VAL A CA    1 
ATOM   5952  C C     . VAL G 3 303 ? 30.498  -34.688  -23.779 1.00 113.92 ? 306 VAL A C     1 
ATOM   5953  O O     . VAL G 3 303 ? 29.910  -35.662  -23.307 1.00 102.19 ? 306 VAL A O     1 
ATOM   5954  C CB    . VAL G 3 303 ? 32.095  -33.258  -22.518 1.00 106.76 ? 306 VAL A CB    1 
ATOM   5955  C CG1   . VAL G 3 303 ? 31.393  -33.569  -21.203 1.00 105.29 ? 306 VAL A CG1   1 
ATOM   5956  C CG2   . VAL G 3 303 ? 33.552  -32.892  -22.273 1.00 109.58 ? 306 VAL A CG2   1 
ATOM   5957  N N     . LYS G 3 304 ? 29.913  -33.774  -24.550 1.00 129.28 ? 307 LYS A N     1 
ATOM   5958  C CA    . LYS G 3 304 ? 28.496  -33.822  -24.925 1.00 136.38 ? 307 LYS A CA    1 
ATOM   5959  C C     . LYS G 3 304 ? 28.168  -35.165  -25.571 1.00 130.88 ? 307 LYS A C     1 
ATOM   5960  O O     . LYS G 3 304 ? 27.157  -35.793  -25.247 1.00 125.38 ? 307 LYS A O     1 
ATOM   5961  C CB    . LYS G 3 304 ? 28.170  -32.670  -25.892 1.00 141.84 ? 307 LYS A CB    1 
ATOM   5962  C CG    . LYS G 3 304 ? 26.771  -32.085  -25.761 1.00 149.49 ? 307 LYS A CG    1 
ATOM   5963  C CD    . LYS G 3 304 ? 25.704  -32.963  -26.393 1.00 158.16 ? 307 LYS A CD    1 
ATOM   5964  C CE    . LYS G 3 304 ? 24.463  -32.161  -26.768 1.00 165.96 ? 307 LYS A CE    1 
ATOM   5965  N NZ    . LYS G 3 304 ? 23.869  -31.419  -25.620 1.00 169.92 ? 307 LYS A NZ    1 
ATOM   5966  N N     . LYS G 3 305 ? 29.041  -35.599  -26.474 1.00 125.29 ? 308 LYS A N     1 
ATOM   5967  C CA    . LYS G 3 305 ? 28.885  -36.882  -27.142 1.00 127.73 ? 308 LYS A CA    1 
ATOM   5968  C C     . LYS G 3 305 ? 28.924  -38.028  -26.135 1.00 119.82 ? 308 LYS A C     1 
ATOM   5969  O O     . LYS G 3 305 ? 28.065  -38.905  -26.153 1.00 122.94 ? 308 LYS A O     1 
ATOM   5970  C CB    . LYS G 3 305 ? 29.983  -37.073  -28.191 1.00 135.67 ? 308 LYS A CB    1 
ATOM   5971  C CG    . LYS G 3 305 ? 29.767  -38.275  -29.099 1.00 142.95 ? 308 LYS A CG    1 
ATOM   5972  C CD    . LYS G 3 305 ? 31.046  -38.690  -29.811 1.00 149.21 ? 308 LYS A CD    1 
ATOM   5973  C CE    . LYS G 3 305 ? 31.001  -40.159  -30.200 1.00 151.69 ? 308 LYS A CE    1 
ATOM   5974  N NZ    . LYS G 3 305 ? 32.292  -40.655  -30.746 1.00 155.02 ? 308 LYS A NZ    1 
ATOM   5975  N N     . TRP G 3 306 ? 29.918  -38.012  -25.256 1.00 114.97 ? 309 TRP A N     1 
ATOM   5976  C CA    . TRP G 3 306 ? 30.091  -39.082  -24.276 1.00 114.41 ? 309 TRP A CA    1 
ATOM   5977  C C     . TRP G 3 306 ? 28.876  -39.214  -23.355 1.00 111.67 ? 309 TRP A C     1 
ATOM   5978  O O     . TRP G 3 306 ? 28.403  -40.327  -23.120 1.00 112.46 ? 309 TRP A O     1 
ATOM   5979  C CB    . TRP G 3 306 ? 31.362  -38.847  -23.455 1.00 116.29 ? 309 TRP A CB    1 
ATOM   5980  C CG    . TRP G 3 306 ? 31.669  -39.935  -22.474 1.00 114.48 ? 309 TRP A CG    1 
ATOM   5981  C CD1   . TRP G 3 306 ? 32.410  -41.056  -22.697 1.00 114.25 ? 309 TRP A CD1   1 
ATOM   5982  C CD2   . TRP G 3 306 ? 31.253  -39.993  -21.106 1.00 112.61 ? 309 TRP A CD2   1 
ATOM   5983  N NE1   . TRP G 3 306 ? 32.477  -41.813  -21.552 1.00 115.90 ? 309 TRP A NE1   1 
ATOM   5984  C CE2   . TRP G 3 306 ? 31.773  -41.182  -20.561 1.00 113.57 ? 309 TRP A CE2   1 
ATOM   5985  C CE3   . TRP G 3 306 ? 30.487  -39.154  -20.288 1.00 110.04 ? 309 TRP A CE3   1 
ATOM   5986  C CZ2   . TRP G 3 306 ? 31.553  -41.553  -19.236 1.00 115.21 ? 309 TRP A CZ2   1 
ATOM   5987  C CZ3   . TRP G 3 306 ? 30.268  -39.523  -18.973 1.00 108.15 ? 309 TRP A CZ3   1 
ATOM   5988  C CH2   . TRP G 3 306 ? 30.798  -40.711  -18.460 1.00 113.18 ? 309 TRP A CH2   1 
ATOM   5989  N N     . LEU G 3 307 ? 28.380  -38.085  -22.844 1.00 109.45 ? 310 LEU A N     1 
ATOM   5990  C CA    . LEU G 3 307 ? 27.184  -38.072  -21.983 1.00 105.74 ? 310 LEU A CA    1 
ATOM   5991  C C     . LEU G 3 307 ? 26.043  -38.854  -22.610 1.00 108.21 ? 310 LEU A C     1 
ATOM   5992  O O     . LEU G 3 307 ? 25.481  -39.753  -21.989 1.00 106.31 ? 310 LEU A O     1 
ATOM   5993  C CB    . LEU G 3 307 ? 26.695  -36.639  -21.708 1.00 103.75 ? 310 LEU A CB    1 
ATOM   5994  C CG    . LEU G 3 307 ? 27.113  -35.930  -20.415 1.00 102.64 ? 310 LEU A CG    1 
ATOM   5995  C CD1   . LEU G 3 307 ? 26.824  -36.781  -19.188 1.00 103.85 ? 310 LEU A CD1   1 
ATOM   5996  C CD2   . LEU G 3 307 ? 28.578  -35.543  -20.458 1.00 105.82 ? 310 LEU A CD2   1 
ATOM   5997  N N     . ASP G 3 308 ? 25.705  -38.494  -23.846 1.00 112.41 ? 311 ASP A N     1 
ATOM   5998  C CA    . ASP G 3 308 ? 24.603  -39.126  -24.566 1.00 110.71 ? 311 ASP A CA    1 
ATOM   5999  C C     . ASP G 3 308 ? 24.766  -40.639  -24.564 1.00 104.59 ? 311 ASP A C     1 
ATOM   6000  O O     . ASP G 3 308 ? 23.906  -41.364  -24.059 1.00 97.42  ? 311 ASP A O     1 
ATOM   6001  C CB    . ASP G 3 308 ? 24.526  -38.608  -26.011 1.00 113.48 ? 311 ASP A CB    1 
ATOM   6002  C CG    . ASP G 3 308 ? 24.022  -37.174  -26.100 1.00 115.13 ? 311 ASP A CG    1 
ATOM   6003  O OD1   . ASP G 3 308 ? 23.238  -36.749  -25.224 1.00 115.61 ? 311 ASP A OD1   1 
ATOM   6004  O OD2   . ASP G 3 308 ? 24.402  -36.472  -27.062 1.00 115.85 ? 311 ASP A OD2   1 
ATOM   6005  N N     . GLU G 3 309 ? 25.887  -41.099  -25.108 1.00 103.78 ? 312 GLU A N     1 
ATOM   6006  C CA    . GLU G 3 309 ? 26.192  -42.527  -25.168 1.00 111.91 ? 312 GLU A CA    1 
ATOM   6007  C C     . GLU G 3 309 ? 26.007  -43.190  -23.806 1.00 109.56 ? 312 GLU A C     1 
ATOM   6008  O O     . GLU G 3 309 ? 25.458  -44.292  -23.712 1.00 108.57 ? 312 GLU A O     1 
ATOM   6009  C CB    . GLU G 3 309 ? 27.623  -42.746  -25.666 1.00 116.20 ? 312 GLU A CB    1 
ATOM   6010  C CG    . GLU G 3 309 ? 27.805  -42.432  -27.144 1.00 116.35 ? 312 GLU A CG    1 
ATOM   6011  C CD    . GLU G 3 309 ? 29.259  -42.402  -27.572 1.00 119.64 ? 312 GLU A CD    1 
ATOM   6012  O OE1   . GLU G 3 309 ? 30.138  -42.110  -26.729 1.00 122.65 ? 312 GLU A OE1   1 
ATOM   6013  O OE2   . GLU G 3 309 ? 29.521  -42.665  -28.764 1.00 121.80 ? 312 GLU A OE2   1 
ATOM   6014  N N     . TRP G 3 310 ? 26.455  -42.502  -22.758 1.00 102.00 ? 313 TRP A N     1 
ATOM   6015  C CA    . TRP G 3 310 ? 26.327  -42.998  -21.392 1.00 101.11 ? 313 TRP A CA    1 
ATOM   6016  C C     . TRP G 3 310 ? 24.865  -43.097  -20.947 1.00 105.09 ? 313 TRP A C     1 
ATOM   6017  O O     . TRP G 3 310 ? 24.472  -44.095  -20.339 1.00 110.83 ? 313 TRP A O     1 
ATOM   6018  C CB    . TRP G 3 310 ? 27.109  -42.102  -20.430 1.00 100.35 ? 313 TRP A CB    1 
ATOM   6019  C CG    . TRP G 3 310 ? 27.318  -42.698  -19.087 1.00 94.91  ? 313 TRP A CG    1 
ATOM   6020  C CD1   . TRP G 3 310 ? 28.265  -43.608  -18.744 1.00 98.41  ? 313 TRP A CD1   1 
ATOM   6021  C CD2   . TRP G 3 310 ? 26.574  -42.420  -17.897 1.00 94.12  ? 313 TRP A CD2   1 
ATOM   6022  N NE1   . TRP G 3 310 ? 28.157  -43.926  -17.414 1.00 102.00 ? 313 TRP A NE1   1 
ATOM   6023  C CE2   . TRP G 3 310 ? 27.127  -43.208  -16.868 1.00 98.24  ? 313 TRP A CE2   1 
ATOM   6024  C CE3   . TRP G 3 310 ? 25.492  -41.585  -17.599 1.00 94.69  ? 313 TRP A CE3   1 
ATOM   6025  C CZ2   . TRP G 3 310 ? 26.639  -43.183  -15.558 1.00 95.09  ? 313 TRP A CZ2   1 
ATOM   6026  C CZ3   . TRP G 3 310 ? 25.003  -41.564  -16.298 1.00 94.39  ? 313 TRP A CZ3   1 
ATOM   6027  C CH2   . TRP G 3 310 ? 25.578  -42.362  -15.295 1.00 94.41  ? 313 TRP A CH2   1 
ATOM   6028  N N     . PHE G 3 311 ? 24.064  -42.073  -21.244 1.00 108.59 ? 314 PHE A N     1 
ATOM   6029  C CA    . PHE G 3 311 ? 22.639  -42.083  -20.879 1.00 112.14 ? 314 PHE A CA    1 
ATOM   6030  C C     . PHE G 3 311 ? 21.857  -43.166  -21.621 1.00 116.99 ? 314 PHE A C     1 
ATOM   6031  O O     . PHE G 3 311 ? 20.912  -43.736  -21.073 1.00 117.94 ? 314 PHE A O     1 
ATOM   6032  C CB    . PHE G 3 311 ? 21.981  -40.728  -21.150 1.00 111.63 ? 314 PHE A CB    1 
ATOM   6033  C CG    . PHE G 3 311 ? 22.348  -39.651  -20.163 1.00 110.67 ? 314 PHE A CG    1 
ATOM   6034  C CD1   . PHE G 3 311 ? 22.236  -39.867  -18.796 1.00 109.78 ? 314 PHE A CD1   1 
ATOM   6035  C CD2   . PHE G 3 311 ? 22.768  -38.402  -20.606 1.00 109.11 ? 314 PHE A CD2   1 
ATOM   6036  C CE1   . PHE G 3 311 ? 22.561  -38.872  -17.893 1.00 109.08 ? 314 PHE A CE1   1 
ATOM   6037  C CE2   . PHE G 3 311 ? 23.091  -37.403  -19.708 1.00 108.74 ? 314 PHE A CE2   1 
ATOM   6038  C CZ    . PHE G 3 311 ? 22.988  -37.638  -18.350 1.00 110.05 ? 314 PHE A CZ    1 
ATOM   6039  N N     . ALA G 3 312 ? 22.248  -43.433  -22.866 1.00 118.74 ? 315 ALA A N     1 
ATOM   6040  C CA    . ALA G 3 312 ? 21.633  -44.491  -23.670 1.00 118.44 ? 315 ALA A CA    1 
ATOM   6041  C C     . ALA G 3 312 ? 21.975  -45.876  -23.116 1.00 115.45 ? 315 ALA A C     1 
ATOM   6042  O O     . ALA G 3 312 ? 21.088  -46.708  -22.902 1.00 104.74 ? 315 ALA A O     1 
ATOM   6043  C CB    . ALA G 3 312 ? 22.088  -44.379  -25.119 1.00 120.35 ? 315 ALA A CB    1 
ATOM   6044  N N     . ALA G 3 313 ? 23.266  -46.108  -22.885 1.00 115.78 ? 316 ALA A N     1 
ATOM   6045  C CA    . ALA G 3 313 ? 23.754  -47.372  -22.323 1.00 118.93 ? 316 ALA A CA    1 
ATOM   6046  C C     . ALA G 3 313 ? 22.947  -47.812  -21.105 1.00 119.44 ? 316 ALA A C     1 
ATOM   6047  O O     . ALA G 3 313 ? 22.657  -48.998  -20.942 1.00 123.62 ? 316 ALA A O     1 
ATOM   6048  C CB    . ALA G 3 313 ? 25.225  -47.249  -21.948 1.00 120.49 ? 316 ALA A CB    1 
ATOM   6049  N N     . LYS G 3 314 ? 22.591  -46.851  -20.256 1.00 118.02 ? 317 LYS A N     1 
ATOM   6050  C CA    . LYS G 3 314 ? 21.808  -47.128  -19.057 1.00 117.03 ? 317 LYS A CA    1 
ATOM   6051  C C     . LYS G 3 314 ? 20.419  -47.672  -19.389 1.00 112.81 ? 317 LYS A C     1 
ATOM   6052  O O     . LYS G 3 314 ? 19.622  -47.001  -20.035 1.00 117.23 ? 317 LYS A O     1 
ATOM   6053  C CB    . LYS G 3 314 ? 21.678  -45.862  -18.205 1.00 115.01 ? 317 LYS A CB    1 
ATOM   6054  C CG    . LYS G 3 314 ? 22.976  -45.428  -17.546 1.00 115.34 ? 317 LYS A CG    1 
ATOM   6055  C CD    . LYS G 3 314 ? 23.352  -46.373  -16.419 1.00 119.28 ? 317 LYS A CD    1 
ATOM   6056  C CE    . LYS G 3 314 ? 24.476  -45.831  -15.555 1.00 123.81 ? 317 LYS A CE    1 
ATOM   6057  N NZ    . LYS G 3 314 ? 25.821  -46.262  -16.025 1.00 126.53 ? 317 LYS A NZ    1 
ATOM   6058  N N     . ASP G 3 315 ? 20.147  -48.896  -18.953 1.00 110.54 ? 318 ASP A N     1 
ATOM   6059  C CA    . ASP G 3 315 ? 18.810  -49.477  -19.066 1.00 117.81 ? 318 ASP A CA    1 
ATOM   6060  C C     . ASP G 3 315 ? 17.871  -48.798  -18.075 1.00 114.29 ? 318 ASP A C     1 
ATOM   6061  O O     . ASP G 3 315 ? 18.309  -48.344  -17.021 1.00 115.59 ? 318 ASP A O     1 
ATOM   6062  C CB    . ASP G 3 315 ? 18.848  -50.985  -18.792 1.00 124.34 ? 318 ASP A CB    1 
ATOM   6063  C CG    . ASP G 3 315 ? 19.558  -51.332  -17.487 1.00 129.51 ? 318 ASP A CG    1 
ATOM   6064  O OD1   . ASP G 3 315 ? 20.548  -50.645  -17.139 1.00 129.37 ? 318 ASP A OD1   1 
ATOM   6065  O OD2   . ASP G 3 315 ? 19.131  -52.295  -16.815 1.00 129.95 ? 318 ASP A OD2   1 
ATOM   6066  N N     . ASP G 3 316 ? 16.584  -48.749  -18.403 1.00 112.08 ? 319 ASP A N     1 
ATOM   6067  C CA    . ASP G 3 316 ? 15.586  -48.067  -17.560 1.00 115.95 ? 319 ASP A CA    1 
ATOM   6068  C C     . ASP G 3 316 ? 15.504  -48.577  -16.115 1.00 118.28 ? 319 ASP A C     1 
ATOM   6069  O O     . ASP G 3 316 ? 15.064  -47.845  -15.231 1.00 119.79 ? 319 ASP A O     1 
ATOM   6070  C CB    . ASP G 3 316 ? 14.190  -48.161  -18.189 1.00 115.65 ? 319 ASP A CB    1 
ATOM   6071  C CG    . ASP G 3 316 ? 14.071  -47.372  -19.476 1.00 115.05 ? 319 ASP A CG    1 
ATOM   6072  O OD1   . ASP G 3 316 ? 15.104  -46.884  -19.985 1.00 119.19 ? 319 ASP A OD1   1 
ATOM   6073  O OD2   . ASP G 3 316 ? 12.937  -47.243  -19.982 1.00 111.08 ? 319 ASP A OD2   1 
ATOM   6074  N N     . GLU G 3 317 ? 15.890  -49.831  -15.887 1.00 121.54 ? 320 GLU A N     1 
ATOM   6075  C CA    . GLU G 3 317 ? 15.961  -50.390  -14.533 1.00 126.01 ? 320 GLU A CA    1 
ATOM   6076  C C     . GLU G 3 317 ? 16.772  -49.481  -13.621 1.00 123.38 ? 320 GLU A C     1 
ATOM   6077  O O     . GLU G 3 317 ? 16.347  -49.159  -12.512 1.00 119.64 ? 320 GLU A O     1 
ATOM   6078  C CB    . GLU G 3 317 ? 16.591  -51.793  -14.547 1.00 137.32 ? 320 GLU A CB    1 
ATOM   6079  C CG    . GLU G 3 317 ? 15.602  -52.937  -14.389 1.00 140.90 ? 320 GLU A CG    1 
ATOM   6080  C CD    . GLU G 3 317 ? 15.123  -53.103  -12.956 1.00 147.46 ? 320 GLU A CD    1 
ATOM   6081  O OE1   . GLU G 3 317 ? 15.978  -53.200  -12.043 1.00 146.37 ? 320 GLU A OE1   1 
ATOM   6082  O OE2   . GLU G 3 317 ? 13.890  -53.142  -12.742 1.00 148.24 ? 320 GLU A OE2   1 
ATOM   6083  N N     . PHE G 3 318 ? 17.943  -49.077  -14.107 1.00 125.88 ? 321 PHE A N     1 
ATOM   6084  C CA    . PHE G 3 318 ? 18.852  -48.199  -13.369 1.00 121.65 ? 321 PHE A CA    1 
ATOM   6085  C C     . PHE G 3 318 ? 18.128  -46.994  -12.766 1.00 114.03 ? 321 PHE A C     1 
ATOM   6086  O O     . PHE G 3 318 ? 18.068  -46.834  -11.543 1.00 112.19 ? 321 PHE A O     1 
ATOM   6087  C CB    . PHE G 3 318 ? 19.984  -47.730  -14.294 1.00 118.39 ? 321 PHE A CB    1 
ATOM   6088  C CG    . PHE G 3 318 ? 21.001  -46.864  -13.617 1.00 114.41 ? 321 PHE A CG    1 
ATOM   6089  C CD1   . PHE G 3 318 ? 20.830  -45.493  -13.555 1.00 112.01 ? 321 PHE A CD1   1 
ATOM   6090  C CD2   . PHE G 3 318 ? 22.133  -47.421  -13.050 1.00 113.63 ? 321 PHE A CD2   1 
ATOM   6091  C CE1   . PHE G 3 318 ? 21.766  -44.694  -12.933 1.00 112.22 ? 321 PHE A CE1   1 
ATOM   6092  C CE2   . PHE G 3 318 ? 23.074  -46.627  -12.426 1.00 114.75 ? 321 PHE A CE2   1 
ATOM   6093  C CZ    . PHE G 3 318 ? 22.892  -45.260  -12.370 1.00 114.25 ? 321 PHE A CZ    1 
ATOM   6094  N N     . TYR G 3 319 ? 17.562  -46.162  -13.630 1.00 104.95 ? 322 TYR A N     1 
ATOM   6095  C CA    . TYR G 3 319 ? 16.892  -44.951  -13.185 1.00 102.71 ? 322 TYR A CA    1 
ATOM   6096  C C     . TYR G 3 319 ? 15.792  -45.259  -12.167 1.00 102.98 ? 322 TYR A C     1 
ATOM   6097  O O     . TYR G 3 319 ? 15.602  -44.517  -11.206 1.00 111.62 ? 322 TYR A O     1 
ATOM   6098  C CB    . TYR G 3 319 ? 16.324  -44.187  -14.377 1.00 98.44  ? 322 TYR A CB    1 
ATOM   6099  C CG    . TYR G 3 319 ? 17.382  -43.736  -15.359 1.00 101.74 ? 322 TYR A CG    1 
ATOM   6100  C CD1   . TYR G 3 319 ? 18.306  -42.756  -15.017 1.00 102.30 ? 322 TYR A CD1   1 
ATOM   6101  C CD2   . TYR G 3 319 ? 17.454  -44.284  -16.634 1.00 107.15 ? 322 TYR A CD2   1 
ATOM   6102  C CE1   . TYR G 3 319 ? 19.274  -42.338  -15.918 1.00 102.32 ? 322 TYR A CE1   1 
ATOM   6103  C CE2   . TYR G 3 319 ? 18.415  -43.871  -17.541 1.00 106.12 ? 322 TYR A CE2   1 
ATOM   6104  C CZ    . TYR G 3 319 ? 19.322  -42.899  -17.179 1.00 104.70 ? 322 TYR A CZ    1 
ATOM   6105  O OH    . TYR G 3 319 ? 20.274  -42.491  -18.085 1.00 107.12 ? 322 TYR A OH    1 
ATOM   6106  N N     . TRP G 3 320 ? 15.088  -46.366  -12.364 1.00 97.45  ? 323 TRP A N     1 
ATOM   6107  C CA    . TRP G 3 320 ? 14.028  -46.761  -11.456 1.00 92.39  ? 323 TRP A CA    1 
ATOM   6108  C C     . TRP G 3 320 ? 14.583  -47.077  -10.065 1.00 92.87  ? 323 TRP A C     1 
ATOM   6109  O O     . TRP G 3 320 ? 14.036  -46.623  -9.062  1.00 93.99  ? 323 TRP A O     1 
ATOM   6110  C CB    . TRP G 3 320 ? 13.271  -47.963  -12.024 1.00 92.63  ? 323 TRP A CB    1 
ATOM   6111  C CG    . TRP G 3 320 ? 12.024  -48.304  -11.279 1.00 92.34  ? 323 TRP A CG    1 
ATOM   6112  C CD1   . TRP G 3 320 ? 10.767  -47.846  -11.535 1.00 91.40  ? 323 TRP A CD1   1 
ATOM   6113  C CD2   . TRP G 3 320 ? 11.910  -49.192  -10.158 1.00 91.60  ? 323 TRP A CD2   1 
ATOM   6114  N NE1   . TRP G 3 320 ? 9.875   -48.383  -10.636 1.00 92.31  ? 323 TRP A NE1   1 
ATOM   6115  C CE2   . TRP G 3 320 ? 10.550  -49.212  -9.779  1.00 92.53  ? 323 TRP A CE2   1 
ATOM   6116  C CE3   . TRP G 3 320 ? 12.825  -49.967  -9.436  1.00 93.81  ? 323 TRP A CE3   1 
ATOM   6117  C CZ2   . TRP G 3 320 ? 10.081  -49.979  -8.707  1.00 96.80  ? 323 TRP A CZ2   1 
ATOM   6118  C CZ3   . TRP G 3 320 ? 12.360  -50.730  -8.366  1.00 100.23 ? 323 TRP A CZ3   1 
ATOM   6119  C CH2   . TRP G 3 320 ? 10.998  -50.731  -8.015  1.00 101.46 ? 323 TRP A CH2   1 
ATOM   6120  N N     . ARG G 3 321 ? 15.672  -47.837  -10.002 1.00 94.29  ? 324 ARG A N     1 
ATOM   6121  C CA    . ARG G 3 321 ? 16.215  -48.285  -8.711  1.00 98.84  ? 324 ARG A CA    1 
ATOM   6122  C C     . ARG G 3 321 ? 16.713  -47.128  -7.852  1.00 97.81  ? 324 ARG A C     1 
ATOM   6123  O O     . ARG G 3 321 ? 16.541  -47.142  -6.628  1.00 93.67  ? 324 ARG A O     1 
ATOM   6124  C CB    . ARG G 3 321 ? 17.337  -49.317  -8.906  1.00 104.41 ? 324 ARG A CB    1 
ATOM   6125  C CG    . ARG G 3 321 ? 16.832  -50.728  -9.169  1.00 107.28 ? 324 ARG A CG    1 
ATOM   6126  C CD    . ARG G 3 321 ? 17.955  -51.726  -9.401  1.00 112.86 ? 324 ARG A CD    1 
ATOM   6127  N NE    . ARG G 3 321 ? 18.835  -51.360  -10.515 1.00 116.63 ? 324 ARG A NE    1 
ATOM   6128  C CZ    . ARG G 3 321 ? 19.974  -50.675  -10.405 1.00 117.85 ? 324 ARG A CZ    1 
ATOM   6129  N NH1   . ARG G 3 321 ? 20.413  -50.243  -9.223  1.00 118.88 ? 324 ARG A NH1   1 
ATOM   6130  N NH2   . ARG G 3 321 ? 20.685  -50.412  -11.495 1.00 116.91 ? 324 ARG A NH2   1 
ATOM   6131  N N     . GLY G 3 322 ? 17.334  -46.139  -8.497  1.00 99.14  ? 325 GLY A N     1 
ATOM   6132  C CA    . GLY G 3 322 ? 17.828  -44.939  -7.810  1.00 94.60  ? 325 GLY A CA    1 
ATOM   6133  C C     . GLY G 3 322 ? 16.733  -44.177  -7.078  1.00 87.54  ? 325 GLY A C     1 
ATOM   6134  O O     . GLY G 3 322 ? 16.908  -43.759  -5.931  1.00 85.34  ? 325 GLY A O     1 
ATOM   6135  N N     . ILE G 3 323 ? 15.595  -44.011  -7.741  1.00 76.91  ? 326 ILE A N     1 
ATOM   6136  C CA    . ILE G 3 323 ? 14.461  -43.340  -7.144  1.00 73.44  ? 326 ILE A CA    1 
ATOM   6137  C C     . ILE G 3 323 ? 13.848  -44.144  -6.018  1.00 79.86  ? 326 ILE A C     1 
ATOM   6138  O O     . ILE G 3 323 ? 13.501  -43.585  -4.984  1.00 90.40  ? 326 ILE A O     1 
ATOM   6139  C CB    . ILE G 3 323 ? 13.368  -43.081  -8.173  1.00 71.94  ? 326 ILE A CB    1 
ATOM   6140  C CG1   . ILE G 3 323 ? 13.893  -42.153  -9.266  1.00 74.45  ? 326 ILE A CG1   1 
ATOM   6141  C CG2   . ILE G 3 323 ? 12.130  -42.499  -7.504  1.00 71.46  ? 326 ILE A CG2   1 
ATOM   6142  C CD1   . ILE G 3 323 ? 14.391  -40.816  -8.763  1.00 75.38  ? 326 ILE A CD1   1 
ATOM   6143  N N     . HIS G 3 324 ? 13.702  -45.449  -6.220  1.00 84.72  ? 327 HIS A N     1 
ATOM   6144  C CA    . HIS G 3 324 ? 13.082  -46.311  -5.209  1.00 88.22  ? 327 HIS A CA    1 
ATOM   6145  C C     . HIS G 3 324 ? 14.067  -46.783  -4.125  1.00 86.92  ? 327 HIS A C     1 
ATOM   6146  O O     . HIS G 3 324 ? 13.708  -47.564  -3.234  1.00 77.99  ? 327 HIS A O     1 
ATOM   6147  C CB    . HIS G 3 324 ? 12.375  -47.488  -5.884  1.00 94.94  ? 327 HIS A CB    1 
ATOM   6148  C CG    . HIS G 3 324 ? 11.150  -47.088  -6.652  1.00 95.43  ? 327 HIS A CG    1 
ATOM   6149  N ND1   . HIS G 3 324 ? 9.874   -47.400  -6.231  1.00 97.96  ? 327 HIS A ND1   1 
ATOM   6150  C CD2   . HIS G 3 324 ? 11.006  -46.388  -7.804  1.00 90.68  ? 327 HIS A CD2   1 
ATOM   6151  C CE1   . HIS G 3 324 ? 8.998   -46.917  -7.093  1.00 94.68  ? 327 HIS A CE1   1 
ATOM   6152  N NE2   . HIS G 3 324 ? 9.658   -46.299  -8.056  1.00 91.84  ? 327 HIS A NE2   1 
ATOM   6153  N N     . LYS G 3 325 ? 15.305  -46.295  -4.189  1.00 90.46  ? 328 LYS A N     1 
ATOM   6154  C CA    . LYS G 3 325 ? 16.204  -46.391  -3.044  1.00 94.21  ? 328 LYS A CA    1 
ATOM   6155  C C     . LYS G 3 325 ? 15.799  -45.390  -1.947  1.00 90.26  ? 328 LYS A C     1 
ATOM   6156  O O     . LYS G 3 325 ? 16.231  -45.518  -0.803  1.00 93.43  ? 328 LYS A O     1 
ATOM   6157  C CB    . LYS G 3 325 ? 17.674  -46.191  -3.455  1.00 98.34  ? 328 LYS A CB    1 
ATOM   6158  C CG    . LYS G 3 325 ? 18.467  -47.489  -3.616  1.00 106.60 ? 328 LYS A CG    1 
ATOM   6159  C CD    . LYS G 3 325 ? 19.977  -47.266  -3.505  1.00 114.34 ? 328 LYS A CD    1 
ATOM   6160  C CE    . LYS G 3 325 ? 20.680  -47.144  -4.856  1.00 118.89 ? 328 LYS A CE    1 
ATOM   6161  N NZ    . LYS G 3 325 ? 21.675  -48.227  -5.109  1.00 120.86 ? 328 LYS A NZ    1 
ATOM   6162  N N     . LEU G 3 326 ? 14.958  -44.412  -2.279  1.00 80.56  ? 329 LEU A N     1 
ATOM   6163  C CA    . LEU G 3 326 ? 14.571  -43.398  -1.299  1.00 79.06  ? 329 LEU A CA    1 
ATOM   6164  C C     . LEU G 3 326 ? 14.075  -43.972  0.025   1.00 76.32  ? 329 LEU A C     1 
ATOM   6165  O O     . LEU G 3 326 ? 14.757  -43.846  1.034   1.00 78.17  ? 329 LEU A O     1 
ATOM   6166  C CB    . LEU G 3 326 ? 13.557  -42.402  -1.883  1.00 77.68  ? 329 LEU A CB    1 
ATOM   6167  C CG    . LEU G 3 326 ? 14.078  -41.027  -2.316  1.00 76.91  ? 329 LEU A CG    1 
ATOM   6168  C CD1   . LEU G 3 326 ? 15.518  -41.045  -2.774  1.00 76.28  ? 329 LEU A CD1   1 
ATOM   6169  C CD2   . LEU G 3 326 ? 13.214  -40.463  -3.430  1.00 80.34  ? 329 LEU A CD2   1 
ATOM   6170  N N     . PRO G 3 327 ? 12.908  -44.626  0.028   1.00 77.01  ? 330 PRO A N     1 
ATOM   6171  C CA    . PRO G 3 327 ? 12.357  -45.087  1.312   1.00 77.26  ? 330 PRO A CA    1 
ATOM   6172  C C     . PRO G 3 327 ? 13.372  -45.814  2.202   1.00 75.58  ? 330 PRO A C     1 
ATOM   6173  O O     . PRO G 3 327 ? 13.334  -45.698  3.426   1.00 70.01  ? 330 PRO A O     1 
ATOM   6174  C CB    . PRO G 3 327 ? 11.231  -46.033  0.889   1.00 78.92  ? 330 PRO A CB    1 
ATOM   6175  C CG    . PRO G 3 327 ? 10.824  -45.557  -0.468  1.00 78.79  ? 330 PRO A CG    1 
ATOM   6176  C CD    . PRO G 3 327 ? 12.070  -45.028  -1.117  1.00 78.18  ? 330 PRO A CD    1 
ATOM   6177  N N     . GLU G 3 328 ? 14.272  -46.560  1.582   1.00 80.10  ? 331 GLU A N     1 
ATOM   6178  C CA    . GLU G 3 328 ? 15.346  -47.223  2.309   1.00 86.43  ? 331 GLU A CA    1 
ATOM   6179  C C     . GLU G 3 328 ? 16.210  -46.179  3.014   1.00 82.58  ? 331 GLU A C     1 
ATOM   6180  O O     . GLU G 3 328 ? 16.434  -46.253  4.227   1.00 81.15  ? 331 GLU A O     1 
ATOM   6181  C CB    . GLU G 3 328 ? 16.168  -48.069  1.324   1.00 92.20  ? 331 GLU A CB    1 
ATOM   6182  C CG    . GLU G 3 328 ? 17.500  -48.611  1.819   1.00 98.03  ? 331 GLU A CG    1 
ATOM   6183  C CD    . GLU G 3 328 ? 18.407  -49.048  0.676   1.00 105.37 ? 331 GLU A CD    1 
ATOM   6184  O OE1   . GLU G 3 328 ? 17.929  -49.155  -0.484  1.00 106.04 ? 331 GLU A OE1   1 
ATOM   6185  O OE2   . GLU G 3 328 ? 19.608  -49.275  0.943   1.00 109.71 ? 331 GLU A OE2   1 
ATOM   6186  N N     . ARG G 3 329 ? 16.666  -45.192  2.247   1.00 79.04  ? 332 ARG A N     1 
ATOM   6187  C CA    . ARG G 3 329 ? 17.593  -44.179  2.758   1.00 76.53  ? 332 ARG A CA    1 
ATOM   6188  C C     . ARG G 3 329 ? 16.948  -43.311  3.843   1.00 73.32  ? 332 ARG A C     1 
ATOM   6189  O O     . ARG G 3 329 ? 17.567  -43.028  4.870   1.00 72.48  ? 332 ARG A O     1 
ATOM   6190  C CB    . ARG G 3 329 ? 18.118  -43.316  1.611   1.00 75.15  ? 332 ARG A CB    1 
ATOM   6191  C CG    . ARG G 3 329 ? 18.738  -44.133  0.490   1.00 76.98  ? 332 ARG A CG    1 
ATOM   6192  C CD    . ARG G 3 329 ? 19.637  -43.305  -0.398  1.00 77.04  ? 332 ARG A CD    1 
ATOM   6193  N NE    . ARG G 3 329 ? 20.950  -43.113  0.209   1.00 77.58  ? 332 ARG A NE    1 
ATOM   6194  C CZ    . ARG G 3 329 ? 22.100  -43.549  -0.297  1.00 84.83  ? 332 ARG A CZ    1 
ATOM   6195  N NH1   . ARG G 3 329 ? 22.140  -44.214  -1.441  1.00 91.40  ? 332 ARG A NH1   1 
ATOM   6196  N NH2   . ARG G 3 329 ? 23.235  -43.312  0.346   1.00 90.85  ? 332 ARG A NH2   1 
ATOM   6197  N N     . TRP G 3 330 ? 15.701  -42.908  3.622   1.00 68.56  ? 333 TRP A N     1 
ATOM   6198  C CA    . TRP G 3 330 ? 14.953  -42.207  4.645   1.00 67.54  ? 333 TRP A CA    1 
ATOM   6199  C C     . TRP G 3 330 ? 14.939  -43.042  5.922   1.00 74.77  ? 333 TRP A C     1 
ATOM   6200  O O     . TRP G 3 330 ? 15.334  -42.562  6.984   1.00 76.08  ? 333 TRP A O     1 
ATOM   6201  C CB    . TRP G 3 330 ? 13.525  -41.915  4.181   1.00 66.69  ? 333 TRP A CB    1 
ATOM   6202  C CG    . TRP G 3 330 ? 13.442  -41.021  2.982   1.00 68.78  ? 333 TRP A CG    1 
ATOM   6203  C CD1   . TRP G 3 330 ? 14.366  -40.103  2.582   1.00 71.76  ? 333 TRP A CD1   1 
ATOM   6204  C CD2   . TRP G 3 330 ? 12.370  -40.943  2.037   1.00 67.58  ? 333 TRP A CD2   1 
ATOM   6205  N NE1   . TRP G 3 330 ? 13.946  -39.471  1.438   1.00 72.79  ? 333 TRP A NE1   1 
ATOM   6206  C CE2   . TRP G 3 330 ? 12.721  -39.967  1.085   1.00 70.05  ? 333 TRP A CE2   1 
ATOM   6207  C CE3   . TRP G 3 330 ? 11.153  -41.607  1.897   1.00 68.96  ? 333 TRP A CE3   1 
ATOM   6208  C CZ2   . TRP G 3 330 ? 11.899  -39.642  0.009   1.00 70.10  ? 333 TRP A CZ2   1 
ATOM   6209  C CZ3   . TRP G 3 330 ? 10.332  -41.280  0.828   1.00 69.10  ? 333 TRP A CZ3   1 
ATOM   6210  C CH2   . TRP G 3 330 ? 10.711  -40.312  -0.103  1.00 69.68  ? 333 TRP A CH2   1 
ATOM   6211  N N     . GLU G 3 331 ? 14.531  -44.305  5.808   1.00 81.61  ? 334 GLU A N     1 
ATOM   6212  C CA    . GLU G 3 331 ? 14.337  -45.159  6.982   1.00 82.76  ? 334 GLU A CA    1 
ATOM   6213  C C     . GLU G 3 331 ? 15.631  -45.309  7.773   1.00 81.23  ? 334 GLU A C     1 
ATOM   6214  O O     . GLU G 3 331 ? 15.595  -45.413  8.999   1.00 80.10  ? 334 GLU A O     1 
ATOM   6215  C CB    . GLU G 3 331 ? 13.786  -46.531  6.574   1.00 92.23  ? 334 GLU A CB    1 
ATOM   6216  C CG    . GLU G 3 331 ? 12.461  -46.906  7.236   1.00 100.52 ? 334 GLU A CG    1 
ATOM   6217  C CD    . GLU G 3 331 ? 11.522  -47.691  6.320   1.00 108.41 ? 334 GLU A CD    1 
ATOM   6218  O OE1   . GLU G 3 331 ? 10.694  -48.467  6.843   1.00 118.78 ? 334 GLU A OE1   1 
ATOM   6219  O OE2   . GLU G 3 331 ? 11.598  -47.539  5.081   1.00 111.34 ? 334 GLU A OE2   1 
ATOM   6220  N N     . LYS G 3 332 ? 16.764  -45.310  7.072   1.00 81.79  ? 335 LYS A N     1 
ATOM   6221  C CA    . LYS G 3 332 ? 18.074  -45.330  7.717   1.00 89.13  ? 335 LYS A CA    1 
ATOM   6222  C C     . LYS G 3 332 ? 18.384  -43.971  8.327   1.00 92.98  ? 335 LYS A C     1 
ATOM   6223  O O     . LYS G 3 332 ? 18.830  -43.894  9.475   1.00 93.17  ? 335 LYS A O     1 
ATOM   6224  C CB    . LYS G 3 332 ? 19.167  -45.699  6.713   1.00 96.35  ? 335 LYS A CB    1 
ATOM   6225  C CG    . LYS G 3 332 ? 19.123  -47.141  6.235   1.00 100.75 ? 335 LYS A CG    1 
ATOM   6226  C CD    . LYS G 3 332 ? 20.186  -47.395  5.178   1.00 105.89 ? 335 LYS A CD    1 
ATOM   6227  C CE    . LYS G 3 332 ? 20.083  -48.796  4.597   1.00 105.17 ? 335 LYS A CE    1 
ATOM   6228  N NZ    . LYS G 3 332 ? 21.017  -48.994  3.455   1.00 103.93 ? 335 LYS A NZ    1 
ATOM   6229  N N     . CYS G 3 333 ? 18.164  -42.916  7.533   1.00 93.69  ? 336 CYS A N     1 
ATOM   6230  C CA    . CYS G 3 333 ? 18.289  -41.516  7.973   1.00 93.10  ? 336 CYS A CA    1 
ATOM   6231  C C     . CYS G 3 333 ? 17.652  -41.361  9.345   1.00 82.77  ? 336 CYS A C     1 
ATOM   6232  O O     . CYS G 3 333 ? 18.346  -41.084  10.319  1.00 79.74  ? 336 CYS A O     1 
ATOM   6233  C CB    . CYS G 3 333 ? 17.677  -40.554  6.912   1.00 101.57 ? 336 CYS A CB    1 
ATOM   6234  S SG    . CYS G 3 333 ? 16.968  -38.952  7.415   1.00 112.89 ? 336 CYS A SG    1 
ATOM   6235  N N     . VAL G 3 334 ? 16.347  -41.603  9.425   1.00 76.55  ? 337 VAL A N     1 
ATOM   6236  C CA    . VAL G 3 334 ? 15.612  -41.462  10.689  1.00 78.78  ? 337 VAL A CA    1 
ATOM   6237  C C     . VAL G 3 334 ? 16.120  -42.385  11.797  1.00 80.95  ? 337 VAL A C     1 
ATOM   6238  O O     . VAL G 3 334 ? 16.067  -42.028  12.972  1.00 82.99  ? 337 VAL A O     1 
ATOM   6239  C CB    . VAL G 3 334 ? 14.080  -41.638  10.510  1.00 77.38  ? 337 VAL A CB    1 
ATOM   6240  C CG1   . VAL G 3 334 ? 13.753  -42.916  9.769   1.00 86.34  ? 337 VAL A CG1   1 
ATOM   6241  C CG2   . VAL G 3 334 ? 13.368  -41.633  11.855  1.00 75.17  ? 337 VAL A CG2   1 
ATOM   6242  N N     . ALA G 3 335 ? 16.605  -43.566  11.426  1.00 86.86  ? 338 ALA A N     1 
ATOM   6243  C CA    . ALA G 3 335 ? 17.101  -44.531  12.406  1.00 87.71  ? 338 ALA A CA    1 
ATOM   6244  C C     . ALA G 3 335 ? 18.420  -44.083  13.033  1.00 85.71  ? 338 ALA A C     1 
ATOM   6245  O O     . ALA G 3 335 ? 18.663  -44.321  14.214  1.00 82.40  ? 338 ALA A O     1 
ATOM   6246  C CB    . ALA G 3 335 ? 17.263  -45.893  11.761  1.00 90.36  ? 338 ALA A CB    1 
ATOM   6247  N N     . SER G 3 336 ? 19.261  -43.426  12.239  1.00 88.94  ? 339 SER A N     1 
ATOM   6248  C CA    . SER G 3 336 ? 20.553  -42.924  12.709  1.00 91.20  ? 339 SER A CA    1 
ATOM   6249  C C     . SER G 3 336 ? 20.442  -41.551  13.385  1.00 92.53  ? 339 SER A C     1 
ATOM   6250  O O     . SER G 3 336 ? 21.452  -40.893  13.613  1.00 100.70 ? 339 SER A O     1 
ATOM   6251  C CB    . SER G 3 336 ? 21.528  -42.850  11.534  1.00 92.05  ? 339 SER A CB    1 
ATOM   6252  O OG    . SER G 3 336 ? 20.901  -42.253  10.414  1.00 93.02  ? 339 SER A OG    1 
ATOM   6253  N N     . ASP G 3 337 ? 19.217  -41.135  13.711  1.00 93.32  ? 340 ASP A N     1 
ATOM   6254  C CA    . ASP G 3 337 ? 18.933  -39.863  14.395  1.00 89.26  ? 340 ASP A CA    1 
ATOM   6255  C C     . ASP G 3 337 ? 19.304  -38.619  13.587  1.00 80.96  ? 340 ASP A C     1 
ATOM   6256  O O     . ASP G 3 337 ? 19.538  -37.552  14.144  1.00 82.49  ? 340 ASP A O     1 
ATOM   6257  C CB    . ASP G 3 337 ? 19.566  -39.828  15.800  1.00 93.46  ? 340 ASP A CB    1 
ATOM   6258  C CG    . ASP G 3 337 ? 18.569  -40.147  16.896  1.00 102.21 ? 340 ASP A CG    1 
ATOM   6259  O OD1   . ASP G 3 337 ? 17.352  -39.974  16.667  1.00 106.97 ? 340 ASP A OD1   1 
ATOM   6260  O OD2   . ASP G 3 337 ? 19.003  -40.563  17.993  1.00 113.46 ? 340 ASP A OD2   1 
ATOM   6261  N N     . GLY G 3 338 ? 19.315  -38.756  12.269  1.00 75.94  ? 341 GLY A N     1 
ATOM   6262  C CA    . GLY G 3 338 ? 19.658  -37.657  11.387  1.00 74.33  ? 341 GLY A CA    1 
ATOM   6263  C C     . GLY G 3 338 ? 21.130  -37.634  11.032  1.00 73.95  ? 341 GLY A C     1 
ATOM   6264  O O     . GLY G 3 338 ? 21.529  -36.910  10.112  1.00 70.73  ? 341 GLY A O     1 
ATOM   6265  N N     . LYS G 3 339 ? 21.945  -38.408  11.752  1.00 72.54  ? 342 LYS A N     1 
ATOM   6266  C CA    . LYS G 3 339 ? 23.356  -38.532  11.407  1.00 76.21  ? 342 LYS A CA    1 
ATOM   6267  C C     . LYS G 3 339 ? 23.441  -39.091  10.009  1.00 73.18  ? 342 LYS A C     1 
ATOM   6268  O O     . LYS G 3 339 ? 22.459  -39.573  9.470   1.00 71.28  ? 342 LYS A O     1 
ATOM   6269  C CB    . LYS G 3 339 ? 24.098  -39.468  12.359  1.00 80.27  ? 342 LYS A CB    1 
ATOM   6270  C CG    . LYS G 3 339 ? 24.234  -38.973  13.789  1.00 86.65  ? 342 LYS A CG    1 
ATOM   6271  C CD    . LYS G 3 339 ? 24.922  -40.024  14.656  1.00 94.40  ? 342 LYS A CD    1 
ATOM   6272  C CE    . LYS G 3 339 ? 25.461  -39.440  15.953  1.00 102.97 ? 342 LYS A CE    1 
ATOM   6273  N NZ    . LYS G 3 339 ? 24.380  -38.912  16.833  1.00 108.07 ? 342 LYS A NZ    1 
ATOM   6274  N N     . TYR G 3 340 ? 24.613  -39.016  9.410   1.00 78.20  ? 343 TYR A N     1 
ATOM   6275  C CA    . TYR G 3 340 ? 24.821  -39.674  8.136   1.00 85.84  ? 343 TYR A CA    1 
ATOM   6276  C C     . TYR G 3 340 ? 24.905  -41.180  8.374   1.00 91.65  ? 343 TYR A C     1 
ATOM   6277  O O     . TYR G 3 340 ? 25.300  -41.617  9.457   1.00 91.26  ? 343 TYR A O     1 
ATOM   6278  C CB    . TYR G 3 340 ? 26.110  -39.182  7.502   1.00 86.85  ? 343 TYR A CB    1 
ATOM   6279  C CG    . TYR G 3 340 ? 26.066  -37.749  7.050   1.00 87.79  ? 343 TYR A CG    1 
ATOM   6280  C CD1   . TYR G 3 340 ? 25.416  -37.396  5.878   1.00 90.79  ? 343 TYR A CD1   1 
ATOM   6281  C CD2   . TYR G 3 340 ? 26.689  -36.741  7.782   1.00 90.52  ? 343 TYR A CD2   1 
ATOM   6282  C CE1   . TYR G 3 340 ? 25.377  -36.082  5.450   1.00 92.09  ? 343 TYR A CE1   1 
ATOM   6283  C CE2   . TYR G 3 340 ? 26.661  -35.423  7.352   1.00 86.97  ? 343 TYR A CE2   1 
ATOM   6284  C CZ    . TYR G 3 340 ? 26.003  -35.103  6.189   1.00 86.89  ? 343 TYR A CZ    1 
ATOM   6285  O OH    . TYR G 3 340 ? 25.964  -33.811  5.745   1.00 87.67  ? 343 TYR A OH    1 
ATOM   6286  N N     . PHE G 3 341 ? 24.537  -41.968  7.367   1.00 96.77  ? 344 PHE A N     1 
ATOM   6287  C CA    . PHE G 3 341 ? 24.628  -43.429  7.456   1.00 99.68  ? 344 PHE A CA    1 
ATOM   6288  C C     . PHE G 3 341 ? 25.651  -43.962  6.448   1.00 109.60 ? 344 PHE A C     1 
ATOM   6289  O O     . PHE G 3 341 ? 25.429  -43.935  5.241   1.00 102.54 ? 344 PHE A O     1 
ATOM   6290  C CB    . PHE G 3 341 ? 23.254  -44.089  7.268   1.00 96.43  ? 344 PHE A CB    1 
ATOM   6291  C CG    . PHE G 3 341 ? 22.432  -43.483  6.168   1.00 93.14  ? 344 PHE A CG    1 
ATOM   6292  C CD1   . PHE G 3 341 ? 22.656  -43.826  4.840   1.00 93.14  ? 344 PHE A CD1   1 
ATOM   6293  C CD2   . PHE G 3 341 ? 21.436  -42.568  6.457   1.00 89.01  ? 344 PHE A CD2   1 
ATOM   6294  C CE1   . PHE G 3 341 ? 21.909  -43.262  3.821   1.00 90.98  ? 344 PHE A CE1   1 
ATOM   6295  C CE2   . PHE G 3 341 ? 20.683  -42.006  5.443   1.00 89.13  ? 344 PHE A CE2   1 
ATOM   6296  C CZ    . PHE G 3 341 ? 20.919  -42.350  4.123   1.00 89.86  ? 344 PHE A CZ    1 
ATOM   6297  N N     . GLU G 3 342 ? 26.777  -44.450  6.964   1.00 132.74 ? 345 GLU A N     1 
ATOM   6298  C CA    . GLU G 3 342 ? 27.914  -44.863  6.134   1.00 149.19 ? 345 GLU A CA    1 
ATOM   6299  C C     . GLU G 3 342 ? 28.172  -43.859  5.008   1.00 151.71 ? 345 GLU A C     1 
ATOM   6300  O O     . GLU G 3 342 ? 28.640  -42.744  5.248   1.00 145.29 ? 345 GLU A O     1 
ATOM   6301  C CB    . GLU G 3 342 ? 27.703  -46.264  5.540   1.00 152.93 ? 345 GLU A CB    1 
ATOM   6302  C CG    . GLU G 3 342 ? 27.066  -47.277  6.484   1.00 155.57 ? 345 GLU A CG    1 
ATOM   6303  C CD    . GLU G 3 342 ? 25.548  -47.269  6.426   1.00 157.81 ? 345 GLU A CD    1 
ATOM   6304  O OE1   . GLU G 3 342 ? 24.991  -47.144  5.313   1.00 154.45 ? 345 GLU A OE1   1 
ATOM   6305  O OE2   . GLU G 3 342 ? 24.912  -47.392  7.495   1.00 157.73 ? 345 GLU A OE2   1 
ATOM   6306  N N     . PHE H 3 1   ? 47.568  -98.818  17.139  1.00 157.44 ? 4   PHE B N     1 
ATOM   6307  C CA    . PHE H 3 1   ? 47.756  -97.487  17.793  1.00 157.56 ? 4   PHE B CA    1 
ATOM   6308  C C     . PHE H 3 1   ? 48.589  -96.513  16.958  1.00 153.41 ? 4   PHE B C     1 
ATOM   6309  O O     . PHE H 3 1   ? 48.082  -95.477  16.534  1.00 161.75 ? 4   PHE B O     1 
ATOM   6310  C CB    . PHE H 3 1   ? 48.395  -97.641  19.180  1.00 160.35 ? 4   PHE B CB    1 
ATOM   6311  C CG    . PHE H 3 1   ? 47.417  -97.993  20.267  1.00 164.67 ? 4   PHE B CG    1 
ATOM   6312  C CD1   . PHE H 3 1   ? 46.530  -97.037  20.754  1.00 161.22 ? 4   PHE B CD1   1 
ATOM   6313  C CD2   . PHE H 3 1   ? 47.390  -99.271  20.817  1.00 163.76 ? 4   PHE B CD2   1 
ATOM   6314  C CE1   . PHE H 3 1   ? 45.629  -97.351  21.759  1.00 159.67 ? 4   PHE B CE1   1 
ATOM   6315  C CE2   . PHE H 3 1   ? 46.492  -99.590  21.824  1.00 161.97 ? 4   PHE B CE2   1 
ATOM   6316  C CZ    . PHE H 3 1   ? 45.611  -98.629  22.295  1.00 161.06 ? 4   PHE B CZ    1 
ATOM   6317  N N     . VAL H 3 2   ? 49.854  -96.852  16.709  1.00 146.27 ? 5   VAL B N     1 
ATOM   6318  C CA    . VAL H 3 2   ? 50.846  -95.857  16.269  1.00 146.24 ? 5   VAL B CA    1 
ATOM   6319  C C     . VAL H 3 2   ? 51.518  -96.122  14.910  1.00 145.97 ? 5   VAL B C     1 
ATOM   6320  O O     . VAL H 3 2   ? 52.743  -96.235  14.830  1.00 142.38 ? 5   VAL B O     1 
ATOM   6321  C CB    . VAL H 3 2   ? 51.956  -95.708  17.340  1.00 142.21 ? 5   VAL B CB    1 
ATOM   6322  C CG1   . VAL H 3 2   ? 52.691  -94.383  17.173  1.00 140.56 ? 5   VAL B CG1   1 
ATOM   6323  C CG2   . VAL H 3 2   ? 51.360  -95.820  18.735  1.00 142.93 ? 5   VAL B CG2   1 
ATOM   6324  N N     . PRO H 3 3   ? 50.725  -96.210  13.829  1.00 144.28 ? 6   PRO B N     1 
ATOM   6325  C CA    . PRO H 3 3   ? 51.360  -96.230  12.514  1.00 137.78 ? 6   PRO B CA    1 
ATOM   6326  C C     . PRO H 3 3   ? 51.582  -94.808  12.021  1.00 128.83 ? 6   PRO B C     1 
ATOM   6327  O O     . PRO H 3 3   ? 51.005  -93.884  12.580  1.00 135.17 ? 6   PRO B O     1 
ATOM   6328  C CB    . PRO H 3 3   ? 50.323  -96.944  11.646  1.00 143.82 ? 6   PRO B CB    1 
ATOM   6329  C CG    . PRO H 3 3   ? 49.010  -96.605  12.272  1.00 144.94 ? 6   PRO B CG    1 
ATOM   6330  C CD    . PRO H 3 3   ? 49.259  -96.358  13.738  1.00 143.52 ? 6   PRO B CD    1 
ATOM   6331  N N     . ASN H 3 4   ? 52.428  -94.637  11.009  1.00 125.63 ? 7   ASN B N     1 
ATOM   6332  C CA    . ASN H 3 4   ? 52.525  -93.374  10.254  1.00 128.38 ? 7   ASN B CA    1 
ATOM   6333  C C     . ASN H 3 4   ? 53.608  -93.417  9.182   1.00 124.47 ? 7   ASN B C     1 
ATOM   6334  O O     . ASN H 3 4   ? 54.763  -93.708  9.475   1.00 118.77 ? 7   ASN B O     1 
ATOM   6335  C CB    . ASN H 3 4   ? 52.809  -92.177  11.160  1.00 134.12 ? 7   ASN B CB    1 
ATOM   6336  C CG    . ASN H 3 4   ? 52.917  -90.874  10.388  1.00 139.25 ? 7   ASN B CG    1 
ATOM   6337  O OD1   . ASN H 3 4   ? 52.348  -90.724  9.305   1.00 144.38 ? 7   ASN B OD1   1 
ATOM   6338  N ND2   . ASN H 3 4   ? 53.647  -89.920  10.947  1.00 140.12 ? 7   ASN B ND2   1 
ATOM   6339  N N     . LYS H 3 5   ? 53.237  -93.054  7.958   1.00 125.42 ? 8   LYS B N     1 
ATOM   6340  C CA    . LYS H 3 5   ? 54.111  -93.210  6.783   1.00 130.22 ? 8   LYS B CA    1 
ATOM   6341  C C     . LYS H 3 5   ? 55.538  -92.723  7.061   1.00 126.98 ? 8   LYS B C     1 
ATOM   6342  O O     . LYS H 3 5   ? 56.509  -93.349  6.636   1.00 123.45 ? 8   LYS B O     1 
ATOM   6343  C CB    . LYS H 3 5   ? 53.548  -92.490  5.537   1.00 135.94 ? 8   LYS B CB    1 
ATOM   6344  C CG    . LYS H 3 5   ? 52.046  -92.185  5.527   1.00 142.29 ? 8   LYS B CG    1 
ATOM   6345  C CD    . LYS H 3 5   ? 51.162  -93.408  5.773   1.00 143.65 ? 8   LYS B CD    1 
ATOM   6346  C CE    . LYS H 3 5   ? 50.229  -93.709  4.609   1.00 142.66 ? 8   LYS B CE    1 
ATOM   6347  N NZ    . LYS H 3 5   ? 49.049  -92.800  4.622   1.00 144.27 ? 8   LYS B NZ    1 
ATOM   6348  N N     . GLU H 3 6   ? 55.653  -91.611  7.784   1.00 129.19 ? 9   GLU B N     1 
ATOM   6349  C CA    . GLU H 3 6   ? 56.960  -91.050  8.150   1.00 130.55 ? 9   GLU B CA    1 
ATOM   6350  C C     . GLU H 3 6   ? 57.641  -91.843  9.254   1.00 119.62 ? 9   GLU B C     1 
ATOM   6351  O O     . GLU H 3 6   ? 58.839  -92.106  9.192   1.00 112.81 ? 9   GLU B O     1 
ATOM   6352  C CB    . GLU H 3 6   ? 56.830  -89.587  8.596   1.00 137.85 ? 9   GLU B CB    1 
ATOM   6353  C CG    . GLU H 3 6   ? 57.490  -88.595  7.650   1.00 141.56 ? 9   GLU B CG    1 
ATOM   6354  C CD    . GLU H 3 6   ? 57.593  -87.200  8.238   1.00 145.28 ? 9   GLU B CD    1 
ATOM   6355  O OE1   . GLU H 3 6   ? 57.316  -86.230  7.504   1.00 148.15 ? 9   GLU B OE1   1 
ATOM   6356  O OE2   . GLU H 3 6   ? 57.948  -87.069  9.431   1.00 140.32 ? 9   GLU B OE2   1 
ATOM   6357  N N     . GLN H 3 7   ? 56.875  -92.204  10.274  1.00 113.75 ? 10  GLN B N     1 
ATOM   6358  C CA    . GLN H 3 7   ? 57.407  -92.984  11.385  1.00 108.87 ? 10  GLN B CA    1 
ATOM   6359  C C     . GLN H 3 7   ? 57.847  -94.371  10.911  1.00 111.21 ? 10  GLN B C     1 
ATOM   6360  O O     . GLN H 3 7   ? 58.899  -94.863  11.318  1.00 112.72 ? 10  GLN B O     1 
ATOM   6361  C CB    . GLN H 3 7   ? 56.362  -93.109  12.496  1.00 102.89 ? 10  GLN B CB    1 
ATOM   6362  C CG    . GLN H 3 7   ? 55.959  -91.781  13.112  1.00 97.47  ? 10  GLN B CG    1 
ATOM   6363  C CD    . GLN H 3 7   ? 54.913  -91.930  14.197  1.00 96.77  ? 10  GLN B CD    1 
ATOM   6364  O OE1   . GLN H 3 7   ? 53.756  -92.267  13.928  1.00 98.83  ? 10  GLN B OE1   1 
ATOM   6365  N NE2   . GLN H 3 7   ? 55.311  -91.669  15.434  1.00 93.02  ? 10  GLN B NE2   1 
ATOM   6366  N N     . THR H 3 8   ? 57.038  -94.987  10.046  1.00 110.82 ? 11  THR B N     1 
ATOM   6367  C CA    . THR H 3 8   ? 57.318  -96.322  9.514   1.00 108.30 ? 11  THR B CA    1 
ATOM   6368  C C     . THR H 3 8   ? 58.698  -96.370  8.870   1.00 109.99 ? 11  THR B C     1 
ATOM   6369  O O     . THR H 3 8   ? 59.498  -97.256  9.169   1.00 112.07 ? 11  THR B O     1 
ATOM   6370  C CB    . THR H 3 8   ? 56.257  -96.746  8.476   1.00 107.93 ? 11  THR B CB    1 
ATOM   6371  O OG1   . THR H 3 8   ? 54.969  -96.786  9.097   1.00 105.62 ? 11  THR B OG1   1 
ATOM   6372  C CG2   . THR H 3 8   ? 56.565  -98.122  7.894   1.00 109.34 ? 11  THR B CG2   1 
ATOM   6373  N N     . ARG H 3 9   ? 58.972  -95.402  8.002   1.00 107.59 ? 12  ARG B N     1 
ATOM   6374  C CA    . ARG H 3 9   ? 60.244  -95.348  7.286   1.00 108.81 ? 12  ARG B CA    1 
ATOM   6375  C C     . ARG H 3 9   ? 61.419  -95.098  8.228   1.00 107.46 ? 12  ARG B C     1 
ATOM   6376  O O     . ARG H 3 9   ? 62.543  -95.493  7.934   1.00 111.77 ? 12  ARG B O     1 
ATOM   6377  C CB    . ARG H 3 9   ? 60.204  -94.264  6.214   1.00 111.27 ? 12  ARG B CB    1 
ATOM   6378  C CG    . ARG H 3 9   ? 59.157  -94.506  5.144   1.00 115.35 ? 12  ARG B CG    1 
ATOM   6379  C CD    . ARG H 3 9   ? 58.722  -93.207  4.493   1.00 122.42 ? 12  ARG B CD    1 
ATOM   6380  N NE    . ARG H 3 9   ? 57.441  -93.347  3.803   1.00 130.61 ? 12  ARG B NE    1 
ATOM   6381  C CZ    . ARG H 3 9   ? 56.932  -92.453  2.957   1.00 132.53 ? 12  ARG B CZ    1 
ATOM   6382  N NH1   . ARG H 3 9   ? 57.596  -91.339  2.659   1.00 126.18 ? 12  ARG B NH1   1 
ATOM   6383  N NH2   . ARG H 3 9   ? 55.750  -92.684  2.394   1.00 139.98 ? 12  ARG B NH2   1 
ATOM   6384  N N     . THR H 3 10  ? 61.151  -94.432  9.349   1.00 106.20 ? 13  THR B N     1 
ATOM   6385  C CA    . THR H 3 10  ? 62.151  -94.240  10.400  1.00 103.57 ? 13  THR B CA    1 
ATOM   6386  C C     . THR H 3 10  ? 62.510  -95.583  11.034  1.00 100.27 ? 13  THR B C     1 
ATOM   6387  O O     . THR H 3 10  ? 63.681  -95.853  11.289  1.00 98.24  ? 13  THR B O     1 
ATOM   6388  C CB    . THR H 3 10  ? 61.658  -93.247  11.483  1.00 103.89 ? 13  THR B CB    1 
ATOM   6389  O OG1   . THR H 3 10  ? 61.747  -91.910  10.980  1.00 103.57 ? 13  THR B OG1   1 
ATOM   6390  C CG2   . THR H 3 10  ? 62.483  -93.343  12.762  1.00 104.72 ? 13  THR B CG2   1 
ATOM   6391  N N     . VAL H 3 11  ? 61.505  -96.419  11.284  1.00 97.43  ? 14  VAL B N     1 
ATOM   6392  C CA    . VAL H 3 11  ? 61.743  -97.751  11.838  1.00 92.40  ? 14  VAL B CA    1 
ATOM   6393  C C     . VAL H 3 11  ? 62.581  -98.581  10.863  1.00 89.20  ? 14  VAL B C     1 
ATOM   6394  O O     . VAL H 3 11  ? 63.468  -99.312  11.280  1.00 84.63  ? 14  VAL B O     1 
ATOM   6395  C CB    . VAL H 3 11  ? 60.425  -98.475  12.188  1.00 91.71  ? 14  VAL B CB    1 
ATOM   6396  C CG1   . VAL H 3 11  ? 60.684  -99.925  12.572  1.00 96.36  ? 14  VAL B CG1   1 
ATOM   6397  C CG2   . VAL H 3 11  ? 59.710  -97.755  13.323  1.00 89.03  ? 14  VAL B CG2   1 
ATOM   6398  N N     . LEU H 3 12  ? 62.312  -98.448  9.567   1.00 91.94  ? 15  LEU B N     1 
ATOM   6399  C CA    . LEU H 3 12  ? 63.100  -99.148  8.548   1.00 95.86  ? 15  LEU B CA    1 
ATOM   6400  C C     . LEU H 3 12  ? 64.576  -98.743  8.582   1.00 98.18  ? 15  LEU B C     1 
ATOM   6401  O O     . LEU H 3 12  ? 65.451  -99.562  8.306   1.00 104.57 ? 15  LEU B O     1 
ATOM   6402  C CB    . LEU H 3 12  ? 62.504  -98.938  7.147   1.00 97.32  ? 15  LEU B CB    1 
ATOM   6403  C CG    . LEU H 3 12  ? 61.490  -99.988  6.666   1.00 101.97 ? 15  LEU B CG    1 
ATOM   6404  C CD1   . LEU H 3 12  ? 60.482  -100.373 7.745   1.00 104.81 ? 15  LEU B CD1   1 
ATOM   6405  C CD2   . LEU H 3 12  ? 60.770  -99.498  5.416   1.00 101.32 ? 15  LEU B CD2   1 
ATOM   6406  N N     . ILE H 3 13  ? 64.846  -97.487  8.928   1.00 100.87 ? 16  ILE B N     1 
ATOM   6407  C CA    . ILE H 3 13  ? 66.219  -97.008  9.110   1.00 104.62 ? 16  ILE B CA    1 
ATOM   6408  C C     . ILE H 3 13  ? 66.865  -97.741  10.285  1.00 101.38 ? 16  ILE B C     1 
ATOM   6409  O O     . ILE H 3 13  ? 68.022  -98.151  10.225  1.00 100.19 ? 16  ILE B O     1 
ATOM   6410  C CB    . ILE H 3 13  ? 66.272  -95.494  9.444   1.00 110.51 ? 16  ILE B CB    1 
ATOM   6411  C CG1   . ILE H 3 13  ? 65.589  -94.640  8.364   1.00 111.42 ? 16  ILE B CG1   1 
ATOM   6412  C CG2   . ILE H 3 13  ? 67.715  -95.047  9.663   1.00 111.80 ? 16  ILE B CG2   1 
ATOM   6413  C CD1   . ILE H 3 13  ? 66.429  -94.383  7.135   1.00 113.27 ? 16  ILE B CD1   1 
ATOM   6414  N N     . PHE H 3 14  ? 66.102  -97.872  11.362  1.00 98.67  ? 17  PHE B N     1 
ATOM   6415  C CA    . PHE H 3 14  ? 66.575  -98.487  12.592  1.00 99.15  ? 17  PHE B CA    1 
ATOM   6416  C C     . PHE H 3 14  ? 66.952  -99.936  12.350  1.00 101.64 ? 17  PHE B C     1 
ATOM   6417  O O     . PHE H 3 14  ? 68.035  -100.364 12.732  1.00 109.68 ? 17  PHE B O     1 
ATOM   6418  C CB    . PHE H 3 14  ? 65.483  -98.385  13.660  1.00 100.04 ? 17  PHE B CB    1 
ATOM   6419  C CG    . PHE H 3 14  ? 65.824  -99.040  14.965  1.00 95.89  ? 17  PHE B CG    1 
ATOM   6420  C CD1   . PHE H 3 14  ? 67.041  -98.805  15.588  1.00 96.57  ? 17  PHE B CD1   1 
ATOM   6421  C CD2   . PHE H 3 14  ? 64.899  -99.861  15.595  1.00 99.29  ? 17  PHE B CD2   1 
ATOM   6422  C CE1   . PHE H 3 14  ? 67.340  -99.399  16.805  1.00 98.61  ? 17  PHE B CE1   1 
ATOM   6423  C CE2   . PHE H 3 14  ? 65.187  -100.454 16.813  1.00 102.76 ? 17  PHE B CE2   1 
ATOM   6424  C CZ    . PHE H 3 14  ? 66.411  -100.224 17.419  1.00 102.21 ? 17  PHE B CZ    1 
ATOM   6425  N N     . CYS H 3 15  ? 66.058  -100.681 11.705  1.00 103.55 ? 18  CYS B N     1 
ATOM   6426  C CA    . CYS H 3 15  ? 66.299  -102.088 11.392  1.00 101.70 ? 18  CYS B CA    1 
ATOM   6427  C C     . CYS H 3 15  ? 67.546  -102.242 10.521  1.00 106.44 ? 18  CYS B C     1 
ATOM   6428  O O     . CYS H 3 15  ? 68.440  -103.026 10.846  1.00 110.85 ? 18  CYS B O     1 
ATOM   6429  C CB    . CYS H 3 15  ? 65.081  -102.700 10.690  1.00 98.44  ? 18  CYS B CB    1 
ATOM   6430  S SG    . CYS H 3 15  ? 63.585  -102.752 11.707  1.00 92.95  ? 18  CYS B SG    1 
ATOM   6431  N N     . PHE H 3 16  ? 67.605  -101.478 9.431   1.00 106.08 ? 19  PHE B N     1 
ATOM   6432  C CA    . PHE H 3 16  ? 68.742  -101.510 8.502   1.00 110.75 ? 19  PHE B CA    1 
ATOM   6433  C C     . PHE H 3 16  ? 70.096  -101.248 9.177   1.00 113.05 ? 19  PHE B C     1 
ATOM   6434  O O     . PHE H 3 16  ? 71.108  -101.827 8.783   1.00 118.47 ? 19  PHE B O     1 
ATOM   6435  C CB    . PHE H 3 16  ? 68.520  -100.500 7.372   1.00 115.12 ? 19  PHE B CB    1 
ATOM   6436  C CG    . PHE H 3 16  ? 69.683  -100.371 6.430   1.00 117.42 ? 19  PHE B CG    1 
ATOM   6437  C CD1   . PHE H 3 16  ? 70.731  -99.510  6.709   1.00 119.42 ? 19  PHE B CD1   1 
ATOM   6438  C CD2   . PHE H 3 16  ? 69.725  -101.105 5.261   1.00 123.49 ? 19  PHE B CD2   1 
ATOM   6439  C CE1   . PHE H 3 16  ? 71.804  -99.392  5.840   1.00 123.03 ? 19  PHE B CE1   1 
ATOM   6440  C CE2   . PHE H 3 16  ? 70.793  -100.988 4.386   1.00 126.65 ? 19  PHE B CE2   1 
ATOM   6441  C CZ    . PHE H 3 16  ? 71.835  -100.130 4.674   1.00 123.11 ? 19  PHE B CZ    1 
ATOM   6442  N N     . HIS H 3 17  ? 70.119  -100.372 10.180  1.00 114.94 ? 20  HIS B N     1 
ATOM   6443  C CA    . HIS H 3 17  ? 71.347  -100.106 10.939  1.00 113.49 ? 20  HIS B CA    1 
ATOM   6444  C C     . HIS H 3 17  ? 71.698  -101.258 11.874  1.00 114.07 ? 20  HIS B C     1 
ATOM   6445  O O     . HIS H 3 17  ? 72.875  -101.531 12.098  1.00 121.29 ? 20  HIS B O     1 
ATOM   6446  C CB    . HIS H 3 17  ? 71.241  -98.797  11.725  1.00 114.20 ? 20  HIS B CB    1 
ATOM   6447  C CG    . HIS H 3 17  ? 71.599  -97.589  10.922  1.00 111.76 ? 20  HIS B CG    1 
ATOM   6448  N ND1   . HIS H 3 17  ? 70.667  -96.860  10.218  1.00 111.29 ? 20  HIS B ND1   1 
ATOM   6449  C CD2   . HIS H 3 17  ? 72.793  -96.996  10.694  1.00 110.87 ? 20  HIS B CD2   1 
ATOM   6450  C CE1   . HIS H 3 17  ? 71.270  -95.863  9.596   1.00 111.06 ? 20  HIS B CE1   1 
ATOM   6451  N NE2   . HIS H 3 17  ? 72.561  -95.923  9.868   1.00 111.84 ? 20  HIS B NE2   1 
ATOM   6452  N N     . LEU H 3 18  ? 70.682  -101.932 12.412  1.00 112.03 ? 21  LEU B N     1 
ATOM   6453  C CA    . LEU H 3 18  ? 70.886  -103.188 13.131  1.00 112.20 ? 21  LEU B CA    1 
ATOM   6454  C C     . LEU H 3 18  ? 71.282  -104.325 12.172  1.00 119.59 ? 21  LEU B C     1 
ATOM   6455  O O     . LEU H 3 18  ? 71.622  -105.423 12.611  1.00 124.00 ? 21  LEU B O     1 
ATOM   6456  C CB    . LEU H 3 18  ? 69.625  -103.576 13.913  1.00 110.26 ? 21  LEU B CB    1 
ATOM   6457  C CG    . LEU H 3 18  ? 69.145  -102.625 15.015  1.00 107.12 ? 21  LEU B CG    1 
ATOM   6458  C CD1   . LEU H 3 18  ? 67.935  -103.201 15.743  1.00 107.87 ? 21  LEU B CD1   1 
ATOM   6459  C CD2   . LEU H 3 18  ? 70.261  -102.337 16.000  1.00 105.70 ? 21  LEU B CD2   1 
ATOM   6460  N N     . LYS H 3 19  ? 71.217  -104.054 10.867  1.00 127.54 ? 22  LYS B N     1 
ATOM   6461  C CA    . LYS H 3 19  ? 71.676  -104.964 9.805   1.00 129.94 ? 22  LYS B CA    1 
ATOM   6462  C C     . LYS H 3 19  ? 70.713  -106.114 9.545   1.00 129.40 ? 22  LYS B C     1 
ATOM   6463  O O     . LYS H 3 19  ? 71.082  -107.104 8.914   1.00 132.59 ? 22  LYS B O     1 
ATOM   6464  C CB    . LYS H 3 19  ? 73.094  -105.483 10.075  1.00 129.70 ? 22  LYS B CB    1 
ATOM   6465  C CG    . LYS H 3 19  ? 74.128  -104.373 10.142  1.00 133.01 ? 22  LYS B CG    1 
ATOM   6466  C CD    . LYS H 3 19  ? 75.404  -104.828 10.824  1.00 133.55 ? 22  LYS B CD    1 
ATOM   6467  C CE    . LYS H 3 19  ? 76.339  -103.654 11.050  1.00 132.24 ? 22  LYS B CE    1 
ATOM   6468  N NZ    . LYS H 3 19  ? 77.500  -104.047 11.890  1.00 133.22 ? 22  LYS B NZ    1 
ATOM   6469  N N     . LYS H 3 20  ? 69.471  -105.973 10.005  1.00 128.05 ? 23  LYS B N     1 
ATOM   6470  C CA    . LYS H 3 20  ? 68.446  -106.968 9.732   1.00 127.34 ? 23  LYS B CA    1 
ATOM   6471  C C     . LYS H 3 20  ? 68.082  -106.928 8.253   1.00 119.81 ? 23  LYS B C     1 
ATOM   6472  O O     . LYS H 3 20  ? 68.420  -105.979 7.549   1.00 104.49 ? 23  LYS B O     1 
ATOM   6473  C CB    . LYS H 3 20  ? 67.216  -106.744 10.615  1.00 131.71 ? 23  LYS B CB    1 
ATOM   6474  C CG    . LYS H 3 20  ? 67.476  -107.016 12.093  1.00 135.17 ? 23  LYS B CG    1 
ATOM   6475  C CD    . LYS H 3 20  ? 66.177  -107.214 12.855  1.00 139.25 ? 23  LYS B CD    1 
ATOM   6476  C CE    . LYS H 3 20  ? 66.392  -107.344 14.356  1.00 142.01 ? 23  LYS B CE    1 
ATOM   6477  N NZ    . LYS H 3 20  ? 67.305  -108.458 14.729  1.00 142.74 ? 23  LYS B NZ    1 
ATOM   6478  N N     . THR H 3 21  ? 67.415  -107.977 7.785   1.00 124.03 ? 24  THR B N     1 
ATOM   6479  C CA    . THR H 3 21  ? 67.092  -108.103 6.369   1.00 125.09 ? 24  THR B CA    1 
ATOM   6480  C C     . THR H 3 21  ? 65.894  -107.221 6.071   1.00 120.11 ? 24  THR B C     1 
ATOM   6481  O O     . THR H 3 21  ? 65.270  -106.678 6.985   1.00 120.33 ? 24  THR B O     1 
ATOM   6482  C CB    . THR H 3 21  ? 66.729  -109.553 5.965   1.00 128.54 ? 24  THR B CB    1 
ATOM   6483  O OG1   . THR H 3 21  ? 65.340  -109.791 6.223   1.00 134.88 ? 24  THR B OG1   1 
ATOM   6484  C CG2   . THR H 3 21  ? 67.583  -110.591 6.708   1.00 126.15 ? 24  THR B CG2   1 
ATOM   6485  N N     . ALA H 3 22  ? 65.563  -107.088 4.793   1.00 111.75 ? 25  ALA B N     1 
ATOM   6486  C CA    . ALA H 3 22  ? 64.343  -106.403 4.414   1.00 109.78 ? 25  ALA B CA    1 
ATOM   6487  C C     . ALA H 3 22  ? 63.155  -107.189 4.954   1.00 107.41 ? 25  ALA B C     1 
ATOM   6488  O O     . ALA H 3 22  ? 62.385  -106.680 5.769   1.00 105.85 ? 25  ALA B O     1 
ATOM   6489  C CB    . ALA H 3 22  ? 64.253  -106.255 2.903   1.00 110.01 ? 25  ALA B CB    1 
ATOM   6490  N N     . ALA H 3 23  ? 63.037  -108.444 4.531   1.00 108.68 ? 26  ALA B N     1 
ATOM   6491  C CA    . ALA H 3 23  ? 61.889  -109.276 4.901   1.00 109.84 ? 26  ALA B CA    1 
ATOM   6492  C C     . ALA H 3 23  ? 61.724  -109.431 6.419   1.00 103.97 ? 26  ALA B C     1 
ATOM   6493  O O     . ALA H 3 23  ? 60.594  -109.522 6.918   1.00 98.41  ? 26  ALA B O     1 
ATOM   6494  C CB    . ALA H 3 23  ? 61.983  -110.641 4.225   1.00 106.53 ? 26  ALA B CB    1 
ATOM   6495  N N     . GLU H 3 24  ? 62.846  -109.445 7.140   1.00 96.48  ? 27  GLU B N     1 
ATOM   6496  C CA    . GLU H 3 24  ? 62.837  -109.656 8.582   1.00 103.01 ? 27  GLU B CA    1 
ATOM   6497  C C     . GLU H 3 24  ? 62.200  -108.481 9.293   1.00 107.37 ? 27  GLU B C     1 
ATOM   6498  O O     . GLU H 3 24  ? 61.402  -108.653 10.213  1.00 111.84 ? 27  GLU B O     1 
ATOM   6499  C CB    . GLU H 3 24  ? 64.260  -109.861 9.093   1.00 114.15 ? 27  GLU B CB    1 
ATOM   6500  C CG    . GLU H 3 24  ? 64.350  -110.347 10.531  1.00 127.69 ? 27  GLU B CG    1 
ATOM   6501  C CD    . GLU H 3 24  ? 65.740  -110.844 10.894  1.00 137.99 ? 27  GLU B CD    1 
ATOM   6502  O OE1   . GLU H 3 24  ? 66.692  -110.607 10.114  1.00 138.40 ? 27  GLU B OE1   1 
ATOM   6503  O OE2   . GLU H 3 24  ? 65.882  -111.477 11.962  1.00 150.98 ? 27  GLU B OE2   1 
ATOM   6504  N N     . SER H 3 25  ? 62.563  -107.284 8.851   1.00 111.02 ? 28  SER B N     1 
ATOM   6505  C CA    . SER H 3 25  ? 61.990  -106.052 9.369   1.00 105.85 ? 28  SER B CA    1 
ATOM   6506  C C     . SER H 3 25  ? 60.479  -106.032 9.173   1.00 107.14 ? 28  SER B C     1 
ATOM   6507  O O     . SER H 3 25  ? 59.740  -105.718 10.103  1.00 109.01 ? 28  SER B O     1 
ATOM   6508  C CB    . SER H 3 25  ? 62.626  -104.866 8.659   1.00 104.00 ? 28  SER B CB    1 
ATOM   6509  O OG    . SER H 3 25  ? 64.021  -105.073 8.534   1.00 101.66 ? 28  SER B OG    1 
ATOM   6510  N N     . HIS H 3 26  ? 60.035  -106.388 7.967   1.00 104.17 ? 29  HIS B N     1 
ATOM   6511  C CA    . HIS H 3 26  ? 58.607  -106.482 7.647   1.00 106.70 ? 29  HIS B CA    1 
ATOM   6512  C C     . HIS H 3 26  ? 57.826  -107.427 8.585   1.00 109.81 ? 29  HIS B C     1 
ATOM   6513  O O     . HIS H 3 26  ? 56.631  -107.214 8.821   1.00 107.09 ? 29  HIS B O     1 
ATOM   6514  C CB    . HIS H 3 26  ? 58.408  -106.888 6.175   1.00 106.84 ? 29  HIS B CB    1 
ATOM   6515  C CG    . HIS H 3 26  ? 56.987  -107.201 5.818   1.00 107.15 ? 29  HIS B CG    1 
ATOM   6516  N ND1   . HIS H 3 26  ? 55.948  -106.329 6.060   1.00 108.10 ? 29  HIS B ND1   1 
ATOM   6517  C CD2   . HIS H 3 26  ? 56.431  -108.298 5.252   1.00 110.74 ? 29  HIS B CD2   1 
ATOM   6518  C CE1   . HIS H 3 26  ? 54.815  -106.874 5.655   1.00 110.63 ? 29  HIS B CE1   1 
ATOM   6519  N NE2   . HIS H 3 26  ? 55.081  -108.067 5.157   1.00 112.24 ? 29  HIS B NE2   1 
ATOM   6520  N N     . ARG H 3 27  ? 58.485  -108.461 9.110   1.00 115.56 ? 30  ARG B N     1 
ATOM   6521  C CA    . ARG H 3 27  ? 57.852  -109.328 10.117  1.00 128.50 ? 30  ARG B CA    1 
ATOM   6522  C C     . ARG H 3 27  ? 57.802  -108.646 11.483  1.00 126.54 ? 30  ARG B C     1 
ATOM   6523  O O     . ARG H 3 27  ? 56.816  -108.770 12.212  1.00 127.52 ? 30  ARG B O     1 
ATOM   6524  C CB    . ARG H 3 27  ? 58.561  -110.684 10.240  1.00 132.98 ? 30  ARG B CB    1 
ATOM   6525  C CG    . ARG H 3 27  ? 58.325  -111.620 9.063   1.00 135.98 ? 30  ARG B CG    1 
ATOM   6526  C CD    . ARG H 3 27  ? 58.567  -113.078 9.433   1.00 136.03 ? 30  ARG B CD    1 
ATOM   6527  N NE    . ARG H 3 27  ? 59.360  -113.764 8.414   1.00 135.46 ? 30  ARG B NE    1 
ATOM   6528  C CZ    . ARG H 3 27  ? 60.682  -113.653 8.283   1.00 129.66 ? 30  ARG B CZ    1 
ATOM   6529  N NH1   . ARG H 3 27  ? 61.388  -112.889 9.109   1.00 126.75 ? 30  ARG B NH1   1 
ATOM   6530  N NH2   . ARG H 3 27  ? 61.308  -114.314 7.317   1.00 127.89 ? 30  ARG B NH2   1 
ATOM   6531  N N     . MET H 3 28  ? 58.868  -107.930 11.826  1.00 126.28 ? 31  MET B N     1 
ATOM   6532  C CA    . MET H 3 28  ? 58.921  -107.181 13.083  1.00 127.20 ? 31  MET B CA    1 
ATOM   6533  C C     . MET H 3 28  ? 57.955  -106.006 13.029  1.00 120.73 ? 31  MET B C     1 
ATOM   6534  O O     . MET H 3 28  ? 57.423  -105.570 14.052  1.00 112.89 ? 31  MET B O     1 
ATOM   6535  C CB    . MET H 3 28  ? 60.328  -106.652 13.337  1.00 126.15 ? 31  MET B CB    1 
ATOM   6536  C CG    . MET H 3 28  ? 61.394  -107.726 13.448  1.00 127.66 ? 31  MET B CG    1 
ATOM   6537  S SD    . MET H 3 28  ? 63.026  -106.993 13.288  1.00 123.35 ? 31  MET B SD    1 
ATOM   6538  C CE    . MET H 3 28  ? 63.135  -106.156 14.869  1.00 122.75 ? 31  MET B CE    1 
ATOM   6539  N N     . LEU H 3 29  ? 57.743  -105.501 11.819  1.00 117.54 ? 32  LEU B N     1 
ATOM   6540  C CA    . LEU H 3 29  ? 56.827  -104.397 11.584  1.00 115.54 ? 32  LEU B CA    1 
ATOM   6541  C C     . LEU H 3 29  ? 55.404  -104.857 11.881  1.00 119.80 ? 32  LEU B C     1 
ATOM   6542  O O     . LEU H 3 29  ? 54.684  -104.213 12.652  1.00 115.33 ? 32  LEU B O     1 
ATOM   6543  C CB    . LEU H 3 29  ? 56.950  -103.911 10.131  1.00 110.29 ? 32  LEU B CB    1 
ATOM   6544  C CG    . LEU H 3 29  ? 57.061  -102.408 9.861   1.00 109.52 ? 32  LEU B CG    1 
ATOM   6545  C CD1   . LEU H 3 29  ? 58.045  -101.722 10.799  1.00 111.21 ? 32  LEU B CD1   1 
ATOM   6546  C CD2   . LEU H 3 29  ? 57.467  -102.186 8.412   1.00 108.31 ? 32  LEU B CD2   1 
ATOM   6547  N N     . VAL H 3 30  ? 55.019  -105.986 11.284  1.00 125.11 ? 33  VAL B N     1 
ATOM   6548  C CA    . VAL H 3 30  ? 53.684  -106.549 11.477  1.00 122.36 ? 33  VAL B CA    1 
ATOM   6549  C C     . VAL H 3 30  ? 53.517  -107.079 12.916  1.00 115.83 ? 33  VAL B C     1 
ATOM   6550  O O     . VAL H 3 30  ? 52.408  -107.078 13.450  1.00 112.49 ? 33  VAL B O     1 
ATOM   6551  C CB    . VAL H 3 30  ? 53.354  -107.607 10.384  1.00 123.93 ? 33  VAL B CB    1 
ATOM   6552  C CG1   . VAL H 3 30  ? 54.084  -108.918 10.624  1.00 126.65 ? 33  VAL B CG1   1 
ATOM   6553  C CG2   . VAL H 3 30  ? 51.852  -107.838 10.275  1.00 129.12 ? 33  VAL B CG2   1 
ATOM   6554  N N     . GLU H 3 31  ? 54.622  -107.482 13.549  1.00 112.75 ? 34  GLU B N     1 
ATOM   6555  C CA    . GLU H 3 31  ? 54.608  -107.955 14.947  1.00 117.14 ? 34  GLU B CA    1 
ATOM   6556  C C     . GLU H 3 31  ? 54.352  -106.854 15.974  1.00 113.49 ? 34  GLU B C     1 
ATOM   6557  O O     . GLU H 3 31  ? 53.847  -107.124 17.067  1.00 111.22 ? 34  GLU B O     1 
ATOM   6558  C CB    . GLU H 3 31  ? 55.929  -108.659 15.294  1.00 124.45 ? 34  GLU B CB    1 
ATOM   6559  C CG    . GLU H 3 31  ? 56.069  -109.066 16.759  1.00 128.38 ? 34  GLU B CG    1 
ATOM   6560  C CD    . GLU H 3 31  ? 57.180  -110.078 16.991  1.00 134.95 ? 34  GLU B CD    1 
ATOM   6561  O OE1   . GLU H 3 31  ? 56.966  -111.026 17.778  1.00 142.23 ? 34  GLU B OE1   1 
ATOM   6562  O OE2   . GLU H 3 31  ? 58.266  -109.932 16.388  1.00 133.79 ? 34  GLU B OE2   1 
ATOM   6563  N N     . ALA H 3 32  ? 54.720  -105.624 15.624  1.00 117.35 ? 35  ALA B N     1 
ATOM   6564  C CA    . ALA H 3 32  ? 54.585  -104.473 16.522  1.00 114.23 ? 35  ALA B CA    1 
ATOM   6565  C C     . ALA H 3 32  ? 53.231  -103.775 16.379  1.00 112.02 ? 35  ALA B C     1 
ATOM   6566  O O     . ALA H 3 32  ? 52.533  -103.544 17.373  1.00 103.27 ? 35  ALA B O     1 
ATOM   6567  C CB    . ALA H 3 32  ? 55.701  -103.482 16.249  1.00 113.16 ? 35  ALA B CB    1 
ATOM   6568  N N     . PHE H 3 33  ? 52.875  -103.455 15.134  1.00 112.11 ? 36  PHE B N     1 
ATOM   6569  C CA    . PHE H 3 33  ? 51.725  -102.600 14.830  1.00 114.45 ? 36  PHE B CA    1 
ATOM   6570  C C     . PHE H 3 33  ? 50.547  -103.315 14.158  1.00 117.65 ? 36  PHE B C     1 
ATOM   6571  O O     . PHE H 3 33  ? 49.533  -102.677 13.871  1.00 122.36 ? 36  PHE B O     1 
ATOM   6572  C CB    . PHE H 3 33  ? 52.165  -101.438 13.926  1.00 115.60 ? 36  PHE B CB    1 
ATOM   6573  C CG    . PHE H 3 33  ? 53.467  -100.790 14.339  1.00 109.80 ? 36  PHE B CG    1 
ATOM   6574  C CD1   . PHE H 3 33  ? 53.685  -100.395 15.658  1.00 104.76 ? 36  PHE B CD1   1 
ATOM   6575  C CD2   . PHE H 3 33  ? 54.469  -100.556 13.400  1.00 102.88 ? 36  PHE B CD2   1 
ATOM   6576  C CE1   . PHE H 3 33  ? 54.878  -99.799  16.031  1.00 99.19  ? 36  PHE B CE1   1 
ATOM   6577  C CE2   . PHE H 3 33  ? 55.663  -99.960  13.768  1.00 97.23  ? 36  PHE B CE2   1 
ATOM   6578  C CZ    . PHE H 3 33  ? 55.867  -99.578  15.084  1.00 96.74  ? 36  PHE B CZ    1 
ATOM   6579  N N     . GLY H 3 34  ? 50.676  -104.613 13.888  1.00 117.80 ? 37  GLY B N     1 
ATOM   6580  C CA    . GLY H 3 34  ? 49.591  -105.379 13.274  1.00 118.87 ? 37  GLY B CA    1 
ATOM   6581  C C     . GLY H 3 34  ? 49.621  -105.381 11.754  1.00 122.66 ? 37  GLY B C     1 
ATOM   6582  O O     . GLY H 3 34  ? 50.586  -104.935 11.134  1.00 113.14 ? 37  GLY B O     1 
ATOM   6583  N N     . GLU H 3 35  ? 48.540  -105.877 11.159  1.00 131.32 ? 38  GLU B N     1 
ATOM   6584  C CA    . GLU H 3 35  ? 48.489  -106.145 9.721   1.00 139.17 ? 38  GLU B CA    1 
ATOM   6585  C C     . GLU H 3 35  ? 48.566  -104.890 8.857   1.00 139.10 ? 38  GLU B C     1 
ATOM   6586  O O     . GLU H 3 35  ? 49.112  -104.930 7.756   1.00 139.13 ? 38  GLU B O     1 
ATOM   6587  C CB    . GLU H 3 35  ? 47.213  -106.923 9.378   1.00 146.37 ? 38  GLU B CB    1 
ATOM   6588  C CG    . GLU H 3 35  ? 47.146  -107.415 7.937   1.00 151.22 ? 38  GLU B CG    1 
ATOM   6589  C CD    . GLU H 3 35  ? 46.003  -108.382 7.683   1.00 154.05 ? 38  GLU B CD    1 
ATOM   6590  O OE1   . GLU H 3 35  ? 45.722  -108.659 6.498   1.00 155.33 ? 38  GLU B OE1   1 
ATOM   6591  O OE2   . GLU H 3 35  ? 45.384  -108.868 8.655   1.00 155.00 ? 38  GLU B OE2   1 
ATOM   6592  N N     . GLN H 3 36  ? 48.039  -103.777 9.364   1.00 136.87 ? 39  GLN B N     1 
ATOM   6593  C CA    . GLN H 3 36  ? 47.834  -102.570 8.550   1.00 133.12 ? 39  GLN B CA    1 
ATOM   6594  C C     . GLN H 3 36  ? 49.128  -101.981 7.986   1.00 123.43 ? 39  GLN B C     1 
ATOM   6595  O O     . GLN H 3 36  ? 49.091  -101.155 7.081   1.00 129.57 ? 39  GLN B O     1 
ATOM   6596  C CB    . GLN H 3 36  ? 47.045  -101.518 9.341   1.00 135.60 ? 39  GLN B CB    1 
ATOM   6597  C CG    . GLN H 3 36  ? 45.531  -101.727 9.309   1.00 139.26 ? 39  GLN B CG    1 
ATOM   6598  C CD    . GLN H 3 36  ? 45.102  -103.169 9.558   1.00 142.17 ? 39  GLN B CD    1 
ATOM   6599  O OE1   . GLN H 3 36  ? 45.741  -103.902 10.317  1.00 140.90 ? 39  GLN B OE1   1 
ATOM   6600  N NE2   . GLN H 3 36  ? 44.010  -103.580 8.919   1.00 140.58 ? 39  GLN B NE2   1 
ATOM   6601  N N     . VAL H 3 37  ? 50.255  -102.418 8.533   1.00 116.81 ? 40  VAL B N     1 
ATOM   6602  C CA    . VAL H 3 37  ? 51.603  -102.157 8.001   1.00 114.59 ? 40  VAL B CA    1 
ATOM   6603  C C     . VAL H 3 37  ? 51.750  -102.392 6.484   1.00 112.69 ? 40  VAL B C     1 
ATOM   6604  O O     . VAL H 3 37  ? 50.953  -103.122 5.892   1.00 123.05 ? 40  VAL B O     1 
ATOM   6605  C CB    . VAL H 3 37  ? 52.604  -103.026 8.809   1.00 119.83 ? 40  VAL B CB    1 
ATOM   6606  C CG1   . VAL H 3 37  ? 53.710  -103.648 7.962   1.00 120.87 ? 40  VAL B CG1   1 
ATOM   6607  C CG2   . VAL H 3 37  ? 53.163  -102.222 9.973   1.00 123.72 ? 40  VAL B CG2   1 
ATOM   6608  N N     . PRO H 3 38  ? 52.768  -101.769 5.846   1.00 105.99 ? 41  PRO B N     1 
ATOM   6609  C CA    . PRO H 3 38  ? 52.999  -101.944 4.399   1.00 107.30 ? 41  PRO B CA    1 
ATOM   6610  C C     . PRO H 3 38  ? 53.548  -103.317 4.001   1.00 111.73 ? 41  PRO B C     1 
ATOM   6611  O O     . PRO H 3 38  ? 53.723  -104.192 4.842   1.00 114.12 ? 41  PRO B O     1 
ATOM   6612  C CB    . PRO H 3 38  ? 54.040  -100.861 4.077   1.00 104.15 ? 41  PRO B CB    1 
ATOM   6613  C CG    . PRO H 3 38  ? 54.743  -100.634 5.368   1.00 105.20 ? 41  PRO B CG    1 
ATOM   6614  C CD    . PRO H 3 38  ? 53.662  -100.740 6.405   1.00 105.37 ? 41  PRO B CD    1 
ATOM   6615  N N     . THR H 3 39  ? 53.823  -103.492 2.714   1.00 110.43 ? 42  THR B N     1 
ATOM   6616  C CA    . THR H 3 39  ? 54.383  -104.740 2.223   1.00 103.45 ? 42  THR B CA    1 
ATOM   6617  C C     . THR H 3 39  ? 55.881  -104.818 2.479   1.00 107.90 ? 42  THR B C     1 
ATOM   6618  O O     . THR H 3 39  ? 56.529  -103.832 2.833   1.00 97.38  ? 42  THR B O     1 
ATOM   6619  C CB    . THR H 3 39  ? 54.170  -104.922 0.705   1.00 99.90  ? 42  THR B CB    1 
ATOM   6620  O OG1   . THR H 3 39  ? 55.027  -104.023 -0.019  1.00 87.08  ? 42  THR B OG1   1 
ATOM   6621  C CG2   . THR H 3 39  ? 52.691  -104.718 0.324   1.00 96.11  ? 42  THR B CG2   1 
ATOM   6622  N N     . VAL H 3 40  ? 56.409  -106.024 2.298   1.00 121.13 ? 43  VAL B N     1 
ATOM   6623  C CA    . VAL H 3 40  ? 57.846  -106.257 2.232   1.00 118.47 ? 43  VAL B CA    1 
ATOM   6624  C C     . VAL H 3 40  ? 58.441  -105.572 1.002   1.00 108.79 ? 43  VAL B C     1 
ATOM   6625  O O     . VAL H 3 40  ? 59.579  -105.117 1.042   1.00 107.03 ? 43  VAL B O     1 
ATOM   6626  C CB    . VAL H 3 40  ? 58.181  -107.774 2.194   1.00 124.81 ? 43  VAL B CB    1 
ATOM   6627  C CG1   . VAL H 3 40  ? 57.662  -108.439 0.917   1.00 126.51 ? 43  VAL B CG1   1 
ATOM   6628  C CG2   . VAL H 3 40  ? 59.679  -108.003 2.354   1.00 123.40 ? 43  VAL B CG2   1 
ATOM   6629  N N     . LYS H 3 41  ? 57.669  -105.492 -0.083  1.00 102.90 ? 44  LYS B N     1 
ATOM   6630  C CA    . LYS H 3 41  ? 58.190  -104.976 -1.351  1.00 101.29 ? 44  LYS B CA    1 
ATOM   6631  C C     . LYS H 3 41  ? 58.678  -103.540 -1.203  1.00 100.55 ? 44  LYS B C     1 
ATOM   6632  O O     . LYS H 3 41  ? 59.675  -103.149 -1.809  1.00 97.79  ? 44  LYS B O     1 
ATOM   6633  C CB    . LYS H 3 41  ? 57.141  -105.085 -2.474  1.00 99.21  ? 44  LYS B CB    1 
ATOM   6634  C CG    . LYS H 3 41  ? 57.604  -104.585 -3.845  1.00 98.79  ? 44  LYS B CG    1 
ATOM   6635  C CD    . LYS H 3 41  ? 58.922  -105.201 -4.303  1.00 99.15  ? 44  LYS B CD    1 
ATOM   6636  C CE    . LYS H 3 41  ? 59.344  -104.690 -5.675  1.00 98.65  ? 44  LYS B CE    1 
ATOM   6637  N NZ    . LYS H 3 41  ? 60.739  -105.089 -6.039  1.00 96.22  ? 44  LYS B NZ    1 
ATOM   6638  N N     . THR H 3 42  ? 57.975  -102.762 -0.387  1.00 100.42 ? 45  THR B N     1 
ATOM   6639  C CA    . THR H 3 42  ? 58.389  -101.398 -0.093  1.00 93.52  ? 45  THR B CA    1 
ATOM   6640  C C     . THR H 3 42  ? 59.603  -101.384 0.829   1.00 88.36  ? 45  THR B C     1 
ATOM   6641  O O     . THR H 3 42  ? 60.572  -100.691 0.547   1.00 89.06  ? 45  THR B O     1 
ATOM   6642  C CB    . THR H 3 42  ? 57.239  -100.583 0.516   1.00 95.36  ? 45  THR B CB    1 
ATOM   6643  O OG1   . THR H 3 42  ? 56.613  -101.330 1.568   1.00 97.80  ? 45  THR B OG1   1 
ATOM   6644  C CG2   . THR H 3 42  ? 56.219  -100.266 -0.554  1.00 93.34  ? 45  THR B CG2   1 
ATOM   6645  N N     . CYS H 3 43  ? 59.567  -102.156 1.913   1.00 86.66  ? 46  CYS B N     1 
ATOM   6646  C CA    . CYS H 3 43  ? 60.742  -102.300 2.781   1.00 88.10  ? 46  CYS B CA    1 
ATOM   6647  C C     . CYS H 3 43  ? 61.992  -102.593 1.944   1.00 95.30  ? 46  CYS B C     1 
ATOM   6648  O O     . CYS H 3 43  ? 63.025  -101.951 2.128   1.00 95.14  ? 46  CYS B O     1 
ATOM   6649  C CB    . CYS H 3 43  ? 60.539  -103.401 3.824   1.00 84.40  ? 46  CYS B CB    1 
ATOM   6650  S SG    . CYS H 3 43  ? 59.084  -103.189 4.875   1.00 85.93  ? 46  CYS B SG    1 
ATOM   6651  N N     . GLU H 3 44  ? 61.884  -103.545 1.014   1.00 101.68 ? 47  GLU B N     1 
ATOM   6652  C CA    . GLU H 3 44  ? 62.979  -103.860 0.081   1.00 106.91 ? 47  GLU B CA    1 
ATOM   6653  C C     . GLU H 3 44  ? 63.446  -102.608 -0.668  1.00 104.24 ? 47  GLU B C     1 
ATOM   6654  O O     . GLU H 3 44  ? 64.642  -102.324 -0.729  1.00 100.98 ? 47  GLU B O     1 
ATOM   6655  C CB    . GLU H 3 44  ? 62.548  -104.919 -0.951  1.00 113.55 ? 47  GLU B CB    1 
ATOM   6656  C CG    . GLU H 3 44  ? 62.327  -106.340 -0.431  1.00 111.61 ? 47  GLU B CG    1 
ATOM   6657  C CD    . GLU H 3 44  ? 61.595  -107.214 -1.445  1.00 107.28 ? 47  GLU B CD    1 
ATOM   6658  O OE1   . GLU H 3 44  ? 61.749  -106.959 -2.664  1.00 92.55  ? 47  GLU B OE1   1 
ATOM   6659  O OE2   . GLU H 3 44  ? 60.864  -108.144 -1.024  1.00 105.15 ? 47  GLU B OE2   1 
ATOM   6660  N N     . ARG H 3 45  ? 62.492  -101.873 -1.238  1.00 106.60 ? 48  ARG B N     1 
ATOM   6661  C CA    . ARG H 3 45  ? 62.780  -100.622 -1.957  1.00 108.51 ? 48  ARG B CA    1 
ATOM   6662  C C     . ARG H 3 45  ? 63.421  -99.572  -1.043  1.00 110.72 ? 48  ARG B C     1 
ATOM   6663  O O     . ARG H 3 45  ? 64.475  -99.020  -1.360  1.00 111.29 ? 48  ARG B O     1 
ATOM   6664  C CB    . ARG H 3 45  ? 61.503  -100.043 -2.580  1.00 101.16 ? 48  ARG B CB    1 
ATOM   6665  C CG    . ARG H 3 45  ? 60.984  -100.809 -3.782  1.00 98.81  ? 48  ARG B CG    1 
ATOM   6666  C CD    . ARG H 3 45  ? 59.508  -100.538 -4.032  1.00 97.66  ? 48  ARG B CD    1 
ATOM   6667  N NE    . ARG H 3 45  ? 59.079  -101.004 -5.353  1.00 95.23  ? 48  ARG B NE    1 
ATOM   6668  C CZ    . ARG H 3 45  ? 57.825  -101.309 -5.696  1.00 94.62  ? 48  ARG B CZ    1 
ATOM   6669  N NH1   . ARG H 3 45  ? 56.819  -101.221 -4.823  1.00 91.87  ? 48  ARG B NH1   1 
ATOM   6670  N NH2   . ARG H 3 45  ? 57.577  -101.722 -6.932  1.00 93.15  ? 48  ARG B NH2   1 
ATOM   6671  N N     . TRP H 3 46  ? 62.783  -99.300  0.092   1.00 110.03 ? 49  TRP B N     1 
ATOM   6672  C CA    . TRP H 3 46  ? 63.327  -98.343  1.053   1.00 112.85 ? 49  TRP B CA    1 
ATOM   6673  C C     . TRP H 3 46  ? 64.740  -98.750  1.455   1.00 111.37 ? 49  TRP B C     1 
ATOM   6674  O O     . TRP H 3 46  ? 65.650  -97.915  1.476   1.00 106.29 ? 49  TRP B O     1 
ATOM   6675  C CB    . TRP H 3 46  ? 62.407  -98.196  2.278   1.00 119.26 ? 49  TRP B CB    1 
ATOM   6676  C CG    . TRP H 3 46  ? 61.291  -97.213  2.036   1.00 125.36 ? 49  TRP B CG    1 
ATOM   6677  C CD1   . TRP H 3 46  ? 59.962  -97.490  1.860   1.00 126.25 ? 49  TRP B CD1   1 
ATOM   6678  C CD2   . TRP H 3 46  ? 61.423  -95.795  1.909   1.00 130.69 ? 49  TRP B CD2   1 
ATOM   6679  N NE1   . TRP H 3 46  ? 59.260  -96.328  1.640   1.00 125.93 ? 49  TRP B NE1   1 
ATOM   6680  C CE2   . TRP H 3 46  ? 60.134  -95.273  1.665   1.00 130.09 ? 49  TRP B CE2   1 
ATOM   6681  C CE3   . TRP H 3 46  ? 62.508  -94.912  1.983   1.00 131.34 ? 49  TRP B CE3   1 
ATOM   6682  C CZ2   . TRP H 3 46  ? 59.902  -93.909  1.493   1.00 133.76 ? 49  TRP B CZ2   1 
ATOM   6683  C CZ3   . TRP H 3 46  ? 62.277  -93.560  1.815   1.00 133.93 ? 49  TRP B CZ3   1 
ATOM   6684  C CH2   . TRP H 3 46  ? 60.983  -93.069  1.572   1.00 134.35 ? 49  TRP B CH2   1 
ATOM   6685  N N     . PHE H 3 47  ? 64.920  -100.038 1.741   1.00 112.45 ? 50  PHE B N     1 
ATOM   6686  C CA    . PHE H 3 47  ? 66.252  -100.596 1.969   1.00 113.52 ? 50  PHE B CA    1 
ATOM   6687  C C     . PHE H 3 47  ? 67.164  -100.336 0.779   1.00 113.69 ? 50  PHE B C     1 
ATOM   6688  O O     . PHE H 3 47  ? 68.340  -100.020 0.952   1.00 111.05 ? 50  PHE B O     1 
ATOM   6689  C CB    . PHE H 3 47  ? 66.186  -102.100 2.238   1.00 111.23 ? 50  PHE B CB    1 
ATOM   6690  C CG    . PHE H 3 47  ? 66.098  -102.447 3.690   1.00 108.78 ? 50  PHE B CG    1 
ATOM   6691  C CD1   . PHE H 3 47  ? 65.076  -101.940 4.474   1.00 109.37 ? 50  PHE B CD1   1 
ATOM   6692  C CD2   . PHE H 3 47  ? 67.036  -103.284 4.271   1.00 108.04 ? 50  PHE B CD2   1 
ATOM   6693  C CE1   . PHE H 3 47  ? 64.993  -102.261 5.815   1.00 113.22 ? 50  PHE B CE1   1 
ATOM   6694  C CE2   . PHE H 3 47  ? 66.959  -103.609 5.608   1.00 110.00 ? 50  PHE B CE2   1 
ATOM   6695  C CZ    . PHE H 3 47  ? 65.936  -103.096 6.383   1.00 112.14 ? 50  PHE B CZ    1 
ATOM   6696  N N     . GLN H 3 48  ? 66.618  -100.482 -0.426  1.00 115.06 ? 51  GLN B N     1 
ATOM   6697  C CA    . GLN H 3 48  ? 67.377  -100.224 -1.649  1.00 118.33 ? 51  GLN B CA    1 
ATOM   6698  C C     . GLN H 3 48  ? 67.952  -98.812  -1.603  1.00 117.46 ? 51  GLN B C     1 
ATOM   6699  O O     . GLN H 3 48  ? 69.143  -98.611  -1.850  1.00 107.99 ? 51  GLN B O     1 
ATOM   6700  C CB    . GLN H 3 48  ? 66.494  -100.405 -2.890  1.00 119.42 ? 51  GLN B CB    1 
ATOM   6701  C CG    . GLN H 3 48  ? 67.207  -100.973 -4.103  1.00 121.75 ? 51  GLN B CG    1 
ATOM   6702  C CD    . GLN H 3 48  ? 66.246  -101.260 -5.242  1.00 128.28 ? 51  GLN B CD    1 
ATOM   6703  O OE1   . GLN H 3 48  ? 65.228  -101.931 -5.059  1.00 126.19 ? 51  GLN B OE1   1 
ATOM   6704  N NE2   . GLN H 3 48  ? 66.562  -100.753 -6.426  1.00 129.76 ? 51  GLN B NE2   1 
ATOM   6705  N N     . ARG H 3 49  ? 67.103  -97.849  -1.250  1.00 120.68 ? 52  ARG B N     1 
ATOM   6706  C CA    . ARG H 3 49  ? 67.508  -96.448  -1.200  1.00 121.03 ? 52  ARG B CA    1 
ATOM   6707  C C     . ARG H 3 49  ? 68.484  -96.162  -0.052  1.00 118.47 ? 52  ARG B C     1 
ATOM   6708  O O     . ARG H 3 49  ? 69.338  -95.287  -0.175  1.00 109.01 ? 52  ARG B O     1 
ATOM   6709  C CB    . ARG H 3 49  ? 66.287  -95.537  -1.093  1.00 124.41 ? 52  ARG B CB    1 
ATOM   6710  C CG    . ARG H 3 49  ? 66.533  -94.148  -1.667  1.00 130.72 ? 52  ARG B CG    1 
ATOM   6711  C CD    . ARG H 3 49  ? 65.549  -93.119  -1.132  1.00 131.37 ? 52  ARG B CD    1 
ATOM   6712  N NE    . ARG H 3 49  ? 64.221  -93.244  -1.728  1.00 127.79 ? 52  ARG B NE    1 
ATOM   6713  C CZ    . ARG H 3 49  ? 63.163  -92.521  -1.365  1.00 130.24 ? 52  ARG B CZ    1 
ATOM   6714  N NH1   . ARG H 3 49  ? 63.258  -91.612  -0.398  1.00 132.19 ? 52  ARG B NH1   1 
ATOM   6715  N NH2   . ARG H 3 49  ? 61.997  -92.708  -1.971  1.00 129.10 ? 52  ARG B NH2   1 
ATOM   6716  N N     . PHE H 3 50  ? 68.360  -96.896  1.052   1.00 120.49 ? 53  PHE B N     1 
ATOM   6717  C CA    . PHE H 3 50  ? 69.318  -96.779  2.157   1.00 123.01 ? 53  PHE B CA    1 
ATOM   6718  C C     . PHE H 3 50  ? 70.716  -97.239  1.745   1.00 128.31 ? 53  PHE B C     1 
ATOM   6719  O O     . PHE H 3 50  ? 71.706  -96.625  2.135   1.00 131.30 ? 53  PHE B O     1 
ATOM   6720  C CB    . PHE H 3 50  ? 68.881  -97.593  3.381   1.00 122.13 ? 53  PHE B CB    1 
ATOM   6721  C CG    . PHE H 3 50  ? 67.539  -97.208  3.949   1.00 120.17 ? 53  PHE B CG    1 
ATOM   6722  C CD1   . PHE H 3 50  ? 66.958  -95.969  3.693   1.00 118.92 ? 53  PHE B CD1   1 
ATOM   6723  C CD2   . PHE H 3 50  ? 66.869  -98.093  4.785   1.00 122.03 ? 53  PHE B CD2   1 
ATOM   6724  C CE1   . PHE H 3 50  ? 65.726  -95.640  4.240   1.00 122.09 ? 53  PHE B CE1   1 
ATOM   6725  C CE2   . PHE H 3 50  ? 65.644  -97.766  5.338   1.00 122.74 ? 53  PHE B CE2   1 
ATOM   6726  C CZ    . PHE H 3 50  ? 65.069  -96.538  5.066   1.00 121.23 ? 53  PHE B CZ    1 
ATOM   6727  N N     . LYS H 3 51  ? 70.795  -98.321  0.971   1.00 138.56 ? 54  LYS B N     1 
ATOM   6728  C CA    . LYS H 3 51  ? 72.079  -98.828  0.457   1.00 145.38 ? 54  LYS B CA    1 
ATOM   6729  C C     . LYS H 3 51  ? 72.744  -97.790  -0.453  1.00 147.65 ? 54  LYS B C     1 
ATOM   6730  O O     . LYS H 3 51  ? 73.972  -97.726  -0.541  1.00 142.97 ? 54  LYS B O     1 
ATOM   6731  C CB    . LYS H 3 51  ? 71.882  -100.141 -0.317  1.00 151.39 ? 54  LYS B CB    1 
ATOM   6732  C CG    . LYS H 3 51  ? 71.266  -101.280 0.491   1.00 155.49 ? 54  LYS B CG    1 
ATOM   6733  C CD    . LYS H 3 51  ? 72.197  -102.475 0.632   1.00 155.08 ? 54  LYS B CD    1 
ATOM   6734  C CE    . LYS H 3 51  ? 71.558  -103.589 1.453   1.00 155.29 ? 54  LYS B CE    1 
ATOM   6735  N NZ    . LYS H 3 51  ? 70.538  -104.362 0.690   1.00 157.17 ? 54  LYS B NZ    1 
ATOM   6736  N N     . SER H 3 52  ? 71.914  -96.992  -1.130  1.00 149.89 ? 55  SER B N     1 
ATOM   6737  C CA    . SER H 3 52  ? 72.372  -95.851  -1.937  1.00 142.42 ? 55  SER B CA    1 
ATOM   6738  C C     . SER H 3 52  ? 73.010  -94.746  -1.080  1.00 138.56 ? 55  SER B C     1 
ATOM   6739  O O     . SER H 3 52  ? 73.929  -94.069  -1.531  1.00 132.01 ? 55  SER B O     1 
ATOM   6740  C CB    . SER H 3 52  ? 71.210  -95.292  -2.782  1.00 138.89 ? 55  SER B CB    1 
ATOM   6741  O OG    . SER H 3 52  ? 71.118  -93.880  -2.702  1.00 135.49 ? 55  SER B OG    1 
ATOM   6742  N N     . GLY H 3 53  ? 72.522  -94.582  0.150   1.00 140.44 ? 56  GLY B N     1 
ATOM   6743  C CA    . GLY H 3 53  ? 73.052  -93.590  1.098   1.00 140.70 ? 56  GLY B CA    1 
ATOM   6744  C C     . GLY H 3 53  ? 72.114  -92.421  1.380   1.00 140.43 ? 56  GLY B C     1 
ATOM   6745  O O     . GLY H 3 53  ? 72.516  -91.438  2.005   1.00 131.33 ? 56  GLY B O     1 
ATOM   6746  N N     . ASP H 3 54  ? 70.860  -92.546  0.942   1.00 142.93 ? 57  ASP B N     1 
ATOM   6747  C CA    . ASP H 3 54  ? 69.869  -91.471  0.991   1.00 139.77 ? 57  ASP B CA    1 
ATOM   6748  C C     . ASP H 3 54  ? 68.809  -91.756  2.063   1.00 135.01 ? 57  ASP B C     1 
ATOM   6749  O O     . ASP H 3 54  ? 67.833  -92.466  1.808   1.00 130.44 ? 57  ASP B O     1 
ATOM   6750  C CB    . ASP H 3 54  ? 69.228  -91.340  -0.400  1.00 143.38 ? 57  ASP B CB    1 
ATOM   6751  C CG    . ASP H 3 54  ? 68.189  -90.231  -0.487  1.00 148.27 ? 57  ASP B CG    1 
ATOM   6752  O OD1   . ASP H 3 54  ? 68.000  -89.471  0.487   1.00 154.22 ? 57  ASP B OD1   1 
ATOM   6753  O OD2   . ASP H 3 54  ? 67.555  -90.121  -1.557  1.00 147.57 ? 57  ASP B OD2   1 
ATOM   6754  N N     . PHE H 3 55  ? 68.997  -91.176  3.250   1.00 134.20 ? 58  PHE B N     1 
ATOM   6755  C CA    . PHE H 3 55  ? 68.125  -91.432  4.405   1.00 136.07 ? 58  PHE B CA    1 
ATOM   6756  C C     . PHE H 3 55  ? 66.987  -90.411  4.572   1.00 129.21 ? 58  PHE B C     1 
ATOM   6757  O O     . PHE H 3 55  ? 66.523  -90.165  5.688   1.00 123.55 ? 58  PHE B O     1 
ATOM   6758  C CB    . PHE H 3 55  ? 68.961  -91.491  5.692   1.00 139.05 ? 58  PHE B CB    1 
ATOM   6759  C CG    . PHE H 3 55  ? 70.058  -92.527  5.664   1.00 145.78 ? 58  PHE B CG    1 
ATOM   6760  C CD1   . PHE H 3 55  ? 69.766  -93.862  5.422   1.00 150.49 ? 58  PHE B CD1   1 
ATOM   6761  C CD2   . PHE H 3 55  ? 71.378  -92.172  5.910   1.00 149.28 ? 58  PHE B CD2   1 
ATOM   6762  C CE1   . PHE H 3 55  ? 70.769  -94.818  5.406   1.00 153.79 ? 58  PHE B CE1   1 
ATOM   6763  C CE2   . PHE H 3 55  ? 72.385  -93.124  5.898   1.00 149.27 ? 58  PHE B CE2   1 
ATOM   6764  C CZ    . PHE H 3 55  ? 72.080  -94.448  5.644   1.00 152.89 ? 58  PHE B CZ    1 
ATOM   6765  N N     . ASP H 3 56  ? 66.526  -89.840  3.461   1.00 128.60 ? 59  ASP B N     1 
ATOM   6766  C CA    . ASP H 3 56  ? 65.414  -88.889  3.475   1.00 128.60 ? 59  ASP B CA    1 
ATOM   6767  C C     . ASP H 3 56  ? 64.099  -89.624  3.725   1.00 123.12 ? 59  ASP B C     1 
ATOM   6768  O O     . ASP H 3 56  ? 63.719  -90.508  2.960   1.00 127.25 ? 59  ASP B O     1 
ATOM   6769  C CB    . ASP H 3 56  ? 65.344  -88.132  2.142   1.00 134.32 ? 59  ASP B CB    1 
ATOM   6770  C CG    . ASP H 3 56  ? 64.181  -87.146  2.077   1.00 134.23 ? 59  ASP B CG    1 
ATOM   6771  O OD1   . ASP H 3 56  ? 63.771  -86.624  3.136   1.00 130.69 ? 59  ASP B OD1   1 
ATOM   6772  O OD2   . ASP H 3 56  ? 63.679  -86.890  0.960   1.00 130.41 ? 59  ASP B OD2   1 
ATOM   6773  N N     . VAL H 3 57  ? 63.398  -89.224  4.778   1.00 117.16 ? 60  VAL B N     1 
ATOM   6774  C CA    . VAL H 3 57  ? 62.183  -89.907  5.224   1.00 116.93 ? 60  VAL B CA    1 
ATOM   6775  C C     . VAL H 3 57  ? 60.923  -89.357  4.537   1.00 116.44 ? 60  VAL B C     1 
ATOM   6776  O O     . VAL H 3 57  ? 59.833  -89.919  4.678   1.00 111.45 ? 60  VAL B O     1 
ATOM   6777  C CB    . VAL H 3 57  ? 62.033  -89.787  6.754   1.00 121.64 ? 60  VAL B CB    1 
ATOM   6778  C CG1   . VAL H 3 57  ? 61.013  -90.784  7.284   1.00 128.06 ? 60  VAL B CG1   1 
ATOM   6779  C CG2   . VAL H 3 57  ? 63.379  -90.009  7.437   1.00 124.48 ? 60  VAL B CG2   1 
ATOM   6780  N N     . ASP H 3 58  ? 61.076  -88.260  3.797   1.00 118.80 ? 61  ASP B N     1 
ATOM   6781  C CA    . ASP H 3 58  ? 59.969  -87.653  3.052   1.00 118.56 ? 61  ASP B CA    1 
ATOM   6782  C C     . ASP H 3 58  ? 60.010  -88.100  1.598   1.00 112.01 ? 61  ASP B C     1 
ATOM   6783  O O     . ASP H 3 58  ? 61.075  -88.456  1.085   1.00 115.35 ? 61  ASP B O     1 
ATOM   6784  C CB    . ASP H 3 58  ? 60.052  -86.122  3.117   1.00 121.42 ? 61  ASP B CB    1 
ATOM   6785  C CG    . ASP H 3 58  ? 59.789  -85.571  4.516   1.00 124.24 ? 61  ASP B CG    1 
ATOM   6786  O OD1   . ASP H 3 58  ? 58.741  -85.906  5.116   1.00 120.40 ? 61  ASP B OD1   1 
ATOM   6787  O OD2   . ASP H 3 58  ? 60.628  -84.787  5.009   1.00 123.25 ? 61  ASP B OD2   1 
ATOM   6788  N N     . ASP H 3 59  ? 58.855  -88.065  0.932   1.00 103.54 ? 62  ASP B N     1 
ATOM   6789  C CA    . ASP H 3 59  ? 58.772  -88.436  -0.483  1.00 102.86 ? 62  ASP B CA    1 
ATOM   6790  C C     . ASP H 3 59  ? 59.629  -87.494  -1.320  1.00 106.75 ? 62  ASP B C     1 
ATOM   6791  O O     . ASP H 3 59  ? 59.924  -86.381  -0.900  1.00 117.99 ? 62  ASP B O     1 
ATOM   6792  C CB    . ASP H 3 59  ? 57.328  -88.370  -1.007  1.00 100.71 ? 62  ASP B CB    1 
ATOM   6793  C CG    . ASP H 3 59  ? 56.356  -89.242  -0.214  1.00 105.17 ? 62  ASP B CG    1 
ATOM   6794  O OD1   . ASP H 3 59  ? 56.656  -89.578  0.950   1.00 109.07 ? 62  ASP B OD1   1 
ATOM   6795  O OD2   . ASP H 3 59  ? 55.275  -89.576  -0.755  1.00 100.34 ? 62  ASP B OD2   1 
ATOM   6796  N N     . LYS H 3 60  ? 60.044  -87.953  -2.495  1.00 111.40 ? 63  LYS B N     1 
ATOM   6797  C CA    . LYS H 3 60  ? 60.519  -87.049  -3.539  1.00 110.30 ? 63  LYS B CA    1 
ATOM   6798  C C     . LYS H 3 60  ? 59.271  -86.353  -4.069  1.00 112.18 ? 63  LYS B C     1 
ATOM   6799  O O     . LYS H 3 60  ? 58.149  -86.736  -3.716  1.00 106.72 ? 63  LYS B O     1 
ATOM   6800  C CB    . LYS H 3 60  ? 61.246  -87.811  -4.658  1.00 113.54 ? 63  LYS B CB    1 
ATOM   6801  C CG    . LYS H 3 60  ? 62.741  -88.009  -4.437  1.00 115.95 ? 63  LYS B CG    1 
ATOM   6802  C CD    . LYS H 3 60  ? 63.059  -88.652  -3.092  1.00 116.85 ? 63  LYS B CD    1 
ATOM   6803  C CE    . LYS H 3 60  ? 64.558  -88.839  -2.908  1.00 118.30 ? 63  LYS B CE    1 
ATOM   6804  N NZ    . LYS H 3 60  ? 64.973  -88.737  -1.481  1.00 118.19 ? 63  LYS B NZ    1 
ATOM   6805  N N     . GLU H 3 61  ? 59.452  -85.331  -4.901  1.00 117.91 ? 64  GLU B N     1 
ATOM   6806  C CA    . GLU H 3 61  ? 58.317  -84.523  -5.355  1.00 118.04 ? 64  GLU B CA    1 
ATOM   6807  C C     . GLU H 3 61  ? 57.477  -85.276  -6.388  1.00 108.32 ? 64  GLU B C     1 
ATOM   6808  O O     . GLU H 3 61  ? 58.008  -85.758  -7.394  1.00 94.32  ? 64  GLU B O     1 
ATOM   6809  C CB    . GLU H 3 61  ? 58.778  -83.177  -5.931  1.00 124.38 ? 64  GLU B CB    1 
ATOM   6810  C CG    . GLU H 3 61  ? 57.672  -82.126  -5.950  1.00 128.15 ? 64  GLU B CG    1 
ATOM   6811  C CD    . GLU H 3 61  ? 57.973  -80.947  -6.860  1.00 131.55 ? 64  GLU B CD    1 
ATOM   6812  O OE1   . GLU H 3 61  ? 57.798  -81.081  -8.093  1.00 125.94 ? 64  GLU B OE1   1 
ATOM   6813  O OE2   . GLU H 3 61  ? 58.366  -79.881  -6.340  1.00 133.54 ? 64  GLU B OE2   1 
ATOM   6814  N N     . HIS H 3 62  ? 56.169  -85.356  -6.127  1.00 100.85 ? 65  HIS B N     1 
ATOM   6815  C CA    . HIS H 3 62  ? 55.214  -86.027  -7.011  1.00 96.54  ? 65  HIS B CA    1 
ATOM   6816  C C     . HIS H 3 62  ? 55.041  -85.274  -8.333  1.00 95.60  ? 65  HIS B C     1 
ATOM   6817  O O     . HIS H 3 62  ? 55.626  -84.215  -8.549  1.00 92.38  ? 65  HIS B O     1 
ATOM   6818  C CB    . HIS H 3 62  ? 53.844  -86.139  -6.330  1.00 95.50  ? 65  HIS B CB    1 
ATOM   6819  C CG    . HIS H 3 62  ? 53.815  -87.058  -5.150  1.00 98.23  ? 65  HIS B CG    1 
ATOM   6820  N ND1   . HIS H 3 62  ? 52.655  -87.663  -4.715  1.00 100.29 ? 65  HIS B ND1   1 
ATOM   6821  C CD2   . HIS H 3 62  ? 54.795  -87.480  -4.316  1.00 100.62 ? 65  HIS B CD2   1 
ATOM   6822  C CE1   . HIS H 3 62  ? 52.921  -88.413  -3.659  1.00 101.83 ? 65  HIS B CE1   1 
ATOM   6823  N NE2   . HIS H 3 62  ? 54.213  -88.323  -3.398  1.00 101.28 ? 65  HIS B NE2   1 
ATOM   6824  N N     . GLY H 3 63  ? 54.229  -85.840  -9.216  1.00 99.92  ? 66  GLY B N     1 
ATOM   6825  C CA    . GLY H 3 63  ? 53.854  -85.179  -10.457 1.00 101.31 ? 66  GLY B CA    1 
ATOM   6826  C C     . GLY H 3 63  ? 52.847  -84.073  -10.209 1.00 105.73 ? 66  GLY B C     1 
ATOM   6827  O O     . GLY H 3 63  ? 52.015  -84.162  -9.298  1.00 102.69 ? 66  GLY B O     1 
ATOM   6828  N N     . LYS H 3 64  ? 52.925  -83.034  -11.038 1.00 110.46 ? 67  LYS B N     1 
ATOM   6829  C CA    . LYS H 3 64  ? 52.109  -81.826  -10.896 1.00 105.06 ? 67  LYS B CA    1 
ATOM   6830  C C     . LYS H 3 64  ? 51.711  -81.303  -12.278 1.00 99.65  ? 67  LYS B C     1 
ATOM   6831  O O     . LYS H 3 64  ? 52.432  -81.549  -13.253 1.00 99.13  ? 67  LYS B O     1 
ATOM   6832  C CB    . LYS H 3 64  ? 52.910  -80.751  -10.156 1.00 107.61 ? 67  LYS B CB    1 
ATOM   6833  C CG    . LYS H 3 64  ? 54.079  -80.190  -10.959 1.00 108.08 ? 67  LYS B CG    1 
ATOM   6834  C CD    . LYS H 3 64  ? 55.137  -79.561  -10.070 1.00 109.07 ? 67  LYS B CD    1 
ATOM   6835  C CE    . LYS H 3 64  ? 56.214  -78.886  -10.901 1.00 109.28 ? 67  LYS B CE    1 
ATOM   6836  N NZ    . LYS H 3 64  ? 57.201  -78.193  -10.029 1.00 114.69 ? 67  LYS B NZ    1 
ATOM   6837  N N     . PRO H 3 65  ? 50.596  -80.545  -12.369 1.00 94.50  ? 68  PRO B N     1 
ATOM   6838  C CA    . PRO H 3 65  ? 50.152  -80.050  -13.675 1.00 93.28  ? 68  PRO B CA    1 
ATOM   6839  C C     . PRO H 3 65  ? 51.117  -79.041  -14.280 1.00 94.73  ? 68  PRO B C     1 
ATOM   6840  O O     . PRO H 3 65  ? 51.901  -78.426  -13.558 1.00 98.31  ? 68  PRO B O     1 
ATOM   6841  C CB    . PRO H 3 65  ? 48.802  -79.383  -13.370 1.00 88.64  ? 68  PRO B CB    1 
ATOM   6842  C CG    . PRO H 3 65  ? 48.433  -79.826  -11.992 1.00 88.63  ? 68  PRO B CG    1 
ATOM   6843  C CD    . PRO H 3 65  ? 49.743  -80.020  -11.295 1.00 93.02  ? 68  PRO B CD    1 
ATOM   6844  N N     . PRO H 3 66  ? 51.065  -78.868  -15.604 1.00 99.25  ? 69  PRO B N     1 
ATOM   6845  C CA    . PRO H 3 66  ? 51.994  -77.948  -16.245 1.00 106.60 ? 69  PRO B CA    1 
ATOM   6846  C C     . PRO H 3 66  ? 51.587  -76.488  -16.030 1.00 112.81 ? 69  PRO B C     1 
ATOM   6847  O O     . PRO H 3 66  ? 50.391  -76.165  -16.020 1.00 113.93 ? 69  PRO B O     1 
ATOM   6848  C CB    . PRO H 3 66  ? 51.898  -78.332  -17.725 1.00 107.67 ? 69  PRO B CB    1 
ATOM   6849  C CG    . PRO H 3 66  ? 50.521  -78.886  -17.892 1.00 104.88 ? 69  PRO B CG    1 
ATOM   6850  C CD    . PRO H 3 66  ? 50.082  -79.424  -16.552 1.00 101.47 ? 69  PRO B CD    1 
ATOM   6851  N N     . LYS H 3 67  ? 52.578  -75.618  -15.848 1.00 113.26 ? 70  LYS B N     1 
ATOM   6852  C CA    . LYS H 3 67  ? 52.319  -74.188  -15.704 1.00 105.34 ? 70  LYS B CA    1 
ATOM   6853  C C     . LYS H 3 67  ? 51.735  -73.636  -17.003 1.00 105.65 ? 70  LYS B C     1 
ATOM   6854  O O     . LYS H 3 67  ? 52.315  -73.805  -18.081 1.00 101.45 ? 70  LYS B O     1 
ATOM   6855  C CB    . LYS H 3 67  ? 53.597  -73.432  -15.329 1.00 102.74 ? 70  LYS B CB    1 
ATOM   6856  C CG    . LYS H 3 67  ? 53.995  -73.591  -13.873 1.00 102.70 ? 70  LYS B CG    1 
ATOM   6857  C CD    . LYS H 3 67  ? 55.340  -72.944  -13.610 1.00 105.14 ? 70  LYS B CD    1 
ATOM   6858  C CE    . LYS H 3 67  ? 55.664  -72.931  -12.128 1.00 109.18 ? 70  LYS B CE    1 
ATOM   6859  N NZ    . LYS H 3 67  ? 56.881  -72.118  -11.848 1.00 113.32 ? 70  LYS B NZ    1 
ATOM   6860  N N     . ARG H 3 68  ? 50.590  -72.967  -16.884 1.00 105.71 ? 71  ARG B N     1 
ATOM   6861  C CA    . ARG H 3 68  ? 49.873  -72.429  -18.045 1.00 101.23 ? 71  ARG B CA    1 
ATOM   6862  C C     . ARG H 3 68  ? 50.561  -71.183  -18.597 1.00 99.76  ? 71  ARG B C     1 
ATOM   6863  O O     . ARG H 3 68  ? 50.294  -70.793  -19.733 1.00 99.24  ? 71  ARG B O     1 
ATOM   6864  C CB    . ARG H 3 68  ? 48.436  -72.059  -17.683 1.00 98.32  ? 71  ARG B CB    1 
ATOM   6865  C CG    . ARG H 3 68  ? 47.731  -73.017  -16.742 1.00 97.30  ? 71  ARG B CG    1 
ATOM   6866  C CD    . ARG H 3 68  ? 46.592  -73.774  -17.391 1.00 99.38  ? 71  ARG B CD    1 
ATOM   6867  N NE    . ARG H 3 68  ? 45.802  -74.431  -16.351 1.00 99.05  ? 71  ARG B NE    1 
ATOM   6868  C CZ    . ARG H 3 68  ? 44.587  -74.942  -16.525 1.00 98.50  ? 71  ARG B CZ    1 
ATOM   6869  N NH1   . ARG H 3 68  ? 43.994  -74.908  -17.715 1.00 102.98 ? 71  ARG B NH1   1 
ATOM   6870  N NH2   . ARG H 3 68  ? 43.962  -75.502  -15.496 1.00 94.86  ? 71  ARG B NH2   1 
ATOM   6871  N N     . TYR H 3 69  ? 51.402  -70.548  -17.772 1.00 97.08  ? 72  TYR B N     1 
ATOM   6872  C CA    . TYR H 3 69  ? 52.240  -69.415  -18.187 1.00 100.93 ? 72  TYR B CA    1 
ATOM   6873  C C     . TYR H 3 69  ? 53.443  -69.304  -17.260 1.00 101.46 ? 72  TYR B C     1 
ATOM   6874  O O     . TYR H 3 69  ? 53.347  -69.657  -16.091 1.00 92.90  ? 72  TYR B O     1 
ATOM   6875  C CB    . TYR H 3 69  ? 51.446  -68.096  -18.174 1.00 103.42 ? 72  TYR B CB    1 
ATOM   6876  C CG    . TYR H 3 69  ? 50.879  -67.692  -16.814 1.00 100.07 ? 72  TYR B CG    1 
ATOM   6877  C CD1   . TYR H 3 69  ? 49.608  -68.096  -16.419 1.00 98.44  ? 72  TYR B CD1   1 
ATOM   6878  C CD2   . TYR H 3 69  ? 51.609  -66.894  -15.936 1.00 97.67  ? 72  TYR B CD2   1 
ATOM   6879  C CE1   . TYR H 3 69  ? 49.090  -67.730  -15.186 1.00 96.03  ? 72  TYR B CE1   1 
ATOM   6880  C CE2   . TYR H 3 69  ? 51.097  -66.528  -14.702 1.00 93.78  ? 72  TYR B CE2   1 
ATOM   6881  C CZ    . TYR H 3 69  ? 49.837  -66.950  -14.334 1.00 94.51  ? 72  TYR B CZ    1 
ATOM   6882  O OH    . TYR H 3 69  ? 49.307  -66.601  -13.115 1.00 93.84  ? 72  TYR B OH    1 
ATOM   6883  N N     . GLU H 3 70  ? 54.561  -68.796  -17.773 1.00 108.81 ? 73  GLU B N     1 
ATOM   6884  C CA    . GLU H 3 70  ? 55.809  -68.747  -17.000 1.00 120.81 ? 73  GLU B CA    1 
ATOM   6885  C C     . GLU H 3 70  ? 55.881  -67.492  -16.126 1.00 115.65 ? 73  GLU B C     1 
ATOM   6886  O O     . GLU H 3 70  ? 55.201  -66.502  -16.388 1.00 114.80 ? 73  GLU B O     1 
ATOM   6887  C CB    . GLU H 3 70  ? 57.027  -68.803  -17.937 1.00 134.31 ? 73  GLU B CB    1 
ATOM   6888  C CG    . GLU H 3 70  ? 58.110  -69.781  -17.496 1.00 144.43 ? 73  GLU B CG    1 
ATOM   6889  C CD    . GLU H 3 70  ? 57.734  -71.230  -17.762 1.00 150.78 ? 73  GLU B CD    1 
ATOM   6890  O OE1   . GLU H 3 70  ? 57.561  -71.591  -18.947 1.00 155.26 ? 73  GLU B OE1   1 
ATOM   6891  O OE2   . GLU H 3 70  ? 57.617  -72.006  -16.787 1.00 150.31 ? 73  GLU B OE2   1 
ATOM   6892  N N     . ASP H 3 71  ? 56.713  -67.538  -15.092 1.00 113.88 ? 74  ASP B N     1 
ATOM   6893  C CA    . ASP H 3 71  ? 56.931  -66.374  -14.236 1.00 109.11 ? 74  ASP B CA    1 
ATOM   6894  C C     . ASP H 3 71  ? 57.478  -65.203  -15.037 1.00 106.11 ? 74  ASP B C     1 
ATOM   6895  O O     . ASP H 3 71  ? 56.972  -64.098  -14.927 1.00 115.06 ? 74  ASP B O     1 
ATOM   6896  C CB    . ASP H 3 71  ? 57.877  -66.709  -13.078 1.00 107.39 ? 74  ASP B CB    1 
ATOM   6897  C CG    . ASP H 3 71  ? 57.189  -67.483  -11.964 1.00 106.44 ? 74  ASP B CG    1 
ATOM   6898  O OD1   . ASP H 3 71  ? 55.988  -67.821  -12.098 1.00 99.80  ? 74  ASP B OD1   1 
ATOM   6899  O OD2   . ASP H 3 71  ? 57.859  -67.750  -10.945 1.00 106.27 ? 74  ASP B OD2   1 
ATOM   6900  N N     . ALA H 3 72  ? 58.496  -65.447  -15.851 1.00 106.76 ? 75  ALA B N     1 
ATOM   6901  C CA    . ALA H 3 72  ? 59.067  -64.393  -16.692 1.00 111.20 ? 75  ALA B CA    1 
ATOM   6902  C C     . ALA H 3 72  ? 58.099  -63.926  -17.792 1.00 107.78 ? 75  ALA B C     1 
ATOM   6903  O O     . ALA H 3 72  ? 58.283  -62.862  -18.375 1.00 113.02 ? 75  ALA B O     1 
ATOM   6904  C CB    . ALA H 3 72  ? 60.383  -64.858  -17.302 1.00 114.73 ? 75  ALA B CB    1 
ATOM   6905  N N     . GLU H 3 73  ? 57.081  -64.729  -18.076 1.00 105.98 ? 76  GLU B N     1 
ATOM   6906  C CA    . GLU H 3 73  ? 56.062  -64.382  -19.061 1.00 113.74 ? 76  GLU B CA    1 
ATOM   6907  C C     . GLU H 3 73  ? 55.114  -63.321  -18.497 1.00 112.61 ? 76  GLU B C     1 
ATOM   6908  O O     . GLU H 3 73  ? 54.581  -62.496  -19.234 1.00 112.64 ? 76  GLU B O     1 
ATOM   6909  C CB    . GLU H 3 73  ? 55.274  -65.640  -19.439 1.00 126.57 ? 76  GLU B CB    1 
ATOM   6910  C CG    . GLU H 3 73  ? 54.602  -65.611  -20.801 1.00 133.28 ? 76  GLU B CG    1 
ATOM   6911  C CD    . GLU H 3 73  ? 53.659  -66.789  -21.000 1.00 137.31 ? 76  GLU B CD    1 
ATOM   6912  O OE1   . GLU H 3 73  ? 52.536  -66.573  -21.500 1.00 140.79 ? 76  GLU B OE1   1 
ATOM   6913  O OE2   . GLU H 3 73  ? 54.033  -67.930  -20.645 1.00 133.58 ? 76  GLU B OE2   1 
ATOM   6914  N N     . LEU H 3 74  ? 54.903  -63.364  -17.184 1.00 115.02 ? 77  LEU B N     1 
ATOM   6915  C CA    . LEU H 3 74  ? 54.091  -62.373  -16.471 1.00 111.42 ? 77  LEU B CA    1 
ATOM   6916  C C     . LEU H 3 74  ? 54.875  -61.081  -16.324 1.00 104.45 ? 77  LEU B C     1 
ATOM   6917  O O     . LEU H 3 74  ? 54.384  -60.015  -16.652 1.00 110.82 ? 77  LEU B O     1 
ATOM   6918  C CB    . LEU H 3 74  ? 53.723  -62.899  -15.081 1.00 112.90 ? 77  LEU B CB    1 
ATOM   6919  C CG    . LEU H 3 74  ? 52.493  -62.330  -14.378 1.00 114.09 ? 77  LEU B CG    1 
ATOM   6920  C CD1   . LEU H 3 74  ? 52.436  -62.882  -12.962 1.00 115.04 ? 77  LEU B CD1   1 
ATOM   6921  C CD2   . LEU H 3 74  ? 52.481  -60.813  -14.358 1.00 116.66 ? 77  LEU B CD2   1 
ATOM   6922  N N     . GLN H 3 75  ? 56.095  -61.195  -15.813 1.00 103.72 ? 78  GLN B N     1 
ATOM   6923  C CA    . GLN H 3 75  ? 57.024  -60.069  -15.678 1.00 107.56 ? 78  GLN B CA    1 
ATOM   6924  C C     . GLN H 3 75  ? 57.187  -59.232  -16.949 1.00 111.82 ? 78  GLN B C     1 
ATOM   6925  O O     . GLN H 3 75  ? 57.454  -58.034  -16.867 1.00 117.69 ? 78  GLN B O     1 
ATOM   6926  C CB    . GLN H 3 75  ? 58.400  -60.586  -15.242 1.00 111.39 ? 78  GLN B CB    1 
ATOM   6927  C CG    . GLN H 3 75  ? 58.657  -60.487  -13.749 1.00 111.73 ? 78  GLN B CG    1 
ATOM   6928  C CD    . GLN H 3 75  ? 59.339  -59.197  -13.358 1.00 114.41 ? 78  GLN B CD    1 
ATOM   6929  O OE1   . GLN H 3 75  ? 59.951  -59.115  -12.295 1.00 119.11 ? 78  GLN B OE1   1 
ATOM   6930  N NE2   . GLN H 3 75  ? 59.252  -58.185  -14.221 1.00 113.29 ? 78  GLN B NE2   1 
ATOM   6931  N N     . ALA H 3 76  ? 57.046  -59.865  -18.112 1.00 113.54 ? 79  ALA B N     1 
ATOM   6932  C CA    . ALA H 3 76  ? 57.142  -59.172  -19.401 1.00 113.59 ? 79  ALA B CA    1 
ATOM   6933  C C     . ALA H 3 76  ? 56.002  -58.170  -19.602 1.00 110.19 ? 79  ALA B C     1 
ATOM   6934  O O     . ALA H 3 76  ? 56.194  -57.115  -20.217 1.00 111.81 ? 79  ALA B O     1 
ATOM   6935  C CB    . ALA H 3 76  ? 57.165  -60.182  -20.540 1.00 117.08 ? 79  ALA B CB    1 
ATOM   6936  N N     . LEU H 3 77  ? 54.822  -58.510  -19.086 1.00 102.38 ? 80  LEU B N     1 
ATOM   6937  C CA    . LEU H 3 77  ? 53.668  -57.602  -19.106 1.00 98.80  ? 80  LEU B CA    1 
ATOM   6938  C C     . LEU H 3 77  ? 53.904  -56.391  -18.207 1.00 98.95  ? 80  LEU B C     1 
ATOM   6939  O O     . LEU H 3 77  ? 53.690  -55.249  -18.617 1.00 98.58  ? 80  LEU B O     1 
ATOM   6940  C CB    . LEU H 3 77  ? 52.393  -58.324  -18.662 1.00 95.37  ? 80  LEU B CB    1 
ATOM   6941  C CG    . LEU H 3 77  ? 51.657  -59.167  -19.705 1.00 96.73  ? 80  LEU B CG    1 
ATOM   6942  C CD1   . LEU H 3 77  ? 52.598  -60.070  -20.494 1.00 99.55  ? 80  LEU B CD1   1 
ATOM   6943  C CD2   . LEU H 3 77  ? 50.577  -59.987  -19.016 1.00 95.41  ? 80  LEU B CD2   1 
ATOM   6944  N N     . LEU H 3 78  ? 54.352  -56.650  -16.983 1.00 97.16  ? 81  LEU B N     1 
ATOM   6945  C CA    . LEU H 3 78  ? 54.635  -55.583  -16.032 1.00 97.29  ? 81  LEU B CA    1 
ATOM   6946  C C     . LEU H 3 78  ? 55.753  -54.660  -16.525 1.00 107.33 ? 81  LEU B C     1 
ATOM   6947  O O     . LEU H 3 78  ? 55.757  -53.475  -16.195 1.00 122.44 ? 81  LEU B O     1 
ATOM   6948  C CB    . LEU H 3 78  ? 54.994  -56.153  -14.661 1.00 92.58  ? 81  LEU B CB    1 
ATOM   6949  C CG    . LEU H 3 78  ? 54.002  -57.141  -14.041 1.00 92.60  ? 81  LEU B CG    1 
ATOM   6950  C CD1   . LEU H 3 78  ? 54.417  -57.451  -12.613 1.00 96.25  ? 81  LEU B CD1   1 
ATOM   6951  C CD2   . LEU H 3 78  ? 52.573  -56.628  -14.073 1.00 92.03  ? 81  LEU B CD2   1 
ATOM   6952  N N     . ASP H 3 79  ? 56.690  -55.184  -17.313 1.00 111.16 ? 82  ASP B N     1 
ATOM   6953  C CA    . ASP H 3 79  ? 57.760  -54.353  -17.871 1.00 121.31 ? 82  ASP B CA    1 
ATOM   6954  C C     . ASP H 3 79  ? 57.200  -53.205  -18.719 1.00 124.09 ? 82  ASP B C     1 
ATOM   6955  O O     . ASP H 3 79  ? 57.611  -52.047  -18.573 1.00 122.69 ? 82  ASP B O     1 
ATOM   6956  C CB    . ASP H 3 79  ? 58.740  -55.196  -18.703 1.00 129.84 ? 82  ASP B CB    1 
ATOM   6957  C CG    . ASP H 3 79  ? 59.725  -55.982  -17.845 1.00 137.87 ? 82  ASP B CG    1 
ATOM   6958  O OD1   . ASP H 3 79  ? 59.526  -56.083  -16.614 1.00 143.90 ? 82  ASP B OD1   1 
ATOM   6959  O OD2   . ASP H 3 79  ? 60.711  -56.501  -18.411 1.00 146.65 ? 82  ASP B OD2   1 
ATOM   6960  N N     . GLU H 3 80  ? 56.256  -53.529  -19.597 1.00 125.89 ? 83  GLU B N     1 
ATOM   6961  C CA    . GLU H 3 80  ? 55.655  -52.518  -20.469 1.00 126.63 ? 83  GLU B CA    1 
ATOM   6962  C C     . GLU H 3 80  ? 54.649  -51.629  -19.729 1.00 119.00 ? 83  GLU B C     1 
ATOM   6963  O O     . GLU H 3 80  ? 54.550  -50.446  -20.036 1.00 120.93 ? 83  GLU B O     1 
ATOM   6964  C CB    . GLU H 3 80  ? 55.017  -53.148  -21.720 1.00 130.56 ? 83  GLU B CB    1 
ATOM   6965  C CG    . GLU H 3 80  ? 54.053  -54.298  -21.459 1.00 132.15 ? 83  GLU B CG    1 
ATOM   6966  C CD    . GLU H 3 80  ? 53.372  -54.801  -22.717 1.00 131.55 ? 83  GLU B CD    1 
ATOM   6967  O OE1   . GLU H 3 80  ? 53.325  -54.059  -23.723 1.00 133.62 ? 83  GLU B OE1   1 
ATOM   6968  O OE2   . GLU H 3 80  ? 52.878  -55.947  -22.696 1.00 125.04 ? 83  GLU B OE2   1 
ATOM   6969  N N     . ASP H 3 81  ? 53.919  -52.191  -18.762 1.00 112.06 ? 84  ASP B N     1 
ATOM   6970  C CA    . ASP H 3 81  ? 52.957  -51.418  -17.955 1.00 107.43 ? 84  ASP B CA    1 
ATOM   6971  C C     . ASP H 3 81  ? 52.919  -51.868  -16.476 1.00 103.97 ? 84  ASP B C     1 
ATOM   6972  O O     . ASP H 3 81  ? 52.141  -52.749  -16.078 1.00 94.06  ? 84  ASP B O     1 
ATOM   6973  C CB    . ASP H 3 81  ? 51.556  -51.461  -18.591 1.00 109.59 ? 84  ASP B CB    1 
ATOM   6974  C CG    . ASP H 3 81  ? 50.549  -50.512  -17.910 1.00 109.92 ? 84  ASP B CG    1 
ATOM   6975  O OD1   . ASP H 3 81  ? 50.832  -49.962  -16.821 1.00 102.73 ? 84  ASP B OD1   1 
ATOM   6976  O OD2   . ASP H 3 81  ? 49.451  -50.321  -18.475 1.00 109.29 ? 84  ASP B OD2   1 
ATOM   6977  N N     . ASP H 3 82  ? 53.780  -51.226  -15.688 1.00 100.98 ? 85  ASP B N     1 
ATOM   6978  C CA    . ASP H 3 82  ? 53.852  -51.348  -14.222 1.00 99.61  ? 85  ASP B CA    1 
ATOM   6979  C C     . ASP H 3 82  ? 52.505  -51.583  -13.523 1.00 89.75  ? 85  ASP B C     1 
ATOM   6980  O O     . ASP H 3 82  ? 52.385  -52.436  -12.649 1.00 79.34  ? 85  ASP B O     1 
ATOM   6981  C CB    . ASP H 3 82  ? 54.474  -50.048  -13.668 1.00 111.44 ? 85  ASP B CB    1 
ATOM   6982  C CG    . ASP H 3 82  ? 55.360  -50.269  -12.452 1.00 125.62 ? 85  ASP B CG    1 
ATOM   6983  O OD1   . ASP H 3 82  ? 55.420  -51.402  -11.929 1.00 136.88 ? 85  ASP B OD1   1 
ATOM   6984  O OD2   . ASP H 3 82  ? 56.008  -49.288  -12.018 1.00 135.61 ? 85  ASP B OD2   1 
ATOM   6985  N N     . ALA H 3 83  ? 51.498  -50.810  -13.915 1.00 91.02  ? 86  ALA B N     1 
ATOM   6986  C CA    . ALA H 3 83  ? 50.236  -50.736  -13.185 1.00 89.45  ? 86  ALA B CA    1 
ATOM   6987  C C     . ALA H 3 83  ? 49.053  -51.223  -14.010 1.00 84.51  ? 86  ALA B C     1 
ATOM   6988  O O     . ALA H 3 83  ? 48.494  -50.483  -14.817 1.00 84.32  ? 86  ALA B O     1 
ATOM   6989  C CB    . ALA H 3 83  ? 49.999  -49.303  -12.729 1.00 89.92  ? 86  ALA B CB    1 
ATOM   6990  N N     . GLN H 3 84  ? 48.686  -52.479  -13.806 1.00 81.28  ? 87  GLN B N     1 
ATOM   6991  C CA    . GLN H 3 84  ? 47.482  -53.037  -14.407 1.00 78.55  ? 87  GLN B CA    1 
ATOM   6992  C C     . GLN H 3 84  ? 46.732  -53.729  -13.290 1.00 79.37  ? 87  GLN B C     1 
ATOM   6993  O O     . GLN H 3 84  ? 47.266  -53.884  -12.188 1.00 78.86  ? 87  GLN B O     1 
ATOM   6994  C CB    . GLN H 3 84  ? 47.824  -54.022  -15.533 1.00 76.51  ? 87  GLN B CB    1 
ATOM   6995  C CG    . GLN H 3 84  ? 49.089  -53.659  -16.316 1.00 76.67  ? 87  GLN B CG    1 
ATOM   6996  C CD    . GLN H 3 84  ? 49.175  -54.305  -17.695 1.00 73.60  ? 87  GLN B CD    1 
ATOM   6997  O OE1   . GLN H 3 84  ? 48.165  -54.516  -18.367 1.00 69.38  ? 87  GLN B OE1   1 
ATOM   6998  N NE2   . GLN H 3 84  ? 50.395  -54.598  -18.132 1.00 73.08  ? 87  GLN B NE2   1 
ATOM   6999  N N     . THR H 3 85  ? 45.491  -54.118  -13.554 1.00 80.31  ? 88  THR B N     1 
ATOM   7000  C CA    . THR H 3 85  ? 44.728  -54.879  -12.571 1.00 88.00  ? 88  THR B CA    1 
ATOM   7001  C C     . THR H 3 85  ? 45.018  -56.358  -12.736 1.00 90.62  ? 88  THR B C     1 
ATOM   7002  O O     . THR H 3 85  ? 45.492  -56.791  -13.789 1.00 93.26  ? 88  THR B O     1 
ATOM   7003  C CB    . THR H 3 85  ? 43.213  -54.646  -12.700 1.00 91.83  ? 88  THR B CB    1 
ATOM   7004  O OG1   . THR H 3 85  ? 42.870  -54.418  -14.074 1.00 86.40  ? 88  THR B OG1   1 
ATOM   7005  C CG2   . THR H 3 85  ? 42.790  -53.452  -11.858 1.00 94.02  ? 88  THR B CG2   1 
ATOM   7006  N N     . GLN H 3 86  ? 44.737  -57.136  -11.693 1.00 88.54  ? 89  GLN B N     1 
ATOM   7007  C CA    . GLN H 3 86  ? 44.942  -58.579  -11.765 1.00 85.23  ? 89  GLN B CA    1 
ATOM   7008  C C     . GLN H 3 86  ? 44.114  -59.157  -12.909 1.00 86.88  ? 89  GLN B C     1 
ATOM   7009  O O     . GLN H 3 86  ? 44.635  -59.900  -13.743 1.00 90.61  ? 89  GLN B O     1 
ATOM   7010  C CB    . GLN H 3 86  ? 44.623  -59.267  -10.431 1.00 76.89  ? 89  GLN B CB    1 
ATOM   7011  C CG    . GLN H 3 86  ? 45.755  -59.155  -9.414  1.00 72.47  ? 89  GLN B CG    1 
ATOM   7012  C CD    . GLN H 3 86  ? 45.414  -59.767  -8.064  1.00 72.24  ? 89  GLN B CD    1 
ATOM   7013  O OE1   . GLN H 3 86  ? 44.416  -60.472  -7.917  1.00 76.88  ? 89  GLN B OE1   1 
ATOM   7014  N NE2   . GLN H 3 86  ? 46.252  -59.505  -7.071  1.00 71.39  ? 89  GLN B NE2   1 
ATOM   7015  N N     . LYS H 3 87  ? 42.846  -58.770  -12.978 1.00 86.29  ? 90  LYS B N     1 
ATOM   7016  C CA    . LYS H 3 87  ? 41.964  -59.265  -14.024 1.00 89.91  ? 90  LYS B CA    1 
ATOM   7017  C C     . LYS H 3 87  ? 42.377  -58.800  -15.427 1.00 90.07  ? 90  LYS B C     1 
ATOM   7018  O O     . LYS H 3 87  ? 42.032  -59.443  -16.415 1.00 90.46  ? 90  LYS B O     1 
ATOM   7019  C CB    . LYS H 3 87  ? 40.524  -58.869  -13.724 1.00 96.81  ? 90  LYS B CB    1 
ATOM   7020  C CG    . LYS H 3 87  ? 39.493  -59.613  -14.559 1.00 105.60 ? 90  LYS B CG    1 
ATOM   7021  C CD    . LYS H 3 87  ? 38.864  -58.717  -15.614 1.00 114.01 ? 90  LYS B CD    1 
ATOM   7022  C CE    . LYS H 3 87  ? 37.980  -57.652  -14.976 1.00 117.26 ? 90  LYS B CE    1 
ATOM   7023  N NZ    . LYS H 3 87  ? 37.033  -57.043  -15.949 1.00 119.48 ? 90  LYS B NZ    1 
ATOM   7024  N N     . GLN H 3 88  ? 43.110  -57.693  -15.513 1.00 92.46  ? 91  GLN B N     1 
ATOM   7025  C CA    . GLN H 3 88  ? 43.666  -57.236  -16.794 1.00 98.77  ? 91  GLN B CA    1 
ATOM   7026  C C     . GLN H 3 88  ? 44.824  -58.119  -17.231 1.00 96.15  ? 91  GLN B C     1 
ATOM   7027  O O     . GLN H 3 88  ? 44.988  -58.396  -18.418 1.00 95.20  ? 91  GLN B O     1 
ATOM   7028  C CB    . GLN H 3 88  ? 44.159  -55.780  -16.714 1.00 108.24 ? 91  GLN B CB    1 
ATOM   7029  C CG    . GLN H 3 88  ? 43.153  -54.714  -17.142 1.00 108.39 ? 91  GLN B CG    1 
ATOM   7030  C CD    . GLN H 3 88  ? 43.695  -53.305  -16.949 1.00 104.87 ? 91  GLN B CD    1 
ATOM   7031  O OE1   . GLN H 3 88  ? 43.151  -52.524  -16.174 1.00 101.86 ? 91  GLN B OE1   1 
ATOM   7032  N NE2   . GLN H 3 88  ? 44.789  -52.986  -17.634 1.00 101.11 ? 91  GLN B NE2   1 
ATOM   7033  N N     . LEU H 3 89  ? 45.644  -58.528  -16.270 1.00 98.07  ? 92  LEU B N     1 
ATOM   7034  C CA    . LEU H 3 89  ? 46.762  -59.425  -16.543 1.00 100.36 ? 92  LEU B CA    1 
ATOM   7035  C C     . LEU H 3 89  ? 46.223  -60.826  -16.836 1.00 101.09 ? 92  LEU B C     1 
ATOM   7036  O O     . LEU H 3 89  ? 46.575  -61.441  -17.845 1.00 101.87 ? 92  LEU B O     1 
ATOM   7037  C CB    . LEU H 3 89  ? 47.730  -59.449  -15.357 1.00 97.51  ? 92  LEU B CB    1 
ATOM   7038  C CG    . LEU H 3 89  ? 48.409  -58.109  -15.060 1.00 95.78  ? 92  LEU B CG    1 
ATOM   7039  C CD1   . LEU H 3 89  ? 48.939  -58.062  -13.636 1.00 97.05  ? 92  LEU B CD1   1 
ATOM   7040  C CD2   . LEU H 3 89  ? 49.524  -57.842  -16.059 1.00 96.81  ? 92  LEU B CD2   1 
ATOM   7041  N N     . ALA H 3 90  ? 45.350  -61.309  -15.959 1.00 99.89  ? 93  ALA B N     1 
ATOM   7042  C CA    . ALA H 3 90  ? 44.687  -62.598  -16.143 1.00 107.57 ? 93  ALA B CA    1 
ATOM   7043  C C     . ALA H 3 90  ? 44.093  -62.752  -17.543 1.00 113.53 ? 93  ALA B C     1 
ATOM   7044  O O     . ALA H 3 90  ? 44.191  -63.816  -18.158 1.00 126.15 ? 93  ALA B O     1 
ATOM   7045  C CB    . ALA H 3 90  ? 43.598  -62.773  -15.098 1.00 105.21 ? 93  ALA B CB    1 
ATOM   7046  N N     . GLU H 3 91  ? 43.480  -61.683  -18.037 1.00 113.27 ? 94  GLU B N     1 
ATOM   7047  C CA    . GLU H 3 91  ? 42.869  -61.682  -19.357 1.00 113.62 ? 94  GLU B CA    1 
ATOM   7048  C C     . GLU H 3 91  ? 43.912  -61.871  -20.464 1.00 109.34 ? 94  GLU B C     1 
ATOM   7049  O O     . GLU H 3 91  ? 43.658  -62.564  -21.442 1.00 111.04 ? 94  GLU B O     1 
ATOM   7050  C CB    . GLU H 3 91  ? 42.109  -60.374  -19.557 1.00 123.19 ? 94  GLU B CB    1 
ATOM   7051  C CG    . GLU H 3 91  ? 41.180  -60.347  -20.755 1.00 133.95 ? 94  GLU B CG    1 
ATOM   7052  C CD    . GLU H 3 91  ? 40.171  -59.212  -20.675 1.00 140.88 ? 94  GLU B CD    1 
ATOM   7053  O OE1   . GLU H 3 91  ? 39.019  -59.406  -21.115 1.00 143.36 ? 94  GLU B OE1   1 
ATOM   7054  O OE2   . GLU H 3 91  ? 40.526  -58.127  -20.161 1.00 141.85 ? 94  GLU B OE2   1 
ATOM   7055  N N     . GLN H 3 92  ? 45.085  -61.264  -20.297 1.00 105.81 ? 95  GLN B N     1 
ATOM   7056  C CA    . GLN H 3 92  ? 46.166  -61.361  -21.284 1.00 106.72 ? 95  GLN B CA    1 
ATOM   7057  C C     . GLN H 3 92  ? 46.884  -62.704  -21.228 1.00 101.87 ? 95  GLN B C     1 
ATOM   7058  O O     . GLN H 3 92  ? 47.533  -63.106  -22.196 1.00 97.88  ? 95  GLN B O     1 
ATOM   7059  C CB    . GLN H 3 92  ? 47.193  -60.243  -21.067 1.00 112.11 ? 95  GLN B CB    1 
ATOM   7060  C CG    . GLN H 3 92  ? 46.661  -58.835  -21.299 1.00 110.53 ? 95  GLN B CG    1 
ATOM   7061  C CD    . GLN H 3 92  ? 47.604  -57.771  -20.770 1.00 111.09 ? 95  GLN B CD    1 
ATOM   7062  O OE1   . GLN H 3 92  ? 48.649  -57.499  -21.366 1.00 115.42 ? 95  GLN B OE1   1 
ATOM   7063  N NE2   . GLN H 3 92  ? 47.247  -57.169  -19.641 1.00 108.57 ? 95  GLN B NE2   1 
ATOM   7064  N N     . LEU H 3 93  ? 46.775  -63.376  -20.084 1.00 102.83 ? 96  LEU B N     1 
ATOM   7065  C CA    . LEU H 3 93  ? 47.394  -64.685  -19.851 1.00 99.05  ? 96  LEU B CA    1 
ATOM   7066  C C     . LEU H 3 93  ? 46.418  -65.854  -20.025 1.00 95.99  ? 96  LEU B C     1 
ATOM   7067  O O     . LEU H 3 93  ? 46.738  -66.977  -19.659 1.00 95.42  ? 96  LEU B O     1 
ATOM   7068  C CB    . LEU H 3 93  ? 47.991  -64.723  -18.436 1.00 96.89  ? 96  LEU B CB    1 
ATOM   7069  C CG    . LEU H 3 93  ? 49.482  -64.423  -18.298 1.00 94.94  ? 96  LEU B CG    1 
ATOM   7070  C CD1   . LEU H 3 93  ? 49.917  -63.256  -19.168 1.00 94.89  ? 96  LEU B CD1   1 
ATOM   7071  C CD2   . LEU H 3 93  ? 49.809  -64.177  -16.832 1.00 95.62  ? 96  LEU B CD2   1 
ATOM   7072  N N     . GLU H 3 94  ? 45.234  -65.596  -20.573 1.00 102.02 ? 97  GLU B N     1 
ATOM   7073  C CA    . GLU H 3 94  ? 44.231  -66.642  -20.778 1.00 106.67 ? 97  GLU B CA    1 
ATOM   7074  C C     . GLU H 3 94  ? 44.001  -67.427  -19.482 1.00 101.71 ? 97  GLU B C     1 
ATOM   7075  O O     . GLU H 3 94  ? 43.853  -68.644  -19.496 1.00 98.26  ? 97  GLU B O     1 
ATOM   7076  C CB    . GLU H 3 94  ? 44.677  -67.592  -21.902 1.00 116.35 ? 97  GLU B CB    1 
ATOM   7077  C CG    . GLU H 3 94  ? 45.009  -66.915  -23.231 1.00 122.35 ? 97  GLU B CG    1 
ATOM   7078  C CD    . GLU H 3 94  ? 43.915  -67.074  -24.277 1.00 129.32 ? 97  GLU B CD    1 
ATOM   7079  O OE1   . GLU H 3 94  ? 44.251  -67.341  -25.450 1.00 137.01 ? 97  GLU B OE1   1 
ATOM   7080  O OE2   . GLU H 3 94  ? 42.720  -66.940  -23.934 1.00 131.25 ? 97  GLU B OE2   1 
ATOM   7081  N N     . VAL H 3 95  ? 43.974  -66.717  -18.360 1.00 99.26  ? 98  VAL B N     1 
ATOM   7082  C CA    . VAL H 3 95  ? 43.933  -67.357  -17.052 1.00 96.19  ? 98  VAL B CA    1 
ATOM   7083  C C     . VAL H 3 95  ? 42.919  -66.609  -16.161 1.00 93.43  ? 98  VAL B C     1 
ATOM   7084  O O     . VAL H 3 95  ? 42.332  -65.618  -16.605 1.00 94.02  ? 98  VAL B O     1 
ATOM   7085  C CB    . VAL H 3 95  ? 45.379  -67.425  -16.493 1.00 96.77  ? 98  VAL B CB    1 
ATOM   7086  C CG1   . VAL H 3 95  ? 45.598  -66.503  -15.307 1.00 100.28 ? 98  VAL B CG1   1 
ATOM   7087  C CG2   . VAL H 3 95  ? 45.742  -68.859  -16.135 1.00 102.05 ? 98  VAL B CG2   1 
ATOM   7088  N N     . SER H 3 96  ? 42.671  -67.089  -14.942 1.00 87.29  ? 99  SER B N     1 
ATOM   7089  C CA    . SER H 3 96  ? 41.723  -66.412  -14.042 1.00 88.55  ? 99  SER B CA    1 
ATOM   7090  C C     . SER H 3 96  ? 42.445  -65.342  -13.220 1.00 92.15  ? 99  SER B C     1 
ATOM   7091  O O     . SER H 3 96  ? 43.678  -65.261  -13.227 1.00 91.21  ? 99  SER B O     1 
ATOM   7092  C CB    . SER H 3 96  ? 40.991  -67.396  -13.115 1.00 86.47  ? 99  SER B CB    1 
ATOM   7093  O OG    . SER H 3 96  ? 41.617  -67.507  -11.844 1.00 84.28  ? 99  SER B OG    1 
ATOM   7094  N N     . GLN H 3 97  ? 41.672  -64.517  -12.517 1.00 87.22  ? 100 GLN B N     1 
ATOM   7095  C CA    . GLN H 3 97  ? 42.249  -63.435  -11.725 1.00 83.16  ? 100 GLN B CA    1 
ATOM   7096  C C     . GLN H 3 97  ? 43.057  -63.989  -10.562 1.00 80.23  ? 100 GLN B C     1 
ATOM   7097  O O     . GLN H 3 97  ? 44.230  -63.637  -10.394 1.00 81.45  ? 100 GLN B O     1 
ATOM   7098  C CB    . GLN H 3 97  ? 41.160  -62.465  -11.230 1.00 81.56  ? 100 GLN B CB    1 
ATOM   7099  C CG    . GLN H 3 97  ? 41.591  -61.483  -10.140 1.00 73.71  ? 100 GLN B CG    1 
ATOM   7100  C CD    . GLN H 3 97  ? 41.096  -61.880  -8.757  1.00 71.17  ? 100 GLN B CD    1 
ATOM   7101  O OE1   . GLN H 3 97  ? 39.920  -62.186  -8.572  1.00 70.23  ? 100 GLN B OE1   1 
ATOM   7102  N NE2   . GLN H 3 97  ? 41.990  -61.865  -7.778  1.00 68.80  ? 100 GLN B NE2   1 
ATOM   7103  N N     . GLN H 3 98  ? 42.448  -64.871  -9.775  1.00 73.08  ? 101 GLN B N     1 
ATOM   7104  C CA    . GLN H 3 98  ? 43.097  -65.311  -8.533  1.00 76.00  ? 101 GLN B CA    1 
ATOM   7105  C C     . GLN H 3 98  ? 44.370  -66.095  -8.797  1.00 78.87  ? 101 GLN B C     1 
ATOM   7106  O O     . GLN H 3 98  ? 45.276  -66.106  -7.966  1.00 79.89  ? 101 GLN B O     1 
ATOM   7107  C CB    . GLN H 3 98  ? 42.158  -66.074  -7.596  1.00 74.27  ? 101 GLN B CB    1 
ATOM   7108  C CG    . GLN H 3 98  ? 41.041  -66.853  -8.258  1.00 79.06  ? 101 GLN B CG    1 
ATOM   7109  C CD    . GLN H 3 98  ? 39.849  -65.993  -8.650  1.00 76.28  ? 101 GLN B CD    1 
ATOM   7110  O OE1   . GLN H 3 98  ? 39.825  -65.399  -9.733  1.00 75.46  ? 101 GLN B OE1   1 
ATOM   7111  N NE2   . GLN H 3 98  ? 38.844  -65.948  -7.784  1.00 72.73  ? 101 GLN B NE2   1 
ATOM   7112  N N     . ALA H 3 99  ? 44.449  -66.733  -9.960  1.00 83.30  ? 102 ALA B N     1 
ATOM   7113  C CA    . ALA H 3 99  ? 45.698  -67.336  -10.400 1.00 87.01  ? 102 ALA B CA    1 
ATOM   7114  C C     . ALA H 3 99  ? 46.815  -66.288  -10.376 1.00 82.82  ? 102 ALA B C     1 
ATOM   7115  O O     . ALA H 3 99  ? 47.924  -66.551  -9.893  1.00 76.09  ? 102 ALA B O     1 
ATOM   7116  C CB    . ALA H 3 99  ? 45.540  -67.922  -11.795 1.00 89.06  ? 102 ALA B CB    1 
ATOM   7117  N N     . VAL H 3 100 ? 46.498  -65.093  -10.871 1.00 84.60  ? 103 VAL B N     1 
ATOM   7118  C CA    . VAL H 3 100 ? 47.480  -64.012  -10.965 1.00 86.90  ? 103 VAL B CA    1 
ATOM   7119  C C     . VAL H 3 100 ? 47.849  -63.449  -9.591  1.00 85.39  ? 103 VAL B C     1 
ATOM   7120  O O     . VAL H 3 100 ? 49.006  -63.066  -9.367  1.00 79.67  ? 103 VAL B O     1 
ATOM   7121  C CB    . VAL H 3 100 ? 46.996  -62.872  -11.879 1.00 86.79  ? 103 VAL B CB    1 
ATOM   7122  C CG1   . VAL H 3 100 ? 48.079  -61.813  -12.011 1.00 90.99  ? 103 VAL B CG1   1 
ATOM   7123  C CG2   . VAL H 3 100 ? 46.617  -63.415  -13.249 1.00 88.06  ? 103 VAL B CG2   1 
ATOM   7124  N N     . SER H 3 101 ? 46.878  -63.405  -8.676  1.00 82.29  ? 104 SER B N     1 
ATOM   7125  C CA    . SER H 3 101 ? 47.168  -63.063  -7.284  1.00 85.83  ? 104 SER B CA    1 
ATOM   7126  C C     . SER H 3 101 ? 48.306  -63.935  -6.765  1.00 89.18  ? 104 SER B C     1 
ATOM   7127  O O     . SER H 3 101 ? 49.353  -63.433  -6.347  1.00 94.77  ? 104 SER B O     1 
ATOM   7128  C CB    . SER H 3 101 ? 45.932  -63.244  -6.398  1.00 88.47  ? 104 SER B CB    1 
ATOM   7129  O OG    . SER H 3 101 ? 46.284  -63.246  -5.023  1.00 88.67  ? 104 SER B OG    1 
ATOM   7130  N N     . ASN H 3 102 ? 48.099  -65.245  -6.839  1.00 92.75  ? 105 ASN B N     1 
ATOM   7131  C CA    . ASN H 3 102 ? 49.073  -66.221  -6.357  1.00 92.48  ? 105 ASN B CA    1 
ATOM   7132  C C     . ASN H 3 102 ? 50.471  -66.036  -6.972  1.00 88.82  ? 105 ASN B C     1 
ATOM   7133  O O     . ASN H 3 102 ? 51.446  -65.891  -6.242  1.00 87.31  ? 105 ASN B O     1 
ATOM   7134  C CB    . ASN H 3 102 ? 48.558  -67.642  -6.608  1.00 91.53  ? 105 ASN B CB    1 
ATOM   7135  C CG    . ASN H 3 102 ? 47.216  -67.908  -5.937  1.00 89.32  ? 105 ASN B CG    1 
ATOM   7136  O OD1   . ASN H 3 102 ? 47.049  -67.683  -4.742  1.00 90.21  ? 105 ASN B OD1   1 
ATOM   7137  N ND2   . ASN H 3 102 ? 46.259  -68.403  -6.707  1.00 90.67  ? 105 ASN B ND2   1 
ATOM   7138  N N     . ARG H 3 103 ? 50.569  -66.016  -8.300  1.00 85.42  ? 106 ARG B N     1 
ATOM   7139  C CA    . ARG H 3 103 ? 51.871  -65.853  -8.957  1.00 92.21  ? 106 ARG B CA    1 
ATOM   7140  C C     . ARG H 3 103 ? 52.600  -64.602  -8.506  1.00 96.12  ? 106 ARG B C     1 
ATOM   7141  O O     . ARG H 3 103 ? 53.836  -64.566  -8.494  1.00 95.16  ? 106 ARG B O     1 
ATOM   7142  C CB    . ARG H 3 103 ? 51.727  -65.779  -10.472 1.00 93.92  ? 106 ARG B CB    1 
ATOM   7143  C CG    . ARG H 3 103 ? 51.381  -67.090  -11.122 1.00 98.16  ? 106 ARG B CG    1 
ATOM   7144  C CD    . ARG H 3 103 ? 52.421  -68.168  -10.897 1.00 100.26 ? 106 ARG B CD    1 
ATOM   7145  N NE    . ARG H 3 103 ? 52.214  -69.205  -11.901 1.00 101.57 ? 106 ARG B NE    1 
ATOM   7146  C CZ    . ARG H 3 103 ? 52.862  -69.286  -13.059 1.00 102.63 ? 106 ARG B CZ    1 
ATOM   7147  N NH1   . ARG H 3 103 ? 52.561  -70.263  -13.901 1.00 105.42 ? 106 ARG B NH1   1 
ATOM   7148  N NH2   . ARG H 3 103 ? 53.819  -68.421  -13.380 1.00 99.31  ? 106 ARG B NH2   1 
ATOM   7149  N N     . LEU H 3 104 ? 51.831  -63.572  -8.164  1.00 96.30  ? 107 LEU B N     1 
ATOM   7150  C CA    . LEU H 3 104 ? 52.406  -62.301  -7.763  1.00 90.33  ? 107 LEU B CA    1 
ATOM   7151  C C     . LEU H 3 104 ? 53.016  -62.400  -6.370  1.00 88.54  ? 107 LEU B C     1 
ATOM   7152  O O     . LEU H 3 104 ? 54.150  -61.971  -6.169  1.00 83.77  ? 107 LEU B O     1 
ATOM   7153  C CB    . LEU H 3 104 ? 51.368  -61.181  -7.866  1.00 86.22  ? 107 LEU B CB    1 
ATOM   7154  C CG    . LEU H 3 104 ? 51.048  -60.780  -9.312  1.00 83.20  ? 107 LEU B CG    1 
ATOM   7155  C CD1   . LEU H 3 104 ? 49.794  -59.930  -9.364  1.00 83.41  ? 107 LEU B CD1   1 
ATOM   7156  C CD2   . LEU H 3 104 ? 52.210  -60.046  -9.965  1.00 83.12  ? 107 LEU B CD2   1 
ATOM   7157  N N     . ARG H 3 105 ? 52.294  -62.990  -5.420  1.00 90.39  ? 108 ARG B N     1 
ATOM   7158  C CA    . ARG H 3 105 ? 52.872  -63.217  -4.092  1.00 100.18 ? 108 ARG B CA    1 
ATOM   7159  C C     . ARG H 3 105 ? 53.928  -64.312  -4.134  1.00 102.04 ? 108 ARG B C     1 
ATOM   7160  O O     . ARG H 3 105 ? 54.810  -64.346  -3.282  1.00 106.35 ? 108 ARG B O     1 
ATOM   7161  C CB    . ARG H 3 105 ? 51.811  -63.553  -3.041  1.00 110.23 ? 108 ARG B CB    1 
ATOM   7162  C CG    . ARG H 3 105 ? 50.943  -64.750  -3.369  1.00 122.63 ? 108 ARG B CG    1 
ATOM   7163  C CD    . ARG H 3 105 ? 50.616  -65.572  -2.136  1.00 137.35 ? 108 ARG B CD    1 
ATOM   7164  N NE    . ARG H 3 105 ? 49.942  -64.800  -1.094  1.00 145.02 ? 108 ARG B NE    1 
ATOM   7165  C CZ    . ARG H 3 105 ? 49.496  -65.318  0.049   1.00 156.20 ? 108 ARG B CZ    1 
ATOM   7166  N NH1   . ARG H 3 105 ? 49.644  -66.616  0.311   1.00 160.91 ? 108 ARG B NH1   1 
ATOM   7167  N NH2   . ARG H 3 105 ? 48.894  -64.537  0.939   1.00 160.13 ? 108 ARG B NH2   1 
ATOM   7168  N N     . GLU H 3 106 ? 53.831  -65.204  -5.122  1.00 103.78 ? 109 GLU B N     1 
ATOM   7169  C CA    . GLU H 3 106 ? 54.820  -66.257  -5.327  1.00 103.35 ? 109 GLU B CA    1 
ATOM   7170  C C     . GLU H 3 106 ? 56.129  -65.648  -5.834  1.00 97.83  ? 109 GLU B C     1 
ATOM   7171  O O     . GLU H 3 106 ? 57.201  -65.978  -5.332  1.00 105.51 ? 109 GLU B O     1 
ATOM   7172  C CB    . GLU H 3 106 ? 54.273  -67.316  -6.290  1.00 112.53 ? 109 GLU B CB    1 
ATOM   7173  C CG    . GLU H 3 106 ? 55.137  -68.560  -6.443  1.00 119.23 ? 109 GLU B CG    1 
ATOM   7174  C CD    . GLU H 3 106 ? 55.830  -68.623  -7.791  1.00 123.29 ? 109 GLU B CD    1 
ATOM   7175  O OE1   . GLU H 3 106 ? 55.129  -68.839  -8.805  1.00 130.84 ? 109 GLU B OE1   1 
ATOM   7176  O OE2   . GLU H 3 106 ? 57.069  -68.459  -7.840  1.00 119.79 ? 109 GLU B OE2   1 
ATOM   7177  N N     . MET H 3 107 ? 56.039  -64.746  -6.808  1.00 90.44  ? 110 MET B N     1 
ATOM   7178  C CA    . MET H 3 107 ? 57.163  -63.863  -7.143  1.00 88.75  ? 110 MET B CA    1 
ATOM   7179  C C     . MET H 3 107 ? 57.300  -62.812  -6.042  1.00 89.77  ? 110 MET B C     1 
ATOM   7180  O O     . MET H 3 107 ? 56.505  -62.774  -5.101  1.00 88.45  ? 110 MET B O     1 
ATOM   7181  C CB    . MET H 3 107 ? 56.932  -63.177  -8.488  1.00 88.71  ? 110 MET B CB    1 
ATOM   7182  C CG    . MET H 3 107 ? 56.802  -64.142  -9.653  1.00 92.23  ? 110 MET B CG    1 
ATOM   7183  S SD    . MET H 3 107 ? 55.653  -63.584  -10.927 1.00 96.74  ? 110 MET B SD    1 
ATOM   7184  C CE    . MET H 3 107 ? 56.751  -62.595  -11.939 1.00 93.76  ? 110 MET B CE    1 
ATOM   7185  N N     . GLY H 3 108 ? 58.292  -61.941  -6.152  1.00 92.36  ? 111 GLY B N     1 
ATOM   7186  C CA    . GLY H 3 108 ? 58.534  -60.955  -5.097  1.00 101.02 ? 111 GLY B CA    1 
ATOM   7187  C C     . GLY H 3 108 ? 57.617  -59.736  -5.069  1.00 101.55 ? 111 GLY B C     1 
ATOM   7188  O O     . GLY H 3 108 ? 57.903  -58.787  -4.351  1.00 107.12 ? 111 GLY B O     1 
ATOM   7189  N N     . LYS H 3 109 ? 56.507  -59.763  -5.807  1.00 97.85  ? 112 LYS B N     1 
ATOM   7190  C CA    . LYS H 3 109 ? 55.748  -58.542  -6.117  1.00 92.91  ? 112 LYS B CA    1 
ATOM   7191  C C     . LYS H 3 109 ? 54.773  -58.085  -5.032  1.00 89.59  ? 112 LYS B C     1 
ATOM   7192  O O     . LYS H 3 109 ? 54.048  -58.892  -4.458  1.00 78.83  ? 112 LYS B O     1 
ATOM   7193  C CB    . LYS H 3 109 ? 54.958  -58.719  -7.422  1.00 93.60  ? 112 LYS B CB    1 
ATOM   7194  C CG    . LYS H 3 109 ? 55.786  -59.148  -8.624  1.00 95.89  ? 112 LYS B CG    1 
ATOM   7195  C CD    . LYS H 3 109 ? 57.009  -58.269  -8.823  1.00 97.87  ? 112 LYS B CD    1 
ATOM   7196  C CE    . LYS H 3 109 ? 57.655  -58.506  -10.181 1.00 102.03 ? 112 LYS B CE    1 
ATOM   7197  N NZ    . LYS H 3 109 ? 58.824  -57.608  -10.418 1.00 105.24 ? 112 LYS B NZ    1 
ATOM   7198  N N     . ILE H 3 110 ? 54.762  -56.770  -4.786  1.00 94.53  ? 113 ILE B N     1 
ATOM   7199  C CA    . ILE H 3 110 ? 53.739  -56.104  -3.962  1.00 90.41  ? 113 ILE B CA    1 
ATOM   7200  C C     . ILE H 3 110 ? 53.049  -54.990  -4.748  1.00 89.48  ? 113 ILE B C     1 
ATOM   7201  O O     . ILE H 3 110 ? 53.483  -54.625  -5.847  1.00 84.80  ? 113 ILE B O     1 
ATOM   7202  C CB    . ILE H 3 110 ? 54.312  -55.504  -2.658  1.00 89.19  ? 113 ILE B CB    1 
ATOM   7203  C CG1   . ILE H 3 110 ? 55.532  -54.622  -2.947  1.00 90.79  ? 113 ILE B CG1   1 
ATOM   7204  C CG2   . ILE H 3 110 ? 54.650  -56.615  -1.667  1.00 89.66  ? 113 ILE B CG2   1 
ATOM   7205  C CD1   . ILE H 3 110 ? 55.976  -53.786  -1.763  1.00 93.17  ? 113 ILE B CD1   1 
ATOM   7206  N N     . GLN H 3 111 ? 51.965  -54.471  -4.172  1.00 91.71  ? 114 GLN B N     1 
ATOM   7207  C CA    . GLN H 3 111 ? 51.192  -53.378  -4.758  1.00 90.77  ? 114 GLN B CA    1 
ATOM   7208  C C     . GLN H 3 111 ? 51.392  -52.108  -3.944  1.00 90.78  ? 114 GLN B C     1 
ATOM   7209  O O     . GLN H 3 111 ? 50.996  -52.048  -2.779  1.00 92.76  ? 114 GLN B O     1 
ATOM   7210  C CB    . GLN H 3 111 ? 49.706  -53.729  -4.756  1.00 92.38  ? 114 GLN B CB    1 
ATOM   7211  C CG    . GLN H 3 111 ? 48.873  -52.883  -5.707  1.00 90.88  ? 114 GLN B CG    1 
ATOM   7212  C CD    . GLN H 3 111 ? 47.460  -52.651  -5.207  1.00 89.62  ? 114 GLN B CD    1 
ATOM   7213  O OE1   . GLN H 3 111 ? 47.233  -52.460  -4.011  1.00 91.36  ? 114 GLN B OE1   1 
ATOM   7214  N NE2   . GLN H 3 111 ? 46.503  -52.644  -6.126  1.00 87.38  ? 114 GLN B NE2   1 
ATOM   7215  N N     . LYS H 3 112 ? 52.001  -51.097  -4.554  1.00 89.88  ? 115 LYS B N     1 
ATOM   7216  C CA    . LYS H 3 112 ? 52.211  -49.814  -3.887  1.00 88.35  ? 115 LYS B CA    1 
ATOM   7217  C C     . LYS H 3 112 ? 51.709  -48.678  -4.770  1.00 90.93  ? 115 LYS B C     1 
ATOM   7218  O O     . LYS H 3 112 ? 51.858  -48.727  -5.995  1.00 89.35  ? 115 LYS B O     1 
ATOM   7219  C CB    . LYS H 3 112 ? 53.683  -49.621  -3.532  1.00 84.47  ? 115 LYS B CB    1 
ATOM   7220  C CG    . LYS H 3 112 ? 54.629  -49.687  -4.709  1.00 86.31  ? 115 LYS B CG    1 
ATOM   7221  C CD    . LYS H 3 112 ? 56.075  -49.760  -4.250  1.00 89.24  ? 115 LYS B CD    1 
ATOM   7222  C CE    . LYS H 3 112 ? 56.488  -48.545  -3.443  1.00 86.27  ? 115 LYS B CE    1 
ATOM   7223  N NZ    . LYS H 3 112 ? 57.960  -48.495  -3.242  1.00 86.03  ? 115 LYS B NZ    1 
ATOM   7224  N N     . VAL H 3 113 ? 51.112  -47.664  -4.139  1.00 90.87  ? 116 VAL B N     1 
ATOM   7225  C CA    . VAL H 3 113 ? 50.461  -46.572  -4.870  1.00 88.88  ? 116 VAL B CA    1 
ATOM   7226  C C     . VAL H 3 113 ? 51.461  -45.576  -5.432  1.00 87.17  ? 116 VAL B C     1 
ATOM   7227  O O     . VAL H 3 113 ? 52.499  -45.295  -4.827  1.00 78.20  ? 116 VAL B O     1 
ATOM   7228  C CB    . VAL H 3 113 ? 49.450  -45.800  -4.001  1.00 89.24  ? 116 VAL B CB    1 
ATOM   7229  C CG1   . VAL H 3 113 ? 48.474  -46.763  -3.337  1.00 93.43  ? 116 VAL B CG1   1 
ATOM   7230  C CG2   . VAL H 3 113 ? 50.164  -44.944  -2.963  1.00 90.11  ? 116 VAL B CG2   1 
ATOM   7231  N N     . GLY H 3 114 ? 51.121  -45.034  -6.595  1.00 93.69  ? 117 GLY B N     1 
ATOM   7232  C CA    . GLY H 3 114 ? 51.954  -44.051  -7.269  1.00 98.59  ? 117 GLY B CA    1 
ATOM   7233  C C     . GLY H 3 114 ? 52.043  -42.730  -6.532  1.00 101.43 ? 117 GLY B C     1 
ATOM   7234  O O     . GLY H 3 114 ? 51.178  -42.379  -5.728  1.00 107.60 ? 117 GLY B O     1 
ATOM   7235  N N     . ARG H 3 115 ? 53.105  -41.994  -6.820  1.00 102.21 ? 118 ARG B N     1 
ATOM   7236  C CA    . ARG H 3 115 ? 53.335  -40.707  -6.200  1.00 95.99  ? 118 ARG B CA    1 
ATOM   7237  C C     . ARG H 3 115 ? 52.586  -39.636  -6.986  1.00 92.65  ? 118 ARG B C     1 
ATOM   7238  O O     . ARG H 3 115 ? 52.461  -39.727  -8.209  1.00 92.11  ? 118 ARG B O     1 
ATOM   7239  C CB    . ARG H 3 115 ? 54.830  -40.409  -6.192  1.00 98.93  ? 118 ARG B CB    1 
ATOM   7240  C CG    . ARG H 3 115 ? 55.288  -39.660  -4.967  1.00 104.06 ? 118 ARG B CG    1 
ATOM   7241  C CD    . ARG H 3 115 ? 56.801  -39.564  -4.914  1.00 107.08 ? 118 ARG B CD    1 
ATOM   7242  N NE    . ARG H 3 115 ? 57.213  -38.298  -4.323  1.00 110.94 ? 118 ARG B NE    1 
ATOM   7243  C CZ    . ARG H 3 115 ? 57.046  -37.967  -3.046  1.00 112.43 ? 118 ARG B CZ    1 
ATOM   7244  N NH1   . ARG H 3 115 ? 56.476  -38.805  -2.192  1.00 113.59 ? 118 ARG B NH1   1 
ATOM   7245  N NH2   . ARG H 3 115 ? 57.454  -36.784  -2.615  1.00 116.72 ? 118 ARG B NH2   1 
ATOM   7246  N N     . TRP H 3 116 ? 52.065  -38.637  -6.282  1.00 90.01  ? 119 TRP B N     1 
ATOM   7247  C CA    . TRP H 3 116 ? 51.514  -37.457  -6.939  1.00 81.88  ? 119 TRP B CA    1 
ATOM   7248  C C     . TRP H 3 116 ? 52.685  -36.566  -7.299  1.00 81.44  ? 119 TRP B C     1 
ATOM   7249  O O     . TRP H 3 116 ? 53.663  -36.493  -6.555  1.00 84.91  ? 119 TRP B O     1 
ATOM   7250  C CB    . TRP H 3 116 ? 50.585  -36.681  -6.013  1.00 78.78  ? 119 TRP B CB    1 
ATOM   7251  C CG    . TRP H 3 116 ? 49.130  -37.064  -6.042  1.00 74.12  ? 119 TRP B CG    1 
ATOM   7252  C CD1   . TRP H 3 116 ? 48.348  -37.357  -4.961  1.00 75.22  ? 119 TRP B CD1   1 
ATOM   7253  C CD2   . TRP H 3 116 ? 48.274  -37.146  -7.187  1.00 67.71  ? 119 TRP B CD2   1 
ATOM   7254  N NE1   . TRP H 3 116 ? 47.061  -37.628  -5.364  1.00 73.98  ? 119 TRP B NE1   1 
ATOM   7255  C CE2   . TRP H 3 116 ? 46.990  -37.510  -6.725  1.00 66.22  ? 119 TRP B CE2   1 
ATOM   7256  C CE3   . TRP H 3 116 ? 48.468  -36.963  -8.556  1.00 70.54  ? 119 TRP B CE3   1 
ATOM   7257  C CZ2   . TRP H 3 116 ? 45.909  -37.692  -7.578  1.00 62.05  ? 119 TRP B CZ2   1 
ATOM   7258  C CZ3   . TRP H 3 116 ? 47.385  -37.147  -9.412  1.00 69.82  ? 119 TRP B CZ3   1 
ATOM   7259  C CH2   . TRP H 3 116 ? 46.120  -37.505  -8.912  1.00 65.82  ? 119 TRP B CH2   1 
ATOM   7260  N N     . VAL H 3 117 ? 52.589  -35.889  -8.434  1.00 81.39  ? 120 VAL B N     1 
ATOM   7261  C CA    . VAL H 3 117 ? 53.650  -34.994  -8.870  1.00 84.38  ? 120 VAL B CA    1 
ATOM   7262  C C     . VAL H 3 117 ? 53.037  -33.661  -9.323  1.00 89.08  ? 120 VAL B C     1 
ATOM   7263  O O     . VAL H 3 117 ? 52.014  -33.658  -10.000 1.00 91.60  ? 120 VAL B O     1 
ATOM   7264  C CB    . VAL H 3 117 ? 54.528  -35.680  -9.943  1.00 84.53  ? 120 VAL B CB    1 
ATOM   7265  C CG1   . VAL H 3 117 ? 54.652  -34.852  -11.215 1.00 86.84  ? 120 VAL B CG1   1 
ATOM   7266  C CG2   . VAL H 3 117 ? 55.894  -36.016  -9.361  1.00 83.63  ? 120 VAL B CG2   1 
ATOM   7267  N N     . PRO H 3 118 ? 53.661  -32.528  -8.938  1.00 93.89  ? 121 PRO B N     1 
ATOM   7268  C CA    . PRO H 3 118 ? 53.079  -31.179  -9.072  1.00 92.24  ? 121 PRO B CA    1 
ATOM   7269  C C     . PRO H 3 118 ? 52.428  -30.818  -10.415 1.00 89.90  ? 121 PRO B C     1 
ATOM   7270  O O     . PRO H 3 118 ? 51.363  -30.210  -10.418 1.00 90.24  ? 121 PRO B O     1 
ATOM   7271  C CB    . PRO H 3 118 ? 54.267  -30.251  -8.821  1.00 90.14  ? 121 PRO B CB    1 
ATOM   7272  C CG    . PRO H 3 118 ? 55.219  -31.040  -8.009  1.00 92.14  ? 121 PRO B CG    1 
ATOM   7273  C CD    . PRO H 3 118 ? 54.994  -32.490  -8.305  1.00 92.78  ? 121 PRO B CD    1 
ATOM   7274  N N     . HIS H 3 119 ? 53.048  -31.164  -11.537 1.00 90.69  ? 122 HIS B N     1 
ATOM   7275  C CA    . HIS H 3 119 ? 52.539  -30.707  -12.833 1.00 99.11  ? 122 HIS B CA    1 
ATOM   7276  C C     . HIS H 3 119 ? 52.976  -31.587  -14.006 1.00 99.46  ? 122 HIS B C     1 
ATOM   7277  O O     . HIS H 3 119 ? 53.989  -32.276  -13.936 1.00 96.92  ? 122 HIS B O     1 
ATOM   7278  C CB    . HIS H 3 119 ? 52.981  -29.253  -13.069 1.00 108.65 ? 122 HIS B CB    1 
ATOM   7279  C CG    . HIS H 3 119 ? 52.342  -28.600  -14.259 1.00 115.40 ? 122 HIS B CG    1 
ATOM   7280  N ND1   . HIS H 3 119 ? 51.090  -28.024  -14.211 1.00 116.92 ? 122 HIS B ND1   1 
ATOM   7281  C CD2   . HIS H 3 119 ? 52.787  -28.426  -15.526 1.00 114.53 ? 122 HIS B CD2   1 
ATOM   7282  C CE1   . HIS H 3 119 ? 50.789  -27.532  -15.399 1.00 120.23 ? 122 HIS B CE1   1 
ATOM   7283  N NE2   . HIS H 3 119 ? 51.802  -27.764  -16.215 1.00 120.72 ? 122 HIS B NE2   1 
ATOM   7284  N N     . GLU H 3 120 ? 52.192  -31.555  -15.082 1.00 104.76 ? 123 GLU B N     1 
ATOM   7285  C CA    . GLU H 3 120 ? 52.525  -32.268  -16.317 1.00 109.33 ? 123 GLU B CA    1 
ATOM   7286  C C     . GLU H 3 120 ? 53.470  -31.385  -17.142 1.00 102.30 ? 123 GLU B C     1 
ATOM   7287  O O     . GLU H 3 120 ? 53.033  -30.545  -17.924 1.00 105.58 ? 123 GLU B O     1 
ATOM   7288  C CB    . GLU H 3 120 ? 51.242  -32.614  -17.097 1.00 115.24 ? 123 GLU B CB    1 
ATOM   7289  C CG    . GLU H 3 120 ? 51.179  -34.037  -17.643 1.00 119.71 ? 123 GLU B CG    1 
ATOM   7290  C CD    . GLU H 3 120 ? 52.016  -34.242  -18.891 1.00 123.27 ? 123 GLU B CD    1 
ATOM   7291  O OE1   . GLU H 3 120 ? 51.439  -34.596  -19.942 1.00 124.94 ? 123 GLU B OE1   1 
ATOM   7292  O OE2   . GLU H 3 120 ? 53.247  -34.051  -18.821 1.00 124.65 ? 123 GLU B OE2   1 
ATOM   7293  N N     . LEU H 3 121 ? 54.769  -31.566  -16.942 1.00 99.14  ? 124 LEU B N     1 
ATOM   7294  C CA    . LEU H 3 121 ? 55.761  -30.713  -17.580 1.00 105.24 ? 124 LEU B CA    1 
ATOM   7295  C C     . LEU H 3 121 ? 55.908  -31.073  -19.047 1.00 112.84 ? 124 LEU B C     1 
ATOM   7296  O O     . LEU H 3 121 ? 55.670  -32.217  -19.431 1.00 114.05 ? 124 LEU B O     1 
ATOM   7297  C CB    . LEU H 3 121 ? 57.120  -30.849  -16.889 1.00 106.80 ? 124 LEU B CB    1 
ATOM   7298  C CG    . LEU H 3 121 ? 57.191  -30.538  -15.389 1.00 108.98 ? 124 LEU B CG    1 
ATOM   7299  C CD1   . LEU H 3 121 ? 58.594  -30.815  -14.869 1.00 112.09 ? 124 LEU B CD1   1 
ATOM   7300  C CD2   . LEU H 3 121 ? 56.781  -29.106  -15.075 1.00 106.14 ? 124 LEU B CD2   1 
ATOM   7301  N N     . ASN H 3 122 ? 56.298  -30.088  -19.856 1.00 126.22 ? 125 ASN B N     1 
ATOM   7302  C CA    . ASN H 3 122 ? 56.671  -30.322  -21.255 1.00 138.68 ? 125 ASN B CA    1 
ATOM   7303  C C     . ASN H 3 122 ? 58.182  -30.463  -21.325 1.00 141.82 ? 125 ASN B C     1 
ATOM   7304  O O     . ASN H 3 122 ? 58.860  -30.423  -20.300 1.00 151.31 ? 125 ASN B O     1 
ATOM   7305  C CB    . ASN H 3 122 ? 56.257  -29.164  -22.178 1.00 142.93 ? 125 ASN B CB    1 
ATOM   7306  C CG    . ASN H 3 122 ? 55.026  -28.422  -21.701 1.00 149.16 ? 125 ASN B CG    1 
ATOM   7307  O OD1   . ASN H 3 122 ? 54.217  -28.941  -20.931 1.00 156.62 ? 125 ASN B OD1   1 
ATOM   7308  N ND2   . ASN H 3 122 ? 54.884  -27.187  -22.161 1.00 151.37 ? 125 ASN B ND2   1 
ATOM   7309  N N     . GLU H 3 123 ? 58.710  -30.615  -22.535 1.00 139.99 ? 126 GLU B N     1 
ATOM   7310  C CA    . GLU H 3 123 ? 60.158  -30.614  -22.733 1.00 139.64 ? 126 GLU B CA    1 
ATOM   7311  C C     . GLU H 3 123 ? 60.717  -29.209  -22.481 1.00 135.84 ? 126 GLU B C     1 
ATOM   7312  O O     . GLU H 3 123 ? 61.877  -29.049  -22.095 1.00 126.62 ? 126 GLU B O     1 
ATOM   7313  C CB    . GLU H 3 123 ? 60.509  -31.109  -24.138 1.00 143.17 ? 126 GLU B CB    1 
ATOM   7314  C CG    . GLU H 3 123 ? 59.933  -32.487  -24.452 1.00 145.60 ? 126 GLU B CG    1 
ATOM   7315  C CD    . GLU H 3 123 ? 60.709  -33.243  -25.517 1.00 145.90 ? 126 GLU B CD    1 
ATOM   7316  O OE1   . GLU H 3 123 ? 60.076  -33.744  -26.472 1.00 137.61 ? 126 GLU B OE1   1 
ATOM   7317  O OE2   . GLU H 3 123 ? 61.949  -33.347  -25.396 1.00 146.27 ? 126 GLU B OE2   1 
ATOM   7318  N N     . ARG H 3 124 ? 59.870  -28.204  -22.698 1.00 139.52 ? 127 ARG B N     1 
ATOM   7319  C CA    . ARG H 3 124 ? 60.172  -26.805  -22.369 1.00 143.35 ? 127 ARG B CA    1 
ATOM   7320  C C     . ARG H 3 124 ? 60.580  -26.593  -20.903 1.00 126.89 ? 127 ARG B C     1 
ATOM   7321  O O     . ARG H 3 124 ? 61.724  -26.220  -20.625 1.00 116.88 ? 127 ARG B O     1 
ATOM   7322  C CB    . ARG H 3 124 ? 58.965  -25.909  -22.709 1.00 156.99 ? 127 ARG B CB    1 
ATOM   7323  C CG    . ARG H 3 124 ? 59.166  -25.010  -23.918 1.00 165.67 ? 127 ARG B CG    1 
ATOM   7324  C CD    . ARG H 3 124 ? 59.895  -23.748  -23.498 1.00 173.56 ? 127 ARG B CD    1 
ATOM   7325  N NE    . ARG H 3 124 ? 60.176  -22.850  -24.612 1.00 183.54 ? 127 ARG B NE    1 
ATOM   7326  C CZ    . ARG H 3 124 ? 60.774  -21.666  -24.488 1.00 188.03 ? 127 ARG B CZ    1 
ATOM   7327  N NH1   . ARG H 3 124 ? 60.988  -20.920  -25.568 1.00 190.62 ? 127 ARG B NH1   1 
ATOM   7328  N NH2   . ARG H 3 124 ? 61.158  -21.222  -23.293 1.00 184.18 ? 127 ARG B NH2   1 
ATOM   7329  N N     . GLN H 3 125 ? 59.641  -26.826  -19.981 1.00 110.11 ? 128 GLN B N     1 
ATOM   7330  C CA    . GLN H 3 125 ? 59.890  -26.634  -18.547 1.00 100.89 ? 128 GLN B CA    1 
ATOM   7331  C C     . GLN H 3 125 ? 61.049  -27.491  -18.048 1.00 103.84 ? 128 GLN B C     1 
ATOM   7332  O O     . GLN H 3 125 ? 61.824  -27.051  -17.199 1.00 97.88  ? 128 GLN B O     1 
ATOM   7333  C CB    . GLN H 3 125 ? 58.643  -26.950  -17.715 1.00 94.54  ? 128 GLN B CB    1 
ATOM   7334  C CG    . GLN H 3 125 ? 57.503  -25.955  -17.857 1.00 93.34  ? 128 GLN B CG    1 
ATOM   7335  C CD    . GLN H 3 125 ? 56.387  -26.464  -18.747 1.00 92.54  ? 128 GLN B CD    1 
ATOM   7336  O OE1   . GLN H 3 125 ? 56.603  -26.761  -19.922 1.00 91.12  ? 128 GLN B OE1   1 
ATOM   7337  N NE2   . GLN H 3 125 ? 55.186  -26.573  -18.188 1.00 91.97  ? 128 GLN B NE2   1 
ATOM   7338  N N     . MET H 3 126 ? 61.149  -28.711  -18.577 1.00 114.76 ? 129 MET B N     1 
ATOM   7339  C CA    . MET H 3 126 ? 62.200  -29.664  -18.194 1.00 121.86 ? 129 MET B CA    1 
ATOM   7340  C C     . MET H 3 126 ? 63.597  -29.134  -18.520 1.00 121.38 ? 129 MET B C     1 
ATOM   7341  O O     . MET H 3 126 ? 64.519  -29.253  -17.711 1.00 110.71 ? 129 MET B O     1 
ATOM   7342  C CB    . MET H 3 126 ? 61.987  -31.022  -18.887 1.00 126.25 ? 129 MET B CB    1 
ATOM   7343  C CG    . MET H 3 126 ? 60.946  -31.922  -18.227 1.00 125.16 ? 129 MET B CG    1 
ATOM   7344  S SD    . MET H 3 126 ? 60.315  -33.234  -19.302 1.00 127.04 ? 129 MET B SD    1 
ATOM   7345  C CE    . MET H 3 126 ? 61.787  -33.739  -20.195 1.00 123.74 ? 129 MET B CE    1 
ATOM   7346  N N     . GLU H 3 127 ? 63.751  -28.549  -19.704 1.00 125.13 ? 130 GLU B N     1 
ATOM   7347  C CA    . GLU H 3 127 ? 65.032  -27.974  -20.092 1.00 131.68 ? 130 GLU B CA    1 
ATOM   7348  C C     . GLU H 3 127 ? 65.381  -26.761  -19.224 1.00 129.79 ? 130 GLU B C     1 
ATOM   7349  O O     . GLU H 3 127 ? 66.530  -26.614  -18.804 1.00 124.31 ? 130 GLU B O     1 
ATOM   7350  C CB    . GLU H 3 127 ? 65.041  -27.605  -21.578 1.00 139.56 ? 130 GLU B CB    1 
ATOM   7351  C CG    . GLU H 3 127 ? 66.418  -27.189  -22.092 1.00 147.82 ? 130 GLU B CG    1 
ATOM   7352  C CD    . GLU H 3 127 ? 66.797  -27.829  -23.420 1.00 151.98 ? 130 GLU B CD    1 
ATOM   7353  O OE1   . GLU H 3 127 ? 66.515  -29.031  -23.619 1.00 152.28 ? 130 GLU B OE1   1 
ATOM   7354  O OE2   . GLU H 3 127 ? 67.402  -27.133  -24.263 1.00 154.88 ? 130 GLU B OE2   1 
ATOM   7355  N N     . ARG H 3 128 ? 64.393  -25.908  -18.945 1.00 128.85 ? 131 ARG B N     1 
ATOM   7356  C CA    . ARG H 3 128 ? 64.613  -24.744  -18.083 1.00 125.07 ? 131 ARG B CA    1 
ATOM   7357  C C     . ARG H 3 128 ? 65.115  -25.211  -16.724 1.00 114.65 ? 131 ARG B C     1 
ATOM   7358  O O     . ARG H 3 128 ? 66.216  -24.851  -16.308 1.00 112.32 ? 131 ARG B O     1 
ATOM   7359  C CB    . ARG H 3 128 ? 63.340  -23.897  -17.913 1.00 133.04 ? 131 ARG B CB    1 
ATOM   7360  C CG    . ARG H 3 128 ? 62.766  -23.346  -19.213 1.00 140.23 ? 131 ARG B CG    1 
ATOM   7361  C CD    . ARG H 3 128 ? 62.378  -21.871  -19.156 1.00 144.78 ? 131 ARG B CD    1 
ATOM   7362  N NE    . ARG H 3 128 ? 61.528  -21.509  -18.018 1.00 149.67 ? 131 ARG B NE    1 
ATOM   7363  C CZ    . ARG H 3 128 ? 61.928  -20.842  -16.932 1.00 150.61 ? 131 ARG B CZ    1 
ATOM   7364  N NH1   . ARG H 3 128 ? 63.191  -20.443  -16.784 1.00 146.45 ? 131 ARG B NH1   1 
ATOM   7365  N NH2   . ARG H 3 128 ? 61.049  -20.569  -15.974 1.00 153.61 ? 131 ARG B NH2   1 
ATOM   7366  N N     . ARG H 3 129 ? 64.309  -26.031  -16.052 1.00 106.15 ? 132 ARG B N     1 
ATOM   7367  C CA    . ARG H 3 129 ? 64.671  -26.593  -14.752 1.00 101.31 ? 132 ARG B CA    1 
ATOM   7368  C C     . ARG H 3 129 ? 66.079  -27.177  -14.776 1.00 104.76 ? 132 ARG B C     1 
ATOM   7369  O O     . ARG H 3 129 ? 66.918  -26.828  -13.944 1.00 94.39  ? 132 ARG B O     1 
ATOM   7370  C CB    . ARG H 3 129 ? 63.688  -27.694  -14.350 1.00 98.58  ? 132 ARG B CB    1 
ATOM   7371  C CG    . ARG H 3 129 ? 62.325  -27.197  -13.911 1.00 98.59  ? 132 ARG B CG    1 
ATOM   7372  C CD    . ARG H 3 129 ? 61.319  -28.336  -13.853 1.00 99.10  ? 132 ARG B CD    1 
ATOM   7373  N NE    . ARG H 3 129 ? 61.778  -29.447  -13.018 1.00 99.31  ? 132 ARG B NE    1 
ATOM   7374  C CZ    . ARG H 3 129 ? 61.560  -29.575  -11.709 1.00 98.98  ? 132 ARG B CZ    1 
ATOM   7375  N NH1   . ARG H 3 129 ? 60.880  -28.658  -11.033 1.00 100.95 ? 132 ARG B NH1   1 
ATOM   7376  N NH2   . ARG H 3 129 ? 62.028  -30.637  -11.064 1.00 99.58  ? 132 ARG B NH2   1 
ATOM   7377  N N     . LYS H 3 130 ? 66.323  -28.066  -15.739 1.00 113.65 ? 133 LYS B N     1 
ATOM   7378  C CA    . LYS H 3 130 ? 67.615  -28.746  -15.881 1.00 118.92 ? 133 LYS B CA    1 
ATOM   7379  C C     . LYS H 3 130 ? 68.776  -27.764  -15.962 1.00 116.92 ? 133 LYS B C     1 
ATOM   7380  O O     . LYS H 3 130 ? 69.788  -27.936  -15.281 1.00 108.30 ? 133 LYS B O     1 
ATOM   7381  C CB    . LYS H 3 130 ? 67.617  -29.643  -17.125 1.00 125.39 ? 133 LYS B CB    1 
ATOM   7382  C CG    . LYS H 3 130 ? 68.999  -30.113  -17.567 1.00 128.91 ? 133 LYS B CG    1 
ATOM   7383  C CD    . LYS H 3 130 ? 68.934  -31.468  -18.252 1.00 132.90 ? 133 LYS B CD    1 
ATOM   7384  C CE    . LYS H 3 130 ? 70.220  -31.813  -18.987 1.00 137.59 ? 133 LYS B CE    1 
ATOM   7385  N NZ    . LYS H 3 130 ? 70.066  -31.693  -20.464 1.00 140.53 ? 133 LYS B NZ    1 
ATOM   7386  N N     . ASN H 3 131 ? 68.618  -26.745  -16.803 1.00 119.18 ? 134 ASN B N     1 
ATOM   7387  C CA    . ASN H 3 131 ? 69.663  -25.751  -17.027 1.00 120.66 ? 134 ASN B CA    1 
ATOM   7388  C C     . ASN H 3 131 ? 69.884  -24.886  -15.788 1.00 109.14 ? 134 ASN B C     1 
ATOM   7389  O O     . ASN H 3 131 ? 71.022  -24.644  -15.382 1.00 98.79  ? 134 ASN B O     1 
ATOM   7390  C CB    . ASN H 3 131 ? 69.311  -24.870  -18.231 1.00 130.16 ? 134 ASN B CB    1 
ATOM   7391  C CG    . ASN H 3 131 ? 70.527  -24.194  -18.834 1.00 137.21 ? 134 ASN B CG    1 
ATOM   7392  O OD1   . ASN H 3 131 ? 71.515  -24.854  -19.156 1.00 140.45 ? 134 ASN B OD1   1 
ATOM   7393  N ND2   . ASN H 3 131 ? 70.461  -22.876  -19.000 1.00 142.31 ? 134 ASN B ND2   1 
ATOM   7394  N N     . THR H 3 132 ? 68.786  -24.428  -15.194 1.00 102.09 ? 135 THR B N     1 
ATOM   7395  C CA    . THR H 3 132 ? 68.838  -23.669  -13.954 1.00 102.46 ? 135 THR B CA    1 
ATOM   7396  C C     . THR H 3 132 ? 69.660  -24.416  -12.909 1.00 103.53 ? 135 THR B C     1 
ATOM   7397  O O     . THR H 3 132 ? 70.630  -23.882  -12.377 1.00 96.69  ? 135 THR B O     1 
ATOM   7398  C CB    . THR H 3 132 ? 67.426  -23.428  -13.387 1.00 103.52 ? 135 THR B CB    1 
ATOM   7399  O OG1   . THR H 3 132 ? 66.568  -22.928  -14.419 1.00 102.82 ? 135 THR B OG1   1 
ATOM   7400  C CG2   . THR H 3 132 ? 67.470  -22.441  -12.229 1.00 104.49 ? 135 THR B CG2   1 
ATOM   7401  N N     . CYS H 3 133 ? 69.270  -25.661  -12.638 1.00 112.78 ? 136 CYS B N     1 
ATOM   7402  C CA    . CYS H 3 133 ? 69.966  -26.507  -11.666 1.00 114.73 ? 136 CYS B CA    1 
ATOM   7403  C C     . CYS H 3 133 ? 71.424  -26.718  -12.085 1.00 113.98 ? 136 CYS B C     1 
ATOM   7404  O O     . CYS H 3 133 ? 72.322  -26.658  -11.252 1.00 108.52 ? 136 CYS B O     1 
ATOM   7405  C CB    . CYS H 3 133 ? 69.258  -27.864  -11.500 1.00 117.34 ? 136 CYS B CB    1 
ATOM   7406  S SG    . CYS H 3 133 ? 67.535  -27.815  -10.918 1.00 117.51 ? 136 CYS B SG    1 
ATOM   7407  N N     . GLU H 3 134 ? 71.649  -26.955  -13.376 1.00 120.27 ? 137 GLU B N     1 
ATOM   7408  C CA    . GLU H 3 134 ? 73.009  -27.061  -13.923 1.00 123.82 ? 137 GLU B CA    1 
ATOM   7409  C C     . GLU H 3 134 ? 73.830  -25.811  -13.612 1.00 117.58 ? 137 GLU B C     1 
ATOM   7410  O O     . GLU H 3 134 ? 75.005  -25.912  -13.264 1.00 109.15 ? 137 GLU B O     1 
ATOM   7411  C CB    . GLU H 3 134 ? 72.985  -27.309  -15.444 1.00 131.77 ? 137 GLU B CB    1 
ATOM   7412  C CG    . GLU H 3 134 ? 72.924  -28.783  -15.841 1.00 134.76 ? 137 GLU B CG    1 
ATOM   7413  C CD    . GLU H 3 134 ? 72.773  -29.015  -17.342 1.00 137.79 ? 137 GLU B CD    1 
ATOM   7414  O OE1   . GLU H 3 134 ? 72.196  -28.152  -18.040 1.00 138.76 ? 137 GLU B OE1   1 
ATOM   7415  O OE2   . GLU H 3 134 ? 73.219  -30.081  -17.827 1.00 134.96 ? 137 GLU B OE2   1 
ATOM   7416  N N     . ILE H 3 135 ? 73.201  -24.643  -13.737 1.00 118.89 ? 138 ILE B N     1 
ATOM   7417  C CA    . ILE H 3 135 ? 73.860  -23.363  -13.457 1.00 118.21 ? 138 ILE B CA    1 
ATOM   7418  C C     . ILE H 3 135 ? 74.094  -23.186  -11.955 1.00 112.08 ? 138 ILE B C     1 
ATOM   7419  O O     . ILE H 3 135 ? 75.212  -22.900  -11.528 1.00 112.18 ? 138 ILE B O     1 
ATOM   7420  C CB    . ILE H 3 135 ? 73.048  -22.167  -14.019 1.00 118.73 ? 138 ILE B CB    1 
ATOM   7421  C CG1   . ILE H 3 135 ? 73.089  -22.170  -15.555 1.00 118.70 ? 138 ILE B CG1   1 
ATOM   7422  C CG2   . ILE H 3 135 ? 73.586  -20.840  -13.490 1.00 118.22 ? 138 ILE B CG2   1 
ATOM   7423  C CD1   . ILE H 3 135 ? 71.970  -21.383  -16.209 1.00 117.65 ? 138 ILE B CD1   1 
ATOM   7424  N N     . LEU H 3 136 ? 73.043  -23.365  -11.160 1.00 107.49 ? 139 LEU B N     1 
ATOM   7425  C CA    . LEU H 3 136 ? 73.133  -23.194  -9.706  1.00 106.56 ? 139 LEU B CA    1 
ATOM   7426  C C     . LEU H 3 136 ? 74.158  -24.130  -9.077  1.00 109.32 ? 139 LEU B C     1 
ATOM   7427  O O     . LEU H 3 136 ? 74.771  -23.802  -8.060  1.00 110.31 ? 139 LEU B O     1 
ATOM   7428  C CB    . LEU H 3 136 ? 71.771  -23.428  -9.050  1.00 104.23 ? 139 LEU B CB    1 
ATOM   7429  C CG    . LEU H 3 136 ? 70.687  -22.416  -9.418  1.00 109.11 ? 139 LEU B CG    1 
ATOM   7430  C CD1   . LEU H 3 136 ? 69.323  -22.875  -8.926  1.00 107.87 ? 139 LEU B CD1   1 
ATOM   7431  C CD2   . LEU H 3 136 ? 71.032  -21.042  -8.865  1.00 113.10 ? 139 LEU B CD2   1 
ATOM   7432  N N     . LEU H 3 137 ? 74.338  -25.295  -9.688  1.00 112.12 ? 140 LEU B N     1 
ATOM   7433  C CA    . LEU H 3 137 ? 75.269  -26.292  -9.186  1.00 111.30 ? 140 LEU B CA    1 
ATOM   7434  C C     . LEU H 3 137 ? 76.699  -25.849  -9.450  1.00 111.42 ? 140 LEU B C     1 
ATOM   7435  O O     . LEU H 3 137 ? 77.496  -25.771  -8.523  1.00 115.85 ? 140 LEU B O     1 
ATOM   7436  C CB    . LEU H 3 137 ? 74.997  -27.650  -9.842  1.00 112.73 ? 140 LEU B CB    1 
ATOM   7437  C CG    . LEU H 3 137 ? 75.284  -28.914  -9.035  1.00 112.45 ? 140 LEU B CG    1 
ATOM   7438  C CD1   . LEU H 3 137 ? 74.635  -28.846  -7.662  1.00 108.87 ? 140 LEU B CD1   1 
ATOM   7439  C CD2   . LEU H 3 137 ? 74.777  -30.118  -9.814  1.00 114.32 ? 140 LEU B CD2   1 
ATOM   7440  N N     . SER H 3 138 ? 77.009  -25.538  -10.708 1.00 114.14 ? 141 SER B N     1 
ATOM   7441  C CA    . SER H 3 138 ? 78.363  -25.134  -11.109 1.00 114.98 ? 141 SER B CA    1 
ATOM   7442  C C     . SER H 3 138 ? 78.905  -24.020  -10.220 1.00 115.86 ? 141 SER B C     1 
ATOM   7443  O O     . SER H 3 138 ? 80.076  -24.050  -9.841  1.00 114.09 ? 141 SER B O     1 
ATOM   7444  C CB    . SER H 3 138 ? 78.400  -24.696  -12.580 1.00 116.94 ? 141 SER B CB    1 
ATOM   7445  O OG    . SER H 3 138 ? 77.637  -23.527  -12.799 1.00 116.42 ? 141 SER B OG    1 
ATOM   7446  N N     . ARG H 3 139 ? 78.046  -23.050  -9.893  1.00 117.60 ? 142 ARG B N     1 
ATOM   7447  C CA    . ARG H 3 139 ? 78.405  -21.948  -8.994  1.00 118.50 ? 142 ARG B CA    1 
ATOM   7448  C C     . ARG H 3 139 ? 78.722  -22.460  -7.580  1.00 116.96 ? 142 ARG B C     1 
ATOM   7449  O O     . ARG H 3 139 ? 79.707  -22.041  -6.974  1.00 116.16 ? 142 ARG B O     1 
ATOM   7450  C CB    . ARG H 3 139 ? 77.296  -20.878  -8.960  1.00 121.65 ? 142 ARG B CB    1 
ATOM   7451  C CG    . ARG H 3 139 ? 77.673  -19.604  -8.193  1.00 128.34 ? 142 ARG B CG    1 
ATOM   7452  C CD    . ARG H 3 139 ? 77.291  -18.311  -8.917  1.00 130.58 ? 142 ARG B CD    1 
ATOM   7453  N NE    . ARG H 3 139 ? 75.941  -17.826  -8.612  1.00 127.48 ? 142 ARG B NE    1 
ATOM   7454  C CZ    . ARG H 3 139 ? 75.629  -16.972  -7.636  1.00 127.60 ? 142 ARG B CZ    1 
ATOM   7455  N NH1   . ARG H 3 139 ? 76.562  -16.488  -6.819  1.00 126.67 ? 142 ARG B NH1   1 
ATOM   7456  N NH2   . ARG H 3 139 ? 74.363  -16.598  -7.472  1.00 126.10 ? 142 ARG B NH2   1 
ATOM   7457  N N     . TYR H 3 140 ? 77.895  -23.371  -7.070  1.00 116.13 ? 143 TYR B N     1 
ATOM   7458  C CA    . TYR H 3 140 ? 78.132  -24.004  -5.764  1.00 114.11 ? 143 TYR B CA    1 
ATOM   7459  C C     . TYR H 3 140 ? 79.444  -24.798  -5.734  1.00 120.05 ? 143 TYR B C     1 
ATOM   7460  O O     . TYR H 3 140 ? 80.089  -24.896  -4.688  1.00 116.05 ? 143 TYR B O     1 
ATOM   7461  C CB    . TYR H 3 140 ? 76.948  -24.906  -5.391  1.00 110.86 ? 143 TYR B CB    1 
ATOM   7462  C CG    . TYR H 3 140 ? 77.133  -25.760  -4.142  1.00 107.10 ? 143 TYR B CG    1 
ATOM   7463  C CD1   . TYR H 3 140 ? 77.154  -25.186  -2.873  1.00 105.68 ? 143 TYR B CD1   1 
ATOM   7464  C CD2   . TYR H 3 140 ? 77.253  -27.148  -4.231  1.00 103.35 ? 143 TYR B CD2   1 
ATOM   7465  C CE1   . TYR H 3 140 ? 77.309  -25.964  -1.732  1.00 101.97 ? 143 TYR B CE1   1 
ATOM   7466  C CE2   . TYR H 3 140 ? 77.404  -27.933  -3.097  1.00 99.94  ? 143 TYR B CE2   1 
ATOM   7467  C CZ    . TYR H 3 140 ? 77.432  -27.338  -1.848  1.00 102.41 ? 143 TYR B CZ    1 
ATOM   7468  O OH    . TYR H 3 140 ? 77.579  -28.112  -0.712  1.00 99.79  ? 143 TYR B OH    1 
ATOM   7469  N N     . LYS H 3 141 ? 79.830  -25.352  -6.885  1.00 132.93 ? 144 LYS B N     1 
ATOM   7470  C CA    . LYS H 3 141 ? 81.095  -26.084  -7.016  1.00 140.95 ? 144 LYS B CA    1 
ATOM   7471  C C     . LYS H 3 141 ? 82.254  -25.152  -6.708  1.00 140.56 ? 144 LYS B C     1 
ATOM   7472  O O     . LYS H 3 141 ? 83.105  -25.457  -5.874  1.00 140.50 ? 144 LYS B O     1 
ATOM   7473  C CB    . LYS H 3 141 ? 81.302  -26.632  -8.436  1.00 149.88 ? 144 LYS B CB    1 
ATOM   7474  C CG    . LYS H 3 141 ? 80.146  -27.396  -9.060  1.00 156.54 ? 144 LYS B CG    1 
ATOM   7475  C CD    . LYS H 3 141 ? 79.800  -28.679  -8.323  1.00 158.70 ? 144 LYS B CD    1 
ATOM   7476  C CE    . LYS H 3 141 ? 79.583  -29.815  -9.317  1.00 159.62 ? 144 LYS B CE    1 
ATOM   7477  N NZ    . LYS H 3 141 ? 79.534  -31.151  -8.669  1.00 159.58 ? 144 LYS B NZ    1 
ATOM   7478  N N     . ARG H 3 142 ? 82.272  -24.015  -7.404  1.00 140.21 ? 145 ARG B N     1 
ATOM   7479  C CA    . ARG H 3 142 ? 83.293  -22.993  -7.220  1.00 138.33 ? 145 ARG B CA    1 
ATOM   7480  C C     . ARG H 3 142 ? 83.220  -22.437  -5.795  1.00 137.95 ? 145 ARG B C     1 
ATOM   7481  O O     . ARG H 3 142 ? 84.161  -22.592  -5.016  1.00 130.56 ? 145 ARG B O     1 
ATOM   7482  C CB    . ARG H 3 142 ? 83.115  -21.865  -8.250  1.00 144.07 ? 145 ARG B CB    1 
ATOM   7483  C CG    . ARG H 3 142 ? 83.286  -22.294  -9.705  1.00 148.05 ? 145 ARG B CG    1 
ATOM   7484  C CD    . ARG H 3 142 ? 83.129  -21.146  -10.700 1.00 154.67 ? 145 ARG B CD    1 
ATOM   7485  N NE    . ARG H 3 142 ? 82.435  -19.972  -10.151 1.00 162.93 ? 145 ARG B NE    1 
ATOM   7486  C CZ    . ARG H 3 142 ? 83.023  -18.844  -9.731  1.00 165.40 ? 145 ARG B CZ    1 
ATOM   7487  N NH1   . ARG H 3 142 ? 84.346  -18.685  -9.782  1.00 162.98 ? 145 ARG B NH1   1 
ATOM   7488  N NH2   . ARG H 3 142 ? 82.277  -17.851  -9.252  1.00 164.78 ? 145 ARG B NH2   1 
ATOM   7489  N N     . LYS H 3 143 ? 82.087  -21.820  -5.455  1.00 141.08 ? 146 LYS B N     1 
ATOM   7490  C CA    . LYS H 3 143 ? 81.892  -21.174  -4.152  1.00 135.22 ? 146 LYS B CA    1 
ATOM   7491  C C     . LYS H 3 143 ? 80.568  -21.606  -3.511  1.00 121.50 ? 146 LYS B C     1 
ATOM   7492  O O     . LYS H 3 143 ? 79.515  -21.505  -4.134  1.00 113.36 ? 146 LYS B O     1 
ATOM   7493  C CB    . LYS H 3 143 ? 81.901  -19.650  -4.321  1.00 140.48 ? 146 LYS B CB    1 
ATOM   7494  C CG    . LYS H 3 143 ? 82.087  -18.870  -3.025  1.00 145.68 ? 146 LYS B CG    1 
ATOM   7495  C CD    . LYS H 3 143 ? 83.452  -18.195  -2.950  1.00 147.75 ? 146 LYS B CD    1 
ATOM   7496  C CE    . LYS H 3 143 ? 83.810  -17.739  -1.541  1.00 147.54 ? 146 LYS B CE    1 
ATOM   7497  N NZ    . LYS H 3 143 ? 82.659  -17.234  -0.740  1.00 149.51 ? 146 LYS B NZ    1 
ATOM   7498  N N     . SER H 3 144 ? 80.624  -22.066  -2.263  1.00 112.88 ? 147 SER B N     1 
ATOM   7499  C CA    . SER H 3 144 ? 79.412  -22.405  -1.511  1.00 108.73 ? 147 SER B CA    1 
ATOM   7500  C C     . SER H 3 144 ? 78.705  -21.144  -1.016  1.00 102.11 ? 147 SER B C     1 
ATOM   7501  O O     . SER H 3 144 ? 79.188  -20.482  -0.093  1.00 94.88  ? 147 SER B O     1 
ATOM   7502  C CB    . SER H 3 144 ? 79.749  -23.301  -0.317  1.00 110.34 ? 147 SER B CB    1 
ATOM   7503  O OG    . SER H 3 144 ? 78.573  -23.667  0.392   1.00 109.14 ? 147 SER B OG    1 
ATOM   7504  N N     . PHE H 3 145 ? 77.549  -20.842  -1.609  1.00 96.88  ? 148 PHE B N     1 
ATOM   7505  C CA    . PHE H 3 145 ? 76.852  -19.573  -1.367  1.00 96.27  ? 148 PHE B CA    1 
ATOM   7506  C C     . PHE H 3 145 ? 75.565  -19.687  -0.540  1.00 96.11  ? 148 PHE B C     1 
ATOM   7507  O O     . PHE H 3 145 ? 74.825  -18.715  -0.400  1.00 92.69  ? 148 PHE B O     1 
ATOM   7508  C CB    . PHE H 3 145 ? 76.553  -18.887  -2.703  1.00 95.75  ? 148 PHE B CB    1 
ATOM   7509  C CG    . PHE H 3 145 ? 75.699  -19.696  -3.631  1.00 94.79  ? 148 PHE B CG    1 
ATOM   7510  C CD1   . PHE H 3 145 ? 74.320  -19.694  -3.507  1.00 98.82  ? 148 PHE B CD1   1 
ATOM   7511  C CD2   . PHE H 3 145 ? 76.273  -20.442  -4.642  1.00 98.53  ? 148 PHE B CD2   1 
ATOM   7512  C CE1   . PHE H 3 145 ? 73.529  -20.433  -4.370  1.00 100.48 ? 148 PHE B CE1   1 
ATOM   7513  C CE2   . PHE H 3 145 ? 75.491  -21.183  -5.510  1.00 101.00 ? 148 PHE B CE2   1 
ATOM   7514  C CZ    . PHE H 3 145 ? 74.116  -21.177  -5.376  1.00 100.89 ? 148 PHE B CZ    1 
ATOM   7515  N N     . LEU H 3 146 ? 75.309  -20.861  0.022   1.00 99.67  ? 149 LEU B N     1 
ATOM   7516  C CA    . LEU H 3 146 ? 74.068  -21.114  0.757   1.00 99.93  ? 149 LEU B CA    1 
ATOM   7517  C C     . LEU H 3 146 ? 73.975  -20.331  2.070   1.00 100.73 ? 149 LEU B C     1 
ATOM   7518  O O     . LEU H 3 146 ? 72.882  -20.005  2.535   1.00 100.52 ? 149 LEU B O     1 
ATOM   7519  C CB    . LEU H 3 146 ? 73.940  -22.609  1.035   1.00 102.17 ? 149 LEU B CB    1 
ATOM   7520  C CG    . LEU H 3 146 ? 73.670  -23.569  -0.136  1.00 103.24 ? 149 LEU B CG    1 
ATOM   7521  C CD1   . LEU H 3 146 ? 73.569  -22.898  -1.504  1.00 102.36 ? 149 LEU B CD1   1 
ATOM   7522  C CD2   . LEU H 3 146 ? 74.735  -24.654  -0.146  1.00 105.32 ? 149 LEU B CD2   1 
ATOM   7523  N N     . HIS H 3 147 ? 75.120  -20.044  2.674   1.00 104.25 ? 150 HIS B N     1 
ATOM   7524  C CA    . HIS H 3 147 ? 75.177  -19.141  3.821   1.00 109.34 ? 150 HIS B CA    1 
ATOM   7525  C C     . HIS H 3 147 ? 74.544  -17.770  3.536   1.00 105.74 ? 150 HIS B C     1 
ATOM   7526  O O     . HIS H 3 147 ? 73.980  -17.163  4.441   1.00 107.56 ? 150 HIS B O     1 
ATOM   7527  C CB    . HIS H 3 147 ? 76.623  -19.000  4.331   1.00 116.59 ? 150 HIS B CB    1 
ATOM   7528  C CG    . HIS H 3 147 ? 77.564  -18.355  3.355   1.00 123.03 ? 150 HIS B CG    1 
ATOM   7529  N ND1   . HIS H 3 147 ? 78.466  -17.384  3.731   1.00 128.81 ? 150 HIS B ND1   1 
ATOM   7530  C CD2   . HIS H 3 147 ? 77.746  -18.539  2.026   1.00 127.41 ? 150 HIS B CD2   1 
ATOM   7531  C CE1   . HIS H 3 147 ? 79.161  -16.997  2.676   1.00 132.05 ? 150 HIS B CE1   1 
ATOM   7532  N NE2   . HIS H 3 147 ? 78.744  -17.683  1.628   1.00 131.10 ? 150 HIS B NE2   1 
ATOM   7533  N N     . ARG H 3 148 ? 74.622  -17.303  2.287   1.00 105.17 ? 151 ARG B N     1 
ATOM   7534  C CA    . ARG H 3 148 ? 74.057  -16.002  1.879   1.00 105.93 ? 151 ARG B CA    1 
ATOM   7535  C C     . ARG H 3 148 ? 72.586  -16.067  1.464   1.00 103.18 ? 151 ARG B C     1 
ATOM   7536  O O     . ARG H 3 148 ? 71.947  -15.032  1.276   1.00 103.87 ? 151 ARG B O     1 
ATOM   7537  C CB    . ARG H 3 148 ? 74.858  -15.409  0.704   1.00 111.04 ? 151 ARG B CB    1 
ATOM   7538  C CG    . ARG H 3 148 ? 76.338  -15.189  0.996   1.00 112.53 ? 151 ARG B CG    1 
ATOM   7539  C CD    . ARG H 3 148 ? 76.987  -14.143  0.093   1.00 114.41 ? 151 ARG B CD    1 
ATOM   7540  N NE    . ARG H 3 148 ? 77.440  -14.661  -1.205  1.00 111.39 ? 151 ARG B NE    1 
ATOM   7541  C CZ    . ARG H 3 148 ? 76.969  -14.296  -2.401  1.00 110.17 ? 151 ARG B CZ    1 
ATOM   7542  N NH1   . ARG H 3 148 ? 75.992  -13.402  -2.520  1.00 111.93 ? 151 ARG B NH1   1 
ATOM   7543  N NH2   . ARG H 3 148 ? 77.483  -14.835  -3.502  1.00 107.14 ? 151 ARG B NH2   1 
ATOM   7544  N N     . ILE H 3 149 ? 72.056  -17.276  1.318   1.00 105.18 ? 152 ILE B N     1 
ATOM   7545  C CA    . ILE H 3 149 ? 70.725  -17.481  0.746   1.00 100.79 ? 152 ILE B CA    1 
ATOM   7546  C C     . ILE H 3 149 ? 69.650  -17.184  1.795   1.00 95.87  ? 152 ILE B C     1 
ATOM   7547  O O     . ILE H 3 149 ? 69.753  -17.616  2.950   1.00 91.73  ? 152 ILE B O     1 
ATOM   7548  C CB    . ILE H 3 149 ? 70.586  -18.923  0.171   1.00 103.19 ? 152 ILE B CB    1 
ATOM   7549  C CG1   . ILE H 3 149 ? 70.223  -18.902  -1.312  1.00 107.10 ? 152 ILE B CG1   1 
ATOM   7550  C CG2   . ILE H 3 149 ? 69.577  -19.763  0.941   1.00 107.89 ? 152 ILE B CG2   1 
ATOM   7551  C CD1   . ILE H 3 149 ? 68.770  -18.582  -1.586  1.00 113.00 ? 152 ILE B CD1   1 
ATOM   7552  N N     . VAL H 3 150 ? 68.640  -16.418  1.387   1.00 93.29  ? 153 VAL B N     1 
ATOM   7553  C CA    . VAL H 3 150 ? 67.444  -16.176  2.204   1.00 94.93  ? 153 VAL B CA    1 
ATOM   7554  C C     . VAL H 3 150 ? 66.236  -16.393  1.299   1.00 89.28  ? 153 VAL B C     1 
ATOM   7555  O O     . VAL H 3 150 ? 66.206  -15.919  0.167   1.00 87.09  ? 153 VAL B O     1 
ATOM   7556  C CB    . VAL H 3 150 ? 67.430  -14.762  2.864   1.00 96.28  ? 153 VAL B CB    1 
ATOM   7557  C CG1   . VAL H 3 150 ? 67.613  -13.658  1.837   1.00 100.36 ? 153 VAL B CG1   1 
ATOM   7558  C CG2   . VAL H 3 150 ? 66.152  -14.525  3.659   1.00 93.86  ? 153 VAL B CG2   1 
ATOM   7559  N N     . THR H 3 151 ? 65.256  -17.138  1.793   1.00 86.41  ? 154 THR B N     1 
ATOM   7560  C CA    . THR H 3 151 ? 64.125  -17.544  0.972   1.00 80.89  ? 154 THR B CA    1 
ATOM   7561  C C     . THR H 3 151 ? 62.824  -17.400  1.735   1.00 77.15  ? 154 THR B C     1 
ATOM   7562  O O     . THR H 3 151 ? 62.814  -17.223  2.953   1.00 73.49  ? 154 THR B O     1 
ATOM   7563  C CB    . THR H 3 151 ? 64.271  -19.008  0.522   1.00 79.42  ? 154 THR B CB    1 
ATOM   7564  O OG1   . THR H 3 151 ? 63.353  -19.277  -0.537  1.00 80.74  ? 154 THR B OG1   1 
ATOM   7565  C CG2   . THR H 3 151 ? 64.001  -19.961  1.679   1.00 78.58  ? 154 THR B CG2   1 
ATOM   7566  N N     . GLY H 3 152 ? 61.729  -17.487  0.996   1.00 73.00  ? 155 GLY B N     1 
ATOM   7567  C CA    . GLY H 3 152 ? 60.407  -17.428  1.578   1.00 70.42  ? 155 GLY B CA    1 
ATOM   7568  C C     . GLY H 3 152 ? 59.359  -17.794  0.551   1.00 74.00  ? 155 GLY B C     1 
ATOM   7569  O O     . GLY H 3 152 ? 59.646  -17.908  -0.647  1.00 76.77  ? 155 GLY B O     1 
ATOM   7570  N N     . ASP H 3 153 ? 58.144  -17.996  1.031   1.00 73.93  ? 156 ASP B N     1 
ATOM   7571  C CA    . ASP H 3 153 ? 57.024  -18.374  0.185   1.00 80.77  ? 156 ASP B CA    1 
ATOM   7572  C C     . ASP H 3 153 ? 55.801  -18.188  1.071   1.00 83.10  ? 156 ASP B C     1 
ATOM   7573  O O     . ASP H 3 153 ? 55.932  -17.794  2.243   1.00 79.80  ? 156 ASP B O     1 
ATOM   7574  C CB    . ASP H 3 153 ? 57.173  -19.834  -0.297  1.00 91.73  ? 156 ASP B CB    1 
ATOM   7575  C CG    . ASP H 3 153 ? 56.243  -20.192  -1.477  1.00 101.02 ? 156 ASP B CG    1 
ATOM   7576  O OD1   . ASP H 3 153 ? 55.179  -19.546  -1.626  1.00 108.23 ? 156 ASP B OD1   1 
ATOM   7577  O OD2   . ASP H 3 153 ? 56.572  -21.132  -2.249  1.00 93.65  ? 156 ASP B OD2   1 
ATOM   7578  N N     . GLU H 3 154 ? 54.622  -18.446  0.522   1.00 84.85  ? 157 GLU B N     1 
ATOM   7579  C CA    . GLU H 3 154 ? 53.382  -18.230  1.247   1.00 96.03  ? 157 GLU B CA    1 
ATOM   7580  C C     . GLU H 3 154 ? 52.525  -19.491  1.187   1.00 98.71  ? 157 GLU B C     1 
ATOM   7581  O O     . GLU H 3 154 ? 52.520  -20.205  0.178   1.00 97.78  ? 157 GLU B O     1 
ATOM   7582  C CB    . GLU H 3 154 ? 52.643  -16.985  0.717   1.00 109.14 ? 157 GLU B CB    1 
ATOM   7583  C CG    . GLU H 3 154 ? 52.570  -16.835  -0.808  1.00 120.35 ? 157 GLU B CG    1 
ATOM   7584  C CD    . GLU H 3 154 ? 52.670  -15.386  -1.276  1.00 126.63 ? 157 GLU B CD    1 
ATOM   7585  O OE1   . GLU H 3 154 ? 53.789  -14.819  -1.272  1.00 122.78 ? 157 GLU B OE1   1 
ATOM   7586  O OE2   . GLU H 3 154 ? 51.628  -14.814  -1.661  1.00 134.90 ? 157 GLU B OE2   1 
ATOM   7587  N N     . LYS H 3 155 ? 51.822  -19.766  2.284   1.00 97.36  ? 158 LYS B N     1 
ATOM   7588  C CA    . LYS H 3 155 ? 51.122  -21.030  2.458   1.00 97.22  ? 158 LYS B CA    1 
ATOM   7589  C C     . LYS H 3 155 ? 49.816  -20.852  3.217   1.00 92.58  ? 158 LYS B C     1 
ATOM   7590  O O     . LYS H 3 155 ? 49.819  -20.330  4.331   1.00 91.32  ? 158 LYS B O     1 
ATOM   7591  C CB    . LYS H 3 155 ? 52.010  -22.002  3.236   1.00 102.44 ? 158 LYS B CB    1 
ATOM   7592  C CG    . LYS H 3 155 ? 51.690  -23.463  2.958   1.00 107.32 ? 158 LYS B CG    1 
ATOM   7593  C CD    . LYS H 3 155 ? 51.951  -24.388  4.139   1.00 102.43 ? 158 LYS B CD    1 
ATOM   7594  C CE    . LYS H 3 155 ? 50.730  -24.548  5.021   1.00 97.94  ? 158 LYS B CE    1 
ATOM   7595  N NZ    . LYS H 3 155 ? 50.329  -25.974  5.128   1.00 99.20  ? 158 LYS B NZ    1 
ATOM   7596  N N     . TRP H 3 156 ? 48.710  -21.304  2.628   1.00 87.64  ? 159 TRP B N     1 
ATOM   7597  C CA    . TRP H 3 156 ? 47.410  -21.267  3.305   1.00 86.47  ? 159 TRP B CA    1 
ATOM   7598  C C     . TRP H 3 156 ? 47.423  -22.143  4.545   1.00 82.92  ? 159 TRP B C     1 
ATOM   7599  O O     . TRP H 3 156 ? 47.955  -23.238  4.513   1.00 94.17  ? 159 TRP B O     1 
ATOM   7600  C CB    . TRP H 3 156 ? 46.302  -21.771  2.384   1.00 90.81  ? 159 TRP B CB    1 
ATOM   7601  C CG    . TRP H 3 156 ? 45.972  -20.841  1.275   1.00 98.02  ? 159 TRP B CG    1 
ATOM   7602  C CD1   . TRP H 3 156 ? 46.230  -21.019  -0.057  1.00 102.21 ? 159 TRP B CD1   1 
ATOM   7603  C CD2   . TRP H 3 156 ? 45.317  -19.577  1.394   1.00 99.72  ? 159 TRP B CD2   1 
ATOM   7604  N NE1   . TRP H 3 156 ? 45.768  -19.940  -0.774  1.00 103.43 ? 159 TRP B NE1   1 
ATOM   7605  C CE2   . TRP H 3 156 ? 45.207  -19.039  0.094   1.00 102.61 ? 159 TRP B CE2   1 
ATOM   7606  C CE3   . TRP H 3 156 ? 44.817  -18.845  2.475   1.00 98.05  ? 159 TRP B CE3   1 
ATOM   7607  C CZ2   . TRP H 3 156 ? 44.614  -17.803  -0.151  1.00 100.93 ? 159 TRP B CZ2   1 
ATOM   7608  C CZ3   . TRP H 3 156 ? 44.226  -17.626  2.232   1.00 100.05 ? 159 TRP B CZ3   1 
ATOM   7609  C CH2   . TRP H 3 156 ? 44.130  -17.113  0.928   1.00 101.77 ? 159 TRP B CH2   1 
ATOM   7610  N N     . ILE H 3 157 ? 46.843  -21.661  5.634   1.00 78.27  ? 160 ILE B N     1 
ATOM   7611  C CA    . ILE H 3 157 ? 46.627  -22.478  6.816   1.00 75.18  ? 160 ILE B CA    1 
ATOM   7612  C C     . ILE H 3 157 ? 45.143  -22.491  7.128   1.00 79.21  ? 160 ILE B C     1 
ATOM   7613  O O     . ILE H 3 157 ? 44.583  -21.464  7.507   1.00 87.04  ? 160 ILE B O     1 
ATOM   7614  C CB    . ILE H 3 157 ? 47.381  -21.931  8.031   1.00 72.75  ? 160 ILE B CB    1 
ATOM   7615  C CG1   . ILE H 3 157 ? 48.877  -22.129  7.830   1.00 70.78  ? 160 ILE B CG1   1 
ATOM   7616  C CG2   . ILE H 3 157 ? 46.908  -22.620  9.310   1.00 74.33  ? 160 ILE B CG2   1 
ATOM   7617  C CD1   . ILE H 3 157 ? 49.706  -21.728  9.031   1.00 72.22  ? 160 ILE B CD1   1 
ATOM   7618  N N     . PHE H 3 158 ? 44.513  -23.652  6.985   1.00 80.58  ? 161 PHE B N     1 
ATOM   7619  C CA    . PHE H 3 158 ? 43.086  -23.782  7.243   1.00 78.32  ? 161 PHE B CA    1 
ATOM   7620  C C     . PHE H 3 158 ? 42.833  -23.948  8.734   1.00 81.78  ? 161 PHE B C     1 
ATOM   7621  O O     . PHE H 3 158 ? 43.657  -24.501  9.452   1.00 81.63  ? 161 PHE B O     1 
ATOM   7622  C CB    . PHE H 3 158 ? 42.519  -24.960  6.483   1.00 75.66  ? 161 PHE B CB    1 
ATOM   7623  C CG    . PHE H 3 158 ? 42.524  -24.781  4.997   1.00 75.46  ? 161 PHE B CG    1 
ATOM   7624  C CD1   . PHE H 3 158 ? 43.696  -24.911  4.267   1.00 78.07  ? 161 PHE B CD1   1 
ATOM   7625  C CD2   . PHE H 3 158 ? 41.342  -24.514  4.318   1.00 80.29  ? 161 PHE B CD2   1 
ATOM   7626  C CE1   . PHE H 3 158 ? 43.695  -24.763  2.887   1.00 81.40  ? 161 PHE B CE1   1 
ATOM   7627  C CE2   . PHE H 3 158 ? 41.331  -24.368  2.938   1.00 82.96  ? 161 PHE B CE2   1 
ATOM   7628  C CZ    . PHE H 3 158 ? 42.511  -24.490  2.220   1.00 80.27  ? 161 PHE B CZ    1 
ATOM   7629  N N     . PHE H 3 159 ? 41.694  -23.447  9.195   1.00 89.81  ? 162 PHE B N     1 
ATOM   7630  C CA    . PHE H 3 159 ? 41.350  -23.495  10.617  1.00 99.16  ? 162 PHE B CA    1 
ATOM   7631  C C     . PHE H 3 159 ? 40.988  -24.920  11.009  1.00 99.02  ? 162 PHE B C     1 
ATOM   7632  O O     . PHE H 3 159 ? 41.182  -25.331  12.155  1.00 93.72  ? 162 PHE B O     1 
ATOM   7633  C CB    . PHE H 3 159 ? 40.176  -22.560  10.922  1.00 104.33 ? 162 PHE B CB    1 
ATOM   7634  C CG    . PHE H 3 159 ? 40.573  -21.125  11.125  1.00 106.02 ? 162 PHE B CG    1 
ATOM   7635  C CD1   . PHE H 3 159 ? 41.280  -20.435  10.143  1.00 104.42 ? 162 PHE B CD1   1 
ATOM   7636  C CD2   . PHE H 3 159 ? 40.222  -20.454  12.292  1.00 107.91 ? 162 PHE B CD2   1 
ATOM   7637  C CE1   . PHE H 3 159 ? 41.639  -19.113  10.325  1.00 103.65 ? 162 PHE B CE1   1 
ATOM   7638  C CE2   . PHE H 3 159 ? 40.578  -19.130  12.479  1.00 108.64 ? 162 PHE B CE2   1 
ATOM   7639  C CZ    . PHE H 3 159 ? 41.288  -18.459  11.496  1.00 108.60 ? 162 PHE B CZ    1 
ATOM   7640  N N     . VAL H 3 160 ? 40.454  -25.658  10.041  1.00 104.35 ? 163 VAL B N     1 
ATOM   7641  C CA    . VAL H 3 160 ? 40.101  -27.058  10.226  1.00 111.35 ? 163 VAL B CA    1 
ATOM   7642  C C     . VAL H 3 160 ? 40.675  -27.889  9.071   1.00 113.03 ? 163 VAL B C     1 
ATOM   7643  O O     . VAL H 3 160 ? 40.275  -27.726  7.917   1.00 108.15 ? 163 VAL B O     1 
ATOM   7644  C CB    . VAL H 3 160 ? 38.568  -27.243  10.360  1.00 109.70 ? 163 VAL B CB    1 
ATOM   7645  C CG1   . VAL H 3 160 ? 37.819  -26.690  9.152   1.00 108.10 ? 163 VAL B CG1   1 
ATOM   7646  C CG2   . VAL H 3 160 ? 38.218  -28.704  10.590  1.00 114.65 ? 163 VAL B CG2   1 
ATOM   7647  N N     . ASN H 3 161 ? 41.642  -28.749  9.395   1.00 116.52 ? 164 ASN B N     1 
ATOM   7648  C CA    . ASN H 3 161 ? 42.224  -29.684  8.427   1.00 121.31 ? 164 ASN B CA    1 
ATOM   7649  C C     . ASN H 3 161 ? 42.101  -31.114  8.961   1.00 120.06 ? 164 ASN B C     1 
ATOM   7650  O O     . ASN H 3 161 ? 43.034  -31.650  9.572   1.00 121.02 ? 164 ASN B O     1 
ATOM   7651  C CB    . ASN H 3 161 ? 43.682  -29.331  8.049   1.00 123.55 ? 164 ASN B CB    1 
ATOM   7652  C CG    . ASN H 3 161 ? 44.440  -28.608  9.154   1.00 122.56 ? 164 ASN B CG    1 
ATOM   7653  O OD1   . ASN H 3 161 ? 44.181  -28.796  10.343  1.00 120.48 ? 164 ASN B OD1   1 
ATOM   7654  N ND2   . ASN H 3 161 ? 45.398  -27.780  8.755   1.00 122.33 ? 164 ASN B ND2   1 
ATOM   7655  N N     . PRO H 3 162 ? 40.931  -31.733  8.735   1.00 113.43 ? 165 PRO B N     1 
ATOM   7656  C CA    . PRO H 3 162 ? 40.669  -33.058  9.259   1.00 106.79 ? 165 PRO B CA    1 
ATOM   7657  C C     . PRO H 3 162 ? 41.366  -34.101  8.414   1.00 100.86 ? 165 PRO B C     1 
ATOM   7658  O O     . PRO H 3 162 ? 41.420  -33.975  7.191   1.00 90.74  ? 165 PRO B O     1 
ATOM   7659  C CB    . PRO H 3 162 ? 39.155  -33.187  9.121   1.00 108.81 ? 165 PRO B CB    1 
ATOM   7660  C CG    . PRO H 3 162 ? 38.825  -32.371  7.915   1.00 110.46 ? 165 PRO B CG    1 
ATOM   7661  C CD    . PRO H 3 162 ? 39.881  -31.304  7.792   1.00 110.73 ? 165 PRO B CD    1 
ATOM   7662  N N     . LYS H 3 163 ? 41.908  -35.119  9.067   1.00 106.23 ? 166 LYS B N     1 
ATOM   7663  C CA    . LYS H 3 163 ? 42.529  -36.228  8.364   1.00 105.16 ? 166 LYS B CA    1 
ATOM   7664  C C     . LYS H 3 163 ? 41.638  -37.450  8.528   1.00 97.91  ? 166 LYS B C     1 
ATOM   7665  O O     . LYS H 3 163 ? 40.950  -37.594  9.541   1.00 99.77  ? 166 LYS B O     1 
ATOM   7666  C CB    . LYS H 3 163 ? 43.932  -36.480  8.913   1.00 109.67 ? 166 LYS B CB    1 
ATOM   7667  C CG    . LYS H 3 163 ? 44.881  -37.125  7.915   1.00 117.97 ? 166 LYS B CG    1 
ATOM   7668  C CD    . LYS H 3 163 ? 46.328  -36.931  8.341   1.00 125.77 ? 166 LYS B CD    1 
ATOM   7669  C CE    . LYS H 3 163 ? 47.284  -37.832  7.574   1.00 126.53 ? 166 LYS B CE    1 
ATOM   7670  N NZ    . LYS H 3 163 ? 48.704  -37.440  7.815   1.00 126.71 ? 166 LYS B NZ    1 
ATOM   7671  N N     . ARG H 3 164 ? 41.631  -38.320  7.528   1.00 92.19  ? 167 ARG B N     1 
ATOM   7672  C CA    . ARG H 3 164 ? 40.784  -39.498  7.589   1.00 95.68  ? 167 ARG B CA    1 
ATOM   7673  C C     . ARG H 3 164 ? 41.314  -40.429  8.667   1.00 96.79  ? 167 ARG B C     1 
ATOM   7674  O O     . ARG H 3 164 ? 42.514  -40.710  8.716   1.00 89.67  ? 167 ARG B O     1 
ATOM   7675  C CB    . ARG H 3 164 ? 40.744  -40.210  6.244   1.00 99.47  ? 167 ARG B CB    1 
ATOM   7676  C CG    . ARG H 3 164 ? 39.334  -40.371  5.707   1.00 102.75 ? 167 ARG B CG    1 
ATOM   7677  C CD    . ARG H 3 164 ? 39.338  -40.445  4.192   1.00 106.54 ? 167 ARG B CD    1 
ATOM   7678  N NE    . ARG H 3 164 ? 39.337  -41.817  3.701   1.00 107.18 ? 167 ARG B NE    1 
ATOM   7679  C CZ    . ARG H 3 164 ? 39.745  -42.187  2.492   1.00 109.02 ? 167 ARG B CZ    1 
ATOM   7680  N NH1   . ARG H 3 164 ? 40.224  -41.300  1.624   1.00 108.54 ? 167 ARG B NH1   1 
ATOM   7681  N NH2   . ARG H 3 164 ? 39.687  -43.466  2.150   1.00 116.23 ? 167 ARG B NH2   1 
ATOM   7682  N N     . LYS H 3 165 ? 40.423  -40.888  9.541   1.00 100.97 ? 168 LYS B N     1 
ATOM   7683  C CA    . LYS H 3 165 ? 40.818  -41.787  10.620  1.00 104.47 ? 168 LYS B CA    1 
ATOM   7684  C C     . LYS H 3 165 ? 41.092  -43.160  10.028  1.00 100.32 ? 168 LYS B C     1 
ATOM   7685  O O     . LYS H 3 165 ? 40.528  -43.514  8.991   1.00 102.43 ? 168 LYS B O     1 
ATOM   7686  C CB    . LYS H 3 165 ? 39.718  -41.922  11.678  1.00 110.84 ? 168 LYS B CB    1 
ATOM   7687  C CG    . LYS H 3 165 ? 39.211  -40.625  12.297  1.00 116.83 ? 168 LYS B CG    1 
ATOM   7688  C CD    . LYS H 3 165 ? 40.213  -39.957  13.226  1.00 117.34 ? 168 LYS B CD    1 
ATOM   7689  C CE    . LYS H 3 165 ? 40.864  -38.735  12.600  1.00 121.85 ? 168 LYS B CE    1 
ATOM   7690  N NZ    . LYS H 3 165 ? 41.024  -37.648  13.600  1.00 127.87 ? 168 LYS B NZ    1 
ATOM   7691  N N     . LYS H 3 166 ? 41.965  -43.921  10.679  1.00 94.77  ? 169 LYS B N     1 
ATOM   7692  C CA    . LYS H 3 166 ? 42.198  -45.310  10.312  1.00 91.68  ? 169 LYS B CA    1 
ATOM   7693  C C     . LYS H 3 166 ? 42.230  -46.143  11.585  1.00 90.61  ? 169 LYS B C     1 
ATOM   7694  O O     . LYS H 3 166 ? 43.134  -46.015  12.412  1.00 93.53  ? 169 LYS B O     1 
ATOM   7695  C CB    . LYS H 3 166 ? 43.455  -45.469  9.448   1.00 94.05  ? 169 LYS B CB    1 
ATOM   7696  C CG    . LYS H 3 166 ? 44.747  -44.912  10.029  1.00 99.94  ? 169 LYS B CG    1 
ATOM   7697  C CD    . LYS H 3 166 ? 45.677  -44.307  8.974   1.00 104.26 ? 169 LYS B CD    1 
ATOM   7698  C CE    . LYS H 3 166 ? 45.721  -45.095  7.668   1.00 108.75 ? 169 LYS B CE    1 
ATOM   7699  N NZ    . LYS H 3 166 ? 46.902  -44.728  6.843   1.00 112.62 ? 169 LYS B NZ    1 
ATOM   7700  N N     . SER H 3 167 ? 41.212  -46.988  11.726  1.00 90.14  ? 170 SER B N     1 
ATOM   7701  C CA    . SER H 3 167 ? 40.898  -47.659  12.976  1.00 88.26  ? 170 SER B CA    1 
ATOM   7702  C C     . SER H 3 167 ? 41.297  -49.134  12.944  1.00 88.10  ? 170 SER B C     1 
ATOM   7703  O O     . SER H 3 167 ? 41.301  -49.754  11.877  1.00 90.95  ? 170 SER B O     1 
ATOM   7704  C CB    . SER H 3 167 ? 39.396  -47.535  13.231  1.00 89.06  ? 170 SER B CB    1 
ATOM   7705  O OG    . SER H 3 167 ? 39.090  -47.768  14.586  1.00 87.90  ? 170 SER B OG    1 
ATOM   7706  N N     . TYR H 3 168 ? 41.633  -49.679  14.117  1.00 88.54  ? 171 TYR B N     1 
ATOM   7707  C CA    . TYR H 3 168 ? 41.939  -51.109  14.284  1.00 87.09  ? 171 TYR B CA    1 
ATOM   7708  C C     . TYR H 3 168 ? 40.712  -51.857  14.772  1.00 87.39  ? 171 TYR B C     1 
ATOM   7709  O O     . TYR H 3 168 ? 40.281  -51.668  15.909  1.00 86.10  ? 171 TYR B O     1 
ATOM   7710  C CB    . TYR H 3 168 ? 43.083  -51.322  15.281  1.00 85.73  ? 171 TYR B CB    1 
ATOM   7711  C CG    . TYR H 3 168 ? 44.447  -51.198  14.655  1.00 86.78  ? 171 TYR B CG    1 
ATOM   7712  C CD1   . TYR H 3 168 ? 44.813  -52.015  13.602  1.00 89.51  ? 171 TYR B CD1   1 
ATOM   7713  C CD2   . TYR H 3 168 ? 45.373  -50.274  15.116  1.00 86.89  ? 171 TYR B CD2   1 
ATOM   7714  C CE1   . TYR H 3 168 ? 46.057  -51.911  13.015  1.00 90.94  ? 171 TYR B CE1   1 
ATOM   7715  C CE2   . TYR H 3 168 ? 46.622  -50.166  14.532  1.00 88.34  ? 171 TYR B CE2   1 
ATOM   7716  C CZ    . TYR H 3 168 ? 46.952  -50.992  13.479  1.00 88.02  ? 171 TYR B CZ    1 
ATOM   7717  O OH    . TYR H 3 168 ? 48.176  -50.915  12.872  1.00 93.69  ? 171 TYR B OH    1 
ATOM   7718  N N     . VAL H 3 169 ? 40.165  -52.721  13.922  1.00 90.85  ? 172 VAL B N     1 
ATOM   7719  C CA    . VAL H 3 169 ? 38.928  -53.420  14.245  1.00 93.87  ? 172 VAL B CA    1 
ATOM   7720  C C     . VAL H 3 169 ? 38.809  -54.778  13.527  1.00 99.36  ? 172 VAL B C     1 
ATOM   7721  O O     . VAL H 3 169 ? 39.501  -55.030  12.532  1.00 101.95 ? 172 VAL B O     1 
ATOM   7722  C CB    . VAL H 3 169 ? 37.726  -52.513  13.919  1.00 90.21  ? 172 VAL B CB    1 
ATOM   7723  C CG1   . VAL H 3 169 ? 37.510  -52.430  12.416  1.00 87.91  ? 172 VAL B CG1   1 
ATOM   7724  C CG2   . VAL H 3 169 ? 36.472  -52.990  14.640  1.00 96.74  ? 172 VAL B CG2   1 
ATOM   7725  N N     . ASP H 3 170 ? 37.947  -55.650  14.058  1.00 101.30 ? 173 ASP B N     1 
ATOM   7726  C CA    . ASP H 3 170 ? 37.672  -56.963  13.455  1.00 99.66  ? 173 ASP B CA    1 
ATOM   7727  C C     . ASP H 3 170 ? 36.954  -56.814  12.122  1.00 88.79  ? 173 ASP B C     1 
ATOM   7728  O O     . ASP H 3 170 ? 36.097  -55.957  11.986  1.00 85.47  ? 173 ASP B O     1 
ATOM   7729  C CB    . ASP H 3 170 ? 36.819  -57.824  14.390  1.00 104.94 ? 173 ASP B CB    1 
ATOM   7730  C CG    . ASP H 3 170 ? 37.585  -58.286  15.613  1.00 111.31 ? 173 ASP B CG    1 
ATOM   7731  O OD1   . ASP H 3 170 ? 38.657  -58.909  15.442  1.00 117.59 ? 173 ASP B OD1   1 
ATOM   7732  O OD2   . ASP H 3 170 ? 37.113  -58.034  16.742  1.00 111.07 ? 173 ASP B OD2   1 
ATOM   7733  N N     . PRO H 3 171 ? 37.286  -57.666  11.143  1.00 83.88  ? 174 PRO B N     1 
ATOM   7734  C CA    . PRO H 3 171 ? 36.789  -57.497  9.777   1.00 84.15  ? 174 PRO B CA    1 
ATOM   7735  C C     . PRO H 3 171 ? 35.277  -57.331  9.667   1.00 84.77  ? 174 PRO B C     1 
ATOM   7736  O O     . PRO H 3 171 ? 34.540  -57.841  10.504  1.00 83.82  ? 174 PRO B O     1 
ATOM   7737  C CB    . PRO H 3 171 ? 37.239  -58.778  9.090   1.00 85.44  ? 174 PRO B CB    1 
ATOM   7738  C CG    . PRO H 3 171 ? 38.486  -59.147  9.806   1.00 86.13  ? 174 PRO B CG    1 
ATOM   7739  C CD    . PRO H 3 171 ? 38.229  -58.791  11.241  1.00 84.83  ? 174 PRO B CD    1 
ATOM   7740  N N     . GLY H 3 172 ? 34.834  -56.599  8.646   1.00 87.15  ? 175 GLY B N     1 
ATOM   7741  C CA    . GLY H 3 172 ? 33.407  -56.357  8.415   1.00 93.68  ? 175 GLY B CA    1 
ATOM   7742  C C     . GLY H 3 172 ? 32.785  -55.288  9.303   1.00 99.68  ? 175 GLY B C     1 
ATOM   7743  O O     . GLY H 3 172 ? 31.675  -54.818  9.034   1.00 95.71  ? 175 GLY B O     1 
ATOM   7744  N N     . GLN H 3 173 ? 33.504  -54.907  10.358  1.00 105.58 ? 176 GLN B N     1 
ATOM   7745  C CA    . GLN H 3 173 ? 33.085  -53.861  11.289  1.00 111.46 ? 176 GLN B CA    1 
ATOM   7746  C C     . GLN H 3 173 ? 33.451  -52.488  10.697  1.00 109.49 ? 176 GLN B C     1 
ATOM   7747  O O     . GLN H 3 173 ? 34.516  -52.348  10.090  1.00 104.36 ? 176 GLN B O     1 
ATOM   7748  C CB    . GLN H 3 173 ? 33.813  -54.065  12.628  1.00 116.40 ? 176 GLN B CB    1 
ATOM   7749  C CG    . GLN H 3 173 ? 33.066  -53.629  13.876  1.00 119.96 ? 176 GLN B CG    1 
ATOM   7750  C CD    . GLN H 3 173 ? 31.929  -54.565  14.253  1.00 123.15 ? 176 GLN B CD    1 
ATOM   7751  O OE1   . GLN H 3 173 ? 31.333  -54.424  15.317  1.00 130.25 ? 176 GLN B OE1   1 
ATOM   7752  N NE2   . GLN H 3 173 ? 31.628  -55.526  13.388  1.00 121.35 ? 176 GLN B NE2   1 
ATOM   7753  N N     . PRO H 3 174 ? 32.580  -51.472  10.870  1.00 105.76 ? 177 PRO B N     1 
ATOM   7754  C CA    . PRO H 3 174 ? 32.860  -50.150  10.292  1.00 98.78  ? 177 PRO B CA    1 
ATOM   7755  C C     . PRO H 3 174 ? 33.902  -49.349  11.077  1.00 91.81  ? 177 PRO B C     1 
ATOM   7756  O O     . PRO H 3 174 ? 33.949  -49.434  12.302  1.00 88.21  ? 177 PRO B O     1 
ATOM   7757  C CB    . PRO H 3 174 ? 31.499  -49.457  10.350  1.00 100.67 ? 177 PRO B CB    1 
ATOM   7758  C CG    . PRO H 3 174 ? 30.831  -50.067  11.534  1.00 104.99 ? 177 PRO B CG    1 
ATOM   7759  C CD    . PRO H 3 174 ? 31.273  -51.503  11.554  1.00 107.35 ? 177 PRO B CD    1 
ATOM   7760  N N     . ALA H 3 175 ? 34.725  -48.583  10.362  1.00 88.83  ? 178 ALA B N     1 
ATOM   7761  C CA    . ALA H 3 175 ? 35.730  -47.717  10.980  1.00 95.46  ? 178 ALA B CA    1 
ATOM   7762  C C     . ALA H 3 175 ? 35.171  -46.320  11.247  1.00 97.22  ? 178 ALA B C     1 
ATOM   7763  O O     . ALA H 3 175 ? 34.103  -45.962  10.755  1.00 96.97  ? 178 ALA B O     1 
ATOM   7764  C CB    . ALA H 3 175 ? 36.963  -47.622  10.094  1.00 98.18  ? 178 ALA B CB    1 
ATOM   7765  N N     . THR H 3 176 ? 35.918  -45.531  12.013  1.00 97.40  ? 179 THR B N     1 
ATOM   7766  C CA    . THR H 3 176 ? 35.493  -44.191  12.410  1.00 97.60  ? 179 THR B CA    1 
ATOM   7767  C C     . THR H 3 176 ? 35.522  -43.207  11.242  1.00 92.57  ? 179 THR B C     1 
ATOM   7768  O O     . THR H 3 176 ? 36.568  -42.982  10.639  1.00 92.37  ? 179 THR B O     1 
ATOM   7769  C CB    . THR H 3 176 ? 36.399  -43.653  13.530  1.00 102.88 ? 179 THR B CB    1 
ATOM   7770  O OG1   . THR H 3 176 ? 36.292  -44.509  14.674  1.00 108.69 ? 179 THR B OG1   1 
ATOM   7771  C CG2   . THR H 3 176 ? 36.007  -42.232  13.922  1.00 105.28 ? 179 THR B CG2   1 
ATOM   7772  N N     . SER H 3 177 ? 34.376  -42.604  10.942  1.00 89.97  ? 180 SER B N     1 
ATOM   7773  C CA    . SER H 3 177 ? 34.275  -41.653  9.831   1.00 90.62  ? 180 SER B CA    1 
ATOM   7774  C C     . SER H 3 177 ? 34.560  -40.216  10.276  1.00 93.04  ? 180 SER B C     1 
ATOM   7775  O O     . SER H 3 177 ? 34.361  -39.856  11.437  1.00 92.96  ? 180 SER B O     1 
ATOM   7776  C CB    . SER H 3 177 ? 32.898  -41.731  9.177   1.00 84.68  ? 180 SER B CB    1 
ATOM   7777  O OG    . SER H 3 177 ? 31.885  -41.704  10.158  1.00 84.25  ? 180 SER B OG    1 
ATOM   7778  N N     . THR H 3 178 ? 35.033  -39.406  9.334   1.00 91.70  ? 181 THR B N     1 
ATOM   7779  C CA    . THR H 3 178 ? 35.376  -38.019  9.600   1.00 91.36  ? 181 THR B CA    1 
ATOM   7780  C C     . THR H 3 178 ? 34.694  -37.110  8.596   1.00 88.87  ? 181 THR B C     1 
ATOM   7781  O O     . THR H 3 178 ? 34.518  -37.474  7.436   1.00 78.71  ? 181 THR B O     1 
ATOM   7782  C CB    . THR H 3 178 ? 36.900  -37.780  9.544   1.00 96.08  ? 181 THR B CB    1 
ATOM   7783  O OG1   . THR H 3 178 ? 37.529  -38.810  8.769   1.00 103.27 ? 181 THR B OG1   1 
ATOM   7784  C CG2   . THR H 3 178 ? 37.488  -37.772  10.946  1.00 97.37  ? 181 THR B CG2   1 
ATOM   7785  N N     . ALA H 3 179 ? 34.322  -35.920  9.065   1.00 93.06  ? 182 ALA B N     1 
ATOM   7786  C CA    . ALA H 3 179 ? 33.627  -34.930  8.250   1.00 92.61  ? 182 ALA B CA    1 
ATOM   7787  C C     . ALA H 3 179 ? 34.562  -34.348  7.203   1.00 92.97  ? 182 ALA B C     1 
ATOM   7788  O O     . ALA H 3 179 ? 35.720  -34.056  7.500   1.00 100.22 ? 182 ALA B O     1 
ATOM   7789  C CB    . ALA H 3 179 ? 33.067  -33.825  9.135   1.00 94.40  ? 182 ALA B CB    1 
ATOM   7790  N N     . ARG H 3 180 ? 34.058  -34.182  5.982   1.00 91.94  ? 183 ARG B N     1 
ATOM   7791  C CA    . ARG H 3 180 ? 34.854  -33.608  4.895   1.00 95.36  ? 183 ARG B CA    1 
ATOM   7792  C C     . ARG H 3 180 ? 35.232  -32.146  5.156   1.00 104.98 ? 183 ARG B C     1 
ATOM   7793  O O     . ARG H 3 180 ? 34.558  -31.450  5.926   1.00 100.89 ? 183 ARG B O     1 
ATOM   7794  C CB    . ARG H 3 180 ? 34.128  -33.710  3.545   1.00 90.67  ? 183 ARG B CB    1 
ATOM   7795  C CG    . ARG H 3 180 ? 34.703  -34.764  2.623   1.00 90.98  ? 183 ARG B CG    1 
ATOM   7796  C CD    . ARG H 3 180 ? 34.474  -34.432  1.160   1.00 93.55  ? 183 ARG B CD    1 
ATOM   7797  N NE    . ARG H 3 180 ? 35.109  -35.427  0.302   1.00 95.26  ? 183 ARG B NE    1 
ATOM   7798  C CZ    . ARG H 3 180 ? 34.574  -36.602  -0.027  1.00 98.31  ? 183 ARG B CZ    1 
ATOM   7799  N NH1   . ARG H 3 180 ? 35.246  -37.437  -0.806  1.00 98.08  ? 183 ARG B NH1   1 
ATOM   7800  N NH2   . ARG H 3 180 ? 33.371  -36.957  0.409   1.00 101.74 ? 183 ARG B NH2   1 
ATOM   7801  N N     . PRO H 3 181 ? 36.311  -31.675  4.502   1.00 116.27 ? 184 PRO B N     1 
ATOM   7802  C CA    . PRO H 3 181 ? 36.756  -30.300  4.661   1.00 118.74 ? 184 PRO B CA    1 
ATOM   7803  C C     . PRO H 3 181 ? 36.109  -29.408  3.610   1.00 123.25 ? 184 PRO B C     1 
ATOM   7804  O O     . PRO H 3 181 ? 36.346  -29.620  2.417   1.00 122.57 ? 184 PRO B O     1 
ATOM   7805  C CB    . PRO H 3 181 ? 38.259  -30.410  4.409   1.00 120.22 ? 184 PRO B CB    1 
ATOM   7806  C CG    . PRO H 3 181 ? 38.400  -31.546  3.435   1.00 118.47 ? 184 PRO B CG    1 
ATOM   7807  C CD    . PRO H 3 181 ? 37.163  -32.401  3.537   1.00 116.91 ? 184 PRO B CD    1 
ATOM   7808  N N     . ASN H 3 182 ? 35.296  -28.432  4.026   1.00 128.74 ? 185 ASN B N     1 
ATOM   7809  C CA    . ASN H 3 182 ? 34.648  -27.534  3.049   1.00 130.65 ? 185 ASN B CA    1 
ATOM   7810  C C     . ASN H 3 182 ? 35.620  -26.471  2.530   1.00 130.62 ? 185 ASN B C     1 
ATOM   7811  O O     . ASN H 3 182 ? 36.038  -25.582  3.268   1.00 123.68 ? 185 ASN B O     1 
ATOM   7812  C CB    . ASN H 3 182 ? 33.317  -26.931  3.561   1.00 127.68 ? 185 ASN B CB    1 
ATOM   7813  C CG    . ASN H 3 182 ? 33.453  -26.156  4.858   1.00 124.40 ? 185 ASN B CG    1 
ATOM   7814  O OD1   . ASN H 3 182 ? 32.587  -26.233  5.727   1.00 121.22 ? 185 ASN B OD1   1 
ATOM   7815  N ND2   . ASN H 3 182 ? 34.515  -25.388  4.985   1.00 128.44 ? 185 ASN B ND2   1 
ATOM   7816  N N     . ARG H 3 183 ? 35.989  -26.590  1.256   1.00 137.66 ? 186 ARG B N     1 
ATOM   7817  C CA    . ARG H 3 183 ? 37.003  -25.726  0.641   1.00 147.32 ? 186 ARG B CA    1 
ATOM   7818  C C     . ARG H 3 183 ? 36.849  -24.262  1.031   1.00 145.32 ? 186 ARG B C     1 
ATOM   7819  O O     . ARG H 3 183 ? 37.831  -23.598  1.382   1.00 146.86 ? 186 ARG B O     1 
ATOM   7820  C CB    . ARG H 3 183 ? 36.951  -25.854  -0.882  1.00 153.06 ? 186 ARG B CB    1 
ATOM   7821  C CG    . ARG H 3 183 ? 37.794  -24.825  -1.624  1.00 154.19 ? 186 ARG B CG    1 
ATOM   7822  C CD    . ARG H 3 183 ? 38.800  -25.482  -2.542  1.00 159.45 ? 186 ARG B CD    1 
ATOM   7823  N NE    . ARG H 3 183 ? 39.814  -26.223  -1.791  1.00 161.92 ? 186 ARG B NE    1 
ATOM   7824  C CZ    . ARG H 3 183 ? 40.939  -26.705  -2.313  1.00 161.95 ? 186 ARG B CZ    1 
ATOM   7825  N NH1   . ARG H 3 183 ? 41.219  -26.525  -3.598  1.00 163.78 ? 186 ARG B NH1   1 
ATOM   7826  N NH2   . ARG H 3 183 ? 41.797  -27.367  -1.545  1.00 158.89 ? 186 ARG B NH2   1 
ATOM   7827  N N     . PHE H 3 184 ? 35.613  -23.774  0.963   1.00 135.57 ? 187 PHE B N     1 
ATOM   7828  C CA    . PHE H 3 184 ? 35.301  -22.393  1.305   1.00 124.52 ? 187 PHE B CA    1 
ATOM   7829  C C     . PHE H 3 184 ? 35.169  -22.277  2.817   1.00 117.70 ? 187 PHE B C     1 
ATOM   7830  O O     . PHE H 3 184 ? 34.066  -22.160  3.354   1.00 123.41 ? 187 PHE B O     1 
ATOM   7831  C CB    . PHE H 3 184 ? 34.015  -21.938  0.605   1.00 125.07 ? 187 PHE B CB    1 
ATOM   7832  C CG    . PHE H 3 184 ? 33.967  -22.264  -0.864  1.00 130.77 ? 187 PHE B CG    1 
ATOM   7833  C CD1   . PHE H 3 184 ? 35.115  -22.199  -1.653  1.00 136.78 ? 187 PHE B CD1   1 
ATOM   7834  C CD2   . PHE H 3 184 ? 32.767  -22.621  -1.465  1.00 132.16 ? 187 PHE B CD2   1 
ATOM   7835  C CE1   . PHE H 3 184 ? 35.066  -22.497  -3.004  1.00 137.29 ? 187 PHE B CE1   1 
ATOM   7836  C CE2   . PHE H 3 184 ? 32.711  -22.917  -2.817  1.00 134.88 ? 187 PHE B CE2   1 
ATOM   7837  C CZ    . PHE H 3 184 ? 33.862  -22.855  -3.587  1.00 136.82 ? 187 PHE B CZ    1 
ATOM   7838  N N     . GLY H 3 185 ? 36.311  -22.322  3.497   1.00 108.00 ? 188 GLY B N     1 
ATOM   7839  C CA    . GLY H 3 185 ? 36.358  -22.296  4.954   1.00 101.34 ? 188 GLY B CA    1 
ATOM   7840  C C     . GLY H 3 185 ? 37.455  -21.381  5.445   1.00 97.42  ? 188 GLY B C     1 
ATOM   7841  O O     . GLY H 3 185 ? 38.347  -21.001  4.682   1.00 91.70  ? 188 GLY B O     1 
ATOM   7842  N N     . LYS H 3 186 ? 37.384  -21.041  6.729   1.00 95.23  ? 189 LYS B N     1 
ATOM   7843  C CA    . LYS H 3 186 ? 38.291  -20.075  7.333   1.00 98.45  ? 189 LYS B CA    1 
ATOM   7844  C C     . LYS H 3 186 ? 39.744  -20.497  7.156   1.00 95.19  ? 189 LYS B C     1 
ATOM   7845  O O     . LYS H 3 186 ? 40.090  -21.639  7.438   1.00 97.35  ? 189 LYS B O     1 
ATOM   7846  C CB    . LYS H 3 186 ? 37.972  -19.906  8.821   1.00 104.97 ? 189 LYS B CB    1 
ATOM   7847  C CG    . LYS H 3 186 ? 36.615  -19.266  9.087   1.00 113.56 ? 189 LYS B CG    1 
ATOM   7848  C CD    . LYS H 3 186 ? 36.521  -18.660  10.482  1.00 121.30 ? 189 LYS B CD    1 
ATOM   7849  C CE    . LYS H 3 186 ? 37.224  -17.310  10.573  1.00 122.83 ? 189 LYS B CE    1 
ATOM   7850  N NZ    . LYS H 3 186 ? 37.092  -16.700  11.926  1.00 124.63 ? 189 LYS B NZ    1 
ATOM   7851  N N     . LYS H 3 187 ? 40.580  -19.569  6.690   1.00 93.44  ? 190 LYS B N     1 
ATOM   7852  C CA    . LYS H 3 187 ? 41.994  -19.843  6.443   1.00 93.28  ? 190 LYS B CA    1 
ATOM   7853  C C     . LYS H 3 187 ? 42.860  -18.590  6.466   1.00 99.66  ? 190 LYS B C     1 
ATOM   7854  O O     . LYS H 3 187 ? 42.677  -17.688  5.650   1.00 107.43 ? 190 LYS B O     1 
ATOM   7855  C CB    . LYS H 3 187 ? 42.174  -20.517  5.083   1.00 91.68  ? 190 LYS B CB    1 
ATOM   7856  C CG    . LYS H 3 187 ? 41.478  -19.821  3.922   1.00 92.99  ? 190 LYS B CG    1 
ATOM   7857  C CD    . LYS H 3 187 ? 41.962  -20.355  2.582   1.00 97.39  ? 190 LYS B CD    1 
ATOM   7858  C CE    . LYS H 3 187 ? 40.836  -20.952  1.757   1.00 103.96 ? 190 LYS B CE    1 
ATOM   7859  N NZ    . LYS H 3 187 ? 40.080  -19.934  0.982   1.00 106.53 ? 190 LYS B NZ    1 
ATOM   7860  N N     . THR H 3 188 ? 43.821  -18.542  7.382   1.00 99.17  ? 191 THR B N     1 
ATOM   7861  C CA    . THR H 3 188 ? 44.832  -17.487  7.361   1.00 99.40  ? 191 THR B CA    1 
ATOM   7862  C C     . THR H 3 188 ? 45.797  -17.764  6.216   1.00 99.47  ? 191 THR B C     1 
ATOM   7863  O O     . THR H 3 188 ? 45.668  -18.778  5.547   1.00 102.56 ? 191 THR B O     1 
ATOM   7864  C CB    . THR H 3 188 ? 45.595  -17.420  8.684   1.00 102.06 ? 191 THR B CB    1 
ATOM   7865  O OG1   . THR H 3 188 ? 46.013  -18.735  9.067   1.00 105.41 ? 191 THR B OG1   1 
ATOM   7866  C CG2   . THR H 3 188 ? 44.710  -16.841  9.762   1.00 104.98 ? 191 THR B CG2   1 
ATOM   7867  N N     . MET H 3 189 ? 46.752  -16.872  5.974   1.00 101.25 ? 192 MET B N     1 
ATOM   7868  C CA    . MET H 3 189 ? 47.631  -17.019  4.813   1.00 98.03  ? 192 MET B CA    1 
ATOM   7869  C C     . MET H 3 189 ? 49.065  -16.622  5.133   1.00 97.70  ? 192 MET B C     1 
ATOM   7870  O O     . MET H 3 189 ? 49.601  -15.677  4.556   1.00 92.11  ? 192 MET B O     1 
ATOM   7871  C CB    . MET H 3 189 ? 47.085  -16.206  3.636   1.00 97.57  ? 192 MET B CB    1 
ATOM   7872  C CG    . MET H 3 189 ? 47.519  -16.702  2.265   1.00 99.95  ? 192 MET B CG    1 
ATOM   7873  S SD    . MET H 3 189 ? 48.976  -15.877  1.599   1.00 106.29 ? 192 MET B SD    1 
ATOM   7874  C CE    . MET H 3 189 ? 48.778  -16.206  -0.157  1.00 100.48 ? 192 MET B CE    1 
ATOM   7875  N N     . LEU H 3 190 ? 49.668  -17.377  6.051   1.00 97.74  ? 193 LEU B N     1 
ATOM   7876  C CA    . LEU H 3 190 ? 51.082  -17.241  6.436   1.00 95.33  ? 193 LEU B CA    1 
ATOM   7877  C C     . LEU H 3 190 ? 52.056  -16.942  5.288   1.00 95.47  ? 193 LEU B C     1 
ATOM   7878  O O     . LEU H 3 190 ? 52.070  -17.635  4.265   1.00 94.22  ? 193 LEU B O     1 
ATOM   7879  C CB    . LEU H 3 190 ? 51.552  -18.522  7.124   1.00 96.44  ? 193 LEU B CB    1 
ATOM   7880  C CG    . LEU H 3 190 ? 53.062  -18.660  7.333   1.00 102.83 ? 193 LEU B CG    1 
ATOM   7881  C CD1   . LEU H 3 190 ? 53.552  -17.598  8.306   1.00 108.58 ? 193 LEU B CD1   1 
ATOM   7882  C CD2   . LEU H 3 190 ? 53.413  -20.056  7.827   1.00 103.79 ? 193 LEU B CD2   1 
ATOM   7883  N N     . CYS H 3 191 ? 52.872  -15.910  5.490   1.00 92.87  ? 194 CYS B N     1 
ATOM   7884  C CA    . CYS H 3 191 ? 53.978  -15.577  4.607   1.00 90.61  ? 194 CYS B CA    1 
ATOM   7885  C C     . CYS H 3 191 ? 55.242  -15.627  5.435   1.00 86.90  ? 194 CYS B C     1 
ATOM   7886  O O     . CYS H 3 191 ? 55.287  -15.044  6.525   1.00 88.27  ? 194 CYS B O     1 
ATOM   7887  C CB    . CYS H 3 191 ? 53.795  -14.170  4.055   1.00 91.24  ? 194 CYS B CB    1 
ATOM   7888  S SG    . CYS H 3 191 ? 52.274  -13.964  3.120   1.00 96.00  ? 194 CYS B SG    1 
ATOM   7889  N N     . VAL H 3 192 ? 56.269  -16.318  4.943   1.00 79.65  ? 195 VAL B N     1 
ATOM   7890  C CA    . VAL H 3 192 ? 57.466  -16.511  5.754   1.00 77.67  ? 195 VAL B CA    1 
ATOM   7891  C C     . VAL H 3 192 ? 58.751  -16.587  4.949   1.00 79.42  ? 195 VAL B C     1 
ATOM   7892  O O     . VAL H 3 192 ? 58.811  -17.228  3.889   1.00 71.84  ? 195 VAL B O     1 
ATOM   7893  C CB    . VAL H 3 192 ? 57.349  -17.754  6.662   1.00 76.39  ? 195 VAL B CB    1 
ATOM   7894  C CG1   . VAL H 3 192 ? 57.143  -19.021  5.844   1.00 77.36  ? 195 VAL B CG1   1 
ATOM   7895  C CG2   . VAL H 3 192 ? 58.565  -17.878  7.565   1.00 76.07  ? 195 VAL B CG2   1 
ATOM   7896  N N     . TRP H 3 193 ? 59.756  -15.894  5.491   1.00 80.85  ? 196 TRP B N     1 
ATOM   7897  C CA    . TRP H 3 193 ? 61.093  -15.817  4.937   1.00 80.16  ? 196 TRP B CA    1 
ATOM   7898  C C     . TRP H 3 193 ? 62.047  -16.270  6.026   1.00 79.30  ? 196 TRP B C     1 
ATOM   7899  O O     . TRP H 3 193 ? 61.830  -15.969  7.206   1.00 77.09  ? 196 TRP B O     1 
ATOM   7900  C CB    . TRP H 3 193 ? 61.426  -14.382  4.507   1.00 79.80  ? 196 TRP B CB    1 
ATOM   7901  C CG    . TRP H 3 193 ? 60.520  -13.863  3.441   1.00 79.98  ? 196 TRP B CG    1 
ATOM   7902  C CD1   . TRP H 3 193 ? 60.722  -13.912  2.090   1.00 83.63  ? 196 TRP B CD1   1 
ATOM   7903  C CD2   . TRP H 3 193 ? 59.255  -13.228  3.634   1.00 78.02  ? 196 TRP B CD2   1 
ATOM   7904  N NE1   . TRP H 3 193 ? 59.653  -13.350  1.430   1.00 84.26  ? 196 TRP B NE1   1 
ATOM   7905  C CE2   . TRP H 3 193 ? 58.742  -12.919  2.357   1.00 81.70  ? 196 TRP B CE2   1 
ATOM   7906  C CE3   . TRP H 3 193 ? 58.505  -12.889  4.763   1.00 80.05  ? 196 TRP B CE3   1 
ATOM   7907  C CZ2   . TRP H 3 193 ? 57.512  -12.287  2.180   1.00 83.47  ? 196 TRP B CZ2   1 
ATOM   7908  C CZ3   . TRP H 3 193 ? 57.285  -12.263  4.588   1.00 80.78  ? 196 TRP B CZ3   1 
ATOM   7909  C CH2   . TRP H 3 193 ? 56.800  -11.968  3.304   1.00 82.72  ? 196 TRP B CH2   1 
ATOM   7910  N N     . TRP H 3 194 ? 63.097  -16.987  5.623   1.00 77.71  ? 197 TRP B N     1 
ATOM   7911  C CA    . TRP H 3 194 ? 64.013  -17.642  6.559   1.00 75.09  ? 197 TRP B CA    1 
ATOM   7912  C C     . TRP H 3 194 ? 65.333  -17.936  5.874   1.00 74.75  ? 197 TRP B C     1 
ATOM   7913  O O     . TRP H 3 194 ? 65.434  -17.854  4.650   1.00 73.36  ? 197 TRP B O     1 
ATOM   7914  C CB    . TRP H 3 194 ? 63.398  -18.947  7.074   1.00 76.81  ? 197 TRP B CB    1 
ATOM   7915  C CG    . TRP H 3 194 ? 63.021  -19.922  5.975   1.00 76.50  ? 197 TRP B CG    1 
ATOM   7916  C CD1   . TRP H 3 194 ? 62.011  -19.789  5.071   1.00 76.96  ? 197 TRP B CD1   1 
ATOM   7917  C CD2   . TRP H 3 194 ? 63.656  -21.171  5.682   1.00 78.80  ? 197 TRP B CD2   1 
ATOM   7918  N NE1   . TRP H 3 194 ? 61.979  -20.871  4.229   1.00 76.76  ? 197 TRP B NE1   1 
ATOM   7919  C CE2   . TRP H 3 194 ? 62.981  -21.734  4.582   1.00 79.59  ? 197 TRP B CE2   1 
ATOM   7920  C CE3   . TRP H 3 194 ? 64.734  -21.870  6.244   1.00 78.54  ? 197 TRP B CE3   1 
ATOM   7921  C CZ2   . TRP H 3 194 ? 63.347  -22.961  4.031   1.00 79.40  ? 197 TRP B CZ2   1 
ATOM   7922  C CZ3   . TRP H 3 194 ? 65.093  -23.081  5.699   1.00 77.10  ? 197 TRP B CZ3   1 
ATOM   7923  C CH2   . TRP H 3 194 ? 64.401  -23.616  4.600   1.00 77.92  ? 197 TRP B CH2   1 
ATOM   7924  N N     . ASP H 3 195 ? 66.342  -18.277  6.667   1.00 78.30  ? 198 ASP B N     1 
ATOM   7925  C CA    . ASP H 3 195 ? 67.664  -18.626  6.140   1.00 84.72  ? 198 ASP B CA    1 
ATOM   7926  C C     . ASP H 3 195 ? 68.228  -19.822  6.901   1.00 84.13  ? 198 ASP B C     1 
ATOM   7927  O O     . ASP H 3 195 ? 67.562  -20.375  7.775   1.00 84.21  ? 198 ASP B O     1 
ATOM   7928  C CB    . ASP H 3 195 ? 68.613  -17.423  6.235   1.00 92.41  ? 198 ASP B CB    1 
ATOM   7929  C CG    . ASP H 3 195 ? 69.013  -17.084  7.679   1.00 96.58  ? 198 ASP B CG    1 
ATOM   7930  O OD1   . ASP H 3 195 ? 68.604  -17.789  8.635   1.00 94.33  ? 198 ASP B OD1   1 
ATOM   7931  O OD2   . ASP H 3 195 ? 69.752  -16.092  7.856   1.00 101.64 ? 198 ASP B OD2   1 
ATOM   7932  N N     . GLN H 3 196 ? 69.463  -20.204  6.602   1.00 82.75  ? 199 GLN B N     1 
ATOM   7933  C CA    . GLN H 3 196 ? 70.036  -21.383  7.240   1.00 84.79  ? 199 GLN B CA    1 
ATOM   7934  C C     . GLN H 3 196 ? 70.152  -21.258  8.774   1.00 85.52  ? 199 GLN B C     1 
ATOM   7935  O O     . GLN H 3 196 ? 70.110  -22.259  9.476   1.00 85.62  ? 199 GLN B O     1 
ATOM   7936  C CB    . GLN H 3 196 ? 71.376  -21.755  6.597   1.00 85.69  ? 199 GLN B CB    1 
ATOM   7937  C CG    . GLN H 3 196 ? 72.597  -21.073  7.179   1.00 90.47  ? 199 GLN B CG    1 
ATOM   7938  C CD    . GLN H 3 196 ? 73.873  -21.458  6.453   1.00 96.34  ? 199 GLN B CD    1 
ATOM   7939  O OE1   . GLN H 3 196 ? 73.855  -21.790  5.261   1.00 95.73  ? 199 GLN B OE1   1 
ATOM   7940  N NE2   . GLN H 3 196 ? 74.995  -21.403  7.164   1.00 98.91  ? 199 GLN B NE2   1 
ATOM   7941  N N     . SER H 3 197 ? 70.277  -20.039  9.293   1.00 91.28  ? 200 SER B N     1 
ATOM   7942  C CA    . SER H 3 197 ? 70.397  -19.835  10.745  1.00 90.11  ? 200 SER B CA    1 
ATOM   7943  C C     . SER H 3 197 ? 69.048  -19.761  11.471  1.00 85.86  ? 200 SER B C     1 
ATOM   7944  O O     . SER H 3 197 ? 69.016  -19.783  12.707  1.00 80.00  ? 200 SER B O     1 
ATOM   7945  C CB    . SER H 3 197 ? 71.245  -18.592  11.059  1.00 90.26  ? 200 SER B CB    1 
ATOM   7946  O OG    . SER H 3 197 ? 72.628  -18.911  11.029  1.00 91.63  ? 200 SER B OG    1 
ATOM   7947  N N     . GLY H 3 198 ? 67.947  -19.679  10.723  1.00 84.20  ? 201 GLY B N     1 
ATOM   7948  C CA    . GLY H 3 198 ? 66.608  -19.669  11.332  1.00 89.01  ? 201 GLY B CA    1 
ATOM   7949  C C     . GLY H 3 198 ? 65.544  -18.931  10.536  1.00 92.65  ? 201 GLY B C     1 
ATOM   7950  O O     . GLY H 3 198 ? 65.739  -18.604  9.357   1.00 90.87  ? 201 GLY B O     1 
ATOM   7951  N N     . VAL H 3 199 ? 64.405  -18.685  11.183  1.00 93.82  ? 202 VAL B N     1 
ATOM   7952  C CA    . VAL H 3 199 ? 63.342  -17.861  10.591  1.00 95.81  ? 202 VAL B CA    1 
ATOM   7953  C C     . VAL H 3 199 ? 63.593  -16.369  10.848  1.00 96.14  ? 202 VAL B C     1 
ATOM   7954  O O     . VAL H 3 199 ? 63.838  -15.950  11.980  1.00 90.79  ? 202 VAL B O     1 
ATOM   7955  C CB    . VAL H 3 199 ? 61.937  -18.246  11.104  1.00 94.39  ? 202 VAL B CB    1 
ATOM   7956  C CG1   . VAL H 3 199 ? 61.792  -17.974  12.601  1.00 96.37  ? 202 VAL B CG1   1 
ATOM   7957  C CG2   . VAL H 3 199 ? 60.866  -17.499  10.314  1.00 93.16  ? 202 VAL B CG2   1 
ATOM   7958  N N     . ILE H 3 200 ? 63.515  -15.576  9.786   1.00 95.12  ? 203 ILE B N     1 
ATOM   7959  C CA    . ILE H 3 200 ? 63.827  -14.157  9.854   1.00 97.25  ? 203 ILE B CA    1 
ATOM   7960  C C     . ILE H 3 200 ? 62.590  -13.369  10.278  1.00 98.54  ? 203 ILE B C     1 
ATOM   7961  O O     . ILE H 3 200 ? 62.577  -12.717  11.327  1.00 100.33 ? 203 ILE B O     1 
ATOM   7962  C CB    . ILE H 3 200 ? 64.309  -13.633  8.481   1.00 97.56  ? 203 ILE B CB    1 
ATOM   7963  C CG1   . ILE H 3 200 ? 65.553  -14.395  8.005   1.00 96.01  ? 203 ILE B CG1   1 
ATOM   7964  C CG2   . ILE H 3 200 ? 64.578  -12.137  8.537   1.00 97.65  ? 203 ILE B CG2   1 
ATOM   7965  C CD1   . ILE H 3 200 ? 66.821  -14.062  8.757   1.00 98.19  ? 203 ILE B CD1   1 
ATOM   7966  N N     . TYR H 3 201 ? 61.551  -13.451  9.453   1.00 96.99  ? 204 TYR B N     1 
ATOM   7967  C CA    . TYR H 3 201 ? 60.376  -12.604  9.589   1.00 96.65  ? 204 TYR B CA    1 
ATOM   7968  C C     . TYR H 3 201 ? 59.163  -13.279  8.952   1.00 94.97  ? 204 TYR B C     1 
ATOM   7969  O O     . TYR H 3 201 ? 59.273  -13.901  7.891   1.00 92.57  ? 204 TYR B O     1 
ATOM   7970  C CB    . TYR H 3 201 ? 60.637  -11.251  8.912   1.00 97.16  ? 204 TYR B CB    1 
ATOM   7971  C CG    . TYR H 3 201 ? 59.436  -10.333  8.899   1.00 94.16  ? 204 TYR B CG    1 
ATOM   7972  C CD1   . TYR H 3 201 ? 58.992  -9.721   10.075  1.00 90.73  ? 204 TYR B CD1   1 
ATOM   7973  C CD2   . TYR H 3 201 ? 58.737  -10.083  7.718   1.00 89.50  ? 204 TYR B CD2   1 
ATOM   7974  C CE1   . TYR H 3 201 ? 57.889  -8.890   10.074  1.00 88.52  ? 204 TYR B CE1   1 
ATOM   7975  C CE2   . TYR H 3 201 ? 57.635  -9.248   7.709   1.00 89.81  ? 204 TYR B CE2   1 
ATOM   7976  C CZ    . TYR H 3 201 ? 57.217  -8.658   8.889   1.00 90.45  ? 204 TYR B CZ    1 
ATOM   7977  O OH    . TYR H 3 201 ? 56.124  -7.830   8.887   1.00 95.84  ? 204 TYR B OH    1 
ATOM   7978  N N     . TYR H 3 202 ? 58.009  -13.149  9.597   1.00 89.56  ? 205 TYR B N     1 
ATOM   7979  C CA    . TYR H 3 202 ? 56.796  -13.751  9.080   1.00 88.30  ? 205 TYR B CA    1 
ATOM   7980  C C     . TYR H 3 202 ? 55.565  -12.904  9.379   1.00 93.79  ? 205 TYR B C     1 
ATOM   7981  O O     . TYR H 3 202 ? 55.490  -12.234  10.413  1.00 95.97  ? 205 TYR B O     1 
ATOM   7982  C CB    . TYR H 3 202 ? 56.635  -15.170  9.645   1.00 88.68  ? 205 TYR B CB    1 
ATOM   7983  C CG    . TYR H 3 202 ? 55.983  -15.273  11.014  1.00 81.20  ? 205 TYR B CG    1 
ATOM   7984  C CD1   . TYR H 3 202 ? 54.604  -15.340  11.132  1.00 80.85  ? 205 TYR B CD1   1 
ATOM   7985  C CD2   . TYR H 3 202 ? 56.742  -15.338  12.176  1.00 79.59  ? 205 TYR B CD2   1 
ATOM   7986  C CE1   . TYR H 3 202 ? 53.990  -15.442  12.364  1.00 81.26  ? 205 TYR B CE1   1 
ATOM   7987  C CE2   . TYR H 3 202 ? 56.136  -15.444  13.421  1.00 82.15  ? 205 TYR B CE2   1 
ATOM   7988  C CZ    . TYR H 3 202 ? 54.753  -15.493  13.504  1.00 83.59  ? 205 TYR B CZ    1 
ATOM   7989  O OH    . TYR H 3 202 ? 54.104  -15.597  14.715  1.00 86.15  ? 205 TYR B OH    1 
ATOM   7990  N N     . GLU H 3 203 ? 54.607  -12.947  8.459   1.00 95.74  ? 206 GLU B N     1 
ATOM   7991  C CA    . GLU H 3 203 ? 53.334  -12.260  8.612   1.00 99.56  ? 206 GLU B CA    1 
ATOM   7992  C C     . GLU H 3 203 ? 52.199  -13.246  8.394   1.00 96.64  ? 206 GLU B C     1 
ATOM   7993  O O     . GLU H 3 203 ? 52.133  -13.899  7.350   1.00 94.55  ? 206 GLU B O     1 
ATOM   7994  C CB    . GLU H 3 203 ? 53.200  -11.129  7.584   1.00 106.07 ? 206 GLU B CB    1 
ATOM   7995  C CG    . GLU H 3 203 ? 53.881  -9.821   7.958   1.00 109.70 ? 206 GLU B CG    1 
ATOM   7996  C CD    . GLU H 3 203 ? 53.778  -8.772   6.860   1.00 112.60 ? 206 GLU B CD    1 
ATOM   7997  O OE1   . GLU H 3 203 ? 52.775  -8.769   6.114   1.00 115.45 ? 206 GLU B OE1   1 
ATOM   7998  O OE2   . GLU H 3 203 ? 54.708  -7.947   6.733   1.00 113.34 ? 206 GLU B OE2   1 
ATOM   7999  N N     . LEU H 3 204 ? 51.298  -13.333  9.368   1.00 95.24  ? 207 LEU B N     1 
ATOM   8000  C CA    . LEU H 3 204 ? 50.081  -14.123  9.226   1.00 98.42  ? 207 LEU B CA    1 
ATOM   8001  C C     . LEU H 3 204 ? 48.878  -13.239  8.873   1.00 95.59  ? 207 LEU B C     1 
ATOM   8002  O O     . LEU H 3 204 ? 48.260  -12.621  9.749   1.00 92.50  ? 207 LEU B O     1 
ATOM   8003  C CB    . LEU H 3 204 ? 49.805  -14.904  10.515  1.00 101.90 ? 207 LEU B CB    1 
ATOM   8004  C CG    . LEU H 3 204 ? 48.663  -15.923  10.438  1.00 101.80 ? 207 LEU B CG    1 
ATOM   8005  C CD1   . LEU H 3 204 ? 48.880  -16.894  9.284   1.00 100.23 ? 207 LEU B CD1   1 
ATOM   8006  C CD2   . LEU H 3 204 ? 48.532  -16.659  11.764  1.00 103.32 ? 207 LEU B CD2   1 
ATOM   8007  N N     . LEU H 3 205 ? 48.533  -13.202  7.591   1.00 90.09  ? 208 LEU B N     1 
ATOM   8008  C CA    . LEU H 3 205 ? 47.420  -12.375  7.124   1.00 94.95  ? 208 LEU B CA    1 
ATOM   8009  C C     . LEU H 3 205 ? 46.085  -12.771  7.767   1.00 108.78 ? 208 LEU B C     1 
ATOM   8010  O O     . LEU H 3 205 ? 45.950  -13.868  8.305   1.00 117.47 ? 208 LEU B O     1 
ATOM   8011  C CB    . LEU H 3 205 ? 47.315  -12.442  5.602   1.00 88.79  ? 208 LEU B CB    1 
ATOM   8012  C CG    . LEU H 3 205 ? 48.223  -11.465  4.852   1.00 86.74  ? 208 LEU B CG    1 
ATOM   8013  C CD1   . LEU H 3 205 ? 49.647  -11.464  5.393   1.00 87.00  ? 208 LEU B CD1   1 
ATOM   8014  C CD2   . LEU H 3 205 ? 48.215  -11.763  3.358   1.00 84.39  ? 208 LEU B CD2   1 
ATOM   8015  N N     . LYS H 3 206 ? 45.103  -11.872  7.702   1.00 122.69 ? 209 LYS B N     1 
ATOM   8016  C CA    . LYS H 3 206 ? 43.802  -12.102  8.345   1.00 123.79 ? 209 LYS B CA    1 
ATOM   8017  C C     . LYS H 3 206 ? 42.932  -12.956  7.421   1.00 114.92 ? 209 LYS B C     1 
ATOM   8018  O O     . LYS H 3 206 ? 43.162  -12.990  6.204   1.00 107.66 ? 209 LYS B O     1 
ATOM   8019  C CB    . LYS H 3 206 ? 43.068  -10.787  8.691   1.00 133.83 ? 209 LYS B CB    1 
ATOM   8020  C CG    . LYS H 3 206 ? 43.933  -9.549   8.917   1.00 140.01 ? 209 LYS B CG    1 
ATOM   8021  C CD    . LYS H 3 206 ? 45.026  -9.758   9.957   1.00 144.99 ? 209 LYS B CD    1 
ATOM   8022  C CE    . LYS H 3 206 ? 46.336  -9.116   9.521   1.00 147.06 ? 209 LYS B CE    1 
ATOM   8023  N NZ    . LYS H 3 206 ? 46.227  -7.639   9.403   1.00 149.77 ? 209 LYS B NZ    1 
ATOM   8024  N N     . PRO H 3 207 ? 41.931  -13.651  7.995   1.00 105.80 ? 210 PRO B N     1 
ATOM   8025  C CA    . PRO H 3 207 ? 41.055  -14.499  7.204   1.00 105.76 ? 210 PRO B CA    1 
ATOM   8026  C C     . PRO H 3 207 ? 40.625  -13.846  5.890   1.00 108.83 ? 210 PRO B C     1 
ATOM   8027  O O     . PRO H 3 207 ? 40.045  -12.765  5.898   1.00 106.99 ? 210 PRO B O     1 
ATOM   8028  C CB    . PRO H 3 207 ? 39.864  -14.716  8.136   1.00 105.99 ? 210 PRO B CB    1 
ATOM   8029  C CG    . PRO H 3 207 ? 40.464  -14.703  9.502   1.00 104.17 ? 210 PRO B CG    1 
ATOM   8030  C CD    . PRO H 3 207 ? 41.653  -13.784  9.439   1.00 105.82 ? 210 PRO B CD    1 
ATOM   8031  N N     . GLY H 3 208 ? 40.952  -14.490  4.772   1.00 115.51 ? 211 GLY B N     1 
ATOM   8032  C CA    . GLY H 3 208 ? 40.553  -14.006  3.457   1.00 117.94 ? 211 GLY B CA    1 
ATOM   8033  C C     . GLY H 3 208 ? 41.549  -13.059  2.820   1.00 125.30 ? 211 GLY B C     1 
ATOM   8034  O O     . GLY H 3 208 ? 41.575  -12.927  1.595   1.00 125.85 ? 211 GLY B O     1 
ATOM   8035  N N     . GLU H 3 209 ? 42.369  -12.398  3.639   1.00 132.15 ? 212 GLU B N     1 
ATOM   8036  C CA    . GLU H 3 209 ? 43.354  -11.443  3.129   1.00 138.39 ? 212 GLU B CA    1 
ATOM   8037  C C     . GLU H 3 209 ? 44.457  -12.155  2.355   1.00 134.69 ? 212 GLU B C     1 
ATOM   8038  O O     . GLU H 3 209 ? 44.851  -13.267  2.707   1.00 141.04 ? 212 GLU B O     1 
ATOM   8039  C CB    . GLU H 3 209 ? 43.962  -10.615  4.268   1.00 143.67 ? 212 GLU B CB    1 
ATOM   8040  C CG    . GLU H 3 209 ? 42.958  -9.767   5.037   1.00 151.06 ? 212 GLU B CG    1 
ATOM   8041  C CD    . GLU H 3 209 ? 42.131  -8.864   4.139   1.00 154.49 ? 212 GLU B CD    1 
ATOM   8042  O OE1   . GLU H 3 209 ? 40.945  -8.645   4.460   1.00 156.14 ? 212 GLU B OE1   1 
ATOM   8043  O OE2   . GLU H 3 209 ? 42.654  -8.383   3.110   1.00 153.22 ? 212 GLU B OE2   1 
ATOM   8044  N N     . THR H 3 210 ? 44.939  -11.501  1.298   1.00 127.72 ? 213 THR B N     1 
ATOM   8045  C CA    . THR H 3 210 ? 45.894  -12.098  0.360   1.00 124.39 ? 213 THR B CA    1 
ATOM   8046  C C     . THR H 3 210 ? 47.062  -11.132  0.066   1.00 122.80 ? 213 THR B C     1 
ATOM   8047  O O     . THR H 3 210 ? 47.279  -10.169  0.803   1.00 124.17 ? 213 THR B O     1 
ATOM   8048  C CB    . THR H 3 210 ? 45.195  -12.514  -0.959  1.00 121.49 ? 213 THR B CB    1 
ATOM   8049  O OG1   . THR H 3 210 ? 45.245  -11.436  -1.904  1.00 129.07 ? 213 THR B OG1   1 
ATOM   8050  C CG2   . THR H 3 210 ? 43.742  -12.900  -0.718  1.00 118.41 ? 213 THR B CG2   1 
ATOM   8051  N N     . VAL H 3 211 ? 47.804  -11.393  -1.010  1.00 118.63 ? 214 VAL B N     1 
ATOM   8052  C CA    . VAL H 3 211 ? 49.012  -10.636  -1.326  1.00 114.43 ? 214 VAL B CA    1 
ATOM   8053  C C     . VAL H 3 211 ? 48.982  -10.061  -2.744  1.00 119.62 ? 214 VAL B C     1 
ATOM   8054  O O     . VAL H 3 211 ? 49.171  -10.782  -3.733  1.00 107.31 ? 214 VAL B O     1 
ATOM   8055  C CB    . VAL H 3 211 ? 50.262  -11.519  -1.130  1.00 114.46 ? 214 VAL B CB    1 
ATOM   8056  C CG1   . VAL H 3 211 ? 51.502  -10.890  -1.754  1.00 114.10 ? 214 VAL B CG1   1 
ATOM   8057  C CG2   . VAL H 3 211 ? 50.482  -11.777  0.354   1.00 116.06 ? 214 VAL B CG2   1 
ATOM   8058  N N     . ASN H 3 212 ? 48.746  -8.751   -2.822  1.00 128.56 ? 215 ASN B N     1 
ATOM   8059  C CA    . ASN H 3 212 ? 48.876  -7.997   -4.070  1.00 128.17 ? 215 ASN B CA    1 
ATOM   8060  C C     . ASN H 3 212 ? 50.202  -7.222   -4.091  1.00 125.11 ? 215 ASN B C     1 
ATOM   8061  O O     . ASN H 3 212 ? 50.775  -6.928   -3.034  1.00 118.59 ? 215 ASN B O     1 
ATOM   8062  C CB    . ASN H 3 212 ? 47.671  -7.062   -4.274  1.00 128.57 ? 215 ASN B CB    1 
ATOM   8063  C CG    . ASN H 3 212 ? 47.751  -5.792   -3.441  1.00 129.93 ? 215 ASN B CG    1 
ATOM   8064  O OD1   . ASN H 3 212 ? 47.956  -4.700   -3.975  1.00 134.99 ? 215 ASN B OD1   1 
ATOM   8065  N ND2   . ASN H 3 212 ? 47.577  -5.925   -2.132  1.00 125.71 ? 215 ASN B ND2   1 
ATOM   8066  N N     . ALA H 3 213 ? 50.676  -6.896   -5.295  1.00 121.56 ? 216 ALA B N     1 
ATOM   8067  C CA    . ALA H 3 213 ? 51.985  -6.249   -5.502  1.00 119.04 ? 216 ALA B CA    1 
ATOM   8068  C C     . ALA H 3 213 ? 52.320  -5.154   -4.482  1.00 121.75 ? 216 ALA B C     1 
ATOM   8069  O O     . ALA H 3 213 ? 53.483  -4.970   -4.131  1.00 121.24 ? 216 ALA B O     1 
ATOM   8070  C CB    . ALA H 3 213 ? 52.080  -5.689   -6.918  1.00 114.50 ? 216 ALA B CB    1 
ATOM   8071  N N     . ALA H 3 214 ? 51.304  -4.430   -4.019  1.00 126.44 ? 217 ALA B N     1 
ATOM   8072  C CA    . ALA H 3 214 ? 51.482  -3.392   -3.000  1.00 128.78 ? 217 ALA B CA    1 
ATOM   8073  C C     . ALA H 3 214 ? 51.825  -3.985   -1.635  1.00 123.73 ? 217 ALA B C     1 
ATOM   8074  O O     . ALA H 3 214 ? 52.788  -3.569   -0.993  1.00 122.79 ? 217 ALA B O     1 
ATOM   8075  C CB    . ALA H 3 214 ? 50.223  -2.539   -2.894  1.00 134.41 ? 217 ALA B CB    1 
ATOM   8076  N N     . ARG H 3 215 ? 51.021  -4.948   -1.196  1.00 119.91 ? 218 ARG B N     1 
ATOM   8077  C CA    . ARG H 3 215 ? 51.211  -5.585   0.108   1.00 117.89 ? 218 ARG B CA    1 
ATOM   8078  C C     . ARG H 3 215 ? 52.566  -6.301   0.202   1.00 114.46 ? 218 ARG B C     1 
ATOM   8079  O O     . ARG H 3 215 ? 53.201  -6.305   1.261   1.00 105.48 ? 218 ARG B O     1 
ATOM   8080  C CB    . ARG H 3 215 ? 50.055  -6.557   0.391   1.00 116.44 ? 218 ARG B CB    1 
ATOM   8081  C CG    . ARG H 3 215 ? 50.339  -7.619   1.446   1.00 115.43 ? 218 ARG B CG    1 
ATOM   8082  C CD    . ARG H 3 215 ? 50.484  -7.061   2.855   1.00 108.98 ? 218 ARG B CD    1 
ATOM   8083  N NE    . ARG H 3 215 ? 49.287  -7.332   3.653   1.00 108.74 ? 218 ARG B NE    1 
ATOM   8084  C CZ    . ARG H 3 215 ? 49.246  -7.395   4.987   1.00 109.96 ? 218 ARG B CZ    1 
ATOM   8085  N NH1   . ARG H 3 215 ? 50.345  -7.208   5.722   1.00 101.50 ? 218 ARG B NH1   1 
ATOM   8086  N NH2   . ARG H 3 215 ? 48.086  -7.653   5.595   1.00 112.87 ? 218 ARG B NH2   1 
ATOM   8087  N N     . TYR H 3 216 ? 52.996  -6.897   -0.908  1.00 112.71 ? 219 TYR B N     1 
ATOM   8088  C CA    . TYR H 3 216 ? 54.260  -7.638   -0.963  1.00 115.29 ? 219 TYR B CA    1 
ATOM   8089  C C     . TYR H 3 216 ? 55.456  -6.697   -0.859  1.00 118.10 ? 219 TYR B C     1 
ATOM   8090  O O     . TYR H 3 216 ? 56.392  -6.944   -0.091  1.00 113.04 ? 219 TYR B O     1 
ATOM   8091  C CB    . TYR H 3 216 ? 54.333  -8.445   -2.266  1.00 114.44 ? 219 TYR B CB    1 
ATOM   8092  C CG    . TYR H 3 216 ? 55.498  -9.414   -2.356  1.00 110.47 ? 219 TYR B CG    1 
ATOM   8093  C CD1   . TYR H 3 216 ? 55.713  -10.378  -1.373  1.00 107.94 ? 219 TYR B CD1   1 
ATOM   8094  C CD2   . TYR H 3 216 ? 56.368  -9.381   -3.440  1.00 105.71 ? 219 TYR B CD2   1 
ATOM   8095  C CE1   . TYR H 3 216 ? 56.776  -11.264  -1.463  1.00 107.99 ? 219 TYR B CE1   1 
ATOM   8096  C CE2   . TYR H 3 216 ? 57.429  -10.264  -3.542  1.00 103.06 ? 219 TYR B CE2   1 
ATOM   8097  C CZ    . TYR H 3 216 ? 57.631  -11.204  -2.552  1.00 106.40 ? 219 TYR B CZ    1 
ATOM   8098  O OH    . TYR H 3 216 ? 58.685  -12.088  -2.651  1.00 107.03 ? 219 TYR B OH    1 
ATOM   8099  N N     . GLN H 3 217 ? 55.408  -5.621   -1.641  1.00 125.71 ? 220 GLN B N     1 
ATOM   8100  C CA    . GLN H 3 217 ? 56.392  -4.534   -1.582  1.00 127.66 ? 220 GLN B CA    1 
ATOM   8101  C C     . GLN H 3 217 ? 56.603  -4.057   -0.144  1.00 115.41 ? 220 GLN B C     1 
ATOM   8102  O O     . GLN H 3 217 ? 57.738  -3.877   0.301   1.00 101.80 ? 220 GLN B O     1 
ATOM   8103  C CB    . GLN H 3 217 ? 55.901  -3.376   -2.454  1.00 141.51 ? 220 GLN B CB    1 
ATOM   8104  C CG    . GLN H 3 217 ? 56.815  -2.164   -2.531  1.00 154.74 ? 220 GLN B CG    1 
ATOM   8105  C CD    . GLN H 3 217 ? 56.322  -1.130   -3.535  1.00 164.21 ? 220 GLN B CD    1 
ATOM   8106  O OE1   . GLN H 3 217 ? 55.213  -1.238   -4.061  1.00 172.06 ? 220 GLN B OE1   1 
ATOM   8107  N NE2   . GLN H 3 217 ? 57.142  -0.121   -3.802  1.00 168.87 ? 220 GLN B NE2   1 
ATOM   8108  N N     . GLN H 3 218 ? 55.491  -3.870   0.565   1.00 108.17 ? 221 GLN B N     1 
ATOM   8109  C CA    . GLN H 3 218 ? 55.492  -3.453   1.963   1.00 109.37 ? 221 GLN B CA    1 
ATOM   8110  C C     . GLN H 3 218 ? 56.109  -4.510   2.868   1.00 107.31 ? 221 GLN B C     1 
ATOM   8111  O O     . GLN H 3 218 ? 56.675  -4.182   3.910   1.00 101.71 ? 221 GLN B O     1 
ATOM   8112  C CB    . GLN H 3 218 ? 54.058  -3.169   2.415   1.00 118.73 ? 221 GLN B CB    1 
ATOM   8113  C CG    . GLN H 3 218 ? 53.953  -2.288   3.649   1.00 126.85 ? 221 GLN B CG    1 
ATOM   8114  C CD    . GLN H 3 218 ? 53.088  -1.062   3.409   1.00 139.26 ? 221 GLN B CD    1 
ATOM   8115  O OE1   . GLN H 3 218 ? 53.108  -0.476   2.325   1.00 141.81 ? 221 GLN B OE1   1 
ATOM   8116  N NE2   . GLN H 3 218 ? 52.336  -0.658   4.425   1.00 148.39 ? 221 GLN B NE2   1 
ATOM   8117  N N     . GLN H 3 219 ? 55.978  -5.775   2.469   1.00 107.09 ? 222 GLN B N     1 
ATOM   8118  C CA    . GLN H 3 219 ? 56.569  -6.903   3.201   1.00 102.42 ? 222 GLN B CA    1 
ATOM   8119  C C     . GLN H 3 219 ? 58.087  -6.975   3.043   1.00 94.48  ? 222 GLN B C     1 
ATOM   8120  O O     . GLN H 3 219 ? 58.806  -7.151   4.025   1.00 89.27  ? 222 GLN B O     1 
ATOM   8121  C CB    . GLN H 3 219 ? 55.928  -8.227   2.765   1.00 102.53 ? 222 GLN B CB    1 
ATOM   8122  C CG    . GLN H 3 219 ? 54.759  -8.654   3.644   1.00 100.16 ? 222 GLN B CG    1 
ATOM   8123  C CD    . GLN H 3 219 ? 53.865  -9.704   3.005   1.00 96.30  ? 222 GLN B CD    1 
ATOM   8124  O OE1   . GLN H 3 219 ? 54.092  -10.143  1.868   1.00 93.16  ? 222 GLN B OE1   1 
ATOM   8125  N NE2   . GLN H 3 219 ? 52.835  -10.113  3.738   1.00 92.75  ? 222 GLN B NE2   1 
ATOM   8126  N N     . LEU H 3 220 ? 58.563  -6.835   1.809   1.00 91.14  ? 223 LEU B N     1 
ATOM   8127  C CA    . LEU H 3 220 ? 60.000  -6.820   1.516   1.00 93.96  ? 223 LEU B CA    1 
ATOM   8128  C C     . LEU H 3 220 ? 60.806  -5.860   2.394   1.00 99.95  ? 223 LEU B C     1 
ATOM   8129  O O     . LEU H 3 220 ? 61.953  -6.143   2.743   1.00 103.14 ? 223 LEU B O     1 
ATOM   8130  C CB    . LEU H 3 220 ? 60.213  -6.448   0.056   1.00 93.43  ? 223 LEU B CB    1 
ATOM   8131  C CG    . LEU H 3 220 ? 59.912  -7.613   -0.875  1.00 97.98  ? 223 LEU B CG    1 
ATOM   8132  C CD1   . LEU H 3 220 ? 59.391  -7.129   -2.214  1.00 100.80 ? 223 LEU B CD1   1 
ATOM   8133  C CD2   . LEU H 3 220 ? 61.156  -8.465   -1.047  1.00 101.55 ? 223 LEU B CD2   1 
ATOM   8134  N N     . ILE H 3 221 ? 60.200  -4.725   2.730   1.00 103.35 ? 224 ILE B N     1 
ATOM   8135  C CA    . ILE H 3 221 ? 60.837  -3.690   3.538   1.00 104.59 ? 224 ILE B CA    1 
ATOM   8136  C C     . ILE H 3 221 ? 60.742  -4.055   5.016   1.00 101.31 ? 224 ILE B C     1 
ATOM   8137  O O     . ILE H 3 221 ? 61.746  -4.033   5.729   1.00 94.94  ? 224 ILE B O     1 
ATOM   8138  C CB    . ILE H 3 221 ? 60.170  -2.315   3.294   1.00 111.28 ? 224 ILE B CB    1 
ATOM   8139  C CG1   . ILE H 3 221 ? 60.295  -1.920   1.820   1.00 112.48 ? 224 ILE B CG1   1 
ATOM   8140  C CG2   . ILE H 3 221 ? 60.785  -1.228   4.170   1.00 112.57 ? 224 ILE B CG2   1 
ATOM   8141  C CD1   . ILE H 3 221 ? 59.154  -1.055   1.343   1.00 118.46 ? 224 ILE B CD1   1 
ATOM   8142  N N     . ASN H 3 222 ? 59.528  -4.370   5.471   1.00 103.16 ? 225 ASN B N     1 
ATOM   8143  C CA    . ASN H 3 222 ? 59.309  -4.876   6.831   1.00 107.17 ? 225 ASN B CA    1 
ATOM   8144  C C     . ASN H 3 222 ? 60.287  -6.013   7.149   1.00 109.28 ? 225 ASN B C     1 
ATOM   8145  O O     . ASN H 3 222 ? 60.819  -6.096   8.265   1.00 106.02 ? 225 ASN B O     1 
ATOM   8146  C CB    . ASN H 3 222 ? 57.865  -5.372   7.001   1.00 109.06 ? 225 ASN B CB    1 
ATOM   8147  C CG    . ASN H 3 222 ? 56.854  -4.237   7.065   1.00 110.13 ? 225 ASN B CG    1 
ATOM   8148  O OD1   . ASN H 3 222 ? 56.993  -3.319   7.872   1.00 119.45 ? 225 ASN B OD1   1 
ATOM   8149  N ND2   . ASN H 3 222 ? 55.822  -4.303   6.225   1.00 106.36 ? 225 ASN B ND2   1 
ATOM   8150  N N     . LEU H 3 223 ? 60.507  -6.876   6.150   1.00 107.34 ? 226 LEU B N     1 
ATOM   8151  C CA    . LEU H 3 223 ? 61.530  -7.925   6.194   1.00 101.42 ? 226 LEU B CA    1 
ATOM   8152  C C     . LEU H 3 223 ? 62.909  -7.322   6.438   1.00 101.84 ? 226 LEU B C     1 
ATOM   8153  O O     . LEU H 3 223 ? 63.504  -7.526   7.501   1.00 93.95  ? 226 LEU B O     1 
ATOM   8154  C CB    . LEU H 3 223 ? 61.524  -8.726   4.878   1.00 101.13 ? 226 LEU B CB    1 
ATOM   8155  C CG    . LEU H 3 223 ? 62.731  -9.605   4.509   1.00 104.09 ? 226 LEU B CG    1 
ATOM   8156  C CD1   . LEU H 3 223 ? 63.023  -10.630  5.594   1.00 105.44 ? 226 LEU B CD1   1 
ATOM   8157  C CD2   . LEU H 3 223 ? 62.510  -10.305  3.175   1.00 102.89 ? 226 LEU B CD2   1 
ATOM   8158  N N     . ASN H 3 224 ? 63.390  -6.561   5.454   1.00 105.00 ? 227 ASN B N     1 
ATOM   8159  C CA    . ASN H 3 224 ? 64.731  -5.973   5.487   1.00 103.14 ? 227 ASN B CA    1 
ATOM   8160  C C     . ASN H 3 224 ? 65.055  -5.239   6.790   1.00 96.73  ? 227 ASN B C     1 
ATOM   8161  O O     . ASN H 3 224 ? 66.192  -5.253   7.236   1.00 90.21  ? 227 ASN B O     1 
ATOM   8162  C CB    . ASN H 3 224 ? 64.928  -5.027   4.300   1.00 109.07 ? 227 ASN B CB    1 
ATOM   8163  C CG    . ASN H 3 224 ? 66.390  -4.753   4.014   1.00 118.43 ? 227 ASN B CG    1 
ATOM   8164  O OD1   . ASN H 3 224 ? 67.201  -5.672   3.949   1.00 124.64 ? 227 ASN B OD1   1 
ATOM   8165  N ND2   . ASN H 3 224 ? 66.732  -3.488   3.831   1.00 124.07 ? 227 ASN B ND2   1 
ATOM   8166  N N     . ARG H 3 225 ? 64.059  -4.596   7.387   1.00 101.72 ? 228 ARG B N     1 
ATOM   8167  C CA    . ARG H 3 225 ? 64.205  -4.011   8.720   1.00 110.45 ? 228 ARG B CA    1 
ATOM   8168  C C     . ARG H 3 225 ? 64.556  -5.086   9.721   1.00 109.33 ? 228 ARG B C     1 
ATOM   8169  O O     . ARG H 3 225 ? 65.599  -5.024   10.370  1.00 103.51 ? 228 ARG B O     1 
ATOM   8170  C CB    . ARG H 3 225 ? 62.901  -3.344   9.153   1.00 121.66 ? 228 ARG B CB    1 
ATOM   8171  C CG    . ARG H 3 225 ? 62.761  -3.025   10.642  1.00 132.25 ? 228 ARG B CG    1 
ATOM   8172  C CD    . ARG H 3 225 ? 61.356  -2.486   10.879  1.00 145.09 ? 228 ARG B CD    1 
ATOM   8173  N NE    . ARG H 3 225 ? 61.227  -1.340   11.779  1.00 157.96 ? 228 ARG B NE    1 
ATOM   8174  C CZ    . ARG H 3 225 ? 61.841  -0.163   11.632  1.00 161.27 ? 228 ARG B CZ    1 
ATOM   8175  N NH1   . ARG H 3 225 ? 62.706  0.058    10.648  1.00 160.46 ? 228 ARG B NH1   1 
ATOM   8176  N NH2   . ARG H 3 225 ? 61.608  0.803    12.509  1.00 161.70 ? 228 ARG B NH2   1 
ATOM   8177  N N     . ALA H 3 226 ? 63.659  -6.063   9.841   1.00 117.62 ? 229 ALA B N     1 
ATOM   8178  C CA    . ALA H 3 226 ? 63.811  -7.163   10.794  1.00 116.92 ? 229 ALA B CA    1 
ATOM   8179  C C     . ALA H 3 226 ? 65.064  -7.977   10.486  1.00 109.86 ? 229 ALA B C     1 
ATOM   8180  O O     . ALA H 3 226 ? 65.678  -8.541   11.383  1.00 109.88 ? 229 ALA B O     1 
ATOM   8181  C CB    . ALA H 3 226 ? 62.578  -8.055   10.772  1.00 116.67 ? 229 ALA B CB    1 
ATOM   8182  N N     . LEU H 3 227 ? 65.435  -8.015   9.212   1.00 102.70 ? 230 LEU B N     1 
ATOM   8183  C CA    . LEU H 3 227 ? 66.635  -8.702   8.764   1.00 100.97 ? 230 LEU B CA    1 
ATOM   8184  C C     . LEU H 3 227 ? 67.900  -7.997   9.254   1.00 107.45 ? 230 LEU B C     1 
ATOM   8185  O O     . LEU H 3 227 ? 68.832  -8.652   9.718   1.00 106.80 ? 230 LEU B O     1 
ATOM   8186  C CB    . LEU H 3 227 ? 66.617  -8.788   7.240   1.00 99.22  ? 230 LEU B CB    1 
ATOM   8187  C CG    . LEU H 3 227 ? 67.634  -9.698   6.559   1.00 100.09 ? 230 LEU B CG    1 
ATOM   8188  C CD1   . LEU H 3 227 ? 67.077  -10.235  5.250   1.00 103.41 ? 230 LEU B CD1   1 
ATOM   8189  C CD2   . LEU H 3 227 ? 68.926  -8.956   6.298   1.00 105.71 ? 230 LEU B CD2   1 
ATOM   8190  N N     . GLN H 3 228 ? 67.927  -6.668   9.140   1.00 119.63 ? 231 GLN B N     1 
ATOM   8191  C CA    . GLN H 3 228 ? 69.052  -5.854   9.618   1.00 119.31 ? 231 GLN B CA    1 
ATOM   8192  C C     . GLN H 3 228 ? 69.340  -6.095   11.095  1.00 114.97 ? 231 GLN B C     1 
ATOM   8193  O O     . GLN H 3 228 ? 70.490  -6.282   11.476  1.00 118.69 ? 231 GLN B O     1 
ATOM   8194  C CB    . GLN H 3 228 ? 68.793  -4.356   9.388   1.00 129.39 ? 231 GLN B CB    1 
ATOM   8195  C CG    . GLN H 3 228 ? 69.126  -3.866   7.985   1.00 140.04 ? 231 GLN B CG    1 
ATOM   8196  C CD    . GLN H 3 228 ? 68.757  -2.400   7.736   1.00 144.13 ? 231 GLN B CD    1 
ATOM   8197  O OE1   . GLN H 3 228 ? 67.744  -1.893   8.234   1.00 135.22 ? 231 GLN B OE1   1 
ATOM   8198  N NE2   . GLN H 3 228 ? 69.579  -1.718   6.945   1.00 145.36 ? 231 GLN B NE2   1 
ATOM   8199  N N     . ARG H 3 229 ? 68.295  -6.095   11.918  1.00 113.01 ? 232 ARG B N     1 
ATOM   8200  C CA    . ARG H 3 229 ? 68.449  -6.277   13.371  1.00 118.07 ? 232 ARG B CA    1 
ATOM   8201  C C     . ARG H 3 229 ? 68.597  -7.737   13.813  1.00 121.53 ? 232 ARG B C     1 
ATOM   8202  O O     . ARG H 3 229 ? 69.019  -8.001   14.939  1.00 123.05 ? 232 ARG B O     1 
ATOM   8203  C CB    . ARG H 3 229 ? 67.290  -5.623   14.133  1.00 123.05 ? 232 ARG B CB    1 
ATOM   8204  C CG    . ARG H 3 229 ? 65.909  -6.134   13.768  1.00 127.96 ? 232 ARG B CG    1 
ATOM   8205  C CD    . ARG H 3 229 ? 64.830  -5.441   14.578  1.00 137.46 ? 232 ARG B CD    1 
ATOM   8206  N NE    . ARG H 3 229 ? 63.526  -6.070   14.373  1.00 143.76 ? 232 ARG B NE    1 
ATOM   8207  C CZ    . ARG H 3 229 ? 63.127  -7.208   14.944  1.00 141.32 ? 232 ARG B CZ    1 
ATOM   8208  N NH1   . ARG H 3 229 ? 63.924  -7.877   15.774  1.00 139.77 ? 232 ARG B NH1   1 
ATOM   8209  N NH2   . ARG H 3 229 ? 61.916  -7.683   14.678  1.00 139.30 ? 232 ARG B NH2   1 
ATOM   8210  N N     . LYS H 3 230 ? 68.240  -8.678   12.941  1.00 127.59 ? 233 LYS B N     1 
ATOM   8211  C CA    . LYS H 3 230 ? 68.385  -10.112  13.229  1.00 124.73 ? 233 LYS B CA    1 
ATOM   8212  C C     . LYS H 3 230 ? 69.728  -10.651  12.741  1.00 125.81 ? 233 LYS B C     1 
ATOM   8213  O O     . LYS H 3 230 ? 70.342  -11.487  13.405  1.00 128.92 ? 233 LYS B O     1 
ATOM   8214  C CB    . LYS H 3 230 ? 67.250  -10.913  12.585  1.00 121.72 ? 233 LYS B CB    1 
ATOM   8215  C CG    . LYS H 3 230 ? 65.927  -10.829  13.331  1.00 121.54 ? 233 LYS B CG    1 
ATOM   8216  C CD    . LYS H 3 230 ? 65.831  -11.888  14.415  1.00 124.09 ? 233 LYS B CD    1 
ATOM   8217  C CE    . LYS H 3 230 ? 64.431  -11.972  14.999  1.00 127.06 ? 233 LYS B CE    1 
ATOM   8218  N NZ    . LYS H 3 230 ? 64.224  -13.254  15.728  1.00 127.15 ? 233 LYS B NZ    1 
ATOM   8219  N N     . ARG H 3 231 ? 70.167  -10.178  11.576  1.00 127.38 ? 234 ARG B N     1 
ATOM   8220  C CA    . ARG H 3 231 ? 71.425  -10.613  10.973  1.00 130.36 ? 234 ARG B CA    1 
ATOM   8221  C C     . ARG H 3 231 ? 72.418  -9.447   10.912  1.00 136.28 ? 234 ARG B C     1 
ATOM   8222  O O     . ARG H 3 231 ? 72.402  -8.667   9.955   1.00 124.33 ? 234 ARG B O     1 
ATOM   8223  C CB    . ARG H 3 231 ? 71.170  -11.179  9.574   1.00 128.35 ? 234 ARG B CB    1 
ATOM   8224  C CG    . ARG H 3 231 ? 70.219  -12.371  9.546   1.00 125.83 ? 234 ARG B CG    1 
ATOM   8225  C CD    . ARG H 3 231 ? 70.851  -13.642  10.101  1.00 122.55 ? 234 ARG B CD    1 
ATOM   8226  N NE    . ARG H 3 231 ? 69.883  -14.737  10.202  1.00 115.71 ? 234 ARG B NE    1 
ATOM   8227  C CZ    . ARG H 3 231 ? 69.104  -14.982  11.256  1.00 115.70 ? 234 ARG B CZ    1 
ATOM   8228  N NH1   . ARG H 3 231 ? 69.160  -14.222  12.345  1.00 117.83 ? 234 ARG B NH1   1 
ATOM   8229  N NH2   . ARG H 3 231 ? 68.257  -16.006  11.222  1.00 114.61 ? 234 ARG B NH2   1 
ATOM   8230  N N     . PRO H 3 232 ? 73.276  -9.319   11.946  1.00 143.92 ? 235 PRO B N     1 
ATOM   8231  C CA    . PRO H 3 232 ? 74.281  -8.252   11.998  1.00 147.90 ? 235 PRO B CA    1 
ATOM   8232  C C     . PRO H 3 232 ? 75.174  -8.193   10.757  1.00 153.32 ? 235 PRO B C     1 
ATOM   8233  O O     . PRO H 3 232 ? 75.367  -7.120   10.187  1.00 157.06 ? 235 PRO B O     1 
ATOM   8234  C CB    . PRO H 3 232 ? 75.113  -8.611   13.237  1.00 147.80 ? 235 PRO B CB    1 
ATOM   8235  C CG    . PRO H 3 232 ? 74.190  -9.391   14.103  1.00 146.68 ? 235 PRO B CG    1 
ATOM   8236  C CD    . PRO H 3 232 ? 73.284  -10.141  13.174  1.00 144.00 ? 235 PRO B CD    1 
ATOM   8237  N N     . GLU H 3 233 ? 75.688  -9.346   10.338  1.00 159.39 ? 236 GLU B N     1 
ATOM   8238  C CA    . GLU H 3 233 ? 76.584  -9.457   9.176   1.00 162.54 ? 236 GLU B CA    1 
ATOM   8239  C C     . GLU H 3 233 ? 75.999  -8.953   7.844   1.00 166.94 ? 236 GLU B C     1 
ATOM   8240  O O     . GLU H 3 233 ? 76.629  -9.103   6.794   1.00 157.01 ? 236 GLU B O     1 
ATOM   8241  C CB    . GLU H 3 233 ? 77.051  -10.914  9.010   1.00 162.98 ? 236 GLU B CB    1 
ATOM   8242  C CG    . GLU H 3 233 ? 75.979  -11.903  8.545   1.00 163.34 ? 236 GLU B CG    1 
ATOM   8243  C CD    . GLU H 3 233 ? 74.970  -12.290  9.620   1.00 162.12 ? 236 GLU B CD    1 
ATOM   8244  O OE1   . GLU H 3 233 ? 75.050  -11.778  10.757  1.00 156.89 ? 236 GLU B OE1   1 
ATOM   8245  O OE2   . GLU H 3 233 ? 74.084  -13.117  9.321   1.00 159.80 ? 236 GLU B OE2   1 
ATOM   8246  N N     . TYR H 3 234 ? 74.809  -8.359   7.891   1.00 180.67 ? 237 TYR B N     1 
ATOM   8247  C CA    . TYR H 3 234 ? 74.109  -7.913   6.694   1.00 196.29 ? 237 TYR B CA    1 
ATOM   8248  C C     . TYR H 3 234 ? 74.288  -6.426   6.388   1.00 196.73 ? 237 TYR B C     1 
ATOM   8249  O O     . TYR H 3 234 ? 74.528  -6.056   5.241   1.00 193.38 ? 237 TYR B O     1 
ATOM   8250  C CB    . TYR H 3 234 ? 72.620  -8.198   6.840   1.00 208.46 ? 237 TYR B CB    1 
ATOM   8251  C CG    . TYR H 3 234 ? 71.799  -7.507   5.795   1.00 223.68 ? 237 TYR B CG    1 
ATOM   8252  C CD1   . TYR H 3 234 ? 71.924  -7.856   4.459   1.00 232.97 ? 237 TYR B CD1   1 
ATOM   8253  C CD2   . TYR H 3 234 ? 70.916  -6.486   6.134   1.00 226.87 ? 237 TYR B CD2   1 
ATOM   8254  C CE1   . TYR H 3 234 ? 71.179  -7.222   3.484   1.00 242.42 ? 237 TYR B CE1   1 
ATOM   8255  C CE2   . TYR H 3 234 ? 70.164  -5.846   5.168   1.00 231.25 ? 237 TYR B CE2   1 
ATOM   8256  C CZ    . TYR H 3 234 ? 70.298  -6.218   3.845   1.00 240.12 ? 237 TYR B CZ    1 
ATOM   8257  O OH    . TYR H 3 234 ? 69.554  -5.581   2.880   1.00 243.47 ? 237 TYR B OH    1 
ATOM   8258  N N     . GLN H 3 235 ? 74.142  -5.581   7.407   1.00 199.50 ? 238 GLN B N     1 
ATOM   8259  C CA    . GLN H 3 235 ? 74.130  -4.122   7.221   1.00 198.89 ? 238 GLN B CA    1 
ATOM   8260  C C     . GLN H 3 235 ? 75.303  -3.629   6.365   1.00 198.50 ? 238 GLN B C     1 
ATOM   8261  O O     . GLN H 3 235 ? 75.131  -2.750   5.518   1.00 192.73 ? 238 GLN B O     1 
ATOM   8262  C CB    . GLN H 3 235 ? 74.118  -3.404   8.578   1.00 200.26 ? 238 GLN B CB    1 
ATOM   8263  C CG    . GLN H 3 235 ? 73.594  -1.975   8.519   1.00 199.29 ? 238 GLN B CG    1 
ATOM   8264  C CD    . GLN H 3 235 ? 73.363  -1.359   9.890   1.00 195.71 ? 238 GLN B CD    1 
ATOM   8265  O OE1   . GLN H 3 235 ? 73.607  -1.988   10.921  1.00 191.01 ? 238 GLN B OE1   1 
ATOM   8266  N NE2   . GLN H 3 235 ? 72.887  -0.118   9.906   1.00 193.15 ? 238 GLN B NE2   1 
ATOM   8267  N N     . LYS H 3 236 ? 76.484  -4.203   6.585   1.00 200.59 ? 239 LYS B N     1 
ATOM   8268  C CA    . LYS H 3 236 ? 77.659  -3.910   5.760   1.00 201.00 ? 239 LYS B CA    1 
ATOM   8269  C C     . LYS H 3 236 ? 77.513  -4.498   4.357   1.00 197.76 ? 239 LYS B C     1 
ATOM   8270  O O     . LYS H 3 236 ? 77.747  -3.817   3.357   1.00 188.32 ? 239 LYS B O     1 
ATOM   8271  C CB    . LYS H 3 236 ? 78.935  -4.461   6.412   1.00 200.06 ? 239 LYS B CB    1 
ATOM   8272  C CG    . LYS H 3 236 ? 79.297  -3.799   7.733   1.00 196.38 ? 239 LYS B CG    1 
ATOM   8273  C CD    . LYS H 3 236 ? 80.797  -3.591   7.869   1.00 192.82 ? 239 LYS B CD    1 
ATOM   8274  C CE    . LYS H 3 236 ? 81.130  -2.820   9.135   1.00 188.13 ? 239 LYS B CE    1 
ATOM   8275  N NZ    . LYS H 3 236 ? 82.596  -2.662   9.328   1.00 187.51 ? 239 LYS B NZ    1 
ATOM   8276  N N     . ARG H 3 237 ? 77.113  -5.764   4.299   1.00 204.95 ? 240 ARG B N     1 
ATOM   8277  C CA    . ARG H 3 237 ? 77.019  -6.506   3.044   1.00 206.44 ? 240 ARG B CA    1 
ATOM   8278  C C     . ARG H 3 237 ? 75.586  -6.493   2.517   1.00 209.72 ? 240 ARG B C     1 
ATOM   8279  O O     . ARG H 3 237 ? 74.983  -7.544   2.282   1.00 205.75 ? 240 ARG B O     1 
ATOM   8280  C CB    . ARG H 3 237 ? 77.521  -7.935   3.263   1.00 200.15 ? 240 ARG B CB    1 
ATOM   8281  C CG    . ARG H 3 237 ? 78.922  -7.958   3.841   1.00 189.53 ? 240 ARG B CG    1 
ATOM   8282  C CD    . ARG H 3 237 ? 79.519  -9.347   3.913   1.00 179.75 ? 240 ARG B CD    1 
ATOM   8283  N NE    . ARG H 3 237 ? 80.953  -9.245   4.156   1.00 175.06 ? 240 ARG B NE    1 
ATOM   8284  C CZ    . ARG H 3 237 ? 81.861  -8.963   3.221   1.00 176.95 ? 240 ARG B CZ    1 
ATOM   8285  N NH1   . ARG H 3 237 ? 81.503  -8.755   1.958   1.00 171.38 ? 240 ARG B NH1   1 
ATOM   8286  N NH2   . ARG H 3 237 ? 83.144  -8.885   3.552   1.00 180.68 ? 240 ARG B NH2   1 
ATOM   8287  N N     . GLN H 3 238 ? 75.058  -5.283   2.331   1.00 210.81 ? 241 GLN B N     1 
ATOM   8288  C CA    . GLN H 3 238 ? 73.676  -5.084   1.878   1.00 207.07 ? 241 GLN B CA    1 
ATOM   8289  C C     . GLN H 3 238 ? 73.436  -5.551   0.443   1.00 201.82 ? 241 GLN B C     1 
ATOM   8290  O O     . GLN H 3 238 ? 72.288  -5.768   0.045   1.00 193.09 ? 241 GLN B O     1 
ATOM   8291  C CB    . GLN H 3 238 ? 73.255  -3.608   2.008   1.00 204.84 ? 241 GLN B CB    1 
ATOM   8292  C CG    . GLN H 3 238 ? 72.426  -3.298   3.246   1.00 202.30 ? 241 GLN B CG    1 
ATOM   8293  C CD    . GLN H 3 238 ? 71.522  -2.095   3.058   1.00 198.38 ? 241 GLN B CD    1 
ATOM   8294  O OE1   . GLN H 3 238 ? 71.921  -1.093   2.465   1.00 200.48 ? 241 GLN B OE1   1 
ATOM   8295  N NE2   . GLN H 3 238 ? 70.294  -2.189   3.562   1.00 194.60 ? 241 GLN B NE2   1 
ATOM   8296  N N     . HIS H 3 239 ? 74.510  -5.696   -0.330  1.00 198.96 ? 242 HIS B N     1 
ATOM   8297  C CA    . HIS H 3 239 ? 74.400  -6.113   -1.726  1.00 196.30 ? 242 HIS B CA    1 
ATOM   8298  C C     . HIS H 3 239 ? 74.646  -7.624   -1.906  1.00 181.80 ? 242 HIS B C     1 
ATOM   8299  O O     . HIS H 3 239 ? 74.451  -8.163   -3.001  1.00 171.59 ? 242 HIS B O     1 
ATOM   8300  C CB    . HIS H 3 239 ? 75.331  -5.253   -2.607  1.00 202.20 ? 242 HIS B CB    1 
ATOM   8301  C CG    . HIS H 3 239 ? 76.515  -5.982   -3.166  1.00 206.99 ? 242 HIS B CG    1 
ATOM   8302  N ND1   . HIS H 3 239 ? 76.465  -6.667   -4.361  1.00 208.36 ? 242 HIS B ND1   1 
ATOM   8303  C CD2   . HIS H 3 239 ? 77.785  -6.107   -2.713  1.00 205.86 ? 242 HIS B CD2   1 
ATOM   8304  C CE1   . HIS H 3 239 ? 77.649  -7.197   -4.613  1.00 206.04 ? 242 HIS B CE1   1 
ATOM   8305  N NE2   . HIS H 3 239 ? 78.468  -6.872   -3.629  1.00 206.37 ? 242 HIS B NE2   1 
ATOM   8306  N N     . ARG H 3 240 ? 75.027  -8.305   -0.823  1.00 164.54 ? 243 ARG B N     1 
ATOM   8307  C CA    . ARG H 3 240 ? 75.443  -9.711   -0.885  1.00 147.57 ? 243 ARG B CA    1 
ATOM   8308  C C     . ARG H 3 240 ? 74.339  -10.724  -0.580  1.00 131.39 ? 243 ARG B C     1 
ATOM   8309  O O     . ARG H 3 240 ? 74.570  -11.927  -0.665  1.00 131.09 ? 243 ARG B O     1 
ATOM   8310  C CB    . ARG H 3 240 ? 76.613  -9.946   0.068   1.00 150.19 ? 243 ARG B CB    1 
ATOM   8311  C CG    . ARG H 3 240 ? 77.848  -9.134   -0.284  1.00 153.94 ? 243 ARG B CG    1 
ATOM   8312  C CD    . ARG H 3 240 ? 79.110  -9.937   -0.043  1.00 156.22 ? 243 ARG B CD    1 
ATOM   8313  N NE    . ARG H 3 240 ? 79.219  -11.065  -0.964  1.00 155.60 ? 243 ARG B NE    1 
ATOM   8314  C CZ    . ARG H 3 240 ? 80.047  -12.097  -0.810  1.00 149.52 ? 243 ARG B CZ    1 
ATOM   8315  N NH1   . ARG H 3 240 ? 80.863  -12.171  0.237   1.00 153.69 ? 243 ARG B NH1   1 
ATOM   8316  N NH2   . ARG H 3 240 ? 80.059  -13.067  -1.713  1.00 142.55 ? 243 ARG B NH2   1 
ATOM   8317  N N     . VAL H 3 241 ? 73.150  -10.248  -0.232  1.00 116.29 ? 244 VAL B N     1 
ATOM   8318  C CA    . VAL H 3 241 ? 72.026  -11.131  0.087   1.00 107.33 ? 244 VAL B CA    1 
ATOM   8319  C C     . VAL H 3 241 ? 71.385  -11.744  -1.170  1.00 106.42 ? 244 VAL B C     1 
ATOM   8320  O O     . VAL H 3 241 ? 70.996  -11.023  -2.098  1.00 103.75 ? 244 VAL B O     1 
ATOM   8321  C CB    . VAL H 3 241 ? 70.978  -10.377  0.933   1.00 103.65 ? 244 VAL B CB    1 
ATOM   8322  C CG1   . VAL H 3 241 ? 69.577  -10.949  0.756   1.00 101.79 ? 244 VAL B CG1   1 
ATOM   8323  C CG2   . VAL H 3 241 ? 71.393  -10.393  2.394   1.00 104.46 ? 244 VAL B CG2   1 
ATOM   8324  N N     . ILE H 3 242 ? 71.270  -13.075  -1.176  1.00 102.33 ? 245 ILE B N     1 
ATOM   8325  C CA    . ILE H 3 242 ? 70.677  -13.823  -2.292  1.00 101.96 ? 245 ILE B CA    1 
ATOM   8326  C C     . ILE H 3 242 ? 69.235  -14.205  -1.966  1.00 100.95 ? 245 ILE B C     1 
ATOM   8327  O O     . ILE H 3 242 ? 68.985  -14.867  -0.959  1.00 104.50 ? 245 ILE B O     1 
ATOM   8328  C CB    . ILE H 3 242 ? 71.471  -15.113  -2.593  1.00 101.34 ? 245 ILE B CB    1 
ATOM   8329  C CG1   . ILE H 3 242 ? 72.959  -14.783  -2.754  1.00 108.13 ? 245 ILE B CG1   1 
ATOM   8330  C CG2   . ILE H 3 242 ? 70.922  -15.812  -3.832  1.00 96.98  ? 245 ILE B CG2   1 
ATOM   8331  C CD1   . ILE H 3 242 ? 73.762  -15.824  -3.506  1.00 109.17 ? 245 ILE B CD1   1 
ATOM   8332  N N     . PHE H 3 243 ? 68.302  -13.804  -2.831  1.00 97.79  ? 246 PHE B N     1 
ATOM   8333  C CA    . PHE H 3 243 ? 66.873  -13.995  -2.584  1.00 96.40  ? 246 PHE B CA    1 
ATOM   8334  C C     . PHE H 3 243 ? 66.257  -15.034  -3.519  1.00 103.21 ? 246 PHE B C     1 
ATOM   8335  O O     . PHE H 3 243 ? 66.347  -14.920  -4.743  1.00 105.59 ? 246 PHE B O     1 
ATOM   8336  C CB    . PHE H 3 243 ? 66.128  -12.670  -2.724  1.00 90.69  ? 246 PHE B CB    1 
ATOM   8337  C CG    . PHE H 3 243 ? 64.741  -12.686  -2.143  1.00 87.04  ? 246 PHE B CG    1 
ATOM   8338  C CD1   . PHE H 3 243 ? 64.551  -12.807  -0.775  1.00 88.01  ? 246 PHE B CD1   1 
ATOM   8339  C CD2   . PHE H 3 243 ? 63.626  -12.563  -2.959  1.00 87.80  ? 246 PHE B CD2   1 
ATOM   8340  C CE1   . PHE H 3 243 ? 63.278  -12.813  -0.228  1.00 88.16  ? 246 PHE B CE1   1 
ATOM   8341  C CE2   . PHE H 3 243 ? 62.351  -12.567  -2.421  1.00 88.61  ? 246 PHE B CE2   1 
ATOM   8342  C CZ    . PHE H 3 243 ? 62.177  -12.693  -1.054  1.00 90.10  ? 246 PHE B CZ    1 
ATOM   8343  N N     . LEU H 3 244 ? 65.610  -16.032  -2.919  1.00 107.71 ? 247 LEU B N     1 
ATOM   8344  C CA    . LEU H 3 244 ? 64.999  -17.136  -3.642  1.00 106.48 ? 247 LEU B CA    1 
ATOM   8345  C C     . LEU H 3 244 ? 63.499  -17.175  -3.360  1.00 107.35 ? 247 LEU B C     1 
ATOM   8346  O O     . LEU H 3 244 ? 63.084  -17.284  -2.201  1.00 106.09 ? 247 LEU B O     1 
ATOM   8347  C CB    . LEU H 3 244 ? 65.662  -18.434  -3.193  1.00 108.73 ? 247 LEU B CB    1 
ATOM   8348  C CG    . LEU H 3 244 ? 65.099  -19.764  -3.686  1.00 111.94 ? 247 LEU B CG    1 
ATOM   8349  C CD1   . LEU H 3 244 ? 64.701  -19.695  -5.153  1.00 118.31 ? 247 LEU B CD1   1 
ATOM   8350  C CD2   . LEU H 3 244 ? 66.123  -20.867  -3.455  1.00 108.54 ? 247 LEU B CD2   1 
ATOM   8351  N N     . HIS H 3 245 ? 62.690  -17.077  -4.415  1.00 106.98 ? 248 HIS B N     1 
ATOM   8352  C CA    . HIS H 3 245 ? 61.231  -17.017  -4.262  1.00 111.87 ? 248 HIS B CA    1 
ATOM   8353  C C     . HIS H 3 245 ? 60.491  -17.481  -5.518  1.00 112.59 ? 248 HIS B C     1 
ATOM   8354  O O     . HIS H 3 245 ? 61.103  -17.671  -6.569  1.00 107.20 ? 248 HIS B O     1 
ATOM   8355  C CB    . HIS H 3 245 ? 60.785  -15.600  -3.845  1.00 116.47 ? 248 HIS B CB    1 
ATOM   8356  C CG    . HIS H 3 245 ? 60.990  -14.545  -4.897  1.00 120.65 ? 248 HIS B CG    1 
ATOM   8357  N ND1   . HIS H 3 245 ? 60.297  -13.353  -4.892  1.00 116.84 ? 248 HIS B ND1   1 
ATOM   8358  C CD2   . HIS H 3 245 ? 61.798  -14.503  -5.986  1.00 121.43 ? 248 HIS B CD2   1 
ATOM   8359  C CE1   . HIS H 3 245 ? 60.672  -12.621  -5.926  1.00 117.10 ? 248 HIS B CE1   1 
ATOM   8360  N NE2   . HIS H 3 245 ? 61.580  -13.296  -6.606  1.00 118.15 ? 248 HIS B NE2   1 
ATOM   8361  N N     . ALA H 3 246 ? 59.174  -17.652  -5.390  1.00 115.66 ? 249 ALA B N     1 
ATOM   8362  C CA    . ALA H 3 246 ? 58.324  -18.161  -6.475  1.00 119.73 ? 249 ALA B CA    1 
ATOM   8363  C C     . ALA H 3 246 ? 58.049  -17.118  -7.571  1.00 125.13 ? 249 ALA B C     1 
ATOM   8364  O O     . ALA H 3 246 ? 58.080  -15.912  -7.319  1.00 125.81 ? 249 ALA B O     1 
ATOM   8365  C CB    . ALA H 3 246 ? 57.007  -18.671  -5.902  1.00 118.20 ? 249 ALA B CB    1 
ATOM   8366  N N     . ASN H 3 247 ? 57.753  -17.601  -8.779  1.00 130.40 ? 250 ASN B N     1 
ATOM   8367  C CA    . ASN H 3 247 ? 57.458  -16.741  -9.936  1.00 135.52 ? 250 ASN B CA    1 
ATOM   8368  C C     . ASN H 3 247 ? 55.970  -16.386  -10.048 1.00 137.95 ? 250 ASN B C     1 
ATOM   8369  O O     . ASN H 3 247 ? 55.372  -16.544  -11.115 1.00 136.24 ? 250 ASN B O     1 
ATOM   8370  C CB    . ASN H 3 247 ? 57.892  -17.425  -11.244 1.00 140.11 ? 250 ASN B CB    1 
ATOM   8371  C CG    . ASN H 3 247 ? 59.343  -17.857  -11.236 1.00 143.37 ? 250 ASN B CG    1 
ATOM   8372  O OD1   . ASN H 3 247 ? 59.917  -18.129  -10.183 1.00 150.30 ? 250 ASN B OD1   1 
ATOM   8373  N ND2   . ASN H 3 247 ? 59.941  -17.940  -12.420 1.00 142.28 ? 250 ASN B ND2   1 
ATOM   8374  N N     . ALA H 3 248 ? 55.376  -15.902  -8.959  1.00 140.72 ? 251 ALA B N     1 
ATOM   8375  C CA    . ALA H 3 248 ? 53.954  -15.531  -8.954  1.00 145.26 ? 251 ALA B CA    1 
ATOM   8376  C C     . ALA H 3 248 ? 53.752  -14.184  -9.668  1.00 153.28 ? 251 ALA B C     1 
ATOM   8377  O O     . ALA H 3 248 ? 54.730  -13.504  -9.988  1.00 160.02 ? 251 ALA B O     1 
ATOM   8378  C CB    . ALA H 3 248 ? 53.419  -15.483  -7.525  1.00 142.33 ? 251 ALA B CB    1 
ATOM   8379  N N     . PRO H 3 249 ? 52.486  -13.793  -9.927  1.00 157.11 ? 252 PRO B N     1 
ATOM   8380  C CA    . PRO H 3 249 ? 52.275  -12.506  -10.598 1.00 155.23 ? 252 PRO B CA    1 
ATOM   8381  C C     . PRO H 3 249 ? 52.678  -11.314  -9.723  1.00 154.72 ? 252 PRO B C     1 
ATOM   8382  O O     . PRO H 3 249 ? 53.326  -10.390  -10.216 1.00 151.50 ? 252 PRO B O     1 
ATOM   8383  C CB    . PRO H 3 249 ? 50.770  -12.499  -10.895 1.00 156.28 ? 252 PRO B CB    1 
ATOM   8384  C CG    . PRO H 3 249 ? 50.172  -13.426  -9.898  1.00 158.48 ? 252 PRO B CG    1 
ATOM   8385  C CD    . PRO H 3 249 ? 51.213  -14.473  -9.621  1.00 160.43 ? 252 PRO B CD    1 
ATOM   8386  N N     . SER H 3 250 ? 52.318  -11.348  -8.436  1.00 150.56 ? 253 SER B N     1 
ATOM   8387  C CA    . SER H 3 250 ? 52.712  -10.295  -7.489  1.00 142.45 ? 253 SER B CA    1 
ATOM   8388  C C     . SER H 3 250 ? 54.199  -10.367  -7.127  1.00 145.25 ? 253 SER B C     1 
ATOM   8389  O O     . SER H 3 250 ? 54.701  -9.501   -6.417  1.00 150.02 ? 253 SER B O     1 
ATOM   8390  C CB    . SER H 3 250 ? 51.868  -10.354  -6.209  1.00 138.23 ? 253 SER B CB    1 
ATOM   8391  O OG    . SER H 3 250 ? 52.310  -11.377  -5.336  1.00 134.53 ? 253 SER B OG    1 
ATOM   8392  N N     . HIS H 3 251 ? 54.886  -11.409  -7.599  1.00 154.04 ? 254 HIS B N     1 
ATOM   8393  C CA    . HIS H 3 251 ? 56.336  -11.546  -7.447  1.00 159.73 ? 254 HIS B CA    1 
ATOM   8394  C C     . HIS H 3 251 ? 57.080  -11.063  -8.701  1.00 160.04 ? 254 HIS B C     1 
ATOM   8395  O O     . HIS H 3 251 ? 58.291  -11.264  -8.821  1.00 156.01 ? 254 HIS B O     1 
ATOM   8396  C CB    . HIS H 3 251 ? 56.711  -13.011  -7.160  1.00 163.70 ? 254 HIS B CB    1 
ATOM   8397  C CG    . HIS H 3 251 ? 56.240  -13.522  -5.829  1.00 168.03 ? 254 HIS B CG    1 
ATOM   8398  N ND1   . HIS H 3 251 ? 54.913  -13.533  -5.455  1.00 170.80 ? 254 HIS B ND1   1 
ATOM   8399  C CD2   . HIS H 3 251 ? 56.923  -14.065  -4.793  1.00 166.94 ? 254 HIS B CD2   1 
ATOM   8400  C CE1   . HIS H 3 251 ? 54.801  -14.046  -4.243  1.00 166.88 ? 254 HIS B CE1   1 
ATOM   8401  N NE2   . HIS H 3 251 ? 56.006  -14.378  -3.819  1.00 166.63 ? 254 HIS B NE2   1 
ATOM   8402  N N     . THR H 3 252 ? 56.359  -10.445  -9.638  1.00 164.91 ? 255 THR B N     1 
ATOM   8403  C CA    . THR H 3 252 ? 56.975  -9.890   -10.851 1.00 166.23 ? 255 THR B CA    1 
ATOM   8404  C C     . THR H 3 252 ? 56.493  -8.477   -11.249 1.00 171.78 ? 255 THR B C     1 
ATOM   8405  O O     . THR H 3 252 ? 57.082  -7.863   -12.143 1.00 174.33 ? 255 THR B O     1 
ATOM   8406  C CB    . THR H 3 252 ? 56.807  -10.858  -12.047 1.00 164.47 ? 255 THR B CB    1 
ATOM   8407  O OG1   . THR H 3 252 ? 57.497  -10.337  -13.189 1.00 166.29 ? 255 THR B OG1   1 
ATOM   8408  C CG2   . THR H 3 252 ? 55.331  -11.088  -12.395 1.00 158.89 ? 255 THR B CG2   1 
ATOM   8409  N N     . ALA H 3 253 ? 55.447  -7.963   -10.591 1.00 175.36 ? 256 ALA B N     1 
ATOM   8410  C CA    . ALA H 3 253 ? 54.899  -6.628   -10.892 1.00 171.22 ? 256 ALA B CA    1 
ATOM   8411  C C     . ALA H 3 253 ? 55.954  -5.536   -10.717 1.00 170.46 ? 256 ALA B C     1 
ATOM   8412  O O     . ALA H 3 253 ? 56.857  -5.666   -9.889  1.00 175.68 ? 256 ALA B O     1 
ATOM   8413  C CB    . ALA H 3 253 ? 53.689  -6.336   -10.012 1.00 166.35 ? 256 ALA B CB    1 
ATOM   8414  N N     . ARG H 3 254 ? 55.826  -4.459   -11.491 1.00 162.40 ? 257 ARG B N     1 
ATOM   8415  C CA    . ARG H 3 254 ? 56.837  -3.396   -11.520 1.00 152.53 ? 257 ARG B CA    1 
ATOM   8416  C C     . ARG H 3 254 ? 57.151  -2.831   -10.135 1.00 136.33 ? 257 ARG B C     1 
ATOM   8417  O O     . ARG H 3 254 ? 58.316  -2.650   -9.783  1.00 125.09 ? 257 ARG B O     1 
ATOM   8418  C CB    . ARG H 3 254 ? 56.395  -2.257   -12.441 1.00 158.79 ? 257 ARG B CB    1 
ATOM   8419  C CG    . ARG H 3 254 ? 57.518  -1.282   -12.777 1.00 160.81 ? 257 ARG B CG    1 
ATOM   8420  C CD    . ARG H 3 254 ? 57.207  -0.443   -14.004 1.00 160.98 ? 257 ARG B CD    1 
ATOM   8421  N NE    . ARG H 3 254 ? 56.950  -1.274   -15.180 1.00 163.42 ? 257 ARG B NE    1 
ATOM   8422  C CZ    . ARG H 3 254 ? 56.875  -0.821   -16.429 1.00 162.78 ? 257 ARG B CZ    1 
ATOM   8423  N NH1   . ARG H 3 254 ? 57.052  0.469    -16.698 1.00 164.60 ? 257 ARG B NH1   1 
ATOM   8424  N NH2   . ARG H 3 254 ? 56.633  -1.671   -17.420 1.00 161.52 ? 257 ARG B NH2   1 
ATOM   8425  N N     . ALA H 3 255 ? 56.104  -2.569   -9.356  1.00 126.74 ? 258 ALA B N     1 
ATOM   8426  C CA    . ALA H 3 255 ? 56.236  -1.965   -8.023  1.00 126.33 ? 258 ALA B CA    1 
ATOM   8427  C C     . ALA H 3 255 ? 57.164  -2.745   -7.078  1.00 126.81 ? 258 ALA B C     1 
ATOM   8428  O O     . ALA H 3 255 ? 57.780  -2.165   -6.183  1.00 109.88 ? 258 ALA B O     1 
ATOM   8429  C CB    . ALA H 3 255 ? 54.858  -1.800   -7.391  1.00 125.76 ? 258 ALA B CB    1 
ATOM   8430  N N     . VAL H 3 256 ? 57.247  -4.058   -7.288  1.00 139.48 ? 259 VAL B N     1 
ATOM   8431  C CA    . VAL H 3 256 ? 58.085  -4.955   -6.487  1.00 139.17 ? 259 VAL B CA    1 
ATOM   8432  C C     . VAL H 3 256 ? 59.424  -5.191   -7.179  1.00 133.80 ? 259 VAL B C     1 
ATOM   8433  O O     . VAL H 3 256 ? 60.488  -5.046   -6.582  1.00 129.45 ? 259 VAL B O     1 
ATOM   8434  C CB    . VAL H 3 256 ? 57.383  -6.314   -6.298  1.00 139.85 ? 259 VAL B CB    1 
ATOM   8435  C CG1   . VAL H 3 256 ? 58.327  -7.328   -5.669  1.00 144.24 ? 259 VAL B CG1   1 
ATOM   8436  C CG2   . VAL H 3 256 ? 56.117  -6.146   -5.467  1.00 138.80 ? 259 VAL B CG2   1 
ATOM   8437  N N     . ARG H 3 257 ? 59.339  -5.591   -8.441  1.00 133.36 ? 260 ARG B N     1 
ATOM   8438  C CA    . ARG H 3 257 ? 60.481  -5.707   -9.344  1.00 141.50 ? 260 ARG B CA    1 
ATOM   8439  C C     . ARG H 3 257 ? 61.446  -4.534   -9.169  1.00 141.65 ? 260 ARG B C     1 
ATOM   8440  O O     . ARG H 3 257 ? 62.669  -4.691   -9.235  1.00 134.35 ? 260 ARG B O     1 
ATOM   8441  C CB    . ARG H 3 257 ? 59.914  -5.774   -10.763 1.00 149.84 ? 260 ARG B CB    1 
ATOM   8442  C CG    . ARG H 3 257 ? 60.870  -5.646   -11.929 1.00 154.97 ? 260 ARG B CG    1 
ATOM   8443  C CD    . ARG H 3 257 ? 60.120  -6.016   -13.205 1.00 157.25 ? 260 ARG B CD    1 
ATOM   8444  N NE    . ARG H 3 257 ? 60.259  -5.007   -14.251 1.00 164.92 ? 260 ARG B NE    1 
ATOM   8445  C CZ    . ARG H 3 257 ? 61.311  -4.882   -15.060 1.00 171.61 ? 260 ARG B CZ    1 
ATOM   8446  N NH1   . ARG H 3 257 ? 62.356  -5.701   -14.958 1.00 174.56 ? 260 ARG B NH1   1 
ATOM   8447  N NH2   . ARG H 3 257 ? 61.321  -3.921   -15.979 1.00 170.22 ? 260 ARG B NH2   1 
ATOM   8448  N N     . ASP H 3 258 ? 60.864  -3.361   -8.938  1.00 148.91 ? 261 ASP B N     1 
ATOM   8449  C CA    . ASP H 3 258 ? 61.590  -2.164   -8.532  1.00 152.06 ? 261 ASP B CA    1 
ATOM   8450  C C     . ASP H 3 258 ? 62.264  -2.335   -7.169  1.00 142.29 ? 261 ASP B C     1 
ATOM   8451  O O     . ASP H 3 258 ? 63.492  -2.285   -7.062  1.00 140.35 ? 261 ASP B O     1 
ATOM   8452  C CB    . ASP H 3 258 ? 60.605  -0.984   -8.497  1.00 159.20 ? 261 ASP B CB    1 
ATOM   8453  C CG    . ASP H 3 258 ? 61.206  0.282    -7.927  1.00 167.84 ? 261 ASP B CG    1 
ATOM   8454  O OD1   . ASP H 3 258 ? 62.441  0.346    -7.735  1.00 172.16 ? 261 ASP B OD1   1 
ATOM   8455  O OD2   . ASP H 3 258 ? 60.424  1.226    -7.682  1.00 175.87 ? 261 ASP B OD2   1 
ATOM   8456  N N     . THR H 3 259 ? 61.443  -2.541   -6.141  1.00 128.16 ? 262 THR B N     1 
ATOM   8457  C CA    . THR H 3 259 ? 61.885  -2.624   -4.744  1.00 114.41 ? 262 THR B CA    1 
ATOM   8458  C C     . THR H 3 259 ? 63.105  -3.515   -4.510  1.00 106.73 ? 262 THR B C     1 
ATOM   8459  O O     . THR H 3 259 ? 63.819  -3.328   -3.534  1.00 98.64  ? 262 THR B O     1 
ATOM   8460  C CB    . THR H 3 259 ? 60.738  -3.151   -3.856  1.00 114.28 ? 262 THR B CB    1 
ATOM   8461  O OG1   . THR H 3 259 ? 59.491  -2.614   -4.318  1.00 113.58 ? 262 THR B OG1   1 
ATOM   8462  C CG2   . THR H 3 259 ? 60.951  -2.783   -2.387  1.00 112.65 ? 262 THR B CG2   1 
ATOM   8463  N N     . LEU H 3 260 ? 63.322  -4.494   -5.388  1.00 112.62 ? 263 LEU B N     1 
ATOM   8464  C CA    . LEU H 3 260 ? 64.458  -5.414   -5.271  1.00 119.37 ? 263 LEU B CA    1 
ATOM   8465  C C     . LEU H 3 260 ? 65.730  -4.821   -5.856  1.00 126.12 ? 263 LEU B C     1 
ATOM   8466  O O     . LEU H 3 260 ? 66.834  -5.150   -5.418  1.00 124.79 ? 263 LEU B O     1 
ATOM   8467  C CB    . LEU H 3 260 ? 64.152  -6.743   -5.967  1.00 121.63 ? 263 LEU B CB    1 
ATOM   8468  C CG    . LEU H 3 260 ? 62.989  -7.565   -5.398  1.00 122.42 ? 263 LEU B CG    1 
ATOM   8469  C CD1   . LEU H 3 260 ? 62.784  -8.823   -6.228  1.00 122.00 ? 263 LEU B CD1   1 
ATOM   8470  C CD2   . LEU H 3 260 ? 63.203  -7.918   -3.930  1.00 118.02 ? 263 LEU B CD2   1 
ATOM   8471  N N     . GLU H 3 261 ? 65.572  -3.961   -6.859  1.00 135.26 ? 264 GLU B N     1 
ATOM   8472  C CA    . GLU H 3 261 ? 66.695  -3.209   -7.402  1.00 136.38 ? 264 GLU B CA    1 
ATOM   8473  C C     . GLU H 3 261 ? 67.234  -2.230   -6.353  1.00 133.97 ? 264 GLU B C     1 
ATOM   8474  O O     . GLU H 3 261 ? 68.448  -2.114   -6.178  1.00 133.25 ? 264 GLU B O     1 
ATOM   8475  C CB    . GLU H 3 261 ? 66.276  -2.447   -8.660  1.00 139.88 ? 264 GLU B CB    1 
ATOM   8476  C CG    . GLU H 3 261 ? 67.442  -2.071   -9.559  1.00 144.56 ? 264 GLU B CG    1 
ATOM   8477  C CD    . GLU H 3 261 ? 67.997  -3.253   -10.332 1.00 144.88 ? 264 GLU B CD    1 
ATOM   8478  O OE1   . GLU H 3 261 ? 67.285  -4.270   -10.465 1.00 142.61 ? 264 GLU B OE1   1 
ATOM   8479  O OE2   . GLU H 3 261 ? 69.147  -3.164   -10.812 1.00 144.10 ? 264 GLU B OE2   1 
ATOM   8480  N N     . THR H 3 262 ? 66.324  -1.547   -5.652  1.00 128.61 ? 265 THR B N     1 
ATOM   8481  C CA    . THR H 3 262 ? 66.695  -0.559   -4.632  1.00 129.14 ? 265 THR B CA    1 
ATOM   8482  C C     . THR H 3 262 ? 67.253  -1.209   -3.360  1.00 124.94 ? 265 THR B C     1 
ATOM   8483  O O     . THR H 3 262 ? 68.141  -0.655   -2.721  1.00 127.43 ? 265 THR B O     1 
ATOM   8484  C CB    . THR H 3 262 ? 65.516  0.375    -4.254  1.00 133.75 ? 265 THR B CB    1 
ATOM   8485  O OG1   . THR H 3 262 ? 64.475  -0.367   -3.608  1.00 134.02 ? 265 THR B OG1   1 
ATOM   8486  C CG2   . THR H 3 262 ? 64.956  1.088    -5.493  1.00 133.86 ? 265 THR B CG2   1 
ATOM   8487  N N     . LEU H 3 263 ? 66.719  -2.373   -2.992  1.00 127.80 ? 266 LEU B N     1 
ATOM   8488  C CA    . LEU H 3 263 ? 67.279  -3.191   -1.899  1.00 122.19 ? 266 LEU B CA    1 
ATOM   8489  C C     . LEU H 3 263 ? 68.613  -3.798   -2.321  1.00 121.63 ? 266 LEU B C     1 
ATOM   8490  O O     . LEU H 3 263 ? 69.476  -4.083   -1.484  1.00 109.24 ? 266 LEU B O     1 
ATOM   8491  C CB    . LEU H 3 263 ? 66.305  -4.311   -1.507  1.00 117.13 ? 266 LEU B CB    1 
ATOM   8492  C CG    . LEU H 3 263 ? 65.179  -4.018   -0.504  1.00 117.14 ? 266 LEU B CG    1 
ATOM   8493  C CD1   . LEU H 3 263 ? 65.456  -4.679   0.834   1.00 113.00 ? 266 LEU B CD1   1 
ATOM   8494  C CD2   . LEU H 3 263 ? 64.909  -2.534   -0.301  1.00 125.81 ? 266 LEU B CD2   1 
ATOM   8495  N N     . ASN H 3 264 ? 68.757  -3.999   -3.630  1.00 125.49 ? 267 ASN B N     1 
ATOM   8496  C CA    . ASN H 3 264 ? 69.995  -4.466   -4.229  1.00 127.73 ? 267 ASN B CA    1 
ATOM   8497  C C     . ASN H 3 264 ? 70.352  -5.866   -3.736  1.00 126.00 ? 267 ASN B C     1 
ATOM   8498  O O     . ASN H 3 264 ? 71.413  -6.090   -3.156  1.00 129.40 ? 267 ASN B O     1 
ATOM   8499  C CB    . ASN H 3 264 ? 71.125  -3.464   -3.966  1.00 131.49 ? 267 ASN B CB    1 
ATOM   8500  C CG    . ASN H 3 264 ? 72.268  -3.602   -4.949  1.00 136.31 ? 267 ASN B CG    1 
ATOM   8501  O OD1   . ASN H 3 264 ? 73.435  -3.563   -4.565  1.00 139.99 ? 267 ASN B OD1   1 
ATOM   8502  N ND2   . ASN H 3 264 ? 71.941  -3.759   -6.227  1.00 135.43 ? 267 ASN B ND2   1 
ATOM   8503  N N     . TRP H 3 265 ? 69.426  -6.795   -3.961  1.00 119.50 ? 268 TRP B N     1 
ATOM   8504  C CA    . TRP H 3 265 ? 69.624  -8.215   -3.672  1.00 112.13 ? 268 TRP B CA    1 
ATOM   8505  C C     . TRP H 3 265 ? 69.872  -8.950   -4.986  1.00 116.94 ? 268 TRP B C     1 
ATOM   8506  O O     . TRP H 3 265 ? 69.648  -8.384   -6.056  1.00 125.55 ? 268 TRP B O     1 
ATOM   8507  C CB    . TRP H 3 265 ? 68.379  -8.788   -2.983  1.00 102.44 ? 268 TRP B CB    1 
ATOM   8508  C CG    . TRP H 3 265 ? 68.219  -8.396   -1.537  1.00 94.83  ? 268 TRP B CG    1 
ATOM   8509  C CD1   . TRP H 3 265 ? 69.185  -7.910   -0.705  1.00 94.54  ? 268 TRP B CD1   1 
ATOM   8510  C CD2   . TRP H 3 265 ? 67.030  -8.509   -0.742  1.00 87.28  ? 268 TRP B CD2   1 
ATOM   8511  N NE1   . TRP H 3 265 ? 68.668  -7.693   0.548   1.00 92.62  ? 268 TRP B NE1   1 
ATOM   8512  C CE2   . TRP H 3 265 ? 67.349  -8.055   0.555   1.00 87.83  ? 268 TRP B CE2   1 
ATOM   8513  C CE3   . TRP H 3 265 ? 65.725  -8.937   -1.003  1.00 85.57  ? 268 TRP B CE3   1 
ATOM   8514  C CZ2   . TRP H 3 265 ? 66.412  -8.020   1.590   1.00 88.78  ? 268 TRP B CZ2   1 
ATOM   8515  C CZ3   . TRP H 3 265 ? 64.793  -8.901   0.027   1.00 86.56  ? 268 TRP B CZ3   1 
ATOM   8516  C CH2   . TRP H 3 265 ? 65.143  -8.445   1.308   1.00 88.35  ? 268 TRP B CH2   1 
ATOM   8517  N N     . GLU H 3 266 ? 70.339  -10.196  -4.920  1.00 116.14 ? 269 GLU B N     1 
ATOM   8518  C CA    . GLU H 3 266 ? 70.424  -11.027  -6.127  1.00 122.18 ? 269 GLU B CA    1 
ATOM   8519  C C     . GLU H 3 266 ? 69.257  -12.005  -6.181  1.00 123.01 ? 269 GLU B C     1 
ATOM   8520  O O     . GLU H 3 266 ? 69.212  -12.961  -5.408  1.00 125.20 ? 269 GLU B O     1 
ATOM   8521  C CB    . GLU H 3 266 ? 71.745  -11.802  -6.206  1.00 123.24 ? 269 GLU B CB    1 
ATOM   8522  C CG    . GLU H 3 266 ? 71.912  -12.524  -7.543  1.00 126.11 ? 269 GLU B CG    1 
ATOM   8523  C CD    . GLU H 3 266 ? 73.056  -13.517  -7.569  1.00 127.96 ? 269 GLU B CD    1 
ATOM   8524  O OE1   . GLU H 3 266 ? 73.979  -13.400  -6.735  1.00 131.44 ? 269 GLU B OE1   1 
ATOM   8525  O OE2   . GLU H 3 266 ? 73.030  -14.417  -8.437  1.00 124.32 ? 269 GLU B OE2   1 
ATOM   8526  N N     . VAL H 3 267 ? 68.316  -11.773  -7.095  1.00 124.46 ? 270 VAL B N     1 
ATOM   8527  C CA    . VAL H 3 267 ? 67.203  -12.706  -7.276  1.00 130.93 ? 270 VAL B CA    1 
ATOM   8528  C C     . VAL H 3 267 ? 67.705  -13.997  -7.918  1.00 128.09 ? 270 VAL B C     1 
ATOM   8529  O O     . VAL H 3 267 ? 68.253  -13.988  -9.021  1.00 125.25 ? 270 VAL B O     1 
ATOM   8530  C CB    . VAL H 3 267 ? 66.029  -12.119  -8.100  1.00 136.12 ? 270 VAL B CB    1 
ATOM   8531  C CG1   . VAL H 3 267 ? 65.468  -10.881  -7.412  1.00 137.58 ? 270 VAL B CG1   1 
ATOM   8532  C CG2   . VAL H 3 267 ? 66.431  -11.824  -9.545  1.00 137.02 ? 270 VAL B CG2   1 
ATOM   8533  N N     . LEU H 3 268 ? 67.528  -15.103  -7.203  1.00 125.97 ? 271 LEU B N     1 
ATOM   8534  C CA    . LEU H 3 268 ? 67.960  -16.410  -7.684  1.00 124.75 ? 271 LEU B CA    1 
ATOM   8535  C C     . LEU H 3 268 ? 67.018  -16.899  -8.777  1.00 126.16 ? 271 LEU B C     1 
ATOM   8536  O O     . LEU H 3 268 ? 65.812  -16.634  -8.713  1.00 128.21 ? 271 LEU B O     1 
ATOM   8537  C CB    . LEU H 3 268 ? 68.008  -17.425  -6.531  1.00 123.42 ? 271 LEU B CB    1 
ATOM   8538  C CG    . LEU H 3 268 ? 69.327  -18.114  -6.137  1.00 123.68 ? 271 LEU B CG    1 
ATOM   8539  C CD1   . LEU H 3 268 ? 69.234  -19.602  -6.425  1.00 128.11 ? 271 LEU B CD1   1 
ATOM   8540  C CD2   . LEU H 3 268 ? 70.580  -17.532  -6.779  1.00 125.16 ? 271 LEU B CD2   1 
ATOM   8541  N N     . PRO H 3 269 ? 67.564  -17.603  -9.791  1.00 123.79 ? 272 PRO B N     1 
ATOM   8542  C CA    . PRO H 3 269 ? 66.696  -18.177  -10.817 1.00 123.13 ? 272 PRO B CA    1 
ATOM   8543  C C     . PRO H 3 269 ? 65.846  -19.292  -10.225 1.00 123.49 ? 272 PRO B C     1 
ATOM   8544  O O     . PRO H 3 269 ? 66.368  -20.137  -9.500  1.00 128.92 ? 272 PRO B O     1 
ATOM   8545  C CB    . PRO H 3 269 ? 67.675  -18.742  -11.860 1.00 121.37 ? 272 PRO B CB    1 
ATOM   8546  C CG    . PRO H 3 269 ? 69.023  -18.228  -11.496 1.00 122.72 ? 272 PRO B CG    1 
ATOM   8547  C CD    . PRO H 3 269 ? 68.986  -17.901  -10.038 1.00 120.89 ? 272 PRO B CD    1 
ATOM   8548  N N     . HIS H 3 270 ? 64.548  -19.275  -10.510 1.00 121.27 ? 273 HIS B N     1 
ATOM   8549  C CA    . HIS H 3 270 ? 63.643  -20.319  -10.043 1.00 120.50 ? 273 HIS B CA    1 
ATOM   8550  C C     . HIS H 3 270 ? 62.723  -20.721  -11.183 1.00 122.03 ? 273 HIS B C     1 
ATOM   8551  O O     . HIS H 3 270 ? 61.883  -19.930  -11.615 1.00 125.66 ? 273 HIS B O     1 
ATOM   8552  C CB    . HIS H 3 270 ? 62.831  -19.832  -8.844  1.00 119.66 ? 273 HIS B CB    1 
ATOM   8553  C CG    . HIS H 3 270 ? 61.988  -20.896  -8.211  1.00 118.96 ? 273 HIS B CG    1 
ATOM   8554  N ND1   . HIS H 3 270 ? 62.393  -21.601  -7.099  1.00 115.60 ? 273 HIS B ND1   1 
ATOM   8555  C CD2   . HIS H 3 270 ? 60.763  -21.374  -8.532  1.00 119.80 ? 273 HIS B CD2   1 
ATOM   8556  C CE1   . HIS H 3 270 ? 61.454  -22.465  -6.761  1.00 115.67 ? 273 HIS B CE1   1 
ATOM   8557  N NE2   . HIS H 3 270 ? 60.454  -22.349  -7.614  1.00 118.75 ? 273 HIS B NE2   1 
ATOM   8558  N N     . ALA H 3 271 ? 62.887  -21.953  -11.662 1.00 124.15 ? 274 ALA B N     1 
ATOM   8559  C CA    . ALA H 3 271 ? 62.165  -22.437  -12.839 1.00 121.12 ? 274 ALA B CA    1 
ATOM   8560  C C     . ALA H 3 271 ? 60.656  -22.578  -12.603 1.00 119.54 ? 274 ALA B C     1 
ATOM   8561  O O     . ALA H 3 271 ? 60.163  -22.462  -11.474 1.00 117.70 ? 274 ALA B O     1 
ATOM   8562  C CB    . ALA H 3 271 ? 62.760  -23.758  -13.308 1.00 119.33 ? 274 ALA B CB    1 
ATOM   8563  N N     . ALA H 3 272 ? 59.928  -22.816  -13.687 1.00 120.04 ? 275 ALA B N     1 
ATOM   8564  C CA    . ALA H 3 272 ? 58.479  -22.930  -13.622 1.00 126.32 ? 275 ALA B CA    1 
ATOM   8565  C C     . ALA H 3 272 ? 58.072  -24.262  -12.993 1.00 126.10 ? 275 ALA B C     1 
ATOM   8566  O O     . ALA H 3 272 ? 58.621  -25.314  -13.339 1.00 115.77 ? 275 ALA B O     1 
ATOM   8567  C CB    . ALA H 3 272 ? 57.872  -22.787  -15.012 1.00 128.85 ? 275 ALA B CB    1 
ATOM   8568  N N     . TYR H 3 273 ? 57.120  -24.192  -12.061 1.00 125.97 ? 276 TYR B N     1 
ATOM   8569  C CA    . TYR H 3 273 ? 56.509  -25.368  -11.432 1.00 117.65 ? 276 TYR B CA    1 
ATOM   8570  C C     . TYR H 3 273 ? 57.538  -26.226  -10.694 1.00 102.96 ? 276 TYR B C     1 
ATOM   8571  O O     . TYR H 3 273 ? 57.616  -27.439  -10.892 1.00 93.59  ? 276 TYR B O     1 
ATOM   8572  C CB    . TYR H 3 273 ? 55.754  -26.196  -12.479 1.00 123.30 ? 276 TYR B CB    1 
ATOM   8573  C CG    . TYR H 3 273 ? 54.825  -25.380  -13.351 1.00 132.32 ? 276 TYR B CG    1 
ATOM   8574  C CD1   . TYR H 3 273 ? 53.557  -25.025  -12.907 1.00 141.65 ? 276 TYR B CD1   1 
ATOM   8575  C CD2   . TYR H 3 273 ? 55.212  -24.963  -14.620 1.00 139.22 ? 276 TYR B CD2   1 
ATOM   8576  C CE1   . TYR H 3 273 ? 52.700  -24.279  -13.700 1.00 144.63 ? 276 TYR B CE1   1 
ATOM   8577  C CE2   . TYR H 3 273 ? 54.361  -24.215  -15.420 1.00 142.46 ? 276 TYR B CE2   1 
ATOM   8578  C CZ    . TYR H 3 273 ? 53.107  -23.877  -14.954 1.00 143.06 ? 276 TYR B CZ    1 
ATOM   8579  O OH    . TYR H 3 273 ? 52.256  -23.137  -15.736 1.00 144.71 ? 276 TYR B OH    1 
ATOM   8580  N N     . SER H 3 274 ? 58.307  -25.588  -9.818  1.00 92.44  ? 277 SER B N     1 
ATOM   8581  C CA    . SER H 3 274 ? 59.417  -26.261  -9.150  1.00 86.20  ? 277 SER B CA    1 
ATOM   8582  C C     . SER H 3 274 ? 59.373  -26.192  -7.621  1.00 78.29  ? 277 SER B C     1 
ATOM   8583  O O     . SER H 3 274 ? 60.336  -25.745  -6.993  1.00 77.09  ? 277 SER B O     1 
ATOM   8584  C CB    . SER H 3 274 ? 60.737  -25.684  -9.662  1.00 86.68  ? 277 SER B CB    1 
ATOM   8585  O OG    . SER H 3 274 ? 60.835  -25.841  -11.063 1.00 87.97  ? 277 SER B OG    1 
ATOM   8586  N N     . PRO H 3 275 ? 58.272  -26.671  -7.012  1.00 71.83  ? 278 PRO B N     1 
ATOM   8587  C CA    . PRO H 3 275 ? 58.213  -26.707  -5.550  1.00 72.31  ? 278 PRO B CA    1 
ATOM   8588  C C     . PRO H 3 275 ? 59.320  -27.559  -4.941  1.00 76.23  ? 278 PRO B C     1 
ATOM   8589  O O     . PRO H 3 275 ? 59.806  -27.258  -3.854  1.00 80.06  ? 278 PRO B O     1 
ATOM   8590  C CB    . PRO H 3 275 ? 56.860  -27.355  -5.253  1.00 70.07  ? 278 PRO B CB    1 
ATOM   8591  C CG    . PRO H 3 275 ? 56.090  -27.312  -6.507  1.00 70.13  ? 278 PRO B CG    1 
ATOM   8592  C CD    . PRO H 3 275 ? 57.066  -27.240  -7.634  1.00 70.79  ? 278 PRO B CD    1 
ATOM   8593  N N     . ASP H 3 276 ? 59.703  -28.619  -5.649  1.00 79.18  ? 279 ASP B N     1 
ATOM   8594  C CA    . ASP H 3 276 ? 60.763  -29.528  -5.205  1.00 77.45  ? 279 ASP B CA    1 
ATOM   8595  C C     . ASP H 3 276 ? 62.154  -28.906  -5.156  1.00 78.77  ? 279 ASP B C     1 
ATOM   8596  O O     . ASP H 3 276 ? 63.079  -29.540  -4.662  1.00 83.29  ? 279 ASP B O     1 
ATOM   8597  C CB    . ASP H 3 276 ? 60.808  -30.765  -6.102  1.00 77.57  ? 279 ASP B CB    1 
ATOM   8598  C CG    . ASP H 3 276 ? 60.894  -30.415  -7.575  1.00 75.98  ? 279 ASP B CG    1 
ATOM   8599  O OD1   . ASP H 3 276 ? 60.250  -29.430  -7.971  1.00 72.57  ? 279 ASP B OD1   1 
ATOM   8600  O OD2   . ASP H 3 276 ? 61.583  -31.129  -8.336  1.00 78.96  ? 279 ASP B OD2   1 
ATOM   8601  N N     . LEU H 3 277 ? 62.314  -27.692  -5.684  1.00 80.98  ? 280 LEU B N     1 
ATOM   8602  C CA    . LEU H 3 277 ? 63.568  -26.944  -5.540  1.00 79.57  ? 280 LEU B CA    1 
ATOM   8603  C C     . LEU H 3 277 ? 63.410  -25.776  -4.577  1.00 74.28  ? 280 LEU B C     1 
ATOM   8604  O O     . LEU H 3 277 ? 64.344  -25.012  -4.387  1.00 78.66  ? 280 LEU B O     1 
ATOM   8605  C CB    . LEU H 3 277 ? 64.058  -26.416  -6.900  1.00 81.63  ? 280 LEU B CB    1 
ATOM   8606  C CG    . LEU H 3 277 ? 64.627  -27.385  -7.950  1.00 80.38  ? 280 LEU B CG    1 
ATOM   8607  C CD1   . LEU H 3 277 ? 65.535  -28.406  -7.298  1.00 81.78  ? 280 LEU B CD1   1 
ATOM   8608  C CD2   . LEU H 3 277 ? 63.535  -28.081  -8.748  1.00 81.91  ? 280 LEU B CD2   1 
ATOM   8609  N N     . ALA H 3 278 ? 62.239  -25.652  -3.962  1.00 70.47  ? 281 ALA B N     1 
ATOM   8610  C CA    . ALA H 3 278 ? 61.908  -24.507  -3.117  1.00 71.38  ? 281 ALA B CA    1 
ATOM   8611  C C     . ALA H 3 278 ? 61.944  -24.871  -1.634  1.00 67.84  ? 281 ALA B C     1 
ATOM   8612  O O     . ALA H 3 278 ? 60.958  -25.374  -1.096  1.00 64.64  ? 281 ALA B O     1 
ATOM   8613  C CB    . ALA H 3 278 ? 60.524  -23.986  -3.483  1.00 75.53  ? 281 ALA B CB    1 
ATOM   8614  N N     . PRO H 3 279 ? 63.068  -24.605  -0.958  1.00 69.79  ? 282 PRO B N     1 
ATOM   8615  C CA    . PRO H 3 279 ? 63.194  -24.985  0.446   1.00 73.44  ? 282 PRO B CA    1 
ATOM   8616  C C     . PRO H 3 279 ? 61.913  -24.821  1.244   1.00 76.19  ? 282 PRO B C     1 
ATOM   8617  O O     . PRO H 3 279 ? 61.424  -25.775  1.832   1.00 79.63  ? 282 PRO B O     1 
ATOM   8618  C CB    . PRO H 3 279 ? 64.286  -24.046  0.955   1.00 72.22  ? 282 PRO B CB    1 
ATOM   8619  C CG    . PRO H 3 279 ? 65.185  -23.903  -0.228  1.00 72.10  ? 282 PRO B CG    1 
ATOM   8620  C CD    . PRO H 3 279 ? 64.302  -23.965  -1.450  1.00 71.72  ? 282 PRO B CD    1 
ATOM   8621  N N     . SER H 3 280 ? 61.351  -23.626  1.236   1.00 81.58  ? 283 SER B N     1 
ATOM   8622  C CA    . SER H 3 280 ? 60.146  -23.362  2.007   1.00 83.36  ? 283 SER B CA    1 
ATOM   8623  C C     . SER H 3 280 ? 59.052  -24.419  1.744   1.00 81.55  ? 283 SER B C     1 
ATOM   8624  O O     . SER H 3 280 ? 58.415  -24.895  2.682   1.00 76.14  ? 283 SER B O     1 
ATOM   8625  C CB    . SER H 3 280 ? 59.656  -21.953  1.692   1.00 85.61  ? 283 SER B CB    1 
ATOM   8626  O OG    . SER H 3 280 ? 60.771  -21.089  1.534   1.00 83.44  ? 283 SER B OG    1 
ATOM   8627  N N     . ASP H 3 281 ? 58.868  -24.796  0.476   1.00 83.07  ? 284 ASP B N     1 
ATOM   8628  C CA    . ASP H 3 281 ? 57.881  -25.813  0.091   1.00 85.66  ? 284 ASP B CA    1 
ATOM   8629  C C     . ASP H 3 281 ? 58.275  -27.219  0.554   1.00 85.35  ? 284 ASP B C     1 
ATOM   8630  O O     . ASP H 3 281 ? 57.597  -27.802  1.404   1.00 81.35  ? 284 ASP B O     1 
ATOM   8631  C CB    . ASP H 3 281 ? 57.658  -25.822  -1.430  1.00 90.53  ? 284 ASP B CB    1 
ATOM   8632  C CG    . ASP H 3 281 ? 56.724  -24.718  -1.900  1.00 95.51  ? 284 ASP B CG    1 
ATOM   8633  O OD1   . ASP H 3 281 ? 55.699  -24.461  -1.233  1.00 98.48  ? 284 ASP B OD1   1 
ATOM   8634  O OD2   . ASP H 3 281 ? 57.005  -24.115  -2.955  1.00 101.63 ? 284 ASP B OD2   1 
ATOM   8635  N N     . TYR H 3 282 ? 59.370  -27.754  0.007   1.00 83.16  ? 285 TYR B N     1 
ATOM   8636  C CA    . TYR H 3 282 ? 59.765  -29.148  0.277   1.00 79.82  ? 285 TYR B CA    1 
ATOM   8637  C C     . TYR H 3 282 ? 60.225  -29.466  1.711   1.00 77.18  ? 285 TYR B C     1 
ATOM   8638  O O     . TYR H 3 282 ? 60.174  -30.618  2.114   1.00 80.62  ? 285 TYR B O     1 
ATOM   8639  C CB    . TYR H 3 282 ? 60.821  -29.640  -0.731  1.00 77.12  ? 285 TYR B CB    1 
ATOM   8640  C CG    . TYR H 3 282 ? 62.215  -29.061  -0.586  1.00 75.32  ? 285 TYR B CG    1 
ATOM   8641  C CD1   . TYR H 3 282 ? 63.004  -29.334  0.529   1.00 72.71  ? 285 TYR B CD1   1 
ATOM   8642  C CD2   . TYR H 3 282 ? 62.765  -28.268  -1.595  1.00 77.66  ? 285 TYR B CD2   1 
ATOM   8643  C CE1   . TYR H 3 282 ? 64.286  -28.809  0.649   1.00 73.98  ? 285 TYR B CE1   1 
ATOM   8644  C CE2   . TYR H 3 282 ? 64.046  -27.742  -1.484  1.00 76.00  ? 285 TYR B CE2   1 
ATOM   8645  C CZ    . TYR H 3 282 ? 64.802  -28.018  -0.362  1.00 73.35  ? 285 TYR B CZ    1 
ATOM   8646  O OH    . TYR H 3 282 ? 66.065  -27.494  -0.249  1.00 72.39  ? 285 TYR B OH    1 
ATOM   8647  N N     . HIS H 3 283 ? 60.661  -28.464  2.469   1.00 77.61  ? 286 HIS B N     1 
ATOM   8648  C CA    . HIS H 3 283 ? 61.264  -28.687  3.791   1.00 79.34  ? 286 HIS B CA    1 
ATOM   8649  C C     . HIS H 3 283 ? 60.503  -28.035  4.930   1.00 77.68  ? 286 HIS B C     1 
ATOM   8650  O O     . HIS H 3 283 ? 60.192  -28.690  5.911   1.00 81.08  ? 286 HIS B O     1 
ATOM   8651  C CB    . HIS H 3 283 ? 62.695  -28.160  3.803   1.00 81.55  ? 286 HIS B CB    1 
ATOM   8652  C CG    . HIS H 3 283 ? 63.391  -28.311  5.116   1.00 82.93  ? 286 HIS B CG    1 
ATOM   8653  N ND1   . HIS H 3 283 ? 64.123  -29.428  5.444   1.00 87.63  ? 286 HIS B ND1   1 
ATOM   8654  C CD2   . HIS H 3 283 ? 63.491  -27.474  6.174   1.00 88.73  ? 286 HIS B CD2   1 
ATOM   8655  C CE1   . HIS H 3 283 ? 64.637  -29.279  6.652   1.00 89.32  ? 286 HIS B CE1   1 
ATOM   8656  N NE2   . HIS H 3 283 ? 64.273  -28.097  7.114   1.00 88.45  ? 286 HIS B NE2   1 
ATOM   8657  N N     . LEU H 3 284 ? 60.236  -26.739  4.813   1.00 79.63  ? 287 LEU B N     1 
ATOM   8658  C CA    . LEU H 3 284 ? 59.616  -25.980  5.903   1.00 78.86  ? 287 LEU B CA    1 
ATOM   8659  C C     . LEU H 3 284 ? 58.135  -26.290  6.007   1.00 76.05  ? 287 LEU B C     1 
ATOM   8660  O O     . LEU H 3 284 ? 57.662  -26.750  7.049   1.00 73.16  ? 287 LEU B O     1 
ATOM   8661  C CB    . LEU H 3 284 ? 59.832  -24.479  5.697   1.00 81.49  ? 287 LEU B CB    1 
ATOM   8662  C CG    . LEU H 3 284 ? 59.198  -23.487  6.676   1.00 85.23  ? 287 LEU B CG    1 
ATOM   8663  C CD1   . LEU H 3 284 ? 59.390  -23.897  8.124   1.00 87.79  ? 287 LEU B CD1   1 
ATOM   8664  C CD2   . LEU H 3 284 ? 59.789  -22.106  6.437   1.00 89.61  ? 287 LEU B CD2   1 
ATOM   8665  N N     . PHE H 3 285 ? 57.413  -26.046  4.917   1.00 75.79  ? 288 PHE B N     1 
ATOM   8666  C CA    . PHE H 3 285 ? 55.965  -26.268  4.878   1.00 76.99  ? 288 PHE B CA    1 
ATOM   8667  C C     . PHE H 3 285 ? 55.600  -27.748  4.989   1.00 77.68  ? 288 PHE B C     1 
ATOM   8668  O O     . PHE H 3 285 ? 54.616  -28.098  5.647   1.00 71.17  ? 288 PHE B O     1 
ATOM   8669  C CB    . PHE H 3 285 ? 55.361  -25.698  3.589   1.00 80.22  ? 288 PHE B CB    1 
ATOM   8670  C CG    . PHE H 3 285 ? 55.468  -24.199  3.450   1.00 83.91  ? 288 PHE B CG    1 
ATOM   8671  C CD1   . PHE H 3 285 ? 55.444  -23.355  4.560   1.00 85.16  ? 288 PHE B CD1   1 
ATOM   8672  C CD2   . PHE H 3 285 ? 55.538  -23.629  2.186   1.00 89.44  ? 288 PHE B CD2   1 
ATOM   8673  C CE1   . PHE H 3 285 ? 55.528  -21.982  4.407   1.00 86.05  ? 288 PHE B CE1   1 
ATOM   8674  C CE2   . PHE H 3 285 ? 55.615  -22.257  2.029   1.00 90.22  ? 288 PHE B CE2   1 
ATOM   8675  C CZ    . PHE H 3 285 ? 55.614  -21.433  3.141   1.00 88.27  ? 288 PHE B CZ    1 
ATOM   8676  N N     . ALA H 3 286 ? 56.387  -28.593  4.314   1.00 83.04  ? 289 ALA B N     1 
ATOM   8677  C CA    . ALA H 3 286 ? 56.315  -30.057  4.440   1.00 76.97  ? 289 ALA B CA    1 
ATOM   8678  C C     . ALA H 3 286 ? 56.261  -30.467  5.895   1.00 68.88  ? 289 ALA B C     1 
ATOM   8679  O O     . ALA H 3 286 ? 55.305  -31.089  6.334   1.00 64.17  ? 289 ALA B O     1 
ATOM   8680  C CB    . ALA H 3 286 ? 57.522  -30.701  3.771   1.00 79.45  ? 289 ALA B CB    1 
ATOM   8681  N N     . SER H 3 287 ? 57.283  -30.096  6.648   1.00 65.78  ? 290 SER B N     1 
ATOM   8682  C CA    . SER H 3 287 ? 57.308  -30.400  8.066   1.00 69.83  ? 290 SER B CA    1 
ATOM   8683  C C     . SER H 3 287 ? 56.027  -29.947  8.719   1.00 73.48  ? 290 SER B C     1 
ATOM   8684  O O     . SER H 3 287 ? 55.408  -30.694  9.462   1.00 75.02  ? 290 SER B O     1 
ATOM   8685  C CB    . SER H 3 287 ? 58.473  -29.701  8.752   1.00 70.84  ? 290 SER B CB    1 
ATOM   8686  O OG    . SER H 3 287 ? 58.458  -29.982  10.135  1.00 72.61  ? 290 SER B OG    1 
ATOM   8687  N N     . MET H 3 288 ? 55.639  -28.711  8.424   1.00 83.82  ? 291 MET B N     1 
ATOM   8688  C CA    . MET H 3 288 ? 54.473  -28.092  9.047   1.00 87.44  ? 291 MET B CA    1 
ATOM   8689  C C     . MET H 3 288 ? 53.223  -28.906  8.738   1.00 81.84  ? 291 MET B C     1 
ATOM   8690  O O     . MET H 3 288 ? 52.440  -29.221  9.635   1.00 77.92  ? 291 MET B O     1 
ATOM   8691  C CB    . MET H 3 288 ? 54.304  -26.650  8.555   1.00 96.32  ? 291 MET B CB    1 
ATOM   8692  C CG    . MET H 3 288 ? 54.038  -25.642  9.666   1.00 102.35 ? 291 MET B CG    1 
ATOM   8693  S SD    . MET H 3 288 ? 53.913  -23.962  9.034   1.00 102.25 ? 291 MET B SD    1 
ATOM   8694  C CE    . MET H 3 288 ? 52.322  -24.089  8.236   1.00 99.39  ? 291 MET B CE    1 
ATOM   8695  N N     . GLY H 3 289 ? 53.058  -29.255  7.465   1.00 81.39  ? 292 GLY B N     1 
ATOM   8696  C CA    . GLY H 3 289 ? 51.970  -30.128  7.027   1.00 83.54  ? 292 GLY B CA    1 
ATOM   8697  C C     . GLY H 3 289 ? 51.668  -31.250  8.008   1.00 80.45  ? 292 GLY B C     1 
ATOM   8698  O O     . GLY H 3 289 ? 50.508  -31.519  8.312   1.00 78.76  ? 292 GLY B O     1 
ATOM   8699  N N     . HIS H 3 290 ? 52.710  -31.898  8.516   1.00 77.63  ? 293 HIS B N     1 
ATOM   8700  C CA    . HIS H 3 290 ? 52.508  -32.948  9.502   1.00 85.01  ? 293 HIS B CA    1 
ATOM   8701  C C     . HIS H 3 290 ? 51.937  -32.392  10.776  1.00 85.09  ? 293 HIS B C     1 
ATOM   8702  O O     . HIS H 3 290 ? 50.832  -32.755  11.159  1.00 88.92  ? 293 HIS B O     1 
ATOM   8703  C CB    . HIS H 3 290 ? 53.788  -33.749  9.763   1.00 90.67  ? 293 HIS B CB    1 
ATOM   8704  C CG    . HIS H 3 290 ? 54.043  -34.774  8.709   1.00 91.56  ? 293 HIS B CG    1 
ATOM   8705  N ND1   . HIS H 3 290 ? 54.901  -34.558  7.654   1.00 93.08  ? 293 HIS B ND1   1 
ATOM   8706  C CD2   . HIS H 3 290 ? 53.479  -35.983  8.496   1.00 88.43  ? 293 HIS B CD2   1 
ATOM   8707  C CE1   . HIS H 3 290 ? 54.882  -35.607  6.855   1.00 91.57  ? 293 HIS B CE1   1 
ATOM   8708  N NE2   . HIS H 3 290 ? 54.028  -36.486  7.343   1.00 93.35  ? 293 HIS B NE2   1 
ATOM   8709  N N     . ALA H 3 291 ? 52.667  -31.480  11.406  1.00 90.19  ? 294 ALA B N     1 
ATOM   8710  C CA    . ALA H 3 291 ? 52.216  -30.853  12.652  1.00 91.24  ? 294 ALA B CA    1 
ATOM   8711  C C     . ALA H 3 291 ? 50.778  -30.336  12.570  1.00 91.82  ? 294 ALA B C     1 
ATOM   8712  O O     . ALA H 3 291 ? 50.044  -30.387  13.560  1.00 89.90  ? 294 ALA B O     1 
ATOM   8713  C CB    . ALA H 3 291 ? 53.153  -29.724  13.036  1.00 94.19  ? 294 ALA B CB    1 
ATOM   8714  N N     . LEU H 3 292 ? 50.381  -29.849  11.393  1.00 92.52  ? 295 LEU B N     1 
ATOM   8715  C CA    . LEU H 3 292 ? 49.027  -29.325  11.184  1.00 98.00  ? 295 LEU B CA    1 
ATOM   8716  C C     . LEU H 3 292 ? 47.946  -30.398  11.075  1.00 102.08 ? 295 LEU B C     1 
ATOM   8717  O O     . LEU H 3 292 ? 46.785  -30.131  11.385  1.00 103.30 ? 295 LEU B O     1 
ATOM   8718  C CB    . LEU H 3 292 ? 48.966  -28.456  9.923   1.00 96.37  ? 295 LEU B CB    1 
ATOM   8719  C CG    . LEU H 3 292 ? 49.589  -27.063  9.972   1.00 93.20  ? 295 LEU B CG    1 
ATOM   8720  C CD1   . LEU H 3 292 ? 49.485  -26.426  8.595   1.00 92.84  ? 295 LEU B CD1   1 
ATOM   8721  C CD2   . LEU H 3 292 ? 48.923  -26.190  11.022  1.00 92.24  ? 295 LEU B CD2   1 
ATOM   8722  N N     . ALA H 3 293 ? 48.313  -31.590  10.611  1.00 106.40 ? 296 ALA B N     1 
ATOM   8723  C CA    . ALA H 3 293 ? 47.338  -32.661  10.393  1.00 108.66 ? 296 ALA B CA    1 
ATOM   8724  C C     . ALA H 3 293 ? 46.449  -32.854  11.620  1.00 109.43 ? 296 ALA B C     1 
ATOM   8725  O O     . ALA H 3 293 ? 46.927  -32.817  12.756  1.00 99.14  ? 296 ALA B O     1 
ATOM   8726  C CB    . ALA H 3 293 ? 48.039  -33.961  10.035  1.00 108.17 ? 296 ALA B CB    1 
ATOM   8727  N N     . GLU H 3 294 ? 45.153  -33.041  11.369  1.00 118.84 ? 297 GLU B N     1 
ATOM   8728  C CA    . GLU H 3 294 ? 44.121  -33.141  12.412  1.00 130.22 ? 297 GLU B CA    1 
ATOM   8729  C C     . GLU H 3 294 ? 44.346  -32.191  13.597  1.00 133.19 ? 297 GLU B C     1 
ATOM   8730  O O     . GLU H 3 294 ? 44.112  -32.554  14.751  1.00 138.50 ? 297 GLU B O     1 
ATOM   8731  C CB    . GLU H 3 294 ? 43.932  -34.601  12.879  1.00 139.23 ? 297 GLU B CB    1 
ATOM   8732  C CG    . GLU H 3 294 ? 45.194  -35.328  13.327  1.00 144.21 ? 297 GLU B CG    1 
ATOM   8733  C CD    . GLU H 3 294 ? 44.923  -36.724  13.874  1.00 147.95 ? 297 GLU B CD    1 
ATOM   8734  O OE1   . GLU H 3 294 ? 45.616  -37.134  14.831  1.00 147.72 ? 297 GLU B OE1   1 
ATOM   8735  O OE2   . GLU H 3 294 ? 44.022  -37.414  13.350  1.00 146.05 ? 297 GLU B OE2   1 
ATOM   8736  N N     . GLN H 3 295 ? 44.798  -30.974  13.291  1.00 132.28 ? 298 GLN B N     1 
ATOM   8737  C CA    . GLN H 3 295 ? 44.898  -29.892  14.265  1.00 121.39 ? 298 GLN B CA    1 
ATOM   8738  C C     . GLN H 3 295 ? 43.725  -28.966  14.006  1.00 115.68 ? 298 GLN B C     1 
ATOM   8739  O O     . GLN H 3 295 ? 43.361  -28.731  12.855  1.00 109.05 ? 298 GLN B O     1 
ATOM   8740  C CB    . GLN H 3 295 ? 46.214  -29.132  14.094  1.00 118.69 ? 298 GLN B CB    1 
ATOM   8741  C CG    . GLN H 3 295 ? 46.568  -28.215  15.251  1.00 119.54 ? 298 GLN B CG    1 
ATOM   8742  C CD    . GLN H 3 295 ? 47.077  -28.964  16.465  1.00 121.35 ? 298 GLN B CD    1 
ATOM   8743  O OE1   . GLN H 3 295 ? 46.961  -30.186  16.553  1.00 122.29 ? 298 GLN B OE1   1 
ATOM   8744  N NE2   . GLN H 3 295 ? 47.646  -28.231  17.413  1.00 123.61 ? 298 GLN B NE2   1 
ATOM   8745  N N     . ARG H 3 296 ? 43.125  -28.443  15.065  1.00 117.09 ? 299 ARG B N     1 
ATOM   8746  C CA    . ARG H 3 296 ? 41.910  -27.652  14.911  1.00 119.80 ? 299 ARG B CA    1 
ATOM   8747  C C     . ARG H 3 296 ? 42.011  -26.283  15.578  1.00 119.06 ? 299 ARG B C     1 
ATOM   8748  O O     . ARG H 3 296 ? 42.174  -26.180  16.797  1.00 119.00 ? 299 ARG B O     1 
ATOM   8749  C CB    . ARG H 3 296 ? 40.715  -28.429  15.457  1.00 122.21 ? 299 ARG B CB    1 
ATOM   8750  C CG    . ARG H 3 296 ? 39.423  -28.124  14.725  1.00 123.63 ? 299 ARG B CG    1 
ATOM   8751  C CD    . ARG H 3 296 ? 38.351  -29.146  15.038  1.00 125.19 ? 299 ARG B CD    1 
ATOM   8752  N NE    . ARG H 3 296 ? 37.232  -29.034  14.109  1.00 129.56 ? 299 ARG B NE    1 
ATOM   8753  C CZ    . ARG H 3 296 ? 36.319  -29.981  13.894  1.00 140.12 ? 299 ARG B CZ    1 
ATOM   8754  N NH1   . ARG H 3 296 ? 36.371  -31.143  14.537  1.00 146.01 ? 299 ARG B NH1   1 
ATOM   8755  N NH2   . ARG H 3 296 ? 35.341  -29.764  13.022  1.00 142.05 ? 299 ARG B NH2   1 
ATOM   8756  N N     . PHE H 3 297 ? 41.908  -25.238  14.761  1.00 117.94 ? 300 PHE B N     1 
ATOM   8757  C CA    . PHE H 3 297 ? 41.992  -23.861  15.230  1.00 116.50 ? 300 PHE B CA    1 
ATOM   8758  C C     . PHE H 3 297 ? 40.620  -23.212  15.189  1.00 116.09 ? 300 PHE B C     1 
ATOM   8759  O O     . PHE H 3 297 ? 39.947  -23.236  14.161  1.00 111.61 ? 300 PHE B O     1 
ATOM   8760  C CB    . PHE H 3 297 ? 42.951  -23.056  14.353  1.00 115.74 ? 300 PHE B CB    1 
ATOM   8761  C CG    . PHE H 3 297 ? 44.330  -23.640  14.269  1.00 113.30 ? 300 PHE B CG    1 
ATOM   8762  C CD1   . PHE H 3 297 ? 45.086  -23.830  15.416  1.00 111.45 ? 300 PHE B CD1   1 
ATOM   8763  C CD2   . PHE H 3 297 ? 44.879  -23.989  13.041  1.00 112.02 ? 300 PHE B CD2   1 
ATOM   8764  C CE1   . PHE H 3 297 ? 46.360  -24.368  15.343  1.00 113.13 ? 300 PHE B CE1   1 
ATOM   8765  C CE2   . PHE H 3 297 ? 46.152  -24.527  12.962  1.00 110.51 ? 300 PHE B CE2   1 
ATOM   8766  C CZ    . PHE H 3 297 ? 46.895  -24.716  14.115  1.00 111.68 ? 300 PHE B CZ    1 
ATOM   8767  N N     . ASP H 3 298 ? 40.219  -22.623  16.310  1.00 119.72 ? 301 ASP B N     1 
ATOM   8768  C CA    . ASP H 3 298 ? 38.946  -21.908  16.393  1.00 123.93 ? 301 ASP B CA    1 
ATOM   8769  C C     . ASP H 3 298 ? 39.090  -20.438  15.980  1.00 120.92 ? 301 ASP B C     1 
ATOM   8770  O O     . ASP H 3 298 ? 38.219  -19.910  15.296  1.00 123.21 ? 301 ASP B O     1 
ATOM   8771  C CB    . ASP H 3 298 ? 38.331  -22.028  17.797  1.00 126.87 ? 301 ASP B CB    1 
ATOM   8772  C CG    . ASP H 3 298 ? 39.300  -21.648  18.906  1.00 134.38 ? 301 ASP B CG    1 
ATOM   8773  O OD1   . ASP H 3 298 ? 40.528  -21.815  18.729  1.00 138.81 ? 301 ASP B OD1   1 
ATOM   8774  O OD2   . ASP H 3 298 ? 38.827  -21.192  19.967  1.00 140.54 ? 301 ASP B OD2   1 
ATOM   8775  N N     . SER H 3 299 ? 40.191  -19.793  16.372  1.00 115.57 ? 302 SER B N     1 
ATOM   8776  C CA    . SER H 3 299 ? 40.405  -18.368  16.096  1.00 111.62 ? 302 SER B CA    1 
ATOM   8777  C C     . SER H 3 299 ? 41.821  -18.051  15.592  1.00 113.05 ? 302 SER B C     1 
ATOM   8778  O O     . SER H 3 299 ? 42.792  -18.707  15.982  1.00 114.52 ? 302 SER B O     1 
ATOM   8779  C CB    . SER H 3 299 ? 40.132  -17.555  17.364  1.00 110.06 ? 302 SER B CB    1 
ATOM   8780  O OG    . SER H 3 299 ? 41.079  -17.854  18.376  1.00 104.00 ? 302 SER B OG    1 
ATOM   8781  N N     . TYR H 3 300 ? 41.922  -17.032  14.736  1.00 106.65 ? 303 TYR B N     1 
ATOM   8782  C CA    . TYR H 3 300 ? 43.206  -16.470  14.284  1.00 105.27 ? 303 TYR B CA    1 
ATOM   8783  C C     . TYR H 3 300 ? 44.235  -16.359  15.417  1.00 107.62 ? 303 TYR B C     1 
ATOM   8784  O O     . TYR H 3 300 ? 45.416  -16.625  15.216  1.00 102.59 ? 303 TYR B O     1 
ATOM   8785  C CB    . TYR H 3 300 ? 42.954  -15.087  13.662  1.00 107.47 ? 303 TYR B CB    1 
ATOM   8786  C CG    . TYR H 3 300 ? 44.182  -14.288  13.246  1.00 107.91 ? 303 TYR B CG    1 
ATOM   8787  C CD1   . TYR H 3 300 ? 45.070  -13.774  14.194  1.00 109.55 ? 303 TYR B CD1   1 
ATOM   8788  C CD2   . TYR H 3 300 ? 44.422  -13.995  11.904  1.00 105.44 ? 303 TYR B CD2   1 
ATOM   8789  C CE1   . TYR H 3 300 ? 46.177  -13.034  13.813  1.00 112.26 ? 303 TYR B CE1   1 
ATOM   8790  C CE2   . TYR H 3 300 ? 45.523  -13.252  11.514  1.00 107.08 ? 303 TYR B CE2   1 
ATOM   8791  C CZ    . TYR H 3 300 ? 46.398  -12.776  12.471  1.00 114.01 ? 303 TYR B CZ    1 
ATOM   8792  O OH    . TYR H 3 300 ? 47.494  -12.039  12.088  1.00 119.94 ? 303 TYR B OH    1 
ATOM   8793  N N     . GLU H 3 301 ? 43.784  -15.954  16.602  1.00 121.60 ? 304 GLU B N     1 
ATOM   8794  C CA    . GLU H 3 301 ? 44.674  -15.789  17.758  1.00 130.66 ? 304 GLU B CA    1 
ATOM   8795  C C     . GLU H 3 301 ? 45.420  -17.084  18.043  1.00 124.07 ? 304 GLU B C     1 
ATOM   8796  O O     . GLU H 3 301 ? 46.643  -17.086  18.160  1.00 124.62 ? 304 GLU B O     1 
ATOM   8797  C CB    . GLU H 3 301 ? 43.906  -15.364  19.029  1.00 142.05 ? 304 GLU B CB    1 
ATOM   8798  C CG    . GLU H 3 301 ? 42.870  -14.247  18.873  1.00 146.79 ? 304 GLU B CG    1 
ATOM   8799  C CD    . GLU H 3 301 ? 43.379  -13.033  18.114  1.00 148.47 ? 304 GLU B CD    1 
ATOM   8800  O OE1   . GLU H 3 301 ? 42.557  -12.375  17.442  1.00 147.81 ? 304 GLU B OE1   1 
ATOM   8801  O OE2   . GLU H 3 301 ? 44.590  -12.731  18.185  1.00 150.41 ? 304 GLU B OE2   1 
ATOM   8802  N N     . SER H 3 302 ? 44.677  -18.182  18.145  1.00 122.50 ? 305 SER B N     1 
ATOM   8803  C CA    . SER H 3 302 ? 45.280  -19.487  18.412  1.00 120.95 ? 305 SER B CA    1 
ATOM   8804  C C     . SER H 3 302 ? 46.215  -19.917  17.279  1.00 116.44 ? 305 SER B C     1 
ATOM   8805  O O     . SER H 3 302 ? 47.227  -20.569  17.540  1.00 119.42 ? 305 SER B O     1 
ATOM   8806  C CB    . SER H 3 302 ? 44.209  -20.557  18.677  1.00 118.45 ? 305 SER B CB    1 
ATOM   8807  O OG    . SER H 3 302 ? 43.166  -20.497  17.726  1.00 118.90 ? 305 SER B OG    1 
ATOM   8808  N N     . VAL H 3 303 ? 45.897  -19.536  16.040  1.00 107.68 ? 306 VAL B N     1 
ATOM   8809  C CA    . VAL H 3 303 ? 46.761  -19.857  14.897  1.00 103.31 ? 306 VAL B CA    1 
ATOM   8810  C C     . VAL H 3 303 ? 48.105  -19.160  15.049  1.00 103.86 ? 306 VAL B C     1 
ATOM   8811  O O     . VAL H 3 303 ? 49.148  -19.807  15.044  1.00 101.64 ? 306 VAL B O     1 
ATOM   8812  C CB    . VAL H 3 303 ? 46.140  -19.458  13.542  1.00 101.11 ? 306 VAL B CB    1 
ATOM   8813  C CG1   . VAL H 3 303 ? 47.083  -19.791  12.396  1.00 99.49  ? 306 VAL B CG1   1 
ATOM   8814  C CG2   . VAL H 3 303 ? 44.819  -20.171  13.332  1.00 103.87 ? 306 VAL B CG2   1 
ATOM   8815  N N     . LYS H 3 304 ? 48.082  -17.841  15.199  1.00 110.61 ? 307 LYS B N     1 
ATOM   8816  C CA    . LYS H 3 304 ? 49.318  -17.097  15.409  1.00 116.01 ? 307 LYS B CA    1 
ATOM   8817  C C     . LYS H 3 304 ? 50.075  -17.622  16.634  1.00 112.54 ? 307 LYS B C     1 
ATOM   8818  O O     . LYS H 3 304 ? 51.302  -17.715  16.609  1.00 114.74 ? 307 LYS B O     1 
ATOM   8819  C CB    . LYS H 3 304 ? 49.060  -15.590  15.540  1.00 120.62 ? 307 LYS B CB    1 
ATOM   8820  C CG    . LYS H 3 304 ? 50.328  -14.791  15.820  1.00 128.90 ? 307 LYS B CG    1 
ATOM   8821  C CD    . LYS H 3 304 ? 50.345  -13.418  15.168  1.00 133.25 ? 307 LYS B CD    1 
ATOM   8822  C CE    . LYS H 3 304 ? 51.652  -12.685  15.458  1.00 134.24 ? 307 LYS B CE    1 
ATOM   8823  N NZ    . LYS H 3 304 ? 52.152  -11.922  14.279  1.00 132.58 ? 307 LYS B NZ    1 
ATOM   8824  N N     . LYS H 3 305 ? 49.347  -17.980  17.689  1.00 107.39 ? 308 LYS B N     1 
ATOM   8825  C CA    . LYS H 3 305 ? 49.974  -18.481  18.912  1.00 112.24 ? 308 LYS B CA    1 
ATOM   8826  C C     . LYS H 3 305 ? 50.570  -19.869  18.712  1.00 112.39 ? 308 LYS B C     1 
ATOM   8827  O O     . LYS H 3 305 ? 51.545  -20.236  19.370  1.00 117.82 ? 308 LYS B O     1 
ATOM   8828  C CB    . LYS H 3 305 ? 48.972  -18.498  20.066  1.00 116.50 ? 308 LYS B CB    1 
ATOM   8829  C CG    . LYS H 3 305 ? 49.595  -18.777  21.427  1.00 119.96 ? 308 LYS B CG    1 
ATOM   8830  C CD    . LYS H 3 305 ? 49.158  -20.121  21.985  1.00 121.51 ? 308 LYS B CD    1 
ATOM   8831  C CE    . LYS H 3 305 ? 49.808  -20.398  23.332  1.00 123.29 ? 308 LYS B CE    1 
ATOM   8832  N NZ    . LYS H 3 305 ? 49.003  -21.339  24.162  1.00 123.86 ? 308 LYS B NZ    1 
ATOM   8833  N N     . TRP H 3 306 ? 49.983  -20.637  17.802  1.00 109.65 ? 309 TRP B N     1 
ATOM   8834  C CA    . TRP H 3 306 ? 50.508  -21.951  17.466  1.00 104.96 ? 309 TRP B CA    1 
ATOM   8835  C C     . TRP H 3 306 ? 51.798  -21.804  16.663  1.00 100.21 ? 309 TRP B C     1 
ATOM   8836  O O     . TRP H 3 306 ? 52.818  -22.390  17.028  1.00 102.65 ? 309 TRP B O     1 
ATOM   8837  C CB    . TRP H 3 306 ? 49.463  -22.762  16.697  1.00 106.15 ? 309 TRP B CB    1 
ATOM   8838  C CG    . TRP H 3 306 ? 49.897  -24.152  16.369  1.00 105.57 ? 309 TRP B CG    1 
ATOM   8839  C CD1   . TRP H 3 306 ? 49.813  -25.249  17.172  1.00 103.62 ? 309 TRP B CD1   1 
ATOM   8840  C CD2   . TRP H 3 306 ? 50.486  -24.595  15.142  1.00 99.46  ? 309 TRP B CD2   1 
ATOM   8841  N NE1   . TRP H 3 306 ? 50.316  -26.348  16.519  1.00 103.62 ? 309 TRP B NE1   1 
ATOM   8842  C CE2   . TRP H 3 306 ? 50.737  -25.969  15.272  1.00 97.93  ? 309 TRP B CE2   1 
ATOM   8843  C CE3   . TRP H 3 306 ? 50.827  -23.959  13.946  1.00 97.56  ? 309 TRP B CE3   1 
ATOM   8844  C CZ2   . TRP H 3 306 ? 51.313  -26.717  14.256  1.00 98.37  ? 309 TRP B CZ2   1 
ATOM   8845  C CZ3   . TRP H 3 306 ? 51.397  -24.707  12.935  1.00 96.06  ? 309 TRP B CZ3   1 
ATOM   8846  C CH2   . TRP H 3 306 ? 51.634  -26.069  13.095  1.00 95.80  ? 309 TRP B CH2   1 
ATOM   8847  N N     . LEU H 3 307 ? 51.751  -21.015  15.586  1.00 96.04  ? 310 LEU B N     1 
ATOM   8848  C CA    . LEU H 3 307 ? 52.940  -20.729  14.764  1.00 96.95  ? 310 LEU B CA    1 
ATOM   8849  C C     . LEU H 3 307 ? 54.174  -20.456  15.611  1.00 103.80 ? 310 LEU B C     1 
ATOM   8850  O O     . LEU H 3 307 ? 55.240  -21.024  15.381  1.00 106.46 ? 310 LEU B O     1 
ATOM   8851  C CB    . LEU H 3 307 ? 52.723  -19.499  13.874  1.00 95.74  ? 310 LEU B CB    1 
ATOM   8852  C CG    . LEU H 3 307 ? 52.298  -19.641  12.409  1.00 99.94  ? 310 LEU B CG    1 
ATOM   8853  C CD1   . LEU H 3 307 ? 53.085  -20.723  11.683  1.00 103.85 ? 310 LEU B CD1   1 
ATOM   8854  C CD2   . LEU H 3 307 ? 50.805  -19.893  12.305  1.00 104.26 ? 310 LEU B CD2   1 
ATOM   8855  N N     . ASP H 3 308 ? 54.015  -19.566  16.585  1.00 109.93 ? 311 ASP B N     1 
ATOM   8856  C CA    . ASP H 3 308 ? 55.131  -19.110  17.395  1.00 110.86 ? 311 ASP B CA    1 
ATOM   8857  C C     . ASP H 3 308 ? 55.710  -20.255  18.192  1.00 105.71 ? 311 ASP B C     1 
ATOM   8858  O O     . ASP H 3 308 ? 56.918  -20.470  18.164  1.00 110.09 ? 311 ASP B O     1 
ATOM   8859  C CB    . ASP H 3 308 ? 54.705  -17.959  18.317  1.00 117.70 ? 311 ASP B CB    1 
ATOM   8860  C CG    . ASP H 3 308 ? 54.483  -16.648  17.558  1.00 119.54 ? 311 ASP B CG    1 
ATOM   8861  O OD1   . ASP H 3 308 ? 55.309  -16.313  16.677  1.00 118.69 ? 311 ASP B OD1   1 
ATOM   8862  O OD2   . ASP H 3 308 ? 53.488  -15.946  17.848  1.00 117.85 ? 311 ASP B OD2   1 
ATOM   8863  N N     . GLU H 3 309 ? 54.853  -21.000  18.882  1.00 107.51 ? 312 GLU B N     1 
ATOM   8864  C CA    . GLU H 3 309 ? 55.297  -22.186  19.627  1.00 114.81 ? 312 GLU B CA    1 
ATOM   8865  C C     . GLU H 3 309 ? 56.111  -23.119  18.727  1.00 109.16 ? 312 GLU B C     1 
ATOM   8866  O O     . GLU H 3 309 ? 57.196  -23.574  19.102  1.00 104.52 ? 312 GLU B O     1 
ATOM   8867  C CB    . GLU H 3 309 ? 54.098  -22.947  20.198  1.00 121.58 ? 312 GLU B CB    1 
ATOM   8868  C CG    . GLU H 3 309 ? 53.379  -22.239  21.337  1.00 130.19 ? 312 GLU B CG    1 
ATOM   8869  C CD    . GLU H 3 309 ? 52.045  -22.888  21.681  1.00 139.90 ? 312 GLU B CD    1 
ATOM   8870  O OE1   . GLU H 3 309 ? 51.226  -23.111  20.758  1.00 139.34 ? 312 GLU B OE1   1 
ATOM   8871  O OE2   . GLU H 3 309 ? 51.811  -23.172  22.878  1.00 141.65 ? 312 GLU B OE2   1 
ATOM   8872  N N     . TRP H 3 310 ? 55.574  -23.376  17.536  1.00 101.02 ? 313 TRP B N     1 
ATOM   8873  C CA    . TRP H 3 310 ? 56.212  -24.222  16.538  1.00 95.05  ? 313 TRP B CA    1 
ATOM   8874  C C     . TRP H 3 310 ? 57.587  -23.695  16.145  1.00 97.63  ? 313 TRP B C     1 
ATOM   8875  O O     . TRP H 3 310 ? 58.593  -24.341  16.434  1.00 107.33 ? 313 TRP B O     1 
ATOM   8876  C CB    . TRP H 3 310 ? 55.321  -24.331  15.301  1.00 96.15  ? 313 TRP B CB    1 
ATOM   8877  C CG    . TRP H 3 310 ? 55.681  -25.456  14.396  1.00 96.71  ? 313 TRP B CG    1 
ATOM   8878  C CD1   . TRP H 3 310 ? 55.474  -26.775  14.629  1.00 96.11  ? 313 TRP B CD1   1 
ATOM   8879  C CD2   . TRP H 3 310 ? 56.288  -25.365  13.101  1.00 94.87  ? 313 TRP B CD2   1 
ATOM   8880  N NE1   . TRP H 3 310 ? 55.921  -27.515  13.570  1.00 100.26 ? 313 TRP B NE1   1 
ATOM   8881  C CE2   . TRP H 3 310 ? 56.425  -26.675  12.616  1.00 93.94  ? 313 TRP B CE2   1 
ATOM   8882  C CE3   . TRP H 3 310 ? 56.734  -24.304  12.309  1.00 98.18  ? 313 TRP B CE3   1 
ATOM   8883  C CZ2   . TRP H 3 310 ? 56.988  -26.960  11.374  1.00 92.61  ? 313 TRP B CZ2   1 
ATOM   8884  C CZ3   . TRP H 3 310 ? 57.294  -24.590  11.070  1.00 95.12  ? 313 TRP B CZ3   1 
ATOM   8885  C CH2   . TRP H 3 310 ? 57.416  -25.907  10.618  1.00 90.83  ? 313 TRP B CH2   1 
ATOM   8886  N N     . PHE H 3 311 ? 57.632  -22.520  15.512  1.00 95.04  ? 314 PHE B N     1 
ATOM   8887  C CA    . PHE H 3 311 ? 58.889  -21.931  15.029  1.00 95.64  ? 314 PHE B CA    1 
ATOM   8888  C C     . PHE H 3 311 ? 60.003  -21.978  16.073  1.00 102.41 ? 314 PHE B C     1 
ATOM   8889  O O     . PHE H 3 311 ? 61.177  -22.183  15.735  1.00 103.68 ? 314 PHE B O     1 
ATOM   8890  C CB    . PHE H 3 311 ? 58.686  -20.469  14.620  1.00 93.90  ? 314 PHE B CB    1 
ATOM   8891  C CG    . PHE H 3 311 ? 58.054  -20.291  13.273  1.00 91.48  ? 314 PHE B CG    1 
ATOM   8892  C CD1   . PHE H 3 311 ? 58.689  -20.748  12.131  1.00 94.13  ? 314 PHE B CD1   1 
ATOM   8893  C CD2   . PHE H 3 311 ? 56.840  -19.640  13.141  1.00 89.97  ? 314 PHE B CD2   1 
ATOM   8894  C CE1   . PHE H 3 311 ? 58.116  -20.576  10.880  1.00 95.10  ? 314 PHE B CE1   1 
ATOM   8895  C CE2   . PHE H 3 311 ? 56.262  -19.463  11.895  1.00 93.71  ? 314 PHE B CE2   1 
ATOM   8896  C CZ    . PHE H 3 311 ? 56.900  -19.932  10.761  1.00 92.11  ? 314 PHE B CZ    1 
ATOM   8897  N N     . ALA H 3 312 ? 59.623  -21.766  17.332  1.00 105.33 ? 315 ALA B N     1 
ATOM   8898  C CA    . ALA H 3 312 ? 60.559  -21.764  18.451  1.00 110.09 ? 315 ALA B CA    1 
ATOM   8899  C C     . ALA H 3 312 ? 61.137  -23.148  18.701  1.00 108.91 ? 315 ALA B C     1 
ATOM   8900  O O     . ALA H 3 312 ? 62.358  -23.314  18.756  1.00 113.04 ? 315 ALA B O     1 
ATOM   8901  C CB    . ALA H 3 312 ? 59.871  -21.253  19.710  1.00 114.46 ? 315 ALA B CB    1 
ATOM   8902  N N     . ALA H 3 313 ? 60.256  -24.134  18.854  1.00 104.31 ? 316 ALA B N     1 
ATOM   8903  C CA    . ALA H 3 313 ? 60.666  -25.514  19.122  1.00 104.80 ? 316 ALA B CA    1 
ATOM   8904  C C     . ALA H 3 313 ? 61.783  -25.968  18.184  1.00 102.65 ? 316 ALA B C     1 
ATOM   8905  O O     . ALA H 3 313 ? 62.753  -26.591  18.615  1.00 104.39 ? 316 ALA B O     1 
ATOM   8906  C CB    . ALA H 3 313 ? 59.474  -26.450  19.004  1.00 105.76 ? 316 ALA B CB    1 
ATOM   8907  N N     . LYS H 3 314 ? 61.643  -25.634  16.906  1.00 98.27  ? 317 LYS B N     1 
ATOM   8908  C CA    . LYS H 3 314 ? 62.614  -26.017  15.887  1.00 98.77  ? 317 LYS B CA    1 
ATOM   8909  C C     . LYS H 3 314 ? 64.023  -25.514  16.188  1.00 99.30  ? 317 LYS B C     1 
ATOM   8910  O O     . LYS H 3 314 ? 64.223  -24.322  16.401  1.00 108.75 ? 317 LYS B O     1 
ATOM   8911  C CB    . LYS H 3 314 ? 62.183  -25.445  14.548  1.00 99.06  ? 317 LYS B CB    1 
ATOM   8912  C CG    . LYS H 3 314 ? 60.860  -25.982  14.045  1.00 103.68 ? 317 LYS B CG    1 
ATOM   8913  C CD    . LYS H 3 314 ? 60.973  -27.449  13.675  1.00 106.74 ? 317 LYS B CD    1 
ATOM   8914  C CE    . LYS H 3 314 ? 60.075  -27.780  12.499  1.00 106.33 ? 317 LYS B CE    1 
ATOM   8915  N NZ    . LYS H 3 314 ? 60.491  -29.046  11.850  1.00 108.51 ? 317 LYS B NZ    1 
ATOM   8916  N N     . ASP H 3 315 ? 64.995  -26.420  16.192  1.00 102.39 ? 318 ASP B N     1 
ATOM   8917  C CA    . ASP H 3 315 ? 66.394  -26.037  16.363  1.00 108.45 ? 318 ASP B CA    1 
ATOM   8918  C C     . ASP H 3 315 ? 66.881  -25.324  15.119  1.00 107.23 ? 318 ASP B C     1 
ATOM   8919  O O     . ASP H 3 315 ? 66.342  -25.521  14.033  1.00 96.47  ? 318 ASP B O     1 
ATOM   8920  C CB    . ASP H 3 315 ? 67.294  -27.254  16.604  1.00 115.58 ? 318 ASP B CB    1 
ATOM   8921  C CG    . ASP H 3 315 ? 66.977  -27.974  17.891  1.00 122.24 ? 318 ASP B CG    1 
ATOM   8922  O OD1   . ASP H 3 315 ? 65.827  -27.872  18.365  1.00 130.59 ? 318 ASP B OD1   1 
ATOM   8923  O OD2   . ASP H 3 315 ? 67.883  -28.651  18.424  1.00 130.55 ? 318 ASP B OD2   1 
ATOM   8924  N N     . ASP H 3 316 ? 67.919  -24.510  15.289  1.00 113.02 ? 319 ASP B N     1 
ATOM   8925  C CA    . ASP H 3 316 ? 68.540  -23.803  14.176  1.00 112.24 ? 319 ASP B CA    1 
ATOM   8926  C C     . ASP H 3 316 ? 68.918  -24.767  13.061  1.00 108.26 ? 319 ASP B C     1 
ATOM   8927  O O     . ASP H 3 316 ? 68.696  -24.476  11.882  1.00 100.46 ? 319 ASP B O     1 
ATOM   8928  C CB    . ASP H 3 316 ? 69.789  -23.045  14.646  1.00 114.82 ? 319 ASP B CB    1 
ATOM   8929  C CG    . ASP H 3 316 ? 69.459  -21.867  15.544  1.00 117.84 ? 319 ASP B CG    1 
ATOM   8930  O OD1   . ASP H 3 316 ? 68.370  -21.269  15.387  1.00 118.09 ? 319 ASP B OD1   1 
ATOM   8931  O OD2   . ASP H 3 316 ? 70.299  -21.533  16.404  1.00 121.59 ? 319 ASP B OD2   1 
ATOM   8932  N N     . GLU H 3 317 ? 69.463  -25.923  13.436  1.00 108.15 ? 320 GLU B N     1 
ATOM   8933  C CA    . GLU H 3 317 ? 70.008  -26.851  12.449  1.00 108.77 ? 320 GLU B CA    1 
ATOM   8934  C C     . GLU H 3 317 ? 68.917  -27.458  11.547  1.00 98.56  ? 320 GLU B C     1 
ATOM   8935  O O     . GLU H 3 317 ? 69.197  -27.822  10.404  1.00 97.27  ? 320 GLU B O     1 
ATOM   8936  C CB    . GLU H 3 317 ? 70.919  -27.903  13.116  1.00 117.76 ? 320 GLU B CB    1 
ATOM   8937  C CG    . GLU H 3 317 ? 70.253  -29.158  13.665  1.00 126.67 ? 320 GLU B CG    1 
ATOM   8938  C CD    . GLU H 3 317 ? 70.273  -30.328  12.684  1.00 132.46 ? 320 GLU B CD    1 
ATOM   8939  O OE1   . GLU H 3 317 ? 71.362  -30.668  12.166  1.00 134.69 ? 320 GLU B OE1   1 
ATOM   8940  O OE2   . GLU H 3 317 ? 69.200  -30.920  12.434  1.00 132.07 ? 320 GLU B OE2   1 
ATOM   8941  N N     . PHE H 3 318 ? 67.677  -27.535  12.030  1.00 87.60  ? 321 PHE B N     1 
ATOM   8942  C CA    . PHE H 3 318 ? 66.573  -27.946  11.159  1.00 82.04  ? 321 PHE B CA    1 
ATOM   8943  C C     . PHE H 3 318 ? 66.535  -27.099  9.896   1.00 81.20  ? 321 PHE B C     1 
ATOM   8944  O O     . PHE H 3 318 ? 66.512  -27.641  8.792   1.00 85.49  ? 321 PHE B O     1 
ATOM   8945  C CB    . PHE H 3 318 ? 65.225  -27.838  11.861  1.00 82.80  ? 321 PHE B CB    1 
ATOM   8946  C CG    . PHE H 3 318 ? 64.053  -27.886  10.920  1.00 84.98  ? 321 PHE B CG    1 
ATOM   8947  C CD1   . PHE H 3 318 ? 63.827  -28.995  10.132  1.00 89.18  ? 321 PHE B CD1   1 
ATOM   8948  C CD2   . PHE H 3 318 ? 63.180  -26.822  10.821  1.00 87.77  ? 321 PHE B CD2   1 
ATOM   8949  C CE1   . PHE H 3 318 ? 62.746  -29.048  9.268   1.00 92.68  ? 321 PHE B CE1   1 
ATOM   8950  C CE2   . PHE H 3 318 ? 62.103  -26.863  9.956   1.00 90.28  ? 321 PHE B CE2   1 
ATOM   8951  C CZ    . PHE H 3 318 ? 61.885  -27.976  9.175   1.00 93.00  ? 321 PHE B CZ    1 
ATOM   8952  N N     . TYR H 3 319 ? 66.538  -25.775  10.067  1.00 76.28  ? 322 TYR B N     1 
ATOM   8953  C CA    . TYR H 3 319 ? 66.481  -24.847  8.936   1.00 73.55  ? 322 TYR B CA    1 
ATOM   8954  C C     . TYR H 3 319 ? 67.771  -24.930  8.119   1.00 76.93  ? 322 TYR B C     1 
ATOM   8955  O O     . TYR H 3 319 ? 67.731  -24.945  6.886   1.00 75.32  ? 322 TYR B O     1 
ATOM   8956  C CB    . TYR H 3 319 ? 66.247  -23.404  9.402   1.00 73.31  ? 322 TYR B CB    1 
ATOM   8957  C CG    . TYR H 3 319 ? 65.009  -23.186  10.262  1.00 69.05  ? 322 TYR B CG    1 
ATOM   8958  C CD1   . TYR H 3 319 ? 63.772  -22.896  9.692   1.00 66.18  ? 322 TYR B CD1   1 
ATOM   8959  C CD2   . TYR H 3 319 ? 65.087  -23.258  11.647  1.00 67.88  ? 322 TYR B CD2   1 
ATOM   8960  C CE1   . TYR H 3 319 ? 62.646  -22.706  10.481  1.00 64.72  ? 322 TYR B CE1   1 
ATOM   8961  C CE2   . TYR H 3 319 ? 63.974  -23.059  12.442  1.00 68.17  ? 322 TYR B CE2   1 
ATOM   8962  C CZ    . TYR H 3 319 ? 62.757  -22.785  11.859  1.00 67.99  ? 322 TYR B CZ    1 
ATOM   8963  O OH    . TYR H 3 319 ? 61.662  -22.587  12.677  1.00 75.04  ? 322 TYR B OH    1 
ATOM   8964  N N     . TRP H 3 320 ? 68.911  -24.994  8.812   1.00 81.17  ? 323 TRP B N     1 
ATOM   8965  C CA    . TRP H 3 320 ? 70.214  -25.217  8.170   1.00 85.88  ? 323 TRP B CA    1 
ATOM   8966  C C     . TRP H 3 320 ? 70.113  -26.382  7.192   1.00 88.69  ? 323 TRP B C     1 
ATOM   8967  O O     . TRP H 3 320 ? 70.513  -26.281  6.027   1.00 88.49  ? 323 TRP B O     1 
ATOM   8968  C CB    . TRP H 3 320 ? 71.302  -25.515  9.223   1.00 90.48  ? 323 TRP B CB    1 
ATOM   8969  C CG    . TRP H 3 320 ? 72.717  -25.501  8.683   1.00 96.88  ? 323 TRP B CG    1 
ATOM   8970  C CD1   . TRP H 3 320 ? 73.580  -24.445  8.680   1.00 99.97  ? 323 TRP B CD1   1 
ATOM   8971  C CD2   . TRP H 3 320 ? 73.421  -26.591  8.076   1.00 102.74 ? 323 TRP B CD2   1 
ATOM   8972  N NE1   . TRP H 3 320 ? 74.771  -24.803  8.104   1.00 100.24 ? 323 TRP B NE1   1 
ATOM   8973  C CE2   . TRP H 3 320 ? 74.704  -26.115  7.726   1.00 101.80 ? 323 TRP B CE2   1 
ATOM   8974  C CE3   . TRP H 3 320 ? 73.092  -27.921  7.790   1.00 105.41 ? 323 TRP B CE3   1 
ATOM   8975  C CZ2   . TRP H 3 320 ? 75.658  -26.918  7.100   1.00 104.92 ? 323 TRP B CZ2   1 
ATOM   8976  C CZ3   . TRP H 3 320 ? 74.045  -28.723  7.170   1.00 110.54 ? 323 TRP B CZ3   1 
ATOM   8977  C CH2   . TRP H 3 320 ? 75.313  -28.216  6.832   1.00 110.39 ? 323 TRP B CH2   1 
ATOM   8978  N N     . ARG H 3 321 ? 69.544  -27.481  7.675   1.00 88.72  ? 324 ARG B N     1 
ATOM   8979  C CA    . ARG H 3 321 ? 69.477  -28.707  6.900   1.00 89.21  ? 324 ARG B CA    1 
ATOM   8980  C C     . ARG H 3 321 ? 68.659  -28.489  5.637   1.00 84.73  ? 324 ARG B C     1 
ATOM   8981  O O     . ARG H 3 321 ? 69.095  -28.847  4.539   1.00 81.86  ? 324 ARG B O     1 
ATOM   8982  C CB    . ARG H 3 321 ? 68.892  -29.839  7.746   1.00 92.90  ? 324 ARG B CB    1 
ATOM   8983  C CG    . ARG H 3 321 ? 69.700  -31.127  7.687   1.00 97.36  ? 324 ARG B CG    1 
ATOM   8984  C CD    . ARG H 3 321 ? 69.582  -31.976  8.953   1.00 98.39  ? 324 ARG B CD    1 
ATOM   8985  N NE    . ARG H 3 321 ? 68.321  -31.827  9.692   1.00 99.07  ? 324 ARG B NE    1 
ATOM   8986  C CZ    . ARG H 3 321 ? 67.115  -32.206  9.257   1.00 100.72 ? 324 ARG B CZ    1 
ATOM   8987  N NH1   . ARG H 3 321 ? 66.952  -32.746  8.049   1.00 96.33  ? 324 ARG B NH1   1 
ATOM   8988  N NH2   . ARG H 3 321 ? 66.051  -32.023  10.038  1.00 98.54  ? 324 ARG B NH2   1 
ATOM   8989  N N     . GLY H 3 322 ? 67.491  -27.874  5.803   1.00 80.63  ? 325 GLY B N     1 
ATOM   8990  C CA    . GLY H 3 322 ? 66.629  -27.521  4.680   1.00 79.98  ? 325 GLY B CA    1 
ATOM   8991  C C     . GLY H 3 322 ? 67.337  -26.773  3.563   1.00 79.94  ? 325 GLY B C     1 
ATOM   8992  O O     . GLY H 3 322 ? 67.096  -27.047  2.383   1.00 75.90  ? 325 GLY B O     1 
ATOM   8993  N N     . ILE H 3 323 ? 68.204  -25.827  3.925   1.00 79.21  ? 326 ILE B N     1 
ATOM   8994  C CA    . ILE H 3 323 ? 68.905  -25.019  2.922   1.00 85.70  ? 326 ILE B CA    1 
ATOM   8995  C C     . ILE H 3 323 ? 70.013  -25.838  2.265   1.00 88.25  ? 326 ILE B C     1 
ATOM   8996  O O     . ILE H 3 323 ? 70.171  -25.817  1.042   1.00 83.75  ? 326 ILE B O     1 
ATOM   8997  C CB    . ILE H 3 323 ? 69.492  -23.706  3.508   1.00 84.06  ? 326 ILE B CB    1 
ATOM   8998  C CG1   . ILE H 3 323 ? 68.390  -22.824  4.112   1.00 84.38  ? 326 ILE B CG1   1 
ATOM   8999  C CG2   . ILE H 3 323 ? 70.224  -22.913  2.431   1.00 80.83  ? 326 ILE B CG2   1 
ATOM   9000  C CD1   . ILE H 3 323 ? 67.387  -22.282  3.110   1.00 82.62  ? 326 ILE B CD1   1 
ATOM   9001  N N     . HIS H 3 324 ? 70.762  -26.577  3.078   1.00 91.10  ? 327 HIS B N     1 
ATOM   9002  C CA    . HIS H 3 324 ? 71.871  -27.376  2.564   1.00 93.25  ? 327 HIS B CA    1 
ATOM   9003  C C     . HIS H 3 324 ? 71.435  -28.657  1.837   1.00 90.57  ? 327 HIS B C     1 
ATOM   9004  O O     . HIS H 3 324 ? 72.276  -29.459  1.445   1.00 94.08  ? 327 HIS B O     1 
ATOM   9005  C CB    . HIS H 3 324 ? 72.856  -27.691  3.688   1.00 95.84  ? 327 HIS B CB    1 
ATOM   9006  C CG    . HIS H 3 324 ? 73.732  -26.535  4.054   1.00 98.15  ? 327 HIS B CG    1 
ATOM   9007  N ND1   . HIS H 3 324 ? 74.916  -26.264  3.402   1.00 99.81  ? 327 HIS B ND1   1 
ATOM   9008  C CD2   . HIS H 3 324 ? 73.590  -25.573  4.993   1.00 96.55  ? 327 HIS B CD2   1 
ATOM   9009  C CE1   . HIS H 3 324 ? 75.472  -25.193  3.935   1.00 99.60  ? 327 HIS B CE1   1 
ATOM   9010  N NE2   . HIS H 3 324 ? 74.689  -24.757  4.905   1.00 98.84  ? 327 HIS B NE2   1 
ATOM   9011  N N     . LYS H 3 325 ? 70.133  -28.849  1.654   1.00 86.28  ? 328 LYS B N     1 
ATOM   9012  C CA    . LYS H 3 325 ? 69.643  -29.889  0.768   1.00 83.79  ? 328 LYS B CA    1 
ATOM   9013  C C     . LYS H 3 325 ? 69.597  -29.431  -0.680  1.00 81.92  ? 328 LYS B C     1 
ATOM   9014  O O     . LYS H 3 325 ? 69.514  -30.255  -1.570  1.00 87.67  ? 328 LYS B O     1 
ATOM   9015  C CB    . LYS H 3 325 ? 68.252  -30.344  1.182   1.00 86.21  ? 328 LYS B CB    1 
ATOM   9016  C CG    . LYS H 3 325 ? 68.232  -31.200  2.432   1.00 92.33  ? 328 LYS B CG    1 
ATOM   9017  C CD    . LYS H 3 325 ? 66.858  -31.823  2.624   1.00 97.67  ? 328 LYS B CD    1 
ATOM   9018  C CE    . LYS H 3 325 ? 66.543  -32.073  4.090   1.00 98.60  ? 328 LYS B CE    1 
ATOM   9019  N NZ    . LYS H 3 325 ? 65.131  -32.504  4.277   1.00 100.82 ? 328 LYS B NZ    1 
ATOM   9020  N N     . LEU H 3 326 ? 69.639  -28.131  -0.935  1.00 83.04  ? 329 LEU B N     1 
ATOM   9021  C CA    . LEU H 3 326 ? 69.560  -27.652  -2.317  1.00 90.35  ? 329 LEU B CA    1 
ATOM   9022  C C     . LEU H 3 326 ? 70.521  -28.372  -3.284  1.00 90.61  ? 329 LEU B C     1 
ATOM   9023  O O     . LEU H 3 326 ? 70.126  -28.712  -4.399  1.00 93.68  ? 329 LEU B O     1 
ATOM   9024  C CB    . LEU H 3 326 ? 69.798  -26.132  -2.416  1.00 97.18  ? 329 LEU B CB    1 
ATOM   9025  C CG    . LEU H 3 326 ? 68.639  -25.116  -2.439  1.00 98.12  ? 329 LEU B CG    1 
ATOM   9026  C CD1   . LEU H 3 326 ? 67.333  -25.690  -2.963  1.00 101.20 ? 329 LEU B CD1   1 
ATOM   9027  C CD2   . LEU H 3 326 ? 68.411  -24.498  -1.072  1.00 99.88  ? 329 LEU B CD2   1 
ATOM   9028  N N     . PRO H 3 327 ? 71.784  -28.593  -2.876  1.00 89.25  ? 330 PRO B N     1 
ATOM   9029  C CA    . PRO H 3 327 ? 72.732  -29.179  -3.828  1.00 88.74  ? 330 PRO B CA    1 
ATOM   9030  C C     . PRO H 3 327 ? 72.327  -30.564  -4.321  1.00 88.67  ? 330 PRO B C     1 
ATOM   9031  O O     . PRO H 3 327 ? 72.318  -30.813  -5.525  1.00 84.67  ? 330 PRO B O     1 
ATOM   9032  C CB    . PRO H 3 327 ? 74.039  -29.253  -3.028  1.00 90.71  ? 330 PRO B CB    1 
ATOM   9033  C CG    . PRO H 3 327 ? 73.889  -28.237  -1.950  1.00 92.59  ? 330 PRO B CG    1 
ATOM   9034  C CD    . PRO H 3 327 ? 72.433  -28.247  -1.601  1.00 91.61  ? 330 PRO B CD    1 
ATOM   9035  N N     . GLU H 3 328 ? 71.985  -31.452  -3.396  1.00 91.47  ? 331 GLU B N     1 
ATOM   9036  C CA    . GLU H 3 328 ? 71.628  -32.817  -3.764  1.00 94.08  ? 331 GLU B CA    1 
ATOM   9037  C C     . GLU H 3 328 ? 70.365  -32.841  -4.622  1.00 89.33  ? 331 GLU B C     1 
ATOM   9038  O O     . GLU H 3 328 ? 70.266  -33.630  -5.559  1.00 97.58  ? 331 GLU B O     1 
ATOM   9039  C CB    . GLU H 3 328 ? 71.466  -33.693  -2.519  1.00 97.93  ? 331 GLU B CB    1 
ATOM   9040  C CG    . GLU H 3 328 ? 70.139  -33.540  -1.798  1.00 102.53 ? 331 GLU B CG    1 
ATOM   9041  C CD    . GLU H 3 328 ? 70.194  -34.001  -0.358  1.00 109.34 ? 331 GLU B CD    1 
ATOM   9042  O OE1   . GLU H 3 328 ? 71.177  -33.668  0.337   1.00 113.86 ? 331 GLU B OE1   1 
ATOM   9043  O OE2   . GLU H 3 328 ? 69.245  -34.683  0.081   1.00 118.07 ? 331 GLU B OE2   1 
ATOM   9044  N N     . ARG H 3 329 ? 69.415  -31.967  -4.310  1.00 82.38  ? 332 ARG B N     1 
ATOM   9045  C CA    . ARG H 3 329 ? 68.210  -31.829  -5.113  1.00 81.64  ? 332 ARG B CA    1 
ATOM   9046  C C     . ARG H 3 329 ? 68.521  -31.309  -6.520  1.00 84.39  ? 332 ARG B C     1 
ATOM   9047  O O     . ARG H 3 329 ? 67.872  -31.714  -7.480  1.00 82.31  ? 332 ARG B O     1 
ATOM   9048  C CB    . ARG H 3 329 ? 67.221  -30.889  -4.438  1.00 80.78  ? 332 ARG B CB    1 
ATOM   9049  C CG    . ARG H 3 329 ? 66.711  -31.375  -3.093  1.00 79.61  ? 332 ARG B CG    1 
ATOM   9050  C CD    . ARG H 3 329 ? 65.260  -30.978  -2.914  1.00 77.62  ? 332 ARG B CD    1 
ATOM   9051  N NE    . ARG H 3 329 ? 64.628  -31.668  -1.800  1.00 73.95  ? 332 ARG B NE    1 
ATOM   9052  C CZ    . ARG H 3 329 ? 63.360  -32.068  -1.781  1.00 76.93  ? 332 ARG B CZ    1 
ATOM   9053  N NH1   . ARG H 3 329 ? 62.555  -31.866  -2.820  1.00 76.71  ? 332 ARG B NH1   1 
ATOM   9054  N NH2   . ARG H 3 329 ? 62.888  -32.692  -0.710  1.00 79.81  ? 332 ARG B NH2   1 
ATOM   9055  N N     . TRP H 3 330 ? 69.496  -30.407  -6.645  1.00 88.84  ? 333 TRP B N     1 
ATOM   9056  C CA    . TRP H 3 330 ? 69.930  -29.944  -7.967  1.00 91.93  ? 333 TRP B CA    1 
ATOM   9057  C C     . TRP H 3 330 ? 70.577  -31.093  -8.743  1.00 94.95  ? 333 TRP B C     1 
ATOM   9058  O O     . TRP H 3 330 ? 70.338  -31.247  -9.942  1.00 92.24  ? 333 TRP B O     1 
ATOM   9059  C CB    . TRP H 3 330 ? 70.900  -28.754  -7.875  1.00 91.64  ? 333 TRP B CB    1 
ATOM   9060  C CG    . TRP H 3 330 ? 70.303  -27.498  -7.315  1.00 89.10  ? 333 TRP B CG    1 
ATOM   9061  C CD1   . TRP H 3 330 ? 69.018  -27.074  -7.444  1.00 89.13  ? 333 TRP B CD1   1 
ATOM   9062  C CD2   . TRP H 3 330 ? 70.984  -26.486  -6.558  1.00 90.44  ? 333 TRP B CD2   1 
ATOM   9063  N NE1   . TRP H 3 330 ? 68.846  -25.876  -6.794  1.00 90.93  ? 333 TRP B NE1   1 
ATOM   9064  C CE2   . TRP H 3 330 ? 70.040  -25.492  -6.247  1.00 89.26  ? 333 TRP B CE2   1 
ATOM   9065  C CE3   . TRP H 3 330 ? 72.301  -26.331  -6.105  1.00 91.50  ? 333 TRP B CE3   1 
ATOM   9066  C CZ2   . TRP H 3 330 ? 70.368  -24.358  -5.507  1.00 90.67  ? 333 TRP B CZ2   1 
ATOM   9067  C CZ3   . TRP H 3 330 ? 72.624  -25.206  -5.367  1.00 88.90  ? 333 TRP B CZ3   1 
ATOM   9068  C CH2   . TRP H 3 330 ? 71.662  -24.235  -5.075  1.00 90.32  ? 333 TRP B CH2   1 
ATOM   9069  N N     . GLU H 3 331 ? 71.384  -31.897  -8.051  1.00 100.81 ? 334 GLU B N     1 
ATOM   9070  C CA    . GLU H 3 331 ? 72.015  -33.077  -8.656  1.00 105.14 ? 334 GLU B CA    1 
ATOM   9071  C C     . GLU H 3 331 ? 70.994  -34.078  -9.206  1.00 102.09 ? 334 GLU B C     1 
ATOM   9072  O O     . GLU H 3 331 ? 71.254  -34.734  -10.213 1.00 108.21 ? 334 GLU B O     1 
ATOM   9073  C CB    . GLU H 3 331 ? 72.956  -33.767  -7.661  1.00 109.74 ? 334 GLU B CB    1 
ATOM   9074  C CG    . GLU H 3 331 ? 74.332  -33.119  -7.580  1.00 119.38 ? 334 GLU B CG    1 
ATOM   9075  C CD    . GLU H 3 331 ? 75.203  -33.669  -6.457  1.00 127.25 ? 334 GLU B CD    1 
ATOM   9076  O OE1   . GLU H 3 331 ? 74.740  -34.541  -5.686  1.00 132.06 ? 334 GLU B OE1   1 
ATOM   9077  O OE2   . GLU H 3 331 ? 76.365  -33.224  -6.343  1.00 127.37 ? 334 GLU B OE2   1 
ATOM   9078  N N     . LYS H 3 332 ? 69.839  -34.186  -8.556  1.00 92.43  ? 335 LYS B N     1 
ATOM   9079  C CA    . LYS H 3 332 ? 68.761  -35.034  -9.050  1.00 92.07  ? 335 LYS B CA    1 
ATOM   9080  C C     . LYS H 3 332 ? 67.974  -34.344  -10.159 1.00 96.71  ? 335 LYS B C     1 
ATOM   9081  O O     . LYS H 3 332 ? 67.626  -34.969  -11.156 1.00 106.94 ? 335 LYS B O     1 
ATOM   9082  C CB    . LYS H 3 332 ? 67.815  -35.406  -7.917  1.00 92.13  ? 335 LYS B CB    1 
ATOM   9083  C CG    . LYS H 3 332 ? 68.474  -36.190  -6.800  1.00 93.39  ? 335 LYS B CG    1 
ATOM   9084  C CD    . LYS H 3 332 ? 67.486  -36.454  -5.678  1.00 95.96  ? 335 LYS B CD    1 
ATOM   9085  C CE    . LYS H 3 332 ? 68.189  -36.986  -4.440  1.00 100.74 ? 335 LYS B CE    1 
ATOM   9086  N NZ    . LYS H 3 332 ? 67.263  -37.099  -3.278  1.00 101.85 ? 335 LYS B NZ    1 
ATOM   9087  N N     . CYS H 3 333 ? 67.676  -33.063  -9.966  1.00 103.58 ? 336 CYS B N     1 
ATOM   9088  C CA    . CYS H 3 333 ? 66.964  -32.255  -10.963 1.00 111.32 ? 336 CYS B CA    1 
ATOM   9089  C C     . CYS H 3 333 ? 67.621  -32.406  -12.329 1.00 112.10 ? 336 CYS B C     1 
ATOM   9090  O O     . CYS H 3 333 ? 66.943  -32.685  -13.324 1.00 110.08 ? 336 CYS B O     1 
ATOM   9091  C CB    . CYS H 3 333 ? 66.933  -30.783  -10.507 1.00 120.34 ? 336 CYS B CB    1 
ATOM   9092  S SG    . CYS H 3 333 ? 66.655  -29.484  -11.746 1.00 134.36 ? 336 CYS B SG    1 
ATOM   9093  N N     . VAL H 3 334 ? 68.945  -32.246  -12.360 1.00 113.53 ? 337 VAL B N     1 
ATOM   9094  C CA    . VAL H 3 334 ? 69.719  -32.410  -13.592 1.00 115.46 ? 337 VAL B CA    1 
ATOM   9095  C C     . VAL H 3 334 ? 69.734  -33.867  -14.038 1.00 116.26 ? 337 VAL B C     1 
ATOM   9096  O O     . VAL H 3 334 ? 69.363  -34.169  -15.175 1.00 121.61 ? 337 VAL B O     1 
ATOM   9097  C CB    . VAL H 3 334 ? 71.168  -31.851  -13.485 1.00 117.42 ? 337 VAL B CB    1 
ATOM   9098  C CG1   . VAL H 3 334 ? 71.970  -32.509  -12.370 1.00 116.51 ? 337 VAL B CG1   1 
ATOM   9099  C CG2   . VAL H 3 334 ? 71.906  -32.001  -14.812 1.00 119.72 ? 337 VAL B CG2   1 
ATOM   9100  N N     . ALA H 3 335 ? 70.126  -34.766  -13.138 1.00 112.74 ? 338 ALA B N     1 
ATOM   9101  C CA    . ALA H 3 335 ? 70.244  -36.184  -13.467 1.00 107.82 ? 338 ALA B CA    1 
ATOM   9102  C C     . ALA H 3 335 ? 68.972  -36.699  -14.129 1.00 112.61 ? 338 ALA B C     1 
ATOM   9103  O O     . ALA H 3 335 ? 69.038  -37.459  -15.092 1.00 127.83 ? 338 ALA B O     1 
ATOM   9104  C CB    . ALA H 3 335 ? 70.556  -36.994  -12.222 1.00 104.70 ? 338 ALA B CB    1 
ATOM   9105  N N     . SER H 3 336 ? 67.818  -36.253  -13.635 1.00 112.85 ? 339 SER B N     1 
ATOM   9106  C CA    . SER H 3 336 ? 66.525  -36.662  -14.186 1.00 114.15 ? 339 SER B CA    1 
ATOM   9107  C C     . SER H 3 336 ? 66.179  -35.965  -15.505 1.00 115.22 ? 339 SER B C     1 
ATOM   9108  O O     . SER H 3 336 ? 65.065  -36.118  -16.009 1.00 122.07 ? 339 SER B O     1 
ATOM   9109  C CB    . SER H 3 336 ? 65.412  -36.394  -13.169 1.00 114.41 ? 339 SER B CB    1 
ATOM   9110  O OG    . SER H 3 336 ? 65.790  -36.834  -11.877 1.00 116.23 ? 339 SER B OG    1 
ATOM   9111  N N     . ASP H 3 337 ? 67.126  -35.209  -16.057 1.00 111.11 ? 340 ASP B N     1 
ATOM   9112  C CA    . ASP H 3 337 ? 66.928  -34.465  -17.301 1.00 113.47 ? 340 ASP B CA    1 
ATOM   9113  C C     . ASP H 3 337 ? 65.697  -33.565  -17.251 1.00 108.33 ? 340 ASP B C     1 
ATOM   9114  O O     . ASP H 3 337 ? 64.952  -33.448  -18.231 1.00 102.27 ? 340 ASP B O     1 
ATOM   9115  C CB    . ASP H 3 337 ? 66.884  -35.407  -18.513 1.00 117.14 ? 340 ASP B CB    1 
ATOM   9116  C CG    . ASP H 3 337 ? 68.247  -36.006  -18.838 1.00 123.59 ? 340 ASP B CG    1 
ATOM   9117  O OD1   . ASP H 3 337 ? 69.259  -35.266  -18.818 1.00 115.87 ? 340 ASP B OD1   1 
ATOM   9118  O OD2   . ASP H 3 337 ? 68.304  -37.222  -19.123 1.00 132.75 ? 340 ASP B OD2   1 
ATOM   9119  N N     . GLY H 3 338 ? 65.501  -32.932  -16.095 1.00 109.06 ? 341 GLY B N     1 
ATOM   9120  C CA    . GLY H 3 338 ? 64.463  -31.922  -15.926 1.00 115.45 ? 341 GLY B CA    1 
ATOM   9121  C C     . GLY H 3 338 ? 63.167  -32.410  -15.309 1.00 117.51 ? 341 GLY B C     1 
ATOM   9122  O O     . GLY H 3 338 ? 62.368  -31.603  -14.832 1.00 119.37 ? 341 GLY B O     1 
ATOM   9123  N N     . LYS H 3 339 ? 62.940  -33.720  -15.327 1.00 120.61 ? 342 LYS B N     1 
ATOM   9124  C CA    . LYS H 3 339 ? 61.718  -34.281  -14.763 1.00 122.66 ? 342 LYS B CA    1 
ATOM   9125  C C     . LYS H 3 339 ? 61.733  -34.123  -13.255 1.00 117.37 ? 342 LYS B C     1 
ATOM   9126  O O     . LYS H 3 339 ? 62.768  -33.795  -12.665 1.00 113.58 ? 342 LYS B O     1 
ATOM   9127  C CB    . LYS H 3 339 ? 61.593  -35.766  -15.101 1.00 128.39 ? 342 LYS B CB    1 
ATOM   9128  C CG    . LYS H 3 339 ? 61.402  -36.073  -16.573 1.00 131.30 ? 342 LYS B CG    1 
ATOM   9129  C CD    . LYS H 3 339 ? 61.384  -37.576  -16.796 1.00 135.24 ? 342 LYS B CD    1 
ATOM   9130  C CE    . LYS H 3 339 ? 60.896  -37.938  -18.188 1.00 138.92 ? 342 LYS B CE    1 
ATOM   9131  N NZ    . LYS H 3 339 ? 61.830  -37.474  -19.250 1.00 141.97 ? 342 LYS B NZ    1 
ATOM   9132  N N     . TYR H 3 340 ? 60.584  -34.366  -12.631 1.00 111.07 ? 343 TYR B N     1 
ATOM   9133  C CA    . TYR H 3 340 ? 60.533  -34.469  -11.179 1.00 108.38 ? 343 TYR B CA    1 
ATOM   9134  C C     . TYR H 3 340 ? 61.275  -35.736  -10.768 1.00 108.14 ? 343 TYR B C     1 
ATOM   9135  O O     . TYR H 3 340 ? 61.329  -36.703  -11.526 1.00 108.73 ? 343 TYR B O     1 
ATOM   9136  C CB    . TYR H 3 340 ? 59.089  -34.506  -10.673 1.00 104.34 ? 343 TYR B CB    1 
ATOM   9137  C CG    . TYR H 3 340 ? 58.297  -33.247  -10.978 1.00 101.70 ? 343 TYR B CG    1 
ATOM   9138  C CD1   . TYR H 3 340 ? 58.413  -32.110  -10.182 1.00 98.90  ? 343 TYR B CD1   1 
ATOM   9139  C CD2   . TYR H 3 340 ? 57.433  -33.197  -12.060 1.00 100.92 ? 343 TYR B CD2   1 
ATOM   9140  C CE1   . TYR H 3 340 ? 57.689  -30.963  -10.461 1.00 98.60  ? 343 TYR B CE1   1 
ATOM   9141  C CE2   . TYR H 3 340 ? 56.706  -32.056  -12.342 1.00 100.26 ? 343 TYR B CE2   1 
ATOM   9142  C CZ    . TYR H 3 340 ? 56.834  -30.942  -11.544 1.00 98.95  ? 343 TYR B CZ    1 
ATOM   9143  O OH    . TYR H 3 340 ? 56.106  -29.811  -11.845 1.00 94.11  ? 343 TYR B OH    1 
ATOM   9144  N N     . PHE H 3 341 ? 61.860  -35.708  -9.577  1.00 111.68 ? 344 PHE B N     1 
ATOM   9145  C CA    . PHE H 3 341 ? 62.577  -36.856  -9.021  1.00 112.49 ? 344 PHE B CA    1 
ATOM   9146  C C     . PHE H 3 341 ? 61.828  -37.313  -7.775  1.00 117.92 ? 344 PHE B C     1 
ATOM   9147  O O     . PHE H 3 341 ? 60.761  -36.783  -7.474  1.00 124.44 ? 344 PHE B O     1 
ATOM   9148  C CB    . PHE H 3 341 ? 64.028  -36.480  -8.705  1.00 112.61 ? 344 PHE B CB    1 
ATOM   9149  C CG    . PHE H 3 341 ? 64.173  -35.167  -7.995  1.00 113.04 ? 344 PHE B CG    1 
ATOM   9150  C CD1   . PHE H 3 341 ? 63.997  -35.080  -6.623  1.00 113.71 ? 344 PHE B CD1   1 
ATOM   9151  C CD2   . PHE H 3 341 ? 64.472  -34.013  -8.704  1.00 113.62 ? 344 PHE B CD2   1 
ATOM   9152  C CE1   . PHE H 3 341 ? 64.121  -33.865  -5.968  1.00 113.88 ? 344 PHE B CE1   1 
ATOM   9153  C CE2   . PHE H 3 341 ? 64.599  -32.797  -8.055  1.00 111.98 ? 344 PHE B CE2   1 
ATOM   9154  C CZ    . PHE H 3 341 ? 64.426  -32.723  -6.685  1.00 112.30 ? 344 PHE B CZ    1 
ATOM   9155  N N     . GLU H 3 342 ? 62.370  -38.292  -7.057  1.00 133.54 ? 345 GLU B N     1 
ATOM   9156  C CA    . GLU H 3 342 ? 61.694  -38.839  -5.874  1.00 151.74 ? 345 GLU B CA    1 
ATOM   9157  C C     . GLU H 3 342 ? 61.616  -37.803  -4.750  1.00 164.95 ? 345 GLU B C     1 
ATOM   9158  O O     . GLU H 3 342 ? 60.551  -37.250  -4.469  1.00 169.92 ? 345 GLU B O     1 
ATOM   9159  C CB    . GLU H 3 342 ? 62.397  -40.104  -5.356  1.00 152.82 ? 345 GLU B CB    1 
ATOM   9160  C CG    . GLU H 3 342 ? 62.662  -41.189  -6.397  1.00 155.45 ? 345 GLU B CG    1 
ATOM   9161  C CD    . GLU H 3 342 ? 61.406  -41.702  -7.083  1.00 153.15 ? 345 GLU B CD    1 
ATOM   9162  O OE1   . GLU H 3 342 ? 60.317  -41.637  -6.478  1.00 153.27 ? 345 GLU B OE1   1 
ATOM   9163  O OE2   . GLU H 3 342 ? 61.511  -42.185  -8.231  1.00 143.92 ? 345 GLU B OE2   1 
ATOM   9164  O OXT   . GLU H 3 342 ? 62.614  -37.495  -4.095  1.00 179.06 ? 345 GLU B OXT   1 
ATOM   9165  N N     . PHE I 3 1   ? -3.151  42.352   54.423  1.00 150.75 ? 4   PHE G N     1 
ATOM   9166  C CA    . PHE I 3 1   ? -2.024  42.828   53.562  1.00 153.89 ? 4   PHE G CA    1 
ATOM   9167  C C     . PHE I 3 1   ? -1.555  41.675   52.678  1.00 149.71 ? 4   PHE G C     1 
ATOM   9168  O O     . PHE I 3 1   ? -1.381  40.553   53.155  1.00 141.45 ? 4   PHE G O     1 
ATOM   9169  C CB    . PHE I 3 1   ? -0.865  43.370   54.411  1.00 155.52 ? 4   PHE G CB    1 
ATOM   9170  C CG    . PHE I 3 1   ? -1.311  44.086   55.657  1.00 160.18 ? 4   PHE G CG    1 
ATOM   9171  C CD1   . PHE I 3 1   ? -2.122  45.214   55.574  1.00 159.83 ? 4   PHE G CD1   1 
ATOM   9172  C CD2   . PHE I 3 1   ? -0.938  43.621   56.915  1.00 159.42 ? 4   PHE G CD2   1 
ATOM   9173  C CE1   . PHE I 3 1   ? -2.546  45.867   56.720  1.00 158.86 ? 4   PHE G CE1   1 
ATOM   9174  C CE2   . PHE I 3 1   ? -1.357  44.273   58.064  1.00 160.66 ? 4   PHE G CE2   1 
ATOM   9175  C CZ    . PHE I 3 1   ? -2.162  45.397   57.967  1.00 159.63 ? 4   PHE G CZ    1 
ATOM   9176  N N     . VAL I 3 2   ? -1.327  41.968   51.400  1.00 151.38 ? 5   VAL G N     1 
ATOM   9177  C CA    . VAL I 3 2   ? -1.209  40.938   50.364  1.00 153.82 ? 5   VAL G CA    1 
ATOM   9178  C C     . VAL I 3 2   ? 0.157   40.948   49.650  1.00 156.13 ? 5   VAL G C     1 
ATOM   9179  O O     . VAL I 3 2   ? 0.244   41.302   48.473  1.00 152.94 ? 5   VAL G O     1 
ATOM   9180  C CB    . VAL I 3 2   ? -2.354  41.113   49.329  1.00 147.46 ? 5   VAL G CB    1 
ATOM   9181  C CG1   . VAL I 3 2   ? -2.416  39.939   48.355  1.00 145.71 ? 5   VAL G CG1   1 
ATOM   9182  C CG2   . VAL I 3 2   ? -3.686  41.287   50.046  1.00 141.76 ? 5   VAL G CG2   1 
ATOM   9183  N N     . PRO I 3 3   ? 1.234   40.557   50.358  1.00 153.78 ? 6   PRO G N     1 
ATOM   9184  C CA    . PRO I 3 3   ? 2.536   40.441   49.699  1.00 151.50 ? 6   PRO G CA    1 
ATOM   9185  C C     . PRO I 3 3   ? 2.742   39.046   49.109  1.00 146.39 ? 6   PRO G C     1 
ATOM   9186  O O     . PRO I 3 3   ? 2.174   38.083   49.626  1.00 147.36 ? 6   PRO G O     1 
ATOM   9187  C CB    . PRO I 3 3   ? 3.515   40.681   50.847  1.00 156.19 ? 6   PRO G CB    1 
ATOM   9188  C CG    . PRO I 3 3   ? 2.814   40.125   52.043  1.00 154.54 ? 6   PRO G CG    1 
ATOM   9189  C CD    . PRO I 3 3   ? 1.336   40.311   51.810  1.00 151.17 ? 6   PRO G CD    1 
ATOM   9190  N N     . ASN I 3 4   ? 3.546   38.939   48.048  1.00 136.50 ? 7   ASN G N     1 
ATOM   9191  C CA    . ASN I 3 4   ? 3.838   37.643   47.412  1.00 125.31 ? 7   ASN G CA    1 
ATOM   9192  C C     . ASN I 3 4   ? 4.850   37.744   46.266  1.00 117.20 ? 7   ASN G C     1 
ATOM   9193  O O     . ASN I 3 4   ? 4.613   38.451   45.295  1.00 118.64 ? 7   ASN G O     1 
ATOM   9194  C CB    . ASN I 3 4   ? 2.544   37.016   46.883  1.00 123.72 ? 7   ASN G CB    1 
ATOM   9195  C CG    . ASN I 3 4   ? 2.783   35.769   46.060  1.00 124.69 ? 7   ASN G CG    1 
ATOM   9196  O OD1   . ASN I 3 4   ? 3.909   35.285   45.935  1.00 121.98 ? 7   ASN G OD1   1 
ATOM   9197  N ND2   . ASN I 3 4   ? 1.711   35.235   45.494  1.00 127.00 ? 7   ASN G ND2   1 
ATOM   9198  N N     . LYS I 3 5   ? 5.937   36.981   46.360  1.00 115.57 ? 8   LYS G N     1 
ATOM   9199  C CA    . LYS I 3 5   ? 7.027   37.009   45.364  1.00 118.83 ? 8   LYS G CA    1 
ATOM   9200  C C     . LYS I 3 5   ? 6.520   37.113   43.927  1.00 119.55 ? 8   LYS G C     1 
ATOM   9201  O O     . LYS I 3 5   ? 7.089   37.833   43.110  1.00 116.27 ? 8   LYS G O     1 
ATOM   9202  C CB    . LYS I 3 5   ? 7.921   35.758   45.463  1.00 121.59 ? 8   LYS G CB    1 
ATOM   9203  C CG    . LYS I 3 5   ? 8.333   35.316   46.865  1.00 124.90 ? 8   LYS G CG    1 
ATOM   9204  C CD    . LYS I 3 5   ? 8.796   36.468   47.746  1.00 127.70 ? 8   LYS G CD    1 
ATOM   9205  C CE    . LYS I 3 5   ? 9.516   35.967   48.988  1.00 128.74 ? 8   LYS G CE    1 
ATOM   9206  N NZ    . LYS I 3 5   ? 8.651   35.080   49.815  1.00 132.76 ? 8   LYS G NZ    1 
ATOM   9207  N N     . GLU I 3 6   ? 5.460   36.371   43.620  1.00 130.08 ? 9   GLU G N     1 
ATOM   9208  C CA    . GLU I 3 6   ? 4.846   36.421   42.292  1.00 134.71 ? 9   GLU G CA    1 
ATOM   9209  C C     . GLU I 3 6   ? 4.076   37.724   42.097  1.00 126.22 ? 9   GLU G C     1 
ATOM   9210  O O     . GLU I 3 6   ? 4.338   38.462   41.147  1.00 120.67 ? 9   GLU G O     1 
ATOM   9211  C CB    . GLU I 3 6   ? 3.915   35.216   42.055  1.00 139.95 ? 9   GLU G CB    1 
ATOM   9212  C CG    . GLU I 3 6   ? 4.463   34.165   41.091  1.00 141.96 ? 9   GLU G CG    1 
ATOM   9213  C CD    . GLU I 3 6   ? 5.580   33.311   41.672  1.00 145.75 ? 9   GLU G CD    1 
ATOM   9214  O OE1   . GLU I 3 6   ? 5.837   33.375   42.896  1.00 144.70 ? 9   GLU G OE1   1 
ATOM   9215  O OE2   . GLU I 3 6   ? 6.205   32.561   40.893  1.00 143.50 ? 9   GLU G OE2   1 
ATOM   9216  N N     . GLN I 3 7   ? 3.139   38.000   43.006  1.00 121.30 ? 10  GLN G N     1 
ATOM   9217  C CA    . GLN I 3 7   ? 2.264   39.180   42.911  1.00 117.58 ? 10  GLN G CA    1 
ATOM   9218  C C     . GLN I 3 7   ? 3.033   40.499   42.868  1.00 117.47 ? 10  GLN G C     1 
ATOM   9219  O O     . GLN I 3 7   ? 2.583   41.465   42.253  1.00 112.72 ? 10  GLN G O     1 
ATOM   9220  C CB    . GLN I 3 7   ? 1.300   39.230   44.092  1.00 112.46 ? 10  GLN G CB    1 
ATOM   9221  C CG    . GLN I 3 7   ? 0.287   38.105   44.139  1.00 111.72 ? 10  GLN G CG    1 
ATOM   9222  C CD    . GLN I 3 7   ? -0.648  38.233   45.326  1.00 113.09 ? 10  GLN G CD    1 
ATOM   9223  O OE1   . GLN I 3 7   ? -0.209  38.402   46.462  1.00 119.71 ? 10  GLN G OE1   1 
ATOM   9224  N NE2   . GLN I 3 7   ? -1.943  38.158   45.071  1.00 111.43 ? 10  GLN G NE2   1 
ATOM   9225  N N     . THR I 3 8   ? 4.176   40.533   43.550  1.00 121.50 ? 11  THR G N     1 
ATOM   9226  C CA    . THR I 3 8   ? 5.062   41.697   43.568  1.00 116.54 ? 11  THR G CA    1 
ATOM   9227  C C     . THR I 3 8   ? 5.626   41.981   42.179  1.00 116.65 ? 11  THR G C     1 
ATOM   9228  O O     . THR I 3 8   ? 5.508   43.097   41.677  1.00 118.92 ? 11  THR G O     1 
ATOM   9229  C CB    . THR I 3 8   ? 6.219   41.486   44.571  1.00 115.39 ? 11  THR G CB    1 
ATOM   9230  O OG1   . THR I 3 8   ? 5.713   41.590   45.908  1.00 109.64 ? 11  THR G OG1   1 
ATOM   9231  C CG2   . THR I 3 8   ? 7.328   42.510   44.376  1.00 119.42 ? 11  THR G CG2   1 
ATOM   9232  N N     . ARG I 3 9   ? 6.225   40.969   41.561  1.00 116.12 ? 12  ARG G N     1 
ATOM   9233  C CA    . ARG I 3 9   ? 6.811   41.127   40.229  1.00 116.89 ? 12  ARG G CA    1 
ATOM   9234  C C     . ARG I 3 9   ? 5.748   41.459   39.176  1.00 113.30 ? 12  ARG G C     1 
ATOM   9235  O O     . ARG I 3 9   ? 6.055   42.098   38.172  1.00 111.46 ? 12  ARG G O     1 
ATOM   9236  C CB    . ARG I 3 9   ? 7.584   39.871   39.826  1.00 122.21 ? 12  ARG G CB    1 
ATOM   9237  C CG    . ARG I 3 9   ? 8.744   39.544   40.753  1.00 129.04 ? 12  ARG G CG    1 
ATOM   9238  C CD    . ARG I 3 9   ? 9.062   38.059   40.753  1.00 134.74 ? 12  ARG G CD    1 
ATOM   9239  N NE    . ARG I 3 9   ? 9.758   37.641   41.967  1.00 136.02 ? 12  ARG G NE    1 
ATOM   9240  C CZ    . ARG I 3 9   ? 10.222  36.413   42.181  1.00 141.48 ? 12  ARG G CZ    1 
ATOM   9241  N NH1   . ARG I 3 9   ? 10.083  35.467   41.259  1.00 146.37 ? 12  ARG G NH1   1 
ATOM   9242  N NH2   . ARG I 3 9   ? 10.835  36.131   43.322  1.00 145.86 ? 12  ARG G NH2   1 
ATOM   9243  N N     . THR I 3 10  ? 4.509   41.022   39.407  1.00 111.05 ? 13  THR G N     1 
ATOM   9244  C CA    . THR I 3 10  ? 3.375   41.404   38.558  1.00 112.78 ? 13  THR G CA    1 
ATOM   9245  C C     . THR I 3 10  ? 3.189   42.922   38.584  1.00 119.45 ? 13  THR G C     1 
ATOM   9246  O O     . THR I 3 10  ? 3.001   43.551   37.543  1.00 126.14 ? 13  THR G O     1 
ATOM   9247  C CB    . THR I 3 10  ? 2.069   40.695   39.001  1.00 110.57 ? 13  THR G CB    1 
ATOM   9248  O OG1   . THR I 3 10  ? 2.073   39.346   38.520  1.00 115.72 ? 13  THR G OG1   1 
ATOM   9249  C CG2   . THR I 3 10  ? 0.816   41.399   38.469  1.00 107.26 ? 13  THR G CG2   1 
ATOM   9250  N N     . VAL I 3 11  ? 3.254   43.502   39.778  1.00 119.79 ? 14  VAL G N     1 
ATOM   9251  C CA    . VAL I 3 11  ? 3.118   44.945   39.941  1.00 113.63 ? 14  VAL G CA    1 
ATOM   9252  C C     . VAL I 3 11  ? 4.279   45.687   39.264  1.00 114.47 ? 14  VAL G C     1 
ATOM   9253  O O     . VAL I 3 11  ? 4.084   46.768   38.720  1.00 118.83 ? 14  VAL G O     1 
ATOM   9254  C CB    . VAL I 3 11  ? 3.005   45.325   41.433  1.00 113.08 ? 14  VAL G CB    1 
ATOM   9255  C CG1   . VAL I 3 11  ? 3.096   46.834   41.633  1.00 117.06 ? 14  VAL G CG1   1 
ATOM   9256  C CG2   . VAL I 3 11  ? 1.700   44.789   42.010  1.00 110.75 ? 14  VAL G CG2   1 
ATOM   9257  N N     . LEU I 3 12  ? 5.474   45.104   39.273  1.00 114.74 ? 15  LEU G N     1 
ATOM   9258  C CA    . LEU I 3 12  ? 6.616   45.712   38.580  1.00 118.69 ? 15  LEU G CA    1 
ATOM   9259  C C     . LEU I 3 12  ? 6.493   45.703   37.048  1.00 126.80 ? 15  LEU G C     1 
ATOM   9260  O O     . LEU I 3 12  ? 7.130   46.514   36.380  1.00 135.56 ? 15  LEU G O     1 
ATOM   9261  C CB    . LEU I 3 12  ? 7.932   45.058   39.005  1.00 118.14 ? 15  LEU G CB    1 
ATOM   9262  C CG    . LEU I 3 12  ? 8.644   45.747   40.166  1.00 120.27 ? 15  LEU G CG    1 
ATOM   9263  C CD1   . LEU I 3 12  ? 7.728   45.894   41.371  1.00 121.31 ? 15  LEU G CD1   1 
ATOM   9264  C CD2   . LEU I 3 12  ? 9.900   44.973   40.525  1.00 124.70 ? 15  LEU G CD2   1 
ATOM   9265  N N     . ILE I 3 13  ? 5.694   44.791   36.497  1.00 130.75 ? 16  ILE G N     1 
ATOM   9266  C CA    . ILE I 3 13  ? 5.370   44.815   35.066  1.00 134.50 ? 16  ILE G CA    1 
ATOM   9267  C C     . ILE I 3 13  ? 4.409   45.972   34.809  1.00 131.89 ? 16  ILE G C     1 
ATOM   9268  O O     . ILE I 3 13  ? 4.506   46.670   33.799  1.00 140.28 ? 16  ILE G O     1 
ATOM   9269  C CB    . ILE I 3 13  ? 4.669   43.518   34.600  1.00 144.72 ? 16  ILE G CB    1 
ATOM   9270  C CG1   . ILE I 3 13  ? 5.514   42.271   34.912  1.00 149.75 ? 16  ILE G CG1   1 
ATOM   9271  C CG2   . ILE I 3 13  ? 4.328   43.597   33.114  1.00 147.86 ? 16  ILE G CG2   1 
ATOM   9272  C CD1   . ILE I 3 13  ? 6.602   41.963   33.911  1.00 151.54 ? 16  ILE G CD1   1 
ATOM   9273  N N     . PHE I 3 14  ? 3.479   46.150   35.743  1.00 124.77 ? 17  PHE G N     1 
ATOM   9274  C CA    . PHE I 3 14  ? 2.440   47.176   35.678  1.00 121.28 ? 17  PHE G CA    1 
ATOM   9275  C C     . PHE I 3 14  ? 3.013   48.590   35.697  1.00 121.35 ? 17  PHE G C     1 
ATOM   9276  O O     . PHE I 3 14  ? 2.696   49.401   34.831  1.00 118.59 ? 17  PHE G O     1 
ATOM   9277  C CB    . PHE I 3 14  ? 1.493   46.974   36.862  1.00 121.07 ? 17  PHE G CB    1 
ATOM   9278  C CG    . PHE I 3 14  ? 0.370   47.963   36.937  1.00 118.58 ? 17  PHE G CG    1 
ATOM   9279  C CD1   . PHE I 3 14  ? -0.439  48.204   35.842  1.00 119.05 ? 17  PHE G CD1   1 
ATOM   9280  C CD2   . PHE I 3 14  ? 0.088   48.611   38.130  1.00 118.49 ? 17  PHE G CD2   1 
ATOM   9281  C CE1   . PHE I 3 14  ? -1.492  49.096   35.924  1.00 120.71 ? 17  PHE G CE1   1 
ATOM   9282  C CE2   . PHE I 3 14  ? -0.966  49.501   38.221  1.00 120.84 ? 17  PHE G CE2   1 
ATOM   9283  C CZ    . PHE I 3 14  ? -1.756  49.746   37.115  1.00 121.24 ? 17  PHE G CZ    1 
ATOM   9284  N N     . CYS I 3 15  ? 3.854   48.874   36.689  1.00 124.22 ? 18  CYS G N     1 
ATOM   9285  C CA    . CYS I 3 15  ? 4.528   50.171   36.800  1.00 124.13 ? 18  CYS G CA    1 
ATOM   9286  C C     . CYS I 3 15  ? 5.422   50.443   35.592  1.00 126.08 ? 18  CYS G C     1 
ATOM   9287  O O     . CYS I 3 15  ? 5.479   51.570   35.107  1.00 140.55 ? 18  CYS G O     1 
ATOM   9288  C CB    . CYS I 3 15  ? 5.373   50.245   38.079  1.00 124.45 ? 18  CYS G CB    1 
ATOM   9289  S SG    . CYS I 3 15  ? 4.432   50.273   39.626  1.00 123.23 ? 18  CYS G SG    1 
ATOM   9290  N N     . PHE I 3 16  ? 6.121   49.410   35.123  1.00 123.39 ? 19  PHE G N     1 
ATOM   9291  C CA    . PHE I 3 16  ? 6.965   49.500   33.925  1.00 122.62 ? 19  PHE G CA    1 
ATOM   9292  C C     . PHE I 3 16  ? 6.151   49.886   32.694  1.00 124.35 ? 19  PHE G C     1 
ATOM   9293  O O     . PHE I 3 16  ? 6.635   50.621   31.834  1.00 124.33 ? 19  PHE G O     1 
ATOM   9294  C CB    . PHE I 3 16  ? 7.677   48.162   33.687  1.00 122.73 ? 19  PHE G CB    1 
ATOM   9295  C CG    . PHE I 3 16  ? 8.549   48.130   32.459  1.00 117.45 ? 19  PHE G CG    1 
ATOM   9296  C CD1   . PHE I 3 16  ? 9.844   48.625   32.500  1.00 118.36 ? 19  PHE G CD1   1 
ATOM   9297  C CD2   . PHE I 3 16  ? 8.089   47.568   31.275  1.00 115.43 ? 19  PHE G CD2   1 
ATOM   9298  C CE1   . PHE I 3 16  ? 10.659  48.582   31.378  1.00 119.77 ? 19  PHE G CE1   1 
ATOM   9299  C CE2   . PHE I 3 16  ? 8.899   47.519   30.150  1.00 117.09 ? 19  PHE G CE2   1 
ATOM   9300  C CZ    . PHE I 3 16  ? 10.186  48.027   30.201  1.00 119.55 ? 19  PHE G CZ    1 
ATOM   9301  N N     . HIS I 3 17  ? 4.915   49.399   32.619  1.00 128.03 ? 20  HIS G N     1 
ATOM   9302  C CA    . HIS I 3 17  ? 4.018   49.728   31.507  1.00 135.45 ? 20  HIS G CA    1 
ATOM   9303  C C     . HIS I 3 17  ? 3.323   51.091   31.651  1.00 134.32 ? 20  HIS G C     1 
ATOM   9304  O O     . HIS I 3 17  ? 2.824   51.634   30.666  1.00 143.06 ? 20  HIS G O     1 
ATOM   9305  C CB    . HIS I 3 17  ? 2.997   48.605   31.302  1.00 138.46 ? 20  HIS G CB    1 
ATOM   9306  C CG    . HIS I 3 17  ? 3.509   47.472   30.465  1.00 145.07 ? 20  HIS G CG    1 
ATOM   9307  N ND1   . HIS I 3 17  ? 2.734   46.381   30.141  1.00 147.96 ? 20  HIS G ND1   1 
ATOM   9308  C CD2   . HIS I 3 17  ? 4.707   47.272   29.864  1.00 146.26 ? 20  HIS G CD2   1 
ATOM   9309  C CE1   . HIS I 3 17  ? 3.436   45.549   29.393  1.00 149.04 ? 20  HIS G CE1   1 
ATOM   9310  N NE2   . HIS I 3 17  ? 4.636   46.068   29.207  1.00 147.76 ? 20  HIS G NE2   1 
ATOM   9311  N N     . LEU I 3 18  ? 3.297   51.640   32.866  1.00 128.02 ? 21  LEU G N     1 
ATOM   9312  C CA    . LEU I 3 18  ? 2.942   53.050   33.076  1.00 118.90 ? 21  LEU G CA    1 
ATOM   9313  C C     . LEU I 3 18  ? 4.185   53.944   32.982  1.00 124.70 ? 21  LEU G C     1 
ATOM   9314  O O     . LEU I 3 18  ? 4.146   55.113   33.369  1.00 124.73 ? 21  LEU G O     1 
ATOM   9315  C CB    . LEU I 3 18  ? 2.275   53.244   34.440  1.00 110.44 ? 21  LEU G CB    1 
ATOM   9316  C CG    . LEU I 3 18  ? 0.981   52.468   34.680  1.00 108.44 ? 21  LEU G CG    1 
ATOM   9317  C CD1   . LEU I 3 18  ? 0.462   52.723   36.086  1.00 108.45 ? 21  LEU G CD1   1 
ATOM   9318  C CD2   . LEU I 3 18  ? -0.073  52.832   33.651  1.00 109.10 ? 21  LEU G CD2   1 
ATOM   9319  N N     . LYS I 3 19  ? 5.287   53.378   32.487  1.00 133.05 ? 22  LYS G N     1 
ATOM   9320  C CA    . LYS I 3 19  ? 6.552   54.091   32.287  1.00 138.36 ? 22  LYS G CA    1 
ATOM   9321  C C     . LYS I 3 19  ? 7.064   54.838   33.529  1.00 137.03 ? 22  LYS G C     1 
ATOM   9322  O O     . LYS I 3 19  ? 7.764   55.846   33.405  1.00 150.56 ? 22  LYS G O     1 
ATOM   9323  C CB    . LYS I 3 19  ? 6.439   55.042   31.088  1.00 141.45 ? 22  LYS G CB    1 
ATOM   9324  C CG    . LYS I 3 19  ? 6.163   54.336   29.769  1.00 146.09 ? 22  LYS G CG    1 
ATOM   9325  C CD    . LYS I 3 19  ? 5.636   55.299   28.718  1.00 150.99 ? 22  LYS G CD    1 
ATOM   9326  C CE    . LYS I 3 19  ? 5.077   54.556   27.515  1.00 153.86 ? 22  LYS G CE    1 
ATOM   9327  N NZ    . LYS I 3 19  ? 4.295   55.458   26.629  1.00 153.07 ? 22  LYS G NZ    1 
ATOM   9328  N N     . LYS I 3 20  ? 6.733   54.336   34.719  1.00 127.49 ? 23  LYS G N     1 
ATOM   9329  C CA    . LYS I 3 20  ? 7.255   54.905   35.960  1.00 123.08 ? 23  LYS G CA    1 
ATOM   9330  C C     . LYS I 3 20  ? 8.681   54.415   36.164  1.00 123.60 ? 23  LYS G C     1 
ATOM   9331  O O     . LYS I 3 20  ? 9.085   53.427   35.557  1.00 123.65 ? 23  LYS G O     1 
ATOM   9332  C CB    . LYS I 3 20  ? 6.371   54.526   37.144  1.00 120.61 ? 23  LYS G CB    1 
ATOM   9333  C CG    . LYS I 3 20  ? 5.002   55.190   37.106  1.00 124.61 ? 23  LYS G CG    1 
ATOM   9334  C CD    . LYS I 3 20  ? 4.278   55.037   38.433  1.00 128.49 ? 23  LYS G CD    1 
ATOM   9335  C CE    . LYS I 3 20  ? 3.202   56.094   38.660  1.00 131.85 ? 23  LYS G CE    1 
ATOM   9336  N NZ    . LYS I 3 20  ? 2.158   56.152   37.604  1.00 133.73 ? 23  LYS G NZ    1 
ATOM   9337  N N     . THR I 3 21  ? 9.447   55.110   37.003  1.00 129.82 ? 24  THR G N     1 
ATOM   9338  C CA    . THR I 3 21  ? 10.868  54.775   37.195  1.00 133.66 ? 24  THR G CA    1 
ATOM   9339  C C     . THR I 3 21  ? 11.000  53.619   38.190  1.00 133.91 ? 24  THR G C     1 
ATOM   9340  O O     . THR I 3 21  ? 10.038  53.269   38.888  1.00 130.70 ? 24  THR G O     1 
ATOM   9341  C CB    . THR I 3 21  ? 11.732  55.982   37.672  1.00 134.27 ? 24  THR G CB    1 
ATOM   9342  O OG1   . THR I 3 21  ? 11.936  55.925   39.092  1.00 136.65 ? 24  THR G OG1   1 
ATOM   9343  C CG2   . THR I 3 21  ? 11.107  57.327   37.296  1.00 134.90 ? 24  THR G CG2   1 
ATOM   9344  N N     . ALA I 3 22  ? 12.190  53.027   38.251  1.00 129.24 ? 25  ALA G N     1 
ATOM   9345  C CA    . ALA I 3 22  ? 12.451  51.958   39.209  1.00 126.79 ? 25  ALA G CA    1 
ATOM   9346  C C     . ALA I 3 22  ? 12.206  52.472   40.627  1.00 123.73 ? 25  ALA G C     1 
ATOM   9347  O O     . ALA I 3 22  ? 11.315  51.986   41.329  1.00 120.89 ? 25  ALA G O     1 
ATOM   9348  C CB    . ALA I 3 22  ? 13.871  51.428   39.058  1.00 125.18 ? 25  ALA G CB    1 
ATOM   9349  N N     . ALA I 3 23  ? 12.972  53.485   41.021  1.00 123.29 ? 26  ALA G N     1 
ATOM   9350  C CA    . ALA I 3 23  ? 12.849  54.080   42.351  1.00 125.44 ? 26  ALA G CA    1 
ATOM   9351  C C     . ALA I 3 23  ? 11.422  54.546   42.661  1.00 123.95 ? 26  ALA G C     1 
ATOM   9352  O O     . ALA I 3 23  ? 10.966  54.448   43.805  1.00 118.55 ? 26  ALA G O     1 
ATOM   9353  C CB    . ALA I 3 23  ? 13.835  55.230   42.502  1.00 124.30 ? 26  ALA G CB    1 
ATOM   9354  N N     . GLU I 3 24  ? 10.724  55.036   41.639  1.00 125.85 ? 27  GLU G N     1 
ATOM   9355  C CA    . GLU I 3 24  ? 9.352   55.521   41.791  1.00 131.43 ? 27  GLU G CA    1 
ATOM   9356  C C     . GLU I 3 24  ? 8.397   54.375   42.101  1.00 128.44 ? 27  GLU G C     1 
ATOM   9357  O O     . GLU I 3 24  ? 7.531   54.502   42.967  1.00 130.08 ? 27  GLU G O     1 
ATOM   9358  C CB    . GLU I 3 24  ? 8.901   56.248   40.519  1.00 137.53 ? 27  GLU G CB    1 
ATOM   9359  C CG    . GLU I 3 24  ? 7.633   57.076   40.671  1.00 139.95 ? 27  GLU G CG    1 
ATOM   9360  C CD    . GLU I 3 24  ? 7.319   57.885   39.422  1.00 146.96 ? 27  GLU G CD    1 
ATOM   9361  O OE1   . GLU I 3 24  ? 6.214   57.721   38.860  1.00 148.82 ? 27  GLU G OE1   1 
ATOM   9362  O OE2   . GLU I 3 24  ? 8.181   58.680   38.992  1.00 151.14 ? 27  GLU G OE2   1 
ATOM   9363  N N     . SER I 3 25  ? 8.562   53.260   41.391  1.00 122.87 ? 28  SER G N     1 
ATOM   9364  C CA    . SER I 3 25  ? 7.744   52.071   41.619  1.00 119.18 ? 28  SER G CA    1 
ATOM   9365  C C     . SER I 3 25  ? 7.967   51.528   43.032  1.00 115.71 ? 28  SER G C     1 
ATOM   9366  O O     . SER I 3 25  ? 7.002   51.235   43.749  1.00 107.83 ? 28  SER G O     1 
ATOM   9367  C CB    . SER I 3 25  ? 8.073   50.994   40.586  1.00 121.39 ? 28  SER G CB    1 
ATOM   9368  O OG    . SER I 3 25  ? 8.079   51.528   39.274  1.00 122.52 ? 28  SER G OG    1 
ATOM   9369  N N     . HIS I 3 26  ? 9.239   51.408   43.421  1.00 108.45 ? 29  HIS G N     1 
ATOM   9370  C CA    . HIS I 3 26  ? 9.611   50.976   44.770  1.00 110.42 ? 29  HIS G CA    1 
ATOM   9371  C C     . HIS I 3 26  ? 8.933   51.807   45.859  1.00 112.61 ? 29  HIS G C     1 
ATOM   9372  O O     . HIS I 3 26  ? 8.472   51.261   46.864  1.00 110.60 ? 29  HIS G O     1 
ATOM   9373  C CB    . HIS I 3 26  ? 11.128  51.037   44.961  1.00 114.08 ? 29  HIS G CB    1 
ATOM   9374  C CG    . HIS I 3 26  ? 11.559  50.832   46.379  1.00 123.06 ? 29  HIS G CG    1 
ATOM   9375  N ND1   . HIS I 3 26  ? 11.428  49.624   47.029  1.00 132.37 ? 29  HIS G ND1   1 
ATOM   9376  C CD2   . HIS I 3 26  ? 12.096  51.686   47.280  1.00 131.64 ? 29  HIS G CD2   1 
ATOM   9377  C CE1   . HIS I 3 26  ? 11.875  49.740   48.266  1.00 133.16 ? 29  HIS G CE1   1 
ATOM   9378  N NE2   . HIS I 3 26  ? 12.289  50.981   48.443  1.00 134.47 ? 29  HIS G NE2   1 
ATOM   9379  N N     . ARG I 3 27  ? 8.886   53.123   45.660  1.00 120.66 ? 30  ARG G N     1 
ATOM   9380  C CA    . ARG I 3 27  ? 8.239   54.029   46.614  1.00 120.27 ? 30  ARG G CA    1 
ATOM   9381  C C     . ARG I 3 27  ? 6.733   53.796   46.681  1.00 115.26 ? 30  ARG G C     1 
ATOM   9382  O O     . ARG I 3 27  ? 6.135   53.903   47.751  1.00 110.20 ? 30  ARG G O     1 
ATOM   9383  C CB    . ARG I 3 27  ? 8.527   55.496   46.274  1.00 125.94 ? 30  ARG G CB    1 
ATOM   9384  C CG    . ARG I 3 27  ? 9.918   55.970   46.677  1.00 128.74 ? 30  ARG G CG    1 
ATOM   9385  C CD    . ARG I 3 27  ? 9.980   57.488   46.798  1.00 130.36 ? 30  ARG G CD    1 
ATOM   9386  N NE    . ARG I 3 27  ? 9.714   58.175   45.530  1.00 130.60 ? 30  ARG G NE    1 
ATOM   9387  C CZ    . ARG I 3 27  ? 10.591  58.309   44.533  1.00 126.52 ? 30  ARG G CZ    1 
ATOM   9388  N NH1   . ARG I 3 27  ? 11.815  57.803   44.627  1.00 127.62 ? 30  ARG G NH1   1 
ATOM   9389  N NH2   . ARG I 3 27  ? 10.244  58.954   43.425  1.00 117.99 ? 30  ARG G NH2   1 
ATOM   9390  N N     . MET I 3 28  ? 6.125   53.482   45.540  1.00 117.97 ? 31  MET G N     1 
ATOM   9391  C CA    . MET I 3 28  ? 4.702   53.141   45.497  1.00 123.31 ? 31  MET G CA    1 
ATOM   9392  C C     . MET I 3 28  ? 4.445   51.788   46.142  1.00 121.66 ? 31  MET G C     1 
ATOM   9393  O O     . MET I 3 28  ? 3.383   51.570   46.734  1.00 113.25 ? 31  MET G O     1 
ATOM   9394  C CB    . MET I 3 28  ? 4.198   53.105   44.062  1.00 127.78 ? 31  MET G CB    1 
ATOM   9395  C CG    . MET I 3 28  ? 4.209   54.451   43.372  1.00 131.36 ? 31  MET G CG    1 
ATOM   9396  S SD    . MET I 3 28  ? 4.001   54.241   41.601  1.00 139.47 ? 31  MET G SD    1 
ATOM   9397  C CE    . MET I 3 28  ? 2.278   53.754   41.503  1.00 137.62 ? 31  MET G CE    1 
ATOM   9398  N N     . LEU I 3 29  ? 5.413   50.882   46.000  1.00 122.40 ? 32  LEU G N     1 
ATOM   9399  C CA    . LEU I 3 29  ? 5.368   49.577   46.670  1.00 121.90 ? 32  LEU G CA    1 
ATOM   9400  C C     . LEU I 3 29  ? 5.313   49.765   48.180  1.00 121.38 ? 32  LEU G C     1 
ATOM   9401  O O     . LEU I 3 29  ? 4.299   49.453   48.818  1.00 117.91 ? 32  LEU G O     1 
ATOM   9402  C CB    . LEU I 3 29  ? 6.581   48.709   46.282  1.00 116.49 ? 32  LEU G CB    1 
ATOM   9403  C CG    . LEU I 3 29  ? 6.353   47.414   45.491  1.00 114.54 ? 32  LEU G CG    1 
ATOM   9404  C CD1   . LEU I 3 29  ? 5.231   47.519   44.467  1.00 111.85 ? 32  LEU G CD1   1 
ATOM   9405  C CD2   . LEU I 3 29  ? 7.656   46.990   44.821  1.00 116.05 ? 32  LEU G CD2   1 
ATOM   9406  N N     . VAL I 3 30  ? 6.394   50.300   48.739  1.00 118.24 ? 33  VAL G N     1 
ATOM   9407  C CA    . VAL I 3 30  ? 6.480   50.524   50.176  1.00 122.12 ? 33  VAL G CA    1 
ATOM   9408  C C     . VAL I 3 30  ? 5.262   51.308   50.692  1.00 119.89 ? 33  VAL G C     1 
ATOM   9409  O O     . VAL I 3 30  ? 4.798   51.072   51.807  1.00 115.93 ? 33  VAL G O     1 
ATOM   9410  C CB    . VAL I 3 30  ? 7.821   51.198   50.571  1.00 125.73 ? 33  VAL G CB    1 
ATOM   9411  C CG1   . VAL I 3 30  ? 7.934   52.596   49.985  1.00 133.16 ? 33  VAL G CG1   1 
ATOM   9412  C CG2   . VAL I 3 30  ? 7.986   51.240   52.083  1.00 127.02 ? 33  VAL G CG2   1 
ATOM   9413  N N     . GLU I 3 31  ? 4.731   52.215   49.874  1.00 122.67 ? 34  GLU G N     1 
ATOM   9414  C CA    . GLU I 3 31  ? 3.506   52.936   50.228  1.00 128.57 ? 34  GLU G CA    1 
ATOM   9415  C C     . GLU I 3 31  ? 2.313   51.987   50.329  1.00 131.74 ? 34  GLU G C     1 
ATOM   9416  O O     . GLU I 3 31  ? 1.577   52.013   51.315  1.00 126.37 ? 34  GLU G O     1 
ATOM   9417  C CB    . GLU I 3 31  ? 3.197   54.048   49.210  1.00 128.43 ? 34  GLU G CB    1 
ATOM   9418  C CG    . GLU I 3 31  ? 1.845   54.732   49.424  1.00 127.47 ? 34  GLU G CG    1 
ATOM   9419  C CD    . GLU I 3 31  ? 1.565   55.855   48.439  1.00 128.71 ? 34  GLU G CD    1 
ATOM   9420  O OE1   . GLU I 3 31  ? 0.408   56.330   48.400  1.00 121.93 ? 34  GLU G OE1   1 
ATOM   9421  O OE2   . GLU I 3 31  ? 2.489   56.264   47.703  1.00 128.77 ? 34  GLU G OE2   1 
ATOM   9422  N N     . ALA I 3 32  ? 2.137   51.154   49.305  1.00 138.78 ? 35  ALA G N     1 
ATOM   9423  C CA    . ALA I 3 32  ? 0.928   50.338   49.154  1.00 138.44 ? 35  ALA G CA    1 
ATOM   9424  C C     . ALA I 3 32  ? 0.753   49.306   50.262  1.00 138.35 ? 35  ALA G C     1 
ATOM   9425  O O     . ALA I 3 32  ? -0.301  49.233   50.895  1.00 139.55 ? 35  ALA G O     1 
ATOM   9426  C CB    . ALA I 3 32  ? 0.940   49.640   47.803  1.00 137.03 ? 35  ALA G CB    1 
ATOM   9427  N N     . PHE I 3 33  ? 1.794   48.516   50.493  1.00 133.04 ? 36  PHE G N     1 
ATOM   9428  C CA    . PHE I 3 33  ? 1.696   47.351   51.363  1.00 130.69 ? 36  PHE G CA    1 
ATOM   9429  C C     . PHE I 3 33  ? 2.271   47.618   52.744  1.00 132.95 ? 36  PHE G C     1 
ATOM   9430  O O     . PHE I 3 33  ? 1.579   47.494   53.758  1.00 132.92 ? 36  PHE G O     1 
ATOM   9431  C CB    . PHE I 3 33  ? 2.411   46.177   50.700  1.00 127.22 ? 36  PHE G CB    1 
ATOM   9432  C CG    . PHE I 3 33  ? 1.947   45.920   49.296  1.00 120.59 ? 36  PHE G CG    1 
ATOM   9433  C CD1   . PHE I 3 33  ? 0.614   45.622   49.047  1.00 113.19 ? 36  PHE G CD1   1 
ATOM   9434  C CD2   . PHE I 3 33  ? 2.827   45.993   48.225  1.00 115.86 ? 36  PHE G CD2   1 
ATOM   9435  C CE1   . PHE I 3 33  ? 0.165   45.392   47.763  1.00 107.82 ? 36  PHE G CE1   1 
ATOM   9436  C CE2   . PHE I 3 33  ? 2.384   45.760   46.933  1.00 110.84 ? 36  PHE G CE2   1 
ATOM   9437  C CZ    . PHE I 3 33  ? 1.052   45.458   46.703  1.00 107.50 ? 36  PHE G CZ    1 
ATOM   9438  N N     . GLY I 3 34  ? 3.540   48.000   52.767  1.00 133.83 ? 37  GLY G N     1 
ATOM   9439  C CA    . GLY I 3 34  ? 4.264   48.217   54.007  1.00 133.61 ? 37  GLY G CA    1 
ATOM   9440  C C     . GLY I 3 34  ? 5.745   48.088   53.738  1.00 138.61 ? 37  GLY G C     1 
ATOM   9441  O O     . GLY I 3 34  ? 6.162   47.912   52.589  1.00 132.62 ? 37  GLY G O     1 
ATOM   9442  N N     . GLU I 3 35  ? 6.540   48.161   54.800  1.00 146.17 ? 38  GLU G N     1 
ATOM   9443  C CA    . GLU I 3 35  ? 7.994   48.114   54.671  1.00 148.73 ? 38  GLU G CA    1 
ATOM   9444  C C     . GLU I 3 35  ? 8.497   46.722   54.276  1.00 149.29 ? 38  GLU G C     1 
ATOM   9445  O O     . GLU I 3 35  ? 9.569   46.597   53.683  1.00 147.21 ? 38  GLU G O     1 
ATOM   9446  C CB    . GLU I 3 35  ? 8.659   48.588   55.966  1.00 150.92 ? 38  GLU G CB    1 
ATOM   9447  C CG    . GLU I 3 35  ? 10.133  48.938   55.804  1.00 155.11 ? 38  GLU G CG    1 
ATOM   9448  C CD    . GLU I 3 35  ? 10.658  49.879   56.877  1.00 157.34 ? 38  GLU G CD    1 
ATOM   9449  O OE1   . GLU I 3 35  ? 11.877  50.161   56.864  1.00 155.67 ? 38  GLU G OE1   1 
ATOM   9450  O OE2   . GLU I 3 35  ? 9.867   50.340   57.729  1.00 153.28 ? 38  GLU G OE2   1 
ATOM   9451  N N     . GLN I 3 36  ? 7.717   45.685   54.588  1.00 154.12 ? 39  GLN G N     1 
ATOM   9452  C CA    . GLN I 3 36  ? 8.075   44.310   54.224  1.00 155.15 ? 39  GLN G CA    1 
ATOM   9453  C C     . GLN I 3 36  ? 7.875   44.115   52.721  1.00 150.21 ? 39  GLN G C     1 
ATOM   9454  O O     . GLN I 3 36  ? 6.863   43.576   52.263  1.00 148.56 ? 39  GLN G O     1 
ATOM   9455  C CB    . GLN I 3 36  ? 7.265   43.282   55.032  1.00 158.84 ? 39  GLN G CB    1 
ATOM   9456  C CG    . GLN I 3 36  ? 7.199   43.517   56.544  1.00 159.65 ? 39  GLN G CG    1 
ATOM   9457  C CD    . GLN I 3 36  ? 8.527   43.894   57.189  1.00 158.48 ? 39  GLN G CD    1 
ATOM   9458  O OE1   . GLN I 3 36  ? 9.601   43.579   56.675  1.00 165.57 ? 39  GLN G OE1   1 
ATOM   9459  N NE2   . GLN I 3 36  ? 8.454   44.560   58.335  1.00 151.46 ? 39  GLN G NE2   1 
ATOM   9460  N N     . VAL I 3 37  ? 8.871   44.570   51.970  1.00 141.77 ? 40  VAL G N     1 
ATOM   9461  C CA    . VAL I 3 37  ? 8.810   44.656   50.518  1.00 133.07 ? 40  VAL G CA    1 
ATOM   9462  C C     . VAL I 3 37  ? 10.257  44.712   50.027  1.00 127.96 ? 40  VAL G C     1 
ATOM   9463  O O     . VAL I 3 37  ? 11.140  45.137   50.774  1.00 131.46 ? 40  VAL G O     1 
ATOM   9464  C CB    . VAL I 3 37  ? 7.972   45.898   50.094  1.00 130.81 ? 40  VAL G CB    1 
ATOM   9465  C CG1   . VAL I 3 37  ? 8.732   46.844   49.163  1.00 133.68 ? 40  VAL G CG1   1 
ATOM   9466  C CG2   . VAL I 3 37  ? 6.635   45.472   49.494  1.00 125.79 ? 40  VAL G CG2   1 
ATOM   9467  N N     . PRO I 3 38  ? 10.516  44.266   48.783  1.00 120.27 ? 41  PRO G N     1 
ATOM   9468  C CA    . PRO I 3 38  ? 11.902  44.202   48.311  1.00 115.06 ? 41  PRO G CA    1 
ATOM   9469  C C     . PRO I 3 38  ? 12.534  45.580   48.157  1.00 112.05 ? 41  PRO G C     1 
ATOM   9470  O O     . PRO I 3 38  ? 11.827  46.589   48.172  1.00 107.55 ? 41  PRO G O     1 
ATOM   9471  C CB    . PRO I 3 38  ? 11.776  43.519   46.947  1.00 112.90 ? 41  PRO G CB    1 
ATOM   9472  C CG    . PRO I 3 38  ? 10.399  43.859   46.493  1.00 115.40 ? 41  PRO G CG    1 
ATOM   9473  C CD    . PRO I 3 38  ? 9.567   43.832   47.742  1.00 117.28 ? 41  PRO G CD    1 
ATOM   9474  N N     . THR I 3 39  ? 13.853  45.612   48.001  1.00 108.28 ? 42  THR G N     1 
ATOM   9475  C CA    . THR I 3 39  ? 14.570  46.874   47.881  1.00 114.83 ? 42  THR G CA    1 
ATOM   9476  C C     . THR I 3 39  ? 14.297  47.529   46.532  1.00 123.72 ? 42  THR G C     1 
ATOM   9477  O O     . THR I 3 39  ? 13.699  46.925   45.636  1.00 125.68 ? 42  THR G O     1 
ATOM   9478  C CB    . THR I 3 39  ? 16.102  46.707   48.036  1.00 116.87 ? 42  THR G CB    1 
ATOM   9479  O OG1   . THR I 3 39  ? 16.644  45.998   46.913  1.00 113.65 ? 42  THR G OG1   1 
ATOM   9480  C CG2   . THR I 3 39  ? 16.453  45.985   49.337  1.00 115.84 ? 42  THR G CG2   1 
ATOM   9481  N N     . VAL I 3 40  ? 14.732  48.777   46.406  1.00 126.96 ? 43  VAL G N     1 
ATOM   9482  C CA    . VAL I 3 40  ? 14.731  49.464   45.124  1.00 129.00 ? 43  VAL G CA    1 
ATOM   9483  C C     . VAL I 3 40  ? 15.691  48.795   44.133  1.00 128.44 ? 43  VAL G C     1 
ATOM   9484  O O     . VAL I 3 40  ? 15.410  48.757   42.936  1.00 125.23 ? 43  VAL G O     1 
ATOM   9485  C CB    . VAL I 3 40  ? 15.117  50.951   45.282  1.00 138.65 ? 43  VAL G CB    1 
ATOM   9486  C CG1   . VAL I 3 40  ? 16.574  51.104   45.720  1.00 142.21 ? 43  VAL G CG1   1 
ATOM   9487  C CG2   . VAL I 3 40  ? 14.861  51.706   43.987  1.00 140.94 ? 43  VAL G CG2   1 
ATOM   9488  N N     . LYS I 3 41  ? 16.816  48.272   44.631  1.00 126.99 ? 44  LYS G N     1 
ATOM   9489  C CA    . LYS I 3 41  ? 17.830  47.656   43.768  1.00 124.14 ? 44  LYS G CA    1 
ATOM   9490  C C     . LYS I 3 41  ? 17.244  46.500   42.985  1.00 124.79 ? 44  LYS G C     1 
ATOM   9491  O O     . LYS I 3 41  ? 17.570  46.319   41.817  1.00 125.38 ? 44  LYS G O     1 
ATOM   9492  C CB    . LYS I 3 41  ? 19.036  47.166   44.577  1.00 122.71 ? 44  LYS G CB    1 
ATOM   9493  C CG    . LYS I 3 41  ? 20.057  46.359   43.773  1.00 121.98 ? 44  LYS G CG    1 
ATOM   9494  C CD    . LYS I 3 41  ? 20.716  47.149   42.651  1.00 121.13 ? 44  LYS G CD    1 
ATOM   9495  C CE    . LYS I 3 41  ? 21.914  46.386   42.096  1.00 125.46 ? 44  LYS G CE    1 
ATOM   9496  N NZ    . LYS I 3 41  ? 22.628  47.082   40.988  1.00 123.89 ? 44  LYS G NZ    1 
ATOM   9497  N N     . THR I 3 42  ? 16.390  45.714   43.634  1.00 126.87 ? 45  THR G N     1 
ATOM   9498  C CA    . THR I 3 42  ? 15.722  44.601   42.965  1.00 127.35 ? 45  THR G CA    1 
ATOM   9499  C C     . THR I 3 42  ? 14.730  45.106   41.927  1.00 121.98 ? 45  THR G C     1 
ATOM   9500  O O     . THR I 3 42  ? 14.684  44.581   40.812  1.00 125.95 ? 45  THR G O     1 
ATOM   9501  C CB    . THR I 3 42  ? 15.021  43.655   43.960  1.00 129.54 ? 45  THR G CB    1 
ATOM   9502  O OG1   . THR I 3 42  ? 14.589  44.388   45.115  1.00 129.78 ? 45  THR G OG1   1 
ATOM   9503  C CG2   . THR I 3 42  ? 15.972  42.570   44.391  1.00 126.12 ? 45  THR G CG2   1 
ATOM   9504  N N     . CYS I 3 43  ? 13.951  46.126   42.293  1.00 115.75 ? 46  CYS G N     1 
ATOM   9505  C CA    . CYS I 3 43  ? 13.072  46.806   41.339  1.00 112.13 ? 46  CYS G CA    1 
ATOM   9506  C C     . CYS I 3 43  ? 13.865  47.289   40.118  1.00 109.74 ? 46  CYS G C     1 
ATOM   9507  O O     . CYS I 3 43  ? 13.373  47.225   38.993  1.00 101.31 ? 46  CYS G O     1 
ATOM   9508  C CB    . CYS I 3 43  ? 12.346  47.986   42.000  1.00 112.54 ? 46  CYS G CB    1 
ATOM   9509  S SG    . CYS I 3 43  ? 11.173  47.554   43.314  1.00 115.87 ? 46  CYS G SG    1 
ATOM   9510  N N     . GLU I 3 44  ? 15.096  47.749   40.345  1.00 113.56 ? 47  GLU G N     1 
ATOM   9511  C CA    . GLU I 3 44  ? 15.979  48.194   39.260  1.00 119.61 ? 47  GLU G CA    1 
ATOM   9512  C C     . GLU I 3 44  ? 16.386  47.055   38.326  1.00 117.00 ? 47  GLU G C     1 
ATOM   9513  O O     . GLU I 3 44  ? 16.360  47.227   37.104  1.00 113.87 ? 47  GLU G O     1 
ATOM   9514  C CB    . GLU I 3 44  ? 17.239  48.883   39.816  1.00 128.39 ? 47  GLU G CB    1 
ATOM   9515  C CG    . GLU I 3 44  ? 17.002  50.267   40.416  1.00 132.89 ? 47  GLU G CG    1 
ATOM   9516  C CD    . GLU I 3 44  ? 18.154  50.743   41.288  1.00 136.37 ? 47  GLU G CD    1 
ATOM   9517  O OE1   . GLU I 3 44  ? 19.290  50.256   41.101  1.00 132.81 ? 47  GLU G OE1   1 
ATOM   9518  O OE2   . GLU I 3 44  ? 17.926  51.608   42.164  1.00 136.03 ? 47  GLU G OE2   1 
ATOM   9519  N N     . ARG I 3 45  ? 16.762  45.904   38.895  1.00 122.58 ? 48  ARG G N     1 
ATOM   9520  C CA    . ARG I 3 45  ? 17.233  44.753   38.084  1.00 122.48 ? 48  ARG G CA    1 
ATOM   9521  C C     . ARG I 3 45  ? 16.091  43.992   37.406  1.00 121.17 ? 48  ARG G C     1 
ATOM   9522  O O     . ARG I 3 45  ? 16.274  43.467   36.306  1.00 119.51 ? 48  ARG G O     1 
ATOM   9523  C CB    . ARG I 3 45  ? 18.163  43.780   38.854  1.00 117.27 ? 48  ARG G CB    1 
ATOM   9524  C CG    . ARG I 3 45  ? 18.116  43.829   40.373  1.00 115.97 ? 48  ARG G CG    1 
ATOM   9525  C CD    . ARG I 3 45  ? 18.761  42.614   41.030  1.00 115.79 ? 48  ARG G CD    1 
ATOM   9526  N NE    . ARG I 3 45  ? 20.184  42.805   41.338  1.00 112.78 ? 48  ARG G NE    1 
ATOM   9527  C CZ    . ARG I 3 45  ? 20.713  42.862   42.567  1.00 111.49 ? 48  ARG G CZ    1 
ATOM   9528  N NH1   . ARG I 3 45  ? 19.951  42.747   43.659  1.00 106.56 ? 48  ARG G NH1   1 
ATOM   9529  N NH2   . ARG I 3 45  ? 22.028  43.031   42.710  1.00 106.33 ? 48  ARG G NH2   1 
ATOM   9530  N N     . TRP I 3 46  ? 14.926  43.930   38.046  1.00 120.29 ? 49  TRP G N     1 
ATOM   9531  C CA    . TRP I 3 46  ? 13.749  43.324   37.413  1.00 129.89 ? 49  TRP G CA    1 
ATOM   9532  C C     . TRP I 3 46  ? 13.220  44.176   36.257  1.00 134.60 ? 49  TRP G C     1 
ATOM   9533  O O     . TRP I 3 46  ? 12.661  43.647   35.291  1.00 138.19 ? 49  TRP G O     1 
ATOM   9534  C CB    . TRP I 3 46  ? 12.651  43.025   38.441  1.00 135.37 ? 49  TRP G CB    1 
ATOM   9535  C CG    . TRP I 3 46  ? 12.826  41.666   39.040  1.00 145.75 ? 49  TRP G CG    1 
ATOM   9536  C CD1   . TRP I 3 46  ? 13.585  41.338   40.124  1.00 148.98 ? 49  TRP G CD1   1 
ATOM   9537  C CD2   . TRP I 3 46  ? 12.267  40.440   38.555  1.00 150.87 ? 49  TRP G CD2   1 
ATOM   9538  N NE1   . TRP I 3 46  ? 13.520  39.987   40.356  1.00 150.19 ? 49  TRP G NE1   1 
ATOM   9539  C CE2   . TRP I 3 46  ? 12.716  39.412   39.408  1.00 151.91 ? 49  TRP G CE2   1 
ATOM   9540  C CE3   . TRP I 3 46  ? 11.422  40.114   37.489  1.00 153.90 ? 49  TRP G CE3   1 
ATOM   9541  C CZ2   . TRP I 3 46  ? 12.346  38.078   39.229  1.00 153.32 ? 49  TRP G CZ2   1 
ATOM   9542  C CZ3   . TRP I 3 46  ? 11.057  38.792   37.311  1.00 153.80 ? 49  TRP G CZ3   1 
ATOM   9543  C CH2   . TRP I 3 46  ? 11.522  37.789   38.176  1.00 153.72 ? 49  TRP G CH2   1 
ATOM   9544  N N     . PHE I 3 47  ? 13.403  45.491   36.360  1.00 134.17 ? 50  PHE G N     1 
ATOM   9545  C CA    . PHE I 3 47  ? 13.175  46.386   35.229  1.00 128.89 ? 50  PHE G CA    1 
ATOM   9546  C C     . PHE I 3 47  ? 14.154  46.059   34.109  1.00 125.09 ? 50  PHE G C     1 
ATOM   9547  O O     . PHE I 3 47  ? 13.748  45.886   32.960  1.00 122.22 ? 50  PHE G O     1 
ATOM   9548  C CB    . PHE I 3 47  ? 13.327  47.852   35.651  1.00 132.81 ? 50  PHE G CB    1 
ATOM   9549  C CG    . PHE I 3 47  ? 12.031  48.514   36.032  1.00 134.52 ? 50  PHE G CG    1 
ATOM   9550  C CD1   . PHE I 3 47  ? 11.135  47.890   36.892  1.00 137.75 ? 50  PHE G CD1   1 
ATOM   9551  C CD2   . PHE I 3 47  ? 11.712  49.769   35.540  1.00 131.97 ? 50  PHE G CD2   1 
ATOM   9552  C CE1   . PHE I 3 47  ? 9.942   48.504   37.244  1.00 137.70 ? 50  PHE G CE1   1 
ATOM   9553  C CE2   . PHE I 3 47  ? 10.522  50.386   35.889  1.00 133.99 ? 50  PHE G CE2   1 
ATOM   9554  C CZ    . PHE I 3 47  ? 9.635   49.754   36.742  1.00 132.20 ? 50  PHE G CZ    1 
ATOM   9555  N N     . GLN I 3 48  ? 15.436  45.948   34.456  1.00 121.87 ? 51  GLN G N     1 
ATOM   9556  C CA    . GLN I 3 48  ? 16.484  45.648   33.477  1.00 125.64 ? 51  GLN G CA    1 
ATOM   9557  C C     . GLN I 3 48  ? 16.102  44.471   32.580  1.00 131.44 ? 51  GLN G C     1 
ATOM   9558  O O     . GLN I 3 48  ? 16.398  44.480   31.385  1.00 131.36 ? 51  GLN G O     1 
ATOM   9559  C CB    . GLN I 3 48  ? 17.825  45.363   34.169  1.00 127.31 ? 51  GLN G CB    1 
ATOM   9560  C CG    . GLN I 3 48  ? 19.033  45.623   33.278  1.00 133.71 ? 51  GLN G CG    1 
ATOM   9561  C CD    . GLN I 3 48  ? 20.354  45.190   33.897  1.00 139.12 ? 51  GLN G CD    1 
ATOM   9562  O OE1   . GLN I 3 48  ? 21.278  44.782   33.191  1.00 137.45 ? 51  GLN G OE1   1 
ATOM   9563  N NE2   . GLN I 3 48  ? 20.452  45.283   35.217  1.00 139.94 ? 51  GLN G NE2   1 
ATOM   9564  N N     . ARG I 3 49  ? 15.434  43.471   33.157  1.00 141.83 ? 52  ARG G N     1 
ATOM   9565  C CA    . ARG I 3 49  ? 15.051  42.263   32.420  1.00 146.52 ? 52  ARG G CA    1 
ATOM   9566  C C     . ARG I 3 49  ? 13.864  42.497   31.484  1.00 138.60 ? 52  ARG G C     1 
ATOM   9567  O O     . ARG I 3 49  ? 13.825  41.932   30.392  1.00 140.46 ? 52  ARG G O     1 
ATOM   9568  C CB    . ARG I 3 49  ? 14.740  41.104   33.381  1.00 154.51 ? 52  ARG G CB    1 
ATOM   9569  C CG    . ARG I 3 49  ? 14.910  39.723   32.753  1.00 157.66 ? 52  ARG G CG    1 
ATOM   9570  C CD    . ARG I 3 49  ? 14.105  38.642   33.468  1.00 156.84 ? 52  ARG G CD    1 
ATOM   9571  N NE    . ARG I 3 49  ? 14.667  38.273   34.766  1.00 152.76 ? 52  ARG G NE    1 
ATOM   9572  C CZ    . ARG I 3 49  ? 14.136  37.373   35.593  1.00 148.78 ? 52  ARG G CZ    1 
ATOM   9573  N NH1   . ARG I 3 49  ? 13.017  36.727   35.275  1.00 148.00 ? 52  ARG G NH1   1 
ATOM   9574  N NH2   . ARG I 3 49  ? 14.730  37.115   36.750  1.00 148.11 ? 52  ARG G NH2   1 
ATOM   9575  N N     . PHE I 3 50  ? 12.901  43.319   31.900  1.00 130.34 ? 53  PHE G N     1 
ATOM   9576  C CA    . PHE I 3 50  ? 11.752  43.620   31.037  1.00 133.96 ? 53  PHE G CA    1 
ATOM   9577  C C     . PHE I 3 50  ? 12.198  44.341   29.766  1.00 136.35 ? 53  PHE G C     1 
ATOM   9578  O O     . PHE I 3 50  ? 11.583  44.181   28.712  1.00 130.30 ? 53  PHE G O     1 
ATOM   9579  C CB    . PHE I 3 50  ? 10.695  44.470   31.753  1.00 136.83 ? 53  PHE G CB    1 
ATOM   9580  C CG    . PHE I 3 50  ? 10.217  43.899   33.063  1.00 138.80 ? 53  PHE G CG    1 
ATOM   9581  C CD1   . PHE I 3 50  ? 10.188  42.530   33.292  1.00 143.33 ? 53  PHE G CD1   1 
ATOM   9582  C CD2   . PHE I 3 50  ? 9.765   44.748   34.064  1.00 141.16 ? 53  PHE G CD2   1 
ATOM   9583  C CE1   . PHE I 3 50  ? 9.745   42.026   34.503  1.00 145.29 ? 53  PHE G CE1   1 
ATOM   9584  C CE2   . PHE I 3 50  ? 9.312   44.248   35.272  1.00 140.76 ? 53  PHE G CE2   1 
ATOM   9585  C CZ    . PHE I 3 50  ? 9.302   42.885   35.493  1.00 141.19 ? 53  PHE G CZ    1 
ATOM   9586  N N     . LYS I 3 51  ? 13.267  45.130   29.876  1.00 146.05 ? 54  LYS G N     1 
ATOM   9587  C CA    . LYS I 3 51  ? 13.856  45.820   28.725  1.00 156.14 ? 54  LYS G CA    1 
ATOM   9588  C C     . LYS I 3 51  ? 14.494  44.845   27.734  1.00 157.51 ? 54  LYS G C     1 
ATOM   9589  O O     . LYS I 3 51  ? 14.492  45.094   26.527  1.00 156.80 ? 54  LYS G O     1 
ATOM   9590  C CB    . LYS I 3 51  ? 14.897  46.847   29.185  1.00 162.64 ? 54  LYS G CB    1 
ATOM   9591  C CG    . LYS I 3 51  ? 14.311  47.987   30.003  1.00 168.99 ? 54  LYS G CG    1 
ATOM   9592  C CD    . LYS I 3 51  ? 15.363  49.018   30.379  1.00 170.87 ? 54  LYS G CD    1 
ATOM   9593  C CE    . LYS I 3 51  ? 14.778  50.106   31.268  1.00 170.82 ? 54  LYS G CE    1 
ATOM   9594  N NZ    . LYS I 3 51  ? 15.825  50.772   32.090  1.00 171.16 ? 54  LYS G NZ    1 
ATOM   9595  N N     . SER I 3 52  ? 15.044  43.745   28.245  1.00 158.92 ? 55  SER G N     1 
ATOM   9596  C CA    . SER I 3 52  ? 15.567  42.680   27.389  1.00 159.28 ? 55  SER G CA    1 
ATOM   9597  C C     . SER I 3 52  ? 14.446  42.046   26.566  1.00 157.60 ? 55  SER G C     1 
ATOM   9598  O O     . SER I 3 52  ? 14.666  41.638   25.425  1.00 154.97 ? 55  SER G O     1 
ATOM   9599  C CB    . SER I 3 52  ? 16.284  41.611   28.218  1.00 159.70 ? 55  SER G CB    1 
ATOM   9600  O OG    . SER I 3 52  ? 16.861  40.623   27.381  1.00 157.20 ? 55  SER G OG    1 
ATOM   9601  N N     . GLY I 3 53  ? 13.252  41.959   27.152  1.00 159.63 ? 56  GLY G N     1 
ATOM   9602  C CA    . GLY I 3 53  ? 12.058  41.541   26.419  1.00 162.23 ? 56  GLY G CA    1 
ATOM   9603  C C     . GLY I 3 53  ? 11.194  40.482   27.082  1.00 160.76 ? 56  GLY G C     1 
ATOM   9604  O O     . GLY I 3 53  ? 10.027  40.334   26.718  1.00 151.20 ? 56  GLY G O     1 
ATOM   9605  N N     . ASP I 3 54  ? 11.753  39.736   28.037  1.00 160.65 ? 57  ASP G N     1 
ATOM   9606  C CA    . ASP I 3 54  ? 11.009  38.653   28.686  1.00 160.39 ? 57  ASP G CA    1 
ATOM   9607  C C     . ASP I 3 54  ? 10.318  39.153   29.955  1.00 152.15 ? 57  ASP G C     1 
ATOM   9608  O O     . ASP I 3 54  ? 10.920  39.851   30.774  1.00 146.32 ? 57  ASP G O     1 
ATOM   9609  C CB    . ASP I 3 54  ? 11.908  37.431   28.952  1.00 164.71 ? 57  ASP G CB    1 
ATOM   9610  C CG    . ASP I 3 54  ? 12.624  37.490   30.285  1.00 167.80 ? 57  ASP G CG    1 
ATOM   9611  O OD1   . ASP I 3 54  ? 11.996  37.157   31.314  1.00 167.80 ? 57  ASP G OD1   1 
ATOM   9612  O OD2   . ASP I 3 54  ? 13.824  37.835   30.296  1.00 168.53 ? 57  ASP G OD2   1 
ATOM   9613  N N     . PHE I 3 55  ? 9.041   38.805   30.087  1.00 147.27 ? 58  PHE G N     1 
ATOM   9614  C CA    . PHE I 3 55  ? 8.204   39.274   31.183  1.00 145.05 ? 58  PHE G CA    1 
ATOM   9615  C C     . PHE I 3 55  ? 7.795   38.073   32.032  1.00 143.35 ? 58  PHE G C     1 
ATOM   9616  O O     . PHE I 3 55  ? 6.653   37.965   32.496  1.00 130.99 ? 58  PHE G O     1 
ATOM   9617  C CB    . PHE I 3 55  ? 6.998   40.032   30.622  1.00 147.56 ? 58  PHE G CB    1 
ATOM   9618  C CG    . PHE I 3 55  ? 7.357   41.369   30.015  1.00 154.12 ? 58  PHE G CG    1 
ATOM   9619  C CD1   . PHE I 3 55  ? 8.283   41.456   28.986  1.00 154.63 ? 58  PHE G CD1   1 
ATOM   9620  C CD2   . PHE I 3 55  ? 6.779   42.541   30.475  1.00 155.99 ? 58  PHE G CD2   1 
ATOM   9621  C CE1   . PHE I 3 55  ? 8.628   42.676   28.430  1.00 152.03 ? 58  PHE G CE1   1 
ATOM   9622  C CE2   . PHE I 3 55  ? 7.116   43.766   29.919  1.00 154.05 ? 58  PHE G CE2   1 
ATOM   9623  C CZ    . PHE I 3 55  ? 8.042   43.834   28.897  1.00 152.02 ? 58  PHE G CZ    1 
ATOM   9624  N N     . ASP I 3 56  ? 8.769   37.185   32.235  1.00 147.09 ? 59  ASP G N     1 
ATOM   9625  C CA    . ASP I 3 56  ? 8.585   35.945   32.976  1.00 150.78 ? 59  ASP G CA    1 
ATOM   9626  C C     . ASP I 3 56  ? 8.542   36.241   34.468  1.00 146.76 ? 59  ASP G C     1 
ATOM   9627  O O     . ASP I 3 56  ? 9.431   36.906   34.997  1.00 150.05 ? 59  ASP G O     1 
ATOM   9628  C CB    . ASP I 3 56  ? 9.735   34.981   32.669  1.00 153.23 ? 59  ASP G CB    1 
ATOM   9629  C CG    . ASP I 3 56  ? 9.636   33.683   33.443  1.00 155.25 ? 59  ASP G CG    1 
ATOM   9630  O OD1   . ASP I 3 56  ? 8.515   33.145   33.570  1.00 153.35 ? 59  ASP G OD1   1 
ATOM   9631  O OD2   . ASP I 3 56  ? 10.686  33.201   33.917  1.00 158.81 ? 59  ASP G OD2   1 
ATOM   9632  N N     . VAL I 3 57  ? 7.520   35.719   35.140  1.00 140.52 ? 60  VAL G N     1 
ATOM   9633  C CA    . VAL I 3 57  ? 7.269   36.033   36.548  1.00 138.96 ? 60  VAL G CA    1 
ATOM   9634  C C     . VAL I 3 57  ? 7.929   35.010   37.489  1.00 140.14 ? 60  VAL G C     1 
ATOM   9635  O O     . VAL I 3 57  ? 8.245   35.331   38.637  1.00 142.36 ? 60  VAL G O     1 
ATOM   9636  C CB    . VAL I 3 57  ? 5.752   36.094   36.853  1.00 138.69 ? 60  VAL G CB    1 
ATOM   9637  C CG1   . VAL I 3 57  ? 5.489   36.976   38.068  1.00 135.75 ? 60  VAL G CG1   1 
ATOM   9638  C CG2   . VAL I 3 57  ? 4.967   36.606   35.651  1.00 137.54 ? 60  VAL G CG2   1 
ATOM   9639  N N     . ASP I 3 58  ? 8.123   33.784   37.003  1.00 138.46 ? 61  ASP G N     1 
ATOM   9640  C CA    . ASP I 3 58  ? 8.788   32.730   37.775  1.00 129.24 ? 61  ASP G CA    1 
ATOM   9641  C C     . ASP I 3 58  ? 10.299  32.904   37.669  1.00 118.11 ? 61  ASP G C     1 
ATOM   9642  O O     . ASP I 3 58  ? 10.792  33.554   36.748  1.00 112.85 ? 61  ASP G O     1 
ATOM   9643  C CB    . ASP I 3 58  ? 8.385   31.338   37.262  1.00 130.01 ? 61  ASP G CB    1 
ATOM   9644  C CG    . ASP I 3 58  ? 6.882   31.079   37.358  1.00 129.33 ? 61  ASP G CG    1 
ATOM   9645  O OD1   . ASP I 3 58  ? 6.300   31.296   38.444  1.00 126.10 ? 61  ASP G OD1   1 
ATOM   9646  O OD2   . ASP I 3 58  ? 6.286   30.646   36.347  1.00 123.01 ? 61  ASP G OD2   1 
ATOM   9647  N N     . ASP I 3 59  ? 11.029  32.313   38.607  1.00 113.81 ? 62  ASP G N     1 
ATOM   9648  C CA    . ASP I 3 59  ? 12.484  32.415   38.621  1.00 113.25 ? 62  ASP G CA    1 
ATOM   9649  C C     . ASP I 3 59  ? 13.071  31.524   37.543  1.00 112.87 ? 62  ASP G C     1 
ATOM   9650  O O     . ASP I 3 59  ? 12.463  30.531   37.161  1.00 113.05 ? 62  ASP G O     1 
ATOM   9651  C CB    . ASP I 3 59  ? 13.059  31.978   39.974  1.00 120.95 ? 62  ASP G CB    1 
ATOM   9652  C CG    . ASP I 3 59  ? 12.427  32.706   41.161  1.00 128.76 ? 62  ASP G CG    1 
ATOM   9653  O OD1   . ASP I 3 59  ? 11.204  32.965   41.131  1.00 130.57 ? 62  ASP G OD1   1 
ATOM   9654  O OD2   . ASP I 3 59  ? 13.152  32.996   42.138  1.00 130.68 ? 62  ASP G OD2   1 
ATOM   9655  N N     . LYS I 3 60  ? 14.250  31.887   37.047  1.00 121.47 ? 63  LYS G N     1 
ATOM   9656  C CA    . LYS I 3 60  ? 15.082  30.957   36.280  1.00 127.20 ? 63  LYS G CA    1 
ATOM   9657  C C     . LYS I 3 60  ? 15.447  29.804   37.201  1.00 134.74 ? 63  LYS G C     1 
ATOM   9658  O O     . LYS I 3 60  ? 15.533  29.985   38.419  1.00 137.27 ? 63  LYS G O     1 
ATOM   9659  C CB    . LYS I 3 60  ? 16.360  31.630   35.752  1.00 125.10 ? 63  LYS G CB    1 
ATOM   9660  C CG    . LYS I 3 60  ? 16.246  32.189   34.345  1.00 125.50 ? 63  LYS G CG    1 
ATOM   9661  C CD    . LYS I 3 60  ? 15.070  33.145   34.200  1.00 127.78 ? 63  LYS G CD    1 
ATOM   9662  C CE    . LYS I 3 60  ? 14.853  33.534   32.746  1.00 130.74 ? 63  LYS G CE    1 
ATOM   9663  N NZ    . LYS I 3 60  ? 13.421  33.812   32.450  1.00 131.26 ? 63  LYS G NZ    1 
ATOM   9664  N N     . GLU I 3 61  ? 15.660  28.625   36.622  1.00 138.72 ? 64  GLU G N     1 
ATOM   9665  C CA    . GLU I 3 61  ? 15.930  27.430   37.414  1.00 138.19 ? 64  GLU G CA    1 
ATOM   9666  C C     . GLU I 3 61  ? 17.158  27.646   38.292  1.00 132.44 ? 64  GLU G C     1 
ATOM   9667  O O     . GLU I 3 61  ? 18.211  28.047   37.796  1.00 126.75 ? 64  GLU G O     1 
ATOM   9668  C CB    . GLU I 3 61  ? 16.137  26.209   36.515  1.00 143.80 ? 64  GLU G CB    1 
ATOM   9669  C CG    . GLU I 3 61  ? 16.166  24.890   37.278  1.00 144.16 ? 64  GLU G CG    1 
ATOM   9670  C CD    . GLU I 3 61  ? 16.272  23.685   36.367  1.00 140.14 ? 64  GLU G CD    1 
ATOM   9671  O OE1   . GLU I 3 61  ? 17.272  22.946   36.476  1.00 137.40 ? 64  GLU G OE1   1 
ATOM   9672  O OE2   . GLU I 3 61  ? 15.359  23.482   35.538  1.00 138.97 ? 64  GLU G OE2   1 
ATOM   9673  N N     . HIS I 3 62  ? 17.003  27.378   39.589  1.00 127.69 ? 65  HIS G N     1 
ATOM   9674  C CA    . HIS I 3 62  ? 18.070  27.571   40.573  1.00 124.92 ? 65  HIS G CA    1 
ATOM   9675  C C     . HIS I 3 62  ? 19.214  26.592   40.346  1.00 125.98 ? 65  HIS G C     1 
ATOM   9676  O O     . HIS I 3 62  ? 19.146  25.724   39.473  1.00 122.16 ? 65  HIS G O     1 
ATOM   9677  C CB    . HIS I 3 62  ? 17.537  27.358   41.992  1.00 123.70 ? 65  HIS G CB    1 
ATOM   9678  C CG    . HIS I 3 62  ? 16.597  28.421   42.459  1.00 126.06 ? 65  HIS G CG    1 
ATOM   9679  N ND1   . HIS I 3 62  ? 16.578  28.870   43.761  1.00 126.69 ? 65  HIS G ND1   1 
ATOM   9680  C CD2   . HIS I 3 62  ? 15.641  29.122   41.806  1.00 128.08 ? 65  HIS G CD2   1 
ATOM   9681  C CE1   . HIS I 3 62  ? 15.647  29.798   43.891  1.00 126.35 ? 65  HIS G CE1   1 
ATOM   9682  N NE2   . HIS I 3 62  ? 15.065  29.971   42.719  1.00 127.28 ? 65  HIS G NE2   1 
ATOM   9683  N N     . GLY I 3 63  ? 20.268  26.742   41.139  1.00 127.03 ? 66  GLY G N     1 
ATOM   9684  C CA    . GLY I 3 63  ? 21.336  25.757   41.181  1.00 128.90 ? 66  GLY G CA    1 
ATOM   9685  C C     . GLY I 3 63  ? 20.783  24.460   41.731  1.00 130.79 ? 66  GLY G C     1 
ATOM   9686  O O     . GLY I 3 63  ? 19.858  24.464   42.550  1.00 128.04 ? 66  GLY G O     1 
ATOM   9687  N N     . LYS I 3 64  ? 21.337  23.348   41.266  1.00 130.43 ? 67  LYS G N     1 
ATOM   9688  C CA    . LYS I 3 64  ? 20.870  22.036   41.678  1.00 127.51 ? 67  LYS G CA    1 
ATOM   9689  C C     . LYS I 3 64  ? 22.063  21.092   41.779  1.00 126.51 ? 67  LYS G C     1 
ATOM   9690  O O     . LYS I 3 64  ? 23.084  21.329   41.123  1.00 124.88 ? 67  LYS G O     1 
ATOM   9691  C CB    . LYS I 3 64  ? 19.858  21.509   40.665  1.00 130.64 ? 67  LYS G CB    1 
ATOM   9692  C CG    . LYS I 3 64  ? 20.479  21.123   39.331  1.00 133.39 ? 67  LYS G CG    1 
ATOM   9693  C CD    . LYS I 3 64  ? 19.448  21.048   38.218  1.00 136.06 ? 67  LYS G CD    1 
ATOM   9694  C CE    . LYS I 3 64  ? 19.873  20.053   37.147  1.00 138.40 ? 67  LYS G CE    1 
ATOM   9695  N NZ    . LYS I 3 64  ? 18.807  19.840   36.132  1.00 140.44 ? 67  LYS G NZ    1 
ATOM   9696  N N     . PRO I 3 65  ? 21.941  20.017   42.587  1.00 119.17 ? 68  PRO G N     1 
ATOM   9697  C CA    . PRO I 3 65  ? 23.058  19.086   42.736  1.00 113.99 ? 68  PRO G CA    1 
ATOM   9698  C C     . PRO I 3 65  ? 23.276  18.252   41.467  1.00 112.28 ? 68  PRO G C     1 
ATOM   9699  O O     . PRO I 3 65  ? 22.326  18.021   40.716  1.00 108.81 ? 68  PRO G O     1 
ATOM   9700  C CB    . PRO I 3 65  ? 22.627  18.198   43.917  1.00 112.49 ? 68  PRO G CB    1 
ATOM   9701  C CG    . PRO I 3 65  ? 21.389  18.821   44.486  1.00 108.78 ? 68  PRO G CG    1 
ATOM   9702  C CD    . PRO I 3 65  ? 20.768  19.565   43.350  1.00 110.91 ? 68  PRO G CD    1 
ATOM   9703  N N     . PRO I 3 66  ? 24.522  17.807   41.224  1.00 114.02 ? 69  PRO G N     1 
ATOM   9704  C CA    . PRO I 3 66  ? 24.805  17.035   40.016  1.00 118.69 ? 69  PRO G CA    1 
ATOM   9705  C C     . PRO I 3 66  ? 24.219  15.621   40.098  1.00 128.61 ? 69  PRO G C     1 
ATOM   9706  O O     . PRO I 3 66  ? 24.008  15.101   41.196  1.00 138.88 ? 69  PRO G O     1 
ATOM   9707  C CB    . PRO I 3 66  ? 26.334  16.989   39.988  1.00 116.68 ? 69  PRO G CB    1 
ATOM   9708  C CG    . PRO I 3 66  ? 26.734  17.042   41.426  1.00 116.31 ? 69  PRO G CG    1 
ATOM   9709  C CD    . PRO I 3 66  ? 25.678  17.841   42.142  1.00 114.98 ? 69  PRO G CD    1 
ATOM   9710  N N     . LYS I 3 67  ? 23.956  15.009   38.948  1.00 129.48 ? 70  LYS G N     1 
ATOM   9711  C CA    . LYS I 3 67  ? 23.447  13.638   38.910  1.00 124.60 ? 70  LYS G CA    1 
ATOM   9712  C C     . LYS I 3 67  ? 24.558  12.622   39.204  1.00 123.56 ? 70  LYS G C     1 
ATOM   9713  O O     . LYS I 3 67  ? 25.660  12.716   38.654  1.00 119.75 ? 70  LYS G O     1 
ATOM   9714  C CB    . LYS I 3 67  ? 22.805  13.343   37.553  1.00 124.49 ? 70  LYS G CB    1 
ATOM   9715  C CG    . LYS I 3 67  ? 21.472  14.042   37.346  1.00 123.21 ? 70  LYS G CG    1 
ATOM   9716  C CD    . LYS I 3 67  ? 20.880  13.728   35.983  1.00 120.18 ? 70  LYS G CD    1 
ATOM   9717  C CE    . LYS I 3 67  ? 19.446  14.218   35.886  1.00 121.34 ? 70  LYS G CE    1 
ATOM   9718  N NZ    . LYS I 3 67  ? 18.879  13.974   34.534  1.00 124.58 ? 70  LYS G NZ    1 
ATOM   9719  N N     . ARG I 3 68  ? 24.252  11.650   40.064  1.00 122.99 ? 71  ARG G N     1 
ATOM   9720  C CA    . ARG I 3 68  ? 25.216  10.613   40.466  1.00 119.67 ? 71  ARG G CA    1 
ATOM   9721  C C     . ARG I 3 68  ? 25.388  9.583    39.342  1.00 118.03 ? 71  ARG G C     1 
ATOM   9722  O O     . ARG I 3 68  ? 26.476  9.035    39.150  1.00 122.49 ? 71  ARG G O     1 
ATOM   9723  C CB    . ARG I 3 68  ? 24.761  9.902    41.750  1.00 113.63 ? 71  ARG G CB    1 
ATOM   9724  C CG    . ARG I 3 68  ? 24.258  10.812   42.869  1.00 107.68 ? 71  ARG G CG    1 
ATOM   9725  C CD    . ARG I 3 68  ? 25.157  10.847   44.093  1.00 102.77 ? 71  ARG G CD    1 
ATOM   9726  N NE    . ARG I 3 68  ? 24.441  11.430   45.230  1.00 102.48 ? 71  ARG G NE    1 
ATOM   9727  C CZ    . ARG I 3 68  ? 24.824  11.347   46.504  1.00 105.93 ? 71  ARG G CZ    1 
ATOM   9728  N NH1   . ARG I 3 68  ? 25.936  10.705   46.844  1.00 108.65 ? 71  ARG G NH1   1 
ATOM   9729  N NH2   . ARG I 3 68  ? 24.085  11.913   47.454  1.00 107.97 ? 71  ARG G NH2   1 
ATOM   9730  N N     . TYR I 3 69  ? 24.297  9.323    38.620  1.00 114.74 ? 72  TYR G N     1 
ATOM   9731  C CA    . TYR I 3 69  ? 24.298  8.451    37.441  1.00 112.21 ? 72  TYR G CA    1 
ATOM   9732  C C     . TYR I 3 69  ? 23.338  9.014    36.397  1.00 113.83 ? 72  TYR G C     1 
ATOM   9733  O O     . TYR I 3 69  ? 22.424  9.759    36.737  1.00 107.30 ? 72  TYR G O     1 
ATOM   9734  C CB    . TYR I 3 69  ? 23.867  7.025    37.817  1.00 104.37 ? 72  TYR G CB    1 
ATOM   9735  C CG    . TYR I 3 69  ? 22.466  6.940    38.401  1.00 95.00  ? 72  TYR G CG    1 
ATOM   9736  C CD1   . TYR I 3 69  ? 22.241  7.199    39.752  1.00 91.12  ? 72  TYR G CD1   1 
ATOM   9737  C CD2   . TYR I 3 69  ? 21.369  6.606    37.602  1.00 85.43  ? 72  TYR G CD2   1 
ATOM   9738  C CE1   . TYR I 3 69  ? 20.969  7.130    40.289  1.00 90.54  ? 72  TYR G CE1   1 
ATOM   9739  C CE2   . TYR I 3 69  ? 20.092  6.531    38.130  1.00 82.18  ? 72  TYR G CE2   1 
ATOM   9740  C CZ    . TYR I 3 69  ? 19.897  6.796    39.474  1.00 90.12  ? 72  TYR G CZ    1 
ATOM   9741  O OH    . TYR I 3 69  ? 18.633  6.727    40.027  1.00 94.72  ? 72  TYR G OH    1 
ATOM   9742  N N     . GLU I 3 70  ? 23.534  8.643    35.136  1.00 118.79 ? 73  GLU G N     1 
ATOM   9743  C CA    . GLU I 3 70  ? 22.676  9.118    34.048  1.00 126.07 ? 73  GLU G CA    1 
ATOM   9744  C C     . GLU I 3 70  ? 21.466  8.228    33.841  1.00 125.88 ? 73  GLU G C     1 
ATOM   9745  O O     . GLU I 3 70  ? 21.347  7.175    34.454  1.00 132.32 ? 73  GLU G O     1 
ATOM   9746  C CB    . GLU I 3 70  ? 23.469  9.178    32.749  1.00 130.49 ? 73  GLU G CB    1 
ATOM   9747  C CG    . GLU I 3 70  ? 24.464  10.315   32.714  1.00 136.64 ? 73  GLU G CG    1 
ATOM   9748  C CD    . GLU I 3 70  ? 25.802  9.874    32.176  1.00 140.68 ? 73  GLU G CD    1 
ATOM   9749  O OE1   . GLU I 3 70  ? 26.822  10.132   32.847  1.00 147.23 ? 73  GLU G OE1   1 
ATOM   9750  O OE2   . GLU I 3 70  ? 25.827  9.253    31.094  1.00 143.10 ? 73  GLU G OE2   1 
ATOM   9751  N N     . ASP I 3 71  ? 20.571  8.663    32.963  1.00 127.64 ? 74  ASP G N     1 
ATOM   9752  C CA    . ASP I 3 71  ? 19.451  7.836    32.541  1.00 130.08 ? 74  ASP G CA    1 
ATOM   9753  C C     . ASP I 3 71  ? 19.936  6.666    31.679  1.00 127.81 ? 74  ASP G C     1 
ATOM   9754  O O     . ASP I 3 71  ? 19.455  5.545    31.832  1.00 138.53 ? 74  ASP G O     1 
ATOM   9755  C CB    . ASP I 3 71  ? 18.411  8.678    31.788  1.00 132.91 ? 74  ASP G CB    1 
ATOM   9756  C CG    . ASP I 3 71  ? 17.683  9.663    32.698  1.00 135.97 ? 74  ASP G CG    1 
ATOM   9757  O OD1   . ASP I 3 71  ? 18.193  9.952    33.806  1.00 137.79 ? 74  ASP G OD1   1 
ATOM   9758  O OD2   . ASP I 3 71  ? 16.598  10.147   32.305  1.00 132.44 ? 74  ASP G OD2   1 
ATOM   9759  N N     . ALA I 3 72  ? 20.897  6.924    30.792  1.00 125.31 ? 75  ALA G N     1 
ATOM   9760  C CA    . ALA I 3 72  ? 21.436  5.888    29.899  1.00 123.81 ? 75  ALA G CA    1 
ATOM   9761  C C     . ALA I 3 72  ? 22.404  4.938    30.611  1.00 124.46 ? 75  ALA G C     1 
ATOM   9762  O O     . ALA I 3 72  ? 22.707  3.854    30.101  1.00 124.34 ? 75  ALA G O     1 
ATOM   9763  C CB    . ALA I 3 72  ? 22.117  6.522    28.693  1.00 122.48 ? 75  ALA G CB    1 
ATOM   9764  N N     . GLU I 3 73  ? 22.894  5.351    31.776  1.00 124.12 ? 76  GLU G N     1 
ATOM   9765  C CA    . GLU I 3 73  ? 23.750  4.502    32.604  1.00 126.75 ? 76  GLU G CA    1 
ATOM   9766  C C     . GLU I 3 73  ? 22.918  3.329    33.117  1.00 122.07 ? 76  GLU G C     1 
ATOM   9767  O O     . GLU I 3 73  ? 23.335  2.174    33.044  1.00 117.89 ? 76  GLU G O     1 
ATOM   9768  C CB    . GLU I 3 73  ? 24.325  5.310    33.777  1.00 133.03 ? 76  GLU G CB    1 
ATOM   9769  C CG    . GLU I 3 73  ? 25.722  4.901    34.224  1.00 134.09 ? 76  GLU G CG    1 
ATOM   9770  C CD    . GLU I 3 73  ? 26.307  5.850    35.262  1.00 135.78 ? 76  GLU G CD    1 
ATOM   9771  O OE1   . GLU I 3 73  ? 26.232  7.083    35.069  1.00 131.44 ? 76  GLU G OE1   1 
ATOM   9772  O OE2   . GLU I 3 73  ? 26.850  5.365    36.275  1.00 138.09 ? 76  GLU G OE2   1 
ATOM   9773  N N     . LEU I 3 74  ? 21.728  3.654    33.613  1.00 120.57 ? 77  LEU G N     1 
ATOM   9774  C CA    . LEU I 3 74  ? 20.766  2.666    34.091  1.00 120.62 ? 77  LEU G CA    1 
ATOM   9775  C C     . LEU I 3 74  ? 20.236  1.818    32.935  1.00 118.51 ? 77  LEU G C     1 
ATOM   9776  O O     . LEU I 3 74  ? 20.224  0.594    33.018  1.00 123.40 ? 77  LEU G O     1 
ATOM   9777  C CB    . LEU I 3 74  ? 19.602  3.371    34.796  1.00 121.96 ? 77  LEU G CB    1 
ATOM   9778  C CG    . LEU I 3 74  ? 18.789  2.589    35.828  1.00 123.17 ? 77  LEU G CG    1 
ATOM   9779  C CD1   . LEU I 3 74  ? 17.795  3.521    36.503  1.00 127.60 ? 77  LEU G CD1   1 
ATOM   9780  C CD2   . LEU I 3 74  ? 18.066  1.405    35.207  1.00 123.63 ? 77  LEU G CD2   1 
ATOM   9781  N N     . GLN I 3 75  ? 19.808  2.473    31.859  1.00 114.05 ? 78  GLN G N     1 
ATOM   9782  C CA    . GLN I 3 75  ? 19.237  1.777    30.697  1.00 115.33 ? 78  GLN G CA    1 
ATOM   9783  C C     . GLN I 3 75  ? 20.190  0.711    30.126  1.00 118.25 ? 78  GLN G C     1 
ATOM   9784  O O     . GLN I 3 75  ? 19.741  -0.291   29.571  1.00 117.62 ? 78  GLN G O     1 
ATOM   9785  C CB    . GLN I 3 75  ? 18.851  2.779    29.599  1.00 116.25 ? 78  GLN G CB    1 
ATOM   9786  C CG    . GLN I 3 75  ? 17.388  2.730    29.171  1.00 117.23 ? 78  GLN G CG    1 
ATOM   9787  C CD    . GLN I 3 75  ? 16.957  1.394    28.590  1.00 116.99 ? 78  GLN G CD    1 
ATOM   9788  O OE1   . GLN I 3 75  ? 15.931  0.847    28.985  1.00 114.97 ? 78  GLN G OE1   1 
ATOM   9789  N NE2   . GLN I 3 75  ? 17.726  0.868    27.644  1.00 117.19 ? 78  GLN G NE2   1 
ATOM   9790  N N     . ALA I 3 76  ? 21.497  0.929    30.260  1.00 121.99 ? 79  ALA G N     1 
ATOM   9791  C CA    . ALA I 3 76  ? 22.486  -0.086   29.897  1.00 121.52 ? 79  ALA G CA    1 
ATOM   9792  C C     . ALA I 3 76  ? 22.284  -1.349   30.723  1.00 119.19 ? 79  ALA G C     1 
ATOM   9793  O O     . ALA I 3 76  ? 22.362  -2.451   30.191  1.00 127.13 ? 79  ALA G O     1 
ATOM   9794  C CB    . ALA I 3 76  ? 23.898  0.444    30.095  1.00 123.64 ? 79  ALA G CB    1 
ATOM   9795  N N     . LEU I 3 77  ? 22.026  -1.173   32.020  1.00 115.13 ? 80  LEU G N     1 
ATOM   9796  C CA    . LEU I 3 77  ? 21.785  -2.293   32.943  1.00 110.01 ? 80  LEU G CA    1 
ATOM   9797  C C     . LEU I 3 77  ? 20.521  -3.078   32.611  1.00 109.58 ? 80  LEU G C     1 
ATOM   9798  O O     . LEU I 3 77  ? 20.466  -4.286   32.825  1.00 116.84 ? 80  LEU G O     1 
ATOM   9799  C CB    . LEU I 3 77  ? 21.691  -1.802   34.393  1.00 107.68 ? 80  LEU G CB    1 
ATOM   9800  C CG    . LEU I 3 77  ? 22.995  -1.604   35.169  1.00 109.32 ? 80  LEU G CG    1 
ATOM   9801  C CD1   . LEU I 3 77  ? 24.016  -0.795   34.386  1.00 111.98 ? 80  LEU G CD1   1 
ATOM   9802  C CD2   . LEU I 3 77  ? 22.696  -0.943   36.508  1.00 106.38 ? 80  LEU G CD2   1 
ATOM   9803  N N     . LEU I 3 78  ? 19.503  -2.390   32.106  1.00 110.21 ? 81  LEU G N     1 
ATOM   9804  C CA    . LEU I 3 78  ? 18.249  -3.043   31.737  1.00 112.71 ? 81  LEU G CA    1 
ATOM   9805  C C     . LEU I 3 78  ? 18.358  -3.758   30.391  1.00 116.90 ? 81  LEU G C     1 
ATOM   9806  O O     . LEU I 3 78  ? 17.642  -4.722   30.139  1.00 124.43 ? 81  LEU G O     1 
ATOM   9807  C CB    . LEU I 3 78  ? 17.105  -2.029   31.707  1.00 110.28 ? 81  LEU G CB    1 
ATOM   9808  C CG    . LEU I 3 78  ? 16.850  -1.285   33.020  1.00 107.10 ? 81  LEU G CG    1 
ATOM   9809  C CD1   . LEU I 3 78  ? 15.719  -0.282   32.846  1.00 107.04 ? 81  LEU G CD1   1 
ATOM   9810  C CD2   . LEU I 3 78  ? 16.549  -2.257   34.155  1.00 106.01 ? 81  LEU G CD2   1 
ATOM   9811  N N     . ASP I 3 79  ? 19.250  -3.284   29.529  1.00 122.61 ? 82  ASP G N     1 
ATOM   9812  C CA    . ASP I 3 79  ? 19.536  -3.973   28.275  1.00 130.39 ? 82  ASP G CA    1 
ATOM   9813  C C     . ASP I 3 79  ? 20.309  -5.262   28.536  1.00 127.25 ? 82  ASP G C     1 
ATOM   9814  O O     . ASP I 3 79  ? 20.179  -6.229   27.786  1.00 126.27 ? 82  ASP G O     1 
ATOM   9815  C CB    . ASP I 3 79  ? 20.328  -3.066   27.330  1.00 141.46 ? 82  ASP G CB    1 
ATOM   9816  C CG    . ASP I 3 79  ? 19.548  -1.829   26.913  1.00 147.26 ? 82  ASP G CG    1 
ATOM   9817  O OD1   . ASP I 3 79  ? 18.303  -1.820   27.047  1.00 145.03 ? 82  ASP G OD1   1 
ATOM   9818  O OD2   . ASP I 3 79  ? 20.188  -0.858   26.454  1.00 156.33 ? 82  ASP G OD2   1 
ATOM   9819  N N     . GLU I 3 80  ? 21.116  -5.266   29.596  1.00 128.82 ? 83  GLU G N     1 
ATOM   9820  C CA    . GLU I 3 80  ? 21.815  -6.470   30.042  1.00 133.26 ? 83  GLU G CA    1 
ATOM   9821  C C     . GLU I 3 80  ? 20.814  -7.480   30.583  1.00 133.61 ? 83  GLU G C     1 
ATOM   9822  O O     . GLU I 3 80  ? 20.764  -8.625   30.128  1.00 138.03 ? 83  GLU G O     1 
ATOM   9823  C CB    . GLU I 3 80  ? 22.813  -6.142   31.158  1.00 136.33 ? 83  GLU G CB    1 
ATOM   9824  C CG    . GLU I 3 80  ? 23.926  -5.180   30.780  1.00 140.94 ? 83  GLU G CG    1 
ATOM   9825  C CD    . GLU I 3 80  ? 25.292  -5.840   30.769  1.00 144.64 ? 83  GLU G CD    1 
ATOM   9826  O OE1   . GLU I 3 80  ? 25.766  -6.224   31.859  1.00 147.34 ? 83  GLU G OE1   1 
ATOM   9827  O OE2   . GLU I 3 80  ? 25.894  -5.969   29.680  1.00 139.68 ? 83  GLU G OE2   1 
ATOM   9828  N N     . ASP I 3 81  ? 20.021  -7.037   31.556  1.00 128.94 ? 84  ASP G N     1 
ATOM   9829  C CA    . ASP I 3 81  ? 19.100  -7.908   32.276  1.00 126.35 ? 84  ASP G CA    1 
ATOM   9830  C C     . ASP I 3 81  ? 17.807  -7.158   32.625  1.00 121.83 ? 84  ASP G C     1 
ATOM   9831  O O     . ASP I 3 81  ? 17.720  -6.462   33.639  1.00 113.66 ? 84  ASP G O     1 
ATOM   9832  C CB    . ASP I 3 81  ? 19.792  -8.443   33.534  1.00 129.68 ? 84  ASP G CB    1 
ATOM   9833  C CG    . ASP I 3 81  ? 18.970  -9.484   34.270  1.00 133.37 ? 84  ASP G CG    1 
ATOM   9834  O OD1   . ASP I 3 81  ? 17.920  -9.919   33.750  1.00 137.78 ? 84  ASP G OD1   1 
ATOM   9835  O OD2   . ASP I 3 81  ? 19.387  -9.873   35.383  1.00 138.58 ? 84  ASP G OD2   1 
ATOM   9836  N N     . ASP I 3 82  ? 16.802  -7.330   31.770  1.00 119.81 ? 85  ASP G N     1 
ATOM   9837  C CA    . ASP I 3 82  ? 15.512  -6.647   31.902  1.00 120.27 ? 85  ASP G CA    1 
ATOM   9838  C C     . ASP I 3 82  ? 14.958  -6.677   33.318  1.00 114.86 ? 85  ASP G C     1 
ATOM   9839  O O     . ASP I 3 82  ? 14.391  -5.691   33.782  1.00 116.93 ? 85  ASP G O     1 
ATOM   9840  C CB    . ASP I 3 82  ? 14.462  -7.285   30.981  1.00 128.39 ? 85  ASP G CB    1 
ATOM   9841  C CG    . ASP I 3 82  ? 14.867  -7.280   29.517  1.00 138.38 ? 85  ASP G CG    1 
ATOM   9842  O OD1   . ASP I 3 82  ? 16.052  -7.540   29.213  1.00 141.31 ? 85  ASP G OD1   1 
ATOM   9843  O OD2   . ASP I 3 82  ? 13.987  -7.033   28.665  1.00 148.68 ? 85  ASP G OD2   1 
ATOM   9844  N N     . ALA I 3 83  ? 15.117  -7.812   33.994  1.00 111.77 ? 86  ALA G N     1 
ATOM   9845  C CA    . ALA I 3 83  ? 14.410  -8.078   35.240  1.00 110.89 ? 86  ALA G CA    1 
ATOM   9846  C C     . ALA I 3 83  ? 15.346  -8.240   36.427  1.00 105.48 ? 86  ALA G C     1 
ATOM   9847  O O     . ALA I 3 83  ? 15.761  -9.346   36.754  1.00 107.67 ? 86  ALA G O     1 
ATOM   9848  C CB    . ALA I 3 83  ? 13.552  -9.323   35.078  1.00 112.08 ? 86  ALA G CB    1 
ATOM   9849  N N     . GLN I 3 84  ? 15.674  -7.127   37.066  1.00 103.54 ? 87  GLN G N     1 
ATOM   9850  C CA    . GLN I 3 84  ? 16.385  -7.148   38.339  1.00 101.46 ? 87  GLN G CA    1 
ATOM   9851  C C     . GLN I 3 84  ? 15.523  -6.385   39.319  1.00 101.57 ? 87  GLN G C     1 
ATOM   9852  O O     . GLN I 3 84  ? 14.588  -5.694   38.917  1.00 103.84 ? 87  GLN G O     1 
ATOM   9853  C CB    . GLN I 3 84  ? 17.757  -6.483   38.217  1.00 101.22 ? 87  GLN G CB    1 
ATOM   9854  C CG    . GLN I 3 84  ? 18.485  -6.792   36.914  1.00 106.88 ? 87  GLN G CG    1 
ATOM   9855  C CD    . GLN I 3 84  ? 19.875  -6.183   36.843  1.00 108.31 ? 87  GLN G CD    1 
ATOM   9856  O OE1   . GLN I 3 84  ? 20.595  -6.131   37.841  1.00 114.82 ? 87  GLN G OE1   1 
ATOM   9857  N NE2   . GLN I 3 84  ? 20.264  -5.724   35.655  1.00 106.12 ? 87  GLN G NE2   1 
ATOM   9858  N N     . THR I 3 85  ? 15.821  -6.514   40.605  1.00 101.27 ? 88  THR G N     1 
ATOM   9859  C CA    . THR I 3 85  ? 15.148  -5.700   41.605  1.00 104.49 ? 88  THR G CA    1 
ATOM   9860  C C     . THR I 3 85  ? 15.739  -4.305   41.568  1.00 107.14 ? 88  THR G C     1 
ATOM   9861  O O     . THR I 3 85  ? 16.752  -4.067   40.909  1.00 108.97 ? 88  THR G O     1 
ATOM   9862  C CB    . THR I 3 85  ? 15.326  -6.262   43.020  1.00 105.47 ? 88  THR G CB    1 
ATOM   9863  O OG1   . THR I 3 85  ? 16.718  -6.493   43.273  1.00 104.30 ? 88  THR G OG1   1 
ATOM   9864  C CG2   . THR I 3 85  ? 14.558  -7.550   43.165  1.00 107.02 ? 88  THR G CG2   1 
ATOM   9865  N N     . GLN I 3 86  ? 15.111  -3.382   42.283  1.00 104.60 ? 89  GLN G N     1 
ATOM   9866  C CA    . GLN I 3 86  ? 15.656  -2.043   42.392  1.00 101.08 ? 89  GLN G CA    1 
ATOM   9867  C C     . GLN I 3 86  ? 16.940  -2.070   43.208  1.00 105.45 ? 89  GLN G C     1 
ATOM   9868  O O     . GLN I 3 86  ? 17.952  -1.507   42.786  1.00 114.71 ? 89  GLN G O     1 
ATOM   9869  C CB    . GLN I 3 86  ? 14.630  -1.086   42.983  1.00 96.73  ? 89  GLN G CB    1 
ATOM   9870  C CG    . GLN I 3 86  ? 13.573  -0.680   41.965  1.00 93.94  ? 89  GLN G CG    1 
ATOM   9871  C CD    . GLN I 3 86  ? 12.372  -0.006   42.595  1.00 94.76  ? 89  GLN G CD    1 
ATOM   9872  O OE1   . GLN I 3 86  ? 12.335  0.223    43.808  1.00 98.26  ? 89  GLN G OE1   1 
ATOM   9873  N NE2   . GLN I 3 86  ? 11.377  0.314    41.774  1.00 92.02  ? 89  GLN G NE2   1 
ATOM   9874  N N     . LYS I 3 87  ? 16.918  -2.754   44.350  1.00 103.75 ? 90  LYS G N     1 
ATOM   9875  C CA    . LYS I 3 87  ? 18.128  -2.898   45.163  1.00 102.92 ? 90  LYS G CA    1 
ATOM   9876  C C     . LYS I 3 87  ? 19.306  -3.424   44.336  1.00 98.09  ? 90  LYS G C     1 
ATOM   9877  O O     . LYS I 3 87  ? 20.425  -2.946   44.481  1.00 93.52  ? 90  LYS G O     1 
ATOM   9878  C CB    . LYS I 3 87  ? 17.891  -3.828   46.351  1.00 107.56 ? 90  LYS G CB    1 
ATOM   9879  C CG    . LYS I 3 87  ? 18.997  -3.759   47.401  1.00 112.56 ? 90  LYS G CG    1 
ATOM   9880  C CD    . LYS I 3 87  ? 19.630  -5.121   47.652  1.00 115.96 ? 90  LYS G CD    1 
ATOM   9881  C CE    . LYS I 3 87  ? 18.678  -6.080   48.352  1.00 118.18 ? 90  LYS G CE    1 
ATOM   9882  N NZ    . LYS I 3 87  ? 19.018  -6.250   49.788  1.00 120.42 ? 90  LYS G NZ    1 
ATOM   9883  N N     . GLN I 3 88  ? 19.045  -4.406   43.478  1.00 97.87  ? 91  GLN G N     1 
ATOM   9884  C CA    . GLN I 3 88  ? 20.072  -4.959   42.596  1.00 102.67 ? 91  GLN G CA    1 
ATOM   9885  C C     . GLN I 3 88  ? 20.689  -3.897   41.693  1.00 103.96 ? 91  GLN G C     1 
ATOM   9886  O O     . GLN I 3 88  ? 21.910  -3.860   41.509  1.00 103.33 ? 91  GLN G O     1 
ATOM   9887  C CB    . GLN I 3 88  ? 19.491  -6.068   41.709  1.00 108.15 ? 91  GLN G CB    1 
ATOM   9888  C CG    . GLN I 3 88  ? 19.568  -7.474   42.280  1.00 110.13 ? 91  GLN G CG    1 
ATOM   9889  C CD    . GLN I 3 88  ? 19.324  -8.521   41.211  1.00 113.28 ? 91  GLN G CD    1 
ATOM   9890  O OE1   . GLN I 3 88  ? 20.130  -8.678   40.295  1.00 117.55 ? 91  GLN G OE1   1 
ATOM   9891  N NE2   . GLN I 3 88  ? 18.210  -9.234   41.311  1.00 114.52 ? 91  GLN G NE2   1 
ATOM   9892  N N     . LEU I 3 89  ? 19.833  -3.056   41.114  1.00 105.68 ? 92  LEU G N     1 
ATOM   9893  C CA    . LEU I 3 89  ? 20.264  -2.030   40.159  1.00 107.08 ? 92  LEU G CA    1 
ATOM   9894  C C     . LEU I 3 89  ? 20.982  -0.883   40.867  1.00 107.28 ? 92  LEU G C     1 
ATOM   9895  O O     . LEU I 3 89  ? 21.982  -0.360   40.371  1.00 103.22 ? 92  LEU G O     1 
ATOM   9896  C CB    . LEU I 3 89  ? 19.063  -1.489   39.380  1.00 106.60 ? 92  LEU G CB    1 
ATOM   9897  C CG    . LEU I 3 89  ? 18.353  -2.481   38.452  1.00 106.98 ? 92  LEU G CG    1 
ATOM   9898  C CD1   . LEU I 3 89  ? 16.934  -2.024   38.141  1.00 109.53 ? 92  LEU G CD1   1 
ATOM   9899  C CD2   . LEU I 3 89  ? 19.136  -2.687   37.166  1.00 106.40 ? 92  LEU G CD2   1 
ATOM   9900  N N     . ALA I 3 90  ? 20.459  -0.501   42.028  1.00 106.36 ? 93  ALA G N     1 
ATOM   9901  C CA    . ALA I 3 90  ? 21.091  0.504    42.871  1.00 109.82 ? 93  ALA G CA    1 
ATOM   9902  C C     . ALA I 3 90  ? 22.481  0.054    43.334  1.00 117.79 ? 93  ALA G C     1 
ATOM   9903  O O     . ALA I 3 90  ? 23.400  0.865    43.419  1.00 123.28 ? 93  ALA G O     1 
ATOM   9904  C CB    . ALA I 3 90  ? 20.208  0.808    44.073  1.00 108.95 ? 93  ALA G CB    1 
ATOM   9905  N N     . GLU I 3 91  ? 22.627  -1.239   43.619  1.00 125.71 ? 94  GLU G N     1 
ATOM   9906  C CA    . GLU I 3 91  ? 23.898  -1.805   44.089  1.00 130.09 ? 94  GLU G CA    1 
ATOM   9907  C C     . GLU I 3 91  ? 25.031  -1.682   43.063  1.00 126.06 ? 94  GLU G C     1 
ATOM   9908  O O     . GLU I 3 91  ? 26.204  -1.653   43.437  1.00 129.09 ? 94  GLU G O     1 
ATOM   9909  C CB    . GLU I 3 91  ? 23.701  -3.274   44.480  1.00 138.36 ? 94  GLU G CB    1 
ATOM   9910  C CG    . GLU I 3 91  ? 24.849  -3.882   45.274  1.00 143.95 ? 94  GLU G CG    1 
ATOM   9911  C CD    . GLU I 3 91  ? 24.449  -5.138   46.040  1.00 150.15 ? 94  GLU G CD    1 
ATOM   9912  O OE1   . GLU I 3 91  ? 23.240  -5.345   46.299  1.00 145.76 ? 94  GLU G OE1   1 
ATOM   9913  O OE2   . GLU I 3 91  ? 25.356  -5.921   46.397  1.00 152.78 ? 94  GLU G OE2   1 
ATOM   9914  N N     . GLN I 3 92  ? 24.677  -1.613   41.780  1.00 117.12 ? 95  GLN G N     1 
ATOM   9915  C CA    . GLN I 3 92  ? 25.651  -1.399   40.707  1.00 115.46 ? 95  GLN G CA    1 
ATOM   9916  C C     . GLN I 3 92  ? 25.868  0.091    40.425  1.00 118.74 ? 95  GLN G C     1 
ATOM   9917  O O     . GLN I 3 92  ? 26.957  0.503    40.021  1.00 127.95 ? 95  GLN G O     1 
ATOM   9918  C CB    . GLN I 3 92  ? 25.190  -2.093   39.427  1.00 112.85 ? 95  GLN G CB    1 
ATOM   9919  C CG    . GLN I 3 92  ? 24.987  -3.594   39.562  1.00 111.15 ? 95  GLN G CG    1 
ATOM   9920  C CD    . GLN I 3 92  ? 24.162  -4.165   38.423  1.00 108.66 ? 95  GLN G CD    1 
ATOM   9921  O OE1   . GLN I 3 92  ? 24.620  -4.216   37.278  1.00 104.64 ? 95  GLN G OE1   1 
ATOM   9922  N NE2   . GLN I 3 92  ? 22.935  -4.593   38.727  1.00 103.08 ? 95  GLN G NE2   1 
ATOM   9923  N N     . LEU I 3 93  ? 24.824  0.893    40.632  1.00 116.76 ? 96  LEU G N     1 
ATOM   9924  C CA    . LEU I 3 93  ? 24.900  2.352    40.462  1.00 111.34 ? 96  LEU G CA    1 
ATOM   9925  C C     . LEU I 3 93  ? 25.465  3.047    41.700  1.00 112.25 ? 96  LEU G C     1 
ATOM   9926  O O     . LEU I 3 93  ? 25.609  4.269    41.722  1.00 108.95 ? 96  LEU G O     1 
ATOM   9927  C CB    . LEU I 3 93  ? 23.509  2.920    40.145  1.00 105.06 ? 96  LEU G CB    1 
ATOM   9928  C CG    . LEU I 3 93  ? 23.110  3.057    38.672  1.00 102.41 ? 96  LEU G CG    1 
ATOM   9929  C CD1   . LEU I 3 93  ? 23.745  2.004    37.779  1.00 106.06 ? 96  LEU G CD1   1 
ATOM   9930  C CD2   . LEU I 3 93  ? 21.593  3.029    38.546  1.00 101.32 ? 96  LEU G CD2   1 
ATOM   9931  N N     . GLU I 3 94  ? 25.760  2.263    42.733  1.00 115.14 ? 97  GLU G N     1 
ATOM   9932  C CA    . GLU I 3 94  ? 26.306  2.776    43.985  1.00 115.34 ? 97  GLU G CA    1 
ATOM   9933  C C     . GLU I 3 94  ? 25.388  3.830    44.618  1.00 108.05 ? 97  GLU G C     1 
ATOM   9934  O O     . GLU I 3 94  ? 25.846  4.703    45.348  1.00 110.64 ? 97  GLU G O     1 
ATOM   9935  C CB    . GLU I 3 94  ? 27.734  3.298    43.764  1.00 118.07 ? 97  GLU G CB    1 
ATOM   9936  C CG    . GLU I 3 94  ? 28.583  2.344    42.922  1.00 120.78 ? 97  GLU G CG    1 
ATOM   9937  C CD    . GLU I 3 94  ? 30.082  2.589    43.010  1.00 123.89 ? 97  GLU G CD    1 
ATOM   9938  O OE1   . GLU I 3 94  ? 30.547  3.240    43.970  1.00 124.06 ? 97  GLU G OE1   1 
ATOM   9939  O OE2   . GLU I 3 94  ? 30.804  2.112    42.109  1.00 122.92 ? 97  GLU G OE2   1 
ATOM   9940  N N     . VAL I 3 95  ? 24.088  3.705    44.352  1.00 103.19 ? 98  VAL G N     1 
ATOM   9941  C CA    . VAL I 3 95  ? 23.065  4.602    44.880  1.00 105.61 ? 98  VAL G CA    1 
ATOM   9942  C C     . VAL I 3 95  ? 22.067  3.770    45.705  1.00 105.57 ? 98  VAL G C     1 
ATOM   9943  O O     . VAL I 3 95  ? 22.219  2.551    45.801  1.00 110.07 ? 98  VAL G O     1 
ATOM   9944  C CB    . VAL I 3 95  ? 22.383  5.357    43.716  1.00 106.25 ? 98  VAL G CB    1 
ATOM   9945  C CG1   . VAL I 3 95  ? 21.213  4.572    43.140  1.00 106.28 ? 98  VAL G CG1   1 
ATOM   9946  C CG2   . VAL I 3 95  ? 21.946  6.748    44.144  1.00 109.04 ? 98  VAL G CG2   1 
ATOM   9947  N N     . SER I 3 96  ? 21.065  4.408    46.309  1.00 101.81 ? 99  SER G N     1 
ATOM   9948  C CA    . SER I 3 96  ? 20.088  3.679    47.133  1.00 104.01 ? 99  SER G CA    1 
ATOM   9949  C C     . SER I 3 96  ? 18.940  3.128    46.282  1.00 105.53 ? 99  SER G C     1 
ATOM   9950  O O     . SER I 3 96  ? 18.657  3.651    45.206  1.00 104.73 ? 99  SER G O     1 
ATOM   9951  C CB    . SER I 3 96  ? 19.536  4.569    48.253  1.00 101.35 ? 99  SER G CB    1 
ATOM   9952  O OG    . SER I 3 96  ? 18.375  5.265    47.841  1.00 100.93 ? 99  SER G OG    1 
ATOM   9953  N N     . GLN I 3 97  ? 18.287  2.069    46.769  1.00 108.76 ? 100 GLN G N     1 
ATOM   9954  C CA    . GLN I 3 97  ? 17.126  1.483    46.082  1.00 107.70 ? 100 GLN G CA    1 
ATOM   9955  C C     . GLN I 3 97  ? 16.123  2.575    45.826  1.00 105.29 ? 100 GLN G C     1 
ATOM   9956  O O     . GLN I 3 97  ? 15.528  2.671    44.748  1.00 97.30  ? 100 GLN G O     1 
ATOM   9957  C CB    . GLN I 3 97  ? 16.468  0.384    46.932  1.00 107.53 ? 100 GLN G CB    1 
ATOM   9958  C CG    . GLN I 3 97  ? 15.077  -0.057   46.454  1.00 106.09 ? 100 GLN G CG    1 
ATOM   9959  C CD    . GLN I 3 97  ? 13.924  0.696    47.111  1.00 106.75 ? 100 GLN G CD    1 
ATOM   9960  O OE1   . GLN I 3 97  ? 12.830  0.808    46.554  1.00 100.51 ? 100 GLN G OE1   1 
ATOM   9961  N NE2   . GLN I 3 97  ? 14.161  1.199    48.307  1.00 111.37 ? 100 GLN G NE2   1 
ATOM   9962  N N     . GLN I 3 98  ? 15.953  3.393    46.853  1.00 106.68 ? 101 GLN G N     1 
ATOM   9963  C CA    . GLN I 3 98  ? 15.014  4.488    46.837  1.00 112.26 ? 101 GLN G CA    1 
ATOM   9964  C C     . GLN I 3 98  ? 15.111  5.361    45.587  1.00 106.04 ? 101 GLN G C     1 
ATOM   9965  O O     . GLN I 3 98  ? 14.103  5.660    44.951  1.00 97.96  ? 101 GLN G O     1 
ATOM   9966  C CB    . GLN I 3 98  ? 15.228  5.341    48.091  1.00 122.04 ? 101 GLN G CB    1 
ATOM   9967  C CG    . GLN I 3 98  ? 13.952  5.616    48.829  1.00 131.21 ? 101 GLN G CG    1 
ATOM   9968  C CD    . GLN I 3 98  ? 13.096  4.392    48.865  1.00 142.97 ? 101 GLN G CD    1 
ATOM   9969  O OE1   . GLN I 3 98  ? 13.394  3.440    49.588  1.00 147.75 ? 101 GLN G OE1   1 
ATOM   9970  N NE2   . GLN I 3 98  ? 12.053  4.382    48.047  1.00 152.77 ? 101 GLN G NE2   1 
ATOM   9971  N N     . ALA I 3 99  ? 16.334  5.754    45.247  1.00 103.08 ? 102 ALA G N     1 
ATOM   9972  C CA    . ALA I 3 99  ? 16.597  6.596    44.088  1.00 103.00 ? 102 ALA G CA    1 
ATOM   9973  C C     . ALA I 3 99  ? 16.209  5.921    42.782  1.00 101.92 ? 102 ALA G C     1 
ATOM   9974  O O     . ALA I 3 99  ? 15.727  6.578    41.850  1.00 99.50  ? 102 ALA G O     1 
ATOM   9975  C CB    . ALA I 3 99  ? 18.068  6.969    44.049  1.00 109.40 ? 102 ALA G CB    1 
ATOM   9976  N N     . VAL I 3 100 ? 16.424  4.610    42.715  1.00 101.31 ? 103 VAL G N     1 
ATOM   9977  C CA    . VAL I 3 100 ? 16.141  3.855    41.497  1.00 96.84  ? 103 VAL G CA    1 
ATOM   9978  C C     . VAL I 3 100 ? 14.636  3.789    41.233  1.00 91.61  ? 103 VAL G C     1 
ATOM   9979  O O     . VAL I 3 100 ? 14.209  3.778    40.072  1.00 85.15  ? 103 VAL G O     1 
ATOM   9980  C CB    . VAL I 3 100 ? 16.741  2.440    41.542  1.00 97.60  ? 103 VAL G CB    1 
ATOM   9981  C CG1   . VAL I 3 100 ? 16.490  1.717    40.226  1.00 101.43 ? 103 VAL G CG1   1 
ATOM   9982  C CG2   . VAL I 3 100 ? 18.235  2.509    41.820  1.00 100.78 ? 103 VAL G CG2   1 
ATOM   9983  N N     . SER I 3 101 ? 13.840  3.760    42.303  1.00 87.25  ? 104 SER G N     1 
ATOM   9984  C CA    . SER I 3 101 ? 12.384  3.802    42.176  1.00 91.22  ? 104 SER G CA    1 
ATOM   9985  C C     . SER I 3 101 ? 11.941  5.054    41.433  1.00 99.69  ? 104 SER G C     1 
ATOM   9986  O O     . SER I 3 101 ? 11.154  4.967    40.486  1.00 107.68 ? 104 SER G O     1 
ATOM   9987  C CB    . SER I 3 101 ? 11.717  3.767    43.547  1.00 93.46  ? 104 SER G CB    1 
ATOM   9988  O OG    . SER I 3 101 ? 10.310  3.841    43.422  1.00 98.00  ? 104 SER G OG    1 
ATOM   9989  N N     . ASN I 3 102 ? 12.465  6.208    41.867  1.00 102.44 ? 105 ASN G N     1 
ATOM   9990  C CA    . ASN I 3 102 ? 12.179  7.512    41.243  1.00 92.10  ? 105 ASN G CA    1 
ATOM   9991  C C     . ASN I 3 102 ? 12.595  7.523    39.775  1.00 86.41  ? 105 ASN G C     1 
ATOM   9992  O O     . ASN I 3 102 ? 11.764  7.702    38.891  1.00 80.58  ? 105 ASN G O     1 
ATOM   9993  C CB    . ASN I 3 102 ? 12.906  8.654    41.973  1.00 90.26  ? 105 ASN G CB    1 
ATOM   9994  C CG    . ASN I 3 102 ? 12.542  8.756    43.452  1.00 90.74  ? 105 ASN G CG    1 
ATOM   9995  O OD1   . ASN I 3 102 ? 11.384  8.602    43.840  1.00 92.67  ? 105 ASN G OD1   1 
ATOM   9996  N ND2   . ASN I 3 102 ? 13.541  9.036    44.284  1.00 89.77  ? 105 ASN G ND2   1 
ATOM   9997  N N     . ARG I 3 103 ? 13.881  7.300    39.525  1.00 83.42  ? 106 ARG G N     1 
ATOM   9998  C CA    . ARG I 3 103 ? 14.428  7.374    38.171  1.00 92.10  ? 106 ARG G CA    1 
ATOM   9999  C C     . ARG I 3 103 ? 13.704  6.529    37.151  1.00 98.76  ? 106 ARG G C     1 
ATOM   10000 O O     . ARG I 3 103 ? 13.546  6.942    36.001  1.00 100.95 ? 106 ARG G O     1 
ATOM   10001 C CB    . ARG I 3 103 ? 15.886  6.964    38.165  1.00 98.22  ? 106 ARG G CB    1 
ATOM   10002 C CG    . ARG I 3 103 ? 16.815  8.144    38.220  1.00 102.32 ? 106 ARG G CG    1 
ATOM   10003 C CD    . ARG I 3 103 ? 16.903  8.889    36.899  1.00 103.13 ? 106 ARG G CD    1 
ATOM   10004 N NE    . ARG I 3 103 ? 18.300  9.185    36.604  1.00 108.68 ? 106 ARG G NE    1 
ATOM   10005 C CZ    . ARG I 3 103 ? 19.085  9.947    37.365  1.00 115.93 ? 106 ARG G CZ    1 
ATOM   10006 N NH1   . ARG I 3 103 ? 20.346  10.137   37.014  1.00 117.96 ? 106 ARG G NH1   1 
ATOM   10007 N NH2   . ARG I 3 103 ? 18.628  10.517   38.478  1.00 116.08 ? 106 ARG G NH2   1 
ATOM   10008 N N     . LEU I 3 104 ? 13.304  5.330    37.568  1.00 105.37 ? 107 LEU G N     1 
ATOM   10009 C CA    . LEU I 3 104 ? 12.550  4.429    36.704  1.00 103.29 ? 107 LEU G CA    1 
ATOM   10010 C C     . LEU I 3 104 ? 11.215  5.058    36.352  1.00 98.35  ? 107 LEU G C     1 
ATOM   10011 O O     . LEU I 3 104 ? 10.753  4.943    35.223  1.00 91.50  ? 107 LEU G O     1 
ATOM   10012 C CB    . LEU I 3 104 ? 12.343  3.071    37.379  1.00 105.60 ? 107 LEU G CB    1 
ATOM   10013 C CG    . LEU I 3 104 ? 13.575  2.160    37.403  1.00 105.31 ? 107 LEU G CG    1 
ATOM   10014 C CD1   . LEU I 3 104 ? 13.351  0.980    38.340  1.00 106.34 ? 107 LEU G CD1   1 
ATOM   10015 C CD2   . LEU I 3 104 ? 13.924  1.674    36.004  1.00 103.80 ? 107 LEU G CD2   1 
ATOM   10016 N N     . ARG I 3 105 ? 10.612  5.735    37.324  1.00 98.95  ? 108 ARG G N     1 
ATOM   10017 C CA    . ARG I 3 105 ? 9.396   6.492    37.083  1.00 99.88  ? 108 ARG G CA    1 
ATOM   10018 C C     . ARG I 3 105 ? 9.657   7.689    36.163  1.00 100.17 ? 108 ARG G C     1 
ATOM   10019 O O     . ARG I 3 105 ? 8.808   8.017    35.337  1.00 93.42  ? 108 ARG G O     1 
ATOM   10020 C CB    . ARG I 3 105 ? 8.786   6.964    38.400  1.00 102.47 ? 108 ARG G CB    1 
ATOM   10021 C CG    . ARG I 3 105 ? 7.326   7.346    38.275  1.00 110.17 ? 108 ARG G CG    1 
ATOM   10022 C CD    . ARG I 3 105 ? 6.896   8.274    39.391  1.00 117.09 ? 108 ARG G CD    1 
ATOM   10023 N NE    . ARG I 3 105 ? 6.642   7.556    40.632  1.00 126.89 ? 108 ARG G NE    1 
ATOM   10024 C CZ    . ARG I 3 105 ? 6.328   8.140    41.786  1.00 133.98 ? 108 ARG G CZ    1 
ATOM   10025 N NH1   . ARG I 3 105 ? 6.231   9.466    41.871  1.00 138.16 ? 108 ARG G NH1   1 
ATOM   10026 N NH2   . ARG I 3 105 ? 6.116   7.398    42.864  1.00 128.58 ? 108 ARG G NH2   1 
ATOM   10027 N N     . GLU I 3 106 ? 10.819  8.334    36.302  1.00 104.92 ? 109 GLU G N     1 
ATOM   10028 C CA    . GLU I 3 106 ? 11.172  9.472    35.438  1.00 110.83 ? 109 GLU G CA    1 
ATOM   10029 C C     . GLU I 3 106 ? 11.248  9.009    33.994  1.00 110.41 ? 109 GLU G C     1 
ATOM   10030 O O     . GLU I 3 106 ? 10.684  9.643    33.105  1.00 118.98 ? 109 GLU G O     1 
ATOM   10031 C CB    . GLU I 3 106 ? 12.512  10.133   35.813  1.00 117.20 ? 109 GLU G CB    1 
ATOM   10032 C CG    . GLU I 3 106 ? 12.740  10.499   37.276  1.00 123.51 ? 109 GLU G CG    1 
ATOM   10033 C CD    . GLU I 3 106 ? 11.725  11.462   37.875  1.00 125.95 ? 109 GLU G CD    1 
ATOM   10034 O OE1   . GLU I 3 106 ? 12.136  12.252   38.754  1.00 124.71 ? 109 GLU G OE1   1 
ATOM   10035 O OE2   . GLU I 3 106 ? 10.528  11.424   37.506  1.00 119.68 ? 109 GLU G OE2   1 
ATOM   10036 N N     . MET I 3 107 ? 11.952  7.906    33.763  1.00 109.20 ? 110 MET G N     1 
ATOM   10037 C CA    . MET I 3 107 ? 11.947  7.255    32.455  1.00 109.05 ? 110 MET G CA    1 
ATOM   10038 C C     . MET I 3 107 ? 10.592  6.571    32.292  1.00 109.70 ? 110 MET G C     1 
ATOM   10039 O O     . MET I 3 107 ? 9.827   6.465    33.252  1.00 109.54 ? 110 MET G O     1 
ATOM   10040 C CB    . MET I 3 107 ? 13.090  6.240    32.351  1.00 109.06 ? 110 MET G CB    1 
ATOM   10041 C CG    . MET I 3 107 ? 14.472  6.862    32.495  1.00 112.28 ? 110 MET G CG    1 
ATOM   10042 S SD    . MET I 3 107 ? 15.696  5.797    33.287  1.00 116.05 ? 110 MET G SD    1 
ATOM   10043 C CE    . MET I 3 107 ? 16.195  4.781    31.901  1.00 113.92 ? 110 MET G CE    1 
ATOM   10044 N N     . GLY I 3 108 ? 10.284  6.103    31.088  1.00 110.80 ? 111 GLY G N     1 
ATOM   10045 C CA    . GLY I 3 108 ? 8.963   5.525    30.822  1.00 114.63 ? 111 GLY G CA    1 
ATOM   10046 C C     . GLY I 3 108 ? 8.664   4.197    31.508  1.00 114.57 ? 111 GLY G C     1 
ATOM   10047 O O     . GLY I 3 108 ? 7.558   3.672    31.372  1.00 120.65 ? 111 GLY G O     1 
ATOM   10048 N N     . LYS I 3 109 ? 9.626   3.686    32.280  1.00 108.84 ? 112 LYS G N     1 
ATOM   10049 C CA    . LYS I 3 109 ? 9.662   2.283    32.708  1.00 101.15 ? 112 LYS G CA    1 
ATOM   10050 C C     . LYS I 3 109 ? 8.531   1.863    33.642  1.00 100.68 ? 112 LYS G C     1 
ATOM   10051 O O     . LYS I 3 109 ? 8.239   2.552    34.618  1.00 89.59  ? 112 LYS G O     1 
ATOM   10052 C CB    . LYS I 3 109 ? 10.995  1.973    33.406  1.00 100.99 ? 112 LYS G CB    1 
ATOM   10053 C CG    . LYS I 3 109 ? 12.252  2.297    32.608  1.00 100.45 ? 112 LYS G CG    1 
ATOM   10054 C CD    . LYS I 3 109 ? 12.167  1.796    31.178  1.00 100.68 ? 112 LYS G CD    1 
ATOM   10055 C CE    . LYS I 3 109 ? 13.520  1.830    30.491  1.00 102.42 ? 112 LYS G CE    1 
ATOM   10056 N NZ    . LYS I 3 109 ? 13.420  1.433    29.058  1.00 105.25 ? 112 LYS G NZ    1 
ATOM   10057 N N     . ILE I 3 110 ? 7.920   0.715    33.328  1.00 109.65 ? 113 ILE G N     1 
ATOM   10058 C CA    . ILE I 3 110 ? 6.951   0.039    34.206  1.00 109.82 ? 113 ILE G CA    1 
ATOM   10059 C C     . ILE I 3 110 ? 7.363   -1.407   34.474  1.00 106.04 ? 113 ILE G C     1 
ATOM   10060 O O     . ILE I 3 110 ? 8.111   -2.000   33.696  1.00 101.89 ? 113 ILE G O     1 
ATOM   10061 C CB    . ILE I 3 110 ? 5.528   0.019    33.614  1.00 106.79 ? 113 ILE G CB    1 
ATOM   10062 C CG1   . ILE I 3 110 ? 5.526   -0.595   32.210  1.00 107.96 ? 113 ILE G CG1   1 
ATOM   10063 C CG2   . ILE I 3 110 ? 4.952   1.424    33.592  1.00 106.24 ? 113 ILE G CG2   1 
ATOM   10064 C CD1   . ILE I 3 110 ? 4.141   -0.955   31.720  1.00 113.22 ? 113 ILE G CD1   1 
ATOM   10065 N N     . GLN I 3 111 ? 6.856   -1.962   35.574  1.00 107.88 ? 114 GLN G N     1 
ATOM   10066 C CA    . GLN I 3 111 ? 7.096   -3.361   35.933  1.00 107.30 ? 114 GLN G CA    1 
ATOM   10067 C C     . GLN I 3 111 ? 6.002   -4.222   35.326  1.00 108.68 ? 114 GLN G C     1 
ATOM   10068 O O     . GLN I 3 111 ? 4.824   -3.880   35.439  1.00 115.02 ? 114 GLN G O     1 
ATOM   10069 C CB    . GLN I 3 111 ? 7.091   -3.542   37.454  1.00 105.32 ? 114 GLN G CB    1 
ATOM   10070 C CG    . GLN I 3 111 ? 7.883   -4.753   37.923  1.00 106.81 ? 114 GLN G CG    1 
ATOM   10071 C CD    . GLN I 3 111 ? 7.566   -5.168   39.348  1.00 108.88 ? 114 GLN G CD    1 
ATOM   10072 O OE1   . GLN I 3 111 ? 6.417   -5.109   39.781  1.00 117.32 ? 114 GLN G OE1   1 
ATOM   10073 N NE2   . GLN I 3 111 ? 8.585   -5.611   40.079  1.00 106.19 ? 114 GLN G NE2   1 
ATOM   10074 N N     . LYS I 3 112 ? 6.381   -5.325   34.679  1.00 107.16 ? 115 LYS G N     1 
ATOM   10075 C CA    . LYS I 3 112 ? 5.398   -6.289   34.166  1.00 107.52 ? 115 LYS G CA    1 
ATOM   10076 C C     . LYS I 3 112 ? 5.912   -7.714   34.251  1.00 107.29 ? 115 LYS G C     1 
ATOM   10077 O O     . LYS I 3 112 ? 7.074   -7.978   33.943  1.00 108.01 ? 115 LYS G O     1 
ATOM   10078 C CB    . LYS I 3 112 ? 4.998   -5.973   32.729  1.00 103.97 ? 115 LYS G CB    1 
ATOM   10079 C CG    . LYS I 3 112 ? 6.149   -5.554   31.842  1.00 104.63 ? 115 LYS G CG    1 
ATOM   10080 C CD    . LYS I 3 112 ? 5.837   -5.782   30.375  1.00 107.35 ? 115 LYS G CD    1 
ATOM   10081 C CE    . LYS I 3 112 ? 4.470   -5.260   29.973  1.00 106.03 ? 115 LYS G CE    1 
ATOM   10082 N NZ    . LYS I 3 112 ? 4.278   -5.357   28.501  1.00 110.42 ? 115 LYS G NZ    1 
ATOM   10083 N N     . VAL I 3 113 ? 5.027   -8.621   34.669  1.00 107.12 ? 116 VAL G N     1 
ATOM   10084 C CA    . VAL I 3 113 ? 5.369   -10.033  34.840  1.00 102.64 ? 116 VAL G CA    1 
ATOM   10085 C C     . VAL I 3 113 ? 5.531   -10.708  33.490  1.00 98.15  ? 116 VAL G C     1 
ATOM   10086 O O     . VAL I 3 113 ? 4.856   -10.355  32.527  1.00 95.68  ? 116 VAL G O     1 
ATOM   10087 C CB    . VAL I 3 113 ? 4.304   -10.804  35.651  1.00 103.37 ? 116 VAL G CB    1 
ATOM   10088 C CG1   . VAL I 3 113 ? 4.105   -10.167  37.022  1.00 107.03 ? 116 VAL G CG1   1 
ATOM   10089 C CG2   . VAL I 3 113 ? 2.983   -10.888  34.891  1.00 103.44 ? 116 VAL G CG2   1 
ATOM   10090 N N     . GLY I 3 114 ? 6.434   -11.679  33.433  1.00 99.67  ? 117 GLY G N     1 
ATOM   10091 C CA    . GLY I 3 114 ? 6.703   -12.424  32.208  1.00 100.31 ? 117 GLY G CA    1 
ATOM   10092 C C     . GLY I 3 114 ? 5.719   -13.552  31.975  1.00 97.56  ? 117 GLY G C     1 
ATOM   10093 O O     . GLY I 3 114 ? 5.055   -14.025  32.900  1.00 98.02  ? 117 GLY G O     1 
ATOM   10094 N N     . ARG I 3 115 ? 5.626   -13.987  30.725  1.00 95.65  ? 118 ARG G N     1 
ATOM   10095 C CA    . ARG I 3 115 ? 4.759   -15.099  30.372  1.00 92.81  ? 118 ARG G CA    1 
ATOM   10096 C C     . ARG I 3 115 ? 5.336   -16.423  30.865  1.00 89.90  ? 118 ARG G C     1 
ATOM   10097 O O     . ARG I 3 115 ? 6.553   -16.592  30.992  1.00 88.76  ? 118 ARG G O     1 
ATOM   10098 C CB    . ARG I 3 115 ? 4.576   -15.180  28.857  1.00 94.28  ? 118 ARG G CB    1 
ATOM   10099 C CG    . ARG I 3 115 ? 3.881   -13.986  28.237  1.00 96.45  ? 118 ARG G CG    1 
ATOM   10100 C CD    . ARG I 3 115 ? 3.122   -14.406  26.993  1.00 98.30  ? 118 ARG G CD    1 
ATOM   10101 N NE    . ARG I 3 115 ? 1.845   -15.020  27.351  1.00 99.26  ? 118 ARG G NE    1 
ATOM   10102 C CZ    . ARG I 3 115 ? 1.139   -15.831  26.570  1.00 104.37 ? 118 ARG G CZ    1 
ATOM   10103 N NH1   . ARG I 3 115 ? 1.572   -16.165  25.362  1.00 110.64 ? 118 ARG G NH1   1 
ATOM   10104 N NH2   . ARG I 3 115 ? -0.013  -16.321  27.004  1.00 107.33 ? 118 ARG G NH2   1 
ATOM   10105 N N     . TRP I 3 116 ? 4.442   -17.355  31.162  1.00 87.64  ? 119 TRP G N     1 
ATOM   10106 C CA    . TRP I 3 116 ? 4.811   -18.750  31.291  1.00 78.96  ? 119 TRP G CA    1 
ATOM   10107 C C     . TRP I 3 116 ? 4.854   -19.292  29.880  1.00 81.34  ? 119 TRP G C     1 
ATOM   10108 O O     . TRP I 3 116 ? 3.954   -19.045  29.077  1.00 79.08  ? 119 TRP G O     1 
ATOM   10109 C CB    . TRP I 3 116 ? 3.756   -19.539  32.047  1.00 73.69  ? 119 TRP G CB    1 
ATOM   10110 C CG    . TRP I 3 116 ? 3.860   -19.586  33.530  1.00 68.09  ? 119 TRP G CG    1 
ATOM   10111 C CD1   . TRP I 3 116 ? 2.851   -19.353  34.415  1.00 68.18  ? 119 TRP G CD1   1 
ATOM   10112 C CD2   . TRP I 3 116 ? 4.996   -19.968  34.308  1.00 64.58  ? 119 TRP G CD2   1 
ATOM   10113 N NE1   . TRP I 3 116 ? 3.290   -19.551  35.702  1.00 68.55  ? 119 TRP G NE1   1 
ATOM   10114 C CE2   . TRP I 3 116 ? 4.607   -19.923  35.666  1.00 63.96  ? 119 TRP G CE2   1 
ATOM   10115 C CE3   . TRP I 3 116 ? 6.305   -20.342  33.995  1.00 67.53  ? 119 TRP G CE3   1 
ATOM   10116 C CZ2   . TRP I 3 116 ? 5.481   -20.223  36.710  1.00 62.08  ? 119 TRP G CZ2   1 
ATOM   10117 C CZ3   . TRP I 3 116 ? 7.183   -20.644  35.041  1.00 67.33  ? 119 TRP G CZ3   1 
ATOM   10118 C CH2   . TRP I 3 116 ? 6.761   -20.580  36.382  1.00 64.24  ? 119 TRP G CH2   1 
ATOM   10119 N N     . VAL I 3 117 ? 5.899   -20.036  29.572  1.00 86.62  ? 120 VAL G N     1 
ATOM   10120 C CA    . VAL I 3 117 ? 5.962   -20.742  28.316  1.00 84.38  ? 120 VAL G CA    1 
ATOM   10121 C C     . VAL I 3 117 ? 5.878   -22.217  28.710  1.00 87.12  ? 120 VAL G C     1 
ATOM   10122 O O     . VAL I 3 117 ? 6.261   -22.574  29.824  1.00 91.34  ? 120 VAL G O     1 
ATOM   10123 C CB    . VAL I 3 117 ? 7.229   -20.334  27.546  1.00 82.53  ? 120 VAL G CB    1 
ATOM   10124 C CG1   . VAL I 3 117 ? 8.268   -21.440  27.510  1.00 85.11  ? 120 VAL G CG1   1 
ATOM   10125 C CG2   . VAL I 3 117 ? 6.857   -19.903  26.141  1.00 85.94  ? 120 VAL G CG2   1 
ATOM   10126 N N     . PRO I 3 118 ? 5.357   -23.073  27.819  1.00 85.97  ? 121 PRO G N     1 
ATOM   10127 C CA    . PRO I 3 118 ? 4.940   -24.390  28.284  1.00 87.00  ? 121 PRO G CA    1 
ATOM   10128 C C     . PRO I 3 118 ? 6.069   -25.393  28.530  1.00 86.33  ? 121 PRO G C     1 
ATOM   10129 O O     . PRO I 3 118 ? 5.855   -26.359  29.258  1.00 86.57  ? 121 PRO G O     1 
ATOM   10130 C CB    . PRO I 3 118 ? 4.015   -24.873  27.169  1.00 85.91  ? 121 PRO G CB    1 
ATOM   10131 C CG    . PRO I 3 118 ? 4.478   -24.171  25.949  1.00 85.41  ? 121 PRO G CG    1 
ATOM   10132 C CD    . PRO I 3 118 ? 5.246   -22.948  26.358  1.00 85.90  ? 121 PRO G CD    1 
ATOM   10133 N N     . HIS I 3 119 ? 7.248   -25.178  27.950  1.00 86.22  ? 122 HIS G N     1 
ATOM   10134 C CA    . HIS I 3 119 ? 8.344   -26.127  28.124  1.00 88.90  ? 122 HIS G CA    1 
ATOM   10135 C C     . HIS I 3 119 ? 9.723   -25.557  27.794  1.00 82.85  ? 122 HIS G C     1 
ATOM   10136 O O     . HIS I 3 119 ? 9.860   -24.625  27.007  1.00 77.41  ? 122 HIS G O     1 
ATOM   10137 C CB    . HIS I 3 119 ? 8.086   -27.374  27.264  1.00 100.56 ? 122 HIS G CB    1 
ATOM   10138 C CG    . HIS I 3 119 ? 8.938   -28.550  27.632  1.00 106.53 ? 122 HIS G CG    1 
ATOM   10139 N ND1   . HIS I 3 119 ? 9.927   -29.041  26.806  1.00 105.39 ? 122 HIS G ND1   1 
ATOM   10140 C CD2   . HIS I 3 119 ? 8.963   -29.316  28.747  1.00 105.50 ? 122 HIS G CD2   1 
ATOM   10141 C CE1   . HIS I 3 119 ? 10.516  -30.067  27.392  1.00 108.09 ? 122 HIS G CE1   1 
ATOM   10142 N NE2   . HIS I 3 119 ? 9.952   -30.253  28.572  1.00 109.20 ? 122 HIS G NE2   1 
ATOM   10143 N N     . GLU I 3 120 ? 10.742  -26.154  28.402  1.00 82.71  ? 123 GLU G N     1 
ATOM   10144 C CA    . GLU I 3 120 ? 12.133  -25.784  28.171  1.00 86.36  ? 123 GLU G CA    1 
ATOM   10145 C C     . GLU I 3 120 ? 12.674  -26.600  26.989  1.00 83.26  ? 123 GLU G C     1 
ATOM   10146 O O     . GLU I 3 120 ? 13.255  -27.665  27.164  1.00 87.22  ? 123 GLU G O     1 
ATOM   10147 C CB    . GLU I 3 120 ? 12.952  -26.030  29.454  1.00 92.65  ? 123 GLU G CB    1 
ATOM   10148 C CG    . GLU I 3 120 ? 13.891  -24.906  29.864  1.00 100.71 ? 123 GLU G CG    1 
ATOM   10149 C CD    . GLU I 3 120 ? 15.169  -24.870  29.054  1.00 110.30 ? 123 GLU G CD    1 
ATOM   10150 O OE1   . GLU I 3 120 ? 15.087  -24.651  27.827  1.00 117.84 ? 123 GLU G OE1   1 
ATOM   10151 O OE2   . GLU I 3 120 ? 16.256  -25.046  29.648  1.00 117.43 ? 123 GLU G OE2   1 
ATOM   10152 N N     . LEU I 3 121 ? 12.473  -26.096  25.777  1.00 83.13  ? 124 LEU G N     1 
ATOM   10153 C CA    . LEU I 3 121 ? 12.920  -26.793  24.567  1.00 82.62  ? 124 LEU G CA    1 
ATOM   10154 C C     . LEU I 3 121 ? 14.438  -26.921  24.505  1.00 80.74  ? 124 LEU G C     1 
ATOM   10155 O O     . LEU I 3 121 ? 15.149  -26.322  25.302  1.00 89.20  ? 124 LEU G O     1 
ATOM   10156 C CB    . LEU I 3 121 ? 12.456  -26.042  23.319  1.00 80.64  ? 124 LEU G CB    1 
ATOM   10157 C CG    . LEU I 3 121 ? 10.971  -25.712  23.236  1.00 82.97  ? 124 LEU G CG    1 
ATOM   10158 C CD1   . LEU I 3 121 ? 10.665  -25.066  21.894  1.00 89.20  ? 124 LEU G CD1   1 
ATOM   10159 C CD2   . LEU I 3 121 ? 10.120  -26.951  23.446  1.00 82.39  ? 124 LEU G CD2   1 
ATOM   10160 N N     . ASN I 3 122 ? 14.923  -27.717  23.561  1.00 74.72  ? 125 ASN G N     1 
ATOM   10161 C CA    . ASN I 3 122 ? 16.321  -27.675  23.161  1.00 76.21  ? 125 ASN G CA    1 
ATOM   10162 C C     . ASN I 3 122 ? 16.417  -27.692  21.643  1.00 79.19  ? 125 ASN G C     1 
ATOM   10163 O O     . ASN I 3 122 ? 15.413  -27.845  20.951  1.00 79.57  ? 125 ASN G O     1 
ATOM   10164 C CB    . ASN I 3 122 ? 17.165  -28.779  23.820  1.00 81.11  ? 125 ASN G CB    1 
ATOM   10165 C CG    . ASN I 3 122 ? 16.669  -30.190  23.525  1.00 83.83  ? 125 ASN G CG    1 
ATOM   10166 O OD1   . ASN I 3 122 ? 16.187  -30.887  24.419  1.00 87.36  ? 125 ASN G OD1   1 
ATOM   10167 N ND2   . ASN I 3 122 ? 16.815  -30.629  22.290  1.00 82.26  ? 125 ASN G ND2   1 
ATOM   10168 N N     . GLU I 3 123 ? 17.626  -27.525  21.130  1.00 81.84  ? 126 GLU G N     1 
ATOM   10169 C CA    . GLU I 3 123 ? 17.817  -27.232  19.719  1.00 86.96  ? 126 GLU G CA    1 
ATOM   10170 C C     . GLU I 3 123 ? 17.210  -28.278  18.780  1.00 86.08  ? 126 GLU G C     1 
ATOM   10171 O O     . GLU I 3 123 ? 16.832  -27.958  17.654  1.00 86.65  ? 126 GLU G O     1 
ATOM   10172 C CB    . GLU I 3 123 ? 19.303  -27.010  19.436  1.00 97.58  ? 126 GLU G CB    1 
ATOM   10173 C CG    . GLU I 3 123 ? 19.917  -25.923  20.315  1.00 107.67 ? 126 GLU G CG    1 
ATOM   10174 C CD    . GLU I 3 123 ? 20.793  -24.959  19.539  1.00 121.34 ? 126 GLU G CD    1 
ATOM   10175 O OE1   . GLU I 3 123 ? 20.525  -23.735  19.600  1.00 125.15 ? 126 GLU G OE1   1 
ATOM   10176 O OE2   . GLU I 3 123 ? 21.737  -25.426  18.861  1.00 128.08 ? 126 GLU G OE2   1 
ATOM   10177 N N     . ARG I 3 124 ? 17.109  -29.524  19.241  1.00 88.99  ? 127 ARG G N     1 
ATOM   10178 C CA    . ARG I 3 124 ? 16.397  -30.561  18.494  1.00 88.47  ? 127 ARG G CA    1 
ATOM   10179 C C     . ARG I 3 124 ? 14.925  -30.188  18.402  1.00 85.17  ? 127 ARG G C     1 
ATOM   10180 O O     . ARG I 3 124 ? 14.415  -29.917  17.313  1.00 81.85  ? 127 ARG G O     1 
ATOM   10181 C CB    . ARG I 3 124 ? 16.545  -31.936  19.160  1.00 97.27  ? 127 ARG G CB    1 
ATOM   10182 C CG    . ARG I 3 124 ? 17.939  -32.550  19.096  1.00 104.90 ? 127 ARG G CG    1 
ATOM   10183 C CD    . ARG I 3 124 ? 18.371  -32.682  17.654  1.00 110.92 ? 127 ARG G CD    1 
ATOM   10184 N NE    . ARG I 3 124 ? 19.209  -33.843  17.344  1.00 114.91 ? 127 ARG G NE    1 
ATOM   10185 C CZ    . ARG I 3 124 ? 18.749  -35.044  16.991  1.00 116.55 ? 127 ARG G CZ    1 
ATOM   10186 N NH1   . ARG I 3 124 ? 19.599  -36.017  16.704  1.00 117.18 ? 127 ARG G NH1   1 
ATOM   10187 N NH2   . ARG I 3 124 ? 17.446  -35.293  16.939  1.00 120.48 ? 127 ARG G NH2   1 
ATOM   10188 N N     . GLN I 3 125 ? 14.261  -30.138  19.557  1.00 79.89  ? 128 GLN G N     1 
ATOM   10189 C CA    . GLN I 3 125 ? 12.844  -29.788  19.629  1.00 76.74  ? 128 GLN G CA    1 
ATOM   10190 C C     . GLN I 3 125 ? 12.494  -28.496  18.884  1.00 81.26  ? 128 GLN G C     1 
ATOM   10191 O O     . GLN I 3 125 ? 11.419  -28.399  18.289  1.00 85.00  ? 128 GLN G O     1 
ATOM   10192 C CB    . GLN I 3 125 ? 12.407  -29.681  21.087  1.00 73.99  ? 128 GLN G CB    1 
ATOM   10193 C CG    . GLN I 3 125 ? 12.277  -31.028  21.773  1.00 74.04  ? 128 GLN G CG    1 
ATOM   10194 C CD    . GLN I 3 125 ? 12.473  -30.962  23.273  1.00 73.67  ? 128 GLN G CD    1 
ATOM   10195 O OE1   . GLN I 3 125 ? 11.597  -31.320  24.051  1.00 77.90  ? 128 GLN G OE1   1 
ATOM   10196 N NE2   . GLN I 3 125 ? 13.634  -30.519  23.681  1.00 75.44  ? 128 GLN G NE2   1 
ATOM   10197 N N     . MET I 3 126 ? 13.396  -27.512  18.915  1.00 83.87  ? 129 MET G N     1 
ATOM   10198 C CA    . MET I 3 126 ? 13.163  -26.233  18.238  1.00 80.44  ? 129 MET G CA    1 
ATOM   10199 C C     . MET I 3 126 ? 13.170  -26.439  16.729  1.00 77.01  ? 129 MET G C     1 
ATOM   10200 O O     . MET I 3 126 ? 12.171  -26.161  16.073  1.00 73.09  ? 129 MET G O     1 
ATOM   10201 C CB    . MET I 3 126 ? 14.189  -25.162  18.670  1.00 85.38  ? 129 MET G CB    1 
ATOM   10202 C CG    . MET I 3 126 ? 13.747  -24.294  19.854  1.00 85.64  ? 129 MET G CG    1 
ATOM   10203 S SD    . MET I 3 126 ? 15.075  -23.713  20.941  1.00 87.57  ? 129 MET G SD    1 
ATOM   10204 C CE    . MET I 3 126 ? 16.234  -23.062  19.746  1.00 87.62  ? 129 MET G CE    1 
ATOM   10205 N N     . GLU I 3 127 ? 14.271  -26.963  16.190  1.00 78.94  ? 130 GLU G N     1 
ATOM   10206 C CA    . GLU I 3 127 ? 14.396  -27.179  14.738  1.00 81.15  ? 130 GLU G CA    1 
ATOM   10207 C C     . GLU I 3 127 ? 13.288  -28.070  14.198  1.00 81.44  ? 130 GLU G C     1 
ATOM   10208 O O     . GLU I 3 127 ? 12.844  -27.904  13.065  1.00 80.61  ? 130 GLU G O     1 
ATOM   10209 C CB    . GLU I 3 127 ? 15.745  -27.794  14.386  1.00 81.22  ? 130 GLU G CB    1 
ATOM   10210 C CG    . GLU I 3 127 ? 15.970  -27.956  12.889  1.00 88.33  ? 130 GLU G CG    1 
ATOM   10211 C CD    . GLU I 3 127 ? 16.098  -26.637  12.139  1.00 94.98  ? 130 GLU G CD    1 
ATOM   10212 O OE1   . GLU I 3 127 ? 15.360  -26.432  11.151  1.00 100.99 ? 130 GLU G OE1   1 
ATOM   10213 O OE2   . GLU I 3 127 ? 16.950  -25.808  12.520  1.00 101.02 ? 130 GLU G OE2   1 
ATOM   10214 N N     . ARG I 3 128 ? 12.850  -29.019  15.016  1.00 84.03  ? 131 ARG G N     1 
ATOM   10215 C CA    . ARG I 3 128 ? 11.719  -29.861  14.670  1.00 89.27  ? 131 ARG G CA    1 
ATOM   10216 C C     . ARG I 3 128 ? 10.479  -29.014  14.411  1.00 86.00  ? 131 ARG G C     1 
ATOM   10217 O O     . ARG I 3 128 ? 9.856   -29.138  13.356  1.00 85.99  ? 131 ARG G O     1 
ATOM   10218 C CB    . ARG I 3 128 ? 11.453  -30.865  15.785  1.00 99.95  ? 131 ARG G CB    1 
ATOM   10219 C CG    . ARG I 3 128 ? 10.151  -31.626  15.638  1.00 110.42 ? 131 ARG G CG    1 
ATOM   10220 C CD    . ARG I 3 128 ? 9.989   -32.666  16.736  1.00 120.02 ? 131 ARG G CD    1 
ATOM   10221 N NE    . ARG I 3 128 ? 10.211  -34.019  16.245  1.00 127.35 ? 131 ARG G NE    1 
ATOM   10222 C CZ    . ARG I 3 128 ? 9.394   -34.664  15.415  1.00 129.60 ? 131 ARG G CZ    1 
ATOM   10223 N NH1   . ARG I 3 128 ? 8.287   -34.090  14.949  1.00 129.79 ? 131 ARG G NH1   1 
ATOM   10224 N NH2   . ARG I 3 128 ? 9.696   -35.893  15.031  1.00 130.66 ? 131 ARG G NH2   1 
ATOM   10225 N N     . ARG I 3 129 ? 10.133  -28.160  15.377  1.00 84.32  ? 132 ARG G N     1 
ATOM   10226 C CA    . ARG I 3 129 ? 9.022   -27.207  15.226  1.00 77.03  ? 132 ARG G CA    1 
ATOM   10227 C C     . ARG I 3 129 ? 9.248   -26.303  14.019  1.00 75.05  ? 132 ARG G C     1 
ATOM   10228 O O     . ARG I 3 129 ? 8.382   -26.179  13.154  1.00 73.19  ? 132 ARG G O     1 
ATOM   10229 C CB    . ARG I 3 129 ? 8.877   -26.329  16.464  1.00 73.84  ? 132 ARG G CB    1 
ATOM   10230 C CG    . ARG I 3 129 ? 8.405   -27.045  17.712  1.00 76.50  ? 132 ARG G CG    1 
ATOM   10231 C CD    . ARG I 3 129 ? 8.678   -26.211  18.953  1.00 78.06  ? 132 ARG G CD    1 
ATOM   10232 N NE    . ARG I 3 129 ? 8.170   -24.850  18.790