data_4U7C
# 
_entry.id   4U7C 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4U7C         
WWPDB D_1000202906 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.details        . 
_pdbx_database_related.db_id          4U6P 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4U7C 
_pdbx_database_status.recvd_initial_deposition_date   2014-07-30 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Jha, V.K.' 1 
'Ling, H.'  2 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nucleic Acids Res.' 
_citation.journal_id_ASTM           NARHAD 
_citation.journal_id_CSD            0389 
_citation.journal_id_ISSN           1362-4962 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            44 
_citation.language                  ? 
_citation.page_first                4957 
_citation.page_last                 4967 
_citation.title                     
'Structure and mechanism of error-free replication past the major benzo[a]pyrene adduct by human DNA polymerase kappa.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1093/nar/gkw204 
_citation.pdbx_database_id_PubMed   27034468 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Jha, V.'  1 
primary 'Bian, C.' 2 
primary 'Xing, G.' 3 
primary 'Ling, H.' 4 
# 
_cell.entry_id           4U7C 
_cell.length_a           63.640 
_cell.length_b           130.170 
_cell.length_c           166.300 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4U7C 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA polymerase kappa'                                                                      56139.246 2   
2.7.7.7 ? 'UNP residues 27-518' ? 
2 polymer     syn 
;DNA (5'-D(P*GP*CP*GP*GP*AP*TP*CP*AP*G)-3')
;
2780.836  2   ?       ? ?                     ? 
3 polymer     syn 
;DNA (5'-D(*P*AP*TP*GP*(VKJ)P*CP*TP*GP*AP*TP*CP*CP*GP*C)-3')
;
4269.909  2   ?       ? ?                     ? 
4 non-polymer nat 'MAGNESIUM ION'                                                                             24.305    2   ? ? ? 
? 
5 non-polymer syn "2'-deoxy-5'-O-[(R)-hydroxy{[(R)-hydroxy(phosphonooxy)phosphoryl]amino}phosphoryl]cytidine" 466.172   2   ? ? ? 
? 
6 non-polymer syn 'DI(HYDROXYETHYL)ETHER'                                                                     106.120   3   ? ? ? 
? 
7 non-polymer syn 1,2-ETHANEDIOL                                                                              62.068    1   ? ? ? 
? 
8 water       nat water                                                                                       18.015    113 ? ? ? 
? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'DINB protein,DINP' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no  
;GMEGLDKEKINKIIMEATKGSRFYGNELKKEKQVNQRIENMMQQKAQITSQQLRKAQLQVDRFAMELEQSRNLSNTIVHI
DMDAFYAAVEMRDNPELKDKPIAVGSMSMLSTSNYHARRFGVRAAMPGFIAKRLCPQLIIVPPNFDKYRAVSKEVKEILA
DYDPNFMAMSLDEAYLNITKHLEERQNWPEDKRRYFIKMGSSVENDNPGKEVNKLSEHERSISPLLFEESPSDVQPPGDP
FQVNFEEQNNPQILQNSVVFGTSAQEVVKEIRFRIEQKTTLTASAGIAPNTMLAKVCSDKNKPNGQYQILPNRQAVMDFI
KDLPIRKVSGIGKVTEKMLKALGIITCTELYQQRALLSLLFSETSWHYFLHISLGLGSTHLTRDGERKSMSVERTFSEIN
KAEEQYSLCQELCSELAQDLQKERLKGRTVTIKLKNVNFEVKTRASTVSSVVSTAEEIFAIAKELLKTEIDADFPHPLRL
RLMGVRISSFPN
;
;GMEGLDKEKINKIIMEATKGSRFYGNELKKEKQVNQRIENMMQQKAQITSQQLRKAQLQVDRFAMELEQSRNLSNTIVHI
DMDAFYAAVEMRDNPELKDKPIAVGSMSMLSTSNYHARRFGVRAAMPGFIAKRLCPQLIIVPPNFDKYRAVSKEVKEILA
DYDPNFMAMSLDEAYLNITKHLEERQNWPEDKRRYFIKMGSSVENDNPGKEVNKLSEHERSISPLLFEESPSDVQPPGDP
FQVNFEEQNNPQILQNSVVFGTSAQEVVKEIRFRIEQKTTLTASAGIAPNTMLAKVCSDKNKPNGQYQILPNRQAVMDFI
KDLPIRKVSGIGKVTEKMLKALGIITCTELYQQRALLSLLFSETSWHYFLHISLGLGSTHLTRDGERKSMSVERTFSEIN
KAEEQYSLCQELCSELAQDLQKERLKGRTVTIKLKNVNFEVKTRASTVSSVVSTAEEIFAIAKELLKTEIDADFPHPLRL
RLMGVRISSFPN
;
A,B ? 
2 polydeoxyribonucleotide no no  '(DG)(DC)(DG)(DG)(DA)(DT)(DC)(DA)(DG)' GCGGATCAG C,P ? 
3 polydeoxyribonucleotide no yes '(DA)(DT)(DG)(VKJ)(DC)(DT)(DG)(DA)(DT)(DC)(DC)(DG)(DC)' ATGXCTGATCCGC D,T ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   MET n 
1 3   GLU n 
1 4   GLY n 
1 5   LEU n 
1 6   ASP n 
1 7   LYS n 
1 8   GLU n 
1 9   LYS n 
1 10  ILE n 
1 11  ASN n 
1 12  LYS n 
1 13  ILE n 
1 14  ILE n 
1 15  MET n 
1 16  GLU n 
1 17  ALA n 
1 18  THR n 
1 19  LYS n 
1 20  GLY n 
1 21  SER n 
1 22  ARG n 
1 23  PHE n 
1 24  TYR n 
1 25  GLY n 
1 26  ASN n 
1 27  GLU n 
1 28  LEU n 
1 29  LYS n 
1 30  LYS n 
1 31  GLU n 
1 32  LYS n 
1 33  GLN n 
1 34  VAL n 
1 35  ASN n 
1 36  GLN n 
1 37  ARG n 
1 38  ILE n 
1 39  GLU n 
1 40  ASN n 
1 41  MET n 
1 42  MET n 
1 43  GLN n 
1 44  GLN n 
1 45  LYS n 
1 46  ALA n 
1 47  GLN n 
1 48  ILE n 
1 49  THR n 
1 50  SER n 
1 51  GLN n 
1 52  GLN n 
1 53  LEU n 
1 54  ARG n 
1 55  LYS n 
1 56  ALA n 
1 57  GLN n 
1 58  LEU n 
1 59  GLN n 
1 60  VAL n 
1 61  ASP n 
1 62  ARG n 
1 63  PHE n 
1 64  ALA n 
1 65  MET n 
1 66  GLU n 
1 67  LEU n 
1 68  GLU n 
1 69  GLN n 
1 70  SER n 
1 71  ARG n 
1 72  ASN n 
1 73  LEU n 
1 74  SER n 
1 75  ASN n 
1 76  THR n 
1 77  ILE n 
1 78  VAL n 
1 79  HIS n 
1 80  ILE n 
1 81  ASP n 
1 82  MET n 
1 83  ASP n 
1 84  ALA n 
1 85  PHE n 
1 86  TYR n 
1 87  ALA n 
1 88  ALA n 
1 89  VAL n 
1 90  GLU n 
1 91  MET n 
1 92  ARG n 
1 93  ASP n 
1 94  ASN n 
1 95  PRO n 
1 96  GLU n 
1 97  LEU n 
1 98  LYS n 
1 99  ASP n 
1 100 LYS n 
1 101 PRO n 
1 102 ILE n 
1 103 ALA n 
1 104 VAL n 
1 105 GLY n 
1 106 SER n 
1 107 MET n 
1 108 SER n 
1 109 MET n 
1 110 LEU n 
1 111 SER n 
1 112 THR n 
1 113 SER n 
1 114 ASN n 
1 115 TYR n 
1 116 HIS n 
1 117 ALA n 
1 118 ARG n 
1 119 ARG n 
1 120 PHE n 
1 121 GLY n 
1 122 VAL n 
1 123 ARG n 
1 124 ALA n 
1 125 ALA n 
1 126 MET n 
1 127 PRO n 
1 128 GLY n 
1 129 PHE n 
1 130 ILE n 
1 131 ALA n 
1 132 LYS n 
1 133 ARG n 
1 134 LEU n 
1 135 CYS n 
1 136 PRO n 
1 137 GLN n 
1 138 LEU n 
1 139 ILE n 
1 140 ILE n 
1 141 VAL n 
1 142 PRO n 
1 143 PRO n 
1 144 ASN n 
1 145 PHE n 
1 146 ASP n 
1 147 LYS n 
1 148 TYR n 
1 149 ARG n 
1 150 ALA n 
1 151 VAL n 
1 152 SER n 
1 153 LYS n 
1 154 GLU n 
1 155 VAL n 
1 156 LYS n 
1 157 GLU n 
1 158 ILE n 
1 159 LEU n 
1 160 ALA n 
1 161 ASP n 
1 162 TYR n 
1 163 ASP n 
1 164 PRO n 
1 165 ASN n 
1 166 PHE n 
1 167 MET n 
1 168 ALA n 
1 169 MET n 
1 170 SER n 
1 171 LEU n 
1 172 ASP n 
1 173 GLU n 
1 174 ALA n 
1 175 TYR n 
1 176 LEU n 
1 177 ASN n 
1 178 ILE n 
1 179 THR n 
1 180 LYS n 
1 181 HIS n 
1 182 LEU n 
1 183 GLU n 
1 184 GLU n 
1 185 ARG n 
1 186 GLN n 
1 187 ASN n 
1 188 TRP n 
1 189 PRO n 
1 190 GLU n 
1 191 ASP n 
1 192 LYS n 
1 193 ARG n 
1 194 ARG n 
1 195 TYR n 
1 196 PHE n 
1 197 ILE n 
1 198 LYS n 
1 199 MET n 
1 200 GLY n 
1 201 SER n 
1 202 SER n 
1 203 VAL n 
1 204 GLU n 
1 205 ASN n 
1 206 ASP n 
1 207 ASN n 
1 208 PRO n 
1 209 GLY n 
1 210 LYS n 
1 211 GLU n 
1 212 VAL n 
1 213 ASN n 
1 214 LYS n 
1 215 LEU n 
1 216 SER n 
1 217 GLU n 
1 218 HIS n 
1 219 GLU n 
1 220 ARG n 
1 221 SER n 
1 222 ILE n 
1 223 SER n 
1 224 PRO n 
1 225 LEU n 
1 226 LEU n 
1 227 PHE n 
1 228 GLU n 
1 229 GLU n 
1 230 SER n 
1 231 PRO n 
1 232 SER n 
1 233 ASP n 
1 234 VAL n 
1 235 GLN n 
1 236 PRO n 
1 237 PRO n 
1 238 GLY n 
1 239 ASP n 
1 240 PRO n 
1 241 PHE n 
1 242 GLN n 
1 243 VAL n 
1 244 ASN n 
1 245 PHE n 
1 246 GLU n 
1 247 GLU n 
1 248 GLN n 
1 249 ASN n 
1 250 ASN n 
1 251 PRO n 
1 252 GLN n 
1 253 ILE n 
1 254 LEU n 
1 255 GLN n 
1 256 ASN n 
1 257 SER n 
1 258 VAL n 
1 259 VAL n 
1 260 PHE n 
1 261 GLY n 
1 262 THR n 
1 263 SER n 
1 264 ALA n 
1 265 GLN n 
1 266 GLU n 
1 267 VAL n 
1 268 VAL n 
1 269 LYS n 
1 270 GLU n 
1 271 ILE n 
1 272 ARG n 
1 273 PHE n 
1 274 ARG n 
1 275 ILE n 
1 276 GLU n 
1 277 GLN n 
1 278 LYS n 
1 279 THR n 
1 280 THR n 
1 281 LEU n 
1 282 THR n 
1 283 ALA n 
1 284 SER n 
1 285 ALA n 
1 286 GLY n 
1 287 ILE n 
1 288 ALA n 
1 289 PRO n 
1 290 ASN n 
1 291 THR n 
1 292 MET n 
1 293 LEU n 
1 294 ALA n 
1 295 LYS n 
1 296 VAL n 
1 297 CYS n 
1 298 SER n 
1 299 ASP n 
1 300 LYS n 
1 301 ASN n 
1 302 LYS n 
1 303 PRO n 
1 304 ASN n 
1 305 GLY n 
1 306 GLN n 
1 307 TYR n 
1 308 GLN n 
1 309 ILE n 
1 310 LEU n 
1 311 PRO n 
1 312 ASN n 
1 313 ARG n 
1 314 GLN n 
1 315 ALA n 
1 316 VAL n 
1 317 MET n 
1 318 ASP n 
1 319 PHE n 
1 320 ILE n 
1 321 LYS n 
1 322 ASP n 
1 323 LEU n 
1 324 PRO n 
1 325 ILE n 
1 326 ARG n 
1 327 LYS n 
1 328 VAL n 
1 329 SER n 
1 330 GLY n 
1 331 ILE n 
1 332 GLY n 
1 333 LYS n 
1 334 VAL n 
1 335 THR n 
1 336 GLU n 
1 337 LYS n 
1 338 MET n 
1 339 LEU n 
1 340 LYS n 
1 341 ALA n 
1 342 LEU n 
1 343 GLY n 
1 344 ILE n 
1 345 ILE n 
1 346 THR n 
1 347 CYS n 
1 348 THR n 
1 349 GLU n 
1 350 LEU n 
1 351 TYR n 
1 352 GLN n 
1 353 GLN n 
1 354 ARG n 
1 355 ALA n 
1 356 LEU n 
1 357 LEU n 
1 358 SER n 
1 359 LEU n 
1 360 LEU n 
1 361 PHE n 
1 362 SER n 
1 363 GLU n 
1 364 THR n 
1 365 SER n 
1 366 TRP n 
1 367 HIS n 
1 368 TYR n 
1 369 PHE n 
1 370 LEU n 
1 371 HIS n 
1 372 ILE n 
1 373 SER n 
1 374 LEU n 
1 375 GLY n 
1 376 LEU n 
1 377 GLY n 
1 378 SER n 
1 379 THR n 
1 380 HIS n 
1 381 LEU n 
1 382 THR n 
1 383 ARG n 
1 384 ASP n 
1 385 GLY n 
1 386 GLU n 
1 387 ARG n 
1 388 LYS n 
1 389 SER n 
1 390 MET n 
1 391 SER n 
1 392 VAL n 
1 393 GLU n 
1 394 ARG n 
1 395 THR n 
1 396 PHE n 
1 397 SER n 
1 398 GLU n 
1 399 ILE n 
1 400 ASN n 
1 401 LYS n 
1 402 ALA n 
1 403 GLU n 
1 404 GLU n 
1 405 GLN n 
1 406 TYR n 
1 407 SER n 
1 408 LEU n 
1 409 CYS n 
1 410 GLN n 
1 411 GLU n 
1 412 LEU n 
1 413 CYS n 
1 414 SER n 
1 415 GLU n 
1 416 LEU n 
1 417 ALA n 
1 418 GLN n 
1 419 ASP n 
1 420 LEU n 
1 421 GLN n 
1 422 LYS n 
1 423 GLU n 
1 424 ARG n 
1 425 LEU n 
1 426 LYS n 
1 427 GLY n 
1 428 ARG n 
1 429 THR n 
1 430 VAL n 
1 431 THR n 
1 432 ILE n 
1 433 LYS n 
1 434 LEU n 
1 435 LYS n 
1 436 ASN n 
1 437 VAL n 
1 438 ASN n 
1 439 PHE n 
1 440 GLU n 
1 441 VAL n 
1 442 LYS n 
1 443 THR n 
1 444 ARG n 
1 445 ALA n 
1 446 SER n 
1 447 THR n 
1 448 VAL n 
1 449 SER n 
1 450 SER n 
1 451 VAL n 
1 452 VAL n 
1 453 SER n 
1 454 THR n 
1 455 ALA n 
1 456 GLU n 
1 457 GLU n 
1 458 ILE n 
1 459 PHE n 
1 460 ALA n 
1 461 ILE n 
1 462 ALA n 
1 463 LYS n 
1 464 GLU n 
1 465 LEU n 
1 466 LEU n 
1 467 LYS n 
1 468 THR n 
1 469 GLU n 
1 470 ILE n 
1 471 ASP n 
1 472 ALA n 
1 473 ASP n 
1 474 PHE n 
1 475 PRO n 
1 476 HIS n 
1 477 PRO n 
1 478 LEU n 
1 479 ARG n 
1 480 LEU n 
1 481 ARG n 
1 482 LEU n 
1 483 MET n 
1 484 GLY n 
1 485 VAL n 
1 486 ARG n 
1 487 ILE n 
1 488 SER n 
1 489 SER n 
1 490 PHE n 
1 491 PRO n 
1 492 ASN n 
2 1   DG  n 
2 2   DC  n 
2 3   DG  n 
2 4   DG  n 
2 5   DA  n 
2 6   DT  n 
2 7   DC  n 
2 8   DA  n 
2 9   DG  n 
3 1   DA  n 
3 2   DT  n 
3 3   DG  n 
3 4   VKJ n 
3 5   DC  n 
3 6   DT  n 
3 7   DG  n 
3 8   DA  n 
3 9   DT  n 
3 10  DC  n 
3 11  DC  n 
3 12  DG  n 
3 13  DC  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   492 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'POLK, DINB1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 9  unidentified ? 32644 ? 
3 1 sample 1 13 unidentified ? 32644 ? 
# 
loop_
_struct_ref.db_code 
_struct_ref.db_name 
_struct_ref.details 
_struct_ref.entity_id 
_struct_ref.id 
_struct_ref.seq_align 
_struct_ref.seq_dif 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_align_end 
POLK_HUMAN UNP ? 1 1 ? ? Q9UBT6 ? 
;GMEGLDKEKINKIIMEATKGSRFYGNELKKEKQVNQRIENMMQQKAQITSQQLRKAQLQVDRFAMELEQSRNLSNTIVHI
DMDAFYAAVEMRDNPELKDKPIAVGSMSMLSTSNYHARRFGVRAAMPGFIAKRLCPQLIIVPPNFDKYRAVSKEVKEILA
DYDPNFMAMSLDEAYLNITKHLEERQNWPEDKRRYFIKMGSSVENDNPGKEVNKLSEHERSISPLLFEESPSDVQPPGDP
FQVNFEEQNNPQILQNSVVFGTSAQEVVKEIRFRIEQKTTLTASAGIAPNTMLAKVCSDKNKPNGQYQILPNRQAVMDFI
KDLPIRKVSGIGKVTEKMLKALGIITCTELYQQRALLSLLFSETSWHYFLHISLGLGSTHLTRDGERKSMSVERTFSEIN
KAEEQYSLCQELCSELAQDLQKERLKGRTVTIKLKNVNFEVKTRASTVSSVVSTAEEIFAIAKELLKTEIDADFPHPLRL
RLMGVRISSFPN
;
27 ? 
4U7C       PDB ? 2 2 ? ? 4U7C   ? ? 1  ? 
4U7C       PDB ? 3 3 ? ? 4U7C   ? ? 1  ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4U7C A 1 ? 492 ? Q9UBT6 27 ? 518 ? 27 518 
2 1 4U7C B 1 ? 492 ? Q9UBT6 27 ? 518 ? 27 518 
3 2 4U7C C 1 ? 9   ? 4U7C   5  ? 13  ? 5  13  
4 3 4U7C D 1 ? 13  ? 4U7C   2  ? 14  ? 2  14  
5 2 4U7C P 1 ? 9   ? 4U7C   5  ? 13  ? 5  13  
6 3 4U7C T 1 ? 13  ? 4U7C   2  ? 14  ? 2  14  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
0KX non-polymer         . "2'-deoxy-5'-O-[(R)-hydroxy{[(R)-hydroxy(phosphonooxy)phosphoryl]amino}phosphoryl]cytidine" ? 
'C9 H17 N4 O12 P3' 466.172 
ALA 'L-peptide linking' y ALANINE ?                 'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE ?                 'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE ?                 'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                 'C4 H7 N O4'       133.103 
CYS 'L-peptide linking' y CYSTEINE ?                 'C3 H7 N O2 S'     121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ?                 'C10 H14 N5 O6 P'  331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE" ?                 'C9 H14 N3 O7 P'   307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ?                 'C10 H14 N5 O7 P'  347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE" ?                 'C10 H15 N2 O8 P'  322.208 
EDO non-polymer         . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2'         62.068  
GLN 'L-peptide linking' y GLUTAMINE ?                 'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                 'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE ?                 'C2 H5 N O2'       75.067  
HIS 'L-peptide linking' y HISTIDINE ?                 'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER ?                 'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE ?                 'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE ?                 'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE ?                 'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE ?                 'C5 H11 N O2 S'    149.211 
MG  non-polymer         . 'MAGNESIUM ION' ?                 'Mg 2'             24.305  
PEG non-polymer         . 'DI(HYDROXYETHYL)ETHER' ?                 'C4 H10 O3'        106.120 
PHE 'L-peptide linking' y PHENYLALANINE ?                 'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE ?                 'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE ?                 'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE ?                 'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ?                 'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE ?                 'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE ?                 'C5 H11 N O2'      117.146 
VKJ non-polymer         . 
;2'-deoxy-N-[(7R,8S,9R,10S)-7,8,9-trihydroxy-7,8,9,10-tetrahydrobenzo[pqr]tetraphen-10-yl]guanosine 5'-(dihydrogen phosphate)
;
?                 'C30 H28 N5 O10 P' 649.545 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4U7C 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.76 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         55.45 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            295.15 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    'PEG 400, ammonium iodide' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           110 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'RAYONIX MX-300' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2013-05-13 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.98 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'CLSI BEAMLINE 08ID-1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.98 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   08ID-1 
_diffrn_source.pdbx_synchrotron_site       CLSI 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         4U7C 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.8 
_reflns.d_resolution_low                 47.111 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       34235 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             98.7 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.3 
_reflns.pdbx_Rmerge_I_obs                0.070 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            12.5 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.80 
_reflns_shell.d_res_low                   2.95 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         2.0 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        98.4 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.671 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             3.3 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4U7C 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     34189 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.36 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             47.111 
_refine.ls_d_res_high                            2.800 
_refine.ls_percent_reflns_obs                    98.06 
_refine.ls_R_factor_obs                          0.2133 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2123 
_refine.ls_R_factor_R_free                       0.2523 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.57 
_refine.ls_number_reflns_R_free                  877 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      2OH2 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.45 
_refine.pdbx_overall_phase_error                 31.33 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6720 
_refine_hist.pdbx_number_atoms_nucleic_acid   946 
_refine_hist.pdbx_number_atoms_ligand         83 
_refine_hist.number_atoms_solvent             113 
_refine_hist.number_atoms_total               7862 
_refine_hist.d_res_high                       2.800 
_refine_hist.d_res_low                        47.111 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.006  ? ? 8005  'X-RAY DIFFRACTION' ? 
f_angle_d          1.057  ? ? 10995 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 20.598 ? ? 3095  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.044  ? ? 1255  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.004  ? ? 1234  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 2.8000 2.9754  5466 0.3565 98.00 0.3868 . . 161 . . 
'X-RAY DIFFRACTION' . 2.9754 3.2051  5494 0.2918 99.00 0.3298 . . 149 . . 
'X-RAY DIFFRACTION' . 3.2051 3.5275  5519 0.2362 98.00 0.3077 . . 128 . . 
'X-RAY DIFFRACTION' . 3.5275 4.0378  5562 0.2094 99.00 0.2875 . . 153 . . 
'X-RAY DIFFRACTION' . 4.0378 5.0862  5586 0.1850 99.00 0.2411 . . 147 . . 
'X-RAY DIFFRACTION' . 5.0862 47.1176 5685 0.1844 96.00 0.1866 . . 139 . . 
# 
_struct.entry_id                     4U7C 
_struct.title                        'Structure of DNA polymerase kappa in complex with benzopyrene adducted DNA' 
_struct.pdbx_descriptor              'DNA polymerase kappa/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4U7C 
_struct_keywords.text            
'benzo[a]pyrene-N2-Guanine, DNA replication, DNA damage tolerance, polymerase kappa, Environment pollution, TRANSFERASE-DNA complex' 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 5 ? 
I N N 6 ? 
J N N 7 ? 
K N N 4 ? 
L N N 5 ? 
M N N 6 ? 
N N N 6 ? 
O N N 8 ? 
P N N 8 ? 
Q N N 8 ? 
R N N 8 ? 
S N N 8 ? 
T N N 8 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASP A 6   ? LYS A 19  ? ASP A 32  LYS A 45  1 ? 14 
HELX_P HELX_P2  AA2 SER A 21  ? GLN A 47  ? SER A 47  GLN A 73  1 ? 27 
HELX_P HELX_P3  AA3 THR A 49  ? SER A 70  ? THR A 75  SER A 96  1 ? 22 
HELX_P HELX_P4  AA4 ALA A 84  ? ASP A 93  ? ALA A 110 ASP A 119 1 ? 10 
HELX_P HELX_P5  AA5 ASN A 94  ? LYS A 98  ? ASN A 120 LYS A 124 5 ? 5  
HELX_P HELX_P6  AA6 ASN A 114 ? ARG A 119 ? ASN A 140 ARG A 145 1 ? 6  
HELX_P HELX_P7  AA7 PRO A 127 ? CYS A 135 ? PRO A 153 CYS A 161 1 ? 9  
HELX_P HELX_P8  AA8 ASN A 144 ? ALA A 160 ? ASN A 170 ALA A 186 1 ? 17 
HELX_P HELX_P9  AA9 ILE A 178 ? GLN A 186 ? ILE A 204 GLN A 212 1 ? 9  
HELX_P HELX_P10 AB1 PRO A 189 ? LYS A 192 ? PRO A 215 LYS A 218 5 ? 4  
HELX_P HELX_P11 AB2 SER A 263 ? THR A 280 ? SER A 289 THR A 306 1 ? 18 
HELX_P HELX_P12 AB3 ASN A 290 ? SER A 298 ? ASN A 316 SER A 324 1 ? 9  
HELX_P HELX_P13 AB4 ASN A 312 ? LYS A 321 ? ASN A 338 LYS A 347 1 ? 10 
HELX_P HELX_P14 AB5 ASP A 322 ? LEU A 323 ? ASP A 348 LEU A 349 5 ? 2  
HELX_P HELX_P15 AB6 PRO A 324 ? VAL A 328 ? PRO A 350 VAL A 354 5 ? 5  
HELX_P HELX_P16 AB7 GLY A 332 ? LEU A 342 ? GLY A 358 LEU A 368 1 ? 11 
HELX_P HELX_P17 AB8 THR A 346 ? GLN A 353 ? THR A 372 GLN A 379 1 ? 8  
HELX_P HELX_P18 AB9 GLN A 353 ? PHE A 361 ? GLN A 379 PHE A 387 1 ? 9  
HELX_P HELX_P19 AC1 SER A 362 ? GLY A 375 ? SER A 388 GLY A 401 1 ? 14 
HELX_P HELX_P20 AC2 LYS A 401 ? ARG A 424 ? LYS A 427 ARG A 450 1 ? 24 
HELX_P HELX_P21 AC3 THR A 454 ? PHE A 474 ? THR A 480 PHE A 500 1 ? 21 
HELX_P HELX_P22 AC4 ASP B 6   ? LYS B 19  ? ASP B 32  LYS B 45  1 ? 14 
HELX_P HELX_P23 AC5 SER B 21  ? GLN B 47  ? SER B 47  GLN B 73  1 ? 27 
HELX_P HELX_P24 AC6 THR B 49  ? SER B 70  ? THR B 75  SER B 96  1 ? 22 
HELX_P HELX_P25 AC7 ALA B 84  ? ASP B 93  ? ALA B 110 ASP B 119 1 ? 10 
HELX_P HELX_P26 AC8 ASN B 94  ? LYS B 98  ? ASN B 120 LYS B 124 5 ? 5  
HELX_P HELX_P27 AC9 ASN B 114 ? ARG B 119 ? ASN B 140 ARG B 145 1 ? 6  
HELX_P HELX_P28 AD1 PRO B 127 ? CYS B 135 ? PRO B 153 CYS B 161 1 ? 9  
HELX_P HELX_P29 AD2 ASN B 144 ? ALA B 160 ? ASN B 170 ALA B 186 1 ? 17 
HELX_P HELX_P30 AD3 ILE B 178 ? GLN B 186 ? ILE B 204 GLN B 212 1 ? 9  
HELX_P HELX_P31 AD4 PRO B 189 ? LYS B 192 ? PRO B 215 LYS B 218 5 ? 4  
HELX_P HELX_P32 AD5 SER B 263 ? THR B 280 ? SER B 289 THR B 306 1 ? 18 
HELX_P HELX_P33 AD6 ASN B 290 ? SER B 298 ? ASN B 316 SER B 324 1 ? 9  
HELX_P HELX_P34 AD7 ASN B 312 ? LYS B 321 ? ASN B 338 LYS B 347 1 ? 10 
HELX_P HELX_P35 AD8 ASP B 322 ? LEU B 323 ? ASP B 348 LEU B 349 5 ? 2  
HELX_P HELX_P36 AD9 PRO B 324 ? VAL B 328 ? PRO B 350 VAL B 354 5 ? 5  
HELX_P HELX_P37 AE1 GLY B 332 ? LEU B 342 ? GLY B 358 LEU B 368 1 ? 11 
HELX_P HELX_P38 AE2 THR B 346 ? GLN B 353 ? THR B 372 GLN B 379 1 ? 8  
HELX_P HELX_P39 AE3 GLN B 353 ? PHE B 361 ? GLN B 379 PHE B 387 1 ? 9  
HELX_P HELX_P40 AE4 SER B 362 ? GLY B 375 ? SER B 388 GLY B 401 1 ? 14 
HELX_P HELX_P41 AE5 LYS B 401 ? ARG B 424 ? LYS B 427 ARG B 450 1 ? 24 
HELX_P HELX_P42 AE6 THR B 454 ? PHE B 474 ? THR B 480 PHE B 500 1 ? 21 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ?   ? A ASP 81  OD1   ? ? ? 1_555 G MG  .  MG  ? ? A ASP 107 A MG  601 1_555 ? ? ? ? ? ? ?            2.115 ? 
metalc2  metalc ?   ? A MET 82  O     ? ? ? 1_555 G MG  .  MG  ? ? A MET 108 A MG  601 1_555 ? ? ? ? ? ? ?            2.070 ? 
metalc3  metalc ?   ? A ASP 172 OD1   ? ? ? 1_555 G MG  .  MG  ? ? A ASP 198 A MG  601 1_555 ? ? ? ? ? ? ?            2.282 ? 
metalc4  metalc ?   ? B ASP 81  OD1   ? ? ? 1_555 K MG  .  MG  ? ? B ASP 107 B MG  602 1_555 ? ? ? ? ? ? ?            2.010 ? 
metalc5  metalc ?   ? B MET 82  O     ? ? ? 1_555 K MG  .  MG  ? ? B MET 108 B MG  602 1_555 ? ? ? ? ? ? ?            2.727 ? 
metalc6  metalc ?   ? B ASP 172 OD2   ? ? ? 1_555 K MG  .  MG  ? ? B ASP 198 B MG  602 1_555 ? ? ? ? ? ? ?            2.686 ? 
covale1  covale one ? D DG  3   "O3'" ? ? ? 1_555 D VKJ 4  P1  ? ? D DG  4   D VKJ 5   1_555 ? ? ? ? ? ? ?            1.518 ? 
covale2  covale one ? D VKJ 4   O3    ? ? ? 1_555 D DC  5  P   ? ? D VKJ 5   D DC  6   1_555 ? ? ? ? ? ? ?            1.504 ? 
covale3  covale one ? F DG  3   "O3'" ? ? ? 1_555 F VKJ 4  P1  ? ? T DG  4   T VKJ 5   1_555 ? ? ? ? ? ? ?            1.588 ? 
covale4  covale one ? F VKJ 4   O3    ? ? ? 1_555 F DC  5  P   ? ? T VKJ 5   T DC  6   1_555 ? ? ? ? ? ? ?            1.581 ? 
metalc7  metalc ?   ? G MG  .   MG    ? ? ? 1_555 H 0KX .  O1B ? ? A MG  601 A 0KX 602 1_555 ? ? ? ? ? ? ?            2.320 ? 
metalc8  metalc ?   ? G MG  .   MG    ? ? ? 1_555 H 0KX .  O2A ? ? A MG  601 A 0KX 602 1_555 ? ? ? ? ? ? ?            2.214 ? 
metalc9  metalc ?   ? G MG  .   MG    ? ? ? 1_555 H 0KX .  O2G ? ? A MG  601 A 0KX 602 1_555 ? ? ? ? ? ? ?            2.181 ? 
metalc10 metalc ?   ? K MG  .   MG    ? ? ? 1_555 L 0KX .  O1A ? ? B MG  602 B 0KX 603 1_555 ? ? ? ? ? ? ?            2.294 ? 
metalc11 metalc ?   ? K MG  .   MG    ? ? ? 1_555 L 0KX .  O2G ? ? B MG  602 B 0KX 603 1_555 ? ? ? ? ? ? ?            2.101 ? 
metalc12 metalc ?   ? K MG  .   MG    ? ? ? 1_555 L 0KX .  O2B ? ? B MG  602 B 0KX 603 1_555 ? ? ? ? ? ? ?            2.287 ? 
hydrog1  hydrog ?   ? C DG  1   N1    ? ? ? 1_555 D DC  13 N3  ? ? C DG  5   D DC  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ?   ? C DG  1   N2    ? ? ? 1_555 D DC  13 O2  ? ? C DG  5   D DC  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ?   ? C DG  1   O6    ? ? ? 1_555 D DC  13 N4  ? ? C DG  5   D DC  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ?   ? C DC  2   N3    ? ? ? 1_555 D DG  12 N1  ? ? C DC  6   D DG  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ?   ? C DC  2   N4    ? ? ? 1_555 D DG  12 O6  ? ? C DC  6   D DG  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ?   ? C DC  2   O2    ? ? ? 1_555 D DG  12 N2  ? ? C DC  6   D DG  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ?   ? C DG  3   N1    ? ? ? 1_555 D DC  11 N3  ? ? C DG  7   D DC  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ?   ? C DG  3   N2    ? ? ? 1_555 D DC  11 O2  ? ? C DG  7   D DC  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ?   ? C DG  3   O6    ? ? ? 1_555 D DC  11 N4  ? ? C DG  7   D DC  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ?   ? C DG  4   N1    ? ? ? 1_555 D DC  10 N3  ? ? C DG  8   D DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ?   ? C DG  4   N2    ? ? ? 1_555 D DC  10 O2  ? ? C DG  8   D DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ?   ? C DG  4   O6    ? ? ? 1_555 D DC  10 N4  ? ? C DG  8   D DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ?   ? C DA  5   N1    ? ? ? 1_555 D DT  9  N3  ? ? C DA  9   D DT  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ?   ? C DA  5   N6    ? ? ? 1_555 D DT  9  O4  ? ? C DA  9   D DT  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ?   ? C DT  6   N3    ? ? ? 1_555 D DA  8  N1  ? ? C DT  10  D DA  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ?   ? C DT  6   O4    ? ? ? 1_555 D DA  8  N6  ? ? C DT  10  D DA  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ?   ? C DC  7   N3    ? ? ? 1_555 D DG  7  N1  ? ? C DC  11  D DG  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ?   ? C DC  7   N4    ? ? ? 1_555 D DG  7  O6  ? ? C DC  11  D DG  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ?   ? C DC  7   O2    ? ? ? 1_555 D DG  7  N2  ? ? C DC  11  D DG  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ?   ? C DA  8   N1    ? ? ? 1_555 D DT  6  N3  ? ? C DA  12  D DT  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ?   ? C DA  8   N6    ? ? ? 1_555 D DT  6  O4  ? ? C DA  12  D DT  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ?   ? C DG  9   N1    ? ? ? 1_555 D DC  5  N3  ? ? C DG  13  D DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ?   ? C DG  9   N2    ? ? ? 1_555 D DC  5  O2  ? ? C DG  13  D DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ?   ? C DG  9   O6    ? ? ? 1_555 D DC  5  N4  ? ? C DG  13  D DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ?   ? E DG  1   N1    ? ? ? 1_555 F DC  13 N3  ? ? P DG  5   T DC  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ?   ? E DG  1   N2    ? ? ? 1_555 F DC  13 O2  ? ? P DG  5   T DC  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ?   ? E DG  1   O6    ? ? ? 1_555 F DC  13 N4  ? ? P DG  5   T DC  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ?   ? E DC  2   N3    ? ? ? 1_555 F DG  12 N1  ? ? P DC  6   T DG  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ?   ? E DC  2   N4    ? ? ? 1_555 F DG  12 O6  ? ? P DC  6   T DG  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ?   ? E DC  2   O2    ? ? ? 1_555 F DG  12 N2  ? ? P DC  6   T DG  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ?   ? E DG  3   N1    ? ? ? 1_555 F DC  11 N3  ? ? P DG  7   T DC  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ?   ? E DG  3   N2    ? ? ? 1_555 F DC  11 O2  ? ? P DG  7   T DC  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ?   ? E DG  3   O6    ? ? ? 1_555 F DC  11 N4  ? ? P DG  7   T DC  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ?   ? E DG  4   N1    ? ? ? 1_555 F DC  10 N3  ? ? P DG  8   T DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ?   ? E DG  4   N2    ? ? ? 1_555 F DC  10 O2  ? ? P DG  8   T DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ?   ? E DG  4   O6    ? ? ? 1_555 F DC  10 N4  ? ? P DG  8   T DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ?   ? E DA  5   N1    ? ? ? 1_555 F DT  9  N3  ? ? P DA  9   T DT  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ?   ? E DA  5   N6    ? ? ? 1_555 F DT  9  O4  ? ? P DA  9   T DT  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ?   ? E DT  6   N3    ? ? ? 1_555 F DA  8  N1  ? ? P DT  10  T DA  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ?   ? E DT  6   O4    ? ? ? 1_555 F DA  8  N6  ? ? P DT  10  T DA  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ?   ? E DC  7   N3    ? ? ? 1_555 F DG  7  N1  ? ? P DC  11  T DG  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ?   ? E DC  7   N4    ? ? ? 1_555 F DG  7  O6  ? ? P DC  11  T DG  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43 hydrog ?   ? E DC  7   O2    ? ? ? 1_555 F DG  7  N2  ? ? P DC  11  T DG  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44 hydrog ?   ? E DA  8   N1    ? ? ? 1_555 F DT  6  N3  ? ? P DA  12  T DT  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45 hydrog ?   ? E DA  8   N6    ? ? ? 1_555 F DT  6  O4  ? ? P DA  12  T DT  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46 hydrog ?   ? E DG  9   N1    ? ? ? 1_555 F DC  5  N3  ? ? P DG  13  T DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47 hydrog ?   ? E DG  9   N2    ? ? ? 1_555 F DC  5  O2  ? ? P DG  13  T DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48 hydrog ?   ? E DG  9   O6    ? ? ? 1_555 F DC  5  N4  ? ? P DG  13  T DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LYS 302 A . ? LYS 328 A PRO 303 A ? PRO 329 A 1 -0.20 
2 PHE 474 A . ? PHE 500 A PRO 475 A ? PRO 501 A 1 7.96  
3 LYS 302 B . ? LYS 328 B PRO 303 B ? PRO 329 B 1 -1.80 
4 PHE 474 B . ? PHE 500 B PRO 475 B ? PRO 501 B 1 7.36  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5 ? 
AA2 ? 3 ? 
AA3 ? 2 ? 
AA4 ? 4 ? 
AA5 ? 5 ? 
AA6 ? 3 ? 
AA7 ? 2 ? 
AA8 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? parallel      
AA2 1 2 ? anti-parallel 
AA2 2 3 ? parallel      
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA5 4 5 ? parallel      
AA6 1 2 ? anti-parallel 
AA6 2 3 ? parallel      
AA7 1 2 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA8 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 MET A 167 ? ALA A 168 ? MET A 193 ALA A 194 
AA1 2 GLU A 173 ? ASN A 177 ? GLU A 199 ASN A 203 
AA1 3 ILE A 77  ? MET A 82  ? ILE A 103 MET A 108 
AA1 4 ALA A 283 ? ALA A 288 ? ALA A 309 ALA A 314 
AA1 5 GLN A 306 ? GLN A 308 ? GLN A 332 GLN A 334 
AA2 1 LEU A 110 ? SER A 113 ? LEU A 136 SER A 139 
AA2 2 ILE A 102 ? GLY A 105 ? ILE A 128 GLY A 131 
AA2 3 ILE A 139 ? VAL A 141 ? ILE A 165 VAL A 167 
AA3 1 ARG A 194 ? PHE A 196 ? ARG A 220 PHE A 222 
AA3 2 SER A 257 ? VAL A 259 ? SER A 283 VAL A 285 
AA4 1 SER A 389 ? ILE A 399 ? SER A 415 ILE A 425 
AA4 2 LEU A 480 ? SER A 488 ? LEU A 506 SER A 514 
AA4 3 GLY A 427 ? ASN A 436 ? GLY A 453 ASN A 462 
AA4 4 VAL A 441 ? VAL A 452 ? VAL A 467 VAL A 478 
AA5 1 MET B 167 ? ALA B 168 ? MET B 193 ALA B 194 
AA5 2 GLU B 173 ? ASN B 177 ? GLU B 199 ASN B 203 
AA5 3 ILE B 77  ? MET B 82  ? ILE B 103 MET B 108 
AA5 4 ALA B 283 ? ALA B 288 ? ALA B 309 ALA B 314 
AA5 5 GLN B 306 ? GLN B 308 ? GLN B 332 GLN B 334 
AA6 1 LEU B 110 ? SER B 113 ? LEU B 136 SER B 139 
AA6 2 ILE B 102 ? GLY B 105 ? ILE B 128 GLY B 131 
AA6 3 ILE B 139 ? VAL B 141 ? ILE B 165 VAL B 167 
AA7 1 ARG B 194 ? PHE B 196 ? ARG B 220 PHE B 222 
AA7 2 SER B 257 ? VAL B 259 ? SER B 283 VAL B 285 
AA8 1 SER B 389 ? ILE B 399 ? SER B 415 ILE B 425 
AA8 2 LEU B 480 ? SER B 488 ? LEU B 506 SER B 514 
AA8 3 GLY B 427 ? ASN B 436 ? GLY B 453 ASN B 462 
AA8 4 VAL B 441 ? VAL B 452 ? VAL B 467 VAL B 478 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N MET A 167 ? N MET A 193 O TYR A 175 ? O TYR A 201 
AA1 2 3 O LEU A 176 ? O LEU A 202 N VAL A 78  ? N VAL A 104 
AA1 3 4 N ILE A 77  ? N ILE A 103 O ALA A 288 ? O ALA A 314 
AA1 4 5 N ILE A 287 ? N ILE A 313 O TYR A 307 ? O TYR A 333 
AA2 1 2 O THR A 112 ? O THR A 138 N VAL A 104 ? N VAL A 130 
AA2 2 3 N ALA A 103 ? N ALA A 129 O ILE A 139 ? O ILE A 165 
AA3 1 2 N TYR A 195 ? N TYR A 221 O VAL A 258 ? O VAL A 284 
AA4 1 2 N MET A 390 ? N MET A 416 O ILE A 487 ? O ILE A 513 
AA4 2 3 O ARG A 486 ? O ARG A 512 N THR A 431 ? N THR A 457 
AA4 3 4 N GLY A 427 ? N GLY A 453 O VAL A 452 ? O VAL A 478 
AA5 1 2 N MET B 167 ? N MET B 193 O TYR B 175 ? O TYR B 201 
AA5 2 3 O LEU B 176 ? O LEU B 202 N VAL B 78  ? N VAL B 104 
AA5 3 4 N ASP B 81  ? N ASP B 107 O SER B 284 ? O SER B 310 
AA5 4 5 N ILE B 287 ? N ILE B 313 O TYR B 307 ? O TYR B 333 
AA6 1 2 O THR B 112 ? O THR B 138 N VAL B 104 ? N VAL B 130 
AA6 2 3 N ALA B 103 ? N ALA B 129 O ILE B 139 ? O ILE B 165 
AA7 1 2 N TYR B 195 ? N TYR B 221 O VAL B 258 ? O VAL B 284 
AA8 1 2 N MET B 390 ? N MET B 416 O ILE B 487 ? O ILE B 513 
AA8 2 3 O ARG B 486 ? O ARG B 512 N THR B 431 ? N THR B 457 
AA8 3 4 N GLY B 427 ? N GLY B 453 O VAL B 452 ? O VAL B 478 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A MG  601 ? 4  'binding site for residue MG A 601'                 
AC2 Software A 0KX 602 ? 14 'binding site for residue 0KX A 602'                
AC3 Software A PEG 603 ? 4  'binding site for residue PEG A 603'                
AC4 Software B EDO 601 ? 5  'binding site for residue EDO B 601'                
AC5 Software B MG  602 ? 4  'binding site for residue MG B 602'                 
AC6 Software B 0KX 603 ? 13 'binding site for residue 0KX B 603'                
AC7 Software B PEG 604 ? 3  'binding site for residue PEG B 604'                
AC8 Software B PEG 605 ? 3  'binding site for residue PEG B 605'                
AC9 Software D DG  4   ? 19 'binding site for Di-nucleotide DG D 4 and VKJ D 5' 
AD1 Software D VKJ 5   ? 18 'binding site for Di-nucleotide VKJ D 5 and DC D 6' 
AD2 Software T DG  4   ? 18 'binding site for Di-nucleotide DG T 4 and VKJ T 5' 
AD3 Software T VKJ 5   ? 16 'binding site for Di-nucleotide VKJ T 5 and DC T 6' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 4  ASP A 81  ? ASP A 107 . ? 1_555 ? 
2   AC1 4  MET A 82  ? MET A 108 . ? 1_555 ? 
3   AC1 4  ASP A 172 ? ASP A 198 . ? 1_555 ? 
4   AC1 4  0KX H .   ? 0KX A 602 . ? 1_555 ? 
5   AC2 14 ASP A 81  ? ASP A 107 . ? 1_555 ? 
6   AC2 14 MET A 82  ? MET A 108 . ? 1_555 ? 
7   AC2 14 ALA A 84  ? ALA A 110 . ? 1_555 ? 
8   AC2 14 PHE A 85  ? PHE A 111 . ? 1_555 ? 
9   AC2 14 TYR A 86  ? TYR A 112 . ? 1_555 ? 
10  AC2 14 SER A 111 ? SER A 137 . ? 1_555 ? 
11  AC2 14 THR A 112 ? THR A 138 . ? 1_555 ? 
12  AC2 14 TYR A 115 ? TYR A 141 . ? 1_555 ? 
13  AC2 14 ARG A 118 ? ARG A 144 . ? 1_555 ? 
14  AC2 14 ASP A 172 ? ASP A 198 . ? 1_555 ? 
15  AC2 14 LYS A 302 ? LYS A 328 . ? 1_555 ? 
16  AC2 14 MG  G .   ? MG  A 601 . ? 1_555 ? 
17  AC2 14 DG  C 9   ? DG  C 13  . ? 1_555 ? 
18  AC2 14 VKJ D 4   ? VKJ D 5   . ? 1_555 ? 
19  AC3 4  LYS A 433 ? LYS A 459 . ? 1_555 ? 
20  AC3 4  LYS A 435 ? LYS A 461 . ? 1_555 ? 
21  AC3 4  VAL A 441 ? VAL A 467 . ? 1_555 ? 
22  AC3 4  DA  C 5   ? DA  C 9   . ? 1_555 ? 
23  AC4 5  GLY B 105 ? GLY B 131 . ? 1_555 ? 
24  AC4 5  SER B 106 ? SER B 132 . ? 1_555 ? 
25  AC4 5  MET B 109 ? MET B 135 . ? 1_555 ? 
26  AC4 5  PRO B 143 ? PRO B 169 . ? 1_555 ? 
27  AC4 5  VKJ F 4   ? VKJ T 5   . ? 1_555 ? 
28  AC5 4  ASP B 81  ? ASP B 107 . ? 1_555 ? 
29  AC5 4  MET B 82  ? MET B 108 . ? 1_555 ? 
30  AC5 4  ASP B 172 ? ASP B 198 . ? 1_555 ? 
31  AC5 4  0KX L .   ? 0KX B 603 . ? 1_555 ? 
32  AC6 13 ASP B 81  ? ASP B 107 . ? 1_555 ? 
33  AC6 13 MET B 82  ? MET B 108 . ? 1_555 ? 
34  AC6 13 ALA B 84  ? ALA B 110 . ? 1_555 ? 
35  AC6 13 PHE B 85  ? PHE B 111 . ? 1_555 ? 
36  AC6 13 SER B 111 ? SER B 137 . ? 1_555 ? 
37  AC6 13 THR B 112 ? THR B 138 . ? 1_555 ? 
38  AC6 13 TYR B 115 ? TYR B 141 . ? 1_555 ? 
39  AC6 13 ARG B 118 ? ARG B 144 . ? 1_555 ? 
40  AC6 13 ASP B 172 ? ASP B 198 . ? 1_555 ? 
41  AC6 13 LYS B 302 ? LYS B 328 . ? 1_555 ? 
42  AC6 13 MG  K .   ? MG  B 602 . ? 1_555 ? 
43  AC6 13 DG  E 9   ? DG  P 13  . ? 1_555 ? 
44  AC6 13 VKJ F 4   ? VKJ T 5   . ? 1_555 ? 
45  AC7 3  PHE B 145 ? PHE B 171 . ? 1_555 ? 
46  AC7 3  HOH P .   ? HOH B 726 . ? 1_555 ? 
47  AC7 3  VKJ F 4   ? VKJ T 5   . ? 1_555 ? 
48  AC8 3  TYR B 406 ? TYR B 432 . ? 1_555 ? 
49  AC8 3  LYS B 463 ? LYS B 489 . ? 1_555 ? 
50  AC8 3  HOH P .   ? HOH B 710 . ? 1_555 ? 
51  AC9 19 THR A 18  ? THR A 44  . ? 1_555 ? 
52  AC9 19 SER A 21  ? SER A 47  . ? 1_555 ? 
53  AC9 19 PHE A 23  ? PHE A 49  . ? 1_555 ? 
54  AC9 19 TYR A 86  ? TYR A 112 . ? 1_555 ? 
55  AC9 19 SER A 108 ? SER A 134 . ? 1_555 ? 
56  AC9 19 MET A 109 ? MET A 135 . ? 1_555 ? 
57  AC9 19 SER A 111 ? SER A 137 . ? 1_555 ? 
58  AC9 19 ALA A 125 ? ALA A 151 . ? 1_555 ? 
59  AC9 19 PRO A 127 ? PRO A 153 . ? 1_555 ? 
60  AC9 19 PRO A 143 ? PRO A 169 . ? 1_555 ? 
61  AC9 19 THR A 395 ? THR A 421 . ? 1_555 ? 
62  AC9 19 ARG A 481 ? ARG A 507 . ? 1_555 ? 
63  AC9 19 0KX H .   ? 0KX A 602 . ? 1_555 ? 
64  AC9 19 HOH O .   ? HOH A 708 . ? 1_555 ? 
65  AC9 19 HOH O .   ? HOH A 722 . ? 1_555 ? 
66  AC9 19 DG  C 9   ? DG  C 13  . ? 1_555 ? 
67  AC9 19 DT  D 2   ? DT  D 3   . ? 1_555 ? 
68  AC9 19 DC  D 5   ? DC  D 6   . ? 1_555 ? 
69  AC9 19 HOH R .   ? HOH D 108 . ? 1_555 ? 
70  AD1 18 TYR A 86  ? TYR A 112 . ? 1_555 ? 
71  AD1 18 MET A 109 ? MET A 135 . ? 1_555 ? 
72  AD1 18 SER A 111 ? SER A 137 . ? 1_555 ? 
73  AD1 18 ALA A 125 ? ALA A 151 . ? 1_555 ? 
74  AD1 18 PRO A 143 ? PRO A 169 . ? 1_555 ? 
75  AD1 18 GLU A 393 ? GLU A 419 . ? 1_555 ? 
76  AD1 18 THR A 395 ? THR A 421 . ? 1_555 ? 
77  AD1 18 ARG A 481 ? ARG A 507 . ? 1_555 ? 
78  AD1 18 LEU A 482 ? LEU A 508 . ? 1_555 ? 
79  AD1 18 0KX H .   ? 0KX A 602 . ? 1_555 ? 
80  AD1 18 HOH O .   ? HOH A 708 . ? 1_555 ? 
81  AD1 18 HOH O .   ? HOH A 722 . ? 1_555 ? 
82  AD1 18 DG  C 9   ? DG  C 13  . ? 1_555 ? 
83  AD1 18 DG  D 3   ? DG  D 4   . ? 1_555 ? 
84  AD1 18 DT  D 6   ? DT  D 7   . ? 1_555 ? 
85  AD1 18 HOH R .   ? HOH D 101 . ? 1_555 ? 
86  AD1 18 HOH R .   ? HOH D 108 . ? 1_555 ? 
87  AD1 18 HOH R .   ? HOH D 109 . ? 1_555 ? 
88  AD2 18 THR B 18  ? THR B 44  . ? 1_555 ? 
89  AD2 18 SER B 21  ? SER B 47  . ? 1_555 ? 
90  AD2 18 PHE B 23  ? PHE B 49  . ? 1_555 ? 
91  AD2 18 TYR B 86  ? TYR B 112 . ? 1_555 ? 
92  AD2 18 SER B 108 ? SER B 134 . ? 1_555 ? 
93  AD2 18 MET B 109 ? MET B 135 . ? 1_555 ? 
94  AD2 18 ALA B 125 ? ALA B 151 . ? 1_555 ? 
95  AD2 18 PRO B 127 ? PRO B 153 . ? 1_555 ? 
96  AD2 18 ILE B 130 ? ILE B 156 . ? 1_555 ? 
97  AD2 18 PHE B 145 ? PHE B 171 . ? 1_555 ? 
98  AD2 18 ARG B 481 ? ARG B 507 . ? 1_555 ? 
99  AD2 18 EDO J .   ? EDO B 601 . ? 1_555 ? 
100 AD2 18 0KX L .   ? 0KX B 603 . ? 1_555 ? 
101 AD2 18 PEG M .   ? PEG B 604 . ? 1_555 ? 
102 AD2 18 HOH P .   ? HOH B 726 . ? 1_555 ? 
103 AD2 18 DG  E 9   ? DG  P 13  . ? 1_555 ? 
104 AD2 18 DT  F 2   ? DT  T 3   . ? 1_555 ? 
105 AD2 18 DC  F 5   ? DC  T 6   . ? 1_555 ? 
106 AD3 16 TYR B 86  ? TYR B 112 . ? 1_555 ? 
107 AD3 16 MET B 109 ? MET B 135 . ? 1_555 ? 
108 AD3 16 ALA B 125 ? ALA B 151 . ? 1_555 ? 
109 AD3 16 PHE B 145 ? PHE B 171 . ? 1_555 ? 
110 AD3 16 GLU B 393 ? GLU B 419 . ? 1_555 ? 
111 AD3 16 THR B 395 ? THR B 421 . ? 1_555 ? 
112 AD3 16 ARG B 481 ? ARG B 507 . ? 1_555 ? 
113 AD3 16 LEU B 482 ? LEU B 508 . ? 1_555 ? 
114 AD3 16 EDO J .   ? EDO B 601 . ? 1_555 ? 
115 AD3 16 0KX L .   ? 0KX B 603 . ? 1_555 ? 
116 AD3 16 PEG M .   ? PEG B 604 . ? 1_555 ? 
117 AD3 16 HOH P .   ? HOH B 712 . ? 1_555 ? 
118 AD3 16 HOH P .   ? HOH B 726 . ? 1_555 ? 
119 AD3 16 DG  E 9   ? DG  P 13  . ? 1_555 ? 
120 AD3 16 DG  F 3   ? DG  T 4   . ? 1_555 ? 
121 AD3 16 DT  F 6   ? DT  T 7   . ? 1_555 ? 
# 
_atom_sites.entry_id                    4U7C 
_atom_sites.fract_transf_matrix[1][1]   0.015713 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007682 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006013 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . ASP A 1 6   ? 39.220  37.275  67.573 1.00 85.08  ? 32  ASP A N     1 
ATOM   2    C  CA    . ASP A 1 6   ? 38.437  38.194  68.397 1.00 91.25  ? 32  ASP A CA    1 
ATOM   3    C  C     . ASP A 1 6   ? 37.779  39.276  67.537 1.00 87.68  ? 32  ASP A C     1 
ATOM   4    O  O     . ASP A 1 6   ? 37.959  39.311  66.320 1.00 81.25  ? 32  ASP A O     1 
ATOM   5    C  CB    . ASP A 1 6   ? 39.311  38.840  69.477 1.00 86.59  ? 32  ASP A CB    1 
ATOM   6    N  N     . LYS A 1 7   ? 37.042  40.174  68.189 1.00 83.48  ? 33  LYS A N     1 
ATOM   7    C  CA    . LYS A 1 7   ? 36.314  41.253  67.515 1.00 79.10  ? 33  LYS A CA    1 
ATOM   8    C  C     . LYS A 1 7   ? 37.208  42.143  66.651 1.00 88.23  ? 33  LYS A C     1 
ATOM   9    O  O     . LYS A 1 7   ? 36.835  42.524  65.529 1.00 87.24  ? 33  LYS A O     1 
ATOM   10   C  CB    . LYS A 1 7   ? 35.583  42.118  68.546 1.00 60.63  ? 33  LYS A CB    1 
ATOM   11   N  N     . GLU A 1 8   ? 38.404  42.431  67.158 1.00 91.42  ? 34  GLU A N     1 
ATOM   12   C  CA    . GLU A 1 8   ? 39.381  43.217  66.412 1.00 88.09  ? 34  GLU A CA    1 
ATOM   13   C  C     . GLU A 1 8   ? 39.765  42.523  65.110 1.00 85.31  ? 34  GLU A C     1 
ATOM   14   O  O     . GLU A 1 8   ? 39.823  43.160  64.062 1.00 85.04  ? 34  GLU A O     1 
ATOM   15   C  CB    . GLU A 1 8   ? 40.631  43.465  67.262 1.00 84.09  ? 34  GLU A CB    1 
ATOM   16   N  N     . LYS A 1 9   ? 39.993  41.215  65.178 1.00 88.24  ? 35  LYS A N     1 
ATOM   17   C  CA    . LYS A 1 9   ? 40.456  40.436  64.031 1.00 89.58  ? 35  LYS A CA    1 
ATOM   18   C  C     . LYS A 1 9   ? 39.338  40.289  62.995 1.00 85.27  ? 35  LYS A C     1 
ATOM   19   O  O     . LYS A 1 9   ? 39.559  40.428  61.783 1.00 86.04  ? 35  LYS A O     1 
ATOM   20   C  CB    . LYS A 1 9   ? 40.960  39.060  64.482 1.00 90.68  ? 35  LYS A CB    1 
ATOM   21   C  CG    . LYS A 1 9   ? 41.967  38.419  63.527 1.00 83.39  ? 35  LYS A CG    1 
ATOM   22   C  CD    . LYS A 1 9   ? 43.200  39.304  63.352 1.00 85.48  ? 35  LYS A CD    1 
ATOM   23   C  CE    . LYS A 1 9   ? 43.902  39.543  64.685 1.00 83.07  ? 35  LYS A CE    1 
ATOM   24   N  N     . ILE A 1 10  ? 38.135  40.021  63.500 1.00 82.05  ? 36  ILE A N     1 
ATOM   25   C  CA    . ILE A 1 10  ? 36.919  39.964  62.691 1.00 81.84  ? 36  ILE A CA    1 
ATOM   26   C  C     . ILE A 1 10  ? 36.716  41.251  61.895 1.00 83.91  ? 36  ILE A C     1 
ATOM   27   O  O     . ILE A 1 10  ? 36.768  41.248  60.652 1.00 74.97  ? 36  ILE A O     1 
ATOM   28   C  CB    . ILE A 1 10  ? 35.672  39.726  63.574 1.00 77.47  ? 36  ILE A CB    1 
ATOM   29   C  CG1   . ILE A 1 10  ? 35.742  38.357  64.256 1.00 79.10  ? 36  ILE A CG1   1 
ATOM   30   C  CG2   . ILE A 1 10  ? 34.398  39.850  62.750 1.00 77.32  ? 36  ILE A CG2   1 
ATOM   31   C  CD1   . ILE A 1 10  ? 34.541  38.045  65.136 1.00 70.11  ? 36  ILE A CD1   1 
ATOM   32   N  N     . ASN A 1 11  ? 36.490  42.349  62.612 1.00 82.34  ? 37  ASN A N     1 
ATOM   33   C  CA    . ASN A 1 11  ? 36.256  43.627  61.953 1.00 79.44  ? 37  ASN A CA    1 
ATOM   34   C  C     . ASN A 1 11  ? 37.421  44.016  61.047 1.00 81.32  ? 37  ASN A C     1 
ATOM   35   O  O     . ASN A 1 11  ? 37.218  44.631  59.993 1.00 80.10  ? 37  ASN A O     1 
ATOM   36   C  CB    . ASN A 1 11  ? 36.006  44.725  62.986 1.00 86.08  ? 37  ASN A CB    1 
ATOM   37   C  CG    . ASN A 1 11  ? 34.558  44.781  63.439 1.00 87.55  ? 37  ASN A CG    1 
ATOM   38   O  OD1   . ASN A 1 11  ? 33.796  45.647  63.004 1.00 87.90  ? 37  ASN A OD1   1 
ATOM   39   N  ND2   . ASN A 1 11  ? 34.168  43.849  64.311 1.00 79.97  ? 37  ASN A ND2   1 
ATOM   40   N  N     . LYS A 1 12  ? 38.633  43.627  61.444 1.00 82.29  ? 38  LYS A N     1 
ATOM   41   C  CA    . LYS A 1 12  ? 39.822  43.891  60.636 1.00 81.08  ? 38  LYS A CA    1 
ATOM   42   C  C     . LYS A 1 12  ? 39.768  43.216  59.273 1.00 80.34  ? 38  LYS A C     1 
ATOM   43   O  O     . LYS A 1 12  ? 39.920  43.887  58.255 1.00 75.89  ? 38  LYS A O     1 
ATOM   44   C  CB    . LYS A 1 12  ? 41.093  43.446  61.365 1.00 78.25  ? 38  LYS A CB    1 
ATOM   45   N  N     . ILE A 1 13  ? 39.569  41.898  59.239 1.00 82.30  ? 39  ILE A N     1 
ATOM   46   C  CA    . ILE A 1 13  ? 39.572  41.201  57.946 1.00 82.91  ? 39  ILE A CA    1 
ATOM   47   C  C     . ILE A 1 13  ? 38.319  41.530  57.117 1.00 79.27  ? 39  ILE A C     1 
ATOM   48   O  O     . ILE A 1 13  ? 38.413  41.676  55.891 1.00 74.40  ? 39  ILE A O     1 
ATOM   49   C  CB    . ILE A 1 13  ? 39.733  39.664  58.099 1.00 77.17  ? 39  ILE A CB    1 
ATOM   50   C  CG1   . ILE A 1 13  ? 39.746  38.991  56.722 1.00 75.13  ? 39  ILE A CG1   1 
ATOM   51   C  CG2   . ILE A 1 13  ? 38.670  39.080  59.007 1.00 79.41  ? 39  ILE A CG2   1 
ATOM   52   C  CD1   . ILE A 1 13  ? 40.807  39.538  55.774 1.00 73.87  ? 39  ILE A CD1   1 
ATOM   53   N  N     . ILE A 1 14  ? 37.159  41.645  57.770 1.00 79.54  ? 40  ILE A N     1 
ATOM   54   C  CA    . ILE A 1 14  ? 35.962  42.126  57.076 1.00 75.55  ? 40  ILE A CA    1 
ATOM   55   C  C     . ILE A 1 14  ? 36.257  43.443  56.361 1.00 76.88  ? 40  ILE A C     1 
ATOM   56   O  O     . ILE A 1 14  ? 36.086  43.549  55.146 1.00 72.51  ? 40  ILE A O     1 
ATOM   57   C  CB    . ILE A 1 14  ? 34.765  42.337  58.027 1.00 76.20  ? 40  ILE A CB    1 
ATOM   58   C  CG1   . ILE A 1 14  ? 34.296  41.008  58.623 1.00 73.75  ? 40  ILE A CG1   1 
ATOM   59   C  CG2   . ILE A 1 14  ? 33.609  43.007  57.282 1.00 66.95  ? 40  ILE A CG2   1 
ATOM   60   C  CD1   . ILE A 1 14  ? 33.105  41.154  59.556 1.00 70.27  ? 40  ILE A CD1   1 
ATOM   61   N  N     . MET A 1 15  ? 36.717  44.433  57.124 1.00 80.24  ? 41  MET A N     1 
ATOM   62   C  CA    . MET A 1 15  ? 37.020  45.753  56.576 1.00 78.52  ? 41  MET A CA    1 
ATOM   63   C  C     . MET A 1 15  ? 38.063  45.675  55.455 1.00 80.80  ? 41  MET A C     1 
ATOM   64   O  O     . MET A 1 15  ? 37.914  46.313  54.412 1.00 76.87  ? 41  MET A O     1 
ATOM   65   C  CB    . MET A 1 15  ? 37.505  46.690  57.690 1.00 79.36  ? 41  MET A CB    1 
ATOM   66   C  CG    . MET A 1 15  ? 37.734  48.139  57.258 1.00 87.26  ? 41  MET A CG    1 
ATOM   67   S  SD    . MET A 1 15  ? 39.374  48.471  56.576 1.00 103.98 ? 41  MET A SD    1 
ATOM   68   C  CE    . MET A 1 15  ? 40.208  49.200  57.978 1.00 87.15  ? 41  MET A CE    1 
ATOM   69   N  N     . GLU A 1 16  ? 39.103  44.873  55.668 1.00 83.24  ? 42  GLU A N     1 
ATOM   70   C  CA    . GLU A 1 16  ? 40.195  44.736  54.710 1.00 79.05  ? 42  GLU A CA    1 
ATOM   71   C  C     . GLU A 1 16  ? 39.698  44.167  53.396 1.00 74.31  ? 42  GLU A C     1 
ATOM   72   O  O     . GLU A 1 16  ? 40.185  44.531  52.327 1.00 75.89  ? 42  GLU A O     1 
ATOM   73   C  CB    . GLU A 1 16  ? 41.303  43.841  55.280 1.00 77.58  ? 42  GLU A CB    1 
ATOM   74   N  N     . ALA A 1 17  ? 38.707  43.289  53.483 1.00 75.28  ? 43  ALA A N     1 
ATOM   75   C  CA    . ALA A 1 17  ? 38.203  42.602  52.303 1.00 78.42  ? 43  ALA A CA    1 
ATOM   76   C  C     . ALA A 1 17  ? 37.043  43.357  51.660 1.00 78.59  ? 43  ALA A C     1 
ATOM   77   O  O     . ALA A 1 17  ? 36.646  43.062  50.532 1.00 76.70  ? 43  ALA A O     1 
ATOM   78   C  CB    . ALA A 1 17  ? 37.772  41.190  52.666 1.00 84.42  ? 43  ALA A CB    1 
ATOM   79   N  N     . THR A 1 18  ? 36.497  44.332  52.379 1.00 75.66  ? 44  THR A N     1 
ATOM   80   C  CA    . THR A 1 18  ? 35.291  45.010  51.913 1.00 72.67  ? 44  THR A CA    1 
ATOM   81   C  C     . THR A 1 18  ? 35.542  46.466  51.487 1.00 72.56  ? 44  THR A C     1 
ATOM   82   O  O     . THR A 1 18  ? 34.781  47.018  50.681 1.00 66.68  ? 44  THR A O     1 
ATOM   83   C  CB    . THR A 1 18  ? 34.187  44.976  53.003 1.00 68.12  ? 44  THR A CB    1 
ATOM   84   O  OG1   . THR A 1 18  ? 32.902  45.172  52.404 1.00 65.19  ? 44  THR A OG1   1 
ATOM   85   C  CG2   . THR A 1 18  ? 34.424  46.043  54.067 1.00 73.51  ? 44  THR A CG2   1 
ATOM   86   N  N     . LYS A 1 19  ? 36.608  47.070  52.017 1.00 76.98  ? 45  LYS A N     1 
ATOM   87   C  CA    . LYS A 1 19  ? 36.910  48.491  51.803 1.00 72.01  ? 45  LYS A CA    1 
ATOM   88   C  C     . LYS A 1 19  ? 36.914  48.918  50.338 1.00 68.34  ? 45  LYS A C     1 
ATOM   89   O  O     . LYS A 1 19  ? 37.526  48.276  49.483 1.00 69.30  ? 45  LYS A O     1 
ATOM   90   C  CB    . LYS A 1 19  ? 38.264  48.849  52.430 1.00 67.64  ? 45  LYS A CB    1 
ATOM   91   N  N     . GLY A 1 20  ? 36.210  50.009  50.066 1.00 65.71  ? 46  GLY A N     1 
ATOM   92   C  CA    . GLY A 1 20  ? 36.168  50.594  48.743 1.00 67.06  ? 46  GLY A CA    1 
ATOM   93   C  C     . GLY A 1 20  ? 35.229  49.933  47.753 1.00 67.90  ? 46  GLY A C     1 
ATOM   94   O  O     . GLY A 1 20  ? 35.224  50.300  46.579 1.00 67.57  ? 46  GLY A O     1 
ATOM   95   N  N     . SER A 1 21  ? 34.437  48.963  48.202 1.00 68.41  ? 47  SER A N     1 
ATOM   96   C  CA    . SER A 1 21  ? 33.405  48.394  47.339 1.00 69.29  ? 47  SER A CA    1 
ATOM   97   C  C     . SER A 1 21  ? 32.274  49.407  47.215 1.00 68.32  ? 47  SER A C     1 
ATOM   98   O  O     . SER A 1 21  ? 32.244  50.400  47.943 1.00 71.69  ? 47  SER A O     1 
ATOM   99   C  CB    . SER A 1 21  ? 32.881  47.063  47.884 1.00 64.52  ? 47  SER A CB    1 
ATOM   100  O  OG    . SER A 1 21  ? 31.837  47.272  48.818 1.00 60.06  ? 47  SER A OG    1 
ATOM   101  N  N     . ARG A 1 22  ? 31.334  49.162  46.309 1.00 59.53  ? 48  ARG A N     1 
ATOM   102  C  CA    . ARG A 1 22  ? 30.215  50.089  46.134 1.00 60.51  ? 48  ARG A CA    1 
ATOM   103  C  C     . ARG A 1 22  ? 29.236  49.961  47.304 1.00 65.70  ? 48  ARG A C     1 
ATOM   104  O  O     . ARG A 1 22  ? 28.687  50.962  47.808 1.00 70.15  ? 48  ARG A O     1 
ATOM   105  C  CB    . ARG A 1 22  ? 29.510  49.835  44.804 1.00 59.12  ? 48  ARG A CB    1 
ATOM   106  C  CG    . ARG A 1 22  ? 30.471  49.620  43.649 1.00 59.74  ? 48  ARG A CG    1 
ATOM   107  C  CD    . ARG A 1 22  ? 29.714  49.323  42.366 1.00 63.57  ? 48  ARG A CD    1 
ATOM   108  N  NE    . ARG A 1 22  ? 30.519  48.543  41.428 1.00 75.74  ? 48  ARG A NE    1 
ATOM   109  C  CZ    . ARG A 1 22  ? 30.049  47.979  40.318 1.00 73.20  ? 48  ARG A CZ    1 
ATOM   110  N  NH1   . ARG A 1 22  ? 28.767  48.103  39.997 1.00 62.86  ? 48  ARG A NH1   1 
ATOM   111  N  NH2   . ARG A 1 22  ? 30.860  47.284  39.529 1.00 70.49  ? 48  ARG A NH2   1 
ATOM   112  N  N     . PHE A 1 23  ? 29.048  48.717  47.741 1.00 56.68  ? 49  PHE A N     1 
ATOM   113  C  CA    . PHE A 1 23  ? 28.242  48.409  48.913 1.00 54.16  ? 49  PHE A CA    1 
ATOM   114  C  C     . PHE A 1 23  ? 28.764  49.184  50.112 1.00 56.06  ? 49  PHE A C     1 
ATOM   115  O  O     . PHE A 1 23  ? 28.010  49.886  50.795 1.00 59.30  ? 49  PHE A O     1 
ATOM   116  C  CB    . PHE A 1 23  ? 28.266  46.906  49.199 1.00 55.29  ? 49  PHE A CB    1 
ATOM   117  C  CG    . PHE A 1 23  ? 27.301  46.472  50.273 1.00 52.89  ? 49  PHE A CG    1 
ATOM   118  C  CD1   . PHE A 1 23  ? 26.009  46.087  49.951 1.00 50.85  ? 49  PHE A CD1   1 
ATOM   119  C  CD2   . PHE A 1 23  ? 27.681  46.463  51.605 1.00 44.36  ? 49  PHE A CD2   1 
ATOM   120  C  CE1   . PHE A 1 23  ? 25.123  45.691  50.934 1.00 42.12  ? 49  PHE A CE1   1 
ATOM   121  C  CE2   . PHE A 1 23  ? 26.796  46.071  52.588 1.00 42.34  ? 49  PHE A CE2   1 
ATOM   122  C  CZ    . PHE A 1 23  ? 25.515  45.687  52.252 1.00 38.03  ? 49  PHE A CZ    1 
ATOM   123  N  N     . TYR A 1 24  ? 30.064  49.043  50.353 1.00 56.46  ? 50  TYR A N     1 
ATOM   124  C  CA    . TYR A 1 24  ? 30.751  49.704  51.462 1.00 62.42  ? 50  TYR A CA    1 
ATOM   125  C  C     . TYR A 1 24  ? 30.533  51.216  51.433 1.00 65.86  ? 50  TYR A C     1 
ATOM   126  O  O     . TYR A 1 24  ? 30.249  51.842  52.462 1.00 65.24  ? 50  TYR A O     1 
ATOM   127  C  CB    . TYR A 1 24  ? 32.245  49.370  51.415 1.00 65.24  ? 50  TYR A CB    1 
ATOM   128  C  CG    . TYR A 1 24  ? 33.081  49.990  52.516 1.00 69.41  ? 50  TYR A CG    1 
ATOM   129  C  CD1   . TYR A 1 24  ? 33.038  49.492  53.816 1.00 64.80  ? 50  TYR A CD1   1 
ATOM   130  C  CD2   . TYR A 1 24  ? 33.941  51.055  52.248 1.00 69.88  ? 50  TYR A CD2   1 
ATOM   131  C  CE1   . TYR A 1 24  ? 33.810  50.051  54.822 1.00 63.71  ? 50  TYR A CE1   1 
ATOM   132  C  CE2   . TYR A 1 24  ? 34.715  51.616  53.248 1.00 68.04  ? 50  TYR A CE2   1 
ATOM   133  C  CZ    . TYR A 1 24  ? 34.645  51.109  54.529 1.00 64.36  ? 50  TYR A CZ    1 
ATOM   134  O  OH    . TYR A 1 24  ? 35.419  51.672  55.516 1.00 77.10  ? 50  TYR A OH    1 
ATOM   135  N  N     . GLY A 1 25  ? 30.658  51.790  50.240 1.00 60.28  ? 51  GLY A N     1 
ATOM   136  C  CA    . GLY A 1 25  ? 30.371  53.195  50.024 1.00 58.61  ? 51  GLY A CA    1 
ATOM   137  C  C     . GLY A 1 25  ? 28.969  53.553  50.472 1.00 60.77  ? 51  GLY A C     1 
ATOM   138  O  O     . GLY A 1 25  ? 28.772  54.510  51.238 1.00 66.45  ? 51  GLY A O     1 
ATOM   139  N  N     . ASN A 1 26  ? 27.985  52.786  50.005 1.00 57.49  ? 52  ASN A N     1 
ATOM   140  C  CA    . ASN A 1 26  ? 26.603  53.081  50.376 1.00 54.36  ? 52  ASN A CA    1 
ATOM   141  C  C     . ASN A 1 26  ? 26.384  52.968  51.884 1.00 53.47  ? 52  ASN A C     1 
ATOM   142  O  O     . ASN A 1 26  ? 25.575  53.699  52.466 1.00 55.02  ? 52  ASN A O     1 
ATOM   143  C  CB    . ASN A 1 26  ? 25.628  52.159  49.644 1.00 53.58  ? 52  ASN A CB    1 
ATOM   144  C  CG    . ASN A 1 26  ? 24.182  52.581  49.831 1.00 50.99  ? 52  ASN A CG    1 
ATOM   145  O  OD1   . ASN A 1 26  ? 23.413  51.913  50.527 1.00 41.55  ? 52  ASN A OD1   1 
ATOM   146  N  ND2   . ASN A 1 26  ? 23.805  53.701  49.214 1.00 57.15  ? 52  ASN A ND2   1 
ATOM   147  N  N     . GLU A 1 27  ? 27.127  52.065  52.518 1.00 55.63  ? 53  GLU A N     1 
ATOM   148  C  CA    . GLU A 1 27  ? 27.051  51.905  53.968 1.00 59.68  ? 53  GLU A CA    1 
ATOM   149  C  C     . GLU A 1 27  ? 27.621  53.129  54.674 1.00 58.06  ? 53  GLU A C     1 
ATOM   150  O  O     . GLU A 1 27  ? 27.089  53.572  55.696 1.00 56.59  ? 53  GLU A O     1 
ATOM   151  C  CB    . GLU A 1 27  ? 27.790  50.639  54.414 1.00 62.23  ? 53  GLU A CB    1 
ATOM   152  C  CG    . GLU A 1 27  ? 27.112  49.346  53.984 1.00 61.82  ? 53  GLU A CG    1 
ATOM   153  C  CD    . GLU A 1 27  ? 25.782  49.125  54.682 1.00 60.52  ? 53  GLU A CD    1 
ATOM   154  O  OE1   . GLU A 1 27  ? 25.741  49.241  55.924 1.00 70.60  ? 53  GLU A OE1   1 
ATOM   155  O  OE2   . GLU A 1 27  ? 24.776  48.847  53.991 1.00 52.47  ? 53  GLU A OE2   1 
ATOM   156  N  N     . LEU A 1 28  ? 28.705  53.672  54.126 1.00 58.64  ? 54  LEU A N     1 
ATOM   157  C  CA    . LEU A 1 28  ? 29.245  54.937  54.616 1.00 60.57  ? 54  LEU A CA    1 
ATOM   158  C  C     . LEU A 1 28  ? 28.213  56.059  54.493 1.00 56.98  ? 54  LEU A C     1 
ATOM   159  O  O     . LEU A 1 28  ? 28.023  56.837  55.430 1.00 51.41  ? 54  LEU A O     1 
ATOM   160  C  CB    . LEU A 1 28  ? 30.533  55.308  53.874 1.00 57.60  ? 54  LEU A CB    1 
ATOM   161  C  CG    . LEU A 1 28  ? 31.760  54.474  54.251 1.00 59.32  ? 54  LEU A CG    1 
ATOM   162  C  CD1   . LEU A 1 28  ? 33.022  55.054  53.627 1.00 57.03  ? 54  LEU A CD1   1 
ATOM   163  C  CD2   . LEU A 1 28  ? 31.893  54.379  55.767 1.00 47.00  ? 54  LEU A CD2   1 
ATOM   164  N  N     . LYS A 1 29  ? 27.552  56.142  53.340 1.00 51.18  ? 55  LYS A N     1 
ATOM   165  C  CA    . LYS A 1 29  ? 26.470  57.114  53.148 1.00 48.77  ? 55  LYS A CA    1 
ATOM   166  C  C     . LYS A 1 29  ? 25.358  56.997  54.204 1.00 55.60  ? 55  LYS A C     1 
ATOM   167  O  O     . LYS A 1 29  ? 24.957  57.994  54.823 1.00 60.88  ? 55  LYS A O     1 
ATOM   168  C  CB    . LYS A 1 29  ? 25.872  56.956  51.754 1.00 45.94  ? 55  LYS A CB    1 
ATOM   169  C  CG    . LYS A 1 29  ? 24.680  57.846  51.487 1.00 49.73  ? 55  LYS A CG    1 
ATOM   170  C  CD    . LYS A 1 29  ? 24.215  57.714  50.042 1.00 48.21  ? 55  LYS A CD    1 
ATOM   171  N  N     . LYS A 1 30  ? 24.874  55.775  54.410 1.00 57.72  ? 56  LYS A N     1 
ATOM   172  C  CA    . LYS A 1 30  ? 23.802  55.512  55.376 1.00 56.88  ? 56  LYS A CA    1 
ATOM   173  C  C     . LYS A 1 30  ? 24.233  55.885  56.805 1.00 54.12  ? 56  LYS A C     1 
ATOM   174  O  O     . LYS A 1 30  ? 23.464  56.479  57.577 1.00 55.58  ? 56  LYS A O     1 
ATOM   175  C  CB    . LYS A 1 30  ? 23.378  54.043  55.300 1.00 54.08  ? 56  LYS A CB    1 
ATOM   176  C  CG    . LYS A 1 30  ? 22.164  53.802  54.404 1.00 51.71  ? 56  LYS A CG    1 
ATOM   177  C  CD    . LYS A 1 30  ? 22.164  52.406  53.777 1.00 58.81  ? 56  LYS A CD    1 
ATOM   178  C  CE    . LYS A 1 30  ? 22.040  51.298  54.818 1.00 67.21  ? 56  LYS A CE    1 
ATOM   179  N  NZ    . LYS A 1 30  ? 22.035  49.938  54.201 1.00 49.86  ? 56  LYS A NZ    1 
ATOM   180  N  N     . GLU A 1 31  ? 25.475  55.525  57.134 1.00 59.52  ? 57  GLU A N     1 
ATOM   181  C  CA    . GLU A 1 31  ? 26.099  55.813  58.426 1.00 60.41  ? 57  GLU A CA    1 
ATOM   182  C  C     . GLU A 1 31  ? 26.127  57.325  58.658 1.00 60.30  ? 57  GLU A C     1 
ATOM   183  O  O     . GLU A 1 31  ? 25.732  57.824  59.718 1.00 57.33  ? 57  GLU A O     1 
ATOM   184  C  CB    . GLU A 1 31  ? 27.536  55.256  58.452 1.00 62.15  ? 57  GLU A CB    1 
ATOM   185  C  CG    . GLU A 1 31  ? 28.385  55.617  59.675 1.00 65.39  ? 57  GLU A CG    1 
ATOM   186  C  CD    . GLU A 1 31  ? 28.176  54.663  60.852 1.00 81.28  ? 57  GLU A CD    1 
ATOM   187  O  OE1   . GLU A 1 31  ? 27.901  53.464  60.608 1.00 87.67  ? 57  GLU A OE1   1 
ATOM   188  O  OE2   . GLU A 1 31  ? 28.258  55.113  62.018 1.00 79.40  ? 57  GLU A OE2   1 
ATOM   189  N  N     . LYS A 1 32  ? 26.621  58.044  57.653 1.00 59.72  ? 58  LYS A N     1 
ATOM   190  C  CA    . LYS A 1 32  ? 26.611  59.502  57.640 1.00 57.77  ? 58  LYS A CA    1 
ATOM   191  C  C     . LYS A 1 32  ? 25.220  60.072  57.914 1.00 56.87  ? 58  LYS A C     1 
ATOM   192  O  O     . LYS A 1 32  ? 25.057  60.985  58.731 1.00 57.43  ? 58  LYS A O     1 
ATOM   193  C  CB    . LYS A 1 32  ? 27.142  60.009  56.294 1.00 55.22  ? 58  LYS A CB    1 
ATOM   194  C  CG    . LYS A 1 32  ? 26.943  61.498  56.048 1.00 62.32  ? 58  LYS A CG    1 
ATOM   195  C  CD    . LYS A 1 32  ? 26.184  61.744  54.745 1.00 60.38  ? 58  LYS A CD    1 
ATOM   196  C  CE    . LYS A 1 32  ? 26.852  61.046  53.557 1.00 60.53  ? 58  LYS A CE    1 
ATOM   197  N  NZ    . LYS A 1 32  ? 26.115  61.271  52.272 1.00 55.78  ? 58  LYS A NZ    1 
ATOM   198  N  N     . GLN A 1 33  ? 24.220  59.505  57.243 1.00 54.30  ? 59  GLN A N     1 
ATOM   199  C  CA    A GLN A 1 33  ? 22.851  59.996  57.390 0.50 55.84  ? 59  GLN A CA    1 
ATOM   200  C  CA    B GLN A 1 33  ? 22.833  59.938  57.385 0.50 55.82  ? 59  GLN A CA    1 
ATOM   201  C  C     . GLN A 1 33  ? 22.321  59.778  58.818 1.00 54.92  ? 59  GLN A C     1 
ATOM   202  O  O     . GLN A 1 33  ? 21.700  60.686  59.393 1.00 57.06  ? 59  GLN A O     1 
ATOM   203  C  CB    A GLN A 1 33  ? 21.939  59.339  56.337 0.50 56.15  ? 59  GLN A CB    1 
ATOM   204  C  CB    B GLN A 1 33  ? 21.939  59.147  56.427 0.50 56.23  ? 59  GLN A CB    1 
ATOM   205  C  CG    A GLN A 1 33  ? 20.697  58.618  56.863 0.50 59.08  ? 59  GLN A CG    1 
ATOM   206  C  CG    B GLN A 1 33  ? 21.000  59.988  55.597 0.50 55.74  ? 59  GLN A CG    1 
ATOM   207  C  CD    A GLN A 1 33  ? 19.543  59.551  57.191 0.50 59.29  ? 59  GLN A CD    1 
ATOM   208  C  CD    B GLN A 1 33  ? 21.120  59.695  54.120 0.50 60.07  ? 59  GLN A CD    1 
ATOM   209  O  OE1   A GLN A 1 33  ? 19.653  60.773  57.066 0.50 58.58  ? 59  GLN A OE1   1 
ATOM   210  O  OE1   B GLN A 1 33  ? 22.135  60.006  53.498 0.50 63.06  ? 59  GLN A OE1   1 
ATOM   211  N  NE2   A GLN A 1 33  ? 18.424  58.973  57.618 0.50 56.31  ? 59  GLN A NE2   1 
ATOM   212  N  NE2   B GLN A 1 33  ? 20.089  59.086  53.550 0.50 61.08  ? 59  GLN A NE2   1 
ATOM   213  N  N     . VAL A 1 34  ? 22.582  58.612  59.408 1.00 54.22  ? 60  VAL A N     1 
ATOM   214  C  CA    . VAL A 1 34  ? 22.085  58.370  60.766 1.00 56.67  ? 60  VAL A CA    1 
ATOM   215  C  C     . VAL A 1 34  ? 22.834  59.278  61.764 1.00 54.01  ? 60  VAL A C     1 
ATOM   216  O  O     . VAL A 1 34  ? 22.223  59.850  62.681 1.00 51.68  ? 60  VAL A O     1 
ATOM   217  C  CB    . VAL A 1 34  ? 22.170  56.867  61.185 1.00 60.73  ? 60  VAL A CB    1 
ATOM   218  C  CG1   . VAL A 1 34  ? 23.598  56.335  61.186 1.00 58.63  ? 60  VAL A CG1   1 
ATOM   219  C  CG2   . VAL A 1 34  ? 21.509  56.656  62.546 1.00 57.08  ? 60  VAL A CG2   1 
ATOM   220  N  N     . ASN A 1 35  ? 24.151  59.397  61.600 1.00 56.06  ? 61  ASN A N     1 
ATOM   221  C  CA    . ASN A 1 35  ? 24.927  60.385  62.346 1.00 50.93  ? 61  ASN A CA    1 
ATOM   222  C  C     . ASN A 1 35  ? 24.288  61.774  62.291 1.00 57.24  ? 61  ASN A C     1 
ATOM   223  O  O     . ASN A 1 35  ? 24.198  62.467  63.304 1.00 53.61  ? 61  ASN A O     1 
ATOM   224  C  CB    . ASN A 1 35  ? 26.355  60.467  61.811 1.00 48.29  ? 61  ASN A CB    1 
ATOM   225  C  CG    . ASN A 1 35  ? 27.249  59.389  62.373 1.00 51.56  ? 61  ASN A CG    1 
ATOM   226  O  OD1   . ASN A 1 35  ? 27.027  58.902  63.478 1.00 52.59  ? 61  ASN A OD1   1 
ATOM   227  N  ND2   . ASN A 1 35  ? 28.278  59.019  61.621 1.00 52.84  ? 61  ASN A ND2   1 
ATOM   228  N  N     . GLN A 1 36  ? 23.855  62.173  61.097 1.00 58.00  ? 62  GLN A N     1 
ATOM   229  C  CA    . GLN A 1 36  ? 23.126  63.428  60.911 1.00 58.69  ? 62  GLN A CA    1 
ATOM   230  C  C     . GLN A 1 36  ? 21.858  63.486  61.767 1.00 54.50  ? 62  GLN A C     1 
ATOM   231  O  O     . GLN A 1 36  ? 21.633  64.455  62.492 1.00 59.67  ? 62  GLN A O     1 
ATOM   232  C  CB    . GLN A 1 36  ? 22.772  63.626  59.430 1.00 60.46  ? 62  GLN A CB    1 
ATOM   233  C  CG    . GLN A 1 36  ? 22.163  64.983  59.100 1.00 64.50  ? 62  GLN A CG    1 
ATOM   234  C  CD    . GLN A 1 36  ? 23.027  66.139  59.569 1.00 70.43  ? 62  GLN A CD    1 
ATOM   235  O  OE1   . GLN A 1 36  ? 24.257  66.038  59.604 1.00 70.76  ? 62  GLN A OE1   1 
ATOM   236  N  NE2   . GLN A 1 36  ? 22.385  67.243  59.946 1.00 78.91  ? 62  GLN A NE2   1 
ATOM   237  N  N     . ARG A 1 37  ? 21.038  62.442  61.677 1.00 53.56  ? 63  ARG A N     1 
ATOM   238  C  CA    . ARG A 1 37  ? 19.819  62.331  62.488 1.00 50.04  ? 63  ARG A CA    1 
ATOM   239  C  C     . ARG A 1 37  ? 20.114  62.535  63.976 1.00 53.13  ? 63  ARG A C     1 
ATOM   240  O  O     . ARG A 1 37  ? 19.350  63.184  64.712 1.00 55.51  ? 63  ARG A O     1 
ATOM   241  C  CB    . ARG A 1 37  ? 19.206  60.954  62.268 1.00 59.55  ? 63  ARG A CB    1 
ATOM   242  C  CG    . ARG A 1 37  ? 18.228  60.841  61.114 1.00 69.12  ? 63  ARG A CG    1 
ATOM   243  C  CD    . ARG A 1 37  ? 17.976  59.358  60.869 1.00 70.50  ? 63  ARG A CD    1 
ATOM   244  N  NE    . ARG A 1 37  ? 16.619  58.870  61.089 1.00 84.55  ? 63  ARG A NE    1 
ATOM   245  C  CZ    . ARG A 1 37  ? 16.260  57.615  60.822 1.00 90.75  ? 63  ARG A CZ    1 
ATOM   246  N  NH1   . ARG A 1 37  ? 17.160  56.768  60.335 1.00 80.28  ? 63  ARG A NH1   1 
ATOM   247  N  NH2   . ARG A 1 37  ? 15.017  57.201  61.031 1.00 89.83  ? 63  ARG A NH2   1 
ATOM   248  N  N     . ILE A 1 38  ? 21.251  61.995  64.405 1.00 53.24  ? 64  ILE A N     1 
ATOM   249  C  CA    . ILE A 1 38  ? 21.656  62.072  65.802 1.00 54.32  ? 64  ILE A CA    1 
ATOM   250  C  C     . ILE A 1 38  ? 22.070  63.501  66.144 1.00 55.18  ? 64  ILE A C     1 
ATOM   251  O  O     . ILE A 1 38  ? 21.671  64.031  67.175 1.00 50.66  ? 64  ILE A O     1 
ATOM   252  C  CB    . ILE A 1 38  ? 22.805  61.094  66.117 1.00 52.16  ? 64  ILE A CB    1 
ATOM   253  C  CG1   . ILE A 1 38  ? 22.268  59.664  66.226 1.00 53.30  ? 64  ILE A CG1   1 
ATOM   254  C  CG2   . ILE A 1 38  ? 23.502  61.479  67.409 1.00 44.32  ? 64  ILE A CG2   1 
ATOM   255  C  CD1   . ILE A 1 38  ? 23.331  58.622  66.521 1.00 49.63  ? 64  ILE A CD1   1 
ATOM   256  N  N     . GLU A 1 39  ? 22.876  64.109  65.276 1.00 60.86  ? 65  GLU A N     1 
ATOM   257  C  CA    . GLU A 1 39  ? 23.266  65.511  65.397 1.00 55.95  ? 65  GLU A CA    1 
ATOM   258  C  C     . GLU A 1 39  ? 22.046  66.395  65.605 1.00 54.48  ? 65  GLU A C     1 
ATOM   259  O  O     . GLU A 1 39  ? 21.994  67.197  66.542 1.00 54.99  ? 65  GLU A O     1 
ATOM   260  C  CB    . GLU A 1 39  ? 24.030  65.951  64.147 1.00 61.09  ? 65  GLU A CB    1 
ATOM   261  C  CG    . GLU A 1 39  ? 24.461  67.408  64.141 1.00 78.14  ? 65  GLU A CG    1 
ATOM   262  C  CD    . GLU A 1 39  ? 25.922  67.593  64.529 1.00 91.80  ? 65  GLU A CD    1 
ATOM   263  O  OE1   . GLU A 1 39  ? 26.617  68.395  63.861 1.00 89.55  ? 65  GLU A OE1   1 
ATOM   264  O  OE2   . GLU A 1 39  ? 26.369  66.941  65.500 1.00 98.24  ? 65  GLU A OE2   1 
ATOM   265  N  N     . ASN A 1 40  ? 21.058  66.221  64.732 1.00 49.58  ? 66  ASN A N     1 
ATOM   266  C  CA    . ASN A 1 40  ? 19.796  66.938  64.853 1.00 49.72  ? 66  ASN A CA    1 
ATOM   267  C  C     . ASN A 1 40  ? 19.096  66.689  66.177 1.00 50.54  ? 66  ASN A C     1 
ATOM   268  O  O     . ASN A 1 40  ? 18.595  67.623  66.801 1.00 50.53  ? 66  ASN A O     1 
ATOM   269  C  CB    . ASN A 1 40  ? 18.857  66.563  63.713 1.00 47.70  ? 66  ASN A CB    1 
ATOM   270  C  CG    . ASN A 1 40  ? 19.413  66.931  62.362 1.00 53.51  ? 66  ASN A CG    1 
ATOM   271  O  OD1   . ASN A 1 40  ? 20.058  67.968  62.203 1.00 56.25  ? 66  ASN A OD1   1 
ATOM   272  N  ND2   . ASN A 1 40  ? 19.162  66.083  61.374 1.00 56.64  ? 66  ASN A ND2   1 
ATOM   273  N  N     . MET A 1 41  ? 19.052  65.430  66.605 1.00 54.69  ? 67  MET A N     1 
ATOM   274  C  CA    . MET A 1 41  ? 18.402  65.118  67.875 1.00 50.35  ? 67  MET A CA    1 
ATOM   275  C  C     . MET A 1 41  ? 19.103  65.767  69.079 1.00 51.40  ? 67  MET A C     1 
ATOM   276  O  O     . MET A 1 41  ? 18.445  66.183  70.029 1.00 50.13  ? 67  MET A O     1 
ATOM   277  C  CB    . MET A 1 41  ? 18.318  63.607  68.073 1.00 51.02  ? 67  MET A CB    1 
ATOM   278  C  CG    . MET A 1 41  ? 17.544  63.203  69.313 1.00 51.54  ? 67  MET A CG    1 
ATOM   279  S  SD    . MET A 1 41  ? 17.844  61.494  69.790 1.00 50.57  ? 67  MET A SD    1 
ATOM   280  C  CE    . MET A 1 41  ? 19.621  61.383  69.564 1.00 46.65  ? 67  MET A CE    1 
ATOM   281  N  N     . MET A 1 42  ? 20.433  65.824  69.050 1.00 53.22  ? 68  MET A N     1 
ATOM   282  C  CA    . MET A 1 42  ? 21.209  66.486  70.100 1.00 52.47  ? 68  MET A CA    1 
ATOM   283  C  C     . MET A 1 42  ? 20.975  67.993  70.101 1.00 55.88  ? 68  MET A C     1 
ATOM   284  O  O     . MET A 1 42  ? 20.768  68.607  71.164 1.00 49.66  ? 68  MET A O     1 
ATOM   285  C  CB    . MET A 1 42  ? 22.705  66.194  69.941 1.00 51.80  ? 68  MET A CB    1 
ATOM   286  C  CG    . MET A 1 42  ? 23.086  64.742  70.143 1.00 49.54  ? 68  MET A CG    1 
ATOM   287  S  SD    . MET A 1 42  ? 22.530  64.136  71.749 1.00 68.38  ? 68  MET A SD    1 
ATOM   288  C  CE    . MET A 1 42  ? 24.042  64.251  72.707 1.00 62.43  ? 68  MET A CE    1 
ATOM   289  N  N     . GLN A 1 43  ? 20.988  68.579  68.903 1.00 62.15  ? 69  GLN A N     1 
ATOM   290  C  CA    . GLN A 1 43  ? 20.703  70.000  68.770 1.00 60.29  ? 69  GLN A CA    1 
ATOM   291  C  C     . GLN A 1 43  ? 19.296  70.289  69.259 1.00 58.11  ? 69  GLN A C     1 
ATOM   292  O  O     . GLN A 1 43  ? 19.051  71.338  69.807 1.00 66.98  ? 69  GLN A O     1 
ATOM   293  C  CB    . GLN A 1 43  ? 20.846  70.479  67.316 1.00 61.18  ? 69  GLN A CB    1 
ATOM   294  C  CG    . GLN A 1 43  ? 22.244  70.381  66.711 1.00 75.07  ? 69  GLN A CG    1 
ATOM   295  C  CD    . GLN A 1 43  ? 23.152  71.531  67.125 1.00 87.99  ? 69  GLN A CD    1 
ATOM   296  O  OE1   . GLN A 1 43  ? 22.684  72.558  67.620 1.00 85.97  ? 69  GLN A OE1   1 
ATOM   297  N  NE2   . GLN A 1 43  ? 24.458  71.367  66.908 1.00 89.03  ? 69  GLN A NE2   1 
ATOM   298  N  N     . GLN A 1 44  ? 18.393  69.326  69.143 1.00 56.25  ? 70  GLN A N     1 
ATOM   299  C  CA    . GLN A 1 44  ? 17.031  69.510  69.631 1.00 51.67  ? 70  GLN A CA    1 
ATOM   300  C  C     . GLN A 1 44  ? 16.937  69.291  71.143 1.00 56.69  ? 70  GLN A C     1 
ATOM   301  O  O     . GLN A 1 44  ? 16.061  69.843  71.808 1.00 60.36  ? 70  GLN A O     1 
ATOM   302  C  CB    . GLN A 1 44  ? 16.088  68.567  68.891 1.00 53.57  ? 70  GLN A CB    1 
ATOM   303  C  CG    . GLN A 1 44  ? 14.673  68.558  69.408 1.00 62.07  ? 70  GLN A CG    1 
ATOM   304  C  CD    . GLN A 1 44  ? 13.656  68.753  68.305 1.00 78.57  ? 70  GLN A CD    1 
ATOM   305  O  OE1   . GLN A 1 44  ? 13.642  69.790  67.636 1.00 93.72  ? 70  GLN A OE1   1 
ATOM   306  N  NE2   . GLN A 1 44  ? 12.803  67.750  68.098 1.00 68.63  ? 70  GLN A NE2   1 
ATOM   307  N  N     . LYS A 1 45  ? 17.842  68.481  71.681 1.00 55.17  ? 71  LYS A N     1 
ATOM   308  C  CA    . LYS A 1 45  ? 17.919  68.262  73.120 1.00 52.63  ? 71  LYS A CA    1 
ATOM   309  C  C     . LYS A 1 45  ? 18.346  69.552  73.797 1.00 58.18  ? 71  LYS A C     1 
ATOM   310  O  O     . LYS A 1 45  ? 17.751  69.974  74.790 1.00 53.85  ? 71  LYS A O     1 
ATOM   311  C  CB    . LYS A 1 45  ? 18.901  67.136  73.453 1.00 54.03  ? 71  LYS A CB    1 
ATOM   312  C  CG    . LYS A 1 45  ? 19.035  66.836  74.939 1.00 51.62  ? 71  LYS A CG    1 
ATOM   313  C  CD    . LYS A 1 45  ? 20.336  66.099  75.236 1.00 50.26  ? 71  LYS A CD    1 
ATOM   314  C  CE    . LYS A 1 45  ? 20.615  66.045  76.729 1.00 62.66  ? 71  LYS A CE    1 
ATOM   315  N  NZ    . LYS A 1 45  ? 21.909  65.373  77.040 1.00 73.09  ? 71  LYS A NZ    1 
ATOM   316  N  N     . ALA A 1 46  ? 19.383  70.170  73.237 1.00 64.14  ? 72  ALA A N     1 
ATOM   317  C  CA    . ALA A 1 46  ? 19.920  71.433  73.745 1.00 58.67  ? 72  ALA A CA    1 
ATOM   318  C  C     . ALA A 1 46  ? 18.881  72.541  74.019 1.00 64.21  ? 72  ALA A C     1 
ATOM   319  O  O     . ALA A 1 46  ? 19.036  73.303  74.976 1.00 59.93  ? 72  ALA A O     1 
ATOM   320  C  CB    . ALA A 1 46  ? 20.983  71.947  72.773 1.00 46.54  ? 72  ALA A CB    1 
ATOM   321  N  N     . GLN A 1 47  ? 17.826  72.631  73.208 1.00 60.57  ? 73  GLN A N     1 
ATOM   322  C  CA    . GLN A 1 47  ? 16.812  73.674  73.422 1.00 62.05  ? 73  GLN A CA    1 
ATOM   323  C  C     . GLN A 1 47  ? 15.688  73.227  74.351 1.00 66.42  ? 73  GLN A C     1 
ATOM   324  O  O     . GLN A 1 47  ? 14.561  73.714  74.251 1.00 70.99  ? 73  GLN A O     1 
ATOM   325  C  CB    . GLN A 1 47  ? 16.181  74.154  72.104 1.00 72.74  ? 73  GLN A CB    1 
ATOM   326  C  CG    . GLN A 1 47  ? 16.949  75.258  71.378 1.00 85.24  ? 73  GLN A CG    1 
ATOM   327  C  CD    . GLN A 1 47  ? 17.942  74.696  70.390 1.00 81.77  ? 73  GLN A CD    1 
ATOM   328  O  OE1   . GLN A 1 47  ? 18.207  73.506  70.405 1.00 80.92  ? 73  GLN A OE1   1 
ATOM   329  N  NE2   . GLN A 1 47  ? 18.509  75.549  69.539 1.00 73.43  ? 73  GLN A NE2   1 
ATOM   330  N  N     . ILE A 1 48  ? 15.975  72.287  75.241 1.00 66.84  ? 74  ILE A N     1 
ATOM   331  C  CA    . ILE A 1 48  ? 14.950  71.825  76.167 1.00 62.91  ? 74  ILE A CA    1 
ATOM   332  C  C     . ILE A 1 48  ? 15.174  72.521  77.510 1.00 67.80  ? 74  ILE A C     1 
ATOM   333  O  O     . ILE A 1 48  ? 16.288  72.539  78.042 1.00 70.10  ? 74  ILE A O     1 
ATOM   334  C  CB    . ILE A 1 48  ? 14.945  70.270  76.289 1.00 61.68  ? 74  ILE A CB    1 
ATOM   335  C  CG1   . ILE A 1 48  ? 13.634  69.705  75.738 1.00 62.89  ? 74  ILE A CG1   1 
ATOM   336  C  CG2   . ILE A 1 48  ? 15.124  69.799  77.722 1.00 58.01  ? 74  ILE A CG2   1 
ATOM   337  C  CD1   . ILE A 1 48  ? 13.476  69.844  74.248 1.00 63.32  ? 74  ILE A CD1   1 
ATOM   338  N  N     . THR A 1 49  ? 14.114  73.144  78.021 1.00 68.78  ? 75  THR A N     1 
ATOM   339  C  CA    . THR A 1 49  ? 14.170  73.861  79.294 1.00 71.34  ? 75  THR A CA    1 
ATOM   340  C  C     . THR A 1 49  ? 13.755  72.943  80.425 1.00 62.65  ? 75  THR A C     1 
ATOM   341  O  O     . THR A 1 49  ? 13.004  71.995  80.217 1.00 61.08  ? 75  THR A O     1 
ATOM   342  C  CB    . THR A 1 49  ? 13.257  75.107  79.311 1.00 64.84  ? 75  THR A CB    1 
ATOM   343  O  OG1   . THR A 1 49  ? 11.911  74.719  79.614 1.00 66.52  ? 75  THR A OG1   1 
ATOM   344  C  CG2   . THR A 1 49  ? 13.298  75.822  77.974 1.00 56.48  ? 75  THR A CG2   1 
ATOM   345  N  N     . SER A 1 50  ? 14.266  73.215  81.618 1.00 62.50  ? 76  SER A N     1 
ATOM   346  C  CA    . SER A 1 50  ? 13.897  72.443  82.794 1.00 66.01  ? 76  SER A CA    1 
ATOM   347  C  C     . SER A 1 50  ? 12.383  72.452  83.009 1.00 64.42  ? 76  SER A C     1 
ATOM   348  O  O     . SER A 1 50  ? 11.820  71.524  83.591 1.00 62.54  ? 76  SER A O     1 
ATOM   349  C  CB    . SER A 1 50  ? 14.608  72.997  84.030 1.00 66.71  ? 76  SER A CB    1 
ATOM   350  O  OG    . SER A 1 50  ? 16.001  73.111  83.799 1.00 71.87  ? 76  SER A OG    1 
ATOM   351  N  N     . GLN A 1 51  ? 11.735  73.508  82.525 1.00 66.41  ? 77  GLN A N     1 
ATOM   352  C  CA    . GLN A 1 51  ? 10.294  73.688  82.691 1.00 68.19  ? 77  GLN A CA    1 
ATOM   353  C  C     . GLN A 1 51  ? 9.442   72.706  81.891 1.00 63.31  ? 77  GLN A C     1 
ATOM   354  O  O     . GLN A 1 51  ? 8.681   71.911  82.463 1.00 64.14  ? 77  GLN A O     1 
ATOM   355  C  CB    . GLN A 1 51  ? 9.906   75.124  82.323 1.00 66.24  ? 77  GLN A CB    1 
ATOM   356  C  CG    . GLN A 1 51  ? 8.407   75.371  82.308 1.00 67.88  ? 77  GLN A CG    1 
ATOM   357  C  CD    . GLN A 1 51  ? 7.802   75.465  83.706 1.00 72.72  ? 77  GLN A CD    1 
ATOM   358  O  OE1   . GLN A 1 51  ? 8.490   75.287  84.716 1.00 60.08  ? 77  GLN A OE1   1 
ATOM   359  N  NE2   . GLN A 1 51  ? 6.500   75.730  83.765 1.00 77.55  ? 77  GLN A NE2   1 
ATOM   360  N  N     . GLN A 1 52  ? 9.567   72.768  80.567 1.00 63.05  ? 78  GLN A N     1 
ATOM   361  C  CA    . GLN A 1 52  ? 8.810   71.888  79.682 1.00 63.86  ? 78  GLN A CA    1 
ATOM   362  C  C     . GLN A 1 52  ? 9.168   70.437  79.977 1.00 65.17  ? 78  GLN A C     1 
ATOM   363  O  O     . GLN A 1 52  ? 8.345   69.533  79.822 1.00 67.26  ? 78  GLN A O     1 
ATOM   364  C  CB    . GLN A 1 52  ? 9.082   72.226  78.211 1.00 62.28  ? 78  GLN A CB    1 
ATOM   365  C  CG    . GLN A 1 52  ? 10.556  72.288  77.841 1.00 59.88  ? 78  GLN A CG    1 
ATOM   366  C  CD    . GLN A 1 52  ? 10.816  73.157  76.620 1.00 66.16  ? 78  GLN A CD    1 
ATOM   367  O  OE1   . GLN A 1 52  ? 11.957  73.303  76.177 1.00 65.64  ? 78  GLN A OE1   1 
ATOM   368  N  NE2   . GLN A 1 52  ? 9.754   73.746  76.075 1.00 62.89  ? 78  GLN A NE2   1 
ATOM   369  N  N     . LEU A 1 53  ? 10.405  70.236  80.422 1.00 61.86  ? 79  LEU A N     1 
ATOM   370  C  CA    . LEU A 1 53  ? 10.881  68.938  80.883 1.00 57.97  ? 79  LEU A CA    1 
ATOM   371  C  C     . LEU A 1 53  ? 10.123  68.486  82.133 1.00 62.43  ? 79  LEU A C     1 
ATOM   372  O  O     . LEU A 1 53  ? 9.771   67.316  82.263 1.00 68.18  ? 79  LEU A O     1 
ATOM   373  C  CB    . LEU A 1 53  ? 12.383  68.993  81.155 1.00 56.43  ? 79  LEU A CB    1 
ATOM   374  C  CG    . LEU A 1 53  ? 13.055  67.709  81.628 1.00 54.80  ? 79  LEU A CG    1 
ATOM   375  C  CD1   . LEU A 1 53  ? 13.135  66.719  80.481 1.00 52.55  ? 79  LEU A CD1   1 
ATOM   376  C  CD2   . LEU A 1 53  ? 14.440  68.013  82.171 1.00 54.82  ? 79  LEU A CD2   1 
ATOM   377  N  N     . ARG A 1 54  ? 9.897   69.414  83.058 1.00 62.32  ? 80  ARG A N     1 
ATOM   378  C  CA    . ARG A 1 54  ? 9.135   69.134  84.273 1.00 62.59  ? 80  ARG A CA    1 
ATOM   379  C  C     . ARG A 1 54  ? 7.697   68.732  83.939 1.00 62.80  ? 80  ARG A C     1 
ATOM   380  O  O     . ARG A 1 54  ? 7.183   67.714  84.433 1.00 68.44  ? 80  ARG A O     1 
ATOM   381  C  CB    . ARG A 1 54  ? 9.150   70.361  85.188 1.00 69.88  ? 80  ARG A CB    1 
ATOM   382  C  CG    . ARG A 1 54  ? 9.865   70.159  86.509 1.00 71.34  ? 80  ARG A CG    1 
ATOM   383  C  CD    . ARG A 1 54  ? 9.825   71.431  87.349 1.00 64.18  ? 80  ARG A CD    1 
ATOM   384  N  NE    . ARG A 1 54  ? 10.915  72.344  87.004 1.00 73.55  ? 80  ARG A NE    1 
ATOM   385  C  CZ    . ARG A 1 54  ? 10.757  73.624  86.677 1.00 68.87  ? 80  ARG A CZ    1 
ATOM   386  N  NH1   . ARG A 1 54  ? 9.543   74.160  86.646 1.00 73.02  ? 80  ARG A NH1   1 
ATOM   387  N  NH2   . ARG A 1 54  ? 11.815  74.371  86.381 1.00 58.66  ? 80  ARG A NH2   1 
ATOM   388  N  N     . LYS A 1 55  ? 7.064   69.529  83.082 1.00 62.68  ? 81  LYS A N     1 
ATOM   389  C  CA    . LYS A 1 55  ? 5.697   69.257  82.633 1.00 67.31  ? 81  LYS A CA    1 
ATOM   390  C  C     . LYS A 1 55  ? 5.616   67.866  81.987 1.00 69.53  ? 81  LYS A C     1 
ATOM   391  O  O     . LYS A 1 55  ? 4.701   67.053  82.269 1.00 69.17  ? 81  LYS A O     1 
ATOM   392  C  CB    . LYS A 1 55  ? 5.257   70.344  81.650 1.00 67.35  ? 81  LYS A CB    1 
ATOM   393  C  CG    . LYS A 1 55  ? 3.814   70.279  81.187 1.00 69.59  ? 81  LYS A CG    1 
ATOM   394  C  CD    . LYS A 1 55  ? 3.490   71.483  80.310 1.00 80.49  ? 81  LYS A CD    1 
ATOM   395  C  CE    . LYS A 1 55  ? 4.137   71.374  78.928 1.00 78.02  ? 81  LYS A CE    1 
ATOM   396  N  NZ    . LYS A 1 55  ? 3.152   71.028  77.864 1.00 75.04  ? 81  LYS A NZ    1 
ATOM   397  N  N     . ALA A 1 56  ? 6.608   67.600  81.139 1.00 64.60  ? 82  ALA A N     1 
ATOM   398  C  CA    . ALA A 1 56  ? 6.776   66.305  80.496 1.00 66.51  ? 82  ALA A CA    1 
ATOM   399  C  C     . ALA A 1 56  ? 6.795   65.194  81.537 1.00 65.86  ? 82  ALA A C     1 
ATOM   400  O  O     . ALA A 1 56  ? 5.960   64.297  81.491 1.00 59.14  ? 82  ALA A O     1 
ATOM   401  C  CB    . ALA A 1 56  ? 8.049   66.282  79.662 1.00 61.18  ? 82  ALA A CB    1 
ATOM   402  N  N     . GLN A 1 57  ? 7.750   65.258  82.464 1.00 61.93  ? 83  GLN A N     1 
ATOM   403  C  CA    . GLN A 1 57  ? 7.861   64.270  83.534 1.00 61.60  ? 83  GLN A CA    1 
ATOM   404  C  C     . GLN A 1 57  ? 6.539   64.045  84.259 1.00 62.07  ? 83  GLN A C     1 
ATOM   405  O  O     . GLN A 1 57  ? 6.194   62.905  84.586 1.00 65.19  ? 83  GLN A O     1 
ATOM   406  C  CB    . GLN A 1 57  ? 8.937   64.687  84.542 1.00 62.34  ? 83  GLN A CB    1 
ATOM   407  C  CG    . GLN A 1 57  ? 9.164   63.672  85.661 1.00 58.57  ? 83  GLN A CG    1 
ATOM   408  C  CD    . GLN A 1 57  ? 10.342  62.750  85.401 1.00 62.98  ? 83  GLN A CD    1 
ATOM   409  O  OE1   . GLN A 1 57  ? 10.480  62.194  84.310 1.00 71.18  ? 83  GLN A OE1   1 
ATOM   410  N  NE2   . GLN A 1 57  ? 11.200  62.584  86.405 1.00 58.25  ? 83  GLN A NE2   1 
ATOM   411  N  N     . LEU A 1 58  ? 5.786   65.119  84.484 1.00 64.14  ? 84  LEU A N     1 
ATOM   412  C  CA    . LEU A 1 58  ? 4.486   64.967  85.138 1.00 67.74  ? 84  LEU A CA    1 
ATOM   413  C  C     . LEU A 1 58  ? 3.519   64.124  84.300 1.00 67.00  ? 84  LEU A C     1 
ATOM   414  O  O     . LEU A 1 58  ? 2.963   63.118  84.789 1.00 61.40  ? 84  LEU A O     1 
ATOM   415  C  CB    . LEU A 1 58  ? 3.862   66.336  85.439 1.00 68.21  ? 84  LEU A CB    1 
ATOM   416  C  CG    . LEU A 1 58  ? 4.443   67.123  86.621 1.00 60.70  ? 84  LEU A CG    1 
ATOM   417  C  CD1   . LEU A 1 58  ? 3.642   68.390  86.868 1.00 64.23  ? 84  LEU A CD1   1 
ATOM   418  C  CD2   . LEU A 1 58  ? 4.496   66.272  87.886 1.00 60.21  ? 84  LEU A CD2   1 
ATOM   419  N  N     . GLN A 1 59  ? 3.333   64.520  83.038 1.00 70.56  ? 85  GLN A N     1 
ATOM   420  C  CA    . GLN A 1 59  ? 2.407   63.795  82.155 1.00 67.46  ? 85  GLN A CA    1 
ATOM   421  C  C     . GLN A 1 59  ? 2.806   62.330  81.961 1.00 64.83  ? 85  GLN A C     1 
ATOM   422  O  O     . GLN A 1 59  ? 2.006   61.404  82.197 1.00 66.28  ? 85  GLN A O     1 
ATOM   423  C  CB    . GLN A 1 59  ? 2.325   64.479  80.791 1.00 73.28  ? 85  GLN A CB    1 
ATOM   424  C  CG    . GLN A 1 59  ? 1.669   65.845  80.815 1.00 78.16  ? 85  GLN A CG    1 
ATOM   425  C  CD    . GLN A 1 59  ? 1.655   66.496  79.446 1.00 82.51  ? 85  GLN A CD    1 
ATOM   426  O  OE1   . GLN A 1 59  ? 2.700   66.659  78.812 1.00 80.10  ? 85  GLN A OE1   1 
ATOM   427  N  NE2   . GLN A 1 59  ? 0.467   66.870  78.979 1.00 87.36  ? 85  GLN A NE2   1 
ATOM   428  N  N     . VAL A 1 60  ? 4.049   62.145  81.523 1.00 65.01  ? 86  VAL A N     1 
ATOM   429  C  CA    . VAL A 1 60  ? 4.674   60.835  81.378 1.00 61.27  ? 86  VAL A CA    1 
ATOM   430  C  C     . VAL A 1 60  ? 4.456   59.965  82.605 1.00 63.67  ? 86  VAL A C     1 
ATOM   431  O  O     . VAL A 1 60  ? 4.064   58.814  82.472 1.00 66.04  ? 86  VAL A O     1 
ATOM   432  C  CB    . VAL A 1 60  ? 6.191   60.953  81.113 1.00 56.67  ? 86  VAL A CB    1 
ATOM   433  C  CG1   . VAL A 1 60  ? 6.880   59.628  81.345 1.00 54.06  ? 86  VAL A CG1   1 
ATOM   434  C  CG2   . VAL A 1 60  ? 6.440   61.414  79.699 1.00 53.24  ? 86  VAL A CG2   1 
ATOM   435  N  N     . ASP A 1 61  ? 4.711   60.502  83.796 1.00 59.17  ? 87  ASP A N     1 
ATOM   436  C  CA    . ASP A 1 61  ? 4.503   59.711  85.007 1.00 56.98  ? 87  ASP A CA    1 
ATOM   437  C  C     . ASP A 1 61  ? 3.032   59.373  85.244 1.00 57.35  ? 87  ASP A C     1 
ATOM   438  O  O     . ASP A 1 61  ? 2.723   58.295  85.752 1.00 60.53  ? 87  ASP A O     1 
ATOM   439  C  CB    . ASP A 1 61  ? 5.084   60.426  86.223 1.00 57.75  ? 87  ASP A CB    1 
ATOM   440  C  CG    . ASP A 1 61  ? 6.588   60.262  86.321 1.00 65.51  ? 87  ASP A CG    1 
ATOM   441  O  OD1   . ASP A 1 61  ? 7.078   59.138  86.068 1.00 60.46  ? 87  ASP A OD1   1 
ATOM   442  O  OD2   . ASP A 1 61  ? 7.277   61.253  86.646 1.00 73.35  ? 87  ASP A OD2   1 
ATOM   443  N  N     . ARG A 1 62  ? 2.125   60.277  84.881 1.00 63.51  ? 88  ARG A N     1 
ATOM   444  C  CA    . ARG A 1 62  ? 0.704   59.943  84.993 1.00 63.50  ? 88  ARG A CA    1 
ATOM   445  C  C     . ARG A 1 62  ? 0.384   58.720  84.118 1.00 61.20  ? 88  ARG A C     1 
ATOM   446  O  O     . ARG A 1 62  ? -0.227  57.727  84.578 1.00 55.07  ? 88  ARG A O     1 
ATOM   447  C  CB    . ARG A 1 62  ? -0.170  61.135  84.595 1.00 60.99  ? 88  ARG A CB    1 
ATOM   448  N  N     . PHE A 1 63  ? 0.831   58.785  82.864 1.00 63.88  ? 89  PHE A N     1 
ATOM   449  C  CA    . PHE A 1 63  ? 0.612   57.683  81.925 1.00 61.68  ? 89  PHE A CA    1 
ATOM   450  C  C     . PHE A 1 63  ? 1.250   56.370  82.397 1.00 61.25  ? 89  PHE A C     1 
ATOM   451  O  O     . PHE A 1 63  ? 0.624   55.315  82.331 1.00 57.41  ? 89  PHE A O     1 
ATOM   452  C  CB    . PHE A 1 63  ? 1.136   58.038  80.531 1.00 58.32  ? 89  PHE A CB    1 
ATOM   453  C  CG    . PHE A 1 63  ? 0.915   56.951  79.520 1.00 63.78  ? 89  PHE A CG    1 
ATOM   454  C  CD1   . PHE A 1 63  ? -0.346  56.730  78.985 1.00 65.32  ? 89  PHE A CD1   1 
ATOM   455  C  CD2   . PHE A 1 63  ? 1.960   56.133  79.120 1.00 63.15  ? 89  PHE A CD2   1 
ATOM   456  C  CE1   . PHE A 1 63  ? -0.557  55.718  78.064 1.00 66.15  ? 89  PHE A CE1   1 
ATOM   457  C  CE2   . PHE A 1 63  ? 1.755   55.122  78.200 1.00 64.52  ? 89  PHE A CE2   1 
ATOM   458  C  CZ    . PHE A 1 63  ? 0.495   54.913  77.670 1.00 66.90  ? 89  PHE A CZ    1 
ATOM   459  N  N     . ALA A 1 64  ? 2.503   56.444  82.839 1.00 59.53  ? 90  ALA A N     1 
ATOM   460  C  CA    . ALA A 1 64  ? 3.233   55.300  83.373 1.00 50.81  ? 90  ALA A CA    1 
ATOM   461  C  C     . ALA A 1 64  ? 2.473   54.673  84.523 1.00 53.26  ? 90  ALA A C     1 
ATOM   462  O  O     . ALA A 1 64  ? 2.394   53.455  84.632 1.00 60.88  ? 90  ALA A O     1 
ATOM   463  C  CB    . ALA A 1 64  ? 4.623   55.718  83.826 1.00 53.38  ? 90  ALA A CB    1 
ATOM   464  N  N     . MET A 1 65  ? 1.929   55.518  85.390 1.00 62.94  ? 91  MET A N     1 
ATOM   465  C  CA    . MET A 1 65  ? 1.080   55.049  86.474 1.00 66.04  ? 91  MET A CA    1 
ATOM   466  C  C     . MET A 1 65  ? -0.079  54.241  85.903 1.00 60.79  ? 91  MET A C     1 
ATOM   467  O  O     . MET A 1 65  ? -0.368  53.123  86.368 1.00 60.77  ? 91  MET A O     1 
ATOM   468  C  CB    . MET A 1 65  ? 0.558   56.223  87.302 1.00 72.64  ? 91  MET A CB    1 
ATOM   469  C  CG    . MET A 1 65  ? -0.430  55.824  88.396 1.00 84.92  ? 91  MET A CG    1 
ATOM   470  S  SD    . MET A 1 65  ? 0.258   54.709  89.630 1.00 111.59 ? 91  MET A SD    1 
ATOM   471  C  CE    . MET A 1 65  ? -1.032  54.752  90.869 1.00 99.85  ? 91  MET A CE    1 
ATOM   472  N  N     . GLU A 1 66  ? -0.726  54.808  84.882 1.00 57.63  ? 92  GLU A N     1 
ATOM   473  C  CA    . GLU A 1 66  ? -1.807  54.100  84.189 1.00 56.57  ? 92  GLU A CA    1 
ATOM   474  C  C     . GLU A 1 66  ? -1.352  52.721  83.684 1.00 60.52  ? 92  GLU A C     1 
ATOM   475  O  O     . GLU A 1 66  ? -2.096  51.740  83.779 1.00 56.12  ? 92  GLU A O     1 
ATOM   476  C  CB    . GLU A 1 66  ? -2.347  54.942  83.030 1.00 57.45  ? 92  GLU A CB    1 
ATOM   477  N  N     . LEU A 1 67  ? -0.132  52.651  83.155 1.00 59.01  ? 93  LEU A N     1 
ATOM   478  C  CA    . LEU A 1 67  ? 0.442   51.387  82.688 1.00 54.48  ? 93  LEU A CA    1 
ATOM   479  C  C     . LEU A 1 67  ? 0.619   50.370  83.809 1.00 56.34  ? 93  LEU A C     1 
ATOM   480  O  O     . LEU A 1 67  ? 0.042   49.283  83.769 1.00 57.61  ? 93  LEU A O     1 
ATOM   481  C  CB    . LEU A 1 67  ? 1.790   51.623  82.002 1.00 51.85  ? 93  LEU A CB    1 
ATOM   482  C  CG    . LEU A 1 67  ? 1.732   52.311  80.638 1.00 52.92  ? 93  LEU A CG    1 
ATOM   483  C  CD1   . LEU A 1 67  ? 3.117   52.388  80.010 1.00 46.53  ? 93  LEU A CD1   1 
ATOM   484  C  CD2   . LEU A 1 67  ? 0.756   51.580  79.726 1.00 45.69  ? 93  LEU A CD2   1 
ATOM   485  N  N     . GLU A 1 68  ? 1.430   50.732  84.800 1.00 53.92  ? 94  GLU A N     1 
ATOM   486  C  CA    . GLU A 1 68  ? 1.730   49.859  85.930 1.00 51.75  ? 94  GLU A CA    1 
ATOM   487  C  C     . GLU A 1 68  ? 0.461   49.397  86.637 1.00 51.34  ? 94  GLU A C     1 
ATOM   488  O  O     . GLU A 1 68  ? 0.428   48.328  87.248 1.00 47.90  ? 94  GLU A O     1 
ATOM   489  C  CB    . GLU A 1 68  ? 2.660   50.576  86.911 1.00 48.02  ? 94  GLU A CB    1 
ATOM   490  C  CG    . GLU A 1 68  ? 2.903   49.836  88.209 1.00 53.40  ? 94  GLU A CG    1 
ATOM   491  C  CD    . GLU A 1 68  ? 4.023   48.820  88.098 1.00 59.16  ? 94  GLU A CD    1 
ATOM   492  O  OE1   . GLU A 1 68  ? 5.093   49.180  87.555 1.00 53.49  ? 94  GLU A OE1   1 
ATOM   493  O  OE2   . GLU A 1 68  ? 3.839   47.669  88.565 1.00 52.50  ? 94  GLU A OE2   1 
ATOM   494  N  N     . GLN A 1 69  ? -0.597  50.194  86.531 1.00 57.49  ? 95  GLN A N     1 
ATOM   495  C  CA    . GLN A 1 69  ? -1.885  49.768  87.066 1.00 59.40  ? 95  GLN A CA    1 
ATOM   496  C  C     . GLN A 1 69  ? -2.449  48.603  86.244 1.00 57.63  ? 95  GLN A C     1 
ATOM   497  O  O     . GLN A 1 69  ? -2.977  47.637  86.800 1.00 51.99  ? 95  GLN A O     1 
ATOM   498  C  CB    . GLN A 1 69  ? -2.875  50.934  87.091 1.00 61.76  ? 95  GLN A CB    1 
ATOM   499  N  N     . SER A 1 70  ? -2.322  48.697  84.921 1.00 60.52  ? 96  SER A N     1 
ATOM   500  C  CA    . SER A 1 70  ? -2.858  47.691  84.001 1.00 51.49  ? 96  SER A CA    1 
ATOM   501  C  C     . SER A 1 70  ? -1.989  46.443  83.830 1.00 55.82  ? 96  SER A C     1 
ATOM   502  O  O     . SER A 1 70  ? -2.291  45.599  82.990 1.00 63.09  ? 96  SER A O     1 
ATOM   503  C  CB    . SER A 1 70  ? -3.096  48.319  82.623 1.00 47.99  ? 96  SER A CB    1 
ATOM   504  N  N     . ARG A 1 71  ? -0.912  46.329  84.602 1.00 55.46  ? 97  ARG A N     1 
ATOM   505  C  CA    . ARG A 1 71  ? 0.005   45.195  84.457 1.00 50.40  ? 97  ARG A CA    1 
ATOM   506  C  C     . ARG A 1 71  ? -0.685  43.850  84.689 1.00 54.09  ? 97  ARG A C     1 
ATOM   507  O  O     . ARG A 1 71  ? -1.465  43.700  85.628 1.00 53.04  ? 97  ARG A O     1 
ATOM   508  C  CB    . ARG A 1 71  ? 1.192   45.333  85.409 1.00 42.38  ? 97  ARG A CB    1 
ATOM   509  C  CG    . ARG A 1 71  ? 2.105   44.121  85.405 1.00 44.30  ? 97  ARG A CG    1 
ATOM   510  C  CD    . ARG A 1 71  ? 3.313   44.316  86.290 1.00 43.07  ? 97  ARG A CD    1 
ATOM   511  N  NE    . ARG A 1 71  ? 4.000   45.559  85.965 1.00 41.64  ? 97  ARG A NE    1 
ATOM   512  C  CZ    . ARG A 1 71  ? 5.280   45.637  85.610 1.00 44.70  ? 97  ARG A CZ    1 
ATOM   513  N  NH1   . ARG A 1 71  ? 6.021   44.543  85.522 1.00 48.94  ? 97  ARG A NH1   1 
ATOM   514  N  NH2   . ARG A 1 71  ? 5.822   46.811  85.334 1.00 50.69  ? 97  ARG A NH2   1 
ATOM   515  N  N     . ASN A 1 72  ? -0.393  42.881  83.821 1.00 59.15  ? 98  ASN A N     1 
ATOM   516  C  CA    . ASN A 1 72  ? -0.955  41.535  83.930 1.00 52.83  ? 98  ASN A CA    1 
ATOM   517  C  C     . ASN A 1 72  ? 0.136   40.479  84.128 1.00 50.92  ? 98  ASN A C     1 
ATOM   518  O  O     . ASN A 1 72  ? 1.082   40.398  83.344 1.00 52.67  ? 98  ASN A O     1 
ATOM   519  C  CB    . ASN A 1 72  ? -1.782  41.208  82.684 1.00 49.81  ? 98  ASN A CB    1 
ATOM   520  C  CG    . ASN A 1 72  ? -2.628  39.956  82.847 1.00 56.60  ? 98  ASN A CG    1 
ATOM   521  O  OD1   . ASN A 1 72  ? -2.342  39.097  83.683 1.00 58.04  ? 98  ASN A OD1   1 
ATOM   522  N  ND2   . ASN A 1 72  ? -3.674  39.844  82.037 1.00 60.32  ? 98  ASN A ND2   1 
ATOM   523  N  N     . LEU A 1 73  ? -0.006  39.666  85.173 1.00 44.26  ? 99  LEU A N     1 
ATOM   524  C  CA    . LEU A 1 73  ? 1.004   38.664  85.510 1.00 44.79  ? 99  LEU A CA    1 
ATOM   525  C  C     . LEU A 1 73  ? 0.458   37.237  85.566 1.00 51.91  ? 99  LEU A C     1 
ATOM   526  O  O     . LEU A 1 73  ? 1.190   36.297  85.890 1.00 48.24  ? 99  LEU A O     1 
ATOM   527  C  CB    . LEU A 1 73  ? 1.656   38.999  86.852 1.00 40.56  ? 99  LEU A CB    1 
ATOM   528  C  CG    . LEU A 1 73  ? 2.729   40.087  86.877 1.00 41.69  ? 99  LEU A CG    1 
ATOM   529  C  CD1   . LEU A 1 73  ? 3.346   40.171  88.264 1.00 45.11  ? 99  LEU A CD1   1 
ATOM   530  C  CD2   . LEU A 1 73  ? 3.797   39.801  85.848 1.00 37.56  ? 99  LEU A CD2   1 
ATOM   531  N  N     . SER A 1 74  ? -0.817  37.072  85.234 1.00 49.37  ? 100 SER A N     1 
ATOM   532  C  CA    . SER A 1 74  ? -1.481  35.789  85.438 1.00 47.62  ? 100 SER A CA    1 
ATOM   533  C  C     . SER A 1 74  ? -1.158  34.773  84.343 1.00 48.56  ? 100 SER A C     1 
ATOM   534  O  O     . SER A 1 74  ? -1.185  33.566  84.586 1.00 50.89  ? 100 SER A O     1 
ATOM   535  C  CB    . SER A 1 74  ? -2.995  35.986  85.531 1.00 49.89  ? 100 SER A CB    1 
ATOM   536  O  OG    . SER A 1 74  ? -3.535  36.351  84.274 1.00 57.51  ? 100 SER A OG    1 
ATOM   537  N  N     . ASN A 1 75  ? -0.849  35.258  83.144 1.00 50.10  ? 101 ASN A N     1 
ATOM   538  C  CA    . ASN A 1 75  ? -0.637  34.378  81.998 1.00 42.64  ? 101 ASN A CA    1 
ATOM   539  C  C     . ASN A 1 75  ? 0.782   33.834  81.899 1.00 40.65  ? 101 ASN A C     1 
ATOM   540  O  O     . ASN A 1 75  ? 1.750   34.486  82.298 1.00 41.09  ? 101 ASN A O     1 
ATOM   541  C  CB    . ASN A 1 75  ? -0.995  35.113  80.707 1.00 39.37  ? 101 ASN A CB    1 
ATOM   542  C  CG    . ASN A 1 75  ? -2.487  35.343  80.564 1.00 46.65  ? 101 ASN A CG    1 
ATOM   543  O  OD1   . ASN A 1 75  ? -3.168  34.636  79.824 1.00 47.39  ? 101 ASN A OD1   1 
ATOM   544  N  ND2   . ASN A 1 75  ? -3.006  36.327  81.290 1.00 54.16  ? 101 ASN A ND2   1 
ATOM   545  N  N     . THR A 1 76  ? 0.896   32.627  81.357 1.00 41.38  ? 102 THR A N     1 
ATOM   546  C  CA    . THR A 1 76  ? 2.200   32.030  81.120 1.00 40.40  ? 102 THR A CA    1 
ATOM   547  C  C     . THR A 1 76  ? 2.434   31.961  79.616 1.00 35.99  ? 102 THR A C     1 
ATOM   548  O  O     . THR A 1 76  ? 1.732   31.257  78.892 1.00 38.98  ? 102 THR A O     1 
ATOM   549  C  CB    . THR A 1 76  ? 2.328   30.622  81.741 1.00 41.92  ? 102 THR A CB    1 
ATOM   550  O  OG1   . THR A 1 76  ? 1.903   30.647  83.110 1.00 42.76  ? 102 THR A OG1   1 
ATOM   551  C  CG2   . THR A 1 76  ? 3.770   30.157  81.685 1.00 35.73  ? 102 THR A CG2   1 
ATOM   552  N  N     . ILE A 1 77  ? 3.438   32.701  79.166 1.00 31.11  ? 103 ILE A N     1 
ATOM   553  C  CA    . ILE A 1 77  ? 3.738   32.869  77.757 1.00 30.70  ? 103 ILE A CA    1 
ATOM   554  C  C     . ILE A 1 77  ? 5.091   32.247  77.468 1.00 29.03  ? 103 ILE A C     1 
ATOM   555  O  O     . ILE A 1 77  ? 6.058   32.448  78.212 1.00 26.01  ? 103 ILE A O     1 
ATOM   556  C  CB    . ILE A 1 77  ? 3.735   34.377  77.351 1.00 36.99  ? 103 ILE A CB    1 
ATOM   557  C  CG1   . ILE A 1 77  ? 2.334   34.979  77.496 1.00 36.70  ? 103 ILE A CG1   1 
ATOM   558  C  CG2   . ILE A 1 77  ? 4.237   34.575  75.929 1.00 29.66  ? 103 ILE A CG2   1 
ATOM   559  C  CD1   . ILE A 1 77  ? 1.292   34.333  76.594 1.00 37.39  ? 103 ILE A CD1   1 
ATOM   560  N  N     . VAL A 1 78  ? 5.147   31.479  76.387 1.00 26.46  ? 104 VAL A N     1 
ATOM   561  C  CA    . VAL A 1 78  ? 6.346   30.742  76.037 1.00 25.66  ? 104 VAL A CA    1 
ATOM   562  C  C     . VAL A 1 78  ? 6.769   31.115  74.624 1.00 27.29  ? 104 VAL A C     1 
ATOM   563  O  O     . VAL A 1 78  ? 5.934   31.274  73.745 1.00 29.78  ? 104 VAL A O     1 
ATOM   564  C  CB    . VAL A 1 78  ? 6.120   29.210  76.128 1.00 25.15  ? 104 VAL A CB    1 
ATOM   565  C  CG1   . VAL A 1 78  ? 7.395   28.452  75.802 1.00 22.91  ? 104 VAL A CG1   1 
ATOM   566  C  CG2   . VAL A 1 78  ? 5.648   28.825  77.505 1.00 28.77  ? 104 VAL A CG2   1 
ATOM   567  N  N     . HIS A 1 79  ? 8.070   31.254  74.411 1.00 25.63  ? 105 HIS A N     1 
ATOM   568  C  CA    . HIS A 1 79  ? 8.597   31.495  73.079 1.00 26.99  ? 105 HIS A CA    1 
ATOM   569  C  C     . HIS A 1 79  ? 9.586   30.411  72.728 1.00 30.52  ? 105 HIS A C     1 
ATOM   570  O  O     . HIS A 1 79  ? 10.602  30.267  73.401 1.00 30.46  ? 105 HIS A O     1 
ATOM   571  C  CB    . HIS A 1 79  ? 9.277   32.861  72.979 1.00 27.54  ? 105 HIS A CB    1 
ATOM   572  C  CG    . HIS A 1 79  ? 9.886   33.130  71.638 1.00 30.73  ? 105 HIS A CG    1 
ATOM   573  N  ND1   . HIS A 1 79  ? 11.252  33.138  71.427 1.00 33.13  ? 105 HIS A ND1   1 
ATOM   574  C  CD2   . HIS A 1 79  ? 9.325   33.392  70.435 1.00 29.09  ? 105 HIS A CD2   1 
ATOM   575  C  CE1   . HIS A 1 79  ? 11.499  33.391  70.158 1.00 32.03  ? 105 HIS A CE1   1 
ATOM   576  N  NE2   . HIS A 1 79  ? 10.345  33.552  69.532 1.00 31.99  ? 105 HIS A NE2   1 
ATOM   577  N  N     . ILE A 1 80  ? 9.290   29.662  71.669 1.00 31.25  ? 106 ILE A N     1 
ATOM   578  C  CA    . ILE A 1 80  ? 10.198  28.624  71.210 1.00 29.22  ? 106 ILE A CA    1 
ATOM   579  C  C     . ILE A 1 80  ? 10.915  29.035  69.928 1.00 30.83  ? 106 ILE A C     1 
ATOM   580  O  O     . ILE A 1 80  ? 10.301  29.555  68.984 1.00 33.71  ? 106 ILE A O     1 
ATOM   581  C  CB    . ILE A 1 80  ? 9.466   27.303  70.969 1.00 33.86  ? 106 ILE A CB    1 
ATOM   582  C  CG1   . ILE A 1 80  ? 8.342   27.140  71.985 1.00 38.48  ? 106 ILE A CG1   1 
ATOM   583  C  CG2   . ILE A 1 80  ? 10.447  26.130  71.038 1.00 35.10  ? 106 ILE A CG2   1 
ATOM   584  C  CD1   . ILE A 1 80  ? 8.080   25.706  72.370 1.00 42.83  ? 106 ILE A CD1   1 
ATOM   585  N  N     . ASP A 1 81  ? 12.217  28.760  69.920 1.00 29.34  ? 107 ASP A N     1 
ATOM   586  C  CA    . ASP A 1 81  ? 13.138  29.151  68.864 1.00 29.02  ? 107 ASP A CA    1 
ATOM   587  C  C     . ASP A 1 81  ? 14.083  28.010  68.528 1.00 32.53  ? 107 ASP A C     1 
ATOM   588  O  O     . ASP A 1 81  ? 14.987  27.718  69.306 1.00 39.33  ? 107 ASP A O     1 
ATOM   589  C  CB    . ASP A 1 81  ? 13.937  30.373  69.316 1.00 32.04  ? 107 ASP A CB    1 
ATOM   590  C  CG    . ASP A 1 81  ? 14.605  31.106  68.173 1.00 38.21  ? 107 ASP A CG    1 
ATOM   591  O  OD1   . ASP A 1 81  ? 15.118  30.451  67.239 1.00 41.27  ? 107 ASP A OD1   1 
ATOM   592  O  OD2   . ASP A 1 81  ? 14.628  32.354  68.220 1.00 48.45  ? 107 ASP A OD2   1 
ATOM   593  N  N     . MET A 1 82  ? 13.890  27.387  67.368 1.00 29.65  ? 108 MET A N     1 
ATOM   594  C  CA    . MET A 1 82  ? 14.749  26.293  66.928 1.00 29.62  ? 108 MET A CA    1 
ATOM   595  C  C     . MET A 1 82  ? 16.206  26.736  66.841 1.00 32.24  ? 108 MET A C     1 
ATOM   596  O  O     . MET A 1 82  ? 16.499  27.841  66.390 1.00 34.65  ? 108 MET A O     1 
ATOM   597  C  CB    . MET A 1 82  ? 14.287  25.757  65.572 1.00 27.34  ? 108 MET A CB    1 
ATOM   598  C  CG    . MET A 1 82  ? 12.902  25.114  65.572 1.00 25.62  ? 108 MET A CG    1 
ATOM   599  S  SD    . MET A 1 82  ? 12.802  23.568  66.521 1.00 33.17  ? 108 MET A SD    1 
ATOM   600  C  CE    . MET A 1 82  ? 14.253  22.708  65.930 1.00 31.28  ? 108 MET A CE    1 
ATOM   601  N  N     . ASP A 1 83  ? 17.117  25.883  67.294 1.00 30.03  ? 109 ASP A N     1 
ATOM   602  C  CA    . ASP A 1 83  ? 18.529  26.247  67.323 1.00 31.17  ? 109 ASP A CA    1 
ATOM   603  C  C     . ASP A 1 83  ? 19.196  26.078  65.959 1.00 33.19  ? 109 ASP A C     1 
ATOM   604  O  O     . ASP A 1 83  ? 19.071  25.024  65.332 1.00 37.71  ? 109 ASP A O     1 
ATOM   605  C  CB    . ASP A 1 83  ? 19.261  25.403  68.357 1.00 31.12  ? 109 ASP A CB    1 
ATOM   606  C  CG    . ASP A 1 83  ? 18.692  25.572  69.750 1.00 38.37  ? 109 ASP A CG    1 
ATOM   607  O  OD1   . ASP A 1 83  ? 18.270  26.693  70.094 1.00 45.20  ? 109 ASP A OD1   1 
ATOM   608  O  OD2   . ASP A 1 83  ? 18.655  24.582  70.506 1.00 42.15  ? 109 ASP A OD2   1 
ATOM   609  N  N     . ALA A 1 84  ? 19.915  27.112  65.523 1.00 28.86  ? 110 ALA A N     1 
ATOM   610  C  CA    . ALA A 1 84  ? 20.603  27.151  64.226 1.00 30.57  ? 110 ALA A CA    1 
ATOM   611  C  C     . ALA A 1 84  ? 19.845  26.485  63.072 1.00 31.36  ? 110 ALA A C     1 
ATOM   612  O  O     . ALA A 1 84  ? 20.460  26.001  62.125 1.00 32.37  ? 110 ALA A O     1 
ATOM   613  C  CB    . ALA A 1 84  ? 21.980  26.525  64.362 1.00 33.27  ? 110 ALA A CB    1 
ATOM   614  N  N     . PHE A 1 85  ? 18.517  26.516  63.156 1.00 29.53  ? 111 PHE A N     1 
ATOM   615  C  CA    . PHE A 1 85  ? 17.587  25.771  62.296 1.00 27.97  ? 111 PHE A CA    1 
ATOM   616  C  C     . PHE A 1 85  ? 18.130  25.132  61.015 1.00 33.24  ? 111 PHE A C     1 
ATOM   617  O  O     . PHE A 1 85  ? 18.460  23.948  61.010 1.00 35.26  ? 111 PHE A O     1 
ATOM   618  C  CB    . PHE A 1 85  ? 16.426  26.678  61.907 1.00 30.98  ? 111 PHE A CB    1 
ATOM   619  C  CG    . PHE A 1 85  ? 15.203  25.923  61.480 1.00 33.43  ? 111 PHE A CG    1 
ATOM   620  C  CD1   . PHE A 1 85  ? 14.997  24.623  61.917 1.00 27.29  ? 111 PHE A CD1   1 
ATOM   621  C  CD2   . PHE A 1 85  ? 14.276  26.493  60.628 1.00 34.46  ? 111 PHE A CD2   1 
ATOM   622  C  CE1   . PHE A 1 85  ? 13.877  23.921  61.525 1.00 27.50  ? 111 PHE A CE1   1 
ATOM   623  C  CE2   . PHE A 1 85  ? 13.157  25.797  60.236 1.00 35.03  ? 111 PHE A CE2   1 
ATOM   624  C  CZ    . PHE A 1 85  ? 12.958  24.508  60.682 1.00 30.45  ? 111 PHE A CZ    1 
ATOM   625  N  N     . TYR A 1 86  ? 18.162  25.904  59.930 1.00 34.78  ? 112 TYR A N     1 
ATOM   626  C  CA    . TYR A 1 86  ? 18.573  25.405  58.613 1.00 32.09  ? 112 TYR A CA    1 
ATOM   627  C  C     . TYR A 1 86  ? 19.830  24.527  58.699 1.00 33.22  ? 112 TYR A C     1 
ATOM   628  O  O     . TYR A 1 86  ? 19.890  23.425  58.131 1.00 40.38  ? 112 TYR A O     1 
ATOM   629  C  CB    . TYR A 1 86  ? 18.824  26.569  57.652 1.00 29.02  ? 112 TYR A CB    1 
ATOM   630  C  CG    . TYR A 1 86  ? 17.601  27.370  57.232 1.00 34.88  ? 112 TYR A CG    1 
ATOM   631  C  CD1   . TYR A 1 86  ? 17.696  28.335  56.234 1.00 40.13  ? 112 TYR A CD1   1 
ATOM   632  C  CD2   . TYR A 1 86  ? 16.368  27.191  57.846 1.00 33.85  ? 112 TYR A CD2   1 
ATOM   633  C  CE1   . TYR A 1 86  ? 16.597  29.086  55.846 1.00 35.29  ? 112 TYR A CE1   1 
ATOM   634  C  CE2   . TYR A 1 86  ? 15.261  27.937  57.466 1.00 30.85  ? 112 TYR A CE2   1 
ATOM   635  C  CZ    . TYR A 1 86  ? 15.383  28.883  56.464 1.00 37.35  ? 112 TYR A CZ    1 
ATOM   636  O  OH    . TYR A 1 86  ? 14.296  29.635  56.074 1.00 37.97  ? 112 TYR A OH    1 
ATOM   637  N  N     . ALA A 1 87  ? 20.818  25.015  59.444 1.00 31.09  ? 113 ALA A N     1 
ATOM   638  C  CA    . ALA A 1 87  ? 22.097  24.333  59.568 1.00 31.68  ? 113 ALA A CA    1 
ATOM   639  C  C     . ALA A 1 87  ? 21.960  23.063  60.397 1.00 37.21  ? 113 ALA A C     1 
ATOM   640  O  O     . ALA A 1 87  ? 22.591  22.047  60.100 1.00 39.94  ? 113 ALA A O     1 
ATOM   641  C  CB    . ALA A 1 87  ? 23.124  25.258  60.182 1.00 32.21  ? 113 ALA A CB    1 
ATOM   642  N  N     . ALA A 1 88  ? 21.117  23.123  61.423 1.00 31.03  ? 114 ALA A N     1 
ATOM   643  C  CA    . ALA A 1 88  ? 20.825  21.957  62.245 1.00 31.00  ? 114 ALA A CA    1 
ATOM   644  C  C     . ALA A 1 88  ? 20.229  20.848  61.387 1.00 34.76  ? 114 ALA A C     1 
ATOM   645  O  O     . ALA A 1 88  ? 20.600  19.683  61.517 1.00 37.49  ? 114 ALA A O     1 
ATOM   646  C  CB    . ALA A 1 88  ? 19.884  22.324  63.383 1.00 29.02  ? 114 ALA A CB    1 
ATOM   647  N  N     . VAL A 1 89  ? 19.296  21.216  60.515 1.00 32.92  ? 115 VAL A N     1 
ATOM   648  C  CA    . VAL A 1 89  ? 18.677  20.251  59.616 1.00 30.57  ? 115 VAL A CA    1 
ATOM   649  C  C     . VAL A 1 89  ? 19.692  19.678  58.642 1.00 31.52  ? 115 VAL A C     1 
ATOM   650  O  O     . VAL A 1 89  ? 19.736  18.467  58.420 1.00 34.48  ? 115 VAL A O     1 
ATOM   651  C  CB    . VAL A 1 89  ? 17.530  20.877  58.821 1.00 28.00  ? 115 VAL A CB    1 
ATOM   652  C  CG1   . VAL A 1 89  ? 17.001  19.893  57.798 1.00 28.60  ? 115 VAL A CG1   1 
ATOM   653  C  CG2   . VAL A 1 89  ? 16.424  21.319  59.757 1.00 29.00  ? 115 VAL A CG2   1 
ATOM   654  N  N     . GLU A 1 90  ? 20.518  20.544  58.066 1.00 32.70  ? 116 GLU A N     1 
ATOM   655  C  CA    . GLU A 1 90  ? 21.546  20.056  57.154 1.00 34.37  ? 116 GLU A CA    1 
ATOM   656  C  C     . GLU A 1 90  ? 22.556  19.137  57.845 1.00 36.70  ? 116 GLU A C     1 
ATOM   657  O  O     . GLU A 1 90  ? 23.176  18.293  57.208 1.00 36.81  ? 116 GLU A O     1 
ATOM   658  C  CB    . GLU A 1 90  ? 22.275  21.227  56.499 1.00 32.25  ? 116 GLU A CB    1 
ATOM   659  C  CG    . GLU A 1 90  ? 21.414  22.021  55.529 1.00 35.88  ? 116 GLU A CG    1 
ATOM   660  C  CD    . GLU A 1 90  ? 20.606  21.153  54.572 1.00 40.64  ? 116 GLU A CD    1 
ATOM   661  O  OE1   . GLU A 1 90  ? 21.077  20.059  54.177 1.00 42.49  ? 116 GLU A OE1   1 
ATOM   662  O  OE2   . GLU A 1 90  ? 19.487  21.581  54.213 1.00 37.92  ? 116 GLU A OE2   1 
ATOM   663  N  N     . MET A 1 91  ? 22.722  19.313  59.148 1.00 38.37  ? 117 MET A N     1 
ATOM   664  C  CA    . MET A 1 91  ? 23.673  18.517  59.902 1.00 37.84  ? 117 MET A CA    1 
ATOM   665  C  C     . MET A 1 91  ? 23.046  17.177  60.272 1.00 40.60  ? 117 MET A C     1 
ATOM   666  O  O     . MET A 1 91  ? 23.718  16.144  60.303 1.00 39.06  ? 117 MET A O     1 
ATOM   667  C  CB    . MET A 1 91  ? 24.124  19.271  61.154 1.00 34.00  ? 117 MET A CB    1 
ATOM   668  C  CG    . MET A 1 91  ? 25.201  20.320  60.906 1.00 40.43  ? 117 MET A CG    1 
ATOM   669  S  SD    . MET A 1 91  ? 25.420  21.440  62.313 1.00 48.81  ? 117 MET A SD    1 
ATOM   670  C  CE    . MET A 1 91  ? 26.120  20.330  63.531 1.00 65.59  ? 117 MET A CE    1 
ATOM   671  N  N     . ARG A 1 92  ? 21.746  17.209  60.544 1.00 34.59  ? 118 ARG A N     1 
ATOM   672  C  CA    . ARG A 1 92  ? 20.993  16.022  60.925 1.00 32.61  ? 118 ARG A CA    1 
ATOM   673  C  C     . ARG A 1 92  ? 21.049  14.938  59.859 1.00 39.95  ? 118 ARG A C     1 
ATOM   674  O  O     . ARG A 1 92  ? 21.079  13.747  60.165 1.00 43.14  ? 118 ARG A O     1 
ATOM   675  C  CB    . ARG A 1 92  ? 19.542  16.399  61.202 1.00 32.13  ? 118 ARG A CB    1 
ATOM   676  C  CG    . ARG A 1 92  ? 18.644  15.228  61.513 1.00 28.82  ? 118 ARG A CG    1 
ATOM   677  C  CD    . ARG A 1 92  ? 17.206  15.675  61.559 1.00 30.55  ? 118 ARG A CD    1 
ATOM   678  N  NE    . ARG A 1 92  ? 16.676  15.910  60.219 1.00 37.64  ? 118 ARG A NE    1 
ATOM   679  C  CZ    . ARG A 1 92  ? 15.401  16.174  59.950 1.00 38.29  ? 118 ARG A CZ    1 
ATOM   680  N  NH1   . ARG A 1 92  ? 14.515  16.248  60.931 1.00 32.84  ? 118 ARG A NH1   1 
ATOM   681  N  NH2   . ARG A 1 92  ? 15.009  16.368  58.698 1.00 33.53  ? 118 ARG A NH2   1 
ATOM   682  N  N     . ASP A 1 93  ? 21.062  15.367  58.604 1.00 42.50  ? 119 ASP A N     1 
ATOM   683  C  CA    . ASP A 1 93  ? 20.915  14.462  57.478 1.00 41.35  ? 119 ASP A CA    1 
ATOM   684  C  C     . ASP A 1 93  ? 22.206  14.334  56.681 1.00 43.61  ? 119 ASP A C     1 
ATOM   685  O  O     . ASP A 1 93  ? 22.228  13.730  55.612 1.00 55.55  ? 119 ASP A O     1 
ATOM   686  C  CB    . ASP A 1 93  ? 19.773  14.933  56.578 1.00 40.62  ? 119 ASP A CB    1 
ATOM   687  C  CG    . ASP A 1 93  ? 18.459  15.057  57.328 1.00 45.67  ? 119 ASP A CG    1 
ATOM   688  O  OD1   . ASP A 1 93  ? 18.190  14.205  58.206 1.00 39.38  ? 119 ASP A OD1   1 
ATOM   689  O  OD2   . ASP A 1 93  ? 17.702  16.013  57.051 1.00 44.06  ? 119 ASP A OD2   1 
ATOM   690  N  N     . ASN A 1 94  ? 23.282  14.897  57.211 1.00 41.00  ? 120 ASN A N     1 
ATOM   691  C  CA    . ASN A 1 94  ? 24.605  14.711  56.635 1.00 42.08  ? 120 ASN A CA    1 
ATOM   692  C  C     . ASN A 1 94  ? 25.636  14.770  57.750 1.00 52.41  ? 120 ASN A C     1 
ATOM   693  O  O     . ASN A 1 94  ? 26.163  15.840  58.058 1.00 52.37  ? 120 ASN A O     1 
ATOM   694  C  CB    . ASN A 1 94  ? 24.891  15.771  55.571 1.00 43.70  ? 120 ASN A CB    1 
ATOM   695  C  CG    . ASN A 1 94  ? 26.199  15.532  54.840 1.00 51.06  ? 120 ASN A CG    1 
ATOM   696  O  OD1   . ASN A 1 94  ? 26.924  14.578  55.127 1.00 49.07  ? 120 ASN A OD1   1 
ATOM   697  N  ND2   . ASN A 1 94  ? 26.508  16.406  53.885 1.00 57.53  ? 120 ASN A ND2   1 
ATOM   698  N  N     . PRO A 1 95  ? 25.921  13.611  58.367 1.00 56.33  ? 121 PRO A N     1 
ATOM   699  C  CA    . PRO A 1 95  ? 26.735  13.544  59.585 1.00 58.38  ? 121 PRO A CA    1 
ATOM   700  C  C     . PRO A 1 95  ? 28.204  13.837  59.318 1.00 61.32  ? 121 PRO A C     1 
ATOM   701  O  O     . PRO A 1 95  ? 28.973  14.047  60.258 1.00 59.59  ? 121 PRO A O     1 
ATOM   702  C  CB    . PRO A 1 95  ? 26.547  12.095  60.049 1.00 60.09  ? 121 PRO A CB    1 
ATOM   703  C  CG    . PRO A 1 95  ? 25.322  11.603  59.319 1.00 54.30  ? 121 PRO A CG    1 
ATOM   704  C  CD    . PRO A 1 95  ? 25.379  12.293  58.006 1.00 52.25  ? 121 PRO A CD    1 
ATOM   705  N  N     . GLU A 1 96  ? 28.585  13.854  58.044 1.00 54.19  ? 122 GLU A N     1 
ATOM   706  C  CA    . GLU A 1 96  ? 29.940  14.224  57.654 1.00 56.65  ? 122 GLU A CA    1 
ATOM   707  C  C     . GLU A 1 96  ? 30.216  15.714  57.895 1.00 62.99  ? 122 GLU A C     1 
ATOM   708  O  O     . GLU A 1 96  ? 31.318  16.202  57.638 1.00 66.02  ? 122 GLU A O     1 
ATOM   709  C  CB    . GLU A 1 96  ? 30.171  13.878  56.185 1.00 60.96  ? 122 GLU A CB    1 
ATOM   710  C  CG    . GLU A 1 96  ? 31.624  13.648  55.812 1.00 75.31  ? 122 GLU A CG    1 
ATOM   711  C  CD    . GLU A 1 96  ? 31.936  12.187  55.532 1.00 88.56  ? 122 GLU A CD    1 
ATOM   712  O  OE1   . GLU A 1 96  ? 30.988  11.370  55.490 1.00 96.08  ? 122 GLU A OE1   1 
ATOM   713  O  OE2   . GLU A 1 96  ? 33.132  11.862  55.350 1.00 94.95  ? 122 GLU A OE2   1 
ATOM   714  N  N     . LEU A 1 97  ? 29.212  16.431  58.395 1.00 62.77  ? 123 LEU A N     1 
ATOM   715  C  CA    . LEU A 1 97  ? 29.349  17.857  58.686 1.00 62.22  ? 123 LEU A CA    1 
ATOM   716  C  C     . LEU A 1 97  ? 29.270  18.167  60.180 1.00 66.96  ? 123 LEU A C     1 
ATOM   717  O  O     . LEU A 1 97  ? 29.670  19.249  60.612 1.00 65.89  ? 123 LEU A O     1 
ATOM   718  C  CB    . LEU A 1 97  ? 28.267  18.664  57.962 1.00 55.81  ? 123 LEU A CB    1 
ATOM   719  C  CG    . LEU A 1 97  ? 28.026  18.472  56.470 1.00 53.93  ? 123 LEU A CG    1 
ATOM   720  C  CD1   . LEU A 1 97  ? 26.706  19.121  56.079 1.00 51.36  ? 123 LEU A CD1   1 
ATOM   721  C  CD2   . LEU A 1 97  ? 29.168  19.058  55.665 1.00 60.52  ? 123 LEU A CD2   1 
ATOM   722  N  N     . LYS A 1 98  ? 28.750  17.213  60.952 1.00 69.05  ? 124 LYS A N     1 
ATOM   723  C  CA    . LYS A 1 98  ? 28.360  17.430  62.352 1.00 71.63  ? 124 LYS A CA    1 
ATOM   724  C  C     . LYS A 1 98  ? 29.400  18.168  63.205 1.00 72.73  ? 124 LYS A C     1 
ATOM   725  O  O     . LYS A 1 98  ? 29.041  18.953  64.088 1.00 69.84  ? 124 LYS A O     1 
ATOM   726  C  CB    . LYS A 1 98  ? 28.036  16.084  63.016 1.00 76.22  ? 124 LYS A CB    1 
ATOM   727  C  CG    . LYS A 1 98  ? 27.507  16.202  64.448 1.00 80.31  ? 124 LYS A CG    1 
ATOM   728  C  CD    . LYS A 1 98  ? 27.878  14.983  65.300 1.00 84.10  ? 124 LYS A CD    1 
ATOM   729  C  CE    . LYS A 1 98  ? 27.094  13.741  64.898 1.00 89.14  ? 124 LYS A CE    1 
ATOM   730  N  NZ    . LYS A 1 98  ? 27.495  12.541  65.691 1.00 80.29  ? 124 LYS A NZ    1 
ATOM   731  N  N     . ASP A 1 99  ? 30.681  17.937  62.920 1.00 73.13  ? 125 ASP A N     1 
ATOM   732  C  CA    . ASP A 1 99  ? 31.751  18.523  63.719 1.00 75.73  ? 125 ASP A CA    1 
ATOM   733  C  C     . ASP A 1 99  ? 32.510  19.628  62.980 1.00 78.30  ? 125 ASP A C     1 
ATOM   734  O  O     . ASP A 1 99  ? 33.615  20.001  63.378 1.00 80.99  ? 125 ASP A O     1 
ATOM   735  C  CB    . ASP A 1 99  ? 32.728  17.432  64.166 1.00 83.29  ? 125 ASP A CB    1 
ATOM   736  C  CG    . ASP A 1 99  ? 32.147  16.534  65.258 1.00 93.88  ? 125 ASP A CG    1 
ATOM   737  O  OD1   . ASP A 1 99  ? 31.056  16.860  65.785 1.00 92.59  ? 125 ASP A OD1   1 
ATOM   738  O  OD2   . ASP A 1 99  ? 32.785  15.505  65.587 1.00 97.32  ? 125 ASP A OD2   1 
ATOM   739  N  N     . LYS A 1 100 ? 31.919  20.147  61.908 1.00 74.72  ? 126 LYS A N     1 
ATOM   740  C  CA    . LYS A 1 100 ? 32.588  21.135  61.068 1.00 64.63  ? 126 LYS A CA    1 
ATOM   741  C  C     . LYS A 1 100 ? 31.820  22.451  61.057 1.00 61.82  ? 126 LYS A C     1 
ATOM   742  O  O     . LYS A 1 100 ? 30.627  22.483  61.359 1.00 58.99  ? 126 LYS A O     1 
ATOM   743  C  CB    . LYS A 1 100 ? 32.760  20.616  59.640 1.00 66.85  ? 126 LYS A CB    1 
ATOM   744  C  CG    . LYS A 1 100 ? 33.673  19.411  59.506 1.00 69.57  ? 126 LYS A CG    1 
ATOM   745  C  CD    . LYS A 1 100 ? 33.972  19.146  58.041 1.00 64.45  ? 126 LYS A CD    1 
ATOM   746  C  CE    . LYS A 1 100 ? 34.979  18.021  57.874 1.00 69.45  ? 126 LYS A CE    1 
ATOM   747  N  NZ    . LYS A 1 100 ? 35.377  17.851  56.442 1.00 72.44  ? 126 LYS A NZ    1 
ATOM   748  N  N     . PRO A 1 101 ? 32.510  23.555  60.736 1.00 63.24  ? 127 PRO A N     1 
ATOM   749  C  CA    . PRO A 1 101 ? 31.792  24.822  60.587 1.00 59.28  ? 127 PRO A CA    1 
ATOM   750  C  C     . PRO A 1 101 ? 31.084  24.912  59.233 1.00 57.03  ? 127 PRO A C     1 
ATOM   751  O  O     . PRO A 1 101 ? 31.724  24.822  58.185 1.00 61.53  ? 127 PRO A O     1 
ATOM   752  C  CB    . PRO A 1 101 ? 32.905  25.862  60.702 1.00 61.19  ? 127 PRO A CB    1 
ATOM   753  C  CG    . PRO A 1 101 ? 34.113  25.172  60.180 1.00 65.13  ? 127 PRO A CG    1 
ATOM   754  C  CD    . PRO A 1 101 ? 33.966  23.721  60.575 1.00 64.77  ? 127 PRO A CD    1 
ATOM   755  N  N     . ILE A 1 102 ? 29.767  25.087  59.260 1.00 51.99  ? 128 ILE A N     1 
ATOM   756  C  CA    . ILE A 1 102 ? 28.992  25.153  58.027 1.00 51.34  ? 128 ILE A CA    1 
ATOM   757  C  C     . ILE A 1 102 ? 28.089  26.375  58.010 1.00 46.84  ? 128 ILE A C     1 
ATOM   758  O  O     . ILE A 1 102 ? 27.799  26.966  59.052 1.00 48.64  ? 128 ILE A O     1 
ATOM   759  C  CB    . ILE A 1 102 ? 28.111  23.892  57.812 1.00 47.26  ? 128 ILE A CB    1 
ATOM   760  C  CG1   . ILE A 1 102 ? 26.966  23.843  58.826 1.00 40.22  ? 128 ILE A CG1   1 
ATOM   761  C  CG2   . ILE A 1 102 ? 28.954  22.619  57.846 1.00 47.29  ? 128 ILE A CG2   1 
ATOM   762  C  CD1   . ILE A 1 102 ? 25.662  23.340  58.250 1.00 29.28  ? 128 ILE A CD1   1 
ATOM   763  N  N     . ALA A 1 103 ? 27.649  26.749  56.816 1.00 41.12  ? 129 ALA A N     1 
ATOM   764  C  CA    . ALA A 1 103 ? 26.655  27.800  56.669 1.00 36.48  ? 129 ALA A CA    1 
ATOM   765  C  C     . ALA A 1 103 ? 25.645  27.436  55.589 1.00 38.95  ? 129 ALA A C     1 
ATOM   766  O  O     . ALA A 1 103 ? 26.018  26.955  54.520 1.00 44.20  ? 129 ALA A O     1 
ATOM   767  C  CB    . ALA A 1 103 ? 27.321  29.118  56.341 1.00 35.58  ? 129 ALA A CB    1 
ATOM   768  N  N     . VAL A 1 104 ? 24.366  27.650  55.873 1.00 33.66  ? 130 VAL A N     1 
ATOM   769  C  CA    . VAL A 1 104 ? 23.327  27.469  54.868 1.00 33.84  ? 130 VAL A CA    1 
ATOM   770  C  C     . VAL A 1 104 ? 23.088  28.777  54.114 1.00 35.26  ? 130 VAL A C     1 
ATOM   771  O  O     . VAL A 1 104 ? 22.695  29.798  54.710 1.00 42.16  ? 130 VAL A O     1 
ATOM   772  C  CB    . VAL A 1 104 ? 22.009  26.984  55.490 1.00 32.75  ? 130 VAL A CB    1 
ATOM   773  C  CG1   . VAL A 1 104 ? 20.914  26.904  54.442 1.00 31.30  ? 130 VAL A CG1   1 
ATOM   774  C  CG2   . VAL A 1 104 ? 22.198  25.635  56.147 1.00 28.11  ? 130 VAL A CG2   1 
ATOM   775  N  N     . GLY A 1 105 ? 23.343  28.732  52.806 1.00 35.08  ? 131 GLY A N     1 
ATOM   776  C  CA    . GLY A 1 105 ? 23.217  29.880  51.926 1.00 37.96  ? 131 GLY A CA    1 
ATOM   777  C  C     . GLY A 1 105 ? 23.945  29.661  50.606 1.00 36.05  ? 131 GLY A C     1 
ATOM   778  O  O     . GLY A 1 105 ? 24.097  28.525  50.159 1.00 35.65  ? 131 GLY A O     1 
ATOM   779  N  N     . SER A 1 106 ? 24.381  30.747  49.970 1.00 39.69  ? 132 SER A N     1 
ATOM   780  C  CA    . SER A 1 106 ? 25.169  30.660  48.740 1.00 40.54  ? 132 SER A CA    1 
ATOM   781  C  C     . SER A 1 106 ? 26.462  31.444  48.890 1.00 38.33  ? 132 SER A C     1 
ATOM   782  O  O     . SER A 1 106 ? 26.894  31.738  50.000 1.00 37.69  ? 132 SER A O     1 
ATOM   783  C  CB    . SER A 1 106 ? 24.384  31.184  47.533 1.00 44.56  ? 132 SER A CB    1 
ATOM   784  O  OG    . SER A 1 106 ? 23.856  32.480  47.772 1.00 42.62  ? 132 SER A OG    1 
ATOM   785  N  N     . MET A 1 107 ? 27.070  31.801  47.767 1.00 43.69  ? 133 MET A N     1 
ATOM   786  C  CA    . MET A 1 107 ? 28.245  32.648  47.801 1.00 39.40  ? 133 MET A CA    1 
ATOM   787  C  C     . MET A 1 107 ? 27.801  34.090  48.008 1.00 49.97  ? 133 MET A C     1 
ATOM   788  O  O     . MET A 1 107 ? 28.525  34.899  48.587 1.00 50.32  ? 133 MET A O     1 
ATOM   789  C  CB    . MET A 1 107 ? 29.047  32.499  46.513 1.00 42.46  ? 133 MET A CB    1 
ATOM   790  C  CG    . MET A 1 107 ? 30.540  32.676  46.698 1.00 50.36  ? 133 MET A CG    1 
ATOM   791  S  SD    . MET A 1 107 ? 31.193  31.611  47.995 1.00 48.71  ? 133 MET A SD    1 
ATOM   792  C  CE    . MET A 1 107 ? 32.915  32.102  47.990 1.00 58.43  ? 133 MET A CE    1 
ATOM   793  N  N     . SER A 1 108 ? 26.595  34.397  47.538 1.00 48.41  ? 134 SER A N     1 
ATOM   794  C  CA    . SER A 1 108 ? 26.039  35.739  47.638 1.00 35.24  ? 134 SER A CA    1 
ATOM   795  C  C     . SER A 1 108 ? 25.605  36.065  49.058 1.00 39.60  ? 134 SER A C     1 
ATOM   796  O  O     . SER A 1 108 ? 25.960  37.110  49.593 1.00 49.70  ? 134 SER A O     1 
ATOM   797  C  CB    . SER A 1 108 ? 24.856  35.902  46.688 1.00 38.40  ? 134 SER A CB    1 
ATOM   798  O  OG    . SER A 1 108 ? 25.110  35.261  45.455 1.00 60.11  ? 134 SER A OG    1 
ATOM   799  N  N     . MET A 1 109 ? 24.817  35.182  49.661 1.00 39.26  ? 135 MET A N     1 
ATOM   800  C  CA    . MET A 1 109 ? 24.250  35.459  50.976 1.00 38.02  ? 135 MET A CA    1 
ATOM   801  C  C     . MET A 1 109 ? 24.062  34.205  51.813 1.00 38.97  ? 135 MET A C     1 
ATOM   802  O  O     . MET A 1 109 ? 23.748  33.147  51.282 1.00 41.35  ? 135 MET A O     1 
ATOM   803  C  CB    . MET A 1 109 ? 22.908  36.184  50.819 1.00 40.49  ? 135 MET A CB    1 
ATOM   804  C  CG    . MET A 1 109 ? 22.323  36.731  52.110 1.00 32.53  ? 135 MET A CG    1 
ATOM   805  S  SD    . MET A 1 109 ? 23.372  37.980  52.859 1.00 34.37  ? 135 MET A SD    1 
ATOM   806  C  CE    . MET A 1 109 ? 23.830  38.958  51.428 1.00 40.00  ? 135 MET A CE    1 
ATOM   807  N  N     . LEU A 1 110 ? 24.221  34.342  53.128 1.00 37.76  ? 136 LEU A N     1 
ATOM   808  C  CA    . LEU A 1 110 ? 24.018  33.227  54.045 1.00 40.64  ? 136 LEU A CA    1 
ATOM   809  C  C     . LEU A 1 110 ? 22.725  33.372  54.839 1.00 41.03  ? 136 LEU A C     1 
ATOM   810  O  O     . LEU A 1 110 ? 22.522  34.367  55.539 1.00 33.29  ? 136 LEU A O     1 
ATOM   811  C  CB    . LEU A 1 110 ? 25.200  33.099  55.012 1.00 43.02  ? 136 LEU A CB    1 
ATOM   812  C  CG    . LEU A 1 110 ? 26.581  32.815  54.418 1.00 39.82  ? 136 LEU A CG    1 
ATOM   813  C  CD1   . LEU A 1 110 ? 27.591  32.651  55.531 1.00 30.24  ? 136 LEU A CD1   1 
ATOM   814  C  CD2   . LEU A 1 110 ? 26.560  31.588  53.521 1.00 40.61  ? 136 LEU A CD2   1 
ATOM   815  N  N     . SER A 1 111 ? 21.851  32.377  54.708 1.00 45.35  ? 137 SER A N     1 
ATOM   816  C  CA    . SER A 1 111 ? 20.655  32.282  55.534 1.00 42.77  ? 137 SER A CA    1 
ATOM   817  C  C     . SER A 1 111 ? 21.022  32.099  57.000 1.00 42.09  ? 137 SER A C     1 
ATOM   818  O  O     . SER A 1 111 ? 20.433  32.737  57.874 1.00 38.14  ? 137 SER A O     1 
ATOM   819  C  CB    . SER A 1 111 ? 19.759  31.135  55.066 1.00 39.61  ? 137 SER A CB    1 
ATOM   820  O  OG    . SER A 1 111 ? 19.006  31.512  53.924 1.00 53.62  ? 137 SER A OG    1 
ATOM   821  N  N     . THR A 1 112 ? 21.999  31.234  57.269 1.00 41.49  ? 138 THR A N     1 
ATOM   822  C  CA    . THR A 1 112 ? 22.408  31.004  58.654 1.00 34.17  ? 138 THR A CA    1 
ATOM   823  C  C     . THR A 1 112 ? 23.696  30.208  58.753 1.00 36.10  ? 138 THR A C     1 
ATOM   824  O  O     . THR A 1 112 ? 24.278  29.842  57.741 1.00 43.95  ? 138 THR A O     1 
ATOM   825  C  CB    . THR A 1 112 ? 21.307  30.261  59.440 1.00 36.35  ? 138 THR A CB    1 
ATOM   826  O  OG1   . THR A 1 112 ? 21.577  30.345  60.841 1.00 43.12  ? 138 THR A OG1   1 
ATOM   827  C  CG2   . THR A 1 112 ? 21.235  28.803  59.023 1.00 31.18  ? 138 THR A CG2   1 
ATOM   828  N  N     . SER A 1 113 ? 24.149  29.962  59.977 1.00 36.32  ? 139 SER A N     1 
ATOM   829  C  CA    . SER A 1 113 ? 25.384  29.218  60.204 1.00 44.85  ? 139 SER A CA    1 
ATOM   830  C  C     . SER A 1 113 ? 25.285  28.431  61.501 1.00 45.16  ? 139 SER A C     1 
ATOM   831  O  O     . SER A 1 113 ? 24.495  28.784  62.377 1.00 45.83  ? 139 SER A O     1 
ATOM   832  C  CB    . SER A 1 113 ? 26.584  30.167  60.245 1.00 47.81  ? 139 SER A CB    1 
ATOM   833  O  OG    . SER A 1 113 ? 26.315  31.278  61.081 1.00 47.26  ? 139 SER A OG    1 
ATOM   834  N  N     . ASN A 1 114 ? 26.080  27.375  61.646 1.00 46.69  ? 140 ASN A N     1 
ATOM   835  C  CA    . ASN A 1 114 ? 26.101  26.677  62.928 1.00 50.56  ? 140 ASN A CA    1 
ATOM   836  C  C     . ASN A 1 114 ? 26.973  27.454  63.909 1.00 52.66  ? 140 ASN A C     1 
ATOM   837  O  O     . ASN A 1 114 ? 27.716  28.349  63.507 1.00 54.86  ? 140 ASN A O     1 
ATOM   838  C  CB    . ASN A 1 114 ? 26.571  25.217  62.784 1.00 47.32  ? 140 ASN A CB    1 
ATOM   839  C  CG    . ASN A 1 114 ? 27.997  25.086  62.264 1.00 53.63  ? 140 ASN A CG    1 
ATOM   840  O  OD1   . ASN A 1 114 ? 28.732  26.064  62.150 1.00 55.01  ? 140 ASN A OD1   1 
ATOM   841  N  ND2   . ASN A 1 114 ? 28.399  23.853  61.967 1.00 51.49  ? 140 ASN A ND2   1 
ATOM   842  N  N     . TYR A 1 115 ? 26.877  27.115  65.191 1.00 54.49  ? 141 TYR A N     1 
ATOM   843  C  CA    . TYR A 1 115 ? 27.602  27.828  66.238 1.00 49.83  ? 141 TYR A CA    1 
ATOM   844  C  C     . TYR A 1 115 ? 29.097  27.602  66.052 1.00 54.95  ? 141 TYR A C     1 
ATOM   845  O  O     . TYR A 1 115 ? 29.938  28.494  66.279 1.00 61.64  ? 141 TYR A O     1 
ATOM   846  C  CB    . TYR A 1 115 ? 27.132  27.347  67.607 1.00 46.84  ? 141 TYR A CB    1 
ATOM   847  C  CG    . TYR A 1 115 ? 25.728  27.800  67.951 1.00 54.99  ? 141 TYR A CG    1 
ATOM   848  C  CD1   . TYR A 1 115 ? 24.633  27.343  67.226 1.00 48.75  ? 141 TYR A CD1   1 
ATOM   849  C  CD2   . TYR A 1 115 ? 25.495  28.683  69.003 1.00 58.30  ? 141 TYR A CD2   1 
ATOM   850  C  CE1   . TYR A 1 115 ? 23.349  27.754  67.534 1.00 46.71  ? 141 TYR A CE1   1 
ATOM   851  C  CE2   . TYR A 1 115 ? 24.210  29.101  69.322 1.00 50.96  ? 141 TYR A CE2   1 
ATOM   852  C  CZ    . TYR A 1 115 ? 23.143  28.632  68.584 1.00 48.40  ? 141 TYR A CZ    1 
ATOM   853  O  OH    . TYR A 1 115 ? 21.864  29.039  68.891 1.00 46.09  ? 141 TYR A OH    1 
ATOM   854  N  N     . HIS A 1 116 ? 29.392  26.403  65.565 1.00 56.12  ? 142 HIS A N     1 
ATOM   855  C  CA    A HIS A 1 116 ? 30.754  25.990  65.275 0.70 57.47  ? 142 HIS A CA    1 
ATOM   856  C  CA    B HIS A 1 116 ? 30.746  25.973  65.267 0.30 57.47  ? 142 HIS A CA    1 
ATOM   857  C  C     . HIS A 1 116 ? 31.421  26.972  64.323 1.00 61.72  ? 142 HIS A C     1 
ATOM   858  O  O     . HIS A 1 116 ? 32.622  27.222  64.422 1.00 65.41  ? 142 HIS A O     1 
ATOM   859  C  CB    A HIS A 1 116 ? 30.766  24.590  64.680 0.70 57.49  ? 142 HIS A CB    1 
ATOM   860  C  CB    B HIS A 1 116 ? 30.730  24.569  64.652 0.30 57.46  ? 142 HIS A CB    1 
ATOM   861  C  CG    A HIS A 1 116 ? 31.886  23.732  65.172 0.70 64.71  ? 142 HIS A CG    1 
ATOM   862  C  CG    B HIS A 1 116 ? 29.687  23.663  65.219 0.30 57.42  ? 142 HIS A CG    1 
ATOM   863  N  ND1   A HIS A 1 116 ? 33.147  24.227  65.445 0.70 66.62  ? 142 HIS A ND1   1 
ATOM   864  N  ND1   B HIS A 1 116 ? 28.329  23.960  65.191 0.30 53.18  ? 142 HIS A ND1   1 
ATOM   865  C  CD2   A HIS A 1 116 ? 31.939  22.408  65.446 0.70 68.04  ? 142 HIS A CD2   1 
ATOM   866  C  CD2   B HIS A 1 116 ? 29.769  22.452  65.820 0.30 60.13  ? 142 HIS A CD2   1 
ATOM   867  C  CE1   A HIS A 1 116 ? 33.922  23.245  65.863 0.70 73.22  ? 142 HIS A CE1   1 
ATOM   868  C  CE1   B HIS A 1 116 ? 27.648  22.993  65.750 0.30 53.48  ? 142 HIS A CE1   1 
ATOM   869  N  NE2   A HIS A 1 116 ? 33.213  22.127  65.873 0.70 73.12  ? 142 HIS A NE2   1 
ATOM   870  N  NE2   B HIS A 1 116 ? 28.504  22.051  66.145 0.30 57.50  ? 142 HIS A NE2   1 
ATOM   871  N  N     . ALA A 1 117 ? 30.629  27.546  63.416 1.00 57.07  ? 143 ALA A N     1 
ATOM   872  C  CA    . ALA A 1 117 ? 31.120  28.553  62.479 1.00 56.21  ? 143 ALA A CA    1 
ATOM   873  C  C     . ALA A 1 117 ? 30.843  29.949  63.010 1.00 55.86  ? 143 ALA A C     1 
ATOM   874  O  O     . ALA A 1 117 ? 31.546  30.897  62.665 1.00 59.50  ? 143 ALA A O     1 
ATOM   875  C  CB    . ALA A 1 117 ? 30.481  28.377  61.108 1.00 52.88  ? 143 ALA A CB    1 
ATOM   876  N  N     . ARG A 1 118 ? 29.819  30.068  63.853 1.00 52.52  ? 144 ARG A N     1 
ATOM   877  C  CA    . ARG A 1 118 ? 29.490  31.345  64.481 1.00 53.63  ? 144 ARG A CA    1 
ATOM   878  C  C     . ARG A 1 118 ? 30.648  31.799  65.373 1.00 62.84  ? 144 ARG A C     1 
ATOM   879  O  O     . ARG A 1 118 ? 30.713  32.960  65.771 1.00 66.73  ? 144 ARG A O     1 
ATOM   880  C  CB    . ARG A 1 118 ? 28.205  31.246  65.305 1.00 50.53  ? 144 ARG A CB    1 
ATOM   881  C  CG    . ARG A 1 118 ? 26.918  31.623  64.582 1.00 46.79  ? 144 ARG A CG    1 
ATOM   882  C  CD    . ARG A 1 118 ? 25.697  31.187  65.399 1.00 38.92  ? 144 ARG A CD    1 
ATOM   883  N  NE    . ARG A 1 118 ? 24.569  30.773  64.564 1.00 40.70  ? 144 ARG A NE    1 
ATOM   884  C  CZ    . ARG A 1 118 ? 23.288  30.891  64.907 1.00 38.08  ? 144 ARG A CZ    1 
ATOM   885  N  NH1   . ARG A 1 118 ? 22.956  31.403  66.080 1.00 30.20  ? 144 ARG A NH1   1 
ATOM   886  N  NH2   . ARG A 1 118 ? 22.333  30.485  64.080 1.00 40.66  ? 144 ARG A NH2   1 
ATOM   887  N  N     . ARG A 1 119 ? 31.575  30.886  65.665 1.00 67.92  ? 145 ARG A N     1 
ATOM   888  C  CA    . ARG A 1 119 ? 32.757  31.241  66.454 1.00 60.52  ? 145 ARG A CA    1 
ATOM   889  C  C     . ARG A 1 119 ? 33.789  32.006  65.627 1.00 61.89  ? 145 ARG A C     1 
ATOM   890  O  O     . ARG A 1 119 ? 34.747  32.550  66.172 1.00 66.75  ? 145 ARG A O     1 
ATOM   891  C  CB    . ARG A 1 119 ? 33.434  29.998  67.012 1.00 59.37  ? 145 ARG A CB    1 
ATOM   892  C  CG    . ARG A 1 119 ? 32.827  29.413  68.257 1.00 70.25  ? 145 ARG A CG    1 
ATOM   893  C  CD    . ARG A 1 119 ? 33.311  27.973  68.366 1.00 77.93  ? 145 ARG A CD    1 
ATOM   894  N  NE    . ARG A 1 119 ? 33.278  27.426  69.720 1.00 88.96  ? 145 ARG A NE    1 
ATOM   895  C  CZ    . ARG A 1 119 ? 33.645  26.182  70.015 1.00 93.96  ? 145 ARG A CZ    1 
ATOM   896  N  NH1   . ARG A 1 119 ? 34.062  25.377  69.045 1.00 88.56  ? 145 ARG A NH1   1 
ATOM   897  N  NH2   . ARG A 1 119 ? 33.598  25.742  71.269 1.00 90.42  ? 145 ARG A NH2   1 
ATOM   898  N  N     . PHE A 1 120 ? 33.587  32.057  64.314 1.00 63.12  ? 146 PHE A N     1 
ATOM   899  C  CA    . PHE A 1 120 ? 34.483  32.795  63.429 1.00 64.47  ? 146 PHE A CA    1 
ATOM   900  C  C     . PHE A 1 120 ? 33.859  34.109  63.012 1.00 67.45  ? 146 PHE A C     1 
ATOM   901  O  O     . PHE A 1 120 ? 34.381  34.797  62.134 1.00 69.89  ? 146 PHE A O     1 
ATOM   902  C  CB    . PHE A 1 120 ? 34.821  31.975  62.178 1.00 69.82  ? 146 PHE A CB    1 
ATOM   903  C  CG    . PHE A 1 120 ? 35.617  30.731  62.454 1.00 73.25  ? 146 PHE A CG    1 
ATOM   904  C  CD1   . PHE A 1 120 ? 35.042  29.649  63.104 1.00 74.49  ? 146 PHE A CD1   1 
ATOM   905  C  CD2   . PHE A 1 120 ? 36.939  30.638  62.042 1.00 72.43  ? 146 PHE A CD2   1 
ATOM   906  C  CE1   . PHE A 1 120 ? 35.774  28.506  63.360 1.00 77.14  ? 146 PHE A CE1   1 
ATOM   907  C  CE2   . PHE A 1 120 ? 37.674  29.500  62.289 1.00 81.27  ? 146 PHE A CE2   1 
ATOM   908  C  CZ    . PHE A 1 120 ? 37.092  28.432  62.951 1.00 82.42  ? 146 PHE A CZ    1 
ATOM   909  N  N     . GLY A 1 121 ? 32.741  34.453  63.645 1.00 63.34  ? 147 GLY A N     1 
ATOM   910  C  CA    . GLY A 1 121 ? 32.037  35.682  63.336 1.00 58.35  ? 147 GLY A CA    1 
ATOM   911  C  C     . GLY A 1 121 ? 31.109  35.469  62.158 1.00 64.81  ? 147 GLY A C     1 
ATOM   912  O  O     . GLY A 1 121 ? 30.386  36.379  61.753 1.00 65.87  ? 147 GLY A O     1 
ATOM   913  N  N     . VAL A 1 122 ? 31.145  34.258  61.605 1.00 64.56  ? 148 VAL A N     1 
ATOM   914  C  CA    . VAL A 1 122 ? 30.281  33.874  60.498 1.00 55.32  ? 148 VAL A CA    1 
ATOM   915  C  C     . VAL A 1 122 ? 28.828  33.817  60.954 1.00 52.37  ? 148 VAL A C     1 
ATOM   916  O  O     . VAL A 1 122 ? 28.479  33.022  61.823 1.00 56.20  ? 148 VAL A O     1 
ATOM   917  C  CB    . VAL A 1 122 ? 30.692  32.504  59.924 1.00 53.12  ? 148 VAL A CB    1 
ATOM   918  C  CG1   . VAL A 1 122 ? 29.626  31.984  58.981 1.00 52.96  ? 148 VAL A CG1   1 
ATOM   919  C  CG2   . VAL A 1 122 ? 32.043  32.598  59.223 1.00 57.38  ? 148 VAL A CG2   1 
ATOM   920  N  N     . ARG A 1 123 ? 27.981  34.655  60.363 1.00 51.65  ? 149 ARG A N     1 
ATOM   921  C  CA    . ARG A 1 123 ? 26.593  34.774  60.809 1.00 49.62  ? 149 ARG A CA    1 
ATOM   922  C  C     . ARG A 1 123 ? 25.617  35.008  59.662 1.00 50.40  ? 149 ARG A C     1 
ATOM   923  O  O     . ARG A 1 123 ? 26.018  35.328  58.542 1.00 48.24  ? 149 ARG A O     1 
ATOM   924  C  CB    . ARG A 1 123 ? 26.466  35.897  61.843 1.00 53.71  ? 149 ARG A CB    1 
ATOM   925  C  CG    . ARG A 1 123 ? 27.106  35.540  63.173 1.00 65.29  ? 149 ARG A CG    1 
ATOM   926  C  CD    . ARG A 1 123 ? 27.162  36.689  64.159 1.00 70.25  ? 149 ARG A CD    1 
ATOM   927  N  NE    . ARG A 1 123 ? 27.972  36.324  65.320 1.00 72.65  ? 149 ARG A NE    1 
ATOM   928  C  CZ    . ARG A 1 123 ? 27.548  35.564  66.326 1.00 73.58  ? 149 ARG A CZ    1 
ATOM   929  N  NH1   . ARG A 1 123 ? 26.309  35.085  66.324 1.00 67.77  ? 149 ARG A NH1   1 
ATOM   930  N  NH2   . ARG A 1 123 ? 28.364  35.282  67.335 1.00 75.33  ? 149 ARG A NH2   1 
ATOM   931  N  N     . ALA A 1 124 ? 24.332  34.823  59.951 1.00 43.29  ? 150 ALA A N     1 
ATOM   932  C  CA    . ALA A 1 124 ? 23.265  35.131  59.006 1.00 38.15  ? 150 ALA A CA    1 
ATOM   933  C  C     . ALA A 1 124 ? 23.385  36.552  58.460 1.00 43.54  ? 150 ALA A C     1 
ATOM   934  O  O     . ALA A 1 124 ? 24.006  37.420  59.082 1.00 44.25  ? 150 ALA A O     1 
ATOM   935  C  CB    . ALA A 1 124 ? 21.912  34.940  59.661 1.00 35.51  ? 150 ALA A CB    1 
ATOM   936  N  N     . ALA A 1 125 ? 22.805  36.763  57.281 1.00 43.10  ? 151 ALA A N     1 
ATOM   937  C  CA    . ALA A 1 125 ? 22.771  38.062  56.615 1.00 34.88  ? 151 ALA A CA    1 
ATOM   938  C  C     . ALA A 1 125 ? 24.161  38.535  56.186 1.00 40.09  ? 151 ALA A C     1 
ATOM   939  O  O     . ALA A 1 125 ? 24.326  39.665  55.727 1.00 45.33  ? 151 ALA A O     1 
ATOM   940  C  CB    . ALA A 1 125 ? 22.103  39.099  57.508 1.00 33.63  ? 151 ALA A CB    1 
ATOM   941  N  N     . MET A 1 126 ? 25.152  37.661  56.326 1.00 40.45  ? 152 MET A N     1 
ATOM   942  C  CA    . MET A 1 126 ? 26.498  37.937  55.835 1.00 39.84  ? 152 MET A CA    1 
ATOM   943  C  C     . MET A 1 126 ? 26.739  37.231  54.509 1.00 43.38  ? 152 MET A C     1 
ATOM   944  O  O     . MET A 1 126 ? 26.371  36.067  54.349 1.00 43.44  ? 152 MET A O     1 
ATOM   945  C  CB    . MET A 1 126 ? 27.544  37.502  56.860 1.00 40.53  ? 152 MET A CB    1 
ATOM   946  C  CG    . MET A 1 126 ? 28.969  37.530  56.345 1.00 42.20  ? 152 MET A CG    1 
ATOM   947  S  SD    . MET A 1 126 ? 30.145  36.939  57.570 1.00 60.80  ? 152 MET A SD    1 
ATOM   948  C  CE    . MET A 1 126 ? 29.613  37.865  59.008 1.00 53.21  ? 152 MET A CE    1 
ATOM   949  N  N     . PRO A 1 127 ? 27.352  37.933  53.546 1.00 45.58  ? 153 PRO A N     1 
ATOM   950  C  CA    . PRO A 1 127 ? 27.702  37.321  52.260 1.00 44.42  ? 153 PRO A CA    1 
ATOM   951  C  C     . PRO A 1 127 ? 28.638  36.122  52.425 1.00 45.94  ? 153 PRO A C     1 
ATOM   952  O  O     . PRO A 1 127 ? 29.511  36.135  53.290 1.00 43.75  ? 153 PRO A O     1 
ATOM   953  C  CB    . PRO A 1 127 ? 28.395  38.461  51.506 1.00 41.91  ? 153 PRO A CB    1 
ATOM   954  C  CG    . PRO A 1 127 ? 27.857  39.698  52.125 1.00 46.09  ? 153 PRO A CG    1 
ATOM   955  C  CD    . PRO A 1 127 ? 27.668  39.371  53.576 1.00 42.19  ? 153 PRO A CD    1 
ATOM   956  N  N     . GLY A 1 128 ? 28.437  35.093  51.607 1.00 45.09  ? 154 GLY A N     1 
ATOM   957  C  CA    . GLY A 1 128 ? 29.264  33.902  51.647 1.00 47.40  ? 154 GLY A CA    1 
ATOM   958  C  C     . GLY A 1 128 ? 30.754  34.142  51.487 1.00 52.40  ? 154 GLY A C     1 
ATOM   959  O  O     . GLY A 1 128 ? 31.548  33.718  52.328 1.00 62.13  ? 154 GLY A O     1 
ATOM   960  N  N     . PHE A 1 129 ? 31.137  34.830  50.416 1.00 54.02  ? 155 PHE A N     1 
ATOM   961  C  CA    . PHE A 1 129 ? 32.552  35.042  50.115 1.00 61.31  ? 155 PHE A CA    1 
ATOM   962  C  C     . PHE A 1 129 ? 33.306  35.744  51.248 1.00 62.15  ? 155 PHE A C     1 
ATOM   963  O  O     . PHE A 1 129 ? 34.515  35.577  51.382 1.00 66.38  ? 155 PHE A O     1 
ATOM   964  C  CB    . PHE A 1 129 ? 32.719  35.811  48.791 1.00 64.96  ? 155 PHE A CB    1 
ATOM   965  C  CG    . PHE A 1 129 ? 32.233  37.242  48.820 1.00 68.82  ? 155 PHE A CG    1 
ATOM   966  C  CD1   . PHE A 1 129 ? 33.133  38.291  48.950 1.00 72.79  ? 155 PHE A CD1   1 
ATOM   967  C  CD2   . PHE A 1 129 ? 30.886  37.542  48.674 1.00 68.86  ? 155 PHE A CD2   1 
ATOM   968  C  CE1   . PHE A 1 129 ? 32.696  39.612  48.956 1.00 64.57  ? 155 PHE A CE1   1 
ATOM   969  C  CE2   . PHE A 1 129 ? 30.443  38.863  48.678 1.00 61.30  ? 155 PHE A CE2   1 
ATOM   970  C  CZ    . PHE A 1 129 ? 31.350  39.895  48.822 1.00 56.67  ? 155 PHE A CZ    1 
ATOM   971  N  N     . ILE A 1 130 ? 32.594  36.521  52.059 1.00 55.48  ? 156 ILE A N     1 
ATOM   972  C  CA    . ILE A 1 130 ? 33.194  37.168  53.225 1.00 56.52  ? 156 ILE A CA    1 
ATOM   973  C  C     . ILE A 1 130 ? 33.370  36.161  54.355 1.00 60.66  ? 156 ILE A C     1 
ATOM   974  O  O     . ILE A 1 130 ? 34.426  36.088  54.991 1.00 60.96  ? 156 ILE A O     1 
ATOM   975  C  CB    . ILE A 1 130 ? 32.332  38.344  53.730 1.00 57.92  ? 156 ILE A CB    1 
ATOM   976  C  CG1   . ILE A 1 130 ? 32.166  39.396  52.637 1.00 60.91  ? 156 ILE A CG1   1 
ATOM   977  C  CG2   . ILE A 1 130 ? 32.933  38.958  54.987 1.00 58.87  ? 156 ILE A CG2   1 
ATOM   978  C  CD1   . ILE A 1 130 ? 31.319  40.570  53.058 1.00 57.59  ? 156 ILE A CD1   1 
ATOM   979  N  N     . ALA A 1 131 ? 32.318  35.383  54.590 1.00 57.21  ? 157 ALA A N     1 
ATOM   980  C  CA    . ALA A 1 131 ? 32.327  34.347  55.610 1.00 58.84  ? 157 ALA A CA    1 
ATOM   981  C  C     . ALA A 1 131 ? 33.440  33.335  55.369 1.00 65.45  ? 157 ALA A C     1 
ATOM   982  O  O     . ALA A 1 131 ? 33.973  32.752  56.316 1.00 70.94  ? 157 ALA A O     1 
ATOM   983  C  CB    . ALA A 1 131 ? 30.988  33.654  55.658 1.00 57.88  ? 157 ALA A CB    1 
ATOM   984  N  N     . LYS A 1 132 ? 33.773  33.111  54.101 1.00 59.46  ? 158 LYS A N     1 
ATOM   985  C  CA    . LYS A 1 132 ? 34.865  32.203  53.763 1.00 68.36  ? 158 LYS A CA    1 
ATOM   986  C  C     . LYS A 1 132 ? 36.217  32.888  53.965 1.00 70.05  ? 158 LYS A C     1 
ATOM   987  O  O     . LYS A 1 132 ? 37.261  32.241  53.926 1.00 74.73  ? 158 LYS A O     1 
ATOM   988  C  CB    . LYS A 1 132 ? 34.730  31.685  52.328 1.00 69.36  ? 158 LYS A CB    1 
ATOM   989  C  CG    . LYS A 1 132 ? 33.719  30.553  52.175 1.00 61.77  ? 158 LYS A CG    1 
ATOM   990  C  CD    . LYS A 1 132 ? 33.772  29.942  50.785 1.00 65.13  ? 158 LYS A CD    1 
ATOM   991  C  CE    . LYS A 1 132 ? 34.625  28.683  50.751 1.00 71.40  ? 158 LYS A CE    1 
ATOM   992  N  NZ    . LYS A 1 132 ? 34.060  27.607  51.614 1.00 77.42  ? 158 LYS A NZ    1 
ATOM   993  N  N     . ARG A 1 133 ? 36.198  34.202  54.163 1.00 67.15  ? 159 ARG A N     1 
ATOM   994  C  CA    . ARG A 1 133 ? 37.426  34.925  54.486 1.00 66.47  ? 159 ARG A CA    1 
ATOM   995  C  C     . ARG A 1 133 ? 37.575  35.066  55.998 1.00 66.61  ? 159 ARG A C     1 
ATOM   996  O  O     . ARG A 1 133 ? 38.680  35.282  56.495 1.00 72.56  ? 159 ARG A O     1 
ATOM   997  C  CB    . ARG A 1 133 ? 37.473  36.290  53.801 1.00 71.19  ? 159 ARG A CB    1 
ATOM   998  C  CG    . ARG A 1 133 ? 37.968  36.212  52.359 1.00 78.43  ? 159 ARG A CG    1 
ATOM   999  C  CD    . ARG A 1 133 ? 38.116  37.594  51.726 1.00 87.43  ? 159 ARG A CD    1 
ATOM   1000 N  NE    . ARG A 1 133 ? 39.291  37.658  50.856 1.00 99.29  ? 159 ARG A NE    1 
ATOM   1001 C  CZ    . ARG A 1 133 ? 39.561  38.657  50.020 1.00 99.48  ? 159 ARG A CZ    1 
ATOM   1002 N  NH1   . ARG A 1 133 ? 38.726  39.683  49.913 1.00 89.23  ? 159 ARG A NH1   1 
ATOM   1003 N  NH2   . ARG A 1 133 ? 40.662  38.619  49.275 1.00 100.02 ? 159 ARG A NH2   1 
ATOM   1004 N  N     . LEU A 1 134 ? 36.467  34.948  56.728 1.00 65.26  ? 160 LEU A N     1 
ATOM   1005 C  CA    . LEU A 1 134 ? 36.533  34.794  58.183 1.00 67.36  ? 160 LEU A CA    1 
ATOM   1006 C  C     . LEU A 1 134 ? 36.924  33.367  58.541 1.00 70.01  ? 160 LEU A C     1 
ATOM   1007 O  O     . LEU A 1 134 ? 37.449  33.102  59.623 1.00 70.39  ? 160 LEU A O     1 
ATOM   1008 C  CB    . LEU A 1 134 ? 35.191  35.121  58.842 1.00 66.47  ? 160 LEU A CB    1 
ATOM   1009 C  CG    . LEU A 1 134 ? 34.577  36.513  58.782 1.00 65.08  ? 160 LEU A CG    1 
ATOM   1010 C  CD1   . LEU A 1 134 ? 33.320  36.543  59.625 1.00 59.64  ? 160 LEU A CD1   1 
ATOM   1011 C  CD2   . LEU A 1 134 ? 35.568  37.526  59.304 1.00 70.61  ? 160 LEU A CD2   1 
ATOM   1012 N  N     . CYS A 1 135 ? 36.677  32.458  57.603 1.00 71.58  ? 161 CYS A N     1 
ATOM   1013 C  CA    . CYS A 1 135 ? 36.800  31.028  57.843 1.00 68.53  ? 161 CYS A CA    1 
ATOM   1014 C  C     . CYS A 1 135 ? 36.873  30.287  56.511 1.00 71.80  ? 161 CYS A C     1 
ATOM   1015 O  O     . CYS A 1 135 ? 35.845  29.936  55.937 1.00 68.49  ? 161 CYS A O     1 
ATOM   1016 C  CB    . CYS A 1 135 ? 35.617  30.532  58.679 1.00 64.64  ? 161 CYS A CB    1 
ATOM   1017 S  SG    . CYS A 1 135 ? 35.485  28.744  58.843 1.00 84.06  ? 161 CYS A SG    1 
ATOM   1018 N  N     . PRO A 1 136 ? 38.094  30.051  56.009 1.00 76.71  ? 162 PRO A N     1 
ATOM   1019 C  CA    . PRO A 1 136 ? 38.283  29.435  54.689 1.00 73.74  ? 162 PRO A CA    1 
ATOM   1020 C  C     . PRO A 1 136 ? 37.918  27.951  54.651 1.00 75.44  ? 162 PRO A C     1 
ATOM   1021 O  O     . PRO A 1 136 ? 37.727  27.394  53.567 1.00 69.77  ? 162 PRO A O     1 
ATOM   1022 C  CB    . PRO A 1 136 ? 39.779  29.640  54.422 1.00 69.84  ? 162 PRO A CB    1 
ATOM   1023 C  CG    . PRO A 1 136 ? 40.391  29.737  55.775 1.00 76.49  ? 162 PRO A CG    1 
ATOM   1024 C  CD    . PRO A 1 136 ? 39.372  30.416  56.645 1.00 77.24  ? 162 PRO A CD    1 
ATOM   1025 N  N     . GLN A 1 137 ? 37.810  27.321  55.816 1.00 71.28  ? 163 GLN A N     1 
ATOM   1026 C  CA    . GLN A 1 137 ? 37.456  25.906  55.870 1.00 74.96  ? 163 GLN A CA    1 
ATOM   1027 C  C     . GLN A 1 137 ? 35.942  25.724  55.883 1.00 71.73  ? 163 GLN A C     1 
ATOM   1028 O  O     . GLN A 1 137 ? 35.437  24.627  56.121 1.00 69.89  ? 163 GLN A O     1 
ATOM   1029 C  CB    . GLN A 1 137 ? 38.073  25.232  57.097 1.00 80.39  ? 163 GLN A CB    1 
ATOM   1030 C  CG    . GLN A 1 137 ? 37.549  25.751  58.427 1.00 79.85  ? 163 GLN A CG    1 
ATOM   1031 C  CD    . GLN A 1 137 ? 38.500  26.733  59.094 1.00 81.71  ? 163 GLN A CD    1 
ATOM   1032 O  OE1   . GLN A 1 137 ? 39.416  27.258  58.461 1.00 90.31  ? 163 GLN A OE1   1 
ATOM   1033 N  NE2   . GLN A 1 137 ? 38.286  26.980  60.383 1.00 74.79  ? 163 GLN A NE2   1 
ATOM   1034 N  N     . LEU A 1 138 ? 35.223  26.811  55.629 1.00 68.64  ? 164 LEU A N     1 
ATOM   1035 C  CA    . LEU A 1 138 ? 33.772  26.805  55.739 1.00 65.34  ? 164 LEU A CA    1 
ATOM   1036 C  C     . LEU A 1 138 ? 33.127  25.986  54.635 1.00 65.97  ? 164 LEU A C     1 
ATOM   1037 O  O     . LEU A 1 138 ? 33.527  26.055  53.472 1.00 60.25  ? 164 LEU A O     1 
ATOM   1038 C  CB    . LEU A 1 138 ? 33.224  28.233  55.705 1.00 64.67  ? 164 LEU A CB    1 
ATOM   1039 C  CG    . LEU A 1 138 ? 31.725  28.412  55.962 1.00 58.44  ? 164 LEU A CG    1 
ATOM   1040 C  CD1   . LEU A 1 138 ? 31.350  27.922  57.347 1.00 54.24  ? 164 LEU A CD1   1 
ATOM   1041 C  CD2   . LEU A 1 138 ? 31.317  29.868  55.771 1.00 51.59  ? 164 LEU A CD2   1 
ATOM   1042 N  N     . ILE A 1 139 ? 32.115  25.216  55.016 1.00 63.87  ? 165 ILE A N     1 
ATOM   1043 C  CA    . ILE A 1 139 ? 31.317  24.470  54.060 1.00 57.56  ? 165 ILE A CA    1 
ATOM   1044 C  C     . ILE A 1 139 ? 29.994  25.197  53.861 1.00 53.66  ? 165 ILE A C     1 
ATOM   1045 O  O     . ILE A 1 139 ? 29.193  25.302  54.784 1.00 55.97  ? 165 ILE A O     1 
ATOM   1046 C  CB    . ILE A 1 139 ? 31.060  23.032  54.533 1.00 57.43  ? 165 ILE A CB    1 
ATOM   1047 C  CG1   . ILE A 1 139 ? 32.390  22.308  54.764 1.00 66.05  ? 165 ILE A CG1   1 
ATOM   1048 C  CG2   . ILE A 1 139 ? 30.163  22.299  53.548 1.00 61.55  ? 165 ILE A CG2   1 
ATOM   1049 C  CD1   . ILE A 1 139 ? 33.130  21.959  53.494 1.00 64.30  ? 165 ILE A CD1   1 
ATOM   1050 N  N     . ILE A 1 140 ? 29.766  25.712  52.663 1.00 46.62  ? 166 ILE A N     1 
ATOM   1051 C  CA    . ILE A 1 140 ? 28.504  26.374  52.378 1.00 40.33  ? 166 ILE A CA    1 
ATOM   1052 C  C     . ILE A 1 140 ? 27.567  25.418  51.650 1.00 42.06  ? 166 ILE A C     1 
ATOM   1053 O  O     . ILE A 1 140 ? 27.769  25.112  50.477 1.00 44.81  ? 166 ILE A O     1 
ATOM   1054 C  CB    . ILE A 1 140 ? 28.711  27.638  51.531 1.00 42.19  ? 166 ILE A CB    1 
ATOM   1055 C  CG1   . ILE A 1 140 ? 29.645  28.614  52.244 1.00 48.52  ? 166 ILE A CG1   1 
ATOM   1056 C  CG2   . ILE A 1 140 ? 27.379  28.287  51.220 1.00 39.26  ? 166 ILE A CG2   1 
ATOM   1057 C  CD1   . ILE A 1 140 ? 29.985  29.837  51.429 1.00 42.55  ? 166 ILE A CD1   1 
ATOM   1058 N  N     . VAL A 1 141 ? 26.543  24.946  52.352 1.00 42.78  ? 167 VAL A N     1 
ATOM   1059 C  CA    . VAL A 1 141 ? 25.589  24.000  51.779 1.00 42.79  ? 167 VAL A CA    1 
ATOM   1060 C  C     . VAL A 1 141 ? 24.292  24.700  51.376 1.00 37.98  ? 167 VAL A C     1 
ATOM   1061 O  O     . VAL A 1 141 ? 23.706  25.436  52.168 1.00 39.07  ? 167 VAL A O     1 
ATOM   1062 C  CB    . VAL A 1 141 ? 25.285  22.846  52.769 1.00 41.26  ? 167 VAL A CB    1 
ATOM   1063 C  CG1   . VAL A 1 141 ? 25.170  23.375  54.183 1.00 43.20  ? 167 VAL A CG1   1 
ATOM   1064 C  CG2   . VAL A 1 141 ? 24.024  22.086  52.371 1.00 46.52  ? 167 VAL A CG2   1 
ATOM   1065 N  N     . PRO A 1 142 ? 23.847  24.480  50.129 1.00 35.43  ? 168 PRO A N     1 
ATOM   1066 C  CA    . PRO A 1 142 ? 22.651  25.146  49.604 1.00 34.51  ? 168 PRO A CA    1 
ATOM   1067 C  C     . PRO A 1 142 ? 21.407  24.814  50.415 1.00 32.46  ? 168 PRO A C     1 
ATOM   1068 O  O     . PRO A 1 142 ? 21.296  23.711  50.930 1.00 33.60  ? 168 PRO A O     1 
ATOM   1069 C  CB    . PRO A 1 142 ? 22.538  24.596  48.181 1.00 29.98  ? 168 PRO A CB    1 
ATOM   1070 C  CG    . PRO A 1 142 ? 23.906  24.115  47.844 1.00 35.57  ? 168 PRO A CG    1 
ATOM   1071 C  CD    . PRO A 1 142 ? 24.482  23.614  49.123 1.00 31.95  ? 168 PRO A CD    1 
ATOM   1072 N  N     . PRO A 1 143 ? 20.480  25.759  50.527 1.00 34.14  ? 169 PRO A N     1 
ATOM   1073 C  CA    . PRO A 1 143 ? 19.255  25.544  51.309 1.00 32.95  ? 169 PRO A CA    1 
ATOM   1074 C  C     . PRO A 1 143 ? 18.212  24.639  50.647 1.00 31.47  ? 169 PRO A C     1 
ATOM   1075 O  O     . PRO A 1 143 ? 18.023  24.683  49.432 1.00 31.79  ? 169 PRO A O     1 
ATOM   1076 C  CB    . PRO A 1 143 ? 18.692  26.960  51.462 1.00 34.46  ? 169 PRO A CB    1 
ATOM   1077 C  CG    . PRO A 1 143 ? 19.196  27.690  50.264 1.00 37.85  ? 169 PRO A CG    1 
ATOM   1078 C  CD    . PRO A 1 143 ? 20.562  27.127  49.987 1.00 32.89  ? 169 PRO A CD    1 
ATOM   1079 N  N     . ASN A 1 144 ? 17.541  23.831  51.466 1.00 32.34  ? 170 ASN A N     1 
ATOM   1080 C  CA    . ASN A 1 144 ? 16.499  22.926  51.007 1.00 27.62  ? 170 ASN A CA    1 
ATOM   1081 C  C     . ASN A 1 144 ? 15.182  23.305  51.675 1.00 27.25  ? 170 ASN A C     1 
ATOM   1082 O  O     . ASN A 1 144 ? 14.746  22.660  52.617 1.00 31.55  ? 170 ASN A O     1 
ATOM   1083 C  CB    . ASN A 1 144 ? 16.878  21.474  51.310 1.00 27.77  ? 170 ASN A CB    1 
ATOM   1084 C  CG    . ASN A 1 144 ? 18.102  21.011  50.527 1.00 31.21  ? 170 ASN A CG    1 
ATOM   1085 O  OD1   . ASN A 1 144 ? 18.063  20.879  49.302 1.00 37.98  ? 170 ASN A OD1   1 
ATOM   1086 N  ND2   . ASN A 1 144 ? 19.199  20.769  51.236 1.00 26.71  ? 170 ASN A ND2   1 
ATOM   1087 N  N     . PHE A 1 145 ? 14.568  24.372  51.177 1.00 27.63  ? 171 PHE A N     1 
ATOM   1088 C  CA    . PHE A 1 145 ? 13.457  25.051  51.843 1.00 31.94  ? 171 PHE A CA    1 
ATOM   1089 C  C     . PHE A 1 145 ? 12.267  24.155  52.223 1.00 32.97  ? 171 PHE A C     1 
ATOM   1090 O  O     . PHE A 1 145 ? 11.643  24.336  53.284 1.00 33.65  ? 171 PHE A O     1 
ATOM   1091 C  CB    . PHE A 1 145 ? 12.972  26.205  50.953 1.00 36.38  ? 171 PHE A CB    1 
ATOM   1092 C  CG    . PHE A 1 145 ? 12.033  27.154  51.646 1.00 41.14  ? 171 PHE A CG    1 
ATOM   1093 C  CD1   . PHE A 1 145 ? 12.500  28.018  52.626 1.00 40.20  ? 171 PHE A CD1   1 
ATOM   1094 C  CD2   . PHE A 1 145 ? 10.684  27.178  51.322 1.00 42.79  ? 171 PHE A CD2   1 
ATOM   1095 C  CE1   . PHE A 1 145 ? 11.640  28.886  53.273 1.00 42.64  ? 171 PHE A CE1   1 
ATOM   1096 C  CE2   . PHE A 1 145 ? 9.820   28.045  51.963 1.00 47.61  ? 171 PHE A CE2   1 
ATOM   1097 C  CZ    . PHE A 1 145 ? 10.298  28.899  52.941 1.00 47.06  ? 171 PHE A CZ    1 
ATOM   1098 N  N     . ASP A 1 146 ? 11.960  23.187  51.366 1.00 32.99  ? 172 ASP A N     1 
ATOM   1099 C  CA    . ASP A 1 146 ? 10.808  22.321  51.583 1.00 33.31  ? 172 ASP A CA    1 
ATOM   1100 C  C     . ASP A 1 146 ? 11.008  21.380  52.766 1.00 33.49  ? 172 ASP A C     1 
ATOM   1101 O  O     . ASP A 1 146 ? 10.057  21.099  53.504 1.00 39.05  ? 172 ASP A O     1 
ATOM   1102 C  CB    . ASP A 1 146 ? 10.505  21.529  50.318 1.00 38.64  ? 172 ASP A CB    1 
ATOM   1103 C  CG    . ASP A 1 146 ? 10.080  22.423  49.169 1.00 46.46  ? 172 ASP A CG    1 
ATOM   1104 O  OD1   . ASP A 1 146 ? 8.898   22.835  49.134 1.00 51.29  ? 172 ASP A OD1   1 
ATOM   1105 O  OD2   . ASP A 1 146 ? 10.937  22.725  48.311 1.00 45.64  ? 172 ASP A OD2   1 
ATOM   1106 N  N     . LYS A 1 147 ? 12.240  20.908  52.954 1.00 31.65  ? 173 LYS A N     1 
ATOM   1107 C  CA    . LYS A 1 147 ? 12.597  20.185  54.170 1.00 33.06  ? 173 LYS A CA    1 
ATOM   1108 C  C     . LYS A 1 147 ? 12.280  21.021  55.406 1.00 33.85  ? 173 LYS A C     1 
ATOM   1109 O  O     . LYS A 1 147 ? 11.625  20.549  56.348 1.00 32.21  ? 173 LYS A O     1 
ATOM   1110 C  CB    . LYS A 1 147 ? 14.083  19.812  54.181 1.00 28.77  ? 173 LYS A CB    1 
ATOM   1111 C  CG    . LYS A 1 147 ? 14.512  18.851  53.113 1.00 27.98  ? 173 LYS A CG    1 
ATOM   1112 C  CD    . LYS A 1 147 ? 15.996  18.544  53.238 1.00 31.17  ? 173 LYS A CD    1 
ATOM   1113 C  CE    . LYS A 1 147 ? 16.303  17.802  54.526 1.00 28.56  ? 173 LYS A CE    1 
ATOM   1114 N  NZ    . LYS A 1 147 ? 17.743  17.442  54.643 1.00 30.62  ? 173 LYS A NZ    1 
ATOM   1115 N  N     . TYR A 1 148 ? 12.747  22.266  55.385 1.00 30.81  ? 174 TYR A N     1 
ATOM   1116 C  CA    . TYR A 1 148 ? 12.570  23.172  56.508 1.00 30.25  ? 174 TYR A CA    1 
ATOM   1117 C  C     . TYR A 1 148 ? 11.084  23.373  56.783 1.00 31.65  ? 174 TYR A C     1 
ATOM   1118 O  O     . TYR A 1 148 ? 10.658  23.458  57.941 1.00 37.07  ? 174 TYR A O     1 
ATOM   1119 C  CB    . TYR A 1 148 ? 13.259  24.510  56.233 1.00 26.74  ? 174 TYR A CB    1 
ATOM   1120 C  CG    . TYR A 1 148 ? 14.699  24.404  55.766 1.00 27.69  ? 174 TYR A CG    1 
ATOM   1121 C  CD1   . TYR A 1 148 ? 15.250  25.374  54.941 1.00 30.76  ? 174 TYR A CD1   1 
ATOM   1122 C  CD2   . TYR A 1 148 ? 15.511  23.354  56.165 1.00 28.79  ? 174 TYR A CD2   1 
ATOM   1123 C  CE1   . TYR A 1 148 ? 16.561  25.296  54.512 1.00 31.11  ? 174 TYR A CE1   1 
ATOM   1124 C  CE2   . TYR A 1 148 ? 16.823  23.265  55.740 1.00 28.55  ? 174 TYR A CE2   1 
ATOM   1125 C  CZ    . TYR A 1 148 ? 17.344  24.240  54.914 1.00 33.59  ? 174 TYR A CZ    1 
ATOM   1126 O  OH    . TYR A 1 148 ? 18.653  24.151  54.494 1.00 35.61  ? 174 TYR A OH    1 
ATOM   1127 N  N     . ARG A 1 149 ? 10.287  23.387  55.720 1.00 30.75  ? 175 ARG A N     1 
ATOM   1128 C  CA    . ARG A 1 149 ? 8.849   23.544  55.890 1.00 33.07  ? 175 ARG A CA    1 
ATOM   1129 C  C     . ARG A 1 149 ? 8.243   22.255  56.511 1.00 35.08  ? 175 ARG A C     1 
ATOM   1130 O  O     . ARG A 1 149 ? 7.323   22.336  57.335 1.00 40.11  ? 175 ARG A O     1 
ATOM   1131 C  CB    . ARG A 1 149 ? 8.177   23.817  54.549 1.00 40.24  ? 175 ARG A CB    1 
ATOM   1132 C  CG    . ARG A 1 149 ? 7.319   25.073  54.545 1.00 45.60  ? 175 ARG A CG    1 
ATOM   1133 C  CD    . ARG A 1 149 ? 5.948   24.815  53.914 1.00 51.04  ? 175 ARG A CD    1 
ATOM   1134 N  NE    . ARG A 1 149 ? 5.787   24.964  52.452 1.00 52.70  ? 175 ARG A NE    1 
ATOM   1135 C  CZ    . ARG A 1 149 ? 6.729   25.215  51.541 1.00 65.34  ? 175 ARG A CZ    1 
ATOM   1136 N  NH1   . ARG A 1 149 ? 6.373   25.317  50.265 1.00 69.00  ? 175 ARG A NH1   1 
ATOM   1137 N  NH2   . ARG A 1 149 ? 8.001   25.360  51.877 1.00 60.81  ? 175 ARG A NH2   1 
ATOM   1138 N  N     . ALA A 1 150 ? 8.760   21.091  56.126 1.00 32.28  ? 176 ALA A N     1 
ATOM   1139 C  CA    . ALA A 1 150 ? 8.236   19.832  56.658 1.00 32.20  ? 176 ALA A CA    1 
ATOM   1140 C  C     . ALA A 1 150 ? 8.524   19.691  58.162 1.00 38.04  ? 176 ALA A C     1 
ATOM   1141 O  O     . ALA A 1 150 ? 7.622   19.385  58.979 1.00 41.99  ? 176 ALA A O     1 
ATOM   1142 C  CB    . ALA A 1 150 ? 8.820   18.662  55.892 1.00 32.11  ? 176 ALA A CB    1 
ATOM   1143 N  N     . VAL A 1 151 ? 9.787   19.911  58.519 1.00 35.17  ? 177 VAL A N     1 
ATOM   1144 C  CA    . VAL A 1 151 ? 10.195  19.908  59.915 1.00 34.89  ? 177 VAL A CA    1 
ATOM   1145 C  C     . VAL A 1 151 ? 9.365   20.921  60.696 1.00 32.53  ? 177 VAL A C     1 
ATOM   1146 O  O     . VAL A 1 151 ? 8.862   20.621  61.793 1.00 39.20  ? 177 VAL A O     1 
ATOM   1147 C  CB    . VAL A 1 151 ? 11.691  20.223  60.060 1.00 35.01  ? 177 VAL A CB    1 
ATOM   1148 C  CG1   . VAL A 1 151 ? 12.031  20.545  61.496 1.00 31.84  ? 177 VAL A CG1   1 
ATOM   1149 C  CG2   . VAL A 1 151 ? 12.526  19.054  59.547 1.00 32.99  ? 177 VAL A CG2   1 
ATOM   1150 N  N     . SER A 1 152 ? 9.192   22.104  60.110 1.00 31.58  ? 178 SER A N     1 
ATOM   1151 C  CA    . SER A 1 152 ? 8.331   23.123  60.704 1.00 34.38  ? 178 SER A CA    1 
ATOM   1152 C  C     . SER A 1 152 ? 6.938   22.576  61.003 1.00 37.55  ? 178 SER A C     1 
ATOM   1153 O  O     . SER A 1 152 ? 6.371   22.851  62.066 1.00 35.12  ? 178 SER A O     1 
ATOM   1154 C  CB    . SER A 1 152 ? 8.226   24.335  59.778 1.00 36.61  ? 178 SER A CB    1 
ATOM   1155 O  OG    . SER A 1 152 ? 7.467   25.375  60.374 1.00 39.03  ? 178 SER A OG    1 
ATOM   1156 N  N     . LYS A 1 153 ? 6.393   21.800  60.067 1.00 35.85  ? 179 LYS A N     1 
ATOM   1157 C  CA    . LYS A 1 153 ? 5.077   21.193  60.266 1.00 35.01  ? 179 LYS A CA    1 
ATOM   1158 C  C     . LYS A 1 153 ? 5.086   20.240  61.456 1.00 38.73  ? 179 LYS A C     1 
ATOM   1159 O  O     . LYS A 1 153 ? 4.178   20.278  62.291 1.00 41.33  ? 179 LYS A O     1 
ATOM   1160 C  CB    . LYS A 1 153 ? 4.614   20.449  59.011 1.00 41.85  ? 179 LYS A CB    1 
ATOM   1161 C  CG    . LYS A 1 153 ? 3.238   19.803  59.136 1.00 44.21  ? 179 LYS A CG    1 
ATOM   1162 C  CD    . LYS A 1 153 ? 3.129   18.573  58.253 1.00 51.70  ? 179 LYS A CD    1 
ATOM   1163 C  CE    . LYS A 1 153 ? 1.826   17.813  58.483 1.00 60.52  ? 179 LYS A CE    1 
ATOM   1164 N  NZ    . LYS A 1 153 ? 0.722   18.281  57.592 1.00 66.59  ? 179 LYS A NZ    1 
ATOM   1165 N  N     . GLU A 1 154 ? 6.110   19.389  61.538 1.00 35.99  ? 180 GLU A N     1 
ATOM   1166 C  CA    . GLU A 1 154 ? 6.243   18.484  62.690 1.00 37.76  ? 180 GLU A CA    1 
ATOM   1167 C  C     . GLU A 1 154 ? 6.224   19.242  64.033 1.00 36.91  ? 180 GLU A C     1 
ATOM   1168 O  O     . GLU A 1 154 ? 5.421   18.937  64.955 1.00 38.42  ? 180 GLU A O     1 
ATOM   1169 C  CB    . GLU A 1 154 ? 7.529   17.656  62.564 1.00 34.33  ? 180 GLU A CB    1 
ATOM   1170 C  CG    . GLU A 1 154 ? 7.482   16.606  61.456 1.00 40.99  ? 180 GLU A CG    1 
ATOM   1171 C  CD    . GLU A 1 154 ? 8.789   15.837  61.284 1.00 45.29  ? 180 GLU A CD    1 
ATOM   1172 O  OE1   . GLU A 1 154 ? 9.831   16.472  61.015 1.00 44.62  ? 180 GLU A OE1   1 
ATOM   1173 O  OE2   . GLU A 1 154 ? 8.772   14.591  61.395 1.00 50.08  ? 180 GLU A OE2   1 
ATOM   1174 N  N     . VAL A 1 155 ? 7.102   20.241  64.130 1.00 35.89  ? 181 VAL A N     1 
ATOM   1175 C  CA    . VAL A 1 155 ? 7.196   21.062  65.338 1.00 33.67  ? 181 VAL A CA    1 
ATOM   1176 C  C     . VAL A 1 155 ? 5.870   21.733  65.687 1.00 31.64  ? 181 VAL A C     1 
ATOM   1177 O  O     . VAL A 1 155 ? 5.445   21.712  66.842 1.00 29.67  ? 181 VAL A O     1 
ATOM   1178 C  CB    . VAL A 1 155 ? 8.288   22.140  65.202 1.00 26.02  ? 181 VAL A CB    1 
ATOM   1179 C  CG1   . VAL A 1 155 ? 8.328   23.021  66.427 1.00 21.59  ? 181 VAL A CG1   1 
ATOM   1180 C  CG2   . VAL A 1 155 ? 9.642   21.492  64.983 1.00 30.25  ? 181 VAL A CG2   1 
ATOM   1181 N  N     . LYS A 1 156 ? 5.208   22.317  64.694 1.00 35.99  ? 182 LYS A N     1 
ATOM   1182 C  CA    . LYS A 1 156 ? 3.906   22.931  64.943 1.00 38.53  ? 182 LYS A CA    1 
ATOM   1183 C  C     . LYS A 1 156 ? 2.891   21.893  65.435 1.00 37.68  ? 182 LYS A C     1 
ATOM   1184 O  O     . LYS A 1 156 ? 2.047   22.186  66.294 1.00 32.83  ? 182 LYS A O     1 
ATOM   1185 C  CB    . LYS A 1 156 ? 3.395   23.635  63.684 1.00 37.56  ? 182 LYS A CB    1 
ATOM   1186 C  CG    . LYS A 1 156 ? 4.147   24.927  63.367 1.00 42.94  ? 182 LYS A CG    1 
ATOM   1187 C  CD    . LYS A 1 156 ? 3.978   25.351  61.914 1.00 46.38  ? 182 LYS A CD    1 
ATOM   1188 C  CE    . LYS A 1 156 ? 4.813   26.584  61.610 1.00 52.74  ? 182 LYS A CE    1 
ATOM   1189 N  NZ    . LYS A 1 156 ? 4.882   26.865  60.149 1.00 59.79  ? 182 LYS A NZ    1 
ATOM   1190 N  N     . GLU A 1 157 ? 2.995   20.672  64.913 1.00 37.61  ? 183 GLU A N     1 
ATOM   1191 C  CA    . GLU A 1 157 ? 2.133   19.588  65.376 1.00 41.49  ? 183 GLU A CA    1 
ATOM   1192 C  C     . GLU A 1 157 ? 2.309   19.364  66.863 1.00 37.47  ? 183 GLU A C     1 
ATOM   1193 O  O     . GLU A 1 157 ? 1.319   19.283  67.595 1.00 33.39  ? 183 GLU A O     1 
ATOM   1194 C  CB    . GLU A 1 157 ? 2.400   18.278  64.638 1.00 39.43  ? 183 GLU A CB    1 
ATOM   1195 C  CG    . GLU A 1 157 ? 1.535   18.051  63.425 1.00 47.73  ? 183 GLU A CG    1 
ATOM   1196 C  CD    . GLU A 1 157 ? 1.981   16.847  62.640 1.00 54.82  ? 183 GLU A CD    1 
ATOM   1197 O  OE1   . GLU A 1 157 ? 2.617   15.959  63.251 1.00 56.19  ? 183 GLU A OE1   1 
ATOM   1198 O  OE2   . GLU A 1 157 ? 1.708   16.795  61.423 1.00 62.70  ? 183 GLU A OE2   1 
ATOM   1199 N  N     . ILE A 1 158 ? 3.558   19.231  67.310 1.00 38.33  ? 184 ILE A N     1 
ATOM   1200 C  CA    . ILE A 1 158 ? 3.794   19.167  68.762 1.00 34.20  ? 184 ILE A CA    1 
ATOM   1201 C  C     . ILE A 1 158 ? 3.224   20.389  69.515 1.00 36.74  ? 184 ILE A C     1 
ATOM   1202 O  O     . ILE A 1 158 ? 2.492   20.234  70.495 1.00 34.11  ? 184 ILE A O     1 
ATOM   1203 C  CB    . ILE A 1 158 ? 5.296   19.026  69.090 1.00 34.14  ? 184 ILE A CB    1 
ATOM   1204 C  CG1   . ILE A 1 158 ? 5.813   17.668  68.613 1.00 28.29  ? 184 ILE A CG1   1 
ATOM   1205 C  CG2   . ILE A 1 158 ? 5.543   19.181  70.588 1.00 25.33  ? 184 ILE A CG2   1 
ATOM   1206 C  CD1   . ILE A 1 158 ? 7.291   17.471  68.817 1.00 27.40  ? 184 ILE A CD1   1 
ATOM   1207 N  N     . LEU A 1 159 ? 3.555   21.595  69.056 1.00 32.04  ? 185 LEU A N     1 
ATOM   1208 C  CA    . LEU A 1 159 ? 3.100   22.828  69.711 1.00 28.97  ? 185 LEU A CA    1 
ATOM   1209 C  C     . LEU A 1 159 ? 1.584   22.956  69.855 1.00 31.53  ? 185 LEU A C     1 
ATOM   1210 O  O     . LEU A 1 159 ? 1.108   23.627  70.765 1.00 32.37  ? 185 LEU A O     1 
ATOM   1211 C  CB    . LEU A 1 159 ? 3.619   24.055  68.961 1.00 29.95  ? 185 LEU A CB    1 
ATOM   1212 C  CG    . LEU A 1 159 ? 5.139   24.192  68.922 1.00 27.04  ? 185 LEU A CG    1 
ATOM   1213 C  CD1   . LEU A 1 159 ? 5.558   25.400  68.105 1.00 26.81  ? 185 LEU A CD1   1 
ATOM   1214 C  CD2   . LEU A 1 159 ? 5.714   24.243  70.318 1.00 28.94  ? 185 LEU A CD2   1 
ATOM   1215 N  N     . ALA A 1 160 ? 0.826   22.347  68.949 1.00 35.24  ? 186 ALA A N     1 
ATOM   1216 C  CA    . ALA A 1 160 ? -0.629  22.494  68.985 1.00 33.23  ? 186 ALA A CA    1 
ATOM   1217 C  C     . ALA A 1 160 ? -1.266  21.763  70.173 1.00 38.90  ? 186 ALA A C     1 
ATOM   1218 O  O     . ALA A 1 160 ? -2.424  22.013  70.507 1.00 41.28  ? 186 ALA A O     1 
ATOM   1219 C  CB    . ALA A 1 160 ? -1.236  22.008  67.684 1.00 34.45  ? 186 ALA A CB    1 
ATOM   1220 N  N     . ASP A 1 161 ? -0.513  20.862  70.802 1.00 34.94  ? 187 ASP A N     1 
ATOM   1221 C  CA    . ASP A 1 161 ? -0.994  20.150  71.982 1.00 38.17  ? 187 ASP A CA    1 
ATOM   1222 C  C     . ASP A 1 161 ? -1.187  21.055  73.187 1.00 38.48  ? 187 ASP A C     1 
ATOM   1223 O  O     . ASP A 1 161 ? -2.068  20.828  74.012 1.00 44.79  ? 187 ASP A O     1 
ATOM   1224 C  CB    . ASP A 1 161 ? -0.024  19.036  72.373 1.00 39.80  ? 187 ASP A CB    1 
ATOM   1225 C  CG    . ASP A 1 161 ? -0.320  17.732  71.676 1.00 44.21  ? 187 ASP A CG    1 
ATOM   1226 O  OD1   . ASP A 1 161 ? -1.377  17.634  71.021 1.00 53.12  ? 187 ASP A OD1   1 
ATOM   1227 O  OD2   . ASP A 1 161 ? 0.493   16.792  71.813 1.00 43.67  ? 187 ASP A OD2   1 
ATOM   1228 N  N     . TYR A 1 162 ? -0.361  22.087  73.277 1.00 37.30  ? 188 TYR A N     1 
ATOM   1229 C  CA    . TYR A 1 162 ? -0.294  22.902  74.478 1.00 37.10  ? 188 TYR A CA    1 
ATOM   1230 C  C     . TYR A 1 162 ? -1.048  24.206  74.286 1.00 38.77  ? 188 TYR A C     1 
ATOM   1231 O  O     . TYR A 1 162 ? -1.671  24.720  75.214 1.00 39.58  ? 188 TYR A O     1 
ATOM   1232 C  CB    . TYR A 1 162 ? 1.168   23.151  74.845 1.00 33.28  ? 188 TYR A CB    1 
ATOM   1233 C  CG    . TYR A 1 162 ? 1.940   21.860  75.042 1.00 38.70  ? 188 TYR A CG    1 
ATOM   1234 C  CD1   . TYR A 1 162 ? 2.113   21.314  76.309 1.00 36.52  ? 188 TYR A CD1   1 
ATOM   1235 C  CD2   . TYR A 1 162 ? 2.472   21.170  73.957 1.00 38.83  ? 188 TYR A CD2   1 
ATOM   1236 C  CE1   . TYR A 1 162 ? 2.808   20.127  76.488 1.00 40.82  ? 188 TYR A CE1   1 
ATOM   1237 C  CE2   . TYR A 1 162 ? 3.163   19.985  74.128 1.00 39.59  ? 188 TYR A CE2   1 
ATOM   1238 C  CZ    . TYR A 1 162 ? 3.330   19.470  75.394 1.00 40.28  ? 188 TYR A CZ    1 
ATOM   1239 O  OH    . TYR A 1 162 ? 4.018   18.295  75.564 1.00 36.92  ? 188 TYR A OH    1 
ATOM   1240 N  N     . ASP A 1 163 ? -0.997  24.733  73.071 1.00 39.39  ? 189 ASP A N     1 
ATOM   1241 C  CA    . ASP A 1 163 ? -1.810  25.882  72.713 1.00 40.65  ? 189 ASP A CA    1 
ATOM   1242 C  C     . ASP A 1 163 ? -2.297  25.680  71.290 1.00 43.51  ? 189 ASP A C     1 
ATOM   1243 O  O     . ASP A 1 163 ? -1.537  25.848  70.337 1.00 43.31  ? 189 ASP A O     1 
ATOM   1244 C  CB    . ASP A 1 163 ? -1.022  27.190  72.843 1.00 40.31  ? 189 ASP A CB    1 
ATOM   1245 C  CG    . ASP A 1 163 ? -1.903  28.425  72.690 1.00 46.74  ? 189 ASP A CG    1 
ATOM   1246 O  OD1   . ASP A 1 163 ? -3.112  28.284  72.411 1.00 47.54  ? 189 ASP A OD1   1 
ATOM   1247 O  OD2   . ASP A 1 163 ? -1.382  29.549  72.844 1.00 48.98  ? 189 ASP A OD2   1 
ATOM   1248 N  N     . PRO A 1 164 ? -3.576  25.316  71.143 1.00 46.44  ? 190 PRO A N     1 
ATOM   1249 C  CA    . PRO A 1 164 ? -4.173  25.194  69.809 1.00 49.68  ? 190 PRO A CA    1 
ATOM   1250 C  C     . PRO A 1 164 ? -4.163  26.529  69.065 1.00 45.29  ? 190 PRO A C     1 
ATOM   1251 O  O     . PRO A 1 164 ? -3.888  26.571  67.865 1.00 51.47  ? 190 PRO A O     1 
ATOM   1252 C  CB    . PRO A 1 164 ? -5.605  24.718  70.100 1.00 48.66  ? 190 PRO A CB    1 
ATOM   1253 C  CG    . PRO A 1 164 ? -5.837  25.027  71.556 1.00 45.42  ? 190 PRO A CG    1 
ATOM   1254 C  CD    . PRO A 1 164 ? -4.503  24.912  72.214 1.00 39.43  ? 190 PRO A CD    1 
ATOM   1255 N  N     . ASN A 1 165 ? -4.447  27.609  69.780 1.00 48.54  ? 191 ASN A N     1 
ATOM   1256 C  CA    . ASN A 1 165 ? -4.499  28.933  69.176 1.00 52.24  ? 191 ASN A CA    1 
ATOM   1257 C  C     . ASN A 1 165 ? -3.158  29.669  69.259 1.00 50.33  ? 191 ASN A C     1 
ATOM   1258 O  O     . ASN A 1 165 ? -3.119  30.893  69.381 1.00 50.90  ? 191 ASN A O     1 
ATOM   1259 C  CB    . ASN A 1 165 ? -5.601  29.763  69.836 1.00 43.48  ? 191 ASN A CB    1 
ATOM   1260 N  N     . PHE A 1 166 ? -2.061  28.919  69.190 1.00 50.03  ? 192 PHE A N     1 
ATOM   1261 C  CA    . PHE A 1 166 ? -0.724  29.506  69.249 1.00 43.09  ? 192 PHE A CA    1 
ATOM   1262 C  C     . PHE A 1 166 ? -0.418  30.316  67.995 1.00 43.12  ? 192 PHE A C     1 
ATOM   1263 O  O     . PHE A 1 166 ? -1.182  30.294  67.033 1.00 51.02  ? 192 PHE A O     1 
ATOM   1264 C  CB    . PHE A 1 166 ? 0.345   28.427  69.430 1.00 41.47  ? 192 PHE A CB    1 
ATOM   1265 C  CG    . PHE A 1 166 ? 0.694   27.696  68.161 1.00 40.13  ? 192 PHE A CG    1 
ATOM   1266 C  CD1   . PHE A 1 166 ? 1.892   27.946  67.511 1.00 36.23  ? 192 PHE A CD1   1 
ATOM   1267 C  CD2   . PHE A 1 166 ? -0.181  26.771  67.608 1.00 45.65  ? 192 PHE A CD2   1 
ATOM   1268 C  CE1   . PHE A 1 166 ? 2.215   27.277  66.342 1.00 42.59  ? 192 PHE A CE1   1 
ATOM   1269 C  CE2   . PHE A 1 166 ? 0.138   26.098  66.438 1.00 39.45  ? 192 PHE A CE2   1 
ATOM   1270 C  CZ    . PHE A 1 166 ? 1.336   26.352  65.805 1.00 38.23  ? 192 PHE A CZ    1 
ATOM   1271 N  N     . MET A 1 167 ? 0.711   31.017  68.013 1.00 39.81  ? 193 MET A N     1 
ATOM   1272 C  CA    . MET A 1 167 ? 1.054   31.984  66.977 1.00 38.61  ? 193 MET A CA    1 
ATOM   1273 C  C     . MET A 1 167 ? 2.436   31.720  66.380 1.00 40.77  ? 193 MET A C     1 
ATOM   1274 O  O     . MET A 1 167 ? 3.452   31.933  67.036 1.00 38.81  ? 193 MET A O     1 
ATOM   1275 C  CB    . MET A 1 167 ? 0.982   33.404  67.548 1.00 44.41  ? 193 MET A CB    1 
ATOM   1276 C  CG    . MET A 1 167 ? 0.929   34.501  66.505 1.00 50.14  ? 193 MET A CG    1 
ATOM   1277 S  SD    . MET A 1 167 ? 0.333   36.040  67.218 1.00 59.24  ? 193 MET A SD    1 
ATOM   1278 C  CE    . MET A 1 167 ? 1.753   36.606  68.145 1.00 50.92  ? 193 MET A CE    1 
ATOM   1279 N  N     . ALA A 1 168 ? 2.475   31.260  65.134 1.00 45.08  ? 194 ALA A N     1 
ATOM   1280 C  CA    . ALA A 1 168 ? 3.748   30.970  64.481 1.00 40.38  ? 194 ALA A CA    1 
ATOM   1281 C  C     . ALA A 1 168 ? 4.330   32.202  63.788 1.00 50.96  ? 194 ALA A C     1 
ATOM   1282 O  O     . ALA A 1 168 ? 3.691   32.804  62.924 1.00 49.71  ? 194 ALA A O     1 
ATOM   1283 C  CB    . ALA A 1 168 ? 3.579   29.844  63.488 1.00 39.03  ? 194 ALA A CB    1 
ATOM   1284 N  N     . MET A 1 169 ? 5.553   32.562  64.171 1.00 50.64  ? 195 MET A N     1 
ATOM   1285 C  CA    . MET A 1 169 ? 6.242   33.708  63.592 1.00 46.88  ? 195 MET A CA    1 
ATOM   1286 C  C     . MET A 1 169 ? 6.770   33.380  62.212 1.00 52.63  ? 195 MET A C     1 
ATOM   1287 O  O     . MET A 1 169 ? 6.286   33.897  61.206 1.00 63.14  ? 195 MET A O     1 
ATOM   1288 C  CB    . MET A 1 169 ? 7.395   34.152  64.488 1.00 47.02  ? 195 MET A CB    1 
ATOM   1289 C  CG    . MET A 1 169 ? 6.969   34.592  65.878 1.00 49.19  ? 195 MET A CG    1 
ATOM   1290 S  SD    . MET A 1 169 ? 5.886   36.032  65.836 1.00 73.74  ? 195 MET A SD    1 
ATOM   1291 C  CE    . MET A 1 169 ? 4.295   35.259  66.098 1.00 48.74  ? 195 MET A CE    1 
ATOM   1292 N  N     . SER A 1 170 ? 7.789   32.533  62.184 1.00 46.34  ? 196 SER A N     1 
ATOM   1293 C  CA    . SER A 1 170 ? 8.373   32.064  60.942 1.00 46.15  ? 196 SER A CA    1 
ATOM   1294 C  C     . SER A 1 170 ? 8.237   30.548  60.882 1.00 43.47  ? 196 SER A C     1 
ATOM   1295 O  O     . SER A 1 170 ? 7.263   29.986  61.381 1.00 44.97  ? 196 SER A O     1 
ATOM   1296 C  CB    . SER A 1 170 ? 9.836   32.495  60.832 1.00 46.45  ? 196 SER A CB    1 
ATOM   1297 O  OG    . SER A 1 170 ? 10.533  32.265  62.043 1.00 43.89  ? 196 SER A OG    1 
ATOM   1298 N  N     . LEU A 1 171 ? 9.210   29.878  60.281 1.00 40.66  ? 197 LEU A N     1 
ATOM   1299 C  CA    . LEU A 1 171 ? 9.166   28.430  60.233 1.00 38.56  ? 197 LEU A CA    1 
ATOM   1300 C  C     . LEU A 1 171 ? 9.713   27.851  61.523 1.00 41.01  ? 197 LEU A C     1 
ATOM   1301 O  O     . LEU A 1 171 ? 9.436   26.700  61.859 1.00 36.12  ? 197 LEU A O     1 
ATOM   1302 C  CB    . LEU A 1 171 ? 9.974   27.892  59.054 1.00 37.02  ? 197 LEU A CB    1 
ATOM   1303 C  CG    . LEU A 1 171 ? 9.515   28.026  57.605 1.00 29.99  ? 197 LEU A CG    1 
ATOM   1304 C  CD1   . LEU A 1 171 ? 10.552  27.383  56.720 1.00 26.26  ? 197 LEU A CD1   1 
ATOM   1305 C  CD2   . LEU A 1 171 ? 8.160   27.389  57.385 1.00 27.05  ? 197 LEU A CD2   1 
ATOM   1306 N  N     . ASP A 1 172 ? 10.476  28.658  62.255 1.00 40.93  ? 198 ASP A N     1 
ATOM   1307 C  CA    . ASP A 1 172 ? 11.204  28.136  63.398 1.00 38.72  ? 198 ASP A CA    1 
ATOM   1308 C  C     . ASP A 1 172 ? 10.951  28.872  64.709 1.00 32.94  ? 198 ASP A C     1 
ATOM   1309 O  O     . ASP A 1 172 ? 11.670  28.664  65.679 1.00 39.52  ? 198 ASP A O     1 
ATOM   1310 C  CB    . ASP A 1 172 ? 12.704  28.131  63.084 1.00 36.69  ? 198 ASP A CB    1 
ATOM   1311 C  CG    . ASP A 1 172 ? 13.432  29.341  63.635 1.00 37.78  ? 198 ASP A CG    1 
ATOM   1312 O  OD1   . ASP A 1 172 ? 14.519  29.162  64.217 1.00 37.84  ? 198 ASP A OD1   1 
ATOM   1313 O  OD2   . ASP A 1 172 ? 12.929  30.468  63.485 1.00 49.07  ? 198 ASP A OD2   1 
ATOM   1314 N  N     . GLU A 1 173 ? 9.924   29.712  64.757 1.00 38.91  ? 199 GLU A N     1 
ATOM   1315 C  CA    . GLU A 1 173 ? 9.666   30.507  65.958 1.00 33.18  ? 199 GLU A CA    1 
ATOM   1316 C  C     . GLU A 1 173 ? 8.189   30.491  66.288 1.00 30.76  ? 199 GLU A C     1 
ATOM   1317 O  O     . GLU A 1 173 ? 7.357   30.465  65.389 1.00 38.85  ? 199 GLU A O     1 
ATOM   1318 C  CB    . GLU A 1 173 ? 10.134  31.940  65.753 1.00 39.15  ? 199 GLU A CB    1 
ATOM   1319 C  CG    . GLU A 1 173 ? 11.600  32.145  66.049 1.00 45.54  ? 199 GLU A CG    1 
ATOM   1320 C  CD    . GLU A 1 173 ? 11.996  33.601  66.002 1.00 53.96  ? 199 GLU A CD    1 
ATOM   1321 O  OE1   . GLU A 1 173 ? 13.173  33.874  65.686 1.00 53.81  ? 199 GLU A OE1   1 
ATOM   1322 O  OE2   . GLU A 1 173 ? 11.132  34.466  66.273 1.00 52.61  ? 199 GLU A OE2   1 
ATOM   1323 N  N     . ALA A 1 174 ? 7.851   30.522  67.570 1.00 32.69  ? 200 ALA A N     1 
ATOM   1324 C  CA    . ALA A 1 174 ? 6.437   30.582  67.932 1.00 35.16  ? 200 ALA A CA    1 
ATOM   1325 C  C     . ALA A 1 174 ? 6.196   31.049  69.348 1.00 37.44  ? 200 ALA A C     1 
ATOM   1326 O  O     . ALA A 1 174 ? 7.032   30.861  70.231 1.00 42.35  ? 200 ALA A O     1 
ATOM   1327 C  CB    . ALA A 1 174 ? 5.783   29.218  67.737 1.00 32.93  ? 200 ALA A CB    1 
ATOM   1328 N  N     . TYR A 1 175 ? 5.033   31.657  69.549 1.00 34.72  ? 201 TYR A N     1 
ATOM   1329 C  CA    . TYR A 1 175 ? 4.559   32.018  70.877 1.00 38.21  ? 201 TYR A CA    1 
ATOM   1330 C  C     . TYR A 1 175 ? 3.418   31.087  71.259 1.00 38.20  ? 201 TYR A C     1 
ATOM   1331 O  O     . TYR A 1 175 ? 2.575   30.755  70.427 1.00 35.19  ? 201 TYR A O     1 
ATOM   1332 C  CB    . TYR A 1 175 ? 4.080   33.472  70.924 1.00 32.04  ? 201 TYR A CB    1 
ATOM   1333 C  CG    . TYR A 1 175 ? 5.163   34.511  70.763 1.00 36.52  ? 201 TYR A CG    1 
ATOM   1334 C  CD1   . TYR A 1 175 ? 5.957   34.893  71.835 1.00 36.10  ? 201 TYR A CD1   1 
ATOM   1335 C  CD2   . TYR A 1 175 ? 5.388   35.114  69.536 1.00 42.35  ? 201 TYR A CD2   1 
ATOM   1336 C  CE1   . TYR A 1 175 ? 6.940   35.849  71.687 1.00 34.41  ? 201 TYR A CE1   1 
ATOM   1337 C  CE2   . TYR A 1 175 ? 6.369   36.067  69.379 1.00 40.96  ? 201 TYR A CE2   1 
ATOM   1338 C  CZ    . TYR A 1 175 ? 7.145   36.430  70.457 1.00 33.92  ? 201 TYR A CZ    1 
ATOM   1339 O  OH    . TYR A 1 175 ? 8.131   37.379  70.300 1.00 33.61  ? 201 TYR A OH    1 
ATOM   1340 N  N     . LEU A 1 176 ? 3.393   30.686  72.525 1.00 35.62  ? 202 LEU A N     1 
ATOM   1341 C  CA    . LEU A 1 176 ? 2.329   29.854  73.060 1.00 34.08  ? 202 LEU A CA    1 
ATOM   1342 C  C     . LEU A 1 176 ? 1.800   30.463  74.338 1.00 32.41  ? 202 LEU A C     1 
ATOM   1343 O  O     . LEU A 1 176 ? 2.565   30.998  75.139 1.00 32.36  ? 202 LEU A O     1 
ATOM   1344 C  CB    . LEU A 1 176 ? 2.810   28.428  73.341 1.00 36.37  ? 202 LEU A CB    1 
ATOM   1345 C  CG    . LEU A 1 176 ? 3.252   27.510  72.205 1.00 30.56  ? 202 LEU A CG    1 
ATOM   1346 C  CD1   . LEU A 1 176 ? 4.655   27.857  71.703 1.00 33.72  ? 202 LEU A CD1   1 
ATOM   1347 C  CD2   . LEU A 1 176 ? 3.182   26.079  72.681 1.00 33.73  ? 202 LEU A CD2   1 
ATOM   1348 N  N     . ASN A 1 177 ? 0.488   30.388  74.516 1.00 36.83  ? 203 ASN A N     1 
ATOM   1349 C  CA    . ASN A 1 177 ? -0.134  30.746  75.778 1.00 40.56  ? 203 ASN A CA    1 
ATOM   1350 C  C     . ASN A 1 177 ? -0.548  29.481  76.523 1.00 39.00  ? 203 ASN A C     1 
ATOM   1351 O  O     . ASN A 1 177 ? -1.643  28.954  76.304 1.00 43.01  ? 203 ASN A O     1 
ATOM   1352 C  CB    . ASN A 1 177 ? -1.341  31.652  75.538 1.00 45.62  ? 203 ASN A CB    1 
ATOM   1353 C  CG    . ASN A 1 177 ? -1.824  32.327  76.800 1.00 41.78  ? 203 ASN A CG    1 
ATOM   1354 O  OD1   . ASN A 1 177 ? -1.395  31.995  77.902 1.00 43.25  ? 203 ASN A OD1   1 
ATOM   1355 N  ND2   . ASN A 1 177 ? -2.723  33.290  76.642 1.00 44.23  ? 203 ASN A ND2   1 
ATOM   1356 N  N     . ILE A 1 178 ? 0.331   28.986  77.391 1.00 37.14  ? 204 ILE A N     1 
ATOM   1357 C  CA    . ILE A 1 178 ? 0.090   27.706  78.050 1.00 40.82  ? 204 ILE A CA    1 
ATOM   1358 C  C     . ILE A 1 178 ? -0.544  27.839  79.431 1.00 39.59  ? 204 ILE A C     1 
ATOM   1359 O  O     . ILE A 1 178 ? -0.342  26.986  80.291 1.00 43.30  ? 204 ILE A O     1 
ATOM   1360 C  CB    . ILE A 1 178 ? 1.397   26.902  78.195 1.00 38.32  ? 204 ILE A CB    1 
ATOM   1361 C  CG1   . ILE A 1 178 ? 2.391   27.638  79.098 1.00 35.41  ? 204 ILE A CG1   1 
ATOM   1362 C  CG2   . ILE A 1 178 ? 2.023   26.663  76.838 1.00 32.97  ? 204 ILE A CG2   1 
ATOM   1363 C  CD1   . ILE A 1 178 ? 3.547   26.775  79.555 1.00 32.21  ? 204 ILE A CD1   1 
ATOM   1364 N  N     . THR A 1 179 ? -1.365  28.866  79.618 1.00 38.96  ? 205 THR A N     1 
ATOM   1365 C  CA    . THR A 1 179 ? -1.995  29.100  80.912 1.00 47.24  ? 205 THR A CA    1 
ATOM   1366 C  C     . THR A 1 179 ? -3.081  28.048  81.092 1.00 46.40  ? 205 THR A C     1 
ATOM   1367 O  O     . THR A 1 179 ? -3.153  27.354  82.121 1.00 55.30  ? 205 THR A O     1 
ATOM   1368 C  CB    . THR A 1 179 ? -2.602  30.526  81.011 1.00 47.90  ? 205 THR A CB    1 
ATOM   1369 O  OG1   . THR A 1 179 ? -1.575  31.507  80.819 1.00 37.68  ? 205 THR A OG1   1 
ATOM   1370 C  CG2   . THR A 1 179 ? -3.281  30.741  82.362 1.00 43.21  ? 205 THR A CG2   1 
ATOM   1371 N  N     . LYS A 1 180 ? -3.909  27.933  80.059 1.00 40.80  ? 206 LYS A N     1 
ATOM   1372 C  CA    . LYS A 1 180 ? -4.984  26.958  79.999 1.00 46.61  ? 206 LYS A CA    1 
ATOM   1373 C  C     . LYS A 1 180 ? -4.443  25.550  80.238 1.00 50.80  ? 206 LYS A C     1 
ATOM   1374 O  O     . LYS A 1 180 ? -4.942  24.795  81.089 1.00 55.02  ? 206 LYS A O     1 
ATOM   1375 C  CB    . LYS A 1 180 ? -5.677  27.053  78.640 1.00 44.33  ? 206 LYS A CB    1 
ATOM   1376 C  CG    . LYS A 1 180 ? -6.816  26.081  78.428 1.00 58.45  ? 206 LYS A CG    1 
ATOM   1377 C  CD    . LYS A 1 180 ? -8.003  26.428  79.296 1.00 66.98  ? 206 LYS A CD    1 
ATOM   1378 C  CE    . LYS A 1 180 ? -9.237  25.644  78.878 1.00 74.17  ? 206 LYS A CE    1 
ATOM   1379 N  NZ    . LYS A 1 180 ? -10.222 25.514  79.994 1.00 68.76  ? 206 LYS A NZ    1 
ATOM   1380 N  N     . HIS A 1 181 ? -3.390  25.215  79.502 1.00 47.86  ? 207 HIS A N     1 
ATOM   1381 C  CA    . HIS A 1 181 ? -2.785  23.900  79.614 1.00 47.07  ? 207 HIS A CA    1 
ATOM   1382 C  C     . HIS A 1 181 ? -2.221  23.643  81.004 1.00 49.89  ? 207 HIS A C     1 
ATOM   1383 O  O     . HIS A 1 181 ? -2.393  22.559  81.522 1.00 52.35  ? 207 HIS A O     1 
ATOM   1384 C  CB    . HIS A 1 181 ? -1.679  23.709  78.584 1.00 40.05  ? 207 HIS A CB    1 
ATOM   1385 C  CG    . HIS A 1 181 ? -0.912  22.438  78.770 1.00 39.94  ? 207 HIS A CG    1 
ATOM   1386 N  ND1   . HIS A 1 181 ? -1.329  21.236  78.243 1.00 44.25  ? 207 HIS A ND1   1 
ATOM   1387 C  CD2   . HIS A 1 181 ? 0.234   22.178  79.446 1.00 38.77  ? 207 HIS A CD2   1 
ATOM   1388 C  CE1   . HIS A 1 181 ? -0.467  20.290  78.574 1.00 44.79  ? 207 HIS A CE1   1 
ATOM   1389 N  NE2   . HIS A 1 181 ? 0.488   20.835  79.305 1.00 46.20  ? 207 HIS A NE2   1 
ATOM   1390 N  N     . LEU A 1 182 ? -1.519  24.612  81.587 1.00 45.47  ? 208 LEU A N     1 
ATOM   1391 C  CA    . LEU A 1 182 ? -0.984  24.442  82.938 1.00 44.56  ? 208 LEU A CA    1 
ATOM   1392 C  C     . LEU A 1 182 ? -2.120  24.126  83.899 1.00 57.65  ? 208 LEU A C     1 
ATOM   1393 O  O     . LEU A 1 182 ? -2.054  23.163  84.690 1.00 63.04  ? 208 LEU A O     1 
ATOM   1394 C  CB    . LEU A 1 182 ? -0.248  25.698  83.406 1.00 36.61  ? 208 LEU A CB    1 
ATOM   1395 C  CG    . LEU A 1 182 ? 1.234   25.843  83.071 1.00 35.97  ? 208 LEU A CG    1 
ATOM   1396 C  CD1   . LEU A 1 182 ? 1.735   27.216  83.483 1.00 37.02  ? 208 LEU A CD1   1 
ATOM   1397 C  CD2   . LEU A 1 182 ? 2.037   24.766  83.754 1.00 33.66  ? 208 LEU A CD2   1 
ATOM   1398 N  N     . GLU A 1 183 ? -3.169  24.943  83.795 1.00 61.22  ? 209 GLU A N     1 
ATOM   1399 C  CA    . GLU A 1 183 ? -4.390  24.761  84.567 1.00 61.66  ? 209 GLU A CA    1 
ATOM   1400 C  C     . GLU A 1 183 ? -4.857  23.319  84.496 1.00 65.20  ? 209 GLU A C     1 
ATOM   1401 O  O     . GLU A 1 183 ? -4.978  22.646  85.521 1.00 66.51  ? 209 GLU A O     1 
ATOM   1402 C  CB    . GLU A 1 183 ? -5.496  25.677  84.053 1.00 63.06  ? 209 GLU A CB    1 
ATOM   1403 C  CG    . GLU A 1 183 ? -6.064  26.638  85.068 1.00 68.09  ? 209 GLU A CG    1 
ATOM   1404 C  CD    . GLU A 1 183 ? -7.101  27.565  84.451 1.00 90.35  ? 209 GLU A CD    1 
ATOM   1405 O  OE1   . GLU A 1 183 ? -8.054  27.046  83.822 1.00 94.94  ? 209 GLU A OE1   1 
ATOM   1406 O  OE2   . GLU A 1 183 ? -6.949  28.804  84.576 1.00 88.48  ? 209 GLU A OE2   1 
ATOM   1407 N  N     . GLU A 1 184 ? -5.104  22.837  83.283 1.00 62.09  ? 210 GLU A N     1 
ATOM   1408 C  CA    . GLU A 1 184 ? -5.614  21.478  83.128 1.00 63.95  ? 210 GLU A CA    1 
ATOM   1409 C  C     . GLU A 1 184 ? -4.581  20.394  83.431 1.00 62.18  ? 210 GLU A C     1 
ATOM   1410 O  O     . GLU A 1 184 ? -4.932  19.225  83.551 1.00 65.72  ? 210 GLU A O     1 
ATOM   1411 C  CB    . GLU A 1 184 ? -6.155  21.285  81.712 1.00 65.90  ? 210 GLU A CB    1 
ATOM   1412 C  CG    . GLU A 1 184 ? -7.445  22.031  81.442 1.00 70.58  ? 210 GLU A CG    1 
ATOM   1413 C  CD    . GLU A 1 184 ? -7.768  22.110  79.965 1.00 75.30  ? 210 GLU A CD    1 
ATOM   1414 O  OE1   . GLU A 1 184 ? -6.998  21.543  79.158 1.00 71.54  ? 210 GLU A OE1   1 
ATOM   1415 O  OE2   . GLU A 1 184 ? -8.802  22.718  79.615 1.00 78.72  ? 210 GLU A OE2   1 
ATOM   1416 N  N     . ARG A 1 185 ? -3.319  20.785  83.570 1.00 57.94  ? 211 ARG A N     1 
ATOM   1417 C  CA    . ARG A 1 185 ? -2.230  19.825  83.710 1.00 56.81  ? 211 ARG A CA    1 
ATOM   1418 C  C     . ARG A 1 185 ? -1.858  19.622  85.162 1.00 58.81  ? 211 ARG A C     1 
ATOM   1419 O  O     . ARG A 1 185 ? -1.200  18.642  85.512 1.00 59.87  ? 211 ARG A O     1 
ATOM   1420 C  CB    . ARG A 1 185 ? -1.002  20.297  82.930 1.00 50.51  ? 211 ARG A CB    1 
ATOM   1421 C  CG    . ARG A 1 185 ? 0.132   19.302  82.844 1.00 44.54  ? 211 ARG A CG    1 
ATOM   1422 C  CD    . ARG A 1 185 ? 1.434   20.025  82.589 1.00 37.69  ? 211 ARG A CD    1 
ATOM   1423 N  NE    . ARG A 1 185 ? 2.587   19.128  82.559 1.00 42.37  ? 211 ARG A NE    1 
ATOM   1424 C  CZ    . ARG A 1 185 ? 2.958   18.417  81.500 1.00 42.61  ? 211 ARG A CZ    1 
ATOM   1425 N  NH1   . ARG A 1 185 ? 2.269   18.495  80.370 1.00 42.74  ? 211 ARG A NH1   1 
ATOM   1426 N  NH2   . ARG A 1 185 ? 4.019   17.627  81.573 1.00 36.45  ? 211 ARG A NH2   1 
ATOM   1427 N  N     . GLN A 1 186 ? -2.300  20.534  86.017 1.00 62.33  ? 212 GLN A N     1 
ATOM   1428 C  CA    . GLN A 1 186 ? -2.051  20.366  87.447 1.00 66.77  ? 212 GLN A CA    1 
ATOM   1429 C  C     . GLN A 1 186 ? -2.653  19.051  87.961 1.00 62.65  ? 212 GLN A C     1 
ATOM   1430 O  O     . GLN A 1 186 ? -2.022  18.326  88.734 1.00 59.77  ? 212 GLN A O     1 
ATOM   1431 C  CB    . GLN A 1 186 ? -2.590  21.564  88.233 1.00 63.40  ? 212 GLN A CB    1 
ATOM   1432 C  CG    . GLN A 1 186 ? -1.545  22.248  89.123 1.00 64.38  ? 212 GLN A CG    1 
ATOM   1433 C  CD    . GLN A 1 186 ? -0.404  22.919  88.348 1.00 66.53  ? 212 GLN A CD    1 
ATOM   1434 O  OE1   . GLN A 1 186 ? -0.278  22.781  87.127 1.00 63.50  ? 212 GLN A OE1   1 
ATOM   1435 N  NE2   . GLN A 1 186 ? 0.433   23.656  89.069 1.00 67.36  ? 212 GLN A NE2   1 
ATOM   1436 N  N     . ASN A 1 187 ? -3.871  18.743  87.526 1.00 58.49  ? 213 ASN A N     1 
ATOM   1437 C  CA    . ASN A 1 187 ? -4.521  17.507  87.946 1.00 64.29  ? 213 ASN A CA    1 
ATOM   1438 C  C     . ASN A 1 187 ? -4.433  16.423  86.870 1.00 62.96  ? 213 ASN A C     1 
ATOM   1439 O  O     . ASN A 1 187 ? -5.444  15.855  86.454 1.00 56.27  ? 213 ASN A O     1 
ATOM   1440 C  CB    . ASN A 1 187 ? -5.980  17.774  88.309 1.00 65.75  ? 213 ASN A CB    1 
ATOM   1441 C  CG    . ASN A 1 187 ? -6.694  18.601  87.269 1.00 67.22  ? 213 ASN A CG    1 
ATOM   1442 O  OD1   . ASN A 1 187 ? -6.816  19.817  87.408 1.00 68.35  ? 213 ASN A OD1   1 
ATOM   1443 N  ND2   . ASN A 1 187 ? -7.177  17.943  86.216 1.00 64.69  ? 213 ASN A ND2   1 
ATOM   1444 N  N     . TRP A 1 188 ? -3.214  16.149  86.419 1.00 63.23  ? 214 TRP A N     1 
ATOM   1445 C  CA    . TRP A 1 188 ? -2.984  15.190  85.344 1.00 61.88  ? 214 TRP A CA    1 
ATOM   1446 C  C     . TRP A 1 188 ? -2.250  13.972  85.874 1.00 59.22  ? 214 TRP A C     1 
ATOM   1447 O  O     . TRP A 1 188 ? -1.171  14.098  86.448 1.00 56.01  ? 214 TRP A O     1 
ATOM   1448 C  CB    . TRP A 1 188 ? -2.185  15.825  84.201 1.00 62.89  ? 214 TRP A CB    1 
ATOM   1449 C  CG    . TRP A 1 188 ? -3.002  16.262  83.017 1.00 60.06  ? 214 TRP A CG    1 
ATOM   1450 C  CD1   . TRP A 1 188 ? -4.348  16.484  82.979 1.00 62.30  ? 214 TRP A CD1   1 
ATOM   1451 C  CD2   . TRP A 1 188 ? -2.511  16.548  81.701 1.00 58.55  ? 214 TRP A CD2   1 
ATOM   1452 N  NE1   . TRP A 1 188 ? -4.728  16.884  81.718 1.00 61.56  ? 214 TRP A NE1   1 
ATOM   1453 C  CE2   . TRP A 1 188 ? -3.619  16.931  80.916 1.00 59.12  ? 214 TRP A CE2   1 
ATOM   1454 C  CE3   . TRP A 1 188 ? -1.243  16.513  81.110 1.00 54.67  ? 214 TRP A CE3   1 
ATOM   1455 C  CZ2   . TRP A 1 188 ? -3.495  17.276  79.571 1.00 53.47  ? 214 TRP A CZ2   1 
ATOM   1456 C  CZ3   . TRP A 1 188 ? -1.124  16.857  79.772 1.00 50.63  ? 214 TRP A CZ3   1 
ATOM   1457 C  CH2   . TRP A 1 188 ? -2.243  17.234  79.019 1.00 51.17  ? 214 TRP A CH2   1 
ATOM   1458 N  N     . PRO A 1 189 ? -2.842  12.784  85.690 1.00 67.00  ? 215 PRO A N     1 
ATOM   1459 C  CA    . PRO A 1 189 ? -2.207  11.514  86.057 1.00 65.35  ? 215 PRO A CA    1 
ATOM   1460 C  C     . PRO A 1 189 ? -0.851  11.345  85.383 1.00 65.03  ? 215 PRO A C     1 
ATOM   1461 O  O     . PRO A 1 189 ? -0.601  11.942  84.337 1.00 67.34  ? 215 PRO A O     1 
ATOM   1462 C  CB    . PRO A 1 189 ? -3.205  10.456  85.558 1.00 67.09  ? 215 PRO A CB    1 
ATOM   1463 C  CG    . PRO A 1 189 ? -4.056  11.157  84.562 1.00 65.71  ? 215 PRO A CG    1 
ATOM   1464 C  CD    . PRO A 1 189 ? -4.147  12.575  85.042 1.00 68.66  ? 215 PRO A CD    1 
ATOM   1465 N  N     . GLU A 1 190 ? 0.009   10.533  85.986 1.00 64.07  ? 216 GLU A N     1 
ATOM   1466 C  CA    . GLU A 1 190 ? 1.388   10.394  85.537 1.00 62.44  ? 216 GLU A CA    1 
ATOM   1467 C  C     . GLU A 1 190 ? 1.506   9.926   84.085 1.00 64.54  ? 216 GLU A C     1 
ATOM   1468 O  O     . GLU A 1 190 ? 2.553   10.090  83.463 1.00 64.42  ? 216 GLU A O     1 
ATOM   1469 C  CB    . GLU A 1 190 ? 2.136   9.428   86.455 1.00 69.88  ? 216 GLU A CB    1 
ATOM   1470 C  CG    . GLU A 1 190 ? 2.358   9.957   87.860 1.00 75.84  ? 216 GLU A CG    1 
ATOM   1471 C  CD    . GLU A 1 190 ? 2.659   8.854   88.862 1.00 93.05  ? 216 GLU A CD    1 
ATOM   1472 O  OE1   . GLU A 1 190 ? 3.638   8.104   88.647 1.00 98.65  ? 216 GLU A OE1   1 
ATOM   1473 O  OE2   . GLU A 1 190 ? 1.912   8.736   89.861 1.00 90.37  ? 216 GLU A OE2   1 
ATOM   1474 N  N     . ASP A 1 191 ? 0.434   9.342   83.553 1.00 66.83  ? 217 ASP A N     1 
ATOM   1475 C  CA    . ASP A 1 191 ? 0.487   8.687   82.251 1.00 63.48  ? 217 ASP A CA    1 
ATOM   1476 C  C     . ASP A 1 191 ? 0.063   9.575   81.085 1.00 64.59  ? 217 ASP A C     1 
ATOM   1477 O  O     . ASP A 1 191 ? 0.106   9.137   79.935 1.00 68.36  ? 217 ASP A O     1 
ATOM   1478 C  CB    . ASP A 1 191 ? -0.384  7.433   82.267 1.00 65.56  ? 217 ASP A CB    1 
ATOM   1479 N  N     . LYS A 1 192 ? -0.344  10.810  81.371 1.00 67.95  ? 218 LYS A N     1 
ATOM   1480 C  CA    . LYS A 1 192 ? -0.488  11.816  80.321 1.00 61.53  ? 218 LYS A CA    1 
ATOM   1481 C  C     . LYS A 1 192 ? 0.756   12.687  80.210 1.00 52.11  ? 218 LYS A C     1 
ATOM   1482 O  O     . LYS A 1 192 ? 0.854   13.530  79.328 1.00 54.76  ? 218 LYS A O     1 
ATOM   1483 C  CB    . LYS A 1 192 ? -1.736  12.660  80.572 1.00 57.49  ? 218 LYS A CB    1 
ATOM   1484 C  CG    . LYS A 1 192 ? -2.870  11.867  81.191 1.00 66.95  ? 218 LYS A CG    1 
ATOM   1485 C  CD    . LYS A 1 192 ? -4.136  12.694  81.310 1.00 62.40  ? 218 LYS A CD    1 
ATOM   1486 C  CE    . LYS A 1 192 ? -4.694  13.023  79.931 1.00 58.63  ? 218 LYS A CE    1 
ATOM   1487 N  NZ    . LYS A 1 192 ? -6.072  13.578  80.011 1.00 59.75  ? 218 LYS A NZ    1 
ATOM   1488 N  N     . ARG A 1 193 ? 1.713   12.443  81.099 1.00 50.97  ? 219 ARG A N     1 
ATOM   1489 C  CA    . ARG A 1 193 ? 2.964   13.183  81.136 1.00 46.35  ? 219 ARG A CA    1 
ATOM   1490 C  C     . ARG A 1 193 ? 4.140   12.257  80.872 1.00 43.30  ? 219 ARG A C     1 
ATOM   1491 O  O     . ARG A 1 193 ? 5.281   12.581  81.199 1.00 41.23  ? 219 ARG A O     1 
ATOM   1492 C  CB    . ARG A 1 193 ? 3.134   13.858  82.496 1.00 46.44  ? 219 ARG A CB    1 
ATOM   1493 C  CG    . ARG A 1 193 ? 1.997   14.799  82.849 1.00 44.06  ? 219 ARG A CG    1 
ATOM   1494 C  CD    . ARG A 1 193 ? 2.221   15.430  84.203 1.00 47.18  ? 219 ARG A CD    1 
ATOM   1495 N  NE    . ARG A 1 193 ? 1.392   14.822  85.239 1.00 55.56  ? 219 ARG A NE    1 
ATOM   1496 C  CZ    . ARG A 1 193 ? 1.861   14.282  86.361 1.00 53.96  ? 219 ARG A CZ    1 
ATOM   1497 N  NH1   . ARG A 1 193 ? 3.164   14.263  86.606 1.00 47.62  ? 219 ARG A NH1   1 
ATOM   1498 N  NH2   . ARG A 1 193 ? 1.022   13.761  87.241 1.00 60.26  ? 219 ARG A NH2   1 
ATOM   1499 N  N     . ARG A 1 194 ? 3.855   11.104  80.276 1.00 49.89  ? 220 ARG A N     1 
ATOM   1500 C  CA    . ARG A 1 194 ? 4.879   10.090  80.045 1.00 56.02  ? 220 ARG A CA    1 
ATOM   1501 C  C     . ARG A 1 194 ? 5.196   9.957   78.563 1.00 49.95  ? 220 ARG A C     1 
ATOM   1502 O  O     . ARG A 1 194 ? 4.296   9.815   77.736 1.00 47.78  ? 220 ARG A O     1 
ATOM   1503 C  CB    . ARG A 1 194 ? 4.433   8.732   80.610 1.00 51.50  ? 220 ARG A CB    1 
ATOM   1504 C  CG    . ARG A 1 194 ? 5.553   7.701   80.716 1.00 56.26  ? 220 ARG A CG    1 
ATOM   1505 C  CD    . ARG A 1 194 ? 5.039   6.319   81.157 1.00 55.98  ? 220 ARG A CD    1 
ATOM   1506 N  NE    . ARG A 1 194 ? 4.320   6.364   82.426 1.00 58.47  ? 220 ARG A NE    1 
ATOM   1507 C  CZ    . ARG A 1 194 ? 4.905   6.255   83.615 1.00 62.98  ? 220 ARG A CZ    1 
ATOM   1508 N  NH1   . ARG A 1 194 ? 6.221   6.091   83.694 1.00 60.28  ? 220 ARG A NH1   1 
ATOM   1509 N  NH2   . ARG A 1 194 ? 4.178   6.315   84.724 1.00 58.80  ? 220 ARG A NH2   1 
ATOM   1510 N  N     . TYR A 1 195 ? 6.477   10.031  78.222 1.00 48.10  ? 221 TYR A N     1 
ATOM   1511 C  CA    . TYR A 1 195 ? 6.877   9.867   76.830 1.00 51.44  ? 221 TYR A CA    1 
ATOM   1512 C  C     . TYR A 1 195 ? 8.040   8.882   76.711 1.00 62.79  ? 221 TYR A C     1 
ATOM   1513 O  O     . TYR A 1 195 ? 8.858   8.751   77.626 1.00 65.19  ? 221 TYR A O     1 
ATOM   1514 C  CB    . TYR A 1 195 ? 7.212   11.227  76.209 1.00 47.36  ? 221 TYR A CB    1 
ATOM   1515 C  CG    . TYR A 1 195 ? 5.977   12.086  76.046 1.00 42.06  ? 221 TYR A CG    1 
ATOM   1516 C  CD1   . TYR A 1 195 ? 5.136   11.921  74.955 1.00 35.84  ? 221 TYR A CD1   1 
ATOM   1517 C  CD2   . TYR A 1 195 ? 5.636   13.039  76.997 1.00 44.73  ? 221 TYR A CD2   1 
ATOM   1518 C  CE1   . TYR A 1 195 ? 3.998   12.687  74.805 1.00 29.70  ? 221 TYR A CE1   1 
ATOM   1519 C  CE2   . TYR A 1 195 ? 4.497   13.813  76.857 1.00 40.90  ? 221 TYR A CE2   1 
ATOM   1520 C  CZ    . TYR A 1 195 ? 3.681   13.630  75.755 1.00 41.38  ? 221 TYR A CZ    1 
ATOM   1521 O  OH    . TYR A 1 195 ? 2.545   14.393  75.600 1.00 48.76  ? 221 TYR A OH    1 
ATOM   1522 N  N     . PHE A 1 196 ? 8.103   8.188   75.579 1.00 66.71  ? 222 PHE A N     1 
ATOM   1523 C  CA    . PHE A 1 196 ? 9.113   7.159   75.370 1.00 69.59  ? 222 PHE A CA    1 
ATOM   1524 C  C     . PHE A 1 196 ? 10.329  7.713   74.644 1.00 68.81  ? 222 PHE A C     1 
ATOM   1525 O  O     . PHE A 1 196 ? 10.202  8.546   73.745 1.00 70.50  ? 222 PHE A O     1 
ATOM   1526 C  CB    . PHE A 1 196 ? 8.532   5.996   74.568 1.00 71.75  ? 222 PHE A CB    1 
ATOM   1527 C  CG    . PHE A 1 196 ? 7.292   5.400   75.165 1.00 76.93  ? 222 PHE A CG    1 
ATOM   1528 C  CD1   . PHE A 1 196 ? 7.153   5.271   76.534 1.00 77.63  ? 222 PHE A CD1   1 
ATOM   1529 C  CD2   . PHE A 1 196 ? 6.262   4.965   74.351 1.00 87.34  ? 222 PHE A CD2   1 
ATOM   1530 C  CE1   . PHE A 1 196 ? 6.006   4.716   77.078 1.00 80.50  ? 222 PHE A CE1   1 
ATOM   1531 C  CE2   . PHE A 1 196 ? 5.114   4.411   74.888 1.00 83.08  ? 222 PHE A CE2   1 
ATOM   1532 C  CZ    . PHE A 1 196 ? 4.986   4.286   76.254 1.00 82.00  ? 222 PHE A CZ    1 
ATOM   1533 N  N     . ILE A 1 197 ? 11.508  7.244   75.038 1.00 66.00  ? 223 ILE A N     1 
ATOM   1534 C  CA    . ILE A 1 197 ? 12.732  7.576   74.322 1.00 68.13  ? 223 ILE A CA    1 
ATOM   1535 C  C     . ILE A 1 197 ? 12.848  6.697   73.076 1.00 76.57  ? 223 ILE A C     1 
ATOM   1536 O  O     . ILE A 1 197 ? 12.633  5.486   73.141 1.00 81.00  ? 223 ILE A O     1 
ATOM   1537 C  CB    . ILE A 1 197 ? 13.984  7.398   75.213 1.00 67.17  ? 223 ILE A CB    1 
ATOM   1538 C  CG1   . ILE A 1 197 ? 13.944  8.363   76.401 1.00 63.58  ? 223 ILE A CG1   1 
ATOM   1539 C  CG2   . ILE A 1 197 ? 15.258  7.599   74.407 1.00 67.79  ? 223 ILE A CG2   1 
ATOM   1540 C  CD1   . ILE A 1 197 ? 13.311  7.779   77.648 1.00 67.91  ? 223 ILE A CD1   1 
ATOM   1541 N  N     . LYS A 1 198 ? 13.171  7.313   71.941 1.00 73.18  ? 224 LYS A N     1 
ATOM   1542 C  CA    . LYS A 1 198 ? 13.269  6.597   70.670 1.00 68.59  ? 224 LYS A CA    1 
ATOM   1543 C  C     . LYS A 1 198 ? 14.408  5.581   70.691 1.00 73.39  ? 224 LYS A C     1 
ATOM   1544 O  O     . LYS A 1 198 ? 15.338  5.655   69.886 1.00 73.81  ? 224 LYS A O     1 
ATOM   1545 C  CB    . LYS A 1 198 ? 13.464  7.581   69.514 1.00 61.51  ? 224 LYS A CB    1 
ATOM   1546 N  N     . GLN A 1 255 ? 9.494   -1.652  77.681 1.00 76.02  ? 281 GLN A N     1 
ATOM   1547 C  CA    . GLN A 1 255 ? 9.050   -0.267  77.628 1.00 83.76  ? 281 GLN A CA    1 
ATOM   1548 C  C     . GLN A 1 255 ? 10.003  0.633   78.419 1.00 81.57  ? 281 GLN A C     1 
ATOM   1549 O  O     . GLN A 1 255 ? 10.368  0.327   79.558 1.00 73.51  ? 281 GLN A O     1 
ATOM   1550 C  CB    . GLN A 1 255 ? 7.625   -0.136  78.168 1.00 20.00  ? 281 GLN A CB    1 
ATOM   1551 N  N     . ASN A 1 256 ? 10.406  1.741   77.800 1.00 77.78  ? 282 ASN A N     1 
ATOM   1552 C  CA    . ASN A 1 256 ? 11.369  2.671   78.392 1.00 79.42  ? 282 ASN A CA    1 
ATOM   1553 C  C     . ASN A 1 256 ? 10.837  4.119   78.352 1.00 75.55  ? 282 ASN A C     1 
ATOM   1554 O  O     . ASN A 1 256 ? 10.734  4.723   77.288 1.00 72.24  ? 282 ASN A O     1 
ATOM   1555 C  CB    . ASN A 1 256 ? 12.719  2.547   77.670 1.00 71.15  ? 282 ASN A CB    1 
ATOM   1556 C  CG    . ASN A 1 256 ? 13.901  2.615   78.625 1.00 71.90  ? 282 ASN A CG    1 
ATOM   1557 O  OD1   . ASN A 1 256 ? 13.947  3.485   79.495 1.00 75.39  ? 282 ASN A OD1   1 
ATOM   1558 N  ND2   . ASN A 1 256 ? 14.857  1.696   78.472 1.00 64.00  ? 282 ASN A ND2   1 
ATOM   1559 N  N     . SER A 1 257 ? 10.518  4.670   79.521 1.00 75.67  ? 283 SER A N     1 
ATOM   1560 C  CA    . SER A 1 257 ? 9.898   5.992   79.618 1.00 67.38  ? 283 SER A CA    1 
ATOM   1561 C  C     . SER A 1 257 ? 10.617  7.086   80.410 1.00 61.97  ? 283 SER A C     1 
ATOM   1562 O  O     . SER A 1 257 ? 11.551  6.818   81.168 1.00 61.34  ? 283 SER A O     1 
ATOM   1563 C  CB    . SER A 1 257 ? 8.512   5.842   80.238 1.00 63.83  ? 283 SER A CB    1 
ATOM   1564 O  OG    . SER A 1 257 ? 7.730   4.910   79.522 1.00 71.31  ? 283 SER A OG    1 
ATOM   1565 N  N     . VAL A 1 258 ? 10.165  8.325   80.192 1.00 57.03  ? 284 VAL A N     1 
ATOM   1566 C  CA    . VAL A 1 258 ? 10.436  9.451   81.092 1.00 53.92  ? 284 VAL A CA    1 
ATOM   1567 C  C     . VAL A 1 258 ? 9.135   10.194  81.386 1.00 47.36  ? 284 VAL A C     1 
ATOM   1568 O  O     . VAL A 1 258 ? 8.174   10.112  80.612 1.00 45.24  ? 284 VAL A O     1 
ATOM   1569 C  CB    . VAL A 1 258 ? 11.473  10.456  80.523 1.00 46.98  ? 284 VAL A CB    1 
ATOM   1570 C  CG1   . VAL A 1 258 ? 12.869  9.851   80.507 1.00 55.57  ? 284 VAL A CG1   1 
ATOM   1571 C  CG2   . VAL A 1 258 ? 11.055  10.963  79.147 1.00 50.29  ? 284 VAL A CG2   1 
ATOM   1572 N  N     . VAL A 1 259 ? 9.111   10.916  82.506 1.00 48.04  ? 285 VAL A N     1 
ATOM   1573 C  CA    . VAL A 1 259 ? 7.924   11.656  82.936 1.00 45.75  ? 285 VAL A CA    1 
ATOM   1574 C  C     . VAL A 1 259 ? 8.245   13.127  83.186 1.00 38.07  ? 285 VAL A C     1 
ATOM   1575 O  O     . VAL A 1 259 ? 9.379   13.479  83.513 1.00 39.84  ? 285 VAL A O     1 
ATOM   1576 C  CB    . VAL A 1 259 ? 7.300   11.038  84.213 1.00 47.65  ? 285 VAL A CB    1 
ATOM   1577 C  CG1   . VAL A 1 259 ? 8.024   11.521  85.468 1.00 46.42  ? 285 VAL A CG1   1 
ATOM   1578 C  CG2   . VAL A 1 259 ? 5.809   11.361  84.290 1.00 41.42  ? 285 VAL A CG2   1 
ATOM   1579 N  N     . PHE A 1 260 ? 7.247   13.991  83.038 1.00 37.76  ? 286 PHE A N     1 
ATOM   1580 C  CA    . PHE A 1 260 ? 7.466   15.420  83.236 1.00 38.75  ? 286 PHE A CA    1 
ATOM   1581 C  C     . PHE A 1 260 ? 6.478   15.998  84.240 1.00 37.65  ? 286 PHE A C     1 
ATOM   1582 O  O     . PHE A 1 260 ? 5.357   15.508  84.379 1.00 36.54  ? 286 PHE A O     1 
ATOM   1583 C  CB    . PHE A 1 260 ? 7.380   16.164  81.897 1.00 35.19  ? 286 PHE A CB    1 
ATOM   1584 C  CG    . PHE A 1 260 ? 8.489   15.814  80.945 1.00 31.34  ? 286 PHE A CG    1 
ATOM   1585 C  CD1   . PHE A 1 260 ? 9.760   16.336  81.124 1.00 26.77  ? 286 PHE A CD1   1 
ATOM   1586 C  CD2   . PHE A 1 260 ? 8.269   14.942  79.890 1.00 29.58  ? 286 PHE A CD2   1 
ATOM   1587 C  CE1   . PHE A 1 260 ? 10.788  16.006  80.262 1.00 28.19  ? 286 PHE A CE1   1 
ATOM   1588 C  CE2   . PHE A 1 260 ? 9.290   14.610  79.023 1.00 28.23  ? 286 PHE A CE2   1 
ATOM   1589 C  CZ    . PHE A 1 260 ? 10.552  15.142  79.208 1.00 27.28  ? 286 PHE A CZ    1 
ATOM   1590 N  N     . GLY A 1 261 ? 6.911   17.041  84.940 1.00 33.24  ? 287 GLY A N     1 
ATOM   1591 C  CA    . GLY A 1 261 ? 6.116   17.643  85.992 1.00 41.13  ? 287 GLY A CA    1 
ATOM   1592 C  C     . GLY A 1 261 ? 4.923   18.453  85.522 1.00 44.16  ? 287 GLY A C     1 
ATOM   1593 O  O     . GLY A 1 261 ? 4.506   18.375  84.363 1.00 37.07  ? 287 GLY A O     1 
ATOM   1594 N  N     . THR A 1 262 ? 4.376   19.246  86.439 1.00 44.36  ? 288 THR A N     1 
ATOM   1595 C  CA    . THR A 1 262 ? 3.207   20.065  86.153 1.00 44.54  ? 288 THR A CA    1 
ATOM   1596 C  C     . THR A 1 262 ? 3.536   21.557  86.146 1.00 39.44  ? 288 THR A C     1 
ATOM   1597 O  O     . THR A 1 262 ? 2.651   22.396  85.974 1.00 37.06  ? 288 THR A O     1 
ATOM   1598 C  CB    . THR A 1 262 ? 2.092   19.797  87.177 1.00 43.87  ? 288 THR A CB    1 
ATOM   1599 O  OG1   . THR A 1 262 ? 2.627   19.917  88.501 1.00 41.80  ? 288 THR A OG1   1 
ATOM   1600 C  CG2   . THR A 1 262 ? 1.540   18.402  86.992 1.00 45.11  ? 288 THR A CG2   1 
ATOM   1601 N  N     . SER A 1 263 ? 4.810   21.882  86.342 1.00 32.32  ? 289 SER A N     1 
ATOM   1602 C  CA    . SER A 1 263 ? 5.246   23.272  86.349 1.00 32.88  ? 289 SER A CA    1 
ATOM   1603 C  C     . SER A 1 263 ? 5.506   23.748  84.920 1.00 39.29  ? 289 SER A C     1 
ATOM   1604 O  O     . SER A 1 263 ? 5.704   22.931  84.018 1.00 40.74  ? 289 SER A O     1 
ATOM   1605 C  CB    . SER A 1 263 ? 6.492   23.441  87.218 1.00 28.72  ? 289 SER A CB    1 
ATOM   1606 O  OG    . SER A 1 263 ? 7.604   22.783  86.652 1.00 30.01  ? 289 SER A OG    1 
ATOM   1607 N  N     . ALA A 1 264 ? 5.487   25.062  84.713 1.00 31.72  ? 290 ALA A N     1 
ATOM   1608 C  CA    . ALA A 1 264 ? 5.723   25.630  83.391 1.00 32.55  ? 290 ALA A CA    1 
ATOM   1609 C  C     . ALA A 1 264 ? 7.074   25.194  82.843 1.00 32.65  ? 290 ALA A C     1 
ATOM   1610 O  O     . ALA A 1 264 ? 7.184   24.774  81.683 1.00 35.18  ? 290 ALA A O     1 
ATOM   1611 C  CB    . ALA A 1 264 ? 5.633   27.150  83.440 1.00 30.58  ? 290 ALA A CB    1 
ATOM   1612 N  N     . GLN A 1 265 ? 8.091   25.290  83.695 1.00 29.91  ? 291 GLN A N     1 
ATOM   1613 C  CA    . GLN A 1 265 ? 9.438   24.860  83.352 1.00 34.46  ? 291 GLN A CA    1 
ATOM   1614 C  C     . GLN A 1 265 ? 9.397   23.433  82.791 1.00 37.41  ? 291 GLN A C     1 
ATOM   1615 O  O     . GLN A 1 265 ? 9.995   23.124  81.748 1.00 37.33  ? 291 GLN A O     1 
ATOM   1616 C  CB    . GLN A 1 265 ? 10.337  24.936  84.586 1.00 32.71  ? 291 GLN A CB    1 
ATOM   1617 C  CG    . GLN A 1 265 ? 11.823  24.956  84.300 1.00 37.82  ? 291 GLN A CG    1 
ATOM   1618 C  CD    . GLN A 1 265 ? 12.389  26.368  84.280 1.00 43.85  ? 291 GLN A CD    1 
ATOM   1619 O  OE1   . GLN A 1 265 ? 11.878  27.263  84.959 1.00 46.26  ? 291 GLN A OE1   1 
ATOM   1620 N  NE2   . GLN A 1 265 ? 13.461  26.570  83.517 1.00 39.57  ? 291 GLN A NE2   1 
ATOM   1621 N  N     . GLU A 1 266 ? 8.631   22.586  83.471 1.00 34.94  ? 292 GLU A N     1 
ATOM   1622 C  CA    . GLU A 1 266 ? 8.504   21.187  83.102 1.00 32.05  ? 292 GLU A CA    1 
ATOM   1623 C  C     . GLU A 1 266 ? 7.748   20.981  81.795 1.00 33.81  ? 292 GLU A C     1 
ATOM   1624 O  O     . GLU A 1 266 ? 8.188   20.204  80.949 1.00 33.62  ? 292 GLU A O     1 
ATOM   1625 C  CB    . GLU A 1 266 ? 7.828   20.407  84.229 1.00 36.31  ? 292 GLU A CB    1 
ATOM   1626 C  CG    . GLU A 1 266 ? 8.749   20.159  85.402 1.00 39.33  ? 292 GLU A CG    1 
ATOM   1627 C  CD    . GLU A 1 266 ? 9.832   19.151  85.073 1.00 38.36  ? 292 GLU A CD    1 
ATOM   1628 O  OE1   . GLU A 1 266 ? 9.488   17.974  84.825 1.00 36.30  ? 292 GLU A OE1   1 
ATOM   1629 O  OE2   . GLU A 1 266 ? 11.022  19.536  85.053 1.00 33.89  ? 292 GLU A OE2   1 
ATOM   1630 N  N     . VAL A 1 267 ? 6.612   21.656  81.634 1.00 35.10  ? 293 VAL A N     1 
ATOM   1631 C  CA    . VAL A 1 267 ? 5.887   21.635  80.365 1.00 35.32  ? 293 VAL A CA    1 
ATOM   1632 C  C     . VAL A 1 267 ? 6.830   21.954  79.207 1.00 31.33  ? 293 VAL A C     1 
ATOM   1633 O  O     . VAL A 1 267 ? 6.858   21.253  78.185 1.00 28.29  ? 293 VAL A O     1 
ATOM   1634 C  CB    . VAL A 1 267 ? 4.724   22.646  80.356 1.00 34.26  ? 293 VAL A CB    1 
ATOM   1635 C  CG1   . VAL A 1 267 ? 4.019   22.628  79.018 1.00 29.00  ? 293 VAL A CG1   1 
ATOM   1636 C  CG2   . VAL A 1 267 ? 3.745   22.340  81.453 1.00 36.75  ? 293 VAL A CG2   1 
ATOM   1637 N  N     . VAL A 1 268 ? 7.618   23.008  79.386 1.00 26.92  ? 294 VAL A N     1 
ATOM   1638 C  CA    . VAL A 1 268 ? 8.565   23.402  78.356 1.00 30.73  ? 294 VAL A CA    1 
ATOM   1639 C  C     . VAL A 1 268 ? 9.665   22.364  78.101 1.00 31.32  ? 294 VAL A C     1 
ATOM   1640 O  O     . VAL A 1 268 ? 9.982   22.102  76.935 1.00 33.06  ? 294 VAL A O     1 
ATOM   1641 C  CB    . VAL A 1 268 ? 9.186   24.775  78.681 1.00 31.24  ? 294 VAL A CB    1 
ATOM   1642 C  CG1   . VAL A 1 268 ? 10.446  25.008  77.881 1.00 28.72  ? 294 VAL A CG1   1 
ATOM   1643 C  CG2   . VAL A 1 268 ? 8.173   25.867  78.388 1.00 26.87  ? 294 VAL A CG2   1 
ATOM   1644 N  N     . LYS A 1 269 ? 10.246  21.754  79.138 1.00 32.73  ? 295 LYS A N     1 
ATOM   1645 C  CA    . LYS A 1 269 ? 11.247  20.715  78.828 1.00 32.49  ? 295 LYS A CA    1 
ATOM   1646 C  C     . LYS A 1 269 ? 10.602  19.464  78.205 1.00 29.90  ? 295 LYS A C     1 
ATOM   1647 O  O     . LYS A 1 269 ? 11.263  18.713  77.477 1.00 21.55  ? 295 LYS A O     1 
ATOM   1648 C  CB    . LYS A 1 269 ? 12.093  20.320  80.050 1.00 27.03  ? 295 LYS A CB    1 
ATOM   1649 C  CG    . LYS A 1 269 ? 11.470  20.531  81.393 1.00 32.83  ? 295 LYS A CG    1 
ATOM   1650 C  CD    . LYS A 1 269 ? 12.514  20.416  82.503 1.00 45.52  ? 295 LYS A CD    1 
ATOM   1651 C  CE    . LYS A 1 269 ? 13.771  21.234  82.233 1.00 43.54  ? 295 LYS A CE    1 
ATOM   1652 N  NZ    . LYS A 1 269 ? 14.727  21.141  83.386 1.00 40.10  ? 295 LYS A NZ    1 
ATOM   1653 N  N     . GLU A 1 270 ? 9.316   19.253  78.476 1.00 29.68  ? 296 GLU A N     1 
ATOM   1654 C  CA    . GLU A 1 270 ? 8.562   18.206  77.797 1.00 27.28  ? 296 GLU A CA    1 
ATOM   1655 C  C     . GLU A 1 270 ? 8.488   18.512  76.317 1.00 27.75  ? 296 GLU A C     1 
ATOM   1656 O  O     . GLU A 1 270 ? 8.816   17.666  75.491 1.00 28.77  ? 296 GLU A O     1 
ATOM   1657 C  CB    . GLU A 1 270 ? 7.146   18.072  78.363 1.00 31.32  ? 296 GLU A CB    1 
ATOM   1658 C  CG    . GLU A 1 270 ? 6.287   17.045  77.627 1.00 29.97  ? 296 GLU A CG    1 
ATOM   1659 C  CD    . GLU A 1 270 ? 4.949   16.784  78.300 1.00 36.50  ? 296 GLU A CD    1 
ATOM   1660 O  OE1   . GLU A 1 270 ? 4.942   16.357  79.468 1.00 44.45  ? 296 GLU A OE1   1 
ATOM   1661 O  OE2   . GLU A 1 270 ? 3.899   17.010  77.663 1.00 40.67  ? 296 GLU A OE2   1 
ATOM   1662 N  N     . ILE A 1 271 ? 8.050   19.725  75.987 1.00 29.98  ? 297 ILE A N     1 
ATOM   1663 C  CA    . ILE A 1 271 ? 7.946   20.142  74.589 1.00 30.76  ? 297 ILE A CA    1 
ATOM   1664 C  C     . ILE A 1 271 ? 9.281   20.038  73.867 1.00 24.88  ? 297 ILE A C     1 
ATOM   1665 O  O     . ILE A 1 271 ? 9.363   19.486  72.772 1.00 24.75  ? 297 ILE A O     1 
ATOM   1666 C  CB    . ILE A 1 271 ? 7.421   21.591  74.461 1.00 29.91  ? 297 ILE A CB    1 
ATOM   1667 C  CG1   . ILE A 1 271 ? 6.037   21.717  75.096 1.00 37.13  ? 297 ILE A CG1   1 
ATOM   1668 C  CG2   . ILE A 1 271 ? 7.319   21.995  73.013 1.00 27.95  ? 297 ILE A CG2   1 
ATOM   1669 C  CD1   . ILE A 1 271 ? 5.420   23.091  74.939 1.00 34.02  ? 297 ILE A CD1   1 
ATOM   1670 N  N     . ARG A 1 272 ? 10.326  20.571  74.482 1.00 22.83  ? 298 ARG A N     1 
ATOM   1671 C  CA    . ARG A 1 272 ? 11.655  20.487  73.895 1.00 25.78  ? 298 ARG A CA    1 
ATOM   1672 C  C     . ARG A 1 272 ? 12.091  19.038  73.690 1.00 26.97  ? 298 ARG A C     1 
ATOM   1673 O  O     . ARG A 1 272 ? 12.713  18.704  72.673 1.00 28.14  ? 298 ARG A O     1 
ATOM   1674 C  CB    . ARG A 1 272 ? 12.656  21.249  74.762 1.00 31.02  ? 298 ARG A CB    1 
ATOM   1675 C  CG    . ARG A 1 272 ? 12.396  22.753  74.753 1.00 32.70  ? 298 ARG A CG    1 
ATOM   1676 C  CD    . ARG A 1 272 ? 13.351  23.521  75.635 1.00 36.83  ? 298 ARG A CD    1 
ATOM   1677 N  NE    . ARG A 1 272 ? 14.749  23.167  75.417 1.00 36.06  ? 298 ARG A NE    1 
ATOM   1678 C  CZ    . ARG A 1 272 ? 15.554  22.734  76.380 1.00 36.10  ? 298 ARG A CZ    1 
ATOM   1679 N  NH1   . ARG A 1 272 ? 15.093  22.611  77.615 1.00 28.84  ? 298 ARG A NH1   1 
ATOM   1680 N  NH2   . ARG A 1 272 ? 16.816  22.439  76.114 1.00 35.61  ? 298 ARG A NH2   1 
ATOM   1681 N  N     . PHE A 1 273 ? 11.743  18.183  74.651 1.00 27.83  ? 299 PHE A N     1 
ATOM   1682 C  CA    . PHE A 1 273 ? 12.053  16.760  74.568 1.00 24.04  ? 299 PHE A CA    1 
ATOM   1683 C  C     . PHE A 1 273 ? 11.372  16.115  73.367 1.00 28.43  ? 299 PHE A C     1 
ATOM   1684 O  O     . PHE A 1 273 ? 12.029  15.504  72.519 1.00 28.23  ? 299 PHE A O     1 
ATOM   1685 C  CB    . PHE A 1 273 ? 11.635  16.035  75.855 1.00 32.34  ? 299 PHE A CB    1 
ATOM   1686 C  CG    . PHE A 1 273 ? 11.810  14.534  75.796 1.00 36.15  ? 299 PHE A CG    1 
ATOM   1687 C  CD1   . PHE A 1 273 ? 13.075  13.966  75.852 1.00 33.29  ? 299 PHE A CD1   1 
ATOM   1688 C  CD2   . PHE A 1 273 ? 10.707  13.695  75.690 1.00 31.82  ? 299 PHE A CD2   1 
ATOM   1689 C  CE1   . PHE A 1 273 ? 13.235  12.599  75.790 1.00 31.44  ? 299 PHE A CE1   1 
ATOM   1690 C  CE2   . PHE A 1 273 ? 10.865  12.328  75.631 1.00 33.21  ? 299 PHE A CE2   1 
ATOM   1691 C  CZ    . PHE A 1 273 ? 12.131  11.782  75.682 1.00 38.55  ? 299 PHE A CZ    1 
ATOM   1692 N  N     . ARG A 1 274 ? 10.052  16.254  73.305 1.00 24.80  ? 300 ARG A N     1 
ATOM   1693 C  CA    . ARG A 1 274 ? 9.269   15.746  72.186 1.00 23.78  ? 300 ARG A CA    1 
ATOM   1694 C  C     . ARG A 1 274 ? 9.811   16.244  70.849 1.00 28.46  ? 300 ARG A C     1 
ATOM   1695 O  O     . ARG A 1 274 ? 9.908   15.471  69.901 1.00 34.31  ? 300 ARG A O     1 
ATOM   1696 C  CB    . ARG A 1 274 ? 7.800   16.139  72.345 1.00 19.04  ? 300 ARG A CB    1 
ATOM   1697 C  CG    . ARG A 1 274 ? 7.192   15.653  73.644 1.00 27.19  ? 300 ARG A CG    1 
ATOM   1698 C  CD    . ARG A 1 274 ? 5.738   16.015  73.752 1.00 24.31  ? 300 ARG A CD    1 
ATOM   1699 N  NE    . ARG A 1 274 ? 5.002   15.607  72.566 1.00 24.31  ? 300 ARG A NE    1 
ATOM   1700 C  CZ    . ARG A 1 274 ? 3.725   15.894  72.351 1.00 30.09  ? 300 ARG A CZ    1 
ATOM   1701 N  NH1   . ARG A 1 274 ? 3.047   16.608  73.239 1.00 29.19  ? 300 ARG A NH1   1 
ATOM   1702 N  NH2   . ARG A 1 274 ? 3.130   15.481  71.240 1.00 27.78  ? 300 ARG A NH2   1 
ATOM   1703 N  N     . ILE A 1 275 ? 10.158  17.529  70.771 1.00 26.64  ? 301 ILE A N     1 
ATOM   1704 C  CA    . ILE A 1 275 ? 10.773  18.079  69.563 1.00 28.64  ? 301 ILE A CA    1 
ATOM   1705 C  C     . ILE A 1 275 ? 12.056  17.347  69.211 1.00 32.28  ? 301 ILE A C     1 
ATOM   1706 O  O     . ILE A 1 275 ? 12.244  16.958  68.056 1.00 34.91  ? 301 ILE A O     1 
ATOM   1707 C  CB    . ILE A 1 275 ? 11.076  19.595  69.696 1.00 31.71  ? 301 ILE A CB    1 
ATOM   1708 C  CG1   . ILE A 1 275 ? 9.803   20.417  69.505 1.00 27.02  ? 301 ILE A CG1   1 
ATOM   1709 C  CG2   . ILE A 1 275 ? 12.109  20.042  68.675 1.00 22.48  ? 301 ILE A CG2   1 
ATOM   1710 C  CD1   . ILE A 1 275 ? 9.920   21.828  70.032 1.00 20.24  ? 301 ILE A CD1   1 
ATOM   1711 N  N     . GLU A 1 276 ? 12.938  17.148  70.189 1.00 27.46  ? 302 GLU A N     1 
ATOM   1712 C  CA    . GLU A 1 276 ? 14.180  16.436  69.891 1.00 32.93  ? 302 GLU A CA    1 
ATOM   1713 C  C     . GLU A 1 276 ? 13.927  14.984  69.452 1.00 36.75  ? 302 GLU A C     1 
ATOM   1714 O  O     . GLU A 1 276 ? 14.631  14.453  68.595 1.00 33.08  ? 302 GLU A O     1 
ATOM   1715 C  CB    . GLU A 1 276 ? 15.130  16.458  71.087 1.00 29.18  ? 302 GLU A CB    1 
ATOM   1716 C  CG    . GLU A 1 276 ? 16.420  15.698  70.821 1.00 36.88  ? 302 GLU A CG    1 
ATOM   1717 C  CD    . GLU A 1 276 ? 17.596  16.185  71.650 1.00 55.86  ? 302 GLU A CD    1 
ATOM   1718 O  OE1   . GLU A 1 276 ? 17.378  16.925  72.636 1.00 61.10  ? 302 GLU A OE1   1 
ATOM   1719 O  OE2   . GLU A 1 276 ? 18.746  15.822  71.309 1.00 58.07  ? 302 GLU A OE2   1 
ATOM   1720 N  N     . GLN A 1 277 ? 12.913  14.346  70.023 1.00 37.52  ? 303 GLN A N     1 
ATOM   1721 C  CA    . GLN A 1 277 ? 12.593  12.967  69.665 1.00 37.11  ? 303 GLN A CA    1 
ATOM   1722 C  C     . GLN A 1 277 ? 12.048  12.867  68.242 1.00 39.62  ? 303 GLN A C     1 
ATOM   1723 O  O     . GLN A 1 277 ? 12.489  12.031  67.455 1.00 43.26  ? 303 GLN A O     1 
ATOM   1724 C  CB    . GLN A 1 277 ? 11.587  12.366  70.653 1.00 41.04  ? 303 GLN A CB    1 
ATOM   1725 C  CG    . GLN A 1 277 ? 12.152  12.051  72.044 1.00 41.02  ? 303 GLN A CG    1 
ATOM   1726 C  CD    . GLN A 1 277 ? 13.435  11.236  71.992 1.00 48.62  ? 303 GLN A CD    1 
ATOM   1727 O  OE1   . GLN A 1 277 ? 13.400  10.021  71.800 1.00 52.92  ? 303 GLN A OE1   1 
ATOM   1728 N  NE2   . GLN A 1 277 ? 14.572  11.899  72.183 1.00 44.67  ? 303 GLN A NE2   1 
ATOM   1729 N  N     . LYS A 1 278 ? 11.086  13.722  67.922 1.00 38.46  ? 304 LYS A N     1 
ATOM   1730 C  CA    A LYS A 1 278 ? 10.405  13.670  66.636 0.30 35.56  ? 304 LYS A CA    1 
ATOM   1731 C  CA    B LYS A 1 278 ? 10.402  13.676  66.633 0.70 35.60  ? 304 LYS A CA    1 
ATOM   1732 C  C     . LYS A 1 278 ? 11.267  14.187  65.483 1.00 38.22  ? 304 LYS A C     1 
ATOM   1733 O  O     . LYS A 1 278 ? 11.190  13.676  64.367 1.00 43.99  ? 304 LYS A O     1 
ATOM   1734 C  CB    A LYS A 1 278 ? 9.098   14.464  66.709 0.30 35.43  ? 304 LYS A CB    1 
ATOM   1735 C  CB    B LYS A 1 278 ? 9.103   14.486  66.700 0.70 35.50  ? 304 LYS A CB    1 
ATOM   1736 C  CG    A LYS A 1 278 ? 8.270   14.425  65.440 0.30 35.44  ? 304 LYS A CG    1 
ATOM   1737 C  CG    B LYS A 1 278 ? 8.215   14.350  65.475 0.70 35.27  ? 304 LYS A CG    1 
ATOM   1738 C  CD    A LYS A 1 278 ? 8.059   12.997  64.968 0.30 38.14  ? 304 LYS A CD    1 
ATOM   1739 C  CD    B LYS A 1 278 ? 6.856   13.769  65.841 0.70 38.63  ? 304 LYS A CD    1 
ATOM   1740 C  CE    A LYS A 1 278 ? 7.324   12.967  63.644 0.30 38.85  ? 304 LYS A CE    1 
ATOM   1741 C  CE    B LYS A 1 278 ? 5.818   14.857  66.086 0.70 40.22  ? 304 LYS A CE    1 
ATOM   1742 N  NZ    A LYS A 1 278 ? 7.378   11.630  62.996 0.30 39.91  ? 304 LYS A NZ    1 
ATOM   1743 N  NZ    B LYS A 1 278 ? 5.342   15.471  64.809 0.70 40.69  ? 304 LYS A NZ    1 
ATOM   1744 N  N     . THR A 1 279 ? 12.095  15.193  65.747 1.00 37.93  ? 305 THR A N     1 
ATOM   1745 C  CA    . THR A 1 279 ? 12.848  15.828  64.664 1.00 32.89  ? 305 THR A CA    1 
ATOM   1746 C  C     . THR A 1 279 ? 14.367  15.674  64.735 1.00 31.27  ? 305 THR A C     1 
ATOM   1747 O  O     . THR A 1 279 ? 15.050  15.974  63.763 1.00 33.42  ? 305 THR A O     1 
ATOM   1748 C  CB    . THR A 1 279 ? 12.537  17.347  64.588 1.00 35.63  ? 305 THR A CB    1 
ATOM   1749 O  OG1   . THR A 1 279 ? 13.078  18.010  65.736 1.00 34.78  ? 305 THR A OG1   1 
ATOM   1750 C  CG2   . THR A 1 279 ? 11.034  17.597  64.522 1.00 33.47  ? 305 THR A CG2   1 
ATOM   1751 N  N     . THR A 1 280 ? 14.888  15.253  65.885 1.00 35.00  ? 306 THR A N     1 
ATOM   1752 C  CA    . THR A 1 280 ? 16.336  15.146  66.109 1.00 36.68  ? 306 THR A CA    1 
ATOM   1753 C  C     . THR A 1 280 ? 16.989  16.532  66.083 1.00 34.38  ? 306 THR A C     1 
ATOM   1754 O  O     . THR A 1 280 ? 18.160  16.687  65.731 1.00 34.69  ? 306 THR A O     1 
ATOM   1755 C  CB    . THR A 1 280 ? 17.020  14.206  65.084 1.00 35.73  ? 306 THR A CB    1 
ATOM   1756 O  OG1   . THR A 1 280 ? 16.137  13.120  64.777 1.00 42.60  ? 306 THR A OG1   1 
ATOM   1757 C  CG2   . THR A 1 280 ? 18.316  13.640  65.652 1.00 28.98  ? 306 THR A CG2   1 
ATOM   1758 N  N     . LEU A 1 281 ? 16.216  17.542  66.466 1.00 32.57  ? 307 LEU A N     1 
ATOM   1759 C  CA    . LEU A 1 281 ? 16.717  18.909  66.505 1.00 34.48  ? 307 LEU A CA    1 
ATOM   1760 C  C     . LEU A 1 281 ? 16.385  19.570  67.838 1.00 34.28  ? 307 LEU A C     1 
ATOM   1761 O  O     . LEU A 1 281 ? 15.330  19.320  68.424 1.00 35.31  ? 307 LEU A O     1 
ATOM   1762 C  CB    . LEU A 1 281 ? 16.133  19.730  65.353 1.00 33.38  ? 307 LEU A CB    1 
ATOM   1763 C  CG    . LEU A 1 281 ? 16.263  19.189  63.929 1.00 27.19  ? 307 LEU A CG    1 
ATOM   1764 C  CD1   . LEU A 1 281 ? 15.310  19.921  63.019 1.00 25.13  ? 307 LEU A CD1   1 
ATOM   1765 C  CD2   . LEU A 1 281 ? 17.693  19.321  63.424 1.00 26.38  ? 307 LEU A CD2   1 
ATOM   1766 N  N     . THR A 1 282 ? 17.292  20.413  68.315 1.00 34.13  ? 308 THR A N     1 
ATOM   1767 C  CA    . THR A 1 282 ? 17.102  21.087  69.595 1.00 37.43  ? 308 THR A CA    1 
ATOM   1768 C  C     . THR A 1 282 ? 16.489  22.474  69.428 1.00 33.70  ? 308 THR A C     1 
ATOM   1769 O  O     . THR A 1 282 ? 16.708  23.143  68.419 1.00 33.98  ? 308 THR A O     1 
ATOM   1770 C  CB    . THR A 1 282 ? 18.430  21.223  70.356 1.00 41.69  ? 308 THR A CB    1 
ATOM   1771 O  OG1   . THR A 1 282 ? 19.328  22.057  69.614 1.00 36.01  ? 308 THR A OG1   1 
ATOM   1772 C  CG2   . THR A 1 282 ? 19.060  19.848  70.580 1.00 39.87  ? 308 THR A CG2   1 
ATOM   1773 N  N     . ALA A 1 283 ? 15.725  22.899  70.428 1.00 34.86  ? 309 ALA A N     1 
ATOM   1774 C  CA    . ALA A 1 283 ? 15.144  24.234  70.443 1.00 29.02  ? 309 ALA A CA    1 
ATOM   1775 C  C     . ALA A 1 283 ? 15.426  24.917  71.773 1.00 30.18  ? 309 ALA A C     1 
ATOM   1776 O  O     . ALA A 1 283 ? 15.595  24.258  72.795 1.00 37.37  ? 309 ALA A O     1 
ATOM   1777 C  CB    . ALA A 1 283 ? 13.645  24.163  70.190 1.00 23.81  ? 309 ALA A CB    1 
ATOM   1778 N  N     . SER A 1 284 ? 15.468  26.240  71.764 1.00 30.87  ? 310 SER A N     1 
ATOM   1779 C  CA    . SER A 1 284 ? 15.502  26.989  73.007 1.00 29.62  ? 310 SER A CA    1 
ATOM   1780 C  C     . SER A 1 284 ? 14.120  27.541  73.298 1.00 28.95  ? 310 SER A C     1 
ATOM   1781 O  O     . SER A 1 284 ? 13.276  27.638  72.402 1.00 26.78  ? 310 SER A O     1 
ATOM   1782 C  CB    . SER A 1 284 ? 16.525  28.118  72.941 1.00 33.48  ? 310 SER A CB    1 
ATOM   1783 O  OG    . SER A 1 284 ? 17.843  27.603  72.918 1.00 35.56  ? 310 SER A OG    1 
ATOM   1784 N  N     . ALA A 1 285 ? 13.883  27.886  74.558 1.00 28.11  ? 311 ALA A N     1 
ATOM   1785 C  CA    . ALA A 1 285 ? 12.591  28.422  74.952 1.00 24.98  ? 311 ALA A CA    1 
ATOM   1786 C  C     . ALA A 1 285 ? 12.715  29.494  76.024 1.00 29.45  ? 311 ALA A C     1 
ATOM   1787 O  O     . ALA A 1 285 ? 13.701  29.556  76.763 1.00 27.74  ? 311 ALA A O     1 
ATOM   1788 C  CB    . ALA A 1 285 ? 11.686  27.311  75.426 1.00 26.41  ? 311 ALA A CB    1 
ATOM   1789 N  N     . GLY A 1 286 ? 11.695  30.340  76.098 1.00 29.18  ? 312 GLY A N     1 
ATOM   1790 C  CA    . GLY A 1 286 ? 11.663  31.413  77.066 1.00 24.39  ? 312 GLY A CA    1 
ATOM   1791 C  C     . GLY A 1 286 ? 10.304  31.419  77.717 1.00 24.16  ? 312 GLY A C     1 
ATOM   1792 O  O     . GLY A 1 286 ? 9.291   31.262  77.045 1.00 25.25  ? 312 GLY A O     1 
ATOM   1793 N  N     . ILE A 1 287 ? 10.280  31.578  79.033 1.00 25.40  ? 313 ILE A N     1 
ATOM   1794 C  CA    . ILE A 1 287 ? 9.031   31.505  79.775 1.00 26.51  ? 313 ILE A CA    1 
ATOM   1795 C  C     . ILE A 1 287 ? 8.843   32.784  80.593 1.00 32.21  ? 313 ILE A C     1 
ATOM   1796 O  O     . ILE A 1 287 ? 9.687   33.135  81.419 1.00 34.24  ? 313 ILE A O     1 
ATOM   1797 C  CB    . ILE A 1 287 ? 8.996   30.275  80.705 1.00 28.02  ? 313 ILE A CB    1 
ATOM   1798 C  CG1   . ILE A 1 287 ? 9.651   29.067  80.029 1.00 29.26  ? 313 ILE A CG1   1 
ATOM   1799 C  CG2   . ILE A 1 287 ? 7.568   29.966  81.122 1.00 28.22  ? 313 ILE A CG2   1 
ATOM   1800 C  CD1   . ILE A 1 287 ? 9.765   27.837  80.910 1.00 32.85  ? 313 ILE A CD1   1 
ATOM   1801 N  N     . ALA A 1 288 ? 7.741   33.486  80.361 1.00 29.61  ? 314 ALA A N     1 
ATOM   1802 C  CA    . ALA A 1 288 ? 7.543   34.778  81.001 1.00 30.74  ? 314 ALA A CA    1 
ATOM   1803 C  C     . ALA A 1 288 ? 6.078   35.178  80.956 1.00 32.22  ? 314 ALA A C     1 
ATOM   1804 O  O     . ALA A 1 288 ? 5.299   34.569  80.238 1.00 29.04  ? 314 ALA A O     1 
ATOM   1805 C  CB    . ALA A 1 288 ? 8.410   35.828  80.328 1.00 29.14  ? 314 ALA A CB    1 
ATOM   1806 N  N     . PRO A 1 289 ? 5.691   36.192  81.744 1.00 31.85  ? 315 PRO A N     1 
ATOM   1807 C  CA    . PRO A 1 289 ? 4.273   36.579  81.747 1.00 34.21  ? 315 PRO A CA    1 
ATOM   1808 C  C     . PRO A 1 289 ? 3.818   37.398  80.533 1.00 31.21  ? 315 PRO A C     1 
ATOM   1809 O  O     . PRO A 1 289 ? 2.617   37.634  80.414 1.00 32.64  ? 315 PRO A O     1 
ATOM   1810 C  CB    . PRO A 1 289 ? 4.135   37.411  83.029 1.00 32.48  ? 315 PRO A CB    1 
ATOM   1811 C  CG    . PRO A 1 289 ? 5.522   37.781  83.418 1.00 32.28  ? 315 PRO A CG    1 
ATOM   1812 C  CD    . PRO A 1 289 ? 6.411   36.702  82.922 1.00 27.17  ? 315 PRO A CD    1 
ATOM   1813 N  N     . ASN A 1 290 ? 4.736   37.823  79.666 1.00 29.80  ? 316 ASN A N     1 
ATOM   1814 C  CA    . ASN A 1 290 ? 4.343   38.465  78.407 1.00 35.83  ? 316 ASN A CA    1 
ATOM   1815 C  C     . ASN A 1 290 ? 5.302   38.169  77.250 1.00 35.58  ? 316 ASN A C     1 
ATOM   1816 O  O     . ASN A 1 290 ? 6.434   37.722  77.459 1.00 35.11  ? 316 ASN A O     1 
ATOM   1817 C  CB    . ASN A 1 290 ? 4.199   39.982  78.588 1.00 30.32  ? 316 ASN A CB    1 
ATOM   1818 C  CG    . ASN A 1 290 ? 5.496   40.654  78.964 1.00 29.61  ? 316 ASN A CG    1 
ATOM   1819 O  OD1   . ASN A 1 290 ? 6.435   40.718  78.172 1.00 28.08  ? 316 ASN A OD1   1 
ATOM   1820 N  ND2   . ASN A 1 290 ? 5.548   41.184  80.176 1.00 31.57  ? 316 ASN A ND2   1 
ATOM   1821 N  N     . THR A 1 291 ? 4.834   38.438  76.033 1.00 34.12  ? 317 THR A N     1 
ATOM   1822 C  CA    . THR A 1 291 ? 5.541   38.063  74.808 1.00 33.53  ? 317 THR A CA    1 
ATOM   1823 C  C     . THR A 1 291 ? 6.942   38.647  74.695 1.00 31.40  ? 317 THR A C     1 
ATOM   1824 O  O     . THR A 1 291 ? 7.885   37.943  74.351 1.00 34.66  ? 317 THR A O     1 
ATOM   1825 C  CB    . THR A 1 291 ? 4.753   38.499  73.566 1.00 32.74  ? 317 THR A CB    1 
ATOM   1826 O  OG1   . THR A 1 291 ? 4.344   39.861  73.726 1.00 46.95  ? 317 THR A OG1   1 
ATOM   1827 C  CG2   . THR A 1 291 ? 3.532   37.623  73.376 1.00 33.69  ? 317 THR A CG2   1 
ATOM   1828 N  N     . MET A 1 292 ? 7.062   39.938  74.972 1.00 33.19  ? 318 MET A N     1 
ATOM   1829 C  CA    . MET A 1 292 ? 8.339   40.640  74.916 1.00 34.15  ? 318 MET A CA    1 
ATOM   1830 C  C     . MET A 1 292 ? 9.387   39.960  75.800 1.00 36.64  ? 318 MET A C     1 
ATOM   1831 O  O     . MET A 1 292 ? 10.507  39.614  75.359 1.00 40.34  ? 318 MET A O     1 
ATOM   1832 C  CB    . MET A 1 292 ? 8.126   42.092  75.340 1.00 28.42  ? 318 MET A CB    1 
ATOM   1833 C  CG    . MET A 1 292 ? 9.295   43.014  75.101 1.00 39.15  ? 318 MET A CG    1 
ATOM   1834 S  SD    . MET A 1 292 ? 10.371  43.199  76.535 1.00 44.25  ? 318 MET A SD    1 
ATOM   1835 C  CE    . MET A 1 292 ? 9.283   44.040  77.679 1.00 30.31  ? 318 MET A CE    1 
ATOM   1836 N  N     . LEU A 1 293 ? 8.985   39.731  77.044 1.00 34.67  ? 319 LEU A N     1 
ATOM   1837 C  CA    . LEU A 1 293 ? 9.849   39.116  78.026 1.00 31.92  ? 319 LEU A CA    1 
ATOM   1838 C  C     . LEU A 1 293 ? 10.245  37.707  77.584 1.00 36.73  ? 319 LEU A C     1 
ATOM   1839 O  O     . LEU A 1 293 ? 11.429  37.383  77.576 1.00 38.42  ? 319 LEU A O     1 
ATOM   1840 C  CB    . LEU A 1 293 ? 9.169   39.087  79.393 1.00 35.60  ? 319 LEU A CB    1 
ATOM   1841 C  CG    . LEU A 1 293 ? 9.073   40.372  80.214 1.00 31.45  ? 319 LEU A CG    1 
ATOM   1842 C  CD1   . LEU A 1 293 ? 8.315   40.099  81.502 1.00 22.99  ? 319 LEU A CD1   1 
ATOM   1843 C  CD2   . LEU A 1 293 ? 10.459  40.924  80.515 1.00 29.54  ? 319 LEU A CD2   1 
ATOM   1844 N  N     . ALA A 1 294 ? 9.259   36.887  77.217 1.00 33.77  ? 320 ALA A N     1 
ATOM   1845 C  CA    . ALA A 1 294 ? 9.497   35.539  76.694 1.00 28.45  ? 320 ALA A CA    1 
ATOM   1846 C  C     . ALA A 1 294 ? 10.510  35.514  75.552 1.00 30.26  ? 320 ALA A C     1 
ATOM   1847 O  O     . ALA A 1 294 ? 11.424  34.675  75.527 1.00 32.81  ? 320 ALA A O     1 
ATOM   1848 C  CB    . ALA A 1 294 ? 8.185   34.922  76.237 1.00 23.60  ? 320 ALA A CB    1 
ATOM   1849 N  N     . LYS A 1 295 ? 10.344  36.435  74.608 1.00 31.18  ? 321 LYS A N     1 
ATOM   1850 C  CA    . LYS A 1 295 ? 11.239  36.500  73.464 1.00 33.68  ? 321 LYS A CA    1 
ATOM   1851 C  C     . LYS A 1 295 ? 12.651  36.865  73.893 1.00 33.70  ? 321 LYS A C     1 
ATOM   1852 O  O     . LYS A 1 295 ? 13.615  36.324  73.353 1.00 39.08  ? 321 LYS A O     1 
ATOM   1853 C  CB    . LYS A 1 295 ? 10.719  37.493  72.414 1.00 38.09  ? 321 LYS A CB    1 
ATOM   1854 C  CG    . LYS A 1 295 ? 11.265  37.263  71.003 1.00 37.12  ? 321 LYS A CG    1 
ATOM   1855 C  CD    . LYS A 1 295 ? 12.643  37.898  70.841 1.00 43.64  ? 321 LYS A CD    1 
ATOM   1856 C  CE    . LYS A 1 295 ? 13.213  37.689  69.464 1.00 42.77  ? 321 LYS A CE    1 
ATOM   1857 N  NZ    . LYS A 1 295 ? 13.033  36.285  68.996 1.00 47.68  ? 321 LYS A NZ    1 
ATOM   1858 N  N     . VAL A 1 296 ? 12.793  37.762  74.863 1.00 34.05  ? 322 VAL A N     1 
ATOM   1859 C  CA    . VAL A 1 296 ? 14.148  38.028  75.354 1.00 40.02  ? 322 VAL A CA    1 
ATOM   1860 C  C     . VAL A 1 296 ? 14.749  36.811  76.076 1.00 40.07  ? 322 VAL A C     1 
ATOM   1861 O  O     . VAL A 1 296 ? 15.940  36.518  75.939 1.00 37.45  ? 322 VAL A O     1 
ATOM   1862 C  CB    . VAL A 1 296 ? 14.191  39.253  76.287 1.00 38.30  ? 322 VAL A CB    1 
ATOM   1863 C  CG1   . VAL A 1 296 ? 15.628  39.588  76.647 1.00 38.44  ? 322 VAL A CG1   1 
ATOM   1864 C  CG2   . VAL A 1 296 ? 13.505  40.447  75.627 1.00 34.96  ? 322 VAL A CG2   1 
ATOM   1865 N  N     . CYS A 1 297 ? 13.915  36.114  76.844 1.00 42.09  ? 323 CYS A N     1 
ATOM   1866 C  CA    . CYS A 1 297 ? 14.312  34.908  77.573 1.00 39.39  ? 323 CYS A CA    1 
ATOM   1867 C  C     . CYS A 1 297 ? 14.867  33.812  76.679 1.00 40.17  ? 323 CYS A C     1 
ATOM   1868 O  O     . CYS A 1 297 ? 15.967  33.312  76.916 1.00 41.15  ? 323 CYS A O     1 
ATOM   1869 C  CB    . CYS A 1 297 ? 13.128  34.333  78.337 1.00 33.07  ? 323 CYS A CB    1 
ATOM   1870 S  SG    . CYS A 1 297 ? 12.655  35.237  79.758 1.00 44.84  ? 323 CYS A SG    1 
ATOM   1871 N  N     . SER A 1 298 ? 14.088  33.432  75.667 1.00 33.67  ? 324 SER A N     1 
ATOM   1872 C  CA    . SER A 1 298 ? 14.457  32.335  74.769 1.00 36.88  ? 324 SER A CA    1 
ATOM   1873 C  C     . SER A 1 298 ? 15.884  32.409  74.220 1.00 37.72  ? 324 SER A C     1 
ATOM   1874 O  O     . SER A 1 298 ? 16.423  31.407  73.763 1.00 38.34  ? 324 SER A O     1 
ATOM   1875 C  CB    . SER A 1 298 ? 13.475  32.265  73.597 1.00 36.86  ? 324 SER A CB    1 
ATOM   1876 O  OG    . SER A 1 298 ? 13.905  33.081  72.519 1.00 44.58  ? 324 SER A OG    1 
ATOM   1877 N  N     . ASP A 1 299 ? 16.496  33.586  74.270 1.00 41.43  ? 325 ASP A N     1 
ATOM   1878 C  CA    . ASP A 1 299 ? 17.843  33.752  73.742 1.00 46.32  ? 325 ASP A CA    1 
ATOM   1879 C  C     . ASP A 1 299 ? 18.959  33.650  74.783 1.00 48.19  ? 325 ASP A C     1 
ATOM   1880 O  O     . ASP A 1 299 ? 20.126  33.510  74.414 1.00 45.66  ? 325 ASP A O     1 
ATOM   1881 C  CB    . ASP A 1 299 ? 17.947  35.091  73.008 1.00 44.13  ? 325 ASP A CB    1 
ATOM   1882 C  CG    . ASP A 1 299 ? 17.635  34.962  71.524 1.00 65.52  ? 325 ASP A CG    1 
ATOM   1883 O  OD1   . ASP A 1 299 ? 16.456  34.711  71.180 1.00 67.51  ? 325 ASP A OD1   1 
ATOM   1884 O  OD2   . ASP A 1 299 ? 18.571  35.101  70.702 1.00 76.22  ? 325 ASP A OD2   1 
ATOM   1885 N  N     . LYS A 1 300 ? 18.618  33.719  76.070 1.00 46.13  ? 326 LYS A N     1 
ATOM   1886 C  CA    . LYS A 1 300 ? 19.644  33.636  77.112 1.00 50.20  ? 326 LYS A CA    1 
ATOM   1887 C  C     . LYS A 1 300 ? 20.328  32.272  77.123 1.00 51.37  ? 326 LYS A C     1 
ATOM   1888 O  O     . LYS A 1 300 ? 21.537  32.178  76.913 1.00 54.14  ? 326 LYS A O     1 
ATOM   1889 C  CB    . LYS A 1 300 ? 19.069  33.928  78.502 1.00 52.75  ? 326 LYS A CB    1 
ATOM   1890 C  CG    . LYS A 1 300 ? 20.170  34.159  79.548 1.00 55.76  ? 326 LYS A CG    1 
ATOM   1891 C  CD    . LYS A 1 300 ? 19.651  34.204  80.981 1.00 50.64  ? 326 LYS A CD    1 
ATOM   1892 C  CE    . LYS A 1 300 ? 19.028  35.541  81.322 1.00 49.92  ? 326 LYS A CE    1 
ATOM   1893 N  NZ    . LYS A 1 300 ? 20.047  36.634  81.349 1.00 65.07  ? 326 LYS A NZ    1 
ATOM   1894 N  N     . ASN A 1 301 ? 19.562  31.216  77.376 1.00 48.93  ? 327 ASN A N     1 
ATOM   1895 C  CA    . ASN A 1 301 ? 20.133  29.872  77.378 1.00 52.73  ? 327 ASN A CA    1 
ATOM   1896 C  C     . ASN A 1 301 ? 20.114  29.191  76.015 1.00 47.65  ? 327 ASN A C     1 
ATOM   1897 O  O     . ASN A 1 301 ? 19.626  28.070  75.888 1.00 52.56  ? 327 ASN A O     1 
ATOM   1898 C  CB    . ASN A 1 301 ? 19.409  28.995  78.395 1.00 49.48  ? 327 ASN A CB    1 
ATOM   1899 C  CG    . ASN A 1 301 ? 19.722  29.393  79.817 1.00 50.64  ? 327 ASN A CG    1 
ATOM   1900 O  OD1   . ASN A 1 301 ? 20.776  29.968  80.090 1.00 55.12  ? 327 ASN A OD1   1 
ATOM   1901 N  ND2   . ASN A 1 301 ? 18.809  29.095  80.732 1.00 43.17  ? 327 ASN A ND2   1 
ATOM   1902 N  N     . LYS A 1 302 ? 20.685  29.809  75.009 1.00 43.26  ? 328 LYS A N     1 
ATOM   1903 C  CA    . LYS A 1 302 ? 20.730  29.217  73.697 1.00 43.61  ? 328 LYS A CA    1 
ATOM   1904 C  C     . LYS A 1 302 ? 22.117  28.655  73.512 1.00 46.30  ? 328 LYS A C     1 
ATOM   1905 O  O     . LYS A 1 302 ? 23.038  29.252  73.969 1.00 47.72  ? 328 LYS A O     1 
ATOM   1906 C  CB    . LYS A 1 302 ? 20.488  30.309  72.675 1.00 48.95  ? 328 LYS A CB    1 
ATOM   1907 C  CG    . LYS A 1 302 ? 19.594  29.929  71.529 1.00 49.18  ? 328 LYS A CG    1 
ATOM   1908 C  CD    . LYS A 1 302 ? 19.080  31.155  70.826 1.00 46.39  ? 328 LYS A CD    1 
ATOM   1909 C  CE    . LYS A 1 302 ? 17.731  30.855  70.201 1.00 49.90  ? 328 LYS A CE    1 
ATOM   1910 N  NZ    . LYS A 1 302 ? 17.616  29.460  69.709 1.00 35.21  ? 328 LYS A NZ    1 
ATOM   1911 N  N     . PRO A 1 303 ? 22.283  27.516  72.850 1.00 45.78  ? 329 PRO A N     1 
ATOM   1912 C  CA    . PRO A 1 303 ? 21.174  26.753  72.279 1.00 39.20  ? 329 PRO A CA    1 
ATOM   1913 C  C     . PRO A 1 303 ? 20.724  25.648  73.213 1.00 38.94  ? 329 PRO A C     1 
ATOM   1914 O  O     . PRO A 1 303 ? 21.431  25.353  74.173 1.00 39.23  ? 329 PRO A O     1 
ATOM   1915 C  CB    . PRO A 1 303 ? 21.788  26.167  71.019 1.00 40.73  ? 329 PRO A CB    1 
ATOM   1916 C  CG    . PRO A 1 303 ? 23.191  25.885  71.441 1.00 42.24  ? 329 PRO A CG    1 
ATOM   1917 C  CD    . PRO A 1 303 ? 23.581  26.980  72.403 1.00 42.02  ? 329 PRO A CD    1 
ATOM   1918 N  N     . ASN A 1 304 ? 19.573  25.049  72.926 1.00 38.17  ? 330 ASN A N     1 
ATOM   1919 C  CA    . ASN A 1 304 ? 19.055  23.933  73.710 1.00 39.35  ? 330 ASN A CA    1 
ATOM   1920 C  C     . ASN A 1 304 ? 19.079  24.225  75.204 1.00 43.03  ? 330 ASN A C     1 
ATOM   1921 O  O     . ASN A 1 304 ? 19.862  23.653  75.962 1.00 44.45  ? 330 ASN A O     1 
ATOM   1922 C  CB    . ASN A 1 304 ? 19.848  22.659  73.412 1.00 38.01  ? 330 ASN A CB    1 
ATOM   1923 C  CG    . ASN A 1 304 ? 19.118  21.406  73.840 1.00 39.99  ? 330 ASN A CG    1 
ATOM   1924 O  OD1   . ASN A 1 304 ? 17.892  21.393  73.955 1.00 41.04  ? 330 ASN A OD1   1 
ATOM   1925 N  ND2   . ASN A 1 304 ? 19.870  20.341  74.081 1.00 44.56  ? 330 ASN A ND2   1 
ATOM   1926 N  N     . GLY A 1 305 ? 18.194  25.118  75.618 1.00 43.81  ? 331 GLY A N     1 
ATOM   1927 C  CA    . GLY A 1 305 ? 18.108  25.531  77.000 1.00 40.43  ? 331 GLY A CA    1 
ATOM   1928 C  C     . GLY A 1 305 ? 16.878  26.388  77.147 1.00 35.78  ? 331 GLY A C     1 
ATOM   1929 O  O     . GLY A 1 305 ? 16.258  26.764  76.155 1.00 34.49  ? 331 GLY A O     1 
ATOM   1930 N  N     . GLN A 1 306 ? 16.511  26.694  78.380 1.00 38.33  ? 332 GLN A N     1 
ATOM   1931 C  CA    . GLN A 1 306 ? 15.350  27.531  78.598 1.00 39.92  ? 332 GLN A CA    1 
ATOM   1932 C  C     . GLN A 1 306 ? 15.599  28.487  79.750 1.00 38.89  ? 332 GLN A C     1 
ATOM   1933 O  O     . GLN A 1 306 ? 16.638  28.427  80.402 1.00 42.89  ? 332 GLN A O     1 
ATOM   1934 C  CB    . GLN A 1 306 ? 14.116  26.668  78.860 1.00 33.96  ? 332 GLN A CB    1 
ATOM   1935 C  CG    . GLN A 1 306 ? 14.387  25.473  79.744 1.00 32.84  ? 332 GLN A CG    1 
ATOM   1936 C  CD    . GLN A 1 306 ? 13.201  24.546  79.830 1.00 34.08  ? 332 GLN A CD    1 
ATOM   1937 O  OE1   . GLN A 1 306 ? 13.080  23.607  79.048 1.00 38.98  ? 332 GLN A OE1   1 
ATOM   1938 N  NE2   . GLN A 1 306 ? 12.309  24.809  80.774 1.00 36.13  ? 332 GLN A NE2   1 
ATOM   1939 N  N     . TYR A 1 307 ? 14.643  29.374  79.988 1.00 36.61  ? 333 TYR A N     1 
ATOM   1940 C  CA    . TYR A 1 307 ? 14.749  30.336  81.068 1.00 35.18  ? 333 TYR A CA    1 
ATOM   1941 C  C     . TYR A 1 307 ? 13.366  30.859  81.398 1.00 36.12  ? 333 TYR A C     1 
ATOM   1942 O  O     . TYR A 1 307 ? 12.586  31.177  80.501 1.00 32.36  ? 333 TYR A O     1 
ATOM   1943 C  CB    . TYR A 1 307 ? 15.696  31.477  80.688 1.00 33.93  ? 333 TYR A CB    1 
ATOM   1944 C  CG    . TYR A 1 307 ? 16.004  32.434  81.820 1.00 47.58  ? 333 TYR A CG    1 
ATOM   1945 C  CD1   . TYR A 1 307 ? 17.189  32.329  82.537 1.00 52.84  ? 333 TYR A CD1   1 
ATOM   1946 C  CD2   . TYR A 1 307 ? 15.099  33.424  82.194 1.00 42.99  ? 333 TYR A CD2   1 
ATOM   1947 C  CE1   . TYR A 1 307 ? 17.475  33.196  83.576 1.00 52.69  ? 333 TYR A CE1   1 
ATOM   1948 C  CE2   . TYR A 1 307 ? 15.379  34.293  83.230 1.00 44.14  ? 333 TYR A CE2   1 
ATOM   1949 C  CZ    . TYR A 1 307 ? 16.568  34.171  83.918 1.00 49.18  ? 333 TYR A CZ    1 
ATOM   1950 O  OH    . TYR A 1 307 ? 16.856  35.030  84.952 1.00 53.57  ? 333 TYR A OH    1 
ATOM   1951 N  N     . GLN A 1 308 ? 13.057  30.927  82.688 1.00 38.30  ? 334 GLN A N     1 
ATOM   1952 C  CA    . GLN A 1 308 ? 11.776  31.461  83.112 1.00 35.96  ? 334 GLN A CA    1 
ATOM   1953 C  C     . GLN A 1 308 ? 11.943  32.754  83.885 1.00 36.56  ? 334 GLN A C     1 
ATOM   1954 O  O     . GLN A 1 308 ? 12.904  32.925  84.634 1.00 42.07  ? 334 GLN A O     1 
ATOM   1955 C  CB    . GLN A 1 308 ? 11.012  30.448  83.967 1.00 31.82  ? 334 GLN A CB    1 
ATOM   1956 C  CG    . GLN A 1 308 ? 9.587   30.883  84.273 1.00 29.96  ? 334 GLN A CG    1 
ATOM   1957 C  CD    . GLN A 1 308 ? 8.847   29.909  85.152 1.00 35.66  ? 334 GLN A CD    1 
ATOM   1958 O  OE1   . GLN A 1 308 ? 9.443   28.999  85.735 1.00 40.48  ? 334 GLN A OE1   1 
ATOM   1959 N  NE2   . GLN A 1 308 ? 7.534   30.085  85.246 1.00 30.19  ? 334 GLN A NE2   1 
ATOM   1960 N  N     . ILE A 1 309 ? 10.998  33.665  83.690 1.00 37.09  ? 335 ILE A N     1 
ATOM   1961 C  CA    . ILE A 1 309 ? 10.837  34.810  84.571 1.00 35.23  ? 335 ILE A CA    1 
ATOM   1962 C  C     . ILE A 1 309 ? 9.562   34.566  85.365 1.00 31.73  ? 335 ILE A C     1 
ATOM   1963 O  O     . ILE A 1 309 ? 8.474   34.540  84.794 1.00 34.11  ? 335 ILE A O     1 
ATOM   1964 C  CB    . ILE A 1 309 ? 10.741  36.130  83.784 1.00 38.71  ? 335 ILE A CB    1 
ATOM   1965 C  CG1   . ILE A 1 309 ? 12.087  36.472  83.145 1.00 39.35  ? 335 ILE A CG1   1 
ATOM   1966 C  CG2   . ILE A 1 309 ? 10.233  37.268  84.668 1.00 36.60  ? 335 ILE A CG2   1 
ATOM   1967 C  CD1   . ILE A 1 309 ? 12.019  37.641  82.209 1.00 38.15  ? 335 ILE A CD1   1 
ATOM   1968 N  N     . LEU A 1 310 ? 9.685   34.368  86.671 1.00 32.74  ? 336 LEU A N     1 
ATOM   1969 C  CA    . LEU A 1 310 ? 8.521   33.993  87.466 1.00 33.34  ? 336 LEU A CA    1 
ATOM   1970 C  C     . LEU A 1 310 ? 7.538   35.158  87.536 1.00 34.92  ? 336 LEU A C     1 
ATOM   1971 O  O     . LEU A 1 310 ? 7.950   36.314  87.534 1.00 34.52  ? 336 LEU A O     1 
ATOM   1972 C  CB    . LEU A 1 310 ? 8.946   33.531  88.861 1.00 31.21  ? 336 LEU A CB    1 
ATOM   1973 C  CG    . LEU A 1 310 ? 9.892   32.326  88.883 1.00 32.67  ? 336 LEU A CG    1 
ATOM   1974 C  CD1   . LEU A 1 310 ? 10.586  32.163  90.232 1.00 28.46  ? 336 LEU A CD1   1 
ATOM   1975 C  CD2   . LEU A 1 310 ? 9.124   31.064  88.519 1.00 28.76  ? 336 LEU A CD2   1 
ATOM   1976 N  N     . PRO A 1 311 ? 6.229   34.856  87.579 1.00 33.34  ? 337 PRO A N     1 
ATOM   1977 C  CA    . PRO A 1 311 ? 5.209   35.910  87.498 1.00 34.91  ? 337 PRO A CA    1 
ATOM   1978 C  C     . PRO A 1 311 ? 5.077   36.752  88.768 1.00 41.31  ? 337 PRO A C     1 
ATOM   1979 O  O     . PRO A 1 311 ? 4.010   36.805  89.381 1.00 47.02  ? 337 PRO A O     1 
ATOM   1980 C  CB    . PRO A 1 311 ? 3.919   35.129  87.229 1.00 36.12  ? 337 PRO A CB    1 
ATOM   1981 C  CG    . PRO A 1 311 ? 4.158   33.782  87.807 1.00 35.97  ? 337 PRO A CG    1 
ATOM   1982 C  CD    . PRO A 1 311 ? 5.639   33.517  87.753 1.00 32.73  ? 337 PRO A CD    1 
ATOM   1983 N  N     . ASN A 1 312 ? 6.167   37.407  89.149 1.00 39.77  ? 338 ASN A N     1 
ATOM   1984 C  CA    . ASN A 1 312 ? 6.134   38.451  90.164 1.00 45.59  ? 338 ASN A CA    1 
ATOM   1985 C  C     . ASN A 1 312 ? 6.904   39.687  89.684 1.00 46.85  ? 338 ASN A C     1 
ATOM   1986 O  O     . ASN A 1 312 ? 7.974   39.564  89.076 1.00 42.10  ? 338 ASN A O     1 
ATOM   1987 C  CB    . ASN A 1 312 ? 6.688   37.932  91.497 1.00 37.58  ? 338 ASN A CB    1 
ATOM   1988 C  CG    . ASN A 1 312 ? 8.110   37.424  91.379 1.00 44.59  ? 338 ASN A CG    1 
ATOM   1989 O  OD1   . ASN A 1 312 ? 9.070   38.169  91.590 1.00 41.65  ? 338 ASN A OD1   1 
ATOM   1990 N  ND2   . ASN A 1 312 ? 8.252   36.138  91.066 1.00 40.37  ? 338 ASN A ND2   1 
ATOM   1991 N  N     . ARG A 1 313 ? 6.345   40.868  89.954 1.00 42.95  ? 339 ARG A N     1 
ATOM   1992 C  CA    . ARG A 1 313 ? 6.879   42.138  89.458 1.00 40.98  ? 339 ARG A CA    1 
ATOM   1993 C  C     . ARG A 1 313 ? 8.367   42.309  89.751 1.00 38.66  ? 339 ARG A C     1 
ATOM   1994 O  O     . ARG A 1 313 ? 9.123   42.882  88.949 1.00 41.99  ? 339 ARG A O     1 
ATOM   1995 C  CB    . ARG A 1 313 ? 6.092   43.306  90.059 1.00 36.60  ? 339 ARG A CB    1 
ATOM   1996 C  CG    . ARG A 1 313 ? 6.576   44.680  89.622 1.00 50.34  ? 339 ARG A CG    1 
ATOM   1997 C  CD    . ARG A 1 313 ? 6.618   45.647  90.793 1.00 52.60  ? 339 ARG A CD    1 
ATOM   1998 N  NE    . ARG A 1 313 ? 7.732   46.589  90.696 1.00 51.30  ? 339 ARG A NE    1 
ATOM   1999 C  CZ    . ARG A 1 313 ? 7.716   47.687  89.948 1.00 56.66  ? 339 ARG A CZ    1 
ATOM   2000 N  NH1   . ARG A 1 313 ? 6.643   47.971  89.225 1.00 51.65  ? 339 ARG A NH1   1 
ATOM   2001 N  NH2   . ARG A 1 313 ? 8.769   48.500  89.915 1.00 51.33  ? 339 ARG A NH2   1 
ATOM   2002 N  N     . GLN A 1 314 ? 8.790   41.790  90.895 1.00 36.80  ? 340 GLN A N     1 
ATOM   2003 C  CA    . GLN A 1 314 ? 10.177  41.916  91.301 1.00 46.22  ? 340 GLN A CA    1 
ATOM   2004 C  C     . GLN A 1 314 ? 11.103  41.178  90.338 1.00 49.11  ? 340 GLN A C     1 
ATOM   2005 O  O     . GLN A 1 314 ? 12.149  41.698  89.964 1.00 45.02  ? 340 GLN A O     1 
ATOM   2006 C  CB    . GLN A 1 314 ? 10.369  41.405  92.729 1.00 45.13  ? 340 GLN A CB    1 
ATOM   2007 C  CG    . GLN A 1 314 ? 11.743  41.719  93.303 1.00 57.14  ? 340 GLN A CG    1 
ATOM   2008 C  CD    . GLN A 1 314 ? 12.149  43.178  93.105 1.00 68.02  ? 340 GLN A CD    1 
ATOM   2009 O  OE1   . GLN A 1 314 ? 11.395  44.098  93.433 1.00 73.04  ? 340 GLN A OE1   1 
ATOM   2010 N  NE2   . GLN A 1 314 ? 13.346  43.393  92.562 1.00 67.19  ? 340 GLN A NE2   1 
ATOM   2011 N  N     . ALA A 1 315 ? 10.715  39.970  89.941 1.00 46.63  ? 341 ALA A N     1 
ATOM   2012 C  CA    . ALA A 1 315 ? 11.502  39.181  89.001 1.00 41.14  ? 341 ALA A CA    1 
ATOM   2013 C  C     . ALA A 1 315 ? 11.649  39.905  87.669 1.00 41.84  ? 341 ALA A C     1 
ATOM   2014 O  O     . ALA A 1 315 ? 12.755  40.017  87.126 1.00 41.58  ? 341 ALA A O     1 
ATOM   2015 C  CB    . ALA A 1 315 ? 10.865  37.824  88.795 1.00 41.35  ? 341 ALA A CB    1 
ATOM   2016 N  N     . VAL A 1 316 ? 10.519  40.383  87.153 1.00 39.03  ? 342 VAL A N     1 
ATOM   2017 C  CA    . VAL A 1 316 ? 10.483  41.213  85.954 1.00 38.99  ? 342 VAL A CA    1 
ATOM   2018 C  C     . VAL A 1 316 ? 11.514  42.329  86.044 1.00 40.80  ? 342 VAL A C     1 
ATOM   2019 O  O     . VAL A 1 316 ? 12.400  42.438  85.193 1.00 33.70  ? 342 VAL A O     1 
ATOM   2020 C  CB    . VAL A 1 316 ? 9.092   41.832  85.735 1.00 34.25  ? 342 VAL A CB    1 
ATOM   2021 C  CG1   . VAL A 1 316 ? 9.059   42.595  84.427 1.00 31.90  ? 342 VAL A CG1   1 
ATOM   2022 C  CG2   . VAL A 1 316 ? 8.016   40.757  85.757 1.00 36.92  ? 342 VAL A CG2   1 
ATOM   2023 N  N     . MET A 1 317 ? 11.398  43.137  87.100 1.00 46.72  ? 343 MET A N     1 
ATOM   2024 C  CA    . MET A 1 317 ? 12.291  44.278  87.320 1.00 42.97  ? 343 MET A CA    1 
ATOM   2025 C  C     . MET A 1 317 ? 13.770  43.904  87.454 1.00 49.78  ? 343 MET A C     1 
ATOM   2026 O  O     . MET A 1 317 ? 14.637  44.635  86.980 1.00 50.00  ? 343 MET A O     1 
ATOM   2027 C  CB    . MET A 1 317 ? 11.846  45.051  88.559 1.00 47.21  ? 343 MET A CB    1 
ATOM   2028 C  CG    . MET A 1 317 ? 10.506  45.735  88.390 1.00 45.31  ? 343 MET A CG    1 
ATOM   2029 S  SD    . MET A 1 317 ? 10.462  46.679  86.852 1.00 61.79  ? 343 MET A SD    1 
ATOM   2030 C  CE    . MET A 1 317 ? 8.703   46.938  86.672 1.00 46.50  ? 343 MET A CE    1 
ATOM   2031 N  N     . ASP A 1 318 ? 14.057  42.780  88.104 1.00 51.30  ? 344 ASP A N     1 
ATOM   2032 C  CA    . ASP A 1 318 ? 15.430  42.306  88.257 1.00 52.71  ? 344 ASP A CA    1 
ATOM   2033 C  C     . ASP A 1 318 ? 16.004  41.938  86.901 1.00 50.33  ? 344 ASP A C     1 
ATOM   2034 O  O     . ASP A 1 318 ? 17.151  42.257  86.584 1.00 48.38  ? 344 ASP A O     1 
ATOM   2035 C  CB    . ASP A 1 318 ? 15.495  41.092  89.186 1.00 55.58  ? 344 ASP A CB    1 
ATOM   2036 C  CG    . ASP A 1 318 ? 15.138  41.430  90.613 1.00 65.77  ? 344 ASP A CG    1 
ATOM   2037 O  OD1   . ASP A 1 318 ? 15.367  42.592  91.020 1.00 74.54  ? 344 ASP A OD1   1 
ATOM   2038 O  OD2   . ASP A 1 318 ? 14.634  40.531  91.328 1.00 68.38  ? 344 ASP A OD2   1 
ATOM   2039 N  N     . PHE A 1 319 ? 15.198  41.242  86.110 1.00 45.05  ? 345 PHE A N     1 
ATOM   2040 C  CA    . PHE A 1 319 ? 15.639  40.783  84.805 1.00 47.70  ? 345 PHE A CA    1 
ATOM   2041 C  C     . PHE A 1 319 ? 15.922  41.991  83.920 1.00 43.87  ? 345 PHE A C     1 
ATOM   2042 O  O     . PHE A 1 319 ? 16.971  42.093  83.286 1.00 42.77  ? 345 PHE A O     1 
ATOM   2043 C  CB    . PHE A 1 319 ? 14.584  39.879  84.167 1.00 44.18  ? 345 PHE A CB    1 
ATOM   2044 C  CG    . PHE A 1 319 ? 15.017  39.278  82.867 1.00 46.59  ? 345 PHE A CG    1 
ATOM   2045 C  CD1   . PHE A 1 319 ? 15.891  38.207  82.851 1.00 44.39  ? 345 PHE A CD1   1 
ATOM   2046 C  CD2   . PHE A 1 319 ? 14.574  39.795  81.662 1.00 45.35  ? 345 PHE A CD2   1 
ATOM   2047 C  CE1   . PHE A 1 319 ? 16.304  37.658  81.668 1.00 39.22  ? 345 PHE A CE1   1 
ATOM   2048 C  CE2   . PHE A 1 319 ? 14.986  39.245  80.472 1.00 41.33  ? 345 PHE A CE2   1 
ATOM   2049 C  CZ    . PHE A 1 319 ? 15.855  38.174  80.477 1.00 43.92  ? 345 PHE A CZ    1 
ATOM   2050 N  N     . ILE A 1 320 ? 14.957  42.898  83.892 1.00 46.58  ? 346 ILE A N     1 
ATOM   2051 C  CA    . ILE A 1 320 ? 15.045  44.145  83.144 1.00 46.68  ? 346 ILE A CA    1 
ATOM   2052 C  C     . ILE A 1 320 ? 16.223  45.058  83.492 1.00 48.63  ? 346 ILE A C     1 
ATOM   2053 O  O     . ILE A 1 320 ? 16.954  45.492  82.599 1.00 45.28  ? 346 ILE A O     1 
ATOM   2054 C  CB    . ILE A 1 320 ? 13.770  44.955  83.361 1.00 40.18  ? 346 ILE A CB    1 
ATOM   2055 C  CG1   . ILE A 1 320 ? 12.649  44.444  82.478 1.00 38.24  ? 346 ILE A CG1   1 
ATOM   2056 C  CG2   . ILE A 1 320 ? 13.999  46.433  83.120 1.00 43.57  ? 346 ILE A CG2   1 
ATOM   2057 C  CD1   . ILE A 1 320 ? 11.442  45.257  82.665 1.00 46.35  ? 346 ILE A CD1   1 
ATOM   2058 N  N     . LYS A 1 321 ? 16.396  45.335  84.787 1.00 51.25  ? 347 LYS A N     1 
ATOM   2059 C  CA    . LYS A 1 321 ? 17.213  46.459  85.263 1.00 50.89  ? 347 LYS A CA    1 
ATOM   2060 C  C     . LYS A 1 321 ? 18.553  46.632  84.546 1.00 53.01  ? 347 LYS A C     1 
ATOM   2061 O  O     . LYS A 1 321 ? 19.046  47.751  84.433 1.00 61.02  ? 347 LYS A O     1 
ATOM   2062 C  CB    . LYS A 1 321 ? 17.438  46.364  86.778 1.00 57.96  ? 347 LYS A CB    1 
ATOM   2063 C  CG    . LYS A 1 321 ? 18.088  45.087  87.275 1.00 65.52  ? 347 LYS A CG    1 
ATOM   2064 C  CD    . LYS A 1 321 ? 18.233  45.107  88.794 1.00 69.94  ? 347 LYS A CD    1 
ATOM   2065 C  CE    . LYS A 1 321 ? 16.922  45.527  89.470 1.00 75.67  ? 347 LYS A CE    1 
ATOM   2066 N  NZ    . LYS A 1 321 ? 16.914  45.183  90.929 1.00 73.95  ? 347 LYS A NZ    1 
ATOM   2067 N  N     . ASP A 1 322 ? 19.141  45.545  84.058 1.00 50.10  ? 348 ASP A N     1 
ATOM   2068 C  CA    . ASP A 1 322 ? 20.414  45.656  83.353 1.00 53.62  ? 348 ASP A CA    1 
ATOM   2069 C  C     . ASP A 1 322 ? 20.391  45.016  81.966 1.00 51.54  ? 348 ASP A C     1 
ATOM   2070 O  O     . ASP A 1 322 ? 21.439  44.705  81.391 1.00 45.64  ? 348 ASP A O     1 
ATOM   2071 C  CB    . ASP A 1 322 ? 21.524  45.049  84.204 1.00 62.61  ? 348 ASP A CB    1 
ATOM   2072 C  CG    . ASP A 1 322 ? 21.804  45.867  85.458 1.00 70.63  ? 348 ASP A CG    1 
ATOM   2073 O  OD1   . ASP A 1 322 ? 21.873  47.114  85.361 1.00 75.86  ? 348 ASP A OD1   1 
ATOM   2074 O  OD2   . ASP A 1 322 ? 21.938  45.265  86.544 1.00 79.64  ? 348 ASP A OD2   1 
ATOM   2075 N  N     . LEU A 1 323 ? 19.185  44.829  81.440 1.00 47.86  ? 349 LEU A N     1 
ATOM   2076 C  CA    . LEU A 1 323 ? 18.983  44.321  80.089 1.00 45.45  ? 349 LEU A CA    1 
ATOM   2077 C  C     . LEU A 1 323 ? 19.284  45.372  79.021 1.00 45.57  ? 349 LEU A C     1 
ATOM   2078 O  O     . LEU A 1 323 ? 18.637  46.418  78.984 1.00 47.41  ? 349 LEU A O     1 
ATOM   2079 C  CB    . LEU A 1 323 ? 17.547  43.821  79.932 1.00 45.81  ? 349 LEU A CB    1 
ATOM   2080 C  CG    . LEU A 1 323 ? 17.118  43.439  78.519 1.00 46.89  ? 349 LEU A CG    1 
ATOM   2081 C  CD1   . LEU A 1 323 ? 17.832  42.181  78.049 1.00 46.92  ? 349 LEU A CD1   1 
ATOM   2082 C  CD2   . LEU A 1 323 ? 15.609  43.270  78.472 1.00 40.63  ? 349 LEU A CD2   1 
ATOM   2083 N  N     . PRO A 1 324 ? 20.272  45.099  78.153 1.00 44.96  ? 350 PRO A N     1 
ATOM   2084 C  CA    . PRO A 1 324 ? 20.569  46.002  77.038 1.00 40.54  ? 350 PRO A CA    1 
ATOM   2085 C  C     . PRO A 1 324 ? 19.346  46.195  76.165 1.00 43.30  ? 350 PRO A C     1 
ATOM   2086 O  O     . PRO A 1 324 ? 18.597  45.250  75.938 1.00 48.10  ? 350 PRO A O     1 
ATOM   2087 C  CB    . PRO A 1 324 ? 21.680  45.280  76.275 1.00 42.49  ? 350 PRO A CB    1 
ATOM   2088 C  CG    . PRO A 1 324 ? 22.301  44.384  77.279 1.00 47.86  ? 350 PRO A CG    1 
ATOM   2089 C  CD    . PRO A 1 324 ? 21.188  43.947  78.183 1.00 46.91  ? 350 PRO A CD    1 
ATOM   2090 N  N     . ILE A 1 325 ? 19.138  47.413  75.691 1.00 49.15  ? 351 ILE A N     1 
ATOM   2091 C  CA    . ILE A 1 325 ? 17.960  47.722  74.896 1.00 48.50  ? 351 ILE A CA    1 
ATOM   2092 C  C     . ILE A 1 325 ? 17.985  47.003  73.548 1.00 46.68  ? 351 ILE A C     1 
ATOM   2093 O  O     . ILE A 1 325 ? 16.947  46.751  72.955 1.00 47.41  ? 351 ILE A O     1 
ATOM   2094 C  CB    . ILE A 1 325 ? 17.838  49.238  74.657 1.00 44.21  ? 351 ILE A CB    1 
ATOM   2095 C  CG1   . ILE A 1 325 ? 19.157  49.782  74.115 1.00 41.43  ? 351 ILE A CG1   1 
ATOM   2096 C  CG2   . ILE A 1 325 ? 17.447  49.948  75.941 1.00 47.17  ? 351 ILE A CG2   1 
ATOM   2097 C  CD1   . ILE A 1 325 ? 19.074  51.185  73.568 1.00 44.82  ? 351 ILE A CD1   1 
ATOM   2098 N  N     . ARG A 1 326 ? 19.184  46.679  73.078 1.00 44.39  ? 352 ARG A N     1 
ATOM   2099 C  CA    . ARG A 1 326 ? 19.393  46.063  71.770 1.00 47.65  ? 352 ARG A CA    1 
ATOM   2100 C  C     . ARG A 1 326 ? 18.725  44.682  71.683 1.00 45.44  ? 352 ARG A C     1 
ATOM   2101 O  O     . ARG A 1 326 ? 18.323  44.221  70.606 1.00 45.13  ? 352 ARG A O     1 
ATOM   2102 C  CB    . ARG A 1 326 ? 20.896  45.987  71.502 1.00 47.58  ? 352 ARG A CB    1 
ATOM   2103 C  CG    . ARG A 1 326 ? 21.335  45.502  70.132 1.00 45.58  ? 352 ARG A CG    1 
ATOM   2104 C  CD    . ARG A 1 326 ? 20.594  46.180  68.974 1.00 40.39  ? 352 ARG A CD    1 
ATOM   2105 N  NE    . ARG A 1 326 ? 21.422  46.086  67.775 1.00 39.72  ? 352 ARG A NE    1 
ATOM   2106 C  CZ    . ARG A 1 326 ? 21.265  45.190  66.804 1.00 44.83  ? 352 ARG A CZ    1 
ATOM   2107 N  NH1   . ARG A 1 326 ? 20.295  44.279  66.870 1.00 54.13  ? 352 ARG A NH1   1 
ATOM   2108 N  NH2   . ARG A 1 326 ? 22.074  45.213  65.747 1.00 44.32  ? 352 ARG A NH2   1 
ATOM   2109 N  N     . LYS A 1 327 ? 18.572  44.053  72.842 1.00 41.59  ? 353 LYS A N     1 
ATOM   2110 C  CA    . LYS A 1 327 ? 18.084  42.691  72.917 1.00 40.69  ? 353 LYS A CA    1 
ATOM   2111 C  C     . LYS A 1 327 ? 16.570  42.573  72.850 1.00 40.80  ? 353 LYS A C     1 
ATOM   2112 O  O     . LYS A 1 327 ? 16.046  41.477  72.680 1.00 49.72  ? 353 LYS A O     1 
ATOM   2113 C  CB    . LYS A 1 327 ? 18.598  42.047  74.202 1.00 40.59  ? 353 LYS A CB    1 
ATOM   2114 C  CG    . LYS A 1 327 ? 20.056  41.658  74.139 1.00 46.11  ? 353 LYS A CG    1 
ATOM   2115 C  CD    . LYS A 1 327 ? 20.475  40.954  75.418 1.00 54.08  ? 353 LYS A CD    1 
ATOM   2116 C  CE    . LYS A 1 327 ? 21.954  40.595  75.393 1.00 61.20  ? 353 LYS A CE    1 
ATOM   2117 N  NZ    . LYS A 1 327 ? 22.297  39.767  74.193 1.00 64.26  ? 353 LYS A NZ    1 
ATOM   2118 N  N     . VAL A 1 328 ? 15.860  43.687  72.963 1.00 38.14  ? 354 VAL A N     1 
ATOM   2119 C  CA    . VAL A 1 328 ? 14.409  43.617  72.856 1.00 43.71  ? 354 VAL A CA    1 
ATOM   2120 C  C     . VAL A 1 328 ? 14.008  43.734  71.387 1.00 44.51  ? 354 VAL A C     1 
ATOM   2121 O  O     . VAL A 1 328 ? 14.698  44.372  70.591 1.00 40.14  ? 354 VAL A O     1 
ATOM   2122 C  CB    . VAL A 1 328 ? 13.704  44.697  73.717 1.00 43.52  ? 354 VAL A CB    1 
ATOM   2123 C  CG1   . VAL A 1 328 ? 14.027  46.068  73.226 1.00 47.32  ? 354 VAL A CG1   1 
ATOM   2124 C  CG2   . VAL A 1 328 ? 12.198  44.494  73.732 1.00 42.94  ? 354 VAL A CG2   1 
ATOM   2125 N  N     . SER A 1 329 ? 12.912  43.075  71.028 1.00 46.51  ? 355 SER A N     1 
ATOM   2126 C  CA    . SER A 1 329 ? 12.455  43.034  69.649 1.00 42.08  ? 355 SER A CA    1 
ATOM   2127 C  C     . SER A 1 329 ? 11.839  44.376  69.263 1.00 49.57  ? 355 SER A C     1 
ATOM   2128 O  O     . SER A 1 329 ? 10.836  44.798  69.836 1.00 53.28  ? 355 SER A O     1 
ATOM   2129 C  CB    . SER A 1 329 ? 11.447  41.896  69.466 1.00 45.24  ? 355 SER A CB    1 
ATOM   2130 O  OG    . SER A 1 329 ? 10.972  41.818  68.138 1.00 56.25  ? 355 SER A OG    1 
ATOM   2131 N  N     . GLY A 1 330 ? 12.456  45.052  68.299 1.00 47.69  ? 356 GLY A N     1 
ATOM   2132 C  CA    . GLY A 1 330 ? 12.019  46.375  67.892 1.00 39.42  ? 356 GLY A CA    1 
ATOM   2133 C  C     . GLY A 1 330 ? 13.141  47.395  67.909 1.00 37.36  ? 356 GLY A C     1 
ATOM   2134 O  O     . GLY A 1 330 ? 13.082  48.411  67.212 1.00 39.99  ? 356 GLY A O     1 
ATOM   2135 N  N     . ILE A 1 331 ? 14.166  47.125  68.709 1.00 35.72  ? 357 ILE A N     1 
ATOM   2136 C  CA    . ILE A 1 331 ? 15.297  48.034  68.830 1.00 37.93  ? 357 ILE A CA    1 
ATOM   2137 C  C     . ILE A 1 331 ? 16.475  47.490  68.042 1.00 33.41  ? 357 ILE A C     1 
ATOM   2138 O  O     . ILE A 1 331 ? 17.176  46.587  68.495 1.00 40.34  ? 357 ILE A O     1 
ATOM   2139 C  CB    . ILE A 1 331 ? 15.724  48.253  70.306 1.00 38.37  ? 357 ILE A CB    1 
ATOM   2140 C  CG1   . ILE A 1 331 ? 14.542  48.723  71.158 1.00 34.58  ? 357 ILE A CG1   1 
ATOM   2141 C  CG2   . ILE A 1 331 ? 16.874  49.251  70.398 1.00 39.00  ? 357 ILE A CG2   1 
ATOM   2142 C  CD1   . ILE A 1 331 ? 13.790  49.889  70.591 1.00 39.88  ? 357 ILE A CD1   1 
ATOM   2143 N  N     . GLY A 1 332 ? 16.678  48.029  66.850 1.00 30.83  ? 358 GLY A N     1 
ATOM   2144 C  CA    . GLY A 1 332 ? 17.756  47.568  66.002 1.00 36.09  ? 358 GLY A CA    1 
ATOM   2145 C  C     . GLY A 1 332 ? 19.007  48.397  66.181 1.00 35.93  ? 358 GLY A C     1 
ATOM   2146 O  O     . GLY A 1 332 ? 19.147  49.102  67.176 1.00 36.58  ? 358 GLY A O     1 
ATOM   2147 N  N     . LYS A 1 333 ? 19.905  48.315  65.205 1.00 37.61  ? 359 LYS A N     1 
ATOM   2148 C  CA    . LYS A 1 333 ? 21.190  48.998  65.252 1.00 40.73  ? 359 LYS A CA    1 
ATOM   2149 C  C     . LYS A 1 333 ? 21.028  50.508  65.444 1.00 44.15  ? 359 LYS A C     1 
ATOM   2150 O  O     . LYS A 1 333 ? 21.613  51.096  66.363 1.00 48.54  ? 359 LYS A O     1 
ATOM   2151 C  CB    . LYS A 1 333 ? 21.977  48.705  63.968 1.00 38.09  ? 359 LYS A CB    1 
ATOM   2152 C  CG    . LYS A 1 333 ? 23.414  49.210  63.969 1.00 44.19  ? 359 LYS A CG    1 
ATOM   2153 C  CD    . LYS A 1 333 ? 24.047  49.156  62.577 1.00 49.61  ? 359 LYS A CD    1 
ATOM   2154 C  CE    . LYS A 1 333 ? 23.511  50.258  61.659 1.00 52.13  ? 359 LYS A CE    1 
ATOM   2155 N  NZ    . LYS A 1 333 ? 23.896  51.633  62.116 1.00 53.30  ? 359 LYS A NZ    1 
ATOM   2156 N  N     . VAL A 1 334 ? 20.210  51.118  64.589 1.00 45.63  ? 360 VAL A N     1 
ATOM   2157 C  CA    . VAL A 1 334 ? 19.993  52.565  64.597 1.00 41.30  ? 360 VAL A CA    1 
ATOM   2158 C  C     . VAL A 1 334 ? 19.421  53.096  65.904 1.00 38.94  ? 360 VAL A C     1 
ATOM   2159 O  O     . VAL A 1 334 ? 20.043  53.935  66.548 1.00 45.48  ? 360 VAL A O     1 
ATOM   2160 C  CB    . VAL A 1 334 ? 19.055  52.991  63.458 1.00 47.02  ? 360 VAL A CB    1 
ATOM   2161 C  CG1   . VAL A 1 334 ? 18.710  54.478  63.589 1.00 42.82  ? 360 VAL A CG1   1 
ATOM   2162 C  CG2   . VAL A 1 334 ? 19.689  52.677  62.109 1.00 42.71  ? 360 VAL A CG2   1 
ATOM   2163 N  N     . THR A 1 335 ? 18.231  52.630  66.277 1.00 35.99  ? 361 THR A N     1 
ATOM   2164 C  CA    . THR A 1 335 ? 17.603  53.056  67.525 1.00 35.47  ? 361 THR A CA    1 
ATOM   2165 C  C     . THR A 1 335 ? 18.569  52.884  68.690 1.00 38.91  ? 361 THR A C     1 
ATOM   2166 O  O     . THR A 1 335 ? 18.646  53.743  69.563 1.00 41.49  ? 361 THR A O     1 
ATOM   2167 C  CB    . THR A 1 335 ? 16.303  52.281  67.813 1.00 32.36  ? 361 THR A CB    1 
ATOM   2168 O  OG1   . THR A 1 335 ? 15.391  52.459  66.725 1.00 36.06  ? 361 THR A OG1   1 
ATOM   2169 C  CG2   . THR A 1 335 ? 15.648  52.786  69.076 1.00 26.40  ? 361 THR A CG2   1 
ATOM   2170 N  N     . GLU A 1 336 ? 19.322  51.786  68.685 1.00 42.01  ? 362 GLU A N     1 
ATOM   2171 C  CA    . GLU A 1 336 ? 20.346  51.565  69.699 1.00 44.31  ? 362 GLU A CA    1 
ATOM   2172 C  C     . GLU A 1 336 ? 21.390  52.674  69.691 1.00 41.56  ? 362 GLU A C     1 
ATOM   2173 O  O     . GLU A 1 336 ? 21.790  53.151  70.751 1.00 42.54  ? 362 GLU A O     1 
ATOM   2174 C  CB    . GLU A 1 336 ? 21.038  50.213  69.510 1.00 44.51  ? 362 GLU A CB    1 
ATOM   2175 C  CG    . GLU A 1 336 ? 21.918  49.839  70.696 1.00 47.75  ? 362 GLU A CG    1 
ATOM   2176 C  CD    . GLU A 1 336 ? 22.858  48.682  70.414 1.00 57.16  ? 362 GLU A CD    1 
ATOM   2177 O  OE1   . GLU A 1 336 ? 22.922  48.229  69.252 1.00 57.62  ? 362 GLU A OE1   1 
ATOM   2178 O  OE2   . GLU A 1 336 ? 23.534  48.223  71.362 1.00 66.24  ? 362 GLU A OE2   1 
ATOM   2179 N  N     . LYS A 1 337 ? 21.832  53.084  68.504 1.00 38.24  ? 363 LYS A N     1 
ATOM   2180 C  CA    . LYS A 1 337 ? 22.824  54.158  68.409 1.00 45.17  ? 363 LYS A CA    1 
ATOM   2181 C  C     . LYS A 1 337 ? 22.277  55.514  68.889 1.00 45.30  ? 363 LYS A C     1 
ATOM   2182 O  O     . LYS A 1 337 ? 22.943  56.244  69.634 1.00 41.80  ? 363 LYS A O     1 
ATOM   2183 C  CB    . LYS A 1 337 ? 23.334  54.287  66.973 1.00 33.04  ? 363 LYS A CB    1 
ATOM   2184 C  CG    . LYS A 1 337 ? 24.758  54.796  66.870 1.00 38.50  ? 363 LYS A CG    1 
ATOM   2185 C  CD    . LYS A 1 337 ? 25.155  55.043  65.423 1.00 49.68  ? 363 LYS A CD    1 
ATOM   2186 C  CE    . LYS A 1 337 ? 26.598  55.520  65.318 1.00 57.93  ? 363 LYS A CE    1 
ATOM   2187 N  NZ    . LYS A 1 337 ? 27.101  55.514  63.916 1.00 60.42  ? 363 LYS A NZ    1 
ATOM   2188 N  N     . MET A 1 338 ? 21.056  55.836  68.480 1.00 43.13  ? 364 MET A N     1 
ATOM   2189 C  CA    . MET A 1 338 ? 20.426  57.083  68.890 1.00 43.77  ? 364 MET A CA    1 
ATOM   2190 C  C     . MET A 1 338 ? 20.199  57.136  70.387 1.00 41.45  ? 364 MET A C     1 
ATOM   2191 O  O     . MET A 1 338 ? 20.453  58.160  71.013 1.00 51.14  ? 364 MET A O     1 
ATOM   2192 C  CB    . MET A 1 338 ? 19.097  57.284  68.167 1.00 45.29  ? 364 MET A CB    1 
ATOM   2193 C  CG    . MET A 1 338 ? 19.215  57.324  66.661 1.00 45.11  ? 364 MET A CG    1 
ATOM   2194 S  SD    . MET A 1 338 ? 17.673  57.855  65.897 1.00 57.19  ? 364 MET A SD    1 
ATOM   2195 C  CE    . MET A 1 338 ? 17.643  59.582  66.374 1.00 57.73  ? 364 MET A CE    1 
ATOM   2196 N  N     . LEU A 1 339 ? 19.725  56.040  70.967 1.00 40.32  ? 365 LEU A N     1 
ATOM   2197 C  CA    . LEU A 1 339 ? 19.495  56.018  72.407 1.00 43.33  ? 365 LEU A CA    1 
ATOM   2198 C  C     . LEU A 1 339 ? 20.826  56.015  73.152 1.00 43.98  ? 365 LEU A C     1 
ATOM   2199 O  O     . LEU A 1 339 ? 20.927  56.532  74.260 1.00 41.69  ? 365 LEU A O     1 
ATOM   2200 C  CB    . LEU A 1 339 ? 18.644  54.811  72.811 1.00 39.23  ? 365 LEU A CB    1 
ATOM   2201 C  CG    . LEU A 1 339 ? 17.223  54.789  72.235 1.00 38.46  ? 365 LEU A CG    1 
ATOM   2202 C  CD1   . LEU A 1 339 ? 16.462  53.552  72.684 1.00 34.63  ? 365 LEU A CD1   1 
ATOM   2203 C  CD2   . LEU A 1 339 ? 16.459  56.050  72.588 1.00 37.13  ? 365 LEU A CD2   1 
ATOM   2204 N  N     . LYS A 1 340 ? 21.848  55.436  72.534 1.00 49.38  ? 366 LYS A N     1 
ATOM   2205 C  CA    . LYS A 1 340 ? 23.181  55.440  73.117 1.00 49.84  ? 366 LYS A CA    1 
ATOM   2206 C  C     . LYS A 1 340 ? 23.748  56.854  73.132 1.00 49.66  ? 366 LYS A C     1 
ATOM   2207 O  O     . LYS A 1 340 ? 24.526  57.208  74.016 1.00 54.21  ? 366 LYS A O     1 
ATOM   2208 C  CB    . LYS A 1 340 ? 24.113  54.500  72.347 1.00 51.84  ? 366 LYS A CB    1 
ATOM   2209 C  CG    . LYS A 1 340 ? 25.458  54.290  73.011 1.00 56.72  ? 366 LYS A CG    1 
ATOM   2210 C  CD    . LYS A 1 340 ? 26.376  53.414  72.179 1.00 61.33  ? 366 LYS A CD    1 
ATOM   2211 C  CE    . LYS A 1 340 ? 27.712  53.203  72.884 1.00 61.57  ? 366 LYS A CE    1 
ATOM   2212 N  NZ    . LYS A 1 340 ? 28.656  52.388  72.067 1.00 77.38  ? 366 LYS A NZ    1 
ATOM   2213 N  N     . ALA A 1 341 ? 23.361  57.656  72.144 1.00 51.70  ? 367 ALA A N     1 
ATOM   2214 C  CA    . ALA A 1 341 ? 23.764  59.059  72.096 1.00 54.44  ? 367 ALA A CA    1 
ATOM   2215 C  C     . ALA A 1 341 ? 23.276  59.830  73.322 1.00 51.60  ? 367 ALA A C     1 
ATOM   2216 O  O     . ALA A 1 341 ? 23.908  60.794  73.750 1.00 51.95  ? 367 ALA A O     1 
ATOM   2217 C  CB    . ALA A 1 341 ? 23.251  59.711  70.823 1.00 49.93  ? 367 ALA A CB    1 
ATOM   2218 N  N     . LEU A 1 342 ? 22.153  59.395  73.884 1.00 48.23  ? 368 LEU A N     1 
ATOM   2219 C  CA    . LEU A 1 342 ? 21.579  60.049  75.055 1.00 45.25  ? 368 LEU A CA    1 
ATOM   2220 C  C     . LEU A 1 342 ? 22.075  59.387  76.332 1.00 47.51  ? 368 LEU A C     1 
ATOM   2221 O  O     . LEU A 1 342 ? 21.559  59.647  77.420 1.00 49.38  ? 368 LEU A O     1 
ATOM   2222 C  CB    . LEU A 1 342 ? 20.051  60.004  75.001 1.00 45.40  ? 368 LEU A CB    1 
ATOM   2223 C  CG    . LEU A 1 342 ? 19.426  60.304  73.636 1.00 47.30  ? 368 LEU A CG    1 
ATOM   2224 C  CD1   . LEU A 1 342 ? 17.907  60.184  73.695 1.00 42.69  ? 368 LEU A CD1   1 
ATOM   2225 C  CD2   . LEU A 1 342 ? 19.846  61.683  73.156 1.00 49.38  ? 368 LEU A CD2   1 
ATOM   2226 N  N     . GLY A 1 343 ? 23.071  58.520  76.186 1.00 51.63  ? 369 GLY A N     1 
ATOM   2227 C  CA    . GLY A 1 343 ? 23.602  57.757  77.301 1.00 52.12  ? 369 GLY A CA    1 
ATOM   2228 C  C     . GLY A 1 343 ? 22.670  56.662  77.798 1.00 52.54  ? 369 GLY A C     1 
ATOM   2229 O  O     . GLY A 1 343 ? 22.793  56.207  78.937 1.00 47.29  ? 369 GLY A O     1 
ATOM   2230 N  N     . ILE A 1 344 ? 21.729  56.247  76.953 1.00 46.21  ? 370 ILE A N     1 
ATOM   2231 C  CA    . ILE A 1 344 ? 20.819  55.160  77.301 1.00 48.23  ? 370 ILE A CA    1 
ATOM   2232 C  C     . ILE A 1 344 ? 21.306  53.832  76.718 1.00 50.71  ? 370 ILE A C     1 
ATOM   2233 O  O     . ILE A 1 344 ? 21.450  53.698  75.500 1.00 51.20  ? 370 ILE A O     1 
ATOM   2234 C  CB    . ILE A 1 344 ? 19.389  55.438  76.805 1.00 45.83  ? 370 ILE A CB    1 
ATOM   2235 C  CG1   . ILE A 1 344 ? 18.855  56.734  77.424 1.00 47.57  ? 370 ILE A CG1   1 
ATOM   2236 C  CG2   . ILE A 1 344 ? 18.478  54.250  77.102 1.00 40.44  ? 370 ILE A CG2   1 
ATOM   2237 C  CD1   . ILE A 1 344 ? 17.516  57.182  76.860 1.00 43.13  ? 370 ILE A CD1   1 
ATOM   2238 N  N     . ILE A 1 345 ? 21.568  52.855  77.585 1.00 45.58  ? 371 ILE A N     1 
ATOM   2239 C  CA    . ILE A 1 345 ? 22.014  51.546  77.122 1.00 45.22  ? 371 ILE A CA    1 
ATOM   2240 C  C     . ILE A 1 345 ? 21.075  50.443  77.590 1.00 41.54  ? 371 ILE A C     1 
ATOM   2241 O  O     . ILE A 1 345 ? 20.765  49.520  76.841 1.00 43.27  ? 371 ILE A O     1 
ATOM   2242 C  CB    . ILE A 1 345 ? 23.427  51.208  77.608 1.00 45.04  ? 371 ILE A CB    1 
ATOM   2243 C  CG1   . ILE A 1 345 ? 24.355  52.407  77.455 1.00 44.93  ? 371 ILE A CG1   1 
ATOM   2244 C  CG2   . ILE A 1 345 ? 23.959  50.007  76.844 1.00 44.40  ? 371 ILE A CG2   1 
ATOM   2245 C  CD1   . ILE A 1 345 ? 24.658  52.750  76.028 1.00 49.51  ? 371 ILE A CD1   1 
ATOM   2246 N  N     . THR A 1 346 ? 20.622  50.549  78.833 1.00 40.97  ? 372 THR A N     1 
ATOM   2247 C  CA    . THR A 1 346 ? 19.809  49.506  79.444 1.00 43.95  ? 372 THR A CA    1 
ATOM   2248 C  C     . THR A 1 346 ? 18.393  50.008  79.669 1.00 45.03  ? 372 THR A C     1 
ATOM   2249 O  O     . THR A 1 346 ? 18.095  51.168  79.397 1.00 47.87  ? 372 THR A O     1 
ATOM   2250 C  CB    . THR A 1 346 ? 20.402  49.042  80.781 1.00 46.62  ? 372 THR A CB    1 
ATOM   2251 O  OG1   . THR A 1 346 ? 20.187  50.051  81.775 1.00 48.18  ? 372 THR A OG1   1 
ATOM   2252 C  CG2   . THR A 1 346 ? 21.892  48.789  80.637 1.00 46.69  ? 372 THR A CG2   1 
ATOM   2253 N  N     . CYS A 1 347 ? 17.518  49.140  80.162 1.00 46.26  ? 373 CYS A N     1 
ATOM   2254 C  CA    . CYS A 1 347 ? 16.114  49.507  80.306 1.00 47.41  ? 373 CYS A CA    1 
ATOM   2255 C  C     . CYS A 1 347 ? 15.874  50.396  81.521 1.00 48.74  ? 373 CYS A C     1 
ATOM   2256 O  O     . CYS A 1 347 ? 14.874  51.122  81.578 1.00 55.86  ? 373 CYS A O     1 
ATOM   2257 C  CB    . CYS A 1 347 ? 15.248  48.254  80.398 1.00 52.04  ? 373 CYS A CB    1 
ATOM   2258 S  SG    . CYS A 1 347 ? 15.287  47.233  78.925 1.00 59.64  ? 373 CYS A SG    1 
ATOM   2259 N  N     . THR A 1 348 ? 16.800  50.358  82.477 1.00 46.10  ? 374 THR A N     1 
ATOM   2260 C  CA    . THR A 1 348 ? 16.734  51.253  83.629 1.00 48.85  ? 374 THR A CA    1 
ATOM   2261 C  C     . THR A 1 348 ? 16.865  52.687  83.131 1.00 44.07  ? 374 THR A C     1 
ATOM   2262 O  O     . THR A 1 348 ? 16.042  53.549  83.440 1.00 41.05  ? 374 THR A O     1 
ATOM   2263 C  CB    . THR A 1 348 ? 17.838  50.968  84.667 1.00 47.63  ? 374 THR A CB    1 
ATOM   2264 O  OG1   . THR A 1 348 ? 17.652  49.663  85.222 1.00 57.71  ? 374 THR A OG1   1 
ATOM   2265 C  CG2   . THR A 1 348 ? 17.783  51.995  85.788 1.00 46.37  ? 374 THR A CG2   1 
ATOM   2266 N  N     . GLU A 1 349 ? 17.905  52.921  82.340 1.00 39.62  ? 375 GLU A N     1 
ATOM   2267 C  CA    . GLU A 1 349 ? 18.167  54.233  81.781 1.00 40.48  ? 375 GLU A CA    1 
ATOM   2268 C  C     . GLU A 1 349 ? 17.078  54.640  80.796 1.00 45.26  ? 375 GLU A C     1 
ATOM   2269 O  O     . GLU A 1 349 ? 16.772  55.821  80.660 1.00 47.97  ? 375 GLU A O     1 
ATOM   2270 C  CB    . GLU A 1 349 ? 19.547  54.251  81.128 1.00 37.91  ? 375 GLU A CB    1 
ATOM   2271 C  CG    . GLU A 1 349 ? 20.605  53.571  81.982 1.00 32.80  ? 375 GLU A CG    1 
ATOM   2272 C  CD    . GLU A 1 349 ? 21.912  53.356  81.251 1.00 46.26  ? 375 GLU A CD    1 
ATOM   2273 O  OE1   . GLU A 1 349 ? 22.044  53.843  80.109 1.00 52.15  ? 375 GLU A OE1   1 
ATOM   2274 O  OE2   . GLU A 1 349 ? 22.814  52.705  81.822 1.00 47.83  ? 375 GLU A OE2   1 
ATOM   2275 N  N     . LEU A 1 350 ? 16.481  53.666  80.121 1.00 46.95  ? 376 LEU A N     1 
ATOM   2276 C  CA    . LEU A 1 350 ? 15.322  53.944  79.288 1.00 45.03  ? 376 LEU A CA    1 
ATOM   2277 C  C     . LEU A 1 350 ? 14.158  54.431  80.141 1.00 45.30  ? 376 LEU A C     1 
ATOM   2278 O  O     . LEU A 1 350 ? 13.353  55.246  79.696 1.00 43.87  ? 376 LEU A O     1 
ATOM   2279 C  CB    . LEU A 1 350 ? 14.914  52.709  78.486 1.00 46.48  ? 376 LEU A CB    1 
ATOM   2280 C  CG    . LEU A 1 350 ? 13.948  52.997  77.335 1.00 42.96  ? 376 LEU A CG    1 
ATOM   2281 C  CD1   . LEU A 1 350 ? 14.654  53.773  76.235 1.00 40.76  ? 376 LEU A CD1   1 
ATOM   2282 C  CD2   . LEU A 1 350 ? 13.377  51.709  76.783 1.00 42.28  ? 376 LEU A CD2   1 
ATOM   2283 N  N     . TYR A 1 351 ? 14.059  53.931  81.367 1.00 44.64  ? 377 TYR A N     1 
ATOM   2284 C  CA    . TYR A 1 351 ? 12.982  54.390  82.239 1.00 47.77  ? 377 TYR A CA    1 
ATOM   2285 C  C     . TYR A 1 351 ? 13.260  55.775  82.818 1.00 52.61  ? 377 TYR A C     1 
ATOM   2286 O  O     . TYR A 1 351 ? 12.360  56.607  82.918 1.00 52.78  ? 377 TYR A O     1 
ATOM   2287 C  CB    . TYR A 1 351 ? 12.741  53.414  83.387 1.00 45.63  ? 377 TYR A CB    1 
ATOM   2288 C  CG    . TYR A 1 351 ? 11.675  53.903  84.337 1.00 49.59  ? 377 TYR A CG    1 
ATOM   2289 C  CD1   . TYR A 1 351 ? 10.337  53.874  83.974 1.00 51.71  ? 377 TYR A CD1   1 
ATOM   2290 C  CD2   . TYR A 1 351 ? 12.006  54.413  85.587 1.00 54.28  ? 377 TYR A CD2   1 
ATOM   2291 C  CE1   . TYR A 1 351 ? 9.352   54.327  84.829 1.00 55.77  ? 377 TYR A CE1   1 
ATOM   2292 C  CE2   . TYR A 1 351 ? 11.028  54.869  86.453 1.00 61.51  ? 377 TYR A CE2   1 
ATOM   2293 C  CZ    . TYR A 1 351 ? 9.699   54.825  86.070 1.00 61.33  ? 377 TYR A CZ    1 
ATOM   2294 O  OH    . TYR A 1 351 ? 8.715   55.278  86.926 1.00 61.13  ? 377 TYR A OH    1 
ATOM   2295 N  N     . GLN A 1 352 ? 14.506  56.006  83.218 1.00 50.33  ? 378 GLN A N     1 
ATOM   2296 C  CA    . GLN A 1 352 ? 14.901  57.273  83.817 1.00 42.41  ? 378 GLN A CA    1 
ATOM   2297 C  C     . GLN A 1 352 ? 14.606  58.460  82.907 1.00 52.00  ? 378 GLN A C     1 
ATOM   2298 O  O     . GLN A 1 352 ? 14.052  59.473  83.337 1.00 55.64  ? 378 GLN A O     1 
ATOM   2299 C  CB    . GLN A 1 352 ? 16.390  57.256  84.148 1.00 38.71  ? 378 GLN A CB    1 
ATOM   2300 C  CG    . GLN A 1 352 ? 16.794  56.266  85.212 1.00 44.34  ? 378 GLN A CG    1 
ATOM   2301 C  CD    . GLN A 1 352 ? 18.302  56.184  85.354 1.00 54.20  ? 378 GLN A CD    1 
ATOM   2302 O  OE1   . GLN A 1 352 ? 19.043  56.717  84.522 1.00 55.79  ? 378 GLN A OE1   1 
ATOM   2303 N  NE2   . GLN A 1 352 ? 18.766  55.520  86.409 1.00 54.02  ? 378 GLN A NE2   1 
ATOM   2304 N  N     . GLN A 1 353 ? 14.968  58.316  81.639 1.00 42.07  ? 379 GLN A N     1 
ATOM   2305 C  CA    . GLN A 1 353 ? 14.924  59.418  80.696 1.00 37.36  ? 379 GLN A CA    1 
ATOM   2306 C  C     . GLN A 1 353 ? 13.590  59.511  79.967 1.00 37.41  ? 379 GLN A C     1 
ATOM   2307 O  O     . GLN A 1 353 ? 13.509  60.122  78.905 1.00 35.80  ? 379 GLN A O     1 
ATOM   2308 C  CB    . GLN A 1 353 ? 16.063  59.265  79.691 1.00 38.60  ? 379 GLN A CB    1 
ATOM   2309 C  CG    . GLN A 1 353 ? 17.404  58.958  80.337 1.00 40.25  ? 379 GLN A CG    1 
ATOM   2310 C  CD    . GLN A 1 353 ? 18.350  60.140  80.319 1.00 52.14  ? 379 GLN A CD    1 
ATOM   2311 O  OE1   . GLN A 1 353 ? 17.938  61.284  80.521 1.00 63.85  ? 379 GLN A OE1   1 
ATOM   2312 N  NE2   . GLN A 1 353 ? 19.628  59.871  80.070 1.00 47.28  ? 379 GLN A NE2   1 
ATOM   2313 N  N     . ARG A 1 354 ? 12.549  58.918  80.547 1.00 34.34  ? 380 ARG A N     1 
ATOM   2314 C  CA    . ARG A 1 354 ? 11.225  58.875  79.920 1.00 40.13  ? 380 ARG A CA    1 
ATOM   2315 C  C     . ARG A 1 354 ? 10.670  60.226  79.447 1.00 46.58  ? 380 ARG A C     1 
ATOM   2316 O  O     . ARG A 1 354 ? 10.074  60.303  78.376 1.00 53.04  ? 380 ARG A O     1 
ATOM   2317 C  CB    . ARG A 1 354 ? 10.222  58.216  80.864 1.00 40.94  ? 380 ARG A CB    1 
ATOM   2318 C  CG    . ARG A 1 354 ? 10.202  58.770  82.266 1.00 54.15  ? 380 ARG A CG    1 
ATOM   2319 C  CD    . ARG A 1 354 ? 9.446   57.825  83.194 1.00 56.74  ? 380 ARG A CD    1 
ATOM   2320 N  NE    . ARG A 1 354 ? 9.302   58.375  84.536 1.00 61.22  ? 380 ARG A NE    1 
ATOM   2321 C  CZ    . ARG A 1 354 ? 10.269  58.372  85.447 1.00 62.32  ? 380 ARG A CZ    1 
ATOM   2322 N  NH1   . ARG A 1 354 ? 11.456  57.852  85.156 1.00 58.99  ? 380 ARG A NH1   1 
ATOM   2323 N  NH2   . ARG A 1 354 ? 10.050  58.894  86.645 1.00 66.74  ? 380 ARG A NH2   1 
ATOM   2324 N  N     . ALA A 1 355 ? 10.844  61.278  80.240 1.00 50.18  ? 381 ALA A N     1 
ATOM   2325 C  CA    . ALA A 1 355 ? 10.322  62.595  79.878 1.00 47.22  ? 381 ALA A CA    1 
ATOM   2326 C  C     . ALA A 1 355 ? 11.062  63.169  78.670 1.00 47.40  ? 381 ALA A C     1 
ATOM   2327 O  O     . ALA A 1 355 ? 10.450  63.604  77.678 1.00 46.02  ? 381 ALA A O     1 
ATOM   2328 C  CB    . ALA A 1 355 ? 10.425  63.539  81.056 1.00 50.62  ? 381 ALA A CB    1 
ATOM   2329 N  N     . LEU A 1 356 ? 12.387  63.171  78.776 1.00 45.24  ? 382 LEU A N     1 
ATOM   2330 C  CA    . LEU A 1 356 ? 13.268  63.577  77.690 1.00 41.97  ? 382 LEU A CA    1 
ATOM   2331 C  C     . LEU A 1 356 ? 12.887  62.873  76.390 1.00 45.36  ? 382 LEU A C     1 
ATOM   2332 O  O     . LEU A 1 356 ? 12.863  63.493  75.325 1.00 48.91  ? 382 LEU A O     1 
ATOM   2333 C  CB    . LEU A 1 356 ? 14.723  63.283  78.059 1.00 37.93  ? 382 LEU A CB    1 
ATOM   2334 C  CG    . LEU A 1 356 ? 15.802  63.487  76.999 1.00 41.80  ? 382 LEU A CG    1 
ATOM   2335 C  CD1   . LEU A 1 356 ? 15.854  64.937  76.556 1.00 48.89  ? 382 LEU A CD1   1 
ATOM   2336 C  CD2   . LEU A 1 356 ? 17.152  63.031  77.532 1.00 46.04  ? 382 LEU A CD2   1 
ATOM   2337 N  N     . LEU A 1 357 ? 12.596  61.576  76.490 1.00 43.07  ? 383 LEU A N     1 
ATOM   2338 C  CA    . LEU A 1 357 ? 12.166  60.782  75.341 1.00 44.44  ? 383 LEU A CA    1 
ATOM   2339 C  C     . LEU A 1 357 ? 10.780  61.197  74.859 1.00 44.89  ? 383 LEU A C     1 
ATOM   2340 O  O     . LEU A 1 357 ? 10.479  61.117  73.665 1.00 48.63  ? 383 LEU A O     1 
ATOM   2341 C  CB    . LEU A 1 357 ? 12.175  59.285  75.677 1.00 42.08  ? 383 LEU A CB    1 
ATOM   2342 C  CG    . LEU A 1 357 ? 13.529  58.661  76.024 1.00 36.71  ? 383 LEU A CG    1 
ATOM   2343 C  CD1   . LEU A 1 357 ? 13.355  57.277  76.602 1.00 32.67  ? 383 LEU A CD1   1 
ATOM   2344 C  CD2   . LEU A 1 357 ? 14.429  58.616  74.801 1.00 35.86  ? 383 LEU A CD2   1 
ATOM   2345 N  N     . SER A 1 358 ? 9.932   61.614  75.792 1.00 42.63  ? 384 SER A N     1 
ATOM   2346 C  CA    . SER A 1 358 ? 8.621   62.145  75.442 1.00 48.15  ? 384 SER A CA    1 
ATOM   2347 C  C     . SER A 1 358 ? 8.756   63.419  74.614 1.00 47.95  ? 384 SER A C     1 
ATOM   2348 O  O     . SER A 1 358 ? 7.909   63.712  73.765 1.00 39.68  ? 384 SER A O     1 
ATOM   2349 C  CB    . SER A 1 358 ? 7.796   62.412  76.698 1.00 47.77  ? 384 SER A CB    1 
ATOM   2350 O  OG    . SER A 1 358 ? 6.827   63.415  76.468 1.00 60.35  ? 384 SER A OG    1 
ATOM   2351 N  N     . LEU A 1 359 ? 9.826   64.172  74.857 1.00 45.58  ? 385 LEU A N     1 
ATOM   2352 C  CA    . LEU A 1 359 ? 10.050  65.399  74.090 1.00 46.59  ? 385 LEU A CA    1 
ATOM   2353 C  C     . LEU A 1 359 ? 10.821  65.157  72.786 1.00 47.52  ? 385 LEU A C     1 
ATOM   2354 O  O     . LEU A 1 359 ? 10.641  65.890  71.813 1.00 46.42  ? 385 LEU A O     1 
ATOM   2355 C  CB    . LEU A 1 359 ? 10.778  66.440  74.944 1.00 48.61  ? 385 LEU A CB    1 
ATOM   2356 C  CG    . LEU A 1 359 ? 9.967   66.975  76.125 1.00 47.80  ? 385 LEU A CG    1 
ATOM   2357 C  CD1   . LEU A 1 359 ? 10.838  67.827  77.022 1.00 56.17  ? 385 LEU A CD1   1 
ATOM   2358 C  CD2   . LEU A 1 359 ? 8.752   67.757  75.640 1.00 38.80  ? 385 LEU A CD2   1 
ATOM   2359 N  N     . LEU A 1 360 ? 11.663  64.127  72.766 1.00 46.04  ? 386 LEU A N     1 
ATOM   2360 C  CA    . LEU A 1 360 ? 12.507  63.835  71.605 1.00 45.28  ? 386 LEU A CA    1 
ATOM   2361 C  C     . LEU A 1 360 ? 11.867  62.931  70.556 1.00 42.84  ? 386 LEU A C     1 
ATOM   2362 O  O     . LEU A 1 360 ? 12.199  63.033  69.377 1.00 41.72  ? 386 LEU A O     1 
ATOM   2363 C  CB    . LEU A 1 360 ? 13.838  63.227  72.057 1.00 45.81  ? 386 LEU A CB    1 
ATOM   2364 C  CG    . LEU A 1 360 ? 14.976  64.205  72.383 1.00 54.62  ? 386 LEU A CG    1 
ATOM   2365 C  CD1   . LEU A 1 360 ? 14.541  65.407  73.219 1.00 56.69  ? 386 LEU A CD1   1 
ATOM   2366 C  CD2   . LEU A 1 360 ? 16.173  63.473  73.005 1.00 47.88  ? 386 LEU A CD2   1 
ATOM   2367 N  N     . PHE A 1 361 ? 10.965  62.049  70.972 1.00 40.55  ? 387 PHE A N     1 
ATOM   2368 C  CA    . PHE A 1 361 ? 10.395  61.070  70.052 1.00 36.23  ? 387 PHE A CA    1 
ATOM   2369 C  C     . PHE A 1 361 ? 8.891   61.228  69.950 1.00 33.22  ? 387 PHE A C     1 
ATOM   2370 O  O     . PHE A 1 361 ? 8.272   61.895  70.778 1.00 39.74  ? 387 PHE A O     1 
ATOM   2371 C  CB    . PHE A 1 361 ? 10.742  59.644  70.492 1.00 41.77  ? 387 PHE A CB    1 
ATOM   2372 C  CG    . PHE A 1 361 ? 12.206  59.321  70.398 1.00 38.31  ? 387 PHE A CG    1 
ATOM   2373 C  CD1   . PHE A 1 361 ? 12.712  58.646  69.299 1.00 37.73  ? 387 PHE A CD1   1 
ATOM   2374 C  CD2   . PHE A 1 361 ? 13.079  59.698  71.403 1.00 34.24  ? 387 PHE A CD2   1 
ATOM   2375 C  CE1   . PHE A 1 361 ? 14.060  58.352  69.208 1.00 37.74  ? 387 PHE A CE1   1 
ATOM   2376 C  CE2   . PHE A 1 361 ? 14.425  59.409  71.312 1.00 36.80  ? 387 PHE A CE2   1 
ATOM   2377 C  CZ    . PHE A 1 361 ? 14.915  58.734  70.214 1.00 36.67  ? 387 PHE A CZ    1 
ATOM   2378 N  N     . SER A 1 362 ? 8.302   60.615  68.932 1.00 34.24  ? 388 SER A N     1 
ATOM   2379 C  CA    . SER A 1 362 ? 6.863   60.693  68.749 1.00 39.10  ? 388 SER A CA    1 
ATOM   2380 C  C     . SER A 1 362 ? 6.161   59.897  69.834 1.00 41.84  ? 388 SER A C     1 
ATOM   2381 O  O     . SER A 1 362 ? 6.795   59.140  70.561 1.00 38.60  ? 388 SER A O     1 
ATOM   2382 C  CB    . SER A 1 362 ? 6.458   60.171  67.375 1.00 45.40  ? 388 SER A CB    1 
ATOM   2383 O  OG    . SER A 1 362 ? 6.713   58.786  67.283 1.00 49.60  ? 388 SER A OG    1 
ATOM   2384 N  N     . GLU A 1 363 ? 4.849   60.073  69.925 1.00 47.82  ? 389 GLU A N     1 
ATOM   2385 C  CA    . GLU A 1 363 ? 4.026   59.412  70.930 1.00 43.24  ? 389 GLU A CA    1 
ATOM   2386 C  C     . GLU A 1 363 ? 4.174   57.889  70.887 1.00 48.79  ? 389 GLU A C     1 
ATOM   2387 O  O     . GLU A 1 363 ? 4.327   57.244  71.924 1.00 45.25  ? 389 GLU A O     1 
ATOM   2388 C  CB    . GLU A 1 363 ? 2.566   59.818  70.731 1.00 48.50  ? 389 GLU A CB    1 
ATOM   2389 C  CG    . GLU A 1 363 ? 1.660   59.594  71.927 1.00 61.55  ? 389 GLU A CG    1 
ATOM   2390 C  CD    . GLU A 1 363 ? 0.281   60.215  71.728 1.00 74.30  ? 389 GLU A CD    1 
ATOM   2391 O  OE1   . GLU A 1 363 ? 0.216   61.423  71.401 1.00 73.76  ? 389 GLU A OE1   1 
ATOM   2392 O  OE2   . GLU A 1 363 ? -0.732  59.498  71.895 1.00 75.47  ? 389 GLU A OE2   1 
ATOM   2393 N  N     . THR A 1 364 ? 4.150   57.324  69.683 1.00 49.60  ? 390 THR A N     1 
ATOM   2394 C  CA    . THR A 1 364 ? 4.227   55.874  69.505 1.00 48.71  ? 390 THR A CA    1 
ATOM   2395 C  C     . THR A 1 364 ? 5.556   55.310  70.009 1.00 48.41  ? 390 THR A C     1 
ATOM   2396 O  O     . THR A 1 364 ? 5.602   54.286  70.709 1.00 44.72  ? 390 THR A O     1 
ATOM   2397 C  CB    . THR A 1 364 ? 4.048   55.500  68.022 1.00 48.74  ? 390 THR A CB    1 
ATOM   2398 O  OG1   . THR A 1 364 ? 3.143   56.426  67.411 1.00 59.68  ? 390 THR A OG1   1 
ATOM   2399 C  CG2   . THR A 1 364 ? 3.491   54.091  67.877 1.00 54.16  ? 390 THR A CG2   1 
ATOM   2400 N  N     . SER A 1 365 ? 6.634   56.005  69.668 1.00 44.07  ? 391 SER A N     1 
ATOM   2401 C  CA    . SER A 1 365 ? 7.968   55.571  70.045 1.00 40.56  ? 391 SER A CA    1 
ATOM   2402 C  C     . SER A 1 365 ? 8.225   55.637  71.546 1.00 41.91  ? 391 SER A C     1 
ATOM   2403 O  O     . SER A 1 365 ? 8.828   54.721  72.094 1.00 43.26  ? 391 SER A O     1 
ATOM   2404 C  CB    . SER A 1 365 ? 9.022   56.392  69.304 1.00 38.71  ? 391 SER A CB    1 
ATOM   2405 O  OG    . SER A 1 365 ? 9.254   55.844  68.020 1.00 49.61  ? 391 SER A OG    1 
ATOM   2406 N  N     . TRP A 1 366 ? 7.797   56.702  72.219 1.00 42.15  ? 392 TRP A N     1 
ATOM   2407 C  CA    . TRP A 1 366 ? 8.118   56.804  73.638 1.00 39.48  ? 392 TRP A CA    1 
ATOM   2408 C  C     . TRP A 1 366 ? 7.102   56.006  74.453 1.00 41.85  ? 392 TRP A C     1 
ATOM   2409 O  O     . TRP A 1 366 ? 7.419   55.537  75.547 1.00 44.63  ? 392 TRP A O     1 
ATOM   2410 C  CB    . TRP A 1 366 ? 8.231   58.272  74.111 1.00 50.00  ? 392 TRP A CB    1 
ATOM   2411 C  CG    . TRP A 1 366 ? 6.965   59.082  74.216 1.00 48.53  ? 392 TRP A CG    1 
ATOM   2412 C  CD1   . TRP A 1 366 ? 6.523   60.018  73.331 1.00 48.03  ? 392 TRP A CD1   1 
ATOM   2413 C  CD2   . TRP A 1 366 ? 6.008   59.059  75.286 1.00 47.36  ? 392 TRP A CD2   1 
ATOM   2414 N  NE1   . TRP A 1 366 ? 5.340   60.563  73.767 1.00 53.77  ? 392 TRP A NE1   1 
ATOM   2415 C  CE2   . TRP A 1 366 ? 5.002   59.992  74.964 1.00 50.23  ? 392 TRP A CE2   1 
ATOM   2416 C  CE3   . TRP A 1 366 ? 5.898   58.332  76.474 1.00 47.20  ? 392 TRP A CE3   1 
ATOM   2417 C  CZ2   . TRP A 1 366 ? 3.899   60.217  75.787 1.00 48.81  ? 392 TRP A CZ2   1 
ATOM   2418 C  CZ3   . TRP A 1 366 ? 4.801   58.558  77.291 1.00 55.13  ? 392 TRP A CZ3   1 
ATOM   2419 C  CH2   . TRP A 1 366 ? 3.817   59.495  76.943 1.00 52.09  ? 392 TRP A CH2   1 
ATOM   2420 N  N     . HIS A 1 367 ? 5.891   55.841  73.928 1.00 41.71  ? 393 HIS A N     1 
ATOM   2421 C  CA    . HIS A 1 367 ? 4.960   54.877  74.513 1.00 43.61  ? 393 HIS A CA    1 
ATOM   2422 C  C     . HIS A 1 367 ? 5.598   53.492  74.521 1.00 43.35  ? 393 HIS A C     1 
ATOM   2423 O  O     . HIS A 1 367 ? 5.675   52.827  75.561 1.00 43.94  ? 393 HIS A O     1 
ATOM   2424 C  CB    . HIS A 1 367 ? 3.644   54.829  73.744 1.00 47.25  ? 393 HIS A CB    1 
ATOM   2425 C  CG    . HIS A 1 367 ? 2.619   55.815  74.219 1.00 56.61  ? 393 HIS A CG    1 
ATOM   2426 N  ND1   . HIS A 1 367 ? 1.288   55.708  73.900 1.00 63.45  ? 393 HIS A ND1   1 
ATOM   2427 C  CD2   . HIS A 1 367 ? 2.743   56.924  74.987 1.00 54.14  ? 393 HIS A CD2   1 
ATOM   2428 C  CE1   . HIS A 1 367 ? 0.622   56.712  74.455 1.00 61.42  ? 393 HIS A CE1   1 
ATOM   2429 N  NE2   . HIS A 1 367 ? 1.481   57.461  75.115 1.00 62.46  ? 393 HIS A NE2   1 
ATOM   2430 N  N     . TYR A 1 368 ? 6.055   53.070  73.344 1.00 45.57  ? 394 TYR A N     1 
ATOM   2431 C  CA    . TYR A 1 368 ? 6.744   51.795  73.211 1.00 42.37  ? 394 TYR A CA    1 
ATOM   2432 C  C     . TYR A 1 368 ? 7.914   51.696  74.191 1.00 39.03  ? 394 TYR A C     1 
ATOM   2433 O  O     . TYR A 1 368 ? 7.999   50.739  74.968 1.00 42.93  ? 394 TYR A O     1 
ATOM   2434 C  CB    . TYR A 1 368 ? 7.224   51.598  71.771 1.00 39.16  ? 394 TYR A CB    1 
ATOM   2435 C  CG    . TYR A 1 368 ? 7.976   50.310  71.545 1.00 45.41  ? 394 TYR A CG    1 
ATOM   2436 C  CD1   . TYR A 1 368 ? 7.329   49.085  71.646 1.00 43.55  ? 394 TYR A CD1   1 
ATOM   2437 C  CD2   . TYR A 1 368 ? 9.324   50.315  71.204 1.00 48.19  ? 394 TYR A CD2   1 
ATOM   2438 C  CE1   . TYR A 1 368 ? 8.003   47.899  71.437 1.00 48.85  ? 394 TYR A CE1   1 
ATOM   2439 C  CE2   . TYR A 1 368 ? 10.013  49.130  70.991 1.00 43.18  ? 394 TYR A CE2   1 
ATOM   2440 C  CZ    . TYR A 1 368 ? 9.345   47.923  71.110 1.00 50.57  ? 394 TYR A CZ    1 
ATOM   2441 O  OH    . TYR A 1 368 ? 10.011  46.732  70.902 1.00 52.14  ? 394 TYR A OH    1 
ATOM   2442 N  N     . PHE A 1 369 ? 8.798   52.691  74.159 1.00 35.91  ? 395 PHE A N     1 
ATOM   2443 C  CA    . PHE A 1 369 ? 9.965   52.715  75.035 1.00 36.34  ? 395 PHE A CA    1 
ATOM   2444 C  C     . PHE A 1 369 ? 9.552   52.547  76.491 1.00 36.77  ? 395 PHE A C     1 
ATOM   2445 O  O     . PHE A 1 369 ? 10.227  51.872  77.267 1.00 37.34  ? 395 PHE A O     1 
ATOM   2446 C  CB    . PHE A 1 369 ? 10.745  54.022  74.886 1.00 34.67  ? 395 PHE A CB    1 
ATOM   2447 C  CG    . PHE A 1 369 ? 11.529  54.131  73.608 1.00 37.01  ? 395 PHE A CG    1 
ATOM   2448 C  CD1   . PHE A 1 369 ? 11.856  55.380  73.091 1.00 37.61  ? 395 PHE A CD1   1 
ATOM   2449 C  CD2   . PHE A 1 369 ? 11.947  52.999  72.927 1.00 35.84  ? 395 PHE A CD2   1 
ATOM   2450 C  CE1   . PHE A 1 369 ? 12.582  55.495  71.911 1.00 36.68  ? 395 PHE A CE1   1 
ATOM   2451 C  CE2   . PHE A 1 369 ? 12.670  53.104  71.745 1.00 35.96  ? 395 PHE A CE2   1 
ATOM   2452 C  CZ    . PHE A 1 369 ? 12.989  54.354  71.238 1.00 38.83  ? 395 PHE A CZ    1 
ATOM   2453 N  N     . LEU A 1 370 ? 8.424   53.141  76.855 1.00 38.96  ? 396 LEU A N     1 
ATOM   2454 C  CA    . LEU A 1 370 ? 7.980   53.080  78.239 1.00 42.55  ? 396 LEU A CA    1 
ATOM   2455 C  C     . LEU A 1 370 ? 7.488   51.677  78.580 1.00 39.79  ? 396 LEU A C     1 
ATOM   2456 O  O     . LEU A 1 370 ? 7.778   51.159  79.668 1.00 40.63  ? 396 LEU A O     1 
ATOM   2457 C  CB    . LEU A 1 370 ? 6.881   54.106  78.515 1.00 42.03  ? 396 LEU A CB    1 
ATOM   2458 C  CG    . LEU A 1 370 ? 6.563   54.265  80.002 1.00 41.07  ? 396 LEU A CG    1 
ATOM   2459 C  CD1   . LEU A 1 370 ? 7.823   54.663  80.758 1.00 39.61  ? 396 LEU A CD1   1 
ATOM   2460 C  CD2   . LEU A 1 370 ? 5.447   55.267  80.222 1.00 45.11  ? 396 LEU A CD2   1 
ATOM   2461 N  N     . HIS A 1 371 ? 6.738   51.071  77.659 1.00 40.59  ? 397 HIS A N     1 
ATOM   2462 C  CA    . HIS A 1 371 ? 6.325   49.682  77.830 1.00 34.64  ? 397 HIS A CA    1 
ATOM   2463 C  C     . HIS A 1 371 ? 7.528   48.789  78.052 1.00 35.32  ? 397 HIS A C     1 
ATOM   2464 O  O     . HIS A 1 371 ? 7.531   47.960  78.959 1.00 34.21  ? 397 HIS A O     1 
ATOM   2465 C  CB    . HIS A 1 371 ? 5.526   49.184  76.632 1.00 35.01  ? 397 HIS A CB    1 
ATOM   2466 C  CG    . HIS A 1 371 ? 4.075   49.546  76.679 1.00 40.77  ? 397 HIS A CG    1 
ATOM   2467 N  ND1   . HIS A 1 371 ? 3.585   50.737  76.193 1.00 45.27  ? 397 HIS A ND1   1 
ATOM   2468 C  CD2   . HIS A 1 371 ? 3.008   48.867  77.163 1.00 42.85  ? 397 HIS A CD2   1 
ATOM   2469 C  CE1   . HIS A 1 371 ? 2.275   50.776  76.370 1.00 45.25  ? 397 HIS A CE1   1 
ATOM   2470 N  NE2   . HIS A 1 371 ? 1.901   49.655  76.958 1.00 39.20  ? 397 HIS A NE2   1 
ATOM   2471 N  N     . ILE A 1 372 ? 8.549   48.968  77.222 1.00 35.47  ? 398 ILE A N     1 
ATOM   2472 C  CA    . ILE A 1 372 ? 9.788   48.213  77.368 1.00 32.72  ? 398 ILE A CA    1 
ATOM   2473 C  C     . ILE A 1 372 ? 10.428  48.430  78.736 1.00 38.21  ? 398 ILE A C     1 
ATOM   2474 O  O     . ILE A 1 372 ? 10.843  47.474  79.396 1.00 38.24  ? 398 ILE A O     1 
ATOM   2475 C  CB    . ILE A 1 372 ? 10.801  48.582  76.274 1.00 35.25  ? 398 ILE A CB    1 
ATOM   2476 C  CG1   . ILE A 1 372 ? 10.219  48.274  74.892 1.00 40.66  ? 398 ILE A CG1   1 
ATOM   2477 C  CG2   . ILE A 1 372 ? 12.116  47.850  76.493 1.00 30.63  ? 398 ILE A CG2   1 
ATOM   2478 C  CD1   . ILE A 1 372 ? 9.509   46.935  74.809 1.00 42.23  ? 398 ILE A CD1   1 
ATOM   2479 N  N     . SER A 1 373 ? 10.498  49.688  79.165 1.00 45.84  ? 399 SER A N     1 
ATOM   2480 C  CA    . SER A 1 373 ? 11.193  50.026  80.405 1.00 40.68  ? 399 SER A CA    1 
ATOM   2481 C  C     . SER A 1 373 ? 10.426  49.564  81.642 1.00 38.68  ? 399 SER A C     1 
ATOM   2482 O  O     . SER A 1 373 ? 11.008  49.427  82.718 1.00 37.96  ? 399 SER A O     1 
ATOM   2483 C  CB    . SER A 1 373 ? 11.446  51.531  80.480 1.00 37.87  ? 399 SER A CB    1 
ATOM   2484 O  OG    . SER A 1 373 ? 10.225  52.247  80.443 1.00 46.59  ? 399 SER A OG    1 
ATOM   2485 N  N     . LEU A 1 374 ? 9.128   49.316  81.487 1.00 36.89  ? 400 LEU A N     1 
ATOM   2486 C  CA    . LEU A 1 374 ? 8.343   48.724  82.569 1.00 37.91  ? 400 LEU A CA    1 
ATOM   2487 C  C     . LEU A 1 374 ? 8.187   47.199  82.456 1.00 41.32  ? 400 LEU A C     1 
ATOM   2488 O  O     . LEU A 1 374 ? 7.648   46.564  83.362 1.00 41.90  ? 400 LEU A O     1 
ATOM   2489 C  CB    . LEU A 1 374 ? 6.958   49.372  82.630 1.00 42.38  ? 400 LEU A CB    1 
ATOM   2490 C  CG    . LEU A 1 374 ? 6.883   50.808  83.156 1.00 47.35  ? 400 LEU A CG    1 
ATOM   2491 C  CD1   . LEU A 1 374 ? 5.431   51.222  83.362 1.00 44.98  ? 400 LEU A CD1   1 
ATOM   2492 C  CD2   . LEU A 1 374 ? 7.684   50.963  84.444 1.00 41.07  ? 400 LEU A CD2   1 
ATOM   2493 N  N     . GLY A 1 375 ? 8.653   46.617  81.351 1.00 42.55  ? 401 GLY A N     1 
ATOM   2494 C  CA    . GLY A 1 375 ? 8.566   45.179  81.145 1.00 32.84  ? 401 GLY A CA    1 
ATOM   2495 C  C     . GLY A 1 375 ? 7.192   44.660  80.811 1.00 34.21  ? 401 GLY A C     1 
ATOM   2496 O  O     . GLY A 1 375 ? 6.874   43.496  81.051 1.00 32.39  ? 401 GLY A O     1 
ATOM   2497 N  N     . LEU A 1 376 ? 6.366   45.541  80.271 1.00 33.20  ? 402 LEU A N     1 
ATOM   2498 C  CA    . LEU A 1 376 ? 5.049   45.159  79.805 1.00 36.20  ? 402 LEU A CA    1 
ATOM   2499 C  C     . LEU A 1 376 ? 5.144   44.605  78.385 1.00 34.36  ? 402 LEU A C     1 
ATOM   2500 O  O     . LEU A 1 376 ? 6.181   44.705  77.729 1.00 34.78  ? 402 LEU A O     1 
ATOM   2501 C  CB    . LEU A 1 376 ? 4.095   46.357  79.874 1.00 42.94  ? 402 LEU A CB    1 
ATOM   2502 C  CG    . LEU A 1 376 ? 3.378   46.620  81.206 1.00 41.18  ? 402 LEU A CG    1 
ATOM   2503 C  CD1   . LEU A 1 376 ? 4.362   46.766  82.348 1.00 39.82  ? 402 LEU A CD1   1 
ATOM   2504 C  CD2   . LEU A 1 376 ? 2.503   47.861  81.110 1.00 37.62  ? 402 LEU A CD2   1 
ATOM   2505 N  N     . GLY A 1 377 ? 4.058   44.012  77.917 1.00 28.78  ? 403 GLY A N     1 
ATOM   2506 C  CA    . GLY A 1 377 ? 4.026   43.428  76.594 1.00 25.43  ? 403 GLY A CA    1 
ATOM   2507 C  C     . GLY A 1 377 ? 2.690   42.742  76.465 1.00 31.73  ? 403 GLY A C     1 
ATOM   2508 O  O     . GLY A 1 377 ? 1.928   42.706  77.428 1.00 37.37  ? 403 GLY A O     1 
ATOM   2509 N  N     . SER A 1 378 ? 2.384   42.204  75.293 1.00 33.89  ? 404 SER A N     1 
ATOM   2510 C  CA    . SER A 1 378 ? 1.111   41.524  75.133 1.00 41.43  ? 404 SER A CA    1 
ATOM   2511 C  C     . SER A 1 378 ? 1.103   40.241  75.965 1.00 45.16  ? 404 SER A C     1 
ATOM   2512 O  O     . SER A 1 378 ? 2.124   39.559  76.097 1.00 41.71  ? 404 SER A O     1 
ATOM   2513 C  CB    . SER A 1 378 ? 0.832   41.234  73.658 1.00 45.53  ? 404 SER A CB    1 
ATOM   2514 O  OG    . SER A 1 378 ? 1.949   40.644  73.014 1.00 57.89  ? 404 SER A OG    1 
ATOM   2515 N  N     . THR A 1 379 ? -0.050  39.934  76.547 1.00 47.38  ? 405 THR A N     1 
ATOM   2516 C  CA    . THR A 1 379 ? -0.193  38.758  77.394 1.00 46.23  ? 405 THR A CA    1 
ATOM   2517 C  C     . THR A 1 379 ? -1.283  37.908  76.775 1.00 45.61  ? 405 THR A C     1 
ATOM   2518 O  O     . THR A 1 379 ? -1.745  36.928  77.355 1.00 48.08  ? 405 THR A O     1 
ATOM   2519 C  CB    . THR A 1 379 ? -0.554  39.119  78.845 1.00 49.58  ? 405 THR A CB    1 
ATOM   2520 O  OG1   . THR A 1 379 ? -1.822  39.784  78.870 1.00 49.42  ? 405 THR A OG1   1 
ATOM   2521 C  CG2   . THR A 1 379 ? 0.514   40.017  79.459 1.00 50.02  ? 405 THR A CG2   1 
ATOM   2522 N  N     . HIS A 1 380 ? -1.683  38.314  75.579 1.00 47.60  ? 406 HIS A N     1 
ATOM   2523 C  CA    . HIS A 1 380 ? -2.733  37.659  74.835 1.00 50.23  ? 406 HIS A CA    1 
ATOM   2524 C  C     . HIS A 1 380 ? -2.294  37.547  73.380 1.00 56.33  ? 406 HIS A C     1 
ATOM   2525 O  O     . HIS A 1 380 ? -2.037  38.547  72.713 1.00 57.93  ? 406 HIS A O     1 
ATOM   2526 C  CB    . HIS A 1 380 ? -4.053  38.413  74.946 1.00 57.31  ? 406 HIS A CB    1 
ATOM   2527 C  CG    . HIS A 1 380 ? -5.118  37.872  74.047 1.00 70.12  ? 406 HIS A CG    1 
ATOM   2528 N  ND1   . HIS A 1 380 ? -5.647  38.592  72.998 1.00 77.20  ? 406 HIS A ND1   1 
ATOM   2529 C  CD2   . HIS A 1 380 ? -5.731  36.664  74.024 1.00 78.48  ? 406 HIS A CD2   1 
ATOM   2530 C  CE1   . HIS A 1 380 ? -6.548  37.856  72.373 1.00 79.50  ? 406 HIS A CE1   1 
ATOM   2531 N  NE2   . HIS A 1 380 ? -6.618  36.682  72.973 1.00 80.90  ? 406 HIS A NE2   1 
ATOM   2532 N  N     . LEU A 1 381 ? -2.182  36.314  72.903 1.00 56.18  ? 407 LEU A N     1 
ATOM   2533 C  CA    . LEU A 1 381 ? -1.728  36.055  71.546 1.00 52.00  ? 407 LEU A CA    1 
ATOM   2534 C  C     . LEU A 1 381 ? -2.839  36.312  70.533 1.00 60.35  ? 407 LEU A C     1 
ATOM   2535 O  O     . LEU A 1 381 ? -3.867  35.635  70.549 1.00 64.74  ? 407 LEU A O     1 
ATOM   2536 C  CB    . LEU A 1 381 ? -1.259  34.611  71.434 1.00 52.39  ? 407 LEU A CB    1 
ATOM   2537 C  CG    . LEU A 1 381 ? 0.034   34.297  72.173 1.00 42.79  ? 407 LEU A CG    1 
ATOM   2538 C  CD1   . LEU A 1 381 ? 0.528   32.910  71.819 1.00 41.29  ? 407 LEU A CD1   1 
ATOM   2539 C  CD2   . LEU A 1 381 ? 1.074   35.344  71.850 1.00 39.75  ? 407 LEU A CD2   1 
ATOM   2540 N  N     . THR A 1 382 ? -2.642  37.299  69.659 1.00 64.36  ? 408 THR A N     1 
ATOM   2541 C  CA    . THR A 1 382 ? -3.702  37.691  68.734 1.00 71.87  ? 408 THR A CA    1 
ATOM   2542 C  C     . THR A 1 382 ? -3.618  36.856  67.443 1.00 79.39  ? 408 THR A C     1 
ATOM   2543 O  O     . THR A 1 382 ? -2.541  36.621  66.900 1.00 73.78  ? 408 THR A O     1 
ATOM   2544 C  CB    . THR A 1 382 ? -3.655  39.218  68.420 1.00 71.43  ? 408 THR A CB    1 
ATOM   2545 O  OG1   . THR A 1 382 ? -4.936  39.656  67.951 1.00 77.27  ? 408 THR A OG1   1 
ATOM   2546 C  CG2   . THR A 1 382 ? -2.567  39.572  67.407 1.00 73.78  ? 408 THR A CG2   1 
ATOM   2547 N  N     . ARG A 1 383 ? -4.762  36.350  67.000 1.00 82.17  ? 409 ARG A N     1 
ATOM   2548 C  CA    . ARG A 1 383 ? -4.847  35.505  65.810 1.00 87.70  ? 409 ARG A CA    1 
ATOM   2549 C  C     . ARG A 1 383 ? -4.154  36.107  64.580 1.00 96.20  ? 409 ARG A C     1 
ATOM   2550 O  O     . ARG A 1 383 ? -4.350  37.285  64.245 1.00 87.98  ? 409 ARG A O     1 
ATOM   2551 C  CB    . ARG A 1 383 ? -6.312  35.196  65.492 1.00 92.00  ? 409 ARG A CB    1 
ATOM   2552 C  CG    . ARG A 1 383 ? -7.203  36.415  65.320 1.00 94.75  ? 409 ARG A CG    1 
ATOM   2553 C  CD    . ARG A 1 383 ? -8.663  35.993  65.388 1.00 92.52  ? 409 ARG A CD    1 
ATOM   2554 N  NE    . ARG A 1 383 ? -9.524  36.758  64.492 1.00 91.87  ? 409 ARG A NE    1 
ATOM   2555 C  CZ    . ARG A 1 383 ? -10.760 36.394  64.161 1.00 87.73  ? 409 ARG A CZ    1 
ATOM   2556 N  NH1   . ARG A 1 383 ? -11.484 37.144  63.338 1.00 77.85  ? 409 ARG A NH1   1 
ATOM   2557 N  NH2   . ARG A 1 383 ? -11.273 35.272  64.652 1.00 92.34  ? 409 ARG A NH2   1 
ATOM   2558 N  N     . ASP A 1 384 ? -3.299  35.301  63.951 1.00 98.67  ? 410 ASP A N     1 
ATOM   2559 C  CA    . ASP A 1 384 ? -2.556  35.720  62.763 1.00 102.26 ? 410 ASP A CA    1 
ATOM   2560 C  C     . ASP A 1 384 ? -3.496  36.350  61.729 1.00 103.74 ? 410 ASP A C     1 
ATOM   2561 O  O     . ASP A 1 384 ? -4.258  35.658  61.054 1.00 101.35 ? 410 ASP A O     1 
ATOM   2562 C  CB    . ASP A 1 384 ? -1.794  34.532  62.153 1.00 89.92  ? 410 ASP A CB    1 
ATOM   2563 N  N     . GLY A 1 385 ? -3.421  37.675  61.629 1.00 98.91  ? 411 GLY A N     1 
ATOM   2564 C  CA    . GLY A 1 385 ? -4.326  38.478  60.826 1.00 93.83  ? 411 GLY A CA    1 
ATOM   2565 C  C     . GLY A 1 385 ? -4.198  38.328  59.323 1.00 91.40  ? 411 GLY A C     1 
ATOM   2566 O  O     . GLY A 1 385 ? -3.344  37.592  58.813 1.00 91.89  ? 411 GLY A O     1 
ATOM   2567 N  N     . GLU A 1 386 ? -5.062  39.040  58.603 1.00 82.03  ? 412 GLU A N     1 
ATOM   2568 C  CA    . GLU A 1 386 ? -5.016  39.021  57.149 1.00 83.24  ? 412 GLU A CA    1 
ATOM   2569 C  C     . GLU A 1 386 ? -3.868  39.919  56.711 1.00 76.98  ? 412 GLU A C     1 
ATOM   2570 O  O     . GLU A 1 386 ? -3.538  40.892  57.387 1.00 72.11  ? 412 GLU A O     1 
ATOM   2571 C  CB    . GLU A 1 386 ? -6.339  39.503  56.546 1.00 86.00  ? 412 GLU A CB    1 
ATOM   2572 N  N     . ARG A 1 387 ? -3.252  39.582  55.586 1.00 68.19  ? 413 ARG A N     1 
ATOM   2573 C  CA    . ARG A 1 387 ? -2.064  40.289  55.135 1.00 62.07  ? 413 ARG A CA    1 
ATOM   2574 C  C     . ARG A 1 387 ? -2.398  41.666  54.568 1.00 64.15  ? 413 ARG A C     1 
ATOM   2575 O  O     . ARG A 1 387 ? -3.554  41.972  54.283 1.00 66.32  ? 413 ARG A O     1 
ATOM   2576 C  CB    . ARG A 1 387 ? -1.299  39.451  54.109 1.00 55.43  ? 413 ARG A CB    1 
ATOM   2577 C  CG    . ARG A 1 387 ? -1.543  39.823  52.668 1.00 59.10  ? 413 ARG A CG    1 
ATOM   2578 C  CD    . ARG A 1 387 ? -1.061  38.714  51.735 1.00 59.47  ? 413 ARG A CD    1 
ATOM   2579 N  NE    . ARG A 1 387 ? 0.330   38.348  51.991 1.00 49.76  ? 413 ARG A NE    1 
ATOM   2580 C  CZ    . ARG A 1 387 ? 0.805   37.110  51.937 1.00 50.09  ? 413 ARG A CZ    1 
ATOM   2581 N  NH1   . ARG A 1 387 ? -0.002  36.100  51.659 1.00 57.17  ? 413 ARG A NH1   1 
ATOM   2582 N  NH2   . ARG A 1 387 ? 2.083   36.886  52.195 1.00 47.41  ? 413 ARG A NH2   1 
ATOM   2583 N  N     . LYS A 1 388 ? -1.379  42.503  54.420 1.00 57.07  ? 414 LYS A N     1 
ATOM   2584 C  CA    . LYS A 1 388 ? -1.600  43.880  54.018 1.00 56.62  ? 414 LYS A CA    1 
ATOM   2585 C  C     . LYS A 1 388 ? -0.830  44.227  52.745 1.00 54.48  ? 414 LYS A C     1 
ATOM   2586 O  O     . LYS A 1 388 ? -1.089  45.254  52.112 1.00 52.92  ? 414 LYS A O     1 
ATOM   2587 C  CB    . LYS A 1 388 ? -1.219  44.813  55.166 1.00 61.41  ? 414 LYS A CB    1 
ATOM   2588 C  CG    . LYS A 1 388 ? -2.046  44.543  56.418 1.00 68.39  ? 414 LYS A CG    1 
ATOM   2589 C  CD    . LYS A 1 388 ? -1.385  45.045  57.691 1.00 69.28  ? 414 LYS A CD    1 
ATOM   2590 C  CE    . LYS A 1 388 ? -1.983  44.345  58.910 1.00 75.08  ? 414 LYS A CE    1 
ATOM   2591 N  NZ    . LYS A 1 388 ? -1.286  44.707  60.178 1.00 69.80  ? 414 LYS A NZ    1 
ATOM   2592 N  N     . SER A 1 389 ? 0.112   43.367  52.370 1.00 51.12  ? 415 SER A N     1 
ATOM   2593 C  CA    . SER A 1 389 ? 0.865   43.550  51.137 1.00 44.05  ? 415 SER A CA    1 
ATOM   2594 C  C     . SER A 1 389 ? 1.368   42.218  50.588 1.00 46.03  ? 415 SER A C     1 
ATOM   2595 O  O     . SER A 1 389 ? 1.404   41.211  51.294 1.00 44.28  ? 415 SER A O     1 
ATOM   2596 C  CB    . SER A 1 389 ? 2.045   44.495  51.353 1.00 44.93  ? 415 SER A CB    1 
ATOM   2597 O  OG    . SER A 1 389 ? 3.207   43.781  51.733 1.00 47.74  ? 415 SER A OG    1 
ATOM   2598 N  N     . MET A 1 390 ? 1.756   42.227  49.318 1.00 47.87  ? 416 MET A N     1 
ATOM   2599 C  CA    . MET A 1 390 ? 2.387   41.070  48.697 1.00 38.04  ? 416 MET A CA    1 
ATOM   2600 C  C     . MET A 1 390 ? 3.356   41.552  47.631 1.00 35.31  ? 416 MET A C     1 
ATOM   2601 O  O     . MET A 1 390 ? 3.071   42.521  46.938 1.00 41.42  ? 416 MET A O     1 
ATOM   2602 C  CB    . MET A 1 390 ? 1.342   40.143  48.093 1.00 35.25  ? 416 MET A CB    1 
ATOM   2603 C  CG    . MET A 1 390 ? 1.899   38.811  47.668 1.00 44.10  ? 416 MET A CG    1 
ATOM   2604 S  SD    . MET A 1 390 ? 0.615   37.711  47.067 1.00 54.50  ? 416 MET A SD    1 
ATOM   2605 C  CE    . MET A 1 390 ? -0.421  37.545  48.513 1.00 53.77  ? 416 MET A CE    1 
ATOM   2606 N  N     . SER A 1 391 ? 4.498   40.892  47.490 1.00 29.15  ? 417 SER A N     1 
ATOM   2607 C  CA    . SER A 1 391 ? 5.555   41.463  46.667 1.00 31.36  ? 417 SER A CA    1 
ATOM   2608 C  C     . SER A 1 391 ? 6.577   40.447  46.197 1.00 31.74  ? 417 SER A C     1 
ATOM   2609 O  O     . SER A 1 391 ? 6.901   39.499  46.906 1.00 34.34  ? 417 SER A O     1 
ATOM   2610 C  CB    . SER A 1 391 ? 6.271   42.574  47.435 1.00 34.19  ? 417 SER A CB    1 
ATOM   2611 O  OG    . SER A 1 391 ? 7.015   42.042  48.517 1.00 40.94  ? 417 SER A OG    1 
ATOM   2612 N  N     . VAL A 1 392 ? 7.077   40.650  44.985 1.00 31.34  ? 418 VAL A N     1 
ATOM   2613 C  CA    . VAL A 1 392 ? 8.179   39.841  44.484 1.00 30.08  ? 418 VAL A CA    1 
ATOM   2614 C  C     . VAL A 1 392 ? 9.325   40.755  44.098 1.00 29.83  ? 418 VAL A C     1 
ATOM   2615 O  O     . VAL A 1 392 ? 9.108   41.774  43.450 1.00 37.00  ? 418 VAL A O     1 
ATOM   2616 C  CB    . VAL A 1 392 ? 7.768   38.997  43.268 1.00 33.39  ? 418 VAL A CB    1 
ATOM   2617 C  CG1   . VAL A 1 392 ? 8.911   38.096  42.837 1.00 37.34  ? 418 VAL A CG1   1 
ATOM   2618 C  CG2   . VAL A 1 392 ? 6.533   38.179  43.589 1.00 40.65  ? 418 VAL A CG2   1 
ATOM   2619 N  N     . GLU A 1 393 ? 10.544  40.392  44.477 1.00 28.97  ? 419 GLU A N     1 
ATOM   2620 C  CA    . GLU A 1 393 ? 11.704  41.153  44.037 1.00 30.99  ? 419 GLU A CA    1 
ATOM   2621 C  C     . GLU A 1 393 ? 12.893  40.240  43.809 1.00 36.20  ? 419 GLU A C     1 
ATOM   2622 O  O     . GLU A 1 393 ? 13.028  39.198  44.454 1.00 41.66  ? 419 GLU A O     1 
ATOM   2623 C  CB    . GLU A 1 393 ? 12.055  42.260  45.039 1.00 36.51  ? 419 GLU A CB    1 
ATOM   2624 C  CG    . GLU A 1 393 ? 12.767  41.826  46.316 1.00 35.64  ? 419 GLU A CG    1 
ATOM   2625 C  CD    . GLU A 1 393 ? 12.803  42.944  47.351 1.00 41.98  ? 419 GLU A CD    1 
ATOM   2626 O  OE1   . GLU A 1 393 ? 13.906  43.266  47.853 1.00 38.35  ? 419 GLU A OE1   1 
ATOM   2627 O  OE2   . GLU A 1 393 ? 11.725  43.504  47.655 1.00 42.99  ? 419 GLU A OE2   1 
ATOM   2628 N  N     . ARG A 1 394 ? 13.740  40.632  42.865 1.00 32.07  ? 420 ARG A N     1 
ATOM   2629 C  CA    . ARG A 1 394 ? 14.828  39.782  42.416 1.00 32.43  ? 420 ARG A CA    1 
ATOM   2630 C  C     . ARG A 1 394 ? 16.117  40.575  42.207 1.00 30.25  ? 420 ARG A C     1 
ATOM   2631 O  O     . ARG A 1 394 ? 16.095  41.665  41.626 1.00 36.25  ? 420 ARG A O     1 
ATOM   2632 C  CB    . ARG A 1 394 ? 14.411  39.075  41.124 1.00 40.73  ? 420 ARG A CB    1 
ATOM   2633 C  CG    . ARG A 1 394 ? 15.292  37.929  40.687 1.00 36.12  ? 420 ARG A CG    1 
ATOM   2634 C  CD    . ARG A 1 394 ? 14.425  36.865  40.058 1.00 43.36  ? 420 ARG A CD    1 
ATOM   2635 N  NE    . ARG A 1 394 ? 13.409  36.402  41.000 1.00 54.74  ? 420 ARG A NE    1 
ATOM   2636 C  CZ    . ARG A 1 394 ? 12.244  35.867  40.649 1.00 52.04  ? 420 ARG A CZ    1 
ATOM   2637 N  NH1   . ARG A 1 394 ? 11.937  35.727  39.369 1.00 52.44  ? 420 ARG A NH1   1 
ATOM   2638 N  NH2   . ARG A 1 394 ? 11.383  35.473  41.579 1.00 46.39  ? 420 ARG A NH2   1 
ATOM   2639 N  N     . THR A 1 395 ? 17.223  40.034  42.711 1.00 28.29  ? 421 THR A N     1 
ATOM   2640 C  CA    . THR A 1 395 ? 18.555  40.567  42.443 1.00 32.60  ? 421 THR A CA    1 
ATOM   2641 C  C     . THR A 1 395 ? 19.194  39.842  41.257 1.00 39.50  ? 421 THR A C     1 
ATOM   2642 O  O     . THR A 1 395 ? 19.071  38.625  41.118 1.00 45.00  ? 421 THR A O     1 
ATOM   2643 C  CB    . THR A 1 395 ? 19.479  40.444  43.671 1.00 32.80  ? 421 THR A CB    1 
ATOM   2644 O  OG1   . THR A 1 395 ? 19.009  41.306  44.713 1.00 36.67  ? 421 THR A OG1   1 
ATOM   2645 C  CG2   . THR A 1 395 ? 20.911  40.831  43.320 1.00 33.27  ? 421 THR A CG2   1 
ATOM   2646 N  N     . PHE A 1 396 ? 19.872  40.601  40.404 1.00 44.60  ? 422 PHE A N     1 
ATOM   2647 C  CA    . PHE A 1 396 ? 20.557  40.053  39.242 1.00 41.51  ? 422 PHE A CA    1 
ATOM   2648 C  C     . PHE A 1 396 ? 21.823  40.840  38.946 1.00 42.09  ? 422 PHE A C     1 
ATOM   2649 O  O     . PHE A 1 396 ? 22.016  41.938  39.463 1.00 41.32  ? 422 PHE A O     1 
ATOM   2650 C  CB    . PHE A 1 396 ? 19.636  40.086  38.031 1.00 38.86  ? 422 PHE A CB    1 
ATOM   2651 C  CG    . PHE A 1 396 ? 18.700  41.253  38.034 1.00 42.99  ? 422 PHE A CG    1 
ATOM   2652 C  CD1   . PHE A 1 396 ? 19.170  42.540  37.823 1.00 41.08  ? 422 PHE A CD1   1 
ATOM   2653 C  CD2   . PHE A 1 396 ? 17.346  41.065  38.256 1.00 45.48  ? 422 PHE A CD2   1 
ATOM   2654 C  CE1   . PHE A 1 396 ? 18.306  43.619  37.837 1.00 36.71  ? 422 PHE A CE1   1 
ATOM   2655 C  CE2   . PHE A 1 396 ? 16.476  42.141  38.271 1.00 40.62  ? 422 PHE A CE2   1 
ATOM   2656 C  CZ    . PHE A 1 396 ? 16.959  43.418  38.057 1.00 39.70  ? 422 PHE A CZ    1 
ATOM   2657 N  N     . SER A 1 397 ? 22.691  40.284  38.113 1.00 43.45  ? 423 SER A N     1 
ATOM   2658 C  CA    . SER A 1 397 ? 23.825  41.054  37.639 1.00 48.16  ? 423 SER A CA    1 
ATOM   2659 C  C     . SER A 1 397 ? 23.265  42.147  36.734 1.00 48.41  ? 423 SER A C     1 
ATOM   2660 O  O     . SER A 1 397 ? 22.161  42.009  36.202 1.00 49.03  ? 423 SER A O     1 
ATOM   2661 C  CB    . SER A 1 397 ? 24.837  40.169  36.908 1.00 53.18  ? 423 SER A CB    1 
ATOM   2662 O  OG    . SER A 1 397 ? 24.207  39.342  35.943 1.00 47.52  ? 423 SER A OG    1 
ATOM   2663 N  N     . GLU A 1 398 ? 24.034  43.216  36.563 1.00 46.26  ? 424 GLU A N     1 
ATOM   2664 C  CA    . GLU A 1 398 ? 23.557  44.475  35.990 1.00 43.10  ? 424 GLU A CA    1 
ATOM   2665 C  C     . GLU A 1 398 ? 22.640  44.349  34.762 1.00 44.85  ? 424 GLU A C     1 
ATOM   2666 O  O     . GLU A 1 398 ? 22.858  43.507  33.889 1.00 45.60  ? 424 GLU A O     1 
ATOM   2667 C  CB    . GLU A 1 398 ? 24.771  45.329  35.641 1.00 43.94  ? 424 GLU A CB    1 
ATOM   2668 C  CG    . GLU A 1 398 ? 24.463  46.769  35.334 1.00 53.35  ? 424 GLU A CG    1 
ATOM   2669 C  CD    . GLU A 1 398 ? 25.702  47.646  35.410 1.00 57.12  ? 424 GLU A CD    1 
ATOM   2670 O  OE1   . GLU A 1 398 ? 26.671  47.249  36.095 1.00 58.89  ? 424 GLU A OE1   1 
ATOM   2671 O  OE2   . GLU A 1 398 ? 25.706  48.731  34.787 1.00 57.06  ? 424 GLU A OE2   1 
ATOM   2672 N  N     . ILE A 1 399 ? 21.610  45.192  34.711 1.00 46.77  ? 425 ILE A N     1 
ATOM   2673 C  CA    . ILE A 1 399 ? 20.738  45.298  33.540 1.00 48.30  ? 425 ILE A CA    1 
ATOM   2674 C  C     . ILE A 1 399 ? 20.597  46.761  33.074 1.00 49.70  ? 425 ILE A C     1 
ATOM   2675 O  O     . ILE A 1 399 ? 20.055  47.598  33.801 1.00 43.13  ? 425 ILE A O     1 
ATOM   2676 C  CB    . ILE A 1 399 ? 19.328  44.728  33.824 1.00 37.05  ? 425 ILE A CB    1 
ATOM   2677 C  CG1   . ILE A 1 399 ? 19.397  43.259  34.220 1.00 39.80  ? 425 ILE A CG1   1 
ATOM   2678 C  CG2   . ILE A 1 399 ? 18.433  44.865  32.606 1.00 44.06  ? 425 ILE A CG2   1 
ATOM   2679 C  CD1   . ILE A 1 399 ? 18.027  42.653  34.473 1.00 37.62  ? 425 ILE A CD1   1 
ATOM   2680 N  N     . ASN A 1 400 ? 21.083  47.055  31.866 1.00 52.73  ? 426 ASN A N     1 
ATOM   2681 C  CA    . ASN A 1 400 ? 21.070  48.416  31.325 1.00 48.54  ? 426 ASN A CA    1 
ATOM   2682 C  C     . ASN A 1 400 ? 19.949  48.668  30.329 1.00 45.43  ? 426 ASN A C     1 
ATOM   2683 O  O     . ASN A 1 400 ? 19.355  49.742  30.311 1.00 48.80  ? 426 ASN A O     1 
ATOM   2684 C  CB    . ASN A 1 400 ? 22.401  48.737  30.644 1.00 46.98  ? 426 ASN A CB    1 
ATOM   2685 C  CG    . ASN A 1 400 ? 23.590  48.444  31.524 1.00 57.50  ? 426 ASN A CG    1 
ATOM   2686 O  OD1   . ASN A 1 400 ? 23.438  48.127  32.702 1.00 56.99  ? 426 ASN A OD1   1 
ATOM   2687 N  ND2   . ASN A 1 400 ? 24.787  48.549  30.959 1.00 64.22  ? 426 ASN A ND2   1 
ATOM   2688 N  N     . LYS A 1 401 ? 19.655  47.673  29.503 1.00 46.31  ? 427 LYS A N     1 
ATOM   2689 C  CA    . LYS A 1 401 ? 18.750  47.872  28.381 1.00 50.38  ? 427 LYS A CA    1 
ATOM   2690 C  C     . LYS A 1 401 ? 17.297  47.955  28.823 1.00 43.71  ? 427 LYS A C     1 
ATOM   2691 O  O     . LYS A 1 401 ? 16.764  47.030  29.424 1.00 44.43  ? 427 LYS A O     1 
ATOM   2692 C  CB    . LYS A 1 401 ? 18.942  46.751  27.358 1.00 54.51  ? 427 LYS A CB    1 
ATOM   2693 C  CG    . LYS A 1 401 ? 20.346  46.725  26.769 1.00 62.69  ? 427 LYS A CG    1 
ATOM   2694 C  CD    . LYS A 1 401 ? 20.535  45.608  25.752 1.00 65.96  ? 427 LYS A CD    1 
ATOM   2695 C  CE    . LYS A 1 401 ? 21.883  45.745  25.050 1.00 67.07  ? 427 LYS A CE    1 
ATOM   2696 N  NZ    . LYS A 1 401 ? 23.030  45.753  26.008 1.00 60.34  ? 427 LYS A NZ    1 
ATOM   2697 N  N     . ALA A 1 402 ? 16.671  49.082  28.504 1.00 46.92  ? 428 ALA A N     1 
ATOM   2698 C  CA    . ALA A 1 402 ? 15.289  49.359  28.875 1.00 45.06  ? 428 ALA A CA    1 
ATOM   2699 C  C     . ALA A 1 402 ? 14.311  48.232  28.541 1.00 44.53  ? 428 ALA A C     1 
ATOM   2700 O  O     . ALA A 1 402 ? 13.482  47.884  29.368 1.00 45.45  ? 428 ALA A O     1 
ATOM   2701 C  CB    . ALA A 1 402 ? 14.831  50.651  28.215 1.00 44.67  ? 428 ALA A CB    1 
ATOM   2702 N  N     . GLU A 1 403 ? 14.402  47.661  27.344 1.00 52.19  ? 429 GLU A N     1 
ATOM   2703 C  CA    . GLU A 1 403 ? 13.456  46.618  26.940 1.00 53.52  ? 429 GLU A CA    1 
ATOM   2704 C  C     . GLU A 1 403 ? 13.537  45.405  27.868 1.00 55.50  ? 429 GLU A C     1 
ATOM   2705 O  O     . GLU A 1 403 ? 12.519  44.769  28.204 1.00 54.78  ? 429 GLU A O     1 
ATOM   2706 C  CB    . GLU A 1 403 ? 13.719  46.186  25.500 1.00 52.67  ? 429 GLU A CB    1 
ATOM   2707 C  CG    . GLU A 1 403 ? 12.632  45.304  24.922 1.00 64.54  ? 429 GLU A CG    1 
ATOM   2708 C  CD    . GLU A 1 403 ? 12.934  44.853  23.504 1.00 64.00  ? 429 GLU A CD    1 
ATOM   2709 O  OE1   . GLU A 1 403 ? 13.569  45.629  22.751 1.00 60.67  ? 429 GLU A OE1   1 
ATOM   2710 O  OE2   . GLU A 1 403 ? 12.536  43.720  23.154 1.00 58.48  ? 429 GLU A OE2   1 
ATOM   2711 N  N     . GLU A 1 404 ? 14.759  45.109  28.297 1.00 53.11  ? 430 GLU A N     1 
ATOM   2712 C  CA    . GLU A 1 404 ? 15.001  44.023  29.234 1.00 49.83  ? 430 GLU A CA    1 
ATOM   2713 C  C     . GLU A 1 404 ? 14.405  44.343  30.600 1.00 49.54  ? 430 GLU A C     1 
ATOM   2714 O  O     . GLU A 1 404 ? 13.851  43.465  31.250 1.00 47.00  ? 430 GLU A O     1 
ATOM   2715 C  CB    . GLU A 1 404 ? 16.498  43.735  29.354 1.00 53.91  ? 430 GLU A CB    1 
ATOM   2716 C  CG    . GLU A 1 404 ? 17.061  42.963  28.167 1.00 59.88  ? 430 GLU A CG    1 
ATOM   2717 C  CD    . GLU A 1 404 ? 18.575  42.842  28.200 1.00 63.48  ? 430 GLU A CD    1 
ATOM   2718 O  OE1   . GLU A 1 404 ? 19.186  43.268  29.204 1.00 62.40  ? 430 GLU A OE1   1 
ATOM   2719 O  OE2   . GLU A 1 404 ? 19.153  42.331  27.214 1.00 60.83  ? 430 GLU A OE2   1 
ATOM   2720 N  N     . GLN A 1 405 ? 14.540  45.593  31.039 1.00 45.63  ? 431 GLN A N     1 
ATOM   2721 C  CA    . GLN A 1 405 ? 13.940  46.041  32.295 1.00 40.33  ? 431 GLN A CA    1 
ATOM   2722 C  C     . GLN A 1 405 ? 12.410  45.941  32.262 1.00 42.38  ? 431 GLN A C     1 
ATOM   2723 O  O     . GLN A 1 405 ? 11.789  45.478  33.225 1.00 43.81  ? 431 GLN A O     1 
ATOM   2724 C  CB    . GLN A 1 405 ? 14.387  47.469  32.613 1.00 35.66  ? 431 GLN A CB    1 
ATOM   2725 C  CG    . GLN A 1 405 ? 15.870  47.566  32.954 1.00 37.79  ? 431 GLN A CG    1 
ATOM   2726 C  CD    . GLN A 1 405 ? 16.430  48.970  32.808 1.00 44.11  ? 431 GLN A CD    1 
ATOM   2727 O  OE1   . GLN A 1 405 ? 15.773  49.865  32.277 1.00 45.02  ? 431 GLN A OE1   1 
ATOM   2728 N  NE2   . GLN A 1 405 ? 17.660  49.164  33.271 1.00 43.33  ? 431 GLN A NE2   1 
ATOM   2729 N  N     . TYR A 1 406 ? 11.805  46.360  31.154 1.00 41.97  ? 432 TYR A N     1 
ATOM   2730 C  CA    . TYR A 1 406 ? 10.365  46.210  30.976 1.00 44.38  ? 432 TYR A CA    1 
ATOM   2731 C  C     . TYR A 1 406 ? 9.957   44.741  31.030 1.00 44.69  ? 432 TYR A C     1 
ATOM   2732 O  O     . TYR A 1 406 ? 8.945   44.395  31.648 1.00 49.45  ? 432 TYR A O     1 
ATOM   2733 C  CB    . TYR A 1 406 ? 9.896   46.838  29.656 1.00 47.87  ? 432 TYR A CB    1 
ATOM   2734 C  CG    . TYR A 1 406 ? 9.849   48.352  29.666 1.00 50.43  ? 432 TYR A CG    1 
ATOM   2735 C  CD1   . TYR A 1 406 ? 8.822   49.030  30.321 1.00 50.23  ? 432 TYR A CD1   1 
ATOM   2736 C  CD2   . TYR A 1 406 ? 10.813  49.103  29.008 1.00 53.12  ? 432 TYR A CD2   1 
ATOM   2737 C  CE1   . TYR A 1 406 ? 8.768   50.415  30.335 1.00 49.39  ? 432 TYR A CE1   1 
ATOM   2738 C  CE2   . TYR A 1 406 ? 10.770  50.488  29.014 1.00 56.55  ? 432 TYR A CE2   1 
ATOM   2739 C  CZ    . TYR A 1 406 ? 9.745   51.140  29.680 1.00 60.12  ? 432 TYR A CZ    1 
ATOM   2740 O  OH    . TYR A 1 406 ? 9.697   52.519  29.688 1.00 60.88  ? 432 TYR A OH    1 
ATOM   2741 N  N     . SER A 1 407 ? 10.737  43.884  30.373 1.00 46.24  ? 433 SER A N     1 
ATOM   2742 C  CA    . SER A 1 407 ? 10.451  42.448  30.368 1.00 44.24  ? 433 SER A CA    1 
ATOM   2743 C  C     . SER A 1 407 ? 10.517  41.864  31.783 1.00 43.47  ? 433 SER A C     1 
ATOM   2744 O  O     . SER A 1 407 ? 9.634   41.109  32.206 1.00 44.26  ? 433 SER A O     1 
ATOM   2745 C  CB    . SER A 1 407 ? 11.428  41.714  29.447 1.00 52.27  ? 433 SER A CB    1 
ATOM   2746 O  OG    . SER A 1 407 ? 11.273  42.117  28.094 1.00 56.69  ? 433 SER A OG    1 
ATOM   2747 N  N     . LEU A 1 408 ? 11.570  42.237  32.505 1.00 45.20  ? 434 LEU A N     1 
ATOM   2748 C  CA    . LEU A 1 408 ? 11.765  41.864  33.901 1.00 42.20  ? 434 LEU A CA    1 
ATOM   2749 C  C     . LEU A 1 408 ? 10.550  42.234  34.732 1.00 41.67  ? 434 LEU A C     1 
ATOM   2750 O  O     . LEU A 1 408 ? 10.013  41.414  35.492 1.00 41.84  ? 434 LEU A O     1 
ATOM   2751 C  CB    . LEU A 1 408 ? 13.004  42.572  34.454 1.00 39.18  ? 434 LEU A CB    1 
ATOM   2752 C  CG    . LEU A 1 408 ? 14.029  41.775  35.251 1.00 43.60  ? 434 LEU A CG    1 
ATOM   2753 C  CD1   . LEU A 1 408 ? 13.362  41.050  36.408 1.00 46.69  ? 434 LEU A CD1   1 
ATOM   2754 C  CD2   . LEU A 1 408 ? 14.759  40.807  34.338 1.00 47.36  ? 434 LEU A CD2   1 
ATOM   2755 N  N     . CYS A 1 409 ? 10.120  43.480  34.562 1.00 37.66  ? 435 CYS A N     1 
ATOM   2756 C  CA    . CYS A 1 409 ? 8.924   43.974  35.219 1.00 39.98  ? 435 CYS A CA    1 
ATOM   2757 C  C     . CYS A 1 409 ? 7.725   43.098  34.914 1.00 43.25  ? 435 CYS A C     1 
ATOM   2758 O  O     . CYS A 1 409 ? 6.969   42.737  35.812 1.00 42.11  ? 435 CYS A O     1 
ATOM   2759 C  CB    . CYS A 1 409 ? 8.621   45.400  34.783 1.00 45.32  ? 435 CYS A CB    1 
ATOM   2760 S  SG    . CYS A 1 409 ? 7.423   46.215  35.837 1.00 46.17  ? 435 CYS A SG    1 
ATOM   2761 N  N     . GLN A 1 410 ? 7.562   42.762  33.638 1.00 42.62  ? 436 GLN A N     1 
ATOM   2762 C  CA    . GLN A 1 410 ? 6.424   41.970  33.195 1.00 41.92  ? 436 GLN A CA    1 
ATOM   2763 C  C     . GLN A 1 410 ? 6.404   40.620  33.883 1.00 43.60  ? 436 GLN A C     1 
ATOM   2764 O  O     . GLN A 1 410 ? 5.358   40.159  34.346 1.00 44.76  ? 436 GLN A O     1 
ATOM   2765 C  CB    . GLN A 1 410 ? 6.472   41.785  31.678 1.00 45.72  ? 436 GLN A CB    1 
ATOM   2766 C  CG    . GLN A 1 410 ? 5.254   41.103  31.082 1.00 49.83  ? 436 GLN A CG    1 
ATOM   2767 C  CD    . GLN A 1 410 ? 5.161   41.315  29.580 1.00 60.12  ? 436 GLN A CD    1 
ATOM   2768 O  OE1   . GLN A 1 410 ? 6.000   41.999  28.984 1.00 61.41  ? 436 GLN A OE1   1 
ATOM   2769 N  NE2   . GLN A 1 410 ? 4.153   40.714  28.956 1.00 66.74  ? 436 GLN A NE2   1 
ATOM   2770 N  N     . GLU A 1 411 ? 7.580   40.008  33.964 1.00 43.76  ? 437 GLU A N     1 
ATOM   2771 C  CA    . GLU A 1 411 ? 7.741   38.717  34.615 1.00 43.20  ? 437 GLU A CA    1 
ATOM   2772 C  C     . GLU A 1 411 ? 7.385   38.780  36.102 1.00 44.53  ? 437 GLU A C     1 
ATOM   2773 O  O     . GLU A 1 411 ? 6.597   37.957  36.608 1.00 43.74  ? 437 GLU A O     1 
ATOM   2774 C  CB    . GLU A 1 411 ? 9.173   38.221  34.405 1.00 51.02  ? 437 GLU A CB    1 
ATOM   2775 C  CG    . GLU A 1 411 ? 9.481   37.918  32.929 1.00 55.38  ? 437 GLU A CG    1 
ATOM   2776 C  CD    . GLU A 1 411 ? 10.968  37.915  32.595 1.00 50.14  ? 437 GLU A CD    1 
ATOM   2777 O  OE1   . GLU A 1 411 ? 11.790  38.272  33.461 1.00 56.89  ? 437 GLU A OE1   1 
ATOM   2778 O  OE2   . GLU A 1 411 ? 11.317  37.565  31.451 1.00 50.72  ? 437 GLU A OE2   1 
ATOM   2779 N  N     . LEU A 1 412 ? 7.963   39.758  36.797 1.00 42.94  ? 438 LEU A N     1 
ATOM   2780 C  CA    . LEU A 1 412 ? 7.693   39.933  38.221 1.00 33.67  ? 438 LEU A CA    1 
ATOM   2781 C  C     . LEU A 1 412 ? 6.199   40.124  38.469 1.00 37.44  ? 438 LEU A C     1 
ATOM   2782 O  O     . LEU A 1 412 ? 5.613   39.503  39.369 1.00 40.51  ? 438 LEU A O     1 
ATOM   2783 C  CB    . LEU A 1 412 ? 8.488   41.113  38.765 1.00 31.17  ? 438 LEU A CB    1 
ATOM   2784 C  CG    . LEU A 1 412 ? 9.996   40.874  38.806 1.00 30.06  ? 438 LEU A CG    1 
ATOM   2785 C  CD1   . LEU A 1 412 ? 10.745  42.135  39.188 1.00 33.30  ? 438 LEU A CD1   1 
ATOM   2786 C  CD2   . LEU A 1 412 ? 10.318  39.752  39.779 1.00 38.15  ? 438 LEU A CD2   1 
ATOM   2787 N  N     . CYS A 1 413 ? 5.590   40.981  37.656 1.00 36.75  ? 439 CYS A N     1 
ATOM   2788 C  CA    . CYS A 1 413 ? 4.149   41.190  37.696 1.00 38.82  ? 439 CYS A CA    1 
ATOM   2789 C  C     . CYS A 1 413 ? 3.387   39.890  37.511 1.00 42.04  ? 439 CYS A C     1 
ATOM   2790 O  O     . CYS A 1 413 ? 2.382   39.668  38.179 1.00 41.56  ? 439 CYS A O     1 
ATOM   2791 C  CB    . CYS A 1 413 ? 3.722   42.198  36.631 1.00 42.47  ? 439 CYS A CB    1 
ATOM   2792 S  SG    . CYS A 1 413 ? 4.331   43.881  36.918 1.00 48.72  ? 439 CYS A SG    1 
ATOM   2793 N  N     . SER A 1 414 ? 3.854   39.049  36.589 1.00 40.20  ? 440 SER A N     1 
ATOM   2794 C  CA    . SER A 1 414 ? 3.244   37.739  36.373 1.00 42.34  ? 440 SER A CA    1 
ATOM   2795 C  C     . SER A 1 414 ? 3.275   36.891  37.642 1.00 49.66  ? 440 SER A C     1 
ATOM   2796 O  O     . SER A 1 414 ? 2.225   36.415  38.099 1.00 50.82  ? 440 SER A O     1 
ATOM   2797 C  CB    . SER A 1 414 ? 3.934   36.997  35.229 1.00 48.20  ? 440 SER A CB    1 
ATOM   2798 O  OG    . SER A 1 414 ? 3.604   37.577  33.978 1.00 56.94  ? 440 SER A OG    1 
ATOM   2799 N  N     . GLU A 1 415 ? 4.470   36.691  38.205 1.00 44.84  ? 441 GLU A N     1 
ATOM   2800 C  CA    . GLU A 1 415 ? 4.577   35.901  39.438 1.00 40.14  ? 441 GLU A CA    1 
ATOM   2801 C  C     . GLU A 1 415 ? 3.647   36.452  40.511 1.00 46.51  ? 441 GLU A C     1 
ATOM   2802 O  O     . GLU A 1 415 ? 2.984   35.691  41.229 1.00 54.36  ? 441 GLU A O     1 
ATOM   2803 C  CB    . GLU A 1 415 ? 6.007   35.882  39.978 1.00 35.87  ? 441 GLU A CB    1 
ATOM   2804 C  CG    . GLU A 1 415 ? 7.094   35.791  38.935 1.00 46.81  ? 441 GLU A CG    1 
ATOM   2805 C  CD    . GLU A 1 415 ? 8.467   35.583  39.553 1.00 55.04  ? 441 GLU A CD    1 
ATOM   2806 O  OE1   . GLU A 1 415 ? 8.543   35.390  40.787 1.00 49.92  ? 441 GLU A OE1   1 
ATOM   2807 O  OE2   . GLU A 1 415 ? 9.470   35.618  38.805 1.00 62.00  ? 441 GLU A OE2   1 
ATOM   2808 N  N     . LEU A 1 416 ? 3.591   37.779  40.607 1.00 43.65  ? 442 LEU A N     1 
ATOM   2809 C  CA    . LEU A 1 416 ? 2.763   38.413  41.620 1.00 43.23  ? 442 LEU A CA    1 
ATOM   2810 C  C     . LEU A 1 416 ? 1.290   38.093  41.396 1.00 47.12  ? 442 LEU A C     1 
ATOM   2811 O  O     . LEU A 1 416 ? 0.580   37.730  42.334 1.00 48.86  ? 442 LEU A O     1 
ATOM   2812 C  CB    . LEU A 1 416 ? 2.990   39.921  41.637 1.00 43.81  ? 442 LEU A CB    1 
ATOM   2813 C  CG    . LEU A 1 416 ? 2.454   40.609  42.893 1.00 38.95  ? 442 LEU A CG    1 
ATOM   2814 C  CD1   . LEU A 1 416 ? 3.108   40.017  44.138 1.00 36.83  ? 442 LEU A CD1   1 
ATOM   2815 C  CD2   . LEU A 1 416 ? 2.681   42.110  42.817 1.00 32.03  ? 442 LEU A CD2   1 
ATOM   2816 N  N     . ALA A 1 417 ? 0.834   38.237  40.155 1.00 44.95  ? 443 ALA A N     1 
ATOM   2817 C  CA    . ALA A 1 417 ? -0.532  37.876  39.792 1.00 48.12  ? 443 ALA A CA    1 
ATOM   2818 C  C     . ALA A 1 417 ? -0.821  36.424  40.157 1.00 50.33  ? 443 ALA A C     1 
ATOM   2819 O  O     . ALA A 1 417 ? -1.930  36.080  40.568 1.00 51.03  ? 443 ALA A O     1 
ATOM   2820 C  CB    . ALA A 1 417 ? -0.763  38.100  38.318 1.00 51.21  ? 443 ALA A CB    1 
ATOM   2821 N  N     . GLN A 1 418 ? 0.191   35.578  40.011 1.00 48.31  ? 444 GLN A N     1 
ATOM   2822 C  CA    . GLN A 1 418 ? 0.061   34.176  40.383 1.00 54.68  ? 444 GLN A CA    1 
ATOM   2823 C  C     . GLN A 1 418 ? -0.157  33.997  41.885 1.00 59.56  ? 444 GLN A C     1 
ATOM   2824 O  O     . GLN A 1 418 ? -1.016  33.214  42.303 1.00 60.84  ? 444 GLN A O     1 
ATOM   2825 C  CB    . GLN A 1 418 ? 1.284   33.387  39.924 1.00 55.97  ? 444 GLN A CB    1 
ATOM   2826 C  CG    . GLN A 1 418 ? 1.049   32.654  38.623 1.00 60.85  ? 444 GLN A CG    1 
ATOM   2827 C  CD    . GLN A 1 418 ? 0.075   31.498  38.781 1.00 72.05  ? 444 GLN A CD    1 
ATOM   2828 O  OE1   . GLN A 1 418 ? 0.399   30.478  39.393 1.00 72.20  ? 444 GLN A OE1   1 
ATOM   2829 N  NE2   . GLN A 1 418 ? -1.135  31.661  38.246 1.00 68.65  ? 444 GLN A NE2   1 
ATOM   2830 N  N     . ASP A 1 419 ? 0.634   34.697  42.695 1.00 58.60  ? 445 ASP A N     1 
ATOM   2831 C  CA    . ASP A 1 419 ? 0.495   34.605  44.153 1.00 54.28  ? 445 ASP A CA    1 
ATOM   2832 C  C     . ASP A 1 419 ? -0.856  35.155  44.648 1.00 52.83  ? 445 ASP A C     1 
ATOM   2833 O  O     . ASP A 1 419 ? -1.549  34.536  45.483 1.00 60.79  ? 445 ASP A O     1 
ATOM   2834 C  CB    . ASP A 1 419 ? 1.640   35.356  44.829 1.00 50.48  ? 445 ASP A CB    1 
ATOM   2835 C  CG    . ASP A 1 419 ? 3.007   34.897  44.352 1.00 52.58  ? 445 ASP A CG    1 
ATOM   2836 O  OD1   . ASP A 1 419 ? 3.110   33.771  43.819 1.00 52.07  ? 445 ASP A OD1   1 
ATOM   2837 O  OD2   . ASP A 1 419 ? 3.978   35.673  44.502 1.00 45.41  ? 445 ASP A OD2   1 
ATOM   2838 N  N     . LEU A 1 420 ? -1.218  36.326  44.128 1.00 52.13  ? 446 LEU A N     1 
ATOM   2839 C  CA    . LEU A 1 420 ? -2.529  36.915  44.365 1.00 53.70  ? 446 LEU A CA    1 
ATOM   2840 C  C     . LEU A 1 420 ? -3.615  35.901  44.038 1.00 60.47  ? 446 LEU A C     1 
ATOM   2841 O  O     . LEU A 1 420 ? -4.576  35.745  44.790 1.00 62.64  ? 446 LEU A O     1 
ATOM   2842 C  CB    . LEU A 1 420 ? -2.714  38.185  43.541 1.00 50.30  ? 446 LEU A CB    1 
ATOM   2843 C  CG    . LEU A 1 420 ? -1.805  39.352  43.916 1.00 51.05  ? 446 LEU A CG    1 
ATOM   2844 C  CD1   . LEU A 1 420 ? -2.171  40.596  43.119 1.00 45.87  ? 446 LEU A CD1   1 
ATOM   2845 C  CD2   . LEU A 1 420 ? -1.893  39.623  45.410 1.00 57.03  ? 446 LEU A CD2   1 
ATOM   2846 N  N     . GLN A 1 421 ? -3.459  35.232  42.897 1.00 62.91  ? 447 GLN A N     1 
ATOM   2847 C  CA    . GLN A 1 421 ? -4.348  34.147  42.505 1.00 60.22  ? 447 GLN A CA    1 
ATOM   2848 C  C     . GLN A 1 421 ? -4.408  33.078  43.598 1.00 65.46  ? 447 GLN A C     1 
ATOM   2849 O  O     . GLN A 1 421 ? -5.499  32.642  43.977 1.00 68.39  ? 447 GLN A O     1 
ATOM   2850 C  CB    . GLN A 1 421 ? -3.905  33.538  41.174 1.00 57.76  ? 447 GLN A CB    1 
ATOM   2851 C  CG    . GLN A 1 421 ? -4.143  32.039  41.062 1.00 70.86  ? 447 GLN A CG    1 
ATOM   2852 C  CD    . GLN A 1 421 ? -5.605  31.702  40.835 1.00 77.14  ? 447 GLN A CD    1 
ATOM   2853 O  OE1   . GLN A 1 421 ? -6.144  30.776  41.449 1.00 73.75  ? 447 GLN A OE1   1 
ATOM   2854 N  NE2   . GLN A 1 421 ? -6.257  32.458  39.953 1.00 71.64  ? 447 GLN A NE2   1 
ATOM   2855 N  N     . LYS A 1 422 ? -3.244  32.651  44.093 1.00 64.27  ? 448 LYS A N     1 
ATOM   2856 C  CA    . LYS A 1 422 ? -3.198  31.701  45.209 1.00 59.12  ? 448 LYS A CA    1 
ATOM   2857 C  C     . LYS A 1 422 ? -4.070  32.127  46.379 1.00 61.61  ? 448 LYS A C     1 
ATOM   2858 O  O     . LYS A 1 422 ? -4.835  31.320  46.910 1.00 61.62  ? 448 LYS A O     1 
ATOM   2859 C  CB    . LYS A 1 422 ? -1.766  31.498  45.712 1.00 61.93  ? 448 LYS A CB    1 
ATOM   2860 C  CG    . LYS A 1 422 ? -1.184  30.125  45.415 1.00 69.18  ? 448 LYS A CG    1 
ATOM   2861 C  CD    . LYS A 1 422 ? 0.155   29.918  46.117 1.00 71.06  ? 448 LYS A CD    1 
ATOM   2862 C  CE    . LYS A 1 422 ? 1.214   30.902  45.616 1.00 67.28  ? 448 LYS A CE    1 
ATOM   2863 N  NZ    . LYS A 1 422 ? 1.685   30.585  44.230 1.00 62.12  ? 448 LYS A NZ    1 
ATOM   2864 N  N     . GLU A 1 423 ? -3.963  33.388  46.792 1.00 68.83  ? 449 GLU A N     1 
ATOM   2865 C  CA    . GLU A 1 423 ? -4.807  33.822  47.912 1.00 65.84  ? 449 GLU A CA    1 
ATOM   2866 C  C     . GLU A 1 423 ? -6.073  34.594  47.519 1.00 68.14  ? 449 GLU A C     1 
ATOM   2867 O  O     . GLU A 1 423 ? -6.735  35.174  48.383 1.00 65.51  ? 449 GLU A O     1 
ATOM   2868 C  CB    . GLU A 1 423 ? -4.001  34.654  48.908 1.00 64.71  ? 449 GLU A CB    1 
ATOM   2869 C  CG    . GLU A 1 423 ? -3.168  33.810  49.858 1.00 71.30  ? 449 GLU A CG    1 
ATOM   2870 C  CD    . GLU A 1 423 ? -2.660  34.591  51.058 1.00 82.31  ? 449 GLU A CD    1 
ATOM   2871 O  OE1   . GLU A 1 423 ? -2.783  35.837  51.059 1.00 76.01  ? 449 GLU A OE1   1 
ATOM   2872 O  OE2   . GLU A 1 423 ? -2.148  33.953  52.007 1.00 90.65  ? 449 GLU A OE2   1 
ATOM   2873 N  N     . ARG A 1 424 ? -6.402  34.599  46.227 1.00 69.24  ? 450 ARG A N     1 
ATOM   2874 C  CA    . ARG A 1 424 ? -7.619  35.245  45.719 1.00 68.20  ? 450 ARG A CA    1 
ATOM   2875 C  C     . ARG A 1 424 ? -7.677  36.731  46.078 1.00 68.35  ? 450 ARG A C     1 
ATOM   2876 O  O     . ARG A 1 424 ? -8.753  37.285  46.314 1.00 64.78  ? 450 ARG A O     1 
ATOM   2877 C  CB    . ARG A 1 424 ? -8.867  34.536  46.254 1.00 69.14  ? 450 ARG A CB    1 
ATOM   2878 C  CG    . ARG A 1 424 ? -8.846  33.024  46.119 1.00 72.39  ? 450 ARG A CG    1 
ATOM   2879 C  CD    . ARG A 1 424 ? -9.441  32.563  44.797 1.00 77.27  ? 450 ARG A CD    1 
ATOM   2880 N  NE    . ARG A 1 424 ? -9.662  31.116  44.779 1.00 90.27  ? 450 ARG A NE    1 
ATOM   2881 C  CZ    . ARG A 1 424 ? -9.060  30.270  43.947 1.00 83.09  ? 450 ARG A CZ    1 
ATOM   2882 N  NH1   . ARG A 1 424 ? -8.195  30.729  43.050 1.00 69.69  ? 450 ARG A NH1   1 
ATOM   2883 N  NH2   . ARG A 1 424 ? -9.328  28.967  44.012 1.00 73.12  ? 450 ARG A NH2   1 
ATOM   2884 N  N     . LEU A 1 425 ? -6.517  37.376  46.104 1.00 62.30  ? 451 LEU A N     1 
ATOM   2885 C  CA    . LEU A 1 425 ? -6.429  38.741  46.600 1.00 60.90  ? 451 LEU A CA    1 
ATOM   2886 C  C     . LEU A 1 425 ? -6.462  39.780  45.495 1.00 66.13  ? 451 LEU A C     1 
ATOM   2887 O  O     . LEU A 1 425 ? -5.937  39.574  44.404 1.00 70.30  ? 451 LEU A O     1 
ATOM   2888 C  CB    . LEU A 1 425 ? -5.162  38.915  47.431 1.00 63.71  ? 451 LEU A CB    1 
ATOM   2889 C  CG    . LEU A 1 425 ? -5.205  38.218  48.790 1.00 66.60  ? 451 LEU A CG    1 
ATOM   2890 C  CD1   . LEU A 1 425 ? -3.888  38.398  49.507 1.00 66.06  ? 451 LEU A CD1   1 
ATOM   2891 C  CD2   . LEU A 1 425 ? -6.357  38.752  49.625 1.00 70.25  ? 451 LEU A CD2   1 
ATOM   2892 N  N     . LYS A 1 426 ? -7.080  40.911  45.806 1.00 61.90  ? 452 LYS A N     1 
ATOM   2893 C  CA    . LYS A 1 426 ? -7.250  41.990  44.854 1.00 59.98  ? 452 LYS A CA    1 
ATOM   2894 C  C     . LYS A 1 426 ? -6.961  43.306  45.552 1.00 68.84  ? 452 LYS A C     1 
ATOM   2895 O  O     . LYS A 1 426 ? -7.575  43.616  46.570 1.00 78.52  ? 452 LYS A O     1 
ATOM   2896 C  CB    . LYS A 1 426 ? -8.674  41.987  44.295 1.00 65.58  ? 452 LYS A CB    1 
ATOM   2897 C  CG    . LYS A 1 426 ? -8.782  41.648  42.829 1.00 71.07  ? 452 LYS A CG    1 
ATOM   2898 C  CD    . LYS A 1 426 ? -9.840  40.588  42.574 1.00 70.92  ? 452 LYS A CD    1 
ATOM   2899 C  CE    . LYS A 1 426 ? -11.031 41.157  41.820 1.00 72.41  ? 452 LYS A CE    1 
ATOM   2900 N  NZ    . LYS A 1 426 ? -12.308 40.879  42.542 1.00 68.69  ? 452 LYS A NZ    1 
ATOM   2901 N  N     . GLY A 1 427 ? -6.030  44.081  45.010 1.00 60.98  ? 453 GLY A N     1 
ATOM   2902 C  CA    . GLY A 1 427 ? -5.668  45.335  45.638 1.00 57.21  ? 453 GLY A CA    1 
ATOM   2903 C  C     . GLY A 1 427 ? -5.513  46.458  44.646 1.00 54.40  ? 453 GLY A C     1 
ATOM   2904 O  O     . GLY A 1 427 ? -5.559  46.240  43.439 1.00 59.40  ? 453 GLY A O     1 
ATOM   2905 N  N     . ARG A 1 428 ? -5.301  47.664  45.157 1.00 53.16  ? 454 ARG A N     1 
ATOM   2906 C  CA    . ARG A 1 428 ? -5.296  48.838  44.298 1.00 53.67  ? 454 ARG A CA    1 
ATOM   2907 C  C     . ARG A 1 428 ? -4.103  49.792  44.451 1.00 47.52  ? 454 ARG A C     1 
ATOM   2908 O  O     . ARG A 1 428 ? -4.154  50.925  43.975 1.00 52.28  ? 454 ARG A O     1 
ATOM   2909 C  CB    . ARG A 1 428 ? -6.608  49.594  44.489 1.00 58.34  ? 454 ARG A CB    1 
ATOM   2910 C  CG    . ARG A 1 428 ? -7.110  49.642  45.911 1.00 56.19  ? 454 ARG A CG    1 
ATOM   2911 C  CD    . ARG A 1 428 ? -8.311  50.563  46.010 1.00 65.31  ? 454 ARG A CD    1 
ATOM   2912 N  NE    . ARG A 1 428 ? -8.563  51.009  47.378 1.00 79.60  ? 454 ARG A NE    1 
ATOM   2913 C  CZ    . ARG A 1 428 ? -8.236  52.208  47.855 1.00 81.77  ? 454 ARG A CZ    1 
ATOM   2914 N  NH1   . ARG A 1 428 ? -7.642  53.104  47.076 1.00 76.15  ? 454 ARG A NH1   1 
ATOM   2915 N  NH2   . ARG A 1 428 ? -8.514  52.513  49.116 1.00 91.75  ? 454 ARG A NH2   1 
ATOM   2916 N  N     . THR A 1 429 ? -3.040  49.346  45.109 1.00 44.70  ? 455 THR A N     1 
ATOM   2917 C  CA    . THR A 1 429 ? -1.802  50.118  45.129 1.00 44.11  ? 455 THR A CA    1 
ATOM   2918 C  C     . THR A 1 429 ? -0.656  49.283  44.592 1.00 38.93  ? 455 THR A C     1 
ATOM   2919 O  O     . THR A 1 429 ? -0.385  48.205  45.106 1.00 44.12  ? 455 THR A O     1 
ATOM   2920 C  CB    . THR A 1 429 ? -1.448  50.611  46.543 1.00 42.49  ? 455 THR A CB    1 
ATOM   2921 O  OG1   . THR A 1 429 ? -2.381  51.623  46.938 1.00 49.40  ? 455 THR A OG1   1 
ATOM   2922 C  CG2   . THR A 1 429 ? -0.045  51.203  46.570 1.00 36.67  ? 455 THR A CG2   1 
ATOM   2923 N  N     . VAL A 1 430 ? 0.023   49.778  43.565 1.00 32.02  ? 456 VAL A N     1 
ATOM   2924 C  CA    . VAL A 1 430 ? 1.153   49.050  42.999 1.00 36.91  ? 456 VAL A CA    1 
ATOM   2925 C  C     . VAL A 1 430 ? 2.420   49.854  43.181 1.00 35.45  ? 456 VAL A C     1 
ATOM   2926 O  O     . VAL A 1 430 ? 2.488   51.017  42.797 1.00 37.76  ? 456 VAL A O     1 
ATOM   2927 C  CB    . VAL A 1 430 ? 0.963   48.734  41.496 1.00 36.50  ? 456 VAL A CB    1 
ATOM   2928 C  CG1   . VAL A 1 430 ? 2.267   48.246  40.881 1.00 32.26  ? 456 VAL A CG1   1 
ATOM   2929 C  CG2   . VAL A 1 430 ? -0.152  47.712  41.284 1.00 33.90  ? 456 VAL A CG2   1 
ATOM   2930 N  N     . THR A 1 431 ? 3.427   49.222  43.765 1.00 34.91  ? 457 THR A N     1 
ATOM   2931 C  CA    . THR A 1 431 ? 4.702   49.869  44.002 1.00 34.40  ? 457 THR A CA    1 
ATOM   2932 C  C     . THR A 1 431 ? 5.800   49.118  43.281 1.00 31.75  ? 457 THR A C     1 
ATOM   2933 O  O     . THR A 1 431 ? 5.880   47.894  43.365 1.00 38.10  ? 457 THR A O     1 
ATOM   2934 C  CB    . THR A 1 431 ? 5.042   49.914  45.504 1.00 33.17  ? 457 THR A CB    1 
ATOM   2935 O  OG1   . THR A 1 431 ? 3.889   50.313  46.255 1.00 34.93  ? 457 THR A OG1   1 
ATOM   2936 C  CG2   . THR A 1 431 ? 6.209   50.855  45.781 1.00 30.82  ? 457 THR A CG2   1 
ATOM   2937 N  N     . ILE A 1 432 ? 6.646   49.840  42.565 1.00 27.73  ? 458 ILE A N     1 
ATOM   2938 C  CA    . ILE A 1 432 ? 7.837   49.218  42.024 1.00 30.13  ? 458 ILE A CA    1 
ATOM   2939 C  C     . ILE A 1 432 ? 9.016   49.611  42.898 1.00 33.62  ? 458 ILE A C     1 
ATOM   2940 O  O     . ILE A 1 432 ? 9.016   50.679  43.526 1.00 30.94  ? 458 ILE A O     1 
ATOM   2941 C  CB    . ILE A 1 432 ? 8.101   49.618  40.551 1.00 28.72  ? 458 ILE A CB    1 
ATOM   2942 C  CG1   . ILE A 1 432 ? 8.507   51.088  40.438 1.00 33.11  ? 458 ILE A CG1   1 
ATOM   2943 C  CG2   . ILE A 1 432 ? 6.878   49.341  39.703 1.00 32.71  ? 458 ILE A CG2   1 
ATOM   2944 C  CD1   . ILE A 1 432 ? 9.140   51.439  39.120 1.00 37.73  ? 458 ILE A CD1   1 
ATOM   2945 N  N     . LYS A 1 433 ? 10.006  48.728  42.943 1.00 29.85  ? 459 LYS A N     1 
ATOM   2946 C  CA    . LYS A 1 433 ? 11.196  48.940  43.740 1.00 28.45  ? 459 LYS A CA    1 
ATOM   2947 C  C     . LYS A 1 433 ? 12.389  48.818  42.813 1.00 29.07  ? 459 LYS A C     1 
ATOM   2948 O  O     . LYS A 1 433 ? 12.435  47.914  41.983 1.00 29.18  ? 459 LYS A O     1 
ATOM   2949 C  CB    . LYS A 1 433 ? 11.261  47.926  44.884 1.00 28.07  ? 459 LYS A CB    1 
ATOM   2950 C  CG    . LYS A 1 433 ? 12.512  47.995  45.740 1.00 29.88  ? 459 LYS A CG    1 
ATOM   2951 C  CD    . LYS A 1 433 ? 12.321  47.180  47.014 1.00 39.25  ? 459 LYS A CD    1 
ATOM   2952 C  CE    . LYS A 1 433 ? 13.591  47.109  47.847 1.00 41.40  ? 459 LYS A CE    1 
ATOM   2953 N  NZ    . LYS A 1 433 ? 13.396  46.287  49.075 1.00 38.48  ? 459 LYS A NZ    1 
ATOM   2954 N  N     . LEU A 1 434 ? 13.340  49.736  42.939 1.00 27.88  ? 460 LEU A N     1 
ATOM   2955 C  CA    . LEU A 1 434 ? 14.502  49.748  42.062 1.00 26.96  ? 460 LEU A CA    1 
ATOM   2956 C  C     . LEU A 1 434 ? 15.760  50.008  42.868 1.00 33.02  ? 460 LEU A C     1 
ATOM   2957 O  O     . LEU A 1 434 ? 15.843  50.976  43.621 1.00 34.73  ? 460 LEU A O     1 
ATOM   2958 C  CB    . LEU A 1 434 ? 14.356  50.808  40.969 1.00 26.47  ? 460 LEU A CB    1 
ATOM   2959 C  CG    . LEU A 1 434 ? 13.136  50.723  40.050 1.00 30.23  ? 460 LEU A CG    1 
ATOM   2960 C  CD1   . LEU A 1 434 ? 12.906  52.045  39.337 1.00 32.25  ? 460 LEU A CD1   1 
ATOM   2961 C  CD2   . LEU A 1 434 ? 13.283  49.594  39.044 1.00 31.21  ? 460 LEU A CD2   1 
ATOM   2962 N  N     . LYS A 1 435 ? 16.736  49.127  42.700 1.00 32.22  ? 461 LYS A N     1 
ATOM   2963 C  CA    . LYS A 1 435 ? 17.994  49.203  43.418 1.00 34.37  ? 461 LYS A CA    1 
ATOM   2964 C  C     . LYS A 1 435 ? 19.091  49.271  42.379 1.00 39.33  ? 461 LYS A C     1 
ATOM   2965 O  O     . LYS A 1 435 ? 19.242  48.336  41.615 1.00 43.95  ? 461 LYS A O     1 
ATOM   2966 C  CB    . LYS A 1 435 ? 18.152  47.972  44.310 1.00 32.95  ? 461 LYS A CB    1 
ATOM   2967 C  CG    . LYS A 1 435 ? 19.332  47.945  45.265 1.00 34.37  ? 461 LYS A CG    1 
ATOM   2968 C  CD    . LYS A 1 435 ? 19.016  46.973  46.405 1.00 37.53  ? 461 LYS A CD    1 
ATOM   2969 C  CE    . LYS A 1 435 ? 20.255  46.504  47.149 1.00 46.39  ? 461 LYS A CE    1 
ATOM   2970 N  NZ    . LYS A 1 435 ? 19.920  45.474  48.183 1.00 38.00  ? 461 LYS A NZ    1 
ATOM   2971 N  N     . ASN A 1 436 ? 19.843  50.366  42.318 1.00 46.50  ? 462 ASN A N     1 
ATOM   2972 C  CA    . ASN A 1 436 ? 20.898  50.470  41.312 1.00 43.39  ? 462 ASN A CA    1 
ATOM   2973 C  C     . ASN A 1 436 ? 22.223  49.885  41.807 1.00 46.33  ? 462 ASN A C     1 
ATOM   2974 O  O     . ASN A 1 436 ? 22.301  49.378  42.927 1.00 41.06  ? 462 ASN A O     1 
ATOM   2975 C  CB    . ASN A 1 436 ? 21.065  51.923  40.847 1.00 41.36  ? 462 ASN A CB    1 
ATOM   2976 C  CG    . ASN A 1 436 ? 21.510  52.869  41.961 1.00 52.13  ? 462 ASN A CG    1 
ATOM   2977 O  OD1   . ASN A 1 436 ? 22.030  52.453  42.999 1.00 50.40  ? 462 ASN A OD1   1 
ATOM   2978 N  ND2   . ASN A 1 436 ? 21.308  54.163  41.735 1.00 52.32  ? 462 ASN A ND2   1 
ATOM   2979 N  N     . VAL A 1 437 ? 23.252  49.936  40.965 1.00 45.73  ? 463 VAL A N     1 
ATOM   2980 C  CA    . VAL A 1 437 ? 24.492  49.213  41.240 1.00 49.35  ? 463 VAL A CA    1 
ATOM   2981 C  C     . VAL A 1 437 ? 25.347  49.836  42.337 1.00 49.97  ? 463 VAL A C     1 
ATOM   2982 O  O     . VAL A 1 437 ? 26.355  49.259  42.744 1.00 52.85  ? 463 VAL A O     1 
ATOM   2983 C  CB    . VAL A 1 437 ? 25.361  49.096  39.982 1.00 48.50  ? 463 VAL A CB    1 
ATOM   2984 C  CG1   . VAL A 1 437 ? 24.572  48.457  38.850 1.00 48.67  ? 463 VAL A CG1   1 
ATOM   2985 C  CG2   . VAL A 1 437 ? 25.888  50.459  39.582 1.00 50.18  ? 463 VAL A CG2   1 
ATOM   2986 N  N     . ASN A 1 438 ? 24.956  51.012  42.809 1.00 51.35  ? 464 ASN A N     1 
ATOM   2987 C  CA    . ASN A 1 438 ? 25.634  51.622  43.943 1.00 51.26  ? 464 ASN A CA    1 
ATOM   2988 C  C     . ASN A 1 438 ? 24.820  51.378  45.203 1.00 50.19  ? 464 ASN A C     1 
ATOM   2989 O  O     . ASN A 1 438 ? 25.105  51.928  46.268 1.00 52.01  ? 464 ASN A O     1 
ATOM   2990 C  CB    . ASN A 1 438 ? 25.872  53.107  43.693 1.00 50.02  ? 464 ASN A CB    1 
ATOM   2991 C  CG    . ASN A 1 438 ? 26.863  53.348  42.564 1.00 60.74  ? 464 ASN A CG    1 
ATOM   2992 O  OD1   . ASN A 1 438 ? 28.069  53.188  42.743 1.00 62.47  ? 464 ASN A OD1   1 
ATOM   2993 N  ND2   . ASN A 1 438 ? 26.355  53.720  41.390 1.00 58.19  ? 464 ASN A ND2   1 
ATOM   2994 N  N     . PHE A 1 439 ? 23.792  50.548  45.031 1.00 49.67  ? 465 PHE A N     1 
ATOM   2995 C  CA    . PHE A 1 439 ? 22.948  50.006  46.099 1.00 50.81  ? 465 PHE A CA    1 
ATOM   2996 C  C     . PHE A 1 439 ? 21.924  51.010  46.601 1.00 48.90  ? 465 PHE A C     1 
ATOM   2997 O  O     . PHE A 1 439 ? 21.331  50.815  47.662 1.00 50.62  ? 465 PHE A O     1 
ATOM   2998 C  CB    . PHE A 1 439 ? 23.804  49.469  47.254 1.00 49.90  ? 465 PHE A CB    1 
ATOM   2999 C  CG    . PHE A 1 439 ? 24.508  48.180  46.926 1.00 52.63  ? 465 PHE A CG    1 
ATOM   3000 C  CD1   . PHE A 1 439 ? 23.867  46.962  47.098 1.00 53.12  ? 465 PHE A CD1   1 
ATOM   3001 C  CD2   . PHE A 1 439 ? 25.791  48.189  46.399 1.00 53.32  ? 465 PHE A CD2   1 
ATOM   3002 C  CE1   . PHE A 1 439 ? 24.506  45.777  46.783 1.00 54.19  ? 465 PHE A CE1   1 
ATOM   3003 C  CE2   . PHE A 1 439 ? 26.435  47.008  46.079 1.00 54.24  ? 465 PHE A CE2   1 
ATOM   3004 C  CZ    . PHE A 1 439 ? 25.789  45.799  46.272 1.00 53.00  ? 465 PHE A CZ    1 
ATOM   3005 N  N     . GLU A 1 440 ? 21.705  52.068  45.825 1.00 48.09  ? 466 GLU A N     1 
ATOM   3006 C  CA    . GLU A 1 440 ? 20.687  53.054  46.164 1.00 49.02  ? 466 GLU A CA    1 
ATOM   3007 C  C     . GLU A 1 440 ? 19.299  52.563  45.762 1.00 44.65  ? 466 GLU A C     1 
ATOM   3008 O  O     . GLU A 1 440 ? 19.056  52.213  44.605 1.00 43.13  ? 466 GLU A O     1 
ATOM   3009 C  CB    . GLU A 1 440 ? 20.985  54.393  45.494 1.00 56.87  ? 466 GLU A CB    1 
ATOM   3010 C  CG    . GLU A 1 440 ? 22.268  55.059  45.968 1.00 61.98  ? 466 GLU A CG    1 
ATOM   3011 C  CD    . GLU A 1 440 ? 22.867  55.992  44.924 1.00 68.25  ? 466 GLU A CD    1 
ATOM   3012 O  OE1   . GLU A 1 440 ? 22.294  56.101  43.814 1.00 54.74  ? 466 GLU A OE1   1 
ATOM   3013 O  OE2   . GLU A 1 440 ? 23.907  56.623  45.225 1.00 76.66  ? 466 GLU A OE2   1 
ATOM   3014 N  N     . VAL A 1 441 ? 18.397  52.537  46.733 1.00 36.58  ? 467 VAL A N     1 
ATOM   3015 C  CA    . VAL A 1 441 ? 17.054  52.019  46.531 1.00 35.81  ? 467 VAL A CA    1 
ATOM   3016 C  C     . VAL A 1 441 ? 16.043  53.145  46.425 1.00 39.07  ? 467 VAL A C     1 
ATOM   3017 O  O     . VAL A 1 441 ? 16.125  54.125  47.161 1.00 43.79  ? 467 VAL A O     1 
ATOM   3018 C  CB    . VAL A 1 441 ? 16.638  51.098  47.681 1.00 36.64  ? 467 VAL A CB    1 
ATOM   3019 C  CG1   . VAL A 1 441 ? 15.208  50.611  47.495 1.00 37.86  ? 467 VAL A CG1   1 
ATOM   3020 C  CG2   . VAL A 1 441 ? 17.600  49.936  47.793 1.00 43.70  ? 467 VAL A CG2   1 
ATOM   3021 N  N     . LYS A 1 442 ? 15.086  53.004  45.517 1.00 36.32  ? 468 LYS A N     1 
ATOM   3022 C  CA    . LYS A 1 442 ? 13.943  53.898  45.497 1.00 39.12  ? 468 LYS A CA    1 
ATOM   3023 C  C     . LYS A 1 442 ? 12.677  53.169  45.085 1.00 30.54  ? 468 LYS A C     1 
ATOM   3024 O  O     . LYS A 1 442 ? 12.726  52.209  44.325 1.00 29.58  ? 468 LYS A O     1 
ATOM   3025 C  CB    . LYS A 1 442 ? 14.208  55.087  44.574 1.00 45.62  ? 468 LYS A CB    1 
ATOM   3026 C  CG    . LYS A 1 442 ? 14.672  54.732  43.177 1.00 42.01  ? 468 LYS A CG    1 
ATOM   3027 C  CD    . LYS A 1 442 ? 14.634  55.967  42.290 1.00 49.60  ? 468 LYS A CD    1 
ATOM   3028 C  CE    . LYS A 1 442 ? 15.872  56.825  42.498 1.00 44.25  ? 468 LYS A CE    1 
ATOM   3029 N  NZ    . LYS A 1 442 ? 16.109  57.773  41.375 1.00 53.49  ? 468 LYS A NZ    1 
ATOM   3030 N  N     . THR A 1 443 ? 11.548  53.617  45.620 1.00 30.20  ? 469 THR A N     1 
ATOM   3031 C  CA    . THR A 1 443 ? 10.263  53.002  45.325 1.00 32.43  ? 469 THR A CA    1 
ATOM   3032 C  C     . THR A 1 443 ? 9.326   54.028  44.710 1.00 37.76  ? 469 THR A C     1 
ATOM   3033 O  O     . THR A 1 443 ? 9.454   55.225  44.967 1.00 46.91  ? 469 THR A O     1 
ATOM   3034 C  CB    . THR A 1 443 ? 9.604   52.409  46.585 1.00 39.72  ? 469 THR A CB    1 
ATOM   3035 O  OG1   . THR A 1 443 ? 9.407   53.441  47.560 1.00 40.59  ? 469 THR A OG1   1 
ATOM   3036 C  CG2   . THR A 1 443 ? 10.475  51.306  47.178 1.00 36.26  ? 469 THR A CG2   1 
ATOM   3037 N  N     . ARG A 1 444 ? 8.378   53.561  43.906 1.00 38.59  ? 470 ARG A N     1 
ATOM   3038 C  CA    . ARG A 1 444 ? 7.404   54.458  43.292 1.00 32.64  ? 470 ARG A CA    1 
ATOM   3039 C  C     . ARG A 1 444 ? 6.057   53.763  43.267 1.00 33.72  ? 470 ARG A C     1 
ATOM   3040 O  O     . ARG A 1 444 ? 5.954   52.636  42.802 1.00 40.48  ? 470 ARG A O     1 
ATOM   3041 C  CB    . ARG A 1 444 ? 7.827   54.847  41.872 1.00 36.73  ? 470 ARG A CB    1 
ATOM   3042 C  CG    . ARG A 1 444 ? 9.183   55.530  41.753 1.00 36.89  ? 470 ARG A CG    1 
ATOM   3043 C  CD    . ARG A 1 444 ? 9.134   56.966  42.228 1.00 48.47  ? 470 ARG A CD    1 
ATOM   3044 N  NE    . ARG A 1 444 ? 10.414  57.645  42.037 1.00 53.50  ? 470 ARG A NE    1 
ATOM   3045 C  CZ    . ARG A 1 444 ? 11.205  58.039  43.030 1.00 50.98  ? 470 ARG A CZ    1 
ATOM   3046 N  NH1   . ARG A 1 444 ? 10.847  57.821  44.288 1.00 46.00  ? 470 ARG A NH1   1 
ATOM   3047 N  NH2   . ARG A 1 444 ? 12.353  58.652  42.767 1.00 50.33  ? 470 ARG A NH2   1 
ATOM   3048 N  N     . ALA A 1 445 ? 5.017   54.422  43.754 1.00 34.15  ? 471 ALA A N     1 
ATOM   3049 C  CA    . ALA A 1 445 ? 3.731   53.752  43.860 1.00 34.03  ? 471 ALA A CA    1 
ATOM   3050 C  C     . ALA A 1 445 ? 2.630   54.445  43.073 1.00 37.04  ? 471 ALA A C     1 
ATOM   3051 O  O     . ALA A 1 445 ? 2.786   55.580  42.615 1.00 33.45  ? 471 ALA A O     1 
ATOM   3052 C  CB    . ALA A 1 445 ? 3.325   53.636  45.318 1.00 35.17  ? 471 ALA A CB    1 
ATOM   3053 N  N     . SER A 1 446 ? 1.514   53.741  42.929 1.00 34.22  ? 472 SER A N     1 
ATOM   3054 C  CA    . SER A 1 446 ? 0.319   54.291  42.319 1.00 37.64  ? 472 SER A CA    1 
ATOM   3055 C  C     . SER A 1 446 ? -0.909  53.624  42.908 1.00 45.96  ? 472 SER A C     1 
ATOM   3056 O  O     . SER A 1 446 ? -1.030  52.400  42.894 1.00 44.96  ? 472 SER A O     1 
ATOM   3057 C  CB    . SER A 1 446 ? 0.336   54.105  40.805 1.00 36.72  ? 472 SER A CB    1 
ATOM   3058 O  OG    . SER A 1 446 ? 1.308   54.927  40.187 1.00 47.38  ? 472 SER A OG    1 
ATOM   3059 N  N     . THR A 1 447 ? -1.821  54.435  43.422 1.00 51.31  ? 473 THR A N     1 
ATOM   3060 C  CA    . THR A 1 447 ? -3.095  53.930  43.896 1.00 49.00  ? 473 THR A CA    1 
ATOM   3061 C  C     . THR A 1 447 ? -4.150  54.226  42.839 1.00 53.75  ? 473 THR A C     1 
ATOM   3062 O  O     . THR A 1 447 ? -4.209  55.331  42.305 1.00 56.55  ? 473 THR A O     1 
ATOM   3063 C  CB    . THR A 1 447 ? -3.481  54.564  45.237 1.00 52.07  ? 473 THR A CB    1 
ATOM   3064 O  OG1   . THR A 1 447 ? -2.415  54.369  46.176 1.00 54.92  ? 473 THR A OG1   1 
ATOM   3065 C  CG2   . THR A 1 447 ? -4.752  53.939  45.784 1.00 59.32  ? 473 THR A CG2   1 
ATOM   3066 N  N     . VAL A 1 448 ? -4.977  53.236  42.527 1.00 55.88  ? 474 VAL A N     1 
ATOM   3067 C  CA    . VAL A 1 448 ? -5.987  53.399  41.492 1.00 60.51  ? 474 VAL A CA    1 
ATOM   3068 C  C     . VAL A 1 448 ? -7.390  53.139  42.029 1.00 65.35  ? 474 VAL A C     1 
ATOM   3069 O  O     . VAL A 1 448 ? -7.559  52.562  43.106 1.00 64.24  ? 474 VAL A O     1 
ATOM   3070 C  CB    . VAL A 1 448 ? -5.712  52.464  40.296 1.00 57.76  ? 474 VAL A CB    1 
ATOM   3071 C  CG1   . VAL A 1 448 ? -4.296  52.672  39.765 1.00 57.00  ? 474 VAL A CG1   1 
ATOM   3072 C  CG2   . VAL A 1 448 ? -5.929  51.016  40.691 1.00 55.91  ? 474 VAL A CG2   1 
ATOM   3073 N  N     . SER A 1 449 ? -8.390  53.592  41.278 1.00 68.68  ? 475 SER A N     1 
ATOM   3074 C  CA    . SER A 1 449 ? -9.784  53.566  41.716 1.00 68.31  ? 475 SER A CA    1 
ATOM   3075 C  C     . SER A 1 449 ? -10.253 52.149  42.068 1.00 74.05  ? 475 SER A C     1 
ATOM   3076 O  O     . SER A 1 449 ? -10.615 51.863  43.205 1.00 74.36  ? 475 SER A O     1 
ATOM   3077 C  CB    . SER A 1 449 ? -10.686 54.158  40.629 1.00 74.19  ? 475 SER A CB    1 
ATOM   3078 O  OG    . SER A 1 449 ? -10.031 55.218  39.952 1.00 76.04  ? 475 SER A OG    1 
ATOM   3079 N  N     . SER A 1 450 ? -10.253 51.262  41.079 1.00 73.13  ? 476 SER A N     1 
ATOM   3080 C  CA    . SER A 1 450 ? -10.753 49.906  41.283 1.00 72.78  ? 476 SER A CA    1 
ATOM   3081 C  C     . SER A 1 450 ? -9.613  48.941  41.589 1.00 69.38  ? 476 SER A C     1 
ATOM   3082 O  O     . SER A 1 450 ? -8.481  49.158  41.159 1.00 68.16  ? 476 SER A O     1 
ATOM   3083 C  CB    . SER A 1 450 ? -11.527 49.433  40.051 1.00 75.58  ? 476 SER A CB    1 
ATOM   3084 O  OG    . SER A 1 450 ? -12.097 50.530  39.352 1.00 75.53  ? 476 SER A OG    1 
ATOM   3085 N  N     . VAL A 1 451 ? -9.909  47.883  42.338 1.00 68.12  ? 477 VAL A N     1 
ATOM   3086 C  CA    . VAL A 1 451 ? -8.904  46.869  42.649 1.00 69.28  ? 477 VAL A CA    1 
ATOM   3087 C  C     . VAL A 1 451 ? -8.373  46.175  41.392 1.00 67.01  ? 477 VAL A C     1 
ATOM   3088 O  O     . VAL A 1 451 ? -9.017  46.172  40.345 1.00 62.87  ? 477 VAL A O     1 
ATOM   3089 C  CB    . VAL A 1 451 ? -9.452  45.807  43.625 1.00 73.00  ? 477 VAL A CB    1 
ATOM   3090 C  CG1   . VAL A 1 451 ? -9.978  46.471  44.889 1.00 69.18  ? 477 VAL A CG1   1 
ATOM   3091 C  CG2   . VAL A 1 451 ? -10.518 44.960  42.950 1.00 74.59  ? 477 VAL A CG2   1 
ATOM   3092 N  N     . VAL A 1 452 ? -7.186  45.592  41.522 1.00 63.34  ? 478 VAL A N     1 
ATOM   3093 C  CA    . VAL A 1 452 ? -6.430  45.050  40.400 1.00 59.23  ? 478 VAL A CA    1 
ATOM   3094 C  C     . VAL A 1 452 ? -5.905  43.666  40.807 1.00 64.12  ? 478 VAL A C     1 
ATOM   3095 O  O     . VAL A 1 452 ? -5.682  43.430  41.996 1.00 63.53  ? 478 VAL A O     1 
ATOM   3096 C  CB    . VAL A 1 452 ? -5.293  46.029  40.009 1.00 54.31  ? 478 VAL A CB    1 
ATOM   3097 C  CG1   . VAL A 1 452 ? -4.043  45.308  39.540 1.00 56.70  ? 478 VAL A CG1   1 
ATOM   3098 C  CG2   . VAL A 1 452 ? -5.789  47.020  38.969 1.00 59.08  ? 478 VAL A CG2   1 
ATOM   3099 N  N     . SER A 1 453 ? -5.711  42.755  39.850 1.00 62.82  ? 479 SER A N     1 
ATOM   3100 C  CA    . SER A 1 453 ? -5.376  41.377  40.204 1.00 55.20  ? 479 SER A CA    1 
ATOM   3101 C  C     . SER A 1 453 ? -4.521  40.610  39.199 1.00 60.55  ? 479 SER A C     1 
ATOM   3102 O  O     . SER A 1 453 ? -3.632  39.855  39.593 1.00 60.27  ? 479 SER A O     1 
ATOM   3103 C  CB    . SER A 1 453 ? -6.664  40.592  40.430 1.00 58.31  ? 479 SER A CB    1 
ATOM   3104 O  OG    . SER A 1 453 ? -6.427  39.197  40.382 1.00 62.19  ? 479 SER A OG    1 
ATOM   3105 N  N     . THR A 1 454 ? -4.774  40.802  37.910 1.00 64.01  ? 480 THR A N     1 
ATOM   3106 C  CA    . THR A 1 454 ? -4.108  39.999  36.891 1.00 55.40  ? 480 THR A CA    1 
ATOM   3107 C  C     . THR A 1 454 ? -2.781  40.618  36.483 1.00 56.24  ? 480 THR A C     1 
ATOM   3108 O  O     . THR A 1 454 ? -2.496  41.769  36.818 1.00 58.88  ? 480 THR A O     1 
ATOM   3109 C  CB    . THR A 1 454 ? -4.988  39.831  35.648 1.00 52.85  ? 480 THR A CB    1 
ATOM   3110 O  OG1   . THR A 1 454 ? -4.901  41.011  34.840 1.00 60.07  ? 480 THR A OG1   1 
ATOM   3111 C  CG2   . THR A 1 454 ? -6.437  39.606  36.053 1.00 47.60  ? 480 THR A CG2   1 
ATOM   3112 N  N     . ALA A 1 455 ? -1.966  39.847  35.768 1.00 54.41  ? 481 ALA A N     1 
ATOM   3113 C  CA    . ALA A 1 455 ? -0.630  40.302  35.397 1.00 53.49  ? 481 ALA A CA    1 
ATOM   3114 C  C     . ALA A 1 455 ? -0.695  41.502  34.448 1.00 50.26  ? 481 ALA A C     1 
ATOM   3115 O  O     . ALA A 1 455 ? 0.191   42.366  34.448 1.00 46.04  ? 481 ALA A O     1 
ATOM   3116 C  CB    . ALA A 1 455 ? 0.156   39.163  34.770 1.00 48.10  ? 481 ALA A CB    1 
ATOM   3117 N  N     . GLU A 1 456 ? -1.773  41.573  33.676 1.00 49.54  ? 482 GLU A N     1 
ATOM   3118 C  CA    . GLU A 1 456 ? -1.937  42.639  32.697 1.00 55.93  ? 482 GLU A CA    1 
ATOM   3119 C  C     . GLU A 1 456 ? -2.138  44.006  33.350 1.00 54.95  ? 482 GLU A C     1 
ATOM   3120 O  O     . GLU A 1 456 ? -1.561  44.995  32.907 1.00 52.84  ? 482 GLU A O     1 
ATOM   3121 C  CB    . GLU A 1 456 ? -3.109  42.329  31.759 1.00 59.25  ? 482 GLU A CB    1 
ATOM   3122 C  CG    . GLU A 1 456 ? -2.867  41.166  30.781 1.00 66.39  ? 482 GLU A CG    1 
ATOM   3123 C  CD    . GLU A 1 456 ? -2.936  39.780  31.427 1.00 66.05  ? 482 GLU A CD    1 
ATOM   3124 O  OE1   . GLU A 1 456 ? -3.832  39.549  32.272 1.00 63.05  ? 482 GLU A OE1   1 
ATOM   3125 O  OE2   . GLU A 1 456 ? -2.094  38.921  31.072 1.00 53.53  ? 482 GLU A OE2   1 
ATOM   3126 N  N     . GLU A 1 457 ? -2.947  44.061  34.403 1.00 54.30  ? 483 GLU A N     1 
ATOM   3127 C  CA    . GLU A 1 457 ? -3.246  45.326  35.076 1.00 56.67  ? 483 GLU A CA    1 
ATOM   3128 C  C     . GLU A 1 457 ? -2.022  45.845  35.833 1.00 52.58  ? 483 GLU A C     1 
ATOM   3129 O  O     . GLU A 1 457 ? -1.574  47.002  35.665 1.00 50.41  ? 483 GLU A O     1 
ATOM   3130 C  CB    . GLU A 1 457 ? -4.423  45.146  36.033 1.00 53.54  ? 483 GLU A CB    1 
ATOM   3131 C  CG    . GLU A 1 457 ? -5.676  44.591  35.379 1.00 56.10  ? 483 GLU A CG    1 
ATOM   3132 C  CD    . GLU A 1 457 ? -6.458  43.686  36.309 1.00 62.77  ? 483 GLU A CD    1 
ATOM   3133 O  OE1   . GLU A 1 457 ? -5.929  43.356  37.391 1.00 64.31  ? 483 GLU A OE1   1 
ATOM   3134 O  OE2   . GLU A 1 457 ? -7.595  43.298  35.961 1.00 65.53  ? 483 GLU A OE2   1 
ATOM   3135 N  N     . ILE A 1 458 ? -1.495  44.968  36.680 1.00 45.10  ? 484 ILE A N     1 
ATOM   3136 C  CA    . ILE A 1 458 ? -0.303  45.260  37.455 1.00 44.93  ? 484 ILE A CA    1 
ATOM   3137 C  C     . ILE A 1 458 ? 0.806   45.727  36.531 1.00 47.79  ? 484 ILE A C     1 
ATOM   3138 O  O     . ILE A 1 458 ? 1.476   46.734  36.810 1.00 52.20  ? 484 ILE A O     1 
ATOM   3139 C  CB    . ILE A 1 458 ? 0.166   44.040  38.256 1.00 47.27  ? 484 ILE A CB    1 
ATOM   3140 C  CG1   . ILE A 1 458 ? -0.976  43.520  39.128 1.00 49.00  ? 484 ILE A CG1   1 
ATOM   3141 C  CG2   . ILE A 1 458 ? 1.350   44.405  39.130 1.00 42.14  ? 484 ILE A CG2   1 
ATOM   3142 C  CD1   . ILE A 1 458 ? -0.630  42.290  39.914 1.00 44.12  ? 484 ILE A CD1   1 
ATOM   3143 N  N     . PHE A 1 459 ? 0.994   45.020  35.418 1.00 50.32  ? 485 PHE A N     1 
ATOM   3144 C  CA    . PHE A 1 459 ? 2.006   45.467  34.474 1.00 46.06  ? 485 PHE A CA    1 
ATOM   3145 C  C     . PHE A 1 459 ? 1.623   46.811  33.870 1.00 47.08  ? 485 PHE A C     1 
ATOM   3146 O  O     . PHE A 1 459 ? 2.488   47.627  33.608 1.00 42.29  ? 485 PHE A O     1 
ATOM   3147 C  CB    . PHE A 1 459 ? 2.254   44.457  33.358 1.00 40.73  ? 485 PHE A CB    1 
ATOM   3148 C  CG    . PHE A 1 459 ? 3.404   44.840  32.470 1.00 41.49  ? 485 PHE A CG    1 
ATOM   3149 C  CD1   . PHE A 1 459 ? 4.659   45.069  33.013 1.00 42.21  ? 485 PHE A CD1   1 
ATOM   3150 C  CD2   . PHE A 1 459 ? 3.236   44.993  31.104 1.00 43.63  ? 485 PHE A CD2   1 
ATOM   3151 C  CE1   . PHE A 1 459 ? 5.726   45.437  32.209 1.00 44.72  ? 485 PHE A CE1   1 
ATOM   3152 C  CE2   . PHE A 1 459 ? 4.301   45.359  30.295 1.00 46.60  ? 485 PHE A CE2   1 
ATOM   3153 C  CZ    . PHE A 1 459 ? 5.546   45.581  30.849 1.00 42.22  ? 485 PHE A CZ    1 
ATOM   3154 N  N     . ALA A 1 460 ? 0.334   47.040  33.644 1.00 51.49  ? 486 ALA A N     1 
ATOM   3155 C  CA    . ALA A 1 460 ? -0.113  48.314  33.089 1.00 47.24  ? 486 ALA A CA    1 
ATOM   3156 C  C     . ALA A 1 460 ? 0.394   49.464  33.950 1.00 46.94  ? 486 ALA A C     1 
ATOM   3157 O  O     . ALA A 1 460 ? 0.953   50.432  33.434 1.00 50.94  ? 486 ALA A O     1 
ATOM   3158 C  CB    . ALA A 1 460 ? -1.627  48.357  32.964 1.00 46.99  ? 486 ALA A CB    1 
ATOM   3159 N  N     . ILE A 1 461 ? 0.214   49.351  35.263 1.00 50.90  ? 487 ILE A N     1 
ATOM   3160 C  CA    . ILE A 1 461 ? 0.700   50.401  36.174 1.00 50.06  ? 487 ILE A CA    1 
ATOM   3161 C  C     . ILE A 1 461 ? 2.240   50.476  36.311 1.00 44.90  ? 487 ILE A C     1 
ATOM   3162 O  O     . ILE A 1 461 ? 2.877   51.548  36.139 1.00 46.71  ? 487 ILE A O     1 
ATOM   3163 C  CB    . ILE A 1 461 ? 0.094   50.209  37.577 1.00 46.58  ? 487 ILE A CB    1 
ATOM   3164 C  CG1   . ILE A 1 461 ? -1.420  50.002  37.473 1.00 47.94  ? 487 ILE A CG1   1 
ATOM   3165 C  CG2   . ILE A 1 461 ? 0.439   51.384  38.472 1.00 40.43  ? 487 ILE A CG2   1 
ATOM   3166 C  CD1   . ILE A 1 461 ? -2.099  49.696  38.787 1.00 49.78  ? 487 ILE A CD1   1 
ATOM   3167 N  N     . ALA A 1 462 ? 2.827   49.329  36.643 1.00 45.87  ? 488 ALA A N     1 
ATOM   3168 C  CA    . ALA A 1 462 ? 4.260   49.239  36.903 1.00 43.73  ? 488 ALA A CA    1 
ATOM   3169 C  C     . ALA A 1 462 ? 5.082   49.696  35.700 1.00 45.10  ? 488 ALA A C     1 
ATOM   3170 O  O     . ALA A 1 462 ? 6.117   50.354  35.853 1.00 45.15  ? 488 ALA A O     1 
ATOM   3171 C  CB    . ALA A 1 462 ? 4.629   47.823  37.292 1.00 39.43  ? 488 ALA A CB    1 
ATOM   3172 N  N     . LYS A 1 463 ? 4.577   49.367  34.539 1.00 44.77  ? 489 LYS A N     1 
ATOM   3173 C  CA    . LYS A 1 463 ? 5.213   49.735  33.320 1.00 46.96  ? 489 LYS A CA    1 
ATOM   3174 C  C     . LYS A 1 463 ? 5.406   51.243  33.217 1.00 49.03  ? 489 LYS A C     1 
ATOM   3175 O  O     . LYS A 1 463 ? 6.473   51.694  32.860 1.00 49.66  ? 489 LYS A O     1 
ATOM   3176 C  CB    . LYS A 1 463 ? 4.373   49.176  32.177 1.00 48.38  ? 489 LYS A CB    1 
ATOM   3177 C  CG    . LYS A 1 463 ? 4.613   49.786  30.817 1.00 52.46  ? 489 LYS A CG    1 
ATOM   3178 C  CD    . LYS A 1 463 ? 3.752   49.128  29.773 1.00 56.65  ? 489 LYS A CD    1 
ATOM   3179 C  CE    . LYS A 1 463 ? 4.252   49.459  28.394 1.00 54.22  ? 489 LYS A CE    1 
ATOM   3180 N  NZ    . LYS A 1 463 ? 3.783   48.425  27.449 1.00 55.90  ? 489 LYS A NZ    1 
ATOM   3181 N  N     . GLU A 1 464 ? 4.392   52.028  33.549 1.00 45.39  ? 490 GLU A N     1 
ATOM   3182 C  CA    . GLU A 1 464 ? 4.495   53.470  33.407 1.00 50.68  ? 490 GLU A CA    1 
ATOM   3183 C  C     . GLU A 1 464 ? 5.209   54.100  34.597 1.00 47.80  ? 490 GLU A C     1 
ATOM   3184 O  O     . GLU A 1 464 ? 5.803   55.167  34.450 1.00 48.52  ? 490 GLU A O     1 
ATOM   3185 C  CB    . GLU A 1 464 ? 3.117   54.100  33.189 1.00 57.09  ? 490 GLU A CB    1 
ATOM   3186 C  CG    . GLU A 1 464 ? 2.259   54.279  34.420 1.00 62.56  ? 490 GLU A CG    1 
ATOM   3187 C  CD    . GLU A 1 464 ? 0.874   54.806  34.067 1.00 77.45  ? 490 GLU A CD    1 
ATOM   3188 O  OE1   . GLU A 1 464 ? 0.021   53.988  33.637 1.00 68.78  ? 490 GLU A OE1   1 
ATOM   3189 O  OE2   . GLU A 1 464 ? 0.647   56.035  34.207 1.00 80.46  ? 490 GLU A OE2   1 
ATOM   3190 N  N     . LEU A 1 465 ? 5.163   53.469  35.771 1.00 44.83  ? 491 LEU A N     1 
ATOM   3191 C  CA    . LEU A 1 465 ? 6.059   53.945  36.840 1.00 43.95  ? 491 LEU A CA    1 
ATOM   3192 C  C     . LEU A 1 465 ? 7.546   53.835  36.427 1.00 44.89  ? 491 LEU A C     1 
ATOM   3193 O  O     . LEU A 1 465 ? 8.366   54.780  36.584 1.00 42.11  ? 491 LEU A O     1 
ATOM   3194 C  CB    . LEU A 1 465 ? 5.812   53.166  38.128 1.00 44.70  ? 491 LEU A CB    1 
ATOM   3195 C  CG    . LEU A 1 465 ? 4.460   53.445  38.786 1.00 45.82  ? 491 LEU A CG    1 
ATOM   3196 C  CD1   . LEU A 1 465 ? 4.050   52.297  39.707 1.00 37.74  ? 491 LEU A CD1   1 
ATOM   3197 C  CD2   . LEU A 1 465 ? 4.507   54.775  39.530 1.00 35.96  ? 491 LEU A CD2   1 
ATOM   3198 N  N     . LEU A 1 466 ? 7.874   52.676  35.863 1.00 48.54  ? 492 LEU A N     1 
ATOM   3199 C  CA    . LEU A 1 466 ? 9.224   52.400  35.393 1.00 48.24  ? 492 LEU A CA    1 
ATOM   3200 C  C     . LEU A 1 466 ? 9.575   53.342  34.252 1.00 48.96  ? 492 LEU A C     1 
ATOM   3201 O  O     . LEU A 1 466 ? 10.666  53.908  34.222 1.00 47.89  ? 492 LEU A O     1 
ATOM   3202 C  CB    . LEU A 1 466 ? 9.357   50.946  34.944 1.00 41.15  ? 492 LEU A CB    1 
ATOM   3203 C  CG    . LEU A 1 466 ? 10.728  50.504  34.430 1.00 41.61  ? 492 LEU A CG    1 
ATOM   3204 C  CD1   . LEU A 1 466 ? 11.854  50.899  35.372 1.00 34.93  ? 492 LEU A CD1   1 
ATOM   3205 C  CD2   . LEU A 1 466 ? 10.735  49.005  34.195 1.00 45.95  ? 492 LEU A CD2   1 
ATOM   3206 N  N     . LYS A 1 467 ? 8.636   53.500  33.324 1.00 47.56  ? 493 LYS A N     1 
ATOM   3207 C  CA    . LYS A 1 467 ? 8.736   54.470  32.239 1.00 51.21  ? 493 LYS A CA    1 
ATOM   3208 C  C     . LYS A 1 467 ? 9.141   55.826  32.783 1.00 48.39  ? 493 LYS A C     1 
ATOM   3209 O  O     . LYS A 1 467 ? 10.103  56.436  32.313 1.00 48.05  ? 493 LYS A O     1 
ATOM   3210 C  CB    . LYS A 1 467 ? 7.403   54.585  31.493 1.00 49.34  ? 493 LYS A CB    1 
ATOM   3211 C  CG    . LYS A 1 467 ? 7.403   55.605  30.364 1.00 52.36  ? 493 LYS A CG    1 
ATOM   3212 C  CD    . LYS A 1 467 ? 7.740   54.984  29.017 1.00 65.82  ? 493 LYS A CD    1 
ATOM   3213 C  CE    . LYS A 1 467 ? 8.284   56.024  28.043 1.00 63.82  ? 493 LYS A CE    1 
ATOM   3214 N  NZ    . LYS A 1 467 ? 7.498   57.285  28.075 1.00 54.35  ? 493 LYS A NZ    1 
ATOM   3215 N  N     . THR A 1 468 ? 8.404   56.275  33.794 1.00 48.03  ? 494 THR A N     1 
ATOM   3216 C  CA    . THR A 1 468 ? 8.707   57.529  34.469 1.00 47.62  ? 494 THR A CA    1 
ATOM   3217 C  C     . THR A 1 468 ? 10.132  57.580  34.999 1.00 48.79  ? 494 THR A C     1 
ATOM   3218 O  O     . THR A 1 468 ? 10.794  58.608  34.868 1.00 48.26  ? 494 THR A O     1 
ATOM   3219 C  CB    . THR A 1 468 ? 7.746   57.790  35.642 1.00 48.12  ? 494 THR A CB    1 
ATOM   3220 O  OG1   . THR A 1 468 ? 6.393   57.781  35.171 1.00 54.56  ? 494 THR A OG1   1 
ATOM   3221 C  CG2   . THR A 1 468 ? 8.042   59.132  36.276 1.00 36.58  ? 494 THR A CG2   1 
ATOM   3222 N  N     . GLU A 1 469 ? 10.626  56.491  35.584 1.00 56.18  ? 495 GLU A N     1 
ATOM   3223 C  CA    . GLU A 1 469 ? 12.013  56.559  36.079 1.00 54.95  ? 495 GLU A CA    1 
ATOM   3224 C  C     . GLU A 1 469 ? 13.068  56.607  34.955 1.00 56.38  ? 495 GLU A C     1 
ATOM   3225 O  O     . GLU A 1 469 ? 14.036  57.400  34.998 1.00 56.78  ? 495 GLU A O     1 
ATOM   3226 C  CB    . GLU A 1 469 ? 12.299  55.382  37.002 1.00 49.63  ? 495 GLU A CB    1 
ATOM   3227 C  CG    . GLU A 1 469 ? 11.451  55.399  38.254 1.00 48.51  ? 495 GLU A CG    1 
ATOM   3228 C  CD    . GLU A 1 469 ? 11.499  56.738  38.962 1.00 51.16  ? 495 GLU A CD    1 
ATOM   3229 O  OE1   . GLU A 1 469 ? 10.423  57.344  39.164 1.00 50.40  ? 495 GLU A OE1   1 
ATOM   3230 O  OE2   . GLU A 1 469 ? 12.611  57.178  39.328 1.00 53.65  ? 495 GLU A OE2   1 
ATOM   3231 N  N     . ILE A 1 470 ? 12.843  55.784  33.936 1.00 53.93  ? 496 ILE A N     1 
ATOM   3232 C  CA    . ILE A 1 470 ? 13.730  55.692  32.784 1.00 58.16  ? 496 ILE A CA    1 
ATOM   3233 C  C     . ILE A 1 470 ? 13.845  57.048  32.102 1.00 62.64  ? 496 ILE A C     1 
ATOM   3234 O  O     . ILE A 1 470 ? 14.944  57.506  31.789 1.00 66.76  ? 496 ILE A O     1 
ATOM   3235 C  CB    . ILE A 1 470 ? 13.234  54.646  31.762 1.00 53.94  ? 496 ILE A CB    1 
ATOM   3236 C  CG1   . ILE A 1 470 ? 13.160  53.261  32.415 1.00 49.17  ? 496 ILE A CG1   1 
ATOM   3237 C  CG2   . ILE A 1 470 ? 14.129  54.649  30.527 1.00 47.71  ? 496 ILE A CG2   1 
ATOM   3238 C  CD1   . ILE A 1 470 ? 13.654  52.127  31.545 1.00 48.18  ? 496 ILE A CD1   1 
ATOM   3239 N  N     . ASP A 1 471 ? 12.695  57.676  31.873 1.00 63.35  ? 497 ASP A N     1 
ATOM   3240 C  CA    . ASP A 1 471 ? 12.629  59.002  31.271 1.00 59.79  ? 497 ASP A CA    1 
ATOM   3241 C  C     . ASP A 1 471 ? 13.289  60.031  32.172 1.00 63.77  ? 497 ASP A C     1 
ATOM   3242 O  O     . ASP A 1 471 ? 14.116  60.823  31.719 1.00 73.23  ? 497 ASP A O     1 
ATOM   3243 C  CB    . ASP A 1 471 ? 11.177  59.396  31.002 1.00 54.99  ? 497 ASP A CB    1 
ATOM   3244 C  CG    . ASP A 1 471 ? 10.506  58.491  29.981 1.00 65.12  ? 497 ASP A CG    1 
ATOM   3245 O  OD1   . ASP A 1 471 ? 11.227  57.735  29.287 1.00 62.44  ? 497 ASP A OD1   1 
ATOM   3246 O  OD2   . ASP A 1 471 ? 9.258   58.536  29.876 1.00 64.78  ? 497 ASP A OD2   1 
ATOM   3247 N  N     . ALA A 1 472 ? 12.888  60.037  33.441 1.00 62.26  ? 498 ALA A N     1 
ATOM   3248 C  CA    . ALA A 1 472 ? 13.490  60.909  34.445 1.00 65.07  ? 498 ALA A CA    1 
ATOM   3249 C  C     . ALA A 1 472 ? 15.019  60.883  34.433 1.00 70.03  ? 498 ALA A C     1 
ATOM   3250 O  O     . ALA A 1 472 ? 15.655  61.886  34.746 1.00 77.39  ? 498 ALA A O     1 
ATOM   3251 C  CB    . ALA A 1 472 ? 12.985  60.540  35.825 1.00 66.91  ? 498 ALA A CB    1 
ATOM   3252 N  N     . ASP A 1 473 ? 15.615  59.747  34.081 1.00 75.82  ? 499 ASP A N     1 
ATOM   3253 C  CA    . ASP A 1 473 ? 17.079  59.701  34.028 1.00 77.32  ? 499 ASP A CA    1 
ATOM   3254 C  C     . ASP A 1 473 ? 17.676  59.971  32.630 1.00 77.52  ? 499 ASP A C     1 
ATOM   3255 O  O     . ASP A 1 473 ? 18.873  60.244  32.517 1.00 77.99  ? 499 ASP A O     1 
ATOM   3256 C  CB    . ASP A 1 473 ? 17.572  58.349  34.546 1.00 76.79  ? 499 ASP A CB    1 
ATOM   3257 N  N     . PHE A 1 474 ? 16.839  59.906  31.590 1.00 77.68  ? 500 PHE A N     1 
ATOM   3258 C  CA    . PHE A 1 474 ? 17.240  60.139  30.186 1.00 74.95  ? 500 PHE A CA    1 
ATOM   3259 C  C     . PHE A 1 474 ? 18.208  61.312  30.000 1.00 82.25  ? 500 PHE A C     1 
ATOM   3260 O  O     . PHE A 1 474 ? 18.039  62.365  30.622 1.00 78.34  ? 500 PHE A O     1 
ATOM   3261 C  CB    . PHE A 1 474 ? 16.002  60.362  29.308 1.00 72.37  ? 500 PHE A CB    1 
ATOM   3262 N  N     . PRO A 1 475 ? 19.219  61.142  29.129 1.00 81.42  ? 501 PRO A N     1 
ATOM   3263 C  CA    . PRO A 1 475 ? 19.427  60.022  28.205 1.00 80.93  ? 501 PRO A CA    1 
ATOM   3264 C  C     . PRO A 1 475 ? 20.213  58.863  28.817 1.00 78.50  ? 501 PRO A C     1 
ATOM   3265 O  O     . PRO A 1 475 ? 20.768  58.043  28.083 1.00 68.21  ? 501 PRO A O     1 
ATOM   3266 C  CB    . PRO A 1 475 ? 20.228  60.670  27.082 1.00 71.03  ? 501 PRO A CB    1 
ATOM   3267 C  CG    . PRO A 1 475 ? 21.115  61.630  27.825 1.00 66.51  ? 501 PRO A CG    1 
ATOM   3268 C  CD    . PRO A 1 475 ? 20.288  62.149  28.990 1.00 71.03  ? 501 PRO A CD    1 
ATOM   3269 N  N     . HIS A 1 476 ? 20.270  58.805  30.144 1.00 75.45  ? 502 HIS A N     1 
ATOM   3270 C  CA    . HIS A 1 476 ? 21.045  57.774  30.826 1.00 79.45  ? 502 HIS A CA    1 
ATOM   3271 C  C     . HIS A 1 476 ? 20.252  56.481  31.003 1.00 76.31  ? 502 HIS A C     1 
ATOM   3272 O  O     . HIS A 1 476 ? 19.037  56.510  31.215 1.00 73.02  ? 502 HIS A O     1 
ATOM   3273 C  CB    . HIS A 1 476 ? 21.521  58.275  32.192 1.00 79.99  ? 502 HIS A CB    1 
ATOM   3274 C  CG    . HIS A 1 476 ? 22.543  59.364  32.114 1.00 88.09  ? 502 HIS A CG    1 
ATOM   3275 N  ND1   . HIS A 1 476 ? 23.084  59.793  30.921 1.00 84.51  ? 502 HIS A ND1   1 
ATOM   3276 C  CD2   . HIS A 1 476 ? 23.128  60.107  33.083 1.00 88.12  ? 502 HIS A CD2   1 
ATOM   3277 C  CE1   . HIS A 1 476 ? 23.960  60.754  31.159 1.00 94.06  ? 502 HIS A CE1   1 
ATOM   3278 N  NE2   . HIS A 1 476 ? 24.005  60.964  32.463 1.00 90.78  ? 502 HIS A NE2   1 
ATOM   3279 N  N     . PRO A 1 477 ? 20.946  55.334  30.915 1.00 71.97  ? 503 PRO A N     1 
ATOM   3280 C  CA    . PRO A 1 477 ? 20.319  54.045  31.209 1.00 64.76  ? 503 PRO A CA    1 
ATOM   3281 C  C     . PRO A 1 477 ? 20.262  53.811  32.712 1.00 59.10  ? 503 PRO A C     1 
ATOM   3282 O  O     . PRO A 1 477 ? 21.179  54.226  33.425 1.00 56.33  ? 503 PRO A O     1 
ATOM   3283 C  CB    . PRO A 1 477 ? 21.253  53.041  30.531 1.00 59.27  ? 503 PRO A CB    1 
ATOM   3284 C  CG    . PRO A 1 477 ? 22.594  53.690  30.618 1.00 61.65  ? 503 PRO A CG    1 
ATOM   3285 C  CD    . PRO A 1 477 ? 22.345  55.177  30.474 1.00 73.16  ? 503 PRO A CD    1 
ATOM   3286 N  N     . LEU A 1 478 ? 19.191  53.184  33.190 1.00 52.92  ? 504 LEU A N     1 
ATOM   3287 C  CA    . LEU A 1 478 ? 19.154  52.736  34.572 1.00 48.86  ? 504 LEU A CA    1 
ATOM   3288 C  C     . LEU A 1 478 ? 20.116  51.576  34.703 1.00 45.52  ? 504 LEU A C     1 
ATOM   3289 O  O     . LEU A 1 478 ? 20.083  50.649  33.899 1.00 43.43  ? 504 LEU A O     1 
ATOM   3290 C  CB    . LEU A 1 478 ? 17.745  52.316  34.996 1.00 47.45  ? 504 LEU A CB    1 
ATOM   3291 C  CG    . LEU A 1 478 ? 16.686  53.411  35.108 1.00 52.54  ? 504 LEU A CG    1 
ATOM   3292 C  CD1   . LEU A 1 478 ? 15.302  52.801  35.253 1.00 47.16  ? 504 LEU A CD1   1 
ATOM   3293 C  CD2   . LEU A 1 478 ? 16.998  54.316  36.289 1.00 59.18  ? 504 LEU A CD2   1 
ATOM   3294 N  N     . ARG A 1 479 ? 20.992  51.641  35.696 1.00 44.16  ? 505 ARG A N     1 
ATOM   3295 C  CA    . ARG A 1 479 ? 21.895  50.532  35.953 1.00 48.19  ? 505 ARG A CA    1 
ATOM   3296 C  C     . ARG A 1 479 ? 21.403  49.767  37.173 1.00 46.27  ? 505 ARG A C     1 
ATOM   3297 O  O     . ARG A 1 479 ? 21.817  50.039  38.301 1.00 48.71  ? 505 ARG A O     1 
ATOM   3298 C  CB    . ARG A 1 479 ? 23.324  51.032  36.157 1.00 48.80  ? 505 ARG A CB    1 
ATOM   3299 C  CG    . ARG A 1 479 ? 23.892  51.735  34.943 1.00 48.61  ? 505 ARG A CG    1 
ATOM   3300 C  CD    . ARG A 1 479 ? 25.292  52.270  35.205 1.00 48.45  ? 505 ARG A CD    1 
ATOM   3301 N  NE    . ARG A 1 479 ? 26.295  51.210  35.219 1.00 48.80  ? 505 ARG A NE    1 
ATOM   3302 C  CZ    . ARG A 1 479 ? 27.474  51.294  35.827 1.00 62.56  ? 505 ARG A CZ    1 
ATOM   3303 N  NH1   . ARG A 1 479 ? 27.811  52.394  36.493 1.00 63.16  ? 505 ARG A NH1   1 
ATOM   3304 N  NH2   . ARG A 1 479 ? 28.315  50.268  35.776 1.00 66.30  ? 505 ARG A NH2   1 
ATOM   3305 N  N     . LEU A 1 480 ? 20.527  48.797  36.935 1.00 38.31  ? 506 LEU A N     1 
ATOM   3306 C  CA    . LEU A 1 480 ? 19.840  48.115  38.019 1.00 39.35  ? 506 LEU A CA    1 
ATOM   3307 C  C     . LEU A 1 480 ? 20.556  46.842  38.465 1.00 42.80  ? 506 LEU A C     1 
ATOM   3308 O  O     . LEU A 1 480 ? 21.215  46.166  37.672 1.00 44.84  ? 506 LEU A O     1 
ATOM   3309 C  CB    . LEU A 1 480 ? 18.401  47.789  37.611 1.00 33.26  ? 506 LEU A CB    1 
ATOM   3310 C  CG    . LEU A 1 480 ? 17.528  48.977  37.223 1.00 35.17  ? 506 LEU A CG    1 
ATOM   3311 C  CD1   . LEU A 1 480 ? 16.076  48.556  37.138 1.00 30.50  ? 506 LEU A CD1   1 
ATOM   3312 C  CD2   . LEU A 1 480 ? 17.695  50.109  38.223 1.00 44.18  ? 506 LEU A CD2   1 
ATOM   3313 N  N     . ARG A 1 481 ? 20.422  46.537  39.751 1.00 43.13  ? 507 ARG A N     1 
ATOM   3314 C  CA    . ARG A 1 481 ? 20.925  45.298  40.328 1.00 40.49  ? 507 ARG A CA    1 
ATOM   3315 C  C     . ARG A 1 481 ? 19.793  44.516  40.981 1.00 40.12  ? 507 ARG A C     1 
ATOM   3316 O  O     . ARG A 1 481 ? 19.940  43.333  41.278 1.00 41.49  ? 507 ARG A O     1 
ATOM   3317 C  CB    . ARG A 1 481 ? 22.016  45.584  41.355 1.00 33.72  ? 507 ARG A CB    1 
ATOM   3318 C  CG    . ARG A 1 481 ? 21.511  45.760  42.774 1.00 39.30  ? 507 ARG A CG    1 
ATOM   3319 C  CD    . ARG A 1 481 ? 22.672  45.968  43.723 1.00 48.73  ? 507 ARG A CD    1 
ATOM   3320 N  NE    . ARG A 1 481 ? 23.744  45.041  43.402 1.00 48.01  ? 507 ARG A NE    1 
ATOM   3321 C  CZ    . ARG A 1 481 ? 23.893  43.869  43.993 1.00 46.62  ? 507 ARG A CZ    1 
ATOM   3322 N  NH1   . ARG A 1 481 ? 23.038  43.507  44.940 1.00 45.06  ? 507 ARG A NH1   1 
ATOM   3323 N  NH2   . ARG A 1 481 ? 24.901  43.082  43.652 1.00 45.43  ? 507 ARG A NH2   1 
ATOM   3324 N  N     . LEU A 1 482 ? 18.660  45.180  41.184 1.00 34.21  ? 508 LEU A N     1 
ATOM   3325 C  CA    . LEU A 1 482 ? 17.488  44.542  41.768 1.00 32.31  ? 508 LEU A CA    1 
ATOM   3326 C  C     . LEU A 1 482 ? 16.225  45.208  41.256 1.00 33.43  ? 508 LEU A C     1 
ATOM   3327 O  O     . LEU A 1 482 ? 16.227  46.391  40.933 1.00 33.60  ? 508 LEU A O     1 
ATOM   3328 C  CB    . LEU A 1 482 ? 17.538  44.599  43.299 1.00 28.43  ? 508 LEU A CB    1 
ATOM   3329 C  CG    . LEU A 1 482 ? 16.316  44.141  44.103 1.00 29.86  ? 508 LEU A CG    1 
ATOM   3330 C  CD1   . LEU A 1 482 ? 16.779  43.540  45.411 1.00 34.94  ? 508 LEU A CD1   1 
ATOM   3331 C  CD2   . LEU A 1 482 ? 15.353  45.295  44.369 1.00 31.48  ? 508 LEU A CD2   1 
ATOM   3332 N  N     . MET A 1 483 ? 15.137  44.455  41.185 1.00 34.92  ? 509 MET A N     1 
ATOM   3333 C  CA    . MET A 1 483 ? 13.874  45.053  40.778 1.00 31.48  ? 509 MET A CA    1 
ATOM   3334 C  C     . MET A 1 483 ? 12.736  44.342  41.491 1.00 32.13  ? 509 MET A C     1 
ATOM   3335 O  O     . MET A 1 483 ? 12.788  43.132  41.685 1.00 38.62  ? 509 MET A O     1 
ATOM   3336 C  CB    . MET A 1 483 ? 13.709  44.977  39.260 1.00 31.03  ? 509 MET A CB    1 
ATOM   3337 C  CG    . MET A 1 483 ? 12.337  45.398  38.781 1.00 34.36  ? 509 MET A CG    1 
ATOM   3338 S  SD    . MET A 1 483 ? 12.350  45.907  37.059 1.00 50.71  ? 509 MET A SD    1 
ATOM   3339 C  CE    . MET A 1 483 ? 10.795  46.779  37.018 1.00 50.74  ? 509 MET A CE    1 
ATOM   3340 N  N     . GLY A 1 484 ? 11.706  45.079  41.883 1.00 29.32  ? 510 GLY A N     1 
ATOM   3341 C  CA    . GLY A 1 484 ? 10.610  44.476  42.611 1.00 26.35  ? 510 GLY A CA    1 
ATOM   3342 C  C     . GLY A 1 484 ? 9.282   45.092  42.250 1.00 30.73  ? 510 GLY A C     1 
ATOM   3343 O  O     . GLY A 1 484 ? 9.221   46.237  41.797 1.00 30.19  ? 510 GLY A O     1 
ATOM   3344 N  N     . VAL A 1 485 ? 8.213   44.330  42.443 1.00 25.94  ? 511 VAL A N     1 
ATOM   3345 C  CA    . VAL A 1 485 ? 6.870   44.864  42.291 1.00 27.99  ? 511 VAL A CA    1 
ATOM   3346 C  C     . VAL A 1 485 ? 6.049   44.423  43.496 1.00 33.01  ? 511 VAL A C     1 
ATOM   3347 O  O     . VAL A 1 485 ? 6.145   43.267  43.938 1.00 32.13  ? 511 VAL A O     1 
ATOM   3348 C  CB    . VAL A 1 485 ? 6.214   44.390  40.985 1.00 29.83  ? 511 VAL A CB    1 
ATOM   3349 C  CG1   . VAL A 1 485 ? 4.763   44.838  40.917 1.00 27.88  ? 511 VAL A CG1   1 
ATOM   3350 C  CG2   . VAL A 1 485 ? 6.982   44.925  39.797 1.00 28.35  ? 511 VAL A CG2   1 
ATOM   3351 N  N     . ARG A 1 486 ? 5.233   45.344  44.007 1.00 33.42  ? 512 ARG A N     1 
ATOM   3352 C  CA    . ARG A 1 486 ? 4.516   45.156  45.264 1.00 33.61  ? 512 ARG A CA    1 
ATOM   3353 C  C     . ARG A 1 486 ? 3.089   45.685  45.163 1.00 32.92  ? 512 ARG A C     1 
ATOM   3354 O  O     . ARG A 1 486 ? 2.854   46.716  44.541 1.00 34.37  ? 512 ARG A O     1 
ATOM   3355 C  CB    . ARG A 1 486 ? 5.268   45.860  46.395 1.00 33.22  ? 512 ARG A CB    1 
ATOM   3356 C  CG    . ARG A 1 486 ? 4.551   45.894  47.726 1.00 33.24  ? 512 ARG A CG    1 
ATOM   3357 C  CD    . ARG A 1 486 ? 5.539   46.158  48.838 1.00 34.01  ? 512 ARG A CD    1 
ATOM   3358 N  NE    . ARG A 1 486 ? 4.951   46.968  49.898 1.00 50.77  ? 512 ARG A NE    1 
ATOM   3359 C  CZ    . ARG A 1 486 ? 5.071   46.699  51.196 1.00 65.92  ? 512 ARG A CZ    1 
ATOM   3360 N  NH1   . ARG A 1 486 ? 5.758   45.629  51.593 1.00 56.63  ? 512 ARG A NH1   1 
ATOM   3361 N  NH2   . ARG A 1 486 ? 4.504   47.497  52.099 1.00 51.80  ? 512 ARG A NH2   1 
ATOM   3362 N  N     . ILE A 1 487 ? 2.140   44.969  45.761 1.00 33.90  ? 513 ILE A N     1 
ATOM   3363 C  CA    . ILE A 1 487 ? 0.749   45.394  45.752 1.00 34.46  ? 513 ILE A CA    1 
ATOM   3364 C  C     . ILE A 1 487 ? 0.143   45.357  47.155 1.00 43.45  ? 513 ILE A C     1 
ATOM   3365 O  O     . ILE A 1 487 ? 0.485   44.504  47.985 1.00 42.81  ? 513 ILE A O     1 
ATOM   3366 C  CB    . ILE A 1 487 ? -0.103  44.533  44.794 1.00 41.90  ? 513 ILE A CB    1 
ATOM   3367 C  CG1   . ILE A 1 487 ? -1.488  45.165  44.593 1.00 45.19  ? 513 ILE A CG1   1 
ATOM   3368 C  CG2   . ILE A 1 487 ? -0.207  43.098  45.297 1.00 40.13  ? 513 ILE A CG2   1 
ATOM   3369 C  CD1   . ILE A 1 487 ? -2.480  44.278  43.864 1.00 46.64  ? 513 ILE A CD1   1 
ATOM   3370 N  N     . SER A 1 488 ? -0.750  46.308  47.407 1.00 45.80  ? 514 SER A N     1 
ATOM   3371 C  CA    . SER A 1 488 ? -1.377  46.484  48.707 1.00 46.69  ? 514 SER A CA    1 
ATOM   3372 C  C     . SER A 1 488 ? -2.737  47.152  48.547 1.00 49.71  ? 514 SER A C     1 
ATOM   3373 O  O     . SER A 1 488 ? -3.310  47.145  47.459 1.00 51.66  ? 514 SER A O     1 
ATOM   3374 C  CB    . SER A 1 488 ? -0.477  47.302  49.632 1.00 44.19  ? 514 SER A CB    1 
ATOM   3375 O  OG    . SER A 1 488 ? 0.275   48.246  48.893 1.00 43.03  ? 514 SER A OG    1 
ATOM   3376 N  N     . SER A 1 489 ? -3.254  47.688  49.649 1.00 48.59  ? 515 SER A N     1 
ATOM   3377 C  CA    . SER A 1 489 ? -4.557  48.343  49.684 1.00 49.24  ? 515 SER A CA    1 
ATOM   3378 C  C     . SER A 1 489 ? -5.662  47.343  49.394 1.00 56.93  ? 515 SER A C     1 
ATOM   3379 O  O     . SER A 1 489 ? -6.513  47.560  48.532 1.00 61.20  ? 515 SER A O     1 
ATOM   3380 C  CB    . SER A 1 489 ? -4.621  49.510  48.698 1.00 49.13  ? 515 SER A CB    1 
ATOM   3381 O  OG    . SER A 1 489 ? -3.648  50.483  49.014 1.00 49.68  ? 515 SER A OG    1 
ATOM   3382 N  N     . PHE A 1 490 ? -5.639  46.237  50.124 1.00 62.21  ? 516 PHE A N     1 
ATOM   3383 C  CA    . PHE A 1 490 ? -6.695  45.251  50.019 1.00 67.15  ? 516 PHE A CA    1 
ATOM   3384 C  C     . PHE A 1 490 ? -7.928  45.768  50.757 1.00 69.21  ? 516 PHE A C     1 
ATOM   3385 O  O     . PHE A 1 490 ? -7.815  46.641  51.616 1.00 66.37  ? 516 PHE A O     1 
ATOM   3386 C  CB    . PHE A 1 490 ? -6.233  43.904  50.582 1.00 67.81  ? 516 PHE A CB    1 
ATOM   3387 C  CG    . PHE A 1 490 ? -4.957  43.397  49.974 1.00 63.30  ? 516 PHE A CG    1 
ATOM   3388 C  CD1   . PHE A 1 490 ? -3.727  43.789  50.471 1.00 64.53  ? 516 PHE A CD1   1 
ATOM   3389 C  CD2   . PHE A 1 490 ? -4.988  42.541  48.892 1.00 68.83  ? 516 PHE A CD2   1 
ATOM   3390 C  CE1   . PHE A 1 490 ? -2.554  43.321  49.908 1.00 58.41  ? 516 PHE A CE1   1 
ATOM   3391 C  CE2   . PHE A 1 490 ? -3.818  42.075  48.326 1.00 68.40  ? 516 PHE A CE2   1 
ATOM   3392 C  CZ    . PHE A 1 490 ? -2.601  42.467  48.835 1.00 55.23  ? 516 PHE A CZ    1 
ATOM   3393 N  N     . PRO A 1 491 ? -9.111  45.223  50.433 1.00 75.86  ? 517 PRO A N     1 
ATOM   3394 C  CA    . PRO A 1 491 ? -10.362 45.633  51.084 1.00 80.74  ? 517 PRO A CA    1 
ATOM   3395 C  C     . PRO A 1 491 ? -10.400 45.388  52.595 1.00 87.32  ? 517 PRO A C     1 
ATOM   3396 O  O     . PRO A 1 491 ? -9.489  44.778  53.157 1.00 87.47  ? 517 PRO A O     1 
ATOM   3397 C  CB    . PRO A 1 491 ? -11.414 44.768  50.380 1.00 84.96  ? 517 PRO A CB    1 
ATOM   3398 C  CG    . PRO A 1 491 ? -10.833 44.500  49.036 1.00 81.96  ? 517 PRO A CG    1 
ATOM   3399 C  CD    . PRO A 1 491 ? -9.360  44.343  49.276 1.00 76.87  ? 517 PRO A CD    1 
ATOM   3400 N  N     . ASN A 1 492 ? -11.465 45.864  53.236 1.00 91.07  ? 518 ASN A N     1 
ATOM   3401 C  CA    . ASN A 1 492 ? -11.665 45.652  54.666 1.00 91.24  ? 518 ASN A CA    1 
ATOM   3402 C  C     . ASN A 1 492 ? -12.822 44.689  54.911 1.00 95.27  ? 518 ASN A C     1 
ATOM   3403 O  O     . ASN A 1 492 ? -12.972 43.692  54.199 1.00 89.54  ? 518 ASN A O     1 
ATOM   3404 C  CB    . ASN A 1 492 ? -11.909 46.979  55.385 1.00 20.00  ? 518 ASN A CB    1 
ATOM   3405 N  N     . LEU B 1 5   ? 44.854  21.176  28.639 1.00 92.17  ? 31  LEU B N     1 
ATOM   3406 C  CA    . LEU B 1 5   ? 44.444  19.815  28.967 1.00 92.37  ? 31  LEU B CA    1 
ATOM   3407 C  C     . LEU B 1 5   ? 44.108  19.003  27.709 1.00 94.78  ? 31  LEU B C     1 
ATOM   3408 O  O     . LEU B 1 5   ? 43.612  19.541  26.712 1.00 89.63  ? 31  LEU B O     1 
ATOM   3409 C  CB    . LEU B 1 5   ? 43.245  19.833  29.924 1.00 85.40  ? 31  LEU B CB    1 
ATOM   3410 N  N     . ASP B 1 6   ? 44.405  17.707  27.769 1.00 95.89  ? 32  ASP B N     1 
ATOM   3411 C  CA    . ASP B 1 6   ? 44.052  16.745  26.722 1.00 93.19  ? 32  ASP B CA    1 
ATOM   3412 C  C     . ASP B 1 6   ? 42.871  15.924  27.226 1.00 93.52  ? 32  ASP B C     1 
ATOM   3413 O  O     . ASP B 1 6   ? 42.306  16.257  28.263 1.00 94.99  ? 32  ASP B O     1 
ATOM   3414 C  CB    . ASP B 1 6   ? 45.235  15.841  26.367 1.00 90.47  ? 32  ASP B CB    1 
ATOM   3415 N  N     . LYS B 1 7   ? 42.427  14.926  26.463 1.00 92.59  ? 33  LYS B N     1 
ATOM   3416 C  CA    . LYS B 1 7   ? 41.339  14.062  26.936 1.00 93.54  ? 33  LYS B CA    1 
ATOM   3417 C  C     . LYS B 1 7   ? 41.748  13.399  28.261 1.00 93.26  ? 33  LYS B C     1 
ATOM   3418 O  O     . LYS B 1 7   ? 40.955  13.322  29.209 1.00 94.32  ? 33  LYS B O     1 
ATOM   3419 C  CB    . LYS B 1 7   ? 40.981  13.007  25.883 1.00 89.73  ? 33  LYS B CB    1 
ATOM   3420 C  CG    . LYS B 1 7   ? 40.201  13.569  24.710 1.00 84.07  ? 33  LYS B CG    1 
ATOM   3421 C  CD    . LYS B 1 7   ? 38.844  14.090  25.170 1.00 85.71  ? 33  LYS B CD    1 
ATOM   3422 C  CE    . LYS B 1 7   ? 38.060  14.729  24.026 1.00 79.36  ? 33  LYS B CE    1 
ATOM   3423 N  NZ    . LYS B 1 7   ? 38.678  16.001  23.541 1.00 64.97  ? 33  LYS B NZ    1 
ATOM   3424 N  N     . GLU B 1 8   ? 42.990  12.919  28.318 1.00 92.83  ? 34  GLU B N     1 
ATOM   3425 C  CA    . GLU B 1 8   ? 43.587  12.466  29.572 1.00 96.69  ? 34  GLU B CA    1 
ATOM   3426 C  C     . GLU B 1 8   ? 43.802  13.702  30.449 1.00 98.27  ? 34  GLU B C     1 
ATOM   3427 O  O     . GLU B 1 8   ? 43.531  14.819  30.015 1.00 94.99  ? 34  GLU B O     1 
ATOM   3428 C  CB    . GLU B 1 8   ? 44.898  11.710  29.330 1.00 88.34  ? 34  GLU B CB    1 
ATOM   3429 N  N     . LYS B 1 9   ? 44.297  13.514  31.669 1.00 91.99  ? 35  LYS B N     1 
ATOM   3430 C  CA    . LYS B 1 9   ? 44.408  14.602  32.652 1.00 94.60  ? 35  LYS B CA    1 
ATOM   3431 C  C     . LYS B 1 9   ? 43.007  15.111  33.031 1.00 93.87  ? 35  LYS B C     1 
ATOM   3432 O  O     . LYS B 1 9   ? 42.700  15.280  34.210 1.00 87.41  ? 35  LYS B O     1 
ATOM   3433 C  CB    . LYS B 1 9   ? 45.285  15.747  32.116 1.00 90.67  ? 35  LYS B CB    1 
ATOM   3434 C  CG    . LYS B 1 9   ? 45.983  16.585  33.176 1.00 87.84  ? 35  LYS B CG    1 
ATOM   3435 C  CD    . LYS B 1 9   ? 46.449  17.913  32.599 1.00 90.07  ? 35  LYS B CD    1 
ATOM   3436 C  CE    . LYS B 1 9   ? 47.262  17.726  31.319 1.00 84.91  ? 35  LYS B CE    1 
ATOM   3437 N  NZ    . LYS B 1 9   ? 47.668  19.037  30.726 1.00 75.98  ? 35  LYS B NZ    1 
ATOM   3438 N  N     . ILE B 1 10  ? 42.176  15.383  32.025 1.00 93.12  ? 36  ILE B N     1 
ATOM   3439 C  CA    . ILE B 1 10  ? 40.747  15.612  32.231 1.00 90.04  ? 36  ILE B CA    1 
ATOM   3440 C  C     . ILE B 1 10  ? 40.085  14.358  32.800 1.00 85.91  ? 36  ILE B C     1 
ATOM   3441 O  O     . ILE B 1 10  ? 39.622  14.354  33.945 1.00 85.04  ? 36  ILE B O     1 
ATOM   3442 C  CB    . ILE B 1 10  ? 40.024  16.022  30.931 1.00 83.95  ? 36  ILE B CB    1 
ATOM   3443 C  CG1   . ILE B 1 10  ? 40.479  17.410  30.482 1.00 86.68  ? 36  ILE B CG1   1 
ATOM   3444 C  CG2   . ILE B 1 10  ? 38.517  16.043  31.152 1.00 79.77  ? 36  ILE B CG2   1 
ATOM   3445 C  CD1   . ILE B 1 10  ? 39.782  17.896  29.220 1.00 78.36  ? 36  ILE B CD1   1 
ATOM   3446 N  N     . ASN B 1 11  ? 40.040  13.299  31.989 1.00 82.89  ? 37  ASN B N     1 
ATOM   3447 C  CA    . ASN B 1 11  ? 39.418  12.044  32.406 1.00 81.62  ? 37  ASN B CA    1 
ATOM   3448 C  C     . ASN B 1 11  ? 40.107  11.501  33.655 1.00 83.91  ? 37  ASN B C     1 
ATOM   3449 O  O     . ASN B 1 11  ? 39.469  10.907  34.533 1.00 81.81  ? 37  ASN B O     1 
ATOM   3450 C  CB    . ASN B 1 11  ? 39.464  11.012  31.275 1.00 73.52  ? 37  ASN B CB    1 
ATOM   3451 N  N     . LYS B 1 12  ? 41.413  11.750  33.730 1.00 86.27  ? 38  LYS B N     1 
ATOM   3452 C  CA    . LYS B 1 12  ? 42.227  11.375  34.878 1.00 81.29  ? 38  LYS B CA    1 
ATOM   3453 C  C     . LYS B 1 12  ? 41.757  12.068  36.156 1.00 82.13  ? 38  LYS B C     1 
ATOM   3454 O  O     . LYS B 1 12  ? 41.535  11.414  37.169 1.00 87.29  ? 38  LYS B O     1 
ATOM   3455 C  CB    . LYS B 1 12  ? 43.702  11.697  34.621 1.00 87.31  ? 38  LYS B CB    1 
ATOM   3456 N  N     . ILE B 1 13  ? 41.622  13.391  36.115 1.00 86.54  ? 39  ILE B N     1 
ATOM   3457 C  CA    . ILE B 1 13  ? 41.243  14.149  37.305 1.00 83.71  ? 39  ILE B CA    1 
ATOM   3458 C  C     . ILE B 1 13  ? 39.799  13.860  37.706 1.00 80.30  ? 39  ILE B C     1 
ATOM   3459 O  O     . ILE B 1 13  ? 39.509  13.681  38.895 1.00 75.53  ? 39  ILE B O     1 
ATOM   3460 C  CB    . ILE B 1 13  ? 41.404  15.675  37.095 1.00 69.67  ? 39  ILE B CB    1 
ATOM   3461 N  N     . ILE B 1 14  ? 38.905  13.792  36.717 1.00 79.66  ? 40  ILE B N     1 
ATOM   3462 C  CA    . ILE B 1 14  ? 37.521  13.383  36.965 1.00 73.63  ? 40  ILE B CA    1 
ATOM   3463 C  C     . ILE B 1 14  ? 37.474  12.051  37.703 1.00 80.37  ? 40  ILE B C     1 
ATOM   3464 O  O     . ILE B 1 14  ? 36.916  11.964  38.795 1.00 77.38  ? 40  ILE B O     1 
ATOM   3465 C  CB    . ILE B 1 14  ? 36.702  13.259  35.662 1.00 73.54  ? 40  ILE B CB    1 
ATOM   3466 C  CG1   . ILE B 1 14  ? 36.551  14.619  34.980 1.00 77.52  ? 40  ILE B CG1   1 
ATOM   3467 C  CG2   . ILE B 1 14  ? 35.321  12.678  35.957 1.00 62.97  ? 40  ILE B CG2   1 
ATOM   3468 C  CD1   . ILE B 1 14  ? 35.760  14.570  33.686 1.00 66.47  ? 40  ILE B CD1   1 
ATOM   3469 N  N     . MET B 1 15  ? 38.077  11.023  37.108 1.00 82.71  ? 41  MET B N     1 
ATOM   3470 C  CA    . MET B 1 15  ? 38.065  9.687   37.704 1.00 77.11  ? 41  MET B CA    1 
ATOM   3471 C  C     . MET B 1 15  ? 38.694  9.667   39.098 1.00 75.55  ? 41  MET B C     1 
ATOM   3472 O  O     . MET B 1 15  ? 38.178  9.025   40.011 1.00 74.58  ? 41  MET B O     1 
ATOM   3473 C  CB    . MET B 1 15  ? 38.782  8.688   36.791 1.00 78.48  ? 41  MET B CB    1 
ATOM   3474 C  CG    . MET B 1 15  ? 38.693  7.248   37.266 1.00 91.28  ? 41  MET B CG    1 
ATOM   3475 S  SD    . MET B 1 15  ? 39.104  6.051   35.987 1.00 118.30 ? 41  MET B SD    1 
ATOM   3476 C  CE    . MET B 1 15  ? 38.999  4.521   36.912 1.00 93.00  ? 41  MET B CE    1 
ATOM   3477 N  N     . GLU B 1 16  ? 39.813  10.368  39.249 1.00 78.75  ? 42  GLU B N     1 
ATOM   3478 C  CA    . GLU B 1 16  ? 40.532  10.421  40.519 1.00 81.19  ? 42  GLU B CA    1 
ATOM   3479 C  C     . GLU B 1 16  ? 39.696  11.080  41.610 1.00 79.16  ? 42  GLU B C     1 
ATOM   3480 O  O     . GLU B 1 16  ? 39.818  10.744  42.791 1.00 73.77  ? 42  GLU B O     1 
ATOM   3481 C  CB    . GLU B 1 16  ? 41.859  11.167  40.358 1.00 80.69  ? 42  GLU B CB    1 
ATOM   3482 N  N     . ALA B 1 17  ? 38.864  12.037  41.211 1.00 81.48  ? 43  ALA B N     1 
ATOM   3483 C  CA    . ALA B 1 17  ? 38.061  12.787  42.169 1.00 79.26  ? 43  ALA B CA    1 
ATOM   3484 C  C     . ALA B 1 17  ? 36.682  12.169  42.394 1.00 79.64  ? 43  ALA B C     1 
ATOM   3485 O  O     . ALA B 1 17  ? 35.993  12.513  43.354 1.00 79.12  ? 43  ALA B O     1 
ATOM   3486 C  CB    . ALA B 1 17  ? 37.915  14.222  41.708 1.00 80.65  ? 43  ALA B CB    1 
ATOM   3487 N  N     . THR B 1 18  ? 36.289  11.243  41.524 1.00 78.37  ? 44  THR B N     1 
ATOM   3488 C  CA    . THR B 1 18  ? 34.926  10.715  41.555 1.00 76.45  ? 44  THR B CA    1 
ATOM   3489 C  C     . THR B 1 18  ? 34.817  9.255   42.022 1.00 72.33  ? 44  THR B C     1 
ATOM   3490 O  O     . THR B 1 18  ? 33.766  8.836   42.506 1.00 63.08  ? 44  THR B O     1 
ATOM   3491 C  CB    . THR B 1 18  ? 34.257  10.856  40.159 1.00 68.20  ? 44  THR B CB    1 
ATOM   3492 O  OG1   . THR B 1 18  ? 32.835  10.766  40.296 1.00 70.37  ? 44  THR B OG1   1 
ATOM   3493 C  CG2   . THR B 1 18  ? 34.737  9.777   39.203 1.00 74.16  ? 44  THR B CG2   1 
ATOM   3494 N  N     . LYS B 1 19  ? 35.902  8.498   41.875 1.00 76.41  ? 45  LYS B N     1 
ATOM   3495 C  CA    . LYS B 1 19  ? 35.935  7.065   42.181 1.00 70.40  ? 45  LYS B CA    1 
ATOM   3496 C  C     . LYS B 1 19  ? 35.427  6.711   43.579 1.00 66.84  ? 45  LYS B C     1 
ATOM   3497 O  O     . LYS B 1 19  ? 35.799  7.348   44.563 1.00 74.63  ? 45  LYS B O     1 
ATOM   3498 C  CB    . LYS B 1 19  ? 37.356  6.520   42.012 1.00 73.68  ? 45  LYS B CB    1 
ATOM   3499 C  CG    . LYS B 1 19  ? 37.436  5.255   41.169 1.00 78.78  ? 45  LYS B CG    1 
ATOM   3500 C  CD    . LYS B 1 19  ? 38.276  4.185   41.851 1.00 73.93  ? 45  LYS B CD    1 
ATOM   3501 C  CE    . LYS B 1 19  ? 38.694  3.097   40.880 1.00 73.67  ? 45  LYS B CE    1 
ATOM   3502 N  NZ    . LYS B 1 19  ? 39.872  3.508   40.063 1.00 75.27  ? 45  LYS B NZ    1 
ATOM   3503 N  N     . GLY B 1 20  ? 34.572  5.695   43.650 1.00 65.54  ? 46  GLY B N     1 
ATOM   3504 C  CA    . GLY B 1 20  ? 34.060  5.204   44.916 1.00 63.02  ? 46  GLY B CA    1 
ATOM   3505 C  C     . GLY B 1 20  ? 32.905  6.006   45.483 1.00 61.15  ? 46  GLY B C     1 
ATOM   3506 O  O     . GLY B 1 20  ? 32.474  5.780   46.616 1.00 60.11  ? 46  GLY B O     1 
ATOM   3507 N  N     . SER B 1 21  ? 32.394  6.944   44.692 1.00 61.09  ? 47  SER B N     1 
ATOM   3508 C  CA    . SER B 1 21  ? 31.199  7.686   45.075 1.00 53.52  ? 47  SER B CA    1 
ATOM   3509 C  C     . SER B 1 21  ? 29.977  6.784   44.976 1.00 52.04  ? 47  SER B C     1 
ATOM   3510 O  O     . SER B 1 21  ? 30.052  5.687   44.425 1.00 54.55  ? 47  SER B O     1 
ATOM   3511 C  CB    . SER B 1 21  ? 31.022  8.920   44.184 1.00 52.83  ? 47  SER B CB    1 
ATOM   3512 O  OG    . SER B 1 21  ? 29.650  9.244   44.011 1.00 53.76  ? 47  SER B OG    1 
ATOM   3513 N  N     . ARG B 1 22  ? 28.852  7.247   45.500 1.00 49.06  ? 48  ARG B N     1 
ATOM   3514 C  CA    A ARG B 1 22  ? 27.614  6.500   45.364 0.70 47.04  ? 48  ARG B CA    1 
ATOM   3515 C  CA    B ARG B 1 22  ? 27.591  6.530   45.369 0.30 46.91  ? 48  ARG B CA    1 
ATOM   3516 C  C     . ARG B 1 22  ? 27.092  6.673   43.941 1.00 48.13  ? 48  ARG B C     1 
ATOM   3517 O  O     . ARG B 1 22  ? 26.602  5.711   43.319 1.00 45.74  ? 48  ARG B O     1 
ATOM   3518 C  CB    A ARG B 1 22  ? 26.594  6.972   46.401 0.70 46.09  ? 48  ARG B CB    1 
ATOM   3519 C  CB    B ARG B 1 22  ? 26.546  7.069   46.348 0.30 45.97  ? 48  ARG B CB    1 
ATOM   3520 C  CG    A ARG B 1 22  ? 27.254  7.544   47.657 0.70 48.86  ? 48  ARG B CG    1 
ATOM   3521 C  CG    B ARG B 1 22  ? 26.889  6.883   47.817 0.30 47.09  ? 48  ARG B CG    1 
ATOM   3522 C  CD    A ARG B 1 22  ? 26.676  6.958   48.937 0.70 47.14  ? 48  ARG B CD    1 
ATOM   3523 C  CD    B ARG B 1 22  ? 25.860  7.590   48.688 0.30 45.93  ? 48  ARG B CD    1 
ATOM   3524 N  NE    A ARG B 1 22  ? 25.550  7.726   49.466 0.70 45.94  ? 48  ARG B NE    1 
ATOM   3525 N  NE    B ARG B 1 22  ? 25.807  7.055   50.045 0.30 45.30  ? 48  ARG B NE    1 
ATOM   3526 C  CZ    A ARG B 1 22  ? 25.644  8.640   50.430 0.70 46.85  ? 48  ARG B CZ    1 
ATOM   3527 C  CZ    B ARG B 1 22  ? 25.110  5.978   50.393 0.30 43.11  ? 48  ARG B CZ    1 
ATOM   3528 N  NH1   A ARG B 1 22  ? 24.559  9.279   50.845 0.70 47.20  ? 48  ARG B NH1   1 
ATOM   3529 N  NH1   B ARG B 1 22  ? 25.113  5.555   51.650 0.30 40.73  ? 48  ARG B NH1   1 
ATOM   3530 N  NH2   A ARG B 1 22  ? 26.818  8.913   50.984 0.70 50.03  ? 48  ARG B NH2   1 
ATOM   3531 N  NH2   B ARG B 1 22  ? 24.412  5.317   49.481 0.30 42.67  ? 48  ARG B NH2   1 
ATOM   3532 N  N     . PHE B 1 23  ? 27.203  7.904   43.449 1.00 46.12  ? 49  PHE B N     1 
ATOM   3533 C  CA    . PHE B 1 23  ? 26.873  8.269   42.081 1.00 43.19  ? 49  PHE B CA    1 
ATOM   3534 C  C     . PHE B 1 23  ? 27.659  7.415   41.105 1.00 43.14  ? 49  PHE B C     1 
ATOM   3535 O  O     . PHE B 1 23  ? 27.093  6.793   40.205 1.00 48.24  ? 49  PHE B O     1 
ATOM   3536 C  CB    . PHE B 1 23  ? 27.171  9.755   41.855 1.00 45.28  ? 49  PHE B CB    1 
ATOM   3537 C  CG    . PHE B 1 23  ? 26.700  10.282  40.531 1.00 42.21  ? 49  PHE B CG    1 
ATOM   3538 C  CD1   . PHE B 1 23  ? 25.424  10.802  40.388 1.00 42.85  ? 49  PHE B CD1   1 
ATOM   3539 C  CD2   . PHE B 1 23  ? 27.539  10.271  39.433 1.00 43.82  ? 49  PHE B CD2   1 
ATOM   3540 C  CE1   . PHE B 1 23  ? 24.992  11.288  39.167 1.00 38.89  ? 49  PHE B CE1   1 
ATOM   3541 C  CE2   . PHE B 1 23  ? 27.111  10.754  38.212 1.00 44.27  ? 49  PHE B CE2   1 
ATOM   3542 C  CZ    . PHE B 1 23  ? 25.838  11.264  38.080 1.00 35.90  ? 49  PHE B CZ    1 
ATOM   3543 N  N     . TYR B 1 24  ? 28.973  7.405   41.303 1.00 44.17  ? 50  TYR B N     1 
ATOM   3544 C  CA    . TYR B 1 24  ? 29.903  6.653   40.473 1.00 46.18  ? 50  TYR B CA    1 
ATOM   3545 C  C     . TYR B 1 24  ? 29.506  5.179   40.412 1.00 47.70  ? 50  TYR B C     1 
ATOM   3546 O  O     . TYR B 1 24  ? 29.493  4.567   39.339 1.00 49.42  ? 50  TYR B O     1 
ATOM   3547 C  CB    . TYR B 1 24  ? 31.321  6.827   41.026 1.00 56.65  ? 50  TYR B CB    1 
ATOM   3548 C  CG    . TYR B 1 24  ? 32.418  6.109   40.275 1.00 65.13  ? 50  TYR B CG    1 
ATOM   3549 C  CD1   . TYR B 1 24  ? 32.895  6.596   39.062 1.00 62.62  ? 50  TYR B CD1   1 
ATOM   3550 C  CD2   . TYR B 1 24  ? 32.995  4.951   40.796 1.00 66.76  ? 50  TYR B CD2   1 
ATOM   3551 C  CE1   . TYR B 1 24  ? 33.909  5.943   38.378 1.00 67.25  ? 50  TYR B CE1   1 
ATOM   3552 C  CE2   . TYR B 1 24  ? 34.006  4.289   40.122 1.00 72.08  ? 50  TYR B CE2   1 
ATOM   3553 C  CZ    . TYR B 1 24  ? 34.460  4.788   38.910 1.00 76.04  ? 50  TYR B CZ    1 
ATOM   3554 O  OH    . TYR B 1 24  ? 35.469  4.127   38.238 1.00 77.05  ? 50  TYR B OH    1 
ATOM   3555 N  N     . GLY B 1 25  ? 29.171  4.625   41.574 1.00 45.16  ? 51  GLY B N     1 
ATOM   3556 C  CA    . GLY B 1 25  ? 28.658  3.273   41.672 1.00 40.38  ? 51  GLY B CA    1 
ATOM   3557 C  C     . GLY B 1 25  ? 27.425  3.065   40.814 1.00 44.29  ? 51  GLY B C     1 
ATOM   3558 O  O     . GLY B 1 25  ? 27.348  2.100   40.037 1.00 44.87  ? 51  GLY B O     1 
ATOM   3559 N  N     . ASN B 1 26  ? 26.449  3.961   40.954 1.00 43.75  ? 52  ASN B N     1 
ATOM   3560 C  CA    . ASN B 1 26  ? 25.214  3.818   40.183 1.00 43.50  ? 52  ASN B CA    1 
ATOM   3561 C  C     . ASN B 1 26  ? 25.480  3.889   38.678 1.00 43.31  ? 52  ASN B C     1 
ATOM   3562 O  O     . ASN B 1 26  ? 24.803  3.234   37.876 1.00 43.85  ? 52  ASN B O     1 
ATOM   3563 C  CB    . ASN B 1 26  ? 24.197  4.882   40.578 1.00 39.81  ? 52  ASN B CB    1 
ATOM   3564 C  CG    . ASN B 1 26  ? 22.834  4.624   39.979 1.00 43.09  ? 52  ASN B CG    1 
ATOM   3565 O  OD1   . ASN B 1 26  ? 22.389  5.340   39.083 1.00 42.46  ? 52  ASN B OD1   1 
ATOM   3566 N  ND2   . ASN B 1 26  ? 22.162  3.589   40.469 1.00 47.53  ? 52  ASN B ND2   1 
ATOM   3567 N  N     . GLU B 1 27  ? 26.489  4.669   38.306 1.00 41.65  ? 53  GLU B N     1 
ATOM   3568 C  CA    . GLU B 1 27  ? 26.908  4.760   36.914 1.00 41.19  ? 53  GLU B CA    1 
ATOM   3569 C  C     . GLU B 1 27  ? 27.538  3.453   36.434 1.00 44.80  ? 53  GLU B C     1 
ATOM   3570 O  O     . GLU B 1 27  ? 27.300  3.024   35.299 1.00 42.04  ? 53  GLU B O     1 
ATOM   3571 C  CB    . GLU B 1 27  ? 27.885  5.924   36.728 1.00 42.21  ? 53  GLU B CB    1 
ATOM   3572 C  CG    . GLU B 1 27  ? 27.245  7.304   36.850 1.00 49.37  ? 53  GLU B CG    1 
ATOM   3573 C  CD    . GLU B 1 27  ? 26.300  7.610   35.696 1.00 52.70  ? 53  GLU B CD    1 
ATOM   3574 O  OE1   . GLU B 1 27  ? 26.713  7.420   34.532 1.00 51.14  ? 53  GLU B OE1   1 
ATOM   3575 O  OE2   . GLU B 1 27  ? 25.152  8.038   35.949 1.00 47.98  ? 53  GLU B OE2   1 
ATOM   3576 N  N     . LEU B 1 28  ? 28.333  2.820   37.295 1.00 44.29  ? 54  LEU B N     1 
ATOM   3577 C  CA    . LEU B 1 28  ? 28.869  1.496   36.985 1.00 43.12  ? 54  LEU B CA    1 
ATOM   3578 C  C     . LEU B 1 28  ? 27.742  0.503   36.754 1.00 42.79  ? 54  LEU B C     1 
ATOM   3579 O  O     . LEU B 1 28  ? 27.765  -0.256  35.788 1.00 46.63  ? 54  LEU B O     1 
ATOM   3580 C  CB    . LEU B 1 28  ? 29.781  0.989   38.102 1.00 43.50  ? 54  LEU B CB    1 
ATOM   3581 C  CG    . LEU B 1 28  ? 31.150  1.657   38.224 1.00 51.84  ? 54  LEU B CG    1 
ATOM   3582 C  CD1   . LEU B 1 28  ? 32.022  0.919   39.229 1.00 52.30  ? 54  LEU B CD1   1 
ATOM   3583 C  CD2   . LEU B 1 28  ? 31.836  1.744   36.868 1.00 48.70  ? 54  LEU B CD2   1 
ATOM   3584 N  N     . LYS B 1 29  ? 26.757  0.512   37.646 1.00 36.91  ? 55  LYS B N     1 
ATOM   3585 C  CA    . LYS B 1 29  ? 25.575  -0.328  37.481 1.00 34.95  ? 55  LYS B CA    1 
ATOM   3586 C  C     . LYS B 1 29  ? 24.870  -0.099  36.139 1.00 42.45  ? 55  LYS B C     1 
ATOM   3587 O  O     . LYS B 1 29  ? 24.583  -1.057  35.402 1.00 48.92  ? 55  LYS B O     1 
ATOM   3588 C  CB    . LYS B 1 29  ? 24.609  -0.081  38.635 1.00 42.75  ? 55  LYS B CB    1 
ATOM   3589 C  CG    . LYS B 1 29  ? 23.257  -0.754  38.508 1.00 47.48  ? 55  LYS B CG    1 
ATOM   3590 C  CD    . LYS B 1 29  ? 22.454  -0.559  39.793 1.00 49.23  ? 55  LYS B CD    1 
ATOM   3591 C  CE    . LYS B 1 29  ? 21.012  -1.021  39.653 1.00 50.70  ? 55  LYS B CE    1 
ATOM   3592 N  NZ    . LYS B 1 29  ? 20.222  -0.731  40.887 1.00 53.12  ? 55  LYS B NZ    1 
ATOM   3593 N  N     . LYS B 1 30  ? 24.609  1.166   35.813 1.00 43.10  ? 56  LYS B N     1 
ATOM   3594 C  CA    . LYS B 1 30  ? 23.914  1.495   34.565 1.00 41.90  ? 56  LYS B CA    1 
ATOM   3595 C  C     . LYS B 1 30  ? 24.699  1.038   33.335 1.00 38.84  ? 56  LYS B C     1 
ATOM   3596 O  O     . LYS B 1 30  ? 24.141  0.454   32.394 1.00 39.40  ? 56  LYS B O     1 
ATOM   3597 C  CB    . LYS B 1 30  ? 23.642  3.001   34.486 1.00 39.69  ? 56  LYS B CB    1 
ATOM   3598 C  CG    . LYS B 1 30  ? 22.239  3.402   34.930 1.00 37.42  ? 56  LYS B CG    1 
ATOM   3599 C  CD    . LYS B 1 30  ? 22.206  4.816   35.481 1.00 43.58  ? 56  LYS B CD    1 
ATOM   3600 C  CE    . LYS B 1 30  ? 22.559  5.848   34.419 1.00 48.20  ? 56  LYS B CE    1 
ATOM   3601 N  NZ    . LYS B 1 30  ? 22.525  7.245   34.962 1.00 48.13  ? 56  LYS B NZ    1 
ATOM   3602 N  N     . GLU B 1 31  ? 26.000  1.301   33.348 1.00 40.23  ? 57  GLU B N     1 
ATOM   3603 C  CA    . GLU B 1 31  ? 26.848  0.875   32.249 1.00 45.16  ? 57  GLU B CA    1 
ATOM   3604 C  C     . GLU B 1 31  ? 26.846  -0.639  32.103 1.00 45.29  ? 57  GLU B C     1 
ATOM   3605 O  O     . GLU B 1 31  ? 26.711  -1.149  30.994 1.00 45.49  ? 57  GLU B O     1 
ATOM   3606 C  CB    . GLU B 1 31  ? 28.277  1.396   32.401 1.00 49.77  ? 57  GLU B CB    1 
ATOM   3607 C  CG    . GLU B 1 31  ? 29.208  0.741   31.410 1.00 56.37  ? 57  GLU B CG    1 
ATOM   3608 C  CD    . GLU B 1 31  ? 28.869  1.124   29.974 1.00 69.85  ? 57  GLU B CD    1 
ATOM   3609 O  OE1   . GLU B 1 31  ? 28.343  2.239   29.755 1.00 73.81  ? 57  GLU B OE1   1 
ATOM   3610 O  OE2   . GLU B 1 31  ? 29.090  0.287   29.071 1.00 67.38  ? 57  GLU B OE2   1 
ATOM   3611 N  N     . LYS B 1 32  ? 27.017  -1.347  33.214 1.00 45.96  ? 58  LYS B N     1 
ATOM   3612 C  CA    . LYS B 1 32  ? 26.892  -2.800  33.221 1.00 46.59  ? 58  LYS B CA    1 
ATOM   3613 C  C     . LYS B 1 32  ? 25.597  -3.237  32.539 1.00 44.46  ? 58  LYS B C     1 
ATOM   3614 O  O     . LYS B 1 32  ? 25.590  -4.181  31.740 1.00 49.46  ? 58  LYS B O     1 
ATOM   3615 C  CB    . LYS B 1 32  ? 26.938  -3.341  34.649 1.00 42.16  ? 58  LYS B CB    1 
ATOM   3616 C  CG    . LYS B 1 32  ? 26.604  -4.820  34.755 1.00 50.97  ? 58  LYS B CG    1 
ATOM   3617 C  CD    . LYS B 1 32  ? 25.733  -5.101  35.970 1.00 56.14  ? 58  LYS B CD    1 
ATOM   3618 N  N     . GLN B 1 33  ? 24.506  -2.544  32.856 1.00 42.92  ? 59  GLN B N     1 
ATOM   3619 C  CA    . GLN B 1 33  ? 23.224  -2.824  32.209 1.00 45.83  ? 59  GLN B CA    1 
ATOM   3620 C  C     . GLN B 1 33  ? 23.261  -2.620  30.686 1.00 44.06  ? 59  GLN B C     1 
ATOM   3621 O  O     . GLN B 1 33  ? 22.711  -3.430  29.919 1.00 41.47  ? 59  GLN B O     1 
ATOM   3622 C  CB    . GLN B 1 33  ? 22.131  -1.954  32.824 1.00 50.21  ? 59  GLN B CB    1 
ATOM   3623 C  CG    . GLN B 1 33  ? 20.760  -2.162  32.218 1.00 61.28  ? 59  GLN B CG    1 
ATOM   3624 C  CD    . GLN B 1 33  ? 19.698  -2.445  33.269 1.00 70.16  ? 59  GLN B CD    1 
ATOM   3625 O  OE1   . GLN B 1 33  ? 19.998  -2.966  34.346 1.00 77.20  ? 59  GLN B OE1   1 
ATOM   3626 N  NE2   . GLN B 1 33  ? 18.449  -2.093  32.964 1.00 59.49  ? 59  GLN B NE2   1 
ATOM   3627 N  N     . VAL B 1 34  ? 23.920  -1.553  30.243 1.00 43.47  ? 60  VAL B N     1 
ATOM   3628 C  CA    . VAL B 1 34  ? 23.971  -1.277  28.809 1.00 42.15  ? 60  VAL B CA    1 
ATOM   3629 C  C     . VAL B 1 34  ? 24.786  -2.346  28.096 1.00 42.93  ? 60  VAL B C     1 
ATOM   3630 O  O     . VAL B 1 34  ? 24.364  -2.883  27.071 1.00 44.32  ? 60  VAL B O     1 
ATOM   3631 C  CB    . VAL B 1 34  ? 24.588  0.101   28.505 1.00 45.62  ? 60  VAL B CB    1 
ATOM   3632 C  CG1   . VAL B 1 34  ? 24.531  0.388   27.018 1.00 43.17  ? 60  VAL B CG1   1 
ATOM   3633 C  CG2   . VAL B 1 34  ? 23.877  1.198   29.284 1.00 46.08  ? 60  VAL B CG2   1 
ATOM   3634 N  N     . ASN B 1 35  ? 25.955  -2.646  28.650 1.00 44.29  ? 61  ASN B N     1 
ATOM   3635 C  CA    . ASN B 1 35  ? 26.772  -3.768  28.213 1.00 38.80  ? 61  ASN B CA    1 
ATOM   3636 C  C     . ASN B 1 35  ? 25.977  -5.069  28.110 1.00 43.94  ? 61  ASN B C     1 
ATOM   3637 O  O     . ASN B 1 35  ? 26.155  -5.832  27.161 1.00 45.67  ? 61  ASN B O     1 
ATOM   3638 C  CB    . ASN B 1 35  ? 27.967  -3.944  29.147 1.00 36.76  ? 61  ASN B CB    1 
ATOM   3639 C  CG    . ASN B 1 35  ? 29.111  -3.015  28.797 1.00 41.81  ? 61  ASN B CG    1 
ATOM   3640 O  OD1   . ASN B 1 35  ? 29.267  -2.626  27.642 1.00 42.69  ? 61  ASN B OD1   1 
ATOM   3641 N  ND2   . ASN B 1 35  ? 29.917  -2.655  29.790 1.00 44.71  ? 61  ASN B ND2   1 
ATOM   3642 N  N     . GLN B 1 36  ? 25.133  -5.342  29.101 1.00 41.05  ? 62  GLN B N     1 
ATOM   3643 C  CA    . GLN B 1 36  ? 24.230  -6.487  29.014 1.00 39.33  ? 62  GLN B CA    1 
ATOM   3644 C  C     . GLN B 1 36  ? 23.319  -6.402  27.793 1.00 40.41  ? 62  GLN B C     1 
ATOM   3645 O  O     . GLN B 1 36  ? 23.228  -7.365  27.025 1.00 43.84  ? 62  GLN B O     1 
ATOM   3646 C  CB    . GLN B 1 36  ? 23.386  -6.621  30.282 1.00 43.74  ? 62  GLN B CB    1 
ATOM   3647 C  CG    . GLN B 1 36  ? 22.523  -7.885  30.322 1.00 49.08  ? 62  GLN B CG    1 
ATOM   3648 C  CD    . GLN B 1 36  ? 23.318  -9.164  30.080 1.00 51.84  ? 62  GLN B CD    1 
ATOM   3649 O  OE1   . GLN B 1 36  ? 24.500  -9.256  30.421 1.00 53.29  ? 62  GLN B OE1   1 
ATOM   3650 N  NE2   . GLN B 1 36  ? 22.665  -10.160 29.489 1.00 47.70  ? 62  GLN B NE2   1 
ATOM   3651 N  N     . ARG B 1 37  ? 22.641  -5.268  27.613 1.00 43.11  ? 63  ARG B N     1 
ATOM   3652 C  CA    . ARG B 1 37  ? 21.800  -5.089  26.419 1.00 42.55  ? 63  ARG B CA    1 
ATOM   3653 C  C     . ARG B 1 37  ? 22.548  -5.326  25.096 1.00 40.07  ? 63  ARG B C     1 
ATOM   3654 O  O     . ARG B 1 37  ? 22.001  -5.896  24.137 1.00 30.92  ? 63  ARG B O     1 
ATOM   3655 C  CB    . ARG B 1 37  ? 21.178  -3.692  26.396 1.00 49.27  ? 63  ARG B CB    1 
ATOM   3656 C  CG    . ARG B 1 37  ? 19.832  -3.605  27.094 1.00 58.17  ? 63  ARG B CG    1 
ATOM   3657 C  CD    . ARG B 1 37  ? 19.028  -2.384  26.620 1.00 61.44  ? 63  ARG B CD    1 
ATOM   3658 N  NE    . ARG B 1 37  ? 19.371  -1.160  27.343 1.00 77.12  ? 63  ARG B NE    1 
ATOM   3659 C  CZ    . ARG B 1 37  ? 18.718  -0.004  27.224 1.00 80.14  ? 63  ARG B CZ    1 
ATOM   3660 N  NH1   . ARG B 1 37  ? 19.108  1.050   27.932 1.00 56.69  ? 63  ARG B NH1   1 
ATOM   3661 N  NH2   . ARG B 1 37  ? 17.677  0.100   26.404 1.00 79.99  ? 63  ARG B NH2   1 
ATOM   3662 N  N     . ILE B 1 38  ? 23.804  -4.889  25.056 1.00 41.32  ? 64  ILE B N     1 
ATOM   3663 C  CA    . ILE B 1 38  ? 24.613  -4.994  23.846 1.00 43.55  ? 64  ILE B CA    1 
ATOM   3664 C  C     . ILE B 1 38  ? 24.984  -6.451  23.614 1.00 46.04  ? 64  ILE B C     1 
ATOM   3665 O  O     . ILE B 1 38  ? 24.860  -6.949  22.497 1.00 44.66  ? 64  ILE B O     1 
ATOM   3666 C  CB    . ILE B 1 38  ? 25.888  -4.123  23.927 1.00 40.58  ? 64  ILE B CB    1 
ATOM   3667 C  CG1   . ILE B 1 38  ? 25.545  -2.653  23.716 1.00 37.36  ? 64  ILE B CG1   1 
ATOM   3668 C  CG2   . ILE B 1 38  ? 26.914  -4.550  22.902 1.00 32.82  ? 64  ILE B CG2   1 
ATOM   3669 C  CD1   . ILE B 1 38  ? 26.737  -1.742  23.814 1.00 39.54  ? 64  ILE B CD1   1 
ATOM   3670 N  N     . GLU B 1 39  ? 25.441  -7.124  24.670 1.00 45.03  ? 65  GLU B N     1 
ATOM   3671 C  CA    . GLU B 1 39  ? 25.703  -8.562  24.631 1.00 40.77  ? 65  GLU B CA    1 
ATOM   3672 C  C     . GLU B 1 39  ? 24.503  -9.319  24.077 1.00 42.11  ? 65  GLU B C     1 
ATOM   3673 O  O     . GLU B 1 39  ? 24.644  -10.132 23.166 1.00 47.34  ? 65  GLU B O     1 
ATOM   3674 C  CB    . GLU B 1 39  ? 26.059  -9.088  26.025 1.00 47.37  ? 65  GLU B CB    1 
ATOM   3675 C  CG    . GLU B 1 39  ? 26.164  -10.611 26.121 1.00 51.76  ? 65  GLU B CG    1 
ATOM   3676 N  N     . ASN B 1 40  ? 23.322  -9.038  24.623 1.00 39.20  ? 66  ASN B N     1 
ATOM   3677 C  CA    . ASN B 1 40  ? 22.096  -9.646  24.118 1.00 36.31  ? 66  ASN B CA    1 
ATOM   3678 C  C     . ASN B 1 40  ? 21.868  -9.366  22.638 1.00 41.06  ? 66  ASN B C     1 
ATOM   3679 O  O     . ASN B 1 40  ? 21.471  -10.263 21.894 1.00 49.45  ? 66  ASN B O     1 
ATOM   3680 C  CB    . ASN B 1 40  ? 20.891  -9.167  24.918 1.00 38.29  ? 66  ASN B CB    1 
ATOM   3681 C  CG    . ASN B 1 40  ? 20.971  -9.551  26.372 1.00 44.62  ? 66  ASN B CG    1 
ATOM   3682 O  OD1   . ASN B 1 40  ? 21.428  -10.642 26.714 1.00 52.50  ? 66  ASN B OD1   1 
ATOM   3683 N  ND2   . ASN B 1 40  ? 20.538  -8.649  27.245 1.00 49.21  ? 66  ASN B ND2   1 
ATOM   3684 N  N     . MET B 1 41  ? 22.099  -8.126  22.211 1.00 44.34  ? 67  MET B N     1 
ATOM   3685 C  CA    . MET B 1 41  ? 21.919  -7.788  20.800 1.00 41.63  ? 67  MET B CA    1 
ATOM   3686 C  C     . MET B 1 41  ? 22.883  -8.560  19.897 1.00 46.44  ? 67  MET B C     1 
ATOM   3687 O  O     . MET B 1 41  ? 22.506  -9.008  18.814 1.00 46.84  ? 67  MET B O     1 
ATOM   3688 C  CB    . MET B 1 41  ? 22.107  -6.292  20.577 1.00 38.66  ? 67  MET B CB    1 
ATOM   3689 C  CG    . MET B 1 41  ? 21.810  -5.851  19.161 1.00 42.35  ? 67  MET B CG    1 
ATOM   3690 S  SD    . MET B 1 41  ? 22.499  -4.235  18.772 1.00 38.21  ? 67  MET B SD    1 
ATOM   3691 C  CE    . MET B 1 41  ? 24.135  -4.377  19.494 1.00 40.18  ? 67  MET B CE    1 
ATOM   3692 N  N     . MET B 1 42  ? 24.118  -8.730  20.359 1.00 45.75  ? 68  MET B N     1 
ATOM   3693 C  CA    . MET B 1 42  ? 25.124  -9.488  19.628 1.00 44.04  ? 68  MET B CA    1 
ATOM   3694 C  C     . MET B 1 42  ? 24.722  -10.949 19.532 1.00 47.90  ? 68  MET B C     1 
ATOM   3695 O  O     . MET B 1 42  ? 24.859  -11.568 18.480 1.00 54.35  ? 68  MET B O     1 
ATOM   3696 C  CB    . MET B 1 42  ? 26.491  -9.364  20.300 1.00 46.08  ? 68  MET B CB    1 
ATOM   3697 C  CG    . MET B 1 42  ? 27.047  -7.965  20.293 1.00 40.65  ? 68  MET B CG    1 
ATOM   3698 S  SD    . MET B 1 42  ? 27.144  -7.319  18.617 1.00 54.42  ? 68  MET B SD    1 
ATOM   3699 C  CE    . MET B 1 42  ? 28.886  -7.560  18.276 1.00 53.31  ? 68  MET B CE    1 
ATOM   3700 N  N     . GLN B 1 43  ? 24.246  -11.508 20.636 1.00 50.19  ? 69  GLN B N     1 
ATOM   3701 C  CA    . GLN B 1 43  ? 23.749  -12.874 20.615 1.00 55.28  ? 69  GLN B CA    1 
ATOM   3702 C  C     . GLN B 1 43  ? 22.522  -13.006 19.718 1.00 49.83  ? 69  GLN B C     1 
ATOM   3703 O  O     . GLN B 1 43  ? 22.246  -14.080 19.209 1.00 56.54  ? 69  GLN B O     1 
ATOM   3704 C  CB    . GLN B 1 43  ? 23.444  -13.373 22.029 1.00 59.66  ? 69  GLN B CB    1 
ATOM   3705 C  CG    . GLN B 1 43  ? 24.675  -13.436 22.927 1.00 65.19  ? 69  GLN B CG    1 
ATOM   3706 C  CD    . GLN B 1 43  ? 25.544  -14.658 22.650 1.00 79.44  ? 69  GLN B CD    1 
ATOM   3707 O  OE1   . GLN B 1 43  ? 25.107  -15.614 22.008 1.00 74.57  ? 69  GLN B OE1   1 
ATOM   3708 N  NE2   . GLN B 1 43  ? 26.782  -14.628 23.138 1.00 88.36  ? 69  GLN B NE2   1 
ATOM   3709 N  N     . GLN B 1 44  ? 21.784  -11.921 19.517 1.00 49.50  ? 70  GLN B N     1 
ATOM   3710 C  CA    . GLN B 1 44  ? 20.641  -11.971 18.605 1.00 50.23  ? 70  GLN B CA    1 
ATOM   3711 C  C     . GLN B 1 44  ? 21.080  -11.853 17.136 1.00 51.15  ? 70  GLN B C     1 
ATOM   3712 O  O     . GLN B 1 44  ? 20.426  -12.378 16.229 1.00 49.41  ? 70  GLN B O     1 
ATOM   3713 C  CB    . GLN B 1 44  ? 19.633  -10.874 18.950 1.00 45.16  ? 70  GLN B CB    1 
ATOM   3714 C  CG    . GLN B 1 44  ? 18.491  -10.751 17.959 1.00 49.29  ? 70  GLN B CG    1 
ATOM   3715 C  CD    . GLN B 1 44  ? 17.134  -10.778 18.624 1.00 60.33  ? 70  GLN B CD    1 
ATOM   3716 O  OE1   . GLN B 1 44  ? 16.769  -11.763 19.271 1.00 58.75  ? 70  GLN B OE1   1 
ATOM   3717 N  NE2   . GLN B 1 44  ? 16.372  -9.698  18.467 1.00 62.18  ? 70  GLN B NE2   1 
ATOM   3718 N  N     . LYS B 1 45  ? 22.210  -11.190 16.912 1.00 46.55  ? 71  LYS B N     1 
ATOM   3719 C  CA    . LYS B 1 45  ? 22.778  -11.081 15.572 1.00 47.65  ? 71  LYS B CA    1 
ATOM   3720 C  C     . LYS B 1 45  ? 23.232  -12.457 15.077 1.00 51.06  ? 71  LYS B C     1 
ATOM   3721 O  O     . LYS B 1 45  ? 22.936  -12.850 13.946 1.00 48.72  ? 71  LYS B O     1 
ATOM   3722 C  CB    . LYS B 1 45  ? 23.943  -10.083 15.566 1.00 45.38  ? 71  LYS B CB    1 
ATOM   3723 C  CG    . LYS B 1 45  ? 24.602  -9.866  14.213 1.00 47.33  ? 71  LYS B CG    1 
ATOM   3724 C  CD    . LYS B 1 45  ? 25.988  -9.262  14.372 1.00 47.94  ? 71  LYS B CD    1 
ATOM   3725 C  CE    . LYS B 1 45  ? 26.763  -9.291  13.061 1.00 52.76  ? 71  LYS B CE    1 
ATOM   3726 N  NZ    . LYS B 1 45  ? 28.139  -8.732  13.228 1.00 57.36  ? 71  LYS B NZ    1 
ATOM   3727 N  N     . ALA B 1 46  ? 23.954  -13.172 15.937 1.00 53.19  ? 72  ALA B N     1 
ATOM   3728 C  CA    . ALA B 1 46  ? 24.448  -14.523 15.660 1.00 48.41  ? 72  ALA B CA    1 
ATOM   3729 C  C     . ALA B 1 46  ? 23.393  -15.509 15.126 1.00 50.93  ? 72  ALA B C     1 
ATOM   3730 O  O     . ALA B 1 46  ? 23.703  -16.367 14.303 1.00 46.18  ? 72  ALA B O     1 
ATOM   3731 C  CB    . ALA B 1 46  ? 25.094  -15.085 16.917 1.00 44.63  ? 72  ALA B CB    1 
ATOM   3732 N  N     . GLN B 1 47  ? 22.152  -15.390 15.586 1.00 50.55  ? 73  GLN B N     1 
ATOM   3733 C  CA    . GLN B 1 47  ? 21.093  -16.285 15.118 1.00 50.90  ? 73  GLN B CA    1 
ATOM   3734 C  C     . GLN B 1 47  ? 20.353  -15.769 13.889 1.00 54.39  ? 73  GLN B C     1 
ATOM   3735 O  O     . GLN B 1 47  ? 19.204  -16.140 13.645 1.00 52.64  ? 73  GLN B O     1 
ATOM   3736 C  CB    . GLN B 1 47  ? 20.091  -16.560 16.243 1.00 56.76  ? 73  GLN B CB    1 
ATOM   3737 C  CG    . GLN B 1 47  ? 20.427  -17.782 17.097 1.00 70.66  ? 73  GLN B CG    1 
ATOM   3738 C  CD    . GLN B 1 47  ? 21.387  -17.492 18.229 1.00 72.84  ? 73  GLN B CD    1 
ATOM   3739 O  OE1   . GLN B 1 47  ? 22.048  -16.456 18.250 1.00 61.49  ? 73  GLN B OE1   1 
ATOM   3740 N  NE2   . GLN B 1 47  ? 21.467  -18.413 19.184 1.00 82.33  ? 73  GLN B NE2   1 
ATOM   3741 N  N     . ILE B 1 48  ? 21.014  -14.918 13.112 1.00 56.55  ? 74  ILE B N     1 
ATOM   3742 C  CA    . ILE B 1 48  ? 20.413  -14.382 11.898 1.00 52.75  ? 74  ILE B CA    1 
ATOM   3743 C  C     . ILE B 1 48  ? 20.976  -15.121 10.696 1.00 46.59  ? 74  ILE B C     1 
ATOM   3744 O  O     . ILE B 1 48  ? 22.193  -15.237 10.543 1.00 48.17  ? 74  ILE B O     1 
ATOM   3745 C  CB    . ILE B 1 48  ? 20.650  -12.857 11.766 1.00 50.03  ? 74  ILE B CB    1 
ATOM   3746 C  CG1   . ILE B 1 48  ? 19.556  -12.102 12.520 1.00 44.61  ? 74  ILE B CG1   1 
ATOM   3747 C  CG2   . ILE B 1 48  ? 20.666  -12.424 10.304 1.00 45.21  ? 74  ILE B CG2   1 
ATOM   3748 C  CD1   . ILE B 1 48  ? 19.897  -10.675 12.822 1.00 43.18  ? 74  ILE B CD1   1 
ATOM   3749 N  N     . THR B 1 49  ? 20.092  -15.645 9.856  1.00 41.75  ? 75  THR B N     1 
ATOM   3750 C  CA    . THR B 1 49  ? 20.530  -16.345 8.658  1.00 43.22  ? 75  THR B CA    1 
ATOM   3751 C  C     . THR B 1 49  ? 20.572  -15.376 7.484  1.00 47.95  ? 75  THR B C     1 
ATOM   3752 O  O     . THR B 1 49  ? 19.796  -14.426 7.427  1.00 52.59  ? 75  THR B O     1 
ATOM   3753 C  CB    . THR B 1 49  ? 19.609  -17.533 8.319  1.00 46.25  ? 75  THR B CB    1 
ATOM   3754 O  OG1   . THR B 1 49  ? 18.418  -17.052 7.685  1.00 47.29  ? 75  THR B OG1   1 
ATOM   3755 C  CG2   . THR B 1 49  ? 19.218  -18.278 9.579  1.00 52.03  ? 75  THR B CG2   1 
ATOM   3756 N  N     . SER B 1 50  ? 21.475  -15.624 6.543  1.00 45.59  ? 76  SER B N     1 
ATOM   3757 C  CA    . SER B 1 50  ? 21.586  -14.803 5.340  1.00 38.91  ? 76  SER B CA    1 
ATOM   3758 C  C     . SER B 1 50  ? 20.267  -14.720 4.558  1.00 38.11  ? 76  SER B C     1 
ATOM   3759 O  O     . SER B 1 50  ? 20.053  -13.784 3.793  1.00 39.17  ? 76  SER B O     1 
ATOM   3760 C  CB    . SER B 1 50  ? 22.707  -15.339 4.453  1.00 37.92  ? 76  SER B CB    1 
ATOM   3761 O  OG    . SER B 1 50  ? 22.739  -16.754 4.492  1.00 46.06  ? 76  SER B OG    1 
ATOM   3762 N  N     . GLN B 1 51  ? 19.400  -15.708 4.749  1.00 39.10  ? 77  GLN B N     1 
ATOM   3763 C  CA    . GLN B 1 51  ? 18.107  -15.779 4.067  1.00 44.93  ? 77  GLN B CA    1 
ATOM   3764 C  C     . GLN B 1 51  ? 17.171  -14.651 4.525  1.00 45.84  ? 77  GLN B C     1 
ATOM   3765 O  O     . GLN B 1 51  ? 16.737  -13.805 3.728  1.00 41.93  ? 77  GLN B O     1 
ATOM   3766 C  CB    . GLN B 1 51  ? 17.465  -17.145 4.337  1.00 45.17  ? 77  GLN B CB    1 
ATOM   3767 C  CG    . GLN B 1 51  ? 16.049  -17.339 3.820  1.00 50.03  ? 77  GLN B CG    1 
ATOM   3768 C  CD    . GLN B 1 51  ? 15.996  -17.621 2.330  1.00 60.29  ? 77  GLN B CD    1 
ATOM   3769 O  OE1   . GLN B 1 51  ? 17.022  -17.616 1.644  1.00 60.31  ? 77  GLN B OE1   1 
ATOM   3770 N  NE2   . GLN B 1 51  ? 14.795  -17.892 1.823  1.00 60.20  ? 77  GLN B NE2   1 
ATOM   3771 N  N     . GLN B 1 52  ? 16.857  -14.659 5.820  1.00 51.36  ? 78  GLN B N     1 
ATOM   3772 C  CA    . GLN B 1 52  ? 15.993  -13.647 6.427  1.00 51.08  ? 78  GLN B CA    1 
ATOM   3773 C  C     . GLN B 1 52  ? 16.628  -12.264 6.306  1.00 51.24  ? 78  GLN B C     1 
ATOM   3774 O  O     . GLN B 1 52  ? 15.930  -11.254 6.211  1.00 49.50  ? 78  GLN B O     1 
ATOM   3775 C  CB    . GLN B 1 52  ? 15.714  -13.994 7.892  1.00 46.32  ? 78  GLN B CB    1 
ATOM   3776 C  CG    . GLN B 1 52  ? 16.967  -14.268 8.703  1.00 49.61  ? 78  GLN B CG    1 
ATOM   3777 C  CD    . GLN B 1 52  ? 16.718  -15.163 9.901  1.00 54.30  ? 78  GLN B CD    1 
ATOM   3778 O  OE1   . GLN B 1 52  ? 17.640  -15.468 10.662 1.00 51.25  ? 78  GLN B OE1   1 
ATOM   3779 N  NE2   . GLN B 1 52  ? 15.471  -15.598 10.071 1.00 50.40  ? 78  GLN B NE2   1 
ATOM   3780 N  N     . LEU B 1 53  ? 17.958  -12.239 6.294  1.00 46.63  ? 79  LEU B N     1 
ATOM   3781 C  CA    . LEU B 1 53  ? 18.727  -11.028 6.037  1.00 38.47  ? 79  LEU B CA    1 
ATOM   3782 C  C     . LEU B 1 53  ? 18.451  -10.497 4.639  1.00 41.17  ? 79  LEU B C     1 
ATOM   3783 O  O     . LEU B 1 53  ? 18.307  -9.298  4.448  1.00 49.84  ? 79  LEU B O     1 
ATOM   3784 C  CB    . LEU B 1 53  ? 20.219  -11.304 6.197  1.00 38.43  ? 79  LEU B CB    1 
ATOM   3785 C  CG    . LEU B 1 53  ? 21.152  -10.125 5.943  1.00 38.44  ? 79  LEU B CG    1 
ATOM   3786 C  CD1   . LEU B 1 53  ? 21.065  -9.131  7.085  1.00 45.91  ? 79  LEU B CD1   1 
ATOM   3787 C  CD2   . LEU B 1 53  ? 22.582  -10.593 5.742  1.00 43.04  ? 79  LEU B CD2   1 
ATOM   3788 N  N     . ARG B 1 54  ? 18.407  -11.401 3.667  1.00 48.18  ? 80  ARG B N     1 
ATOM   3789 C  CA    . ARG B 1 54  ? 18.091  -11.068 2.283  1.00 40.48  ? 80  ARG B CA    1 
ATOM   3790 C  C     . ARG B 1 54  ? 16.678  -10.512 2.146  1.00 41.45  ? 80  ARG B C     1 
ATOM   3791 O  O     . ARG B 1 54  ? 16.454  -9.487  1.491  1.00 48.79  ? 80  ARG B O     1 
ATOM   3792 C  CB    . ARG B 1 54  ? 18.239  -12.306 1.404  1.00 40.71  ? 80  ARG B CB    1 
ATOM   3793 C  CG    . ARG B 1 54  ? 19.333  -12.235 0.368  1.00 46.12  ? 80  ARG B CG    1 
ATOM   3794 C  CD    . ARG B 1 54  ? 19.358  -13.518 -0.460 1.00 40.62  ? 80  ARG B CD    1 
ATOM   3795 N  NE    . ARG B 1 54  ? 20.136  -14.570 0.187  1.00 33.45  ? 80  ARG B NE    1 
ATOM   3796 C  CZ    . ARG B 1 54  ? 19.678  -15.791 0.429  1.00 34.78  ? 80  ARG B CZ    1 
ATOM   3797 N  NH1   . ARG B 1 54  ? 18.445  -16.121 0.071  1.00 39.09  ? 80  ARG B NH1   1 
ATOM   3798 N  NH2   . ARG B 1 54  ? 20.454  -16.680 1.027  1.00 36.16  ? 80  ARG B NH2   1 
ATOM   3799 N  N     . LYS B 1 55  ? 15.724  -11.215 2.753  1.00 44.52  ? 81  LYS B N     1 
ATOM   3800 C  CA    . LYS B 1 55  ? 14.323  -10.795 2.723  1.00 52.57  ? 81  LYS B CA    1 
ATOM   3801 C  C     . LYS B 1 55  ? 14.200  -9.385  3.309  1.00 56.46  ? 81  LYS B C     1 
ATOM   3802 O  O     . LYS B 1 55  ? 13.531  -8.480  2.752  1.00 60.21  ? 81  LYS B O     1 
ATOM   3803 C  CB    . LYS B 1 55  ? 13.468  -11.802 3.497  1.00 50.59  ? 81  LYS B CB    1 
ATOM   3804 C  CG    . LYS B 1 55  ? 11.968  -11.577 3.416  1.00 62.16  ? 81  LYS B CG    1 
ATOM   3805 C  CD    . LYS B 1 55  ? 11.213  -12.705 4.109  1.00 67.06  ? 81  LYS B CD    1 
ATOM   3806 C  CE    . LYS B 1 55  ? 11.314  -12.605 5.629  1.00 80.44  ? 81  LYS B CE    1 
ATOM   3807 N  NZ    . LYS B 1 55  ? 10.042  -12.115 6.246  1.00 80.96  ? 81  LYS B NZ    1 
ATOM   3808 N  N     . ALA B 1 56  ? 14.895  -9.212  4.428  1.00 51.30  ? 82  ALA B N     1 
ATOM   3809 C  CA    . ALA B 1 56  ? 15.010  -7.930  5.090  1.00 47.65  ? 82  ALA B CA    1 
ATOM   3810 C  C     . ALA B 1 56  ? 15.504  -6.876  4.114  1.00 46.25  ? 82  ALA B C     1 
ATOM   3811 O  O     . ALA B 1 56  ? 14.808  -5.901  3.868  1.00 54.58  ? 82  ALA B O     1 
ATOM   3812 C  CB    . ALA B 1 56  ? 15.944  -8.030  6.285  1.00 48.16  ? 82  ALA B CB    1 
ATOM   3813 N  N     . GLN B 1 57  ? 16.695  -7.079  3.558  1.00 39.63  ? 83  GLN B N     1 
ATOM   3814 C  CA    . GLN B 1 57  ? 17.277  -6.138  2.605  1.00 48.04  ? 83  GLN B CA    1 
ATOM   3815 C  C     . GLN B 1 57  ? 16.314  -5.769  1.477  1.00 47.68  ? 83  GLN B C     1 
ATOM   3816 O  O     . GLN B 1 57  ? 16.275  -4.618  1.043  1.00 52.79  ? 83  GLN B O     1 
ATOM   3817 C  CB    . GLN B 1 57  ? 18.573  -6.700  2.020  1.00 46.34  ? 83  GLN B CB    1 
ATOM   3818 C  CG    . GLN B 1 57  ? 19.305  -5.723  1.109  1.00 47.07  ? 83  GLN B CG    1 
ATOM   3819 C  CD    . GLN B 1 57  ? 20.438  -4.998  1.812  1.00 47.98  ? 83  GLN B CD    1 
ATOM   3820 O  OE1   . GLN B 1 57  ? 20.274  -4.491  2.918  1.00 58.52  ? 83  GLN B OE1   1 
ATOM   3821 N  NE2   . GLN B 1 57  ? 21.600  -4.954  1.173  1.00 55.37  ? 83  GLN B NE2   1 
ATOM   3822 N  N     . LEU B 1 58  ? 15.539  -6.742  1.006  1.00 47.81  ? 84  LEU B N     1 
ATOM   3823 C  CA    . LEU B 1 58  ? 14.549  -6.462  -0.035 1.00 54.75  ? 84  LEU B CA    1 
ATOM   3824 C  C     . LEU B 1 58  ? 13.464  -5.492  0.446  1.00 52.33  ? 84  LEU B C     1 
ATOM   3825 O  O     . LEU B 1 58  ? 13.232  -4.434  -0.177 1.00 56.94  ? 84  LEU B O     1 
ATOM   3826 C  CB    . LEU B 1 58  ? 13.903  -7.763  -0.529 1.00 52.91  ? 84  LEU B CB    1 
ATOM   3827 N  N     . GLN B 1 59  ? 12.819  -5.834  1.562  1.00 50.22  ? 85  GLN B N     1 
ATOM   3828 C  CA    . GLN B 1 59  ? 11.753  -4.969  2.091  1.00 56.39  ? 85  GLN B CA    1 
ATOM   3829 C  C     . GLN B 1 59  ? 12.272  -3.559  2.435  1.00 54.26  ? 85  GLN B C     1 
ATOM   3830 O  O     . GLN B 1 59  ? 11.711  -2.542  1.993  1.00 52.53  ? 85  GLN B O     1 
ATOM   3831 C  CB    . GLN B 1 59  ? 11.096  -5.623  3.311  1.00 54.82  ? 85  GLN B CB    1 
ATOM   3832 C  CG    . GLN B 1 59  ? 10.299  -6.875  2.953  1.00 63.98  ? 85  GLN B CG    1 
ATOM   3833 C  CD    . GLN B 1 59  ? 9.689   -7.574  4.158  1.00 77.00  ? 85  GLN B CD    1 
ATOM   3834 O  OE1   . GLN B 1 59  ? 10.390  -7.946  5.103  1.00 76.71  ? 85  GLN B OE1   1 
ATOM   3835 N  NE2   . GLN B 1 59  ? 8.371   -7.761  4.125  1.00 76.13  ? 85  GLN B NE2   1 
ATOM   3836 N  N     . VAL B 1 60  ? 13.332  -3.519  3.236  1.00 48.22  ? 86  VAL B N     1 
ATOM   3837 C  CA    . VAL B 1 60  ? 14.053  -2.295  3.565  1.00 52.22  ? 86  VAL B CA    1 
ATOM   3838 C  C     . VAL B 1 60  ? 14.354  -1.448  2.329  1.00 53.69  ? 86  VAL B C     1 
ATOM   3839 O  O     . VAL B 1 60  ? 14.104  -0.247  2.334  1.00 48.74  ? 86  VAL B O     1 
ATOM   3840 C  CB    . VAL B 1 60  ? 15.375  -2.600  4.283  1.00 47.20  ? 86  VAL B CB    1 
ATOM   3841 C  CG1   . VAL B 1 60  ? 16.253  -1.366  4.315  1.00 46.14  ? 86  VAL B CG1   1 
ATOM   3842 C  CG2   . VAL B 1 60  ? 15.102  -3.054  5.684  1.00 49.99  ? 86  VAL B CG2   1 
ATOM   3843 N  N     . ASP B 1 61  ? 14.891  -2.059  1.276  1.00 51.83  ? 87  ASP B N     1 
ATOM   3844 C  CA    . ASP B 1 61  ? 15.184  -1.298  0.066  1.00 49.96  ? 87  ASP B CA    1 
ATOM   3845 C  C     . ASP B 1 61  ? 13.918  -0.771  -0.594 1.00 49.02  ? 87  ASP B C     1 
ATOM   3846 O  O     . ASP B 1 61  ? 13.933  0.317   -1.168 1.00 50.42  ? 87  ASP B O     1 
ATOM   3847 C  CB    . ASP B 1 61  ? 15.987  -2.134  -0.931 1.00 51.07  ? 87  ASP B CB    1 
ATOM   3848 C  CG    . ASP B 1 61  ? 17.466  -2.195  -0.580 1.00 59.48  ? 87  ASP B CG    1 
ATOM   3849 O  OD1   . ASP B 1 61  ? 18.020  -1.151  -0.169 1.00 55.67  ? 87  ASP B OD1   1 
ATOM   3850 O  OD2   . ASP B 1 61  ? 18.077  -3.277  -0.737 1.00 67.32  ? 87  ASP B OD2   1 
ATOM   3851 N  N     . ARG B 1 62  ? 12.827  -1.529  -0.519 1.00 48.00  ? 88  ARG B N     1 
ATOM   3852 C  CA    . ARG B 1 62  ? 11.557  -1.021  -1.041 1.00 51.68  ? 88  ARG B CA    1 
ATOM   3853 C  C     . ARG B 1 62  ? 11.137  0.255   -0.299 1.00 53.94  ? 88  ARG B C     1 
ATOM   3854 O  O     . ARG B 1 62  ? 10.815  1.297   -0.914 1.00 61.25  ? 88  ARG B O     1 
ATOM   3855 C  CB    . ARG B 1 62  ? 10.462  -2.084  -0.926 1.00 52.66  ? 88  ARG B CB    1 
ATOM   3856 N  N     . PHE B 1 63  ? 11.170  0.171   1.029  1.00 53.49  ? 89  PHE B N     1 
ATOM   3857 C  CA    . PHE B 1 63  ? 10.781  1.295   1.875  1.00 54.49  ? 89  PHE B CA    1 
ATOM   3858 C  C     . PHE B 1 63  ? 11.662  2.516   1.620  1.00 54.79  ? 89  PHE B C     1 
ATOM   3859 O  O     . PHE B 1 63  ? 11.167  3.631   1.437  1.00 60.59  ? 89  PHE B O     1 
ATOM   3860 C  CB    . PHE B 1 63  ? 10.855  0.904   3.355  1.00 56.19  ? 89  PHE B CB    1 
ATOM   3861 C  CG    . PHE B 1 63  ? 10.424  1.999   4.293  1.00 55.95  ? 89  PHE B CG    1 
ATOM   3862 C  CD1   . PHE B 1 63  ? 9.077   2.289   4.472  1.00 57.77  ? 89  PHE B CD1   1 
ATOM   3863 C  CD2   . PHE B 1 63  ? 11.364  2.754   4.978  1.00 50.26  ? 89  PHE B CD2   1 
ATOM   3864 C  CE1   . PHE B 1 63  ? 8.679   3.303   5.323  1.00 56.47  ? 89  PHE B CE1   1 
ATOM   3865 C  CE2   . PHE B 1 63  ? 10.974  3.768   5.826  1.00 51.30  ? 89  PHE B CE2   1 
ATOM   3866 C  CZ    . PHE B 1 63  ? 9.630   4.044   5.999  1.00 58.52  ? 89  PHE B CZ    1 
ATOM   3867 N  N     . ALA B 1 64  ? 12.970  2.290   1.608  1.00 48.08  ? 90  ALA B N     1 
ATOM   3868 C  CA    . ALA B 1 64  ? 13.950  3.331   1.327  1.00 46.39  ? 90  ALA B CA    1 
ATOM   3869 C  C     . ALA B 1 64  ? 13.674  3.985   -0.020 1.00 57.48  ? 90  ALA B C     1 
ATOM   3870 O  O     . ALA B 1 64  ? 13.775  5.207   -0.163 1.00 57.60  ? 90  ALA B O     1 
ATOM   3871 C  CB    . ALA B 1 64  ? 15.356  2.761   1.360  1.00 39.77  ? 90  ALA B CB    1 
ATOM   3872 N  N     . MET B 1 65  ? 13.340  3.165   -1.011 1.00 60.77  ? 91  MET B N     1 
ATOM   3873 C  CA    . MET B 1 65  ? 12.954  3.687   -2.315 1.00 63.20  ? 91  MET B CA    1 
ATOM   3874 C  C     . MET B 1 65  ? 11.788  4.660   -2.155 1.00 65.04  ? 91  MET B C     1 
ATOM   3875 O  O     . MET B 1 65  ? 11.814  5.770   -2.699 1.00 64.74  ? 91  MET B O     1 
ATOM   3876 C  CB    . MET B 1 65  ? 12.578  2.557   -3.278 1.00 63.63  ? 91  MET B CB    1 
ATOM   3877 C  CG    . MET B 1 65  ? 12.109  3.050   -4.645 1.00 72.62  ? 91  MET B CG    1 
ATOM   3878 S  SD    . MET B 1 65  ? 10.536  2.325   -5.145 1.00 102.13 ? 91  MET B SD    1 
ATOM   3879 C  CE    . MET B 1 65  ? 10.821  0.584   -4.816 1.00 75.93  ? 91  MET B CE    1 
ATOM   3880 N  N     . GLU B 1 66  ? 10.766  4.246   -1.408 1.00 60.78  ? 92  GLU B N     1 
ATOM   3881 C  CA    . GLU B 1 66  ? 9.649   5.158   -1.126 1.00 61.77  ? 92  GLU B CA    1 
ATOM   3882 C  C     . GLU B 1 66  ? 10.103  6.476   -0.473 1.00 62.45  ? 92  GLU B C     1 
ATOM   3883 O  O     . GLU B 1 66  ? 9.616   7.567   -0.824 1.00 66.52  ? 92  GLU B O     1 
ATOM   3884 C  CB    . GLU B 1 66  ? 8.607   4.466   -0.243 1.00 67.25  ? 92  GLU B CB    1 
ATOM   3885 C  CG    . GLU B 1 66  ? 7.881   3.327   -0.950 1.00 78.65  ? 92  GLU B CG    1 
ATOM   3886 C  CD    . GLU B 1 66  ? 6.980   2.521   -0.026 1.00 79.61  ? 92  GLU B CD    1 
ATOM   3887 O  OE1   . GLU B 1 66  ? 6.297   3.130   0.828  1.00 83.55  ? 92  GLU B OE1   1 
ATOM   3888 O  OE2   . GLU B 1 66  ? 6.964   1.275   -0.159 1.00 72.14  ? 92  GLU B OE2   1 
ATOM   3889 N  N     . LEU B 1 67  ? 11.049  6.377   0.461  1.00 58.14  ? 93  LEU B N     1 
ATOM   3890 C  CA    . LEU B 1 67  ? 11.580  7.568   1.131  1.00 54.99  ? 93  LEU B CA    1 
ATOM   3891 C  C     . LEU B 1 67  ? 12.258  8.525   0.158  1.00 58.16  ? 93  LEU B C     1 
ATOM   3892 O  O     . LEU B 1 67  ? 11.836  9.673   0.027  1.00 59.40  ? 93  LEU B O     1 
ATOM   3893 C  CB    . LEU B 1 67  ? 12.568  7.189   2.237  1.00 54.36  ? 93  LEU B CB    1 
ATOM   3894 C  CG    . LEU B 1 67  ? 12.007  6.532   3.499  1.00 49.59  ? 93  LEU B CG    1 
ATOM   3895 C  CD1   . LEU B 1 67  ? 13.111  6.346   4.523  1.00 41.89  ? 93  LEU B CD1   1 
ATOM   3896 C  CD2   . LEU B 1 67  ? 10.853  7.342   4.074  1.00 40.69  ? 93  LEU B CD2   1 
ATOM   3897 N  N     . GLU B 1 68  ? 13.315  8.061   -0.508 1.00 61.51  ? 94  GLU B N     1 
ATOM   3898 C  CA    . GLU B 1 68  ? 14.043  8.890   -1.477 1.00 56.21  ? 94  GLU B CA    1 
ATOM   3899 C  C     . GLU B 1 68  ? 13.096  9.414   -2.553 1.00 56.01  ? 94  GLU B C     1 
ATOM   3900 O  O     . GLU B 1 68  ? 13.332  10.461  -3.161 1.00 51.92  ? 94  GLU B O     1 
ATOM   3901 C  CB    . GLU B 1 68  ? 15.196  8.103   -2.106 1.00 47.31  ? 94  GLU B CB    1 
ATOM   3902 C  CG    . GLU B 1 68  ? 15.883  8.811   -3.264 1.00 48.72  ? 94  GLU B CG    1 
ATOM   3903 C  CD    . GLU B 1 68  ? 16.966  9.779   -2.823 1.00 51.97  ? 94  GLU B CD    1 
ATOM   3904 O  OE1   . GLU B 1 68  ? 17.794  9.396   -1.972 1.00 54.22  ? 94  GLU B OE1   1 
ATOM   3905 O  OE2   . GLU B 1 68  ? 17.001  10.917  -3.346 1.00 41.16  ? 94  GLU B OE2   1 
ATOM   3906 N  N     . GLN B 1 69  ? 12.002  8.687   -2.757 1.00 62.40  ? 95  GLN B N     1 
ATOM   3907 C  CA    . GLN B 1 69  ? 10.950  9.122   -3.664 1.00 64.79  ? 95  GLN B CA    1 
ATOM   3908 C  C     . GLN B 1 69  ? 10.269  10.362  -3.086 1.00 62.60  ? 95  GLN B C     1 
ATOM   3909 O  O     . GLN B 1 69  ? 9.999   11.324  -3.809 1.00 59.99  ? 95  GLN B O     1 
ATOM   3910 C  CB    . GLN B 1 69  ? 9.937   7.998   -3.876 1.00 69.89  ? 95  GLN B CB    1 
ATOM   3911 C  CG    . GLN B 1 69  ? 9.022   8.149   -5.076 1.00 76.03  ? 95  GLN B CG    1 
ATOM   3912 C  CD    . GLN B 1 69  ? 7.974   7.048   -5.128 1.00 80.81  ? 95  GLN B CD    1 
ATOM   3913 O  OE1   . GLN B 1 69  ? 8.101   6.085   -5.887 1.00 84.33  ? 95  GLN B OE1   1 
ATOM   3914 N  NE2   . GLN B 1 69  ? 6.938   7.180   -4.304 1.00 75.06  ? 95  GLN B NE2   1 
ATOM   3915 N  N     . SER B 1 70  ? 10.010  10.341  -1.776 1.00 62.29  ? 96  SER B N     1 
ATOM   3916 C  CA    . SER B 1 70  ? 9.338   11.469  -1.104 1.00 55.06  ? 96  SER B CA    1 
ATOM   3917 C  C     . SER B 1 70  ? 10.232  12.671  -0.710 1.00 52.62  ? 96  SER B C     1 
ATOM   3918 O  O     . SER B 1 70  ? 9.754   13.606  -0.062 1.00 52.61  ? 96  SER B O     1 
ATOM   3919 C  CB    . SER B 1 70  ? 8.612   10.966  0.152  1.00 59.18  ? 96  SER B CB    1 
ATOM   3920 O  OG    . SER B 1 70  ? 9.506   10.764  1.237  1.00 62.79  ? 96  SER B OG    1 
ATOM   3921 N  N     . ARG B 1 71  ? 11.508  12.657  -1.092 1.00 46.08  ? 97  ARG B N     1 
ATOM   3922 C  CA    . ARG B 1 71  ? 12.437  13.722  -0.684 1.00 46.41  ? 97  ARG B CA    1 
ATOM   3923 C  C     . ARG B 1 71  ? 12.031  15.127  -1.147 1.00 47.01  ? 97  ARG B C     1 
ATOM   3924 O  O     . ARG B 1 71  ? 11.636  15.319  -2.296 1.00 56.00  ? 97  ARG B O     1 
ATOM   3925 C  CB    . ARG B 1 71  ? 13.847  13.428  -1.194 1.00 41.56  ? 97  ARG B CB    1 
ATOM   3926 C  CG    . ARG B 1 71  ? 14.840  14.546  -0.900 1.00 38.33  ? 97  ARG B CG    1 
ATOM   3927 C  CD    . ARG B 1 71  ? 16.225  14.185  -1.389 1.00 40.12  ? 97  ARG B CD    1 
ATOM   3928 N  NE    . ARG B 1 71  ? 16.618  12.869  -0.906 1.00 52.63  ? 97  ARG B NE    1 
ATOM   3929 C  CZ    . ARG B 1 71  ? 17.722  12.621  -0.210 1.00 53.16  ? 97  ARG B CZ    1 
ATOM   3930 N  NH1   . ARG B 1 71  ? 18.565  13.605  0.088  1.00 52.80  ? 97  ARG B NH1   1 
ATOM   3931 N  NH2   . ARG B 1 71  ? 17.984  11.383  0.182  1.00 44.96  ? 97  ARG B NH2   1 
ATOM   3932 N  N     . ASN B 1 72  ? 12.144  16.101  -0.244 1.00 55.26  ? 98  ASN B N     1 
ATOM   3933 C  CA    . ASN B 1 72  ? 11.834  17.502  -0.545 1.00 54.99  ? 98  ASN B CA    1 
ATOM   3934 C  C     . ASN B 1 72  ? 13.058  18.412  -0.363 1.00 53.63  ? 98  ASN B C     1 
ATOM   3935 O  O     . ASN B 1 72  ? 13.704  18.395  0.686  1.00 54.83  ? 98  ASN B O     1 
ATOM   3936 C  CB    . ASN B 1 72  ? 10.679  17.988  0.335  1.00 51.43  ? 98  ASN B CB    1 
ATOM   3937 C  CG    . ASN B 1 72  ? 10.111  19.324  -0.122 1.00 58.49  ? 98  ASN B CG    1 
ATOM   3938 O  OD1   . ASN B 1 72  ? 10.776  20.098  -0.812 1.00 62.28  ? 98  ASN B OD1   1 
ATOM   3939 N  ND2   . ASN B 1 72  ? 8.870   19.600  0.268  1.00 57.15  ? 98  ASN B ND2   1 
ATOM   3940 N  N     . LEU B 1 73  ? 13.371  19.207  -1.382 1.00 51.69  ? 99  LEU B N     1 
ATOM   3941 C  CA    . LEU B 1 73  ? 14.566  20.051  -1.347 1.00 52.73  ? 99  LEU B CA    1 
ATOM   3942 C  C     . LEU B 1 73  ? 14.233  21.536  -1.514 1.00 53.04  ? 99  LEU B C     1 
ATOM   3943 O  O     . LEU B 1 73  ? 15.128  22.383  -1.590 1.00 45.94  ? 99  LEU B O     1 
ATOM   3944 C  CB    . LEU B 1 73  ? 15.555  19.613  -2.431 1.00 53.61  ? 99  LEU B CB    1 
ATOM   3945 C  CG    . LEU B 1 73  ? 16.380  18.355  -2.141 1.00 50.36  ? 99  LEU B CG    1 
ATOM   3946 C  CD1   . LEU B 1 73  ? 17.429  18.120  -3.220 1.00 42.93  ? 99  LEU B CD1   1 
ATOM   3947 C  CD2   . LEU B 1 73  ? 17.026  18.447  -0.766 1.00 48.30  ? 99  LEU B CD2   1 
ATOM   3948 N  N     . SER B 1 74  ? 12.941  21.846  -1.561 1.00 53.32  ? 100 SER B N     1 
ATOM   3949 C  CA    . SER B 1 74  ? 12.490  23.190  -1.907 1.00 46.21  ? 100 SER B CA    1 
ATOM   3950 C  C     . SER B 1 74  ? 12.550  24.191  -0.755 1.00 54.72  ? 100 SER B C     1 
ATOM   3951 O  O     . SER B 1 74  ? 12.724  25.391  -0.980 1.00 57.85  ? 100 SER B O     1 
ATOM   3952 C  CB    . SER B 1 74  ? 11.059  23.134  -2.442 1.00 57.21  ? 100 SER B CB    1 
ATOM   3953 O  OG    . SER B 1 74  ? 10.147  22.812  -1.406 1.00 54.70  ? 100 SER B OG    1 
ATOM   3954 N  N     . ASN B 1 75  ? 12.413  23.706  0.476  1.00 60.43  ? 101 ASN B N     1 
ATOM   3955 C  CA    . ASN B 1 75  ? 12.345  24.596  1.635  1.00 49.15  ? 101 ASN B CA    1 
ATOM   3956 C  C     . ASN B 1 75  ? 13.712  24.989  2.177  1.00 43.22  ? 101 ASN B C     1 
ATOM   3957 O  O     . ASN B 1 75  ? 14.681  24.240  2.076  1.00 43.69  ? 101 ASN B O     1 
ATOM   3958 C  CB    . ASN B 1 75  ? 11.516  23.957  2.749  1.00 47.94  ? 101 ASN B CB    1 
ATOM   3959 C  CG    . ASN B 1 75  ? 10.039  23.895  2.412  1.00 53.64  ? 101 ASN B CG    1 
ATOM   3960 O  OD1   . ASN B 1 75  ? 9.252   24.724  2.870  1.00 52.51  ? 101 ASN B OD1   1 
ATOM   3961 N  ND2   . ASN B 1 75  ? 9.652   22.903  1.617  1.00 56.48  ? 101 ASN B ND2   1 
ATOM   3962 N  N     . THR B 1 76  ? 13.783  26.185  2.741  1.00 43.71  ? 102 THR B N     1 
ATOM   3963 C  CA    . THR B 1 76  ? 15.008  26.642  3.370  1.00 48.03  ? 102 THR B CA    1 
ATOM   3964 C  C     . THR B 1 76  ? 14.776  26.718  4.864  1.00 48.67  ? 102 THR B C     1 
ATOM   3965 O  O     . THR B 1 76  ? 13.948  27.496  5.345  1.00 46.13  ? 102 THR B O     1 
ATOM   3966 C  CB    . THR B 1 76  ? 15.470  28.013  2.844  1.00 53.41  ? 102 THR B CB    1 
ATOM   3967 O  OG1   . THR B 1 76  ? 15.466  28.011  1.409  1.00 57.96  ? 102 THR B OG1   1 
ATOM   3968 C  CG2   . THR B 1 76  ? 16.873  28.327  3.349  1.00 41.82  ? 102 THR B CG2   1 
ATOM   3969 N  N     . ILE B 1 77  ? 15.507  25.889  5.595  1.00 49.42  ? 103 ILE B N     1 
ATOM   3970 C  CA    . ILE B 1 77  ? 15.317  25.768  7.024  1.00 40.06  ? 103 ILE B CA    1 
ATOM   3971 C  C     . ILE B 1 77  ? 16.587  26.236  7.720  1.00 42.21  ? 103 ILE B C     1 
ATOM   3972 O  O     . ILE B 1 77  ? 17.705  25.878  7.325  1.00 38.77  ? 103 ILE B O     1 
ATOM   3973 C  CB    . ILE B 1 77  ? 14.975  24.323  7.429  1.00 39.84  ? 103 ILE B CB    1 
ATOM   3974 C  CG1   . ILE B 1 77  ? 13.661  23.877  6.781  1.00 41.52  ? 103 ILE B CG1   1 
ATOM   3975 C  CG2   . ILE B 1 77  ? 14.918  24.186  8.939  1.00 44.09  ? 103 ILE B CG2   1 
ATOM   3976 C  CD1   . ILE B 1 77  ? 12.458  24.683  7.209  1.00 43.70  ? 103 ILE B CD1   1 
ATOM   3977 N  N     . VAL B 1 78  ? 16.394  27.045  8.755  1.00 37.96  ? 104 VAL B N     1 
ATOM   3978 C  CA    . VAL B 1 78  ? 17.480  27.677  9.475  1.00 35.51  ? 104 VAL B CA    1 
ATOM   3979 C  C     . VAL B 1 78  ? 17.395  27.300  10.937 1.00 40.35  ? 104 VAL B C     1 
ATOM   3980 O  O     . VAL B 1 78  ? 16.317  27.271  11.506 1.00 42.41  ? 104 VAL B O     1 
ATOM   3981 C  CB    . VAL B 1 78  ? 17.419  29.208  9.342  1.00 40.29  ? 104 VAL B CB    1 
ATOM   3982 C  CG1   . VAL B 1 78  ? 18.534  29.875  10.145 1.00 39.31  ? 104 VAL B CG1   1 
ATOM   3983 C  CG2   . VAL B 1 78  ? 17.475  29.614  7.881  1.00 41.94  ? 104 VAL B CG2   1 
ATOM   3984 N  N     . HIS B 1 79  ? 18.532  27.020  11.555 1.00 34.26  ? 105 HIS B N     1 
ATOM   3985 C  CA    . HIS B 1 79  ? 18.541  26.744  12.977 1.00 34.42  ? 105 HIS B CA    1 
ATOM   3986 C  C     . HIS B 1 79  ? 19.486  27.711  13.649 1.00 42.86  ? 105 HIS B C     1 
ATOM   3987 O  O     . HIS B 1 79  ? 20.678  27.692  13.368 1.00 43.84  ? 105 HIS B O     1 
ATOM   3988 C  CB    . HIS B 1 79  ? 18.966  25.303  13.261 1.00 41.83  ? 105 HIS B CB    1 
ATOM   3989 C  CG    . HIS B 1 79  ? 18.995  24.961  14.719 1.00 43.84  ? 105 HIS B CG    1 
ATOM   3990 N  ND1   . HIS B 1 79  ? 20.166  24.779  15.420 1.00 45.80  ? 105 HIS B ND1   1 
ATOM   3991 C  CD2   . HIS B 1 79  ? 17.988  24.775  15.607 1.00 44.14  ? 105 HIS B CD2   1 
ATOM   3992 C  CE1   . HIS B 1 79  ? 19.882  24.497  16.681 1.00 46.71  ? 105 HIS B CE1   1 
ATOM   3993 N  NE2   . HIS B 1 79  ? 18.569  24.486  16.819 1.00 49.88  ? 105 HIS B NE2   1 
ATOM   3994 N  N     . ILE B 1 80  ? 18.957  28.539  14.548 1.00 43.91  ? 106 ILE B N     1 
ATOM   3995 C  CA    . ILE B 1 80  ? 19.793  29.481  15.277 1.00 38.43  ? 106 ILE B CA    1 
ATOM   3996 C  C     . ILE B 1 80  ? 19.981  29.015  16.709 1.00 37.15  ? 106 ILE B C     1 
ATOM   3997 O  O     . ILE B 1 80  ? 19.022  28.611  17.382 1.00 38.26  ? 106 ILE B O     1 
ATOM   3998 C  CB    . ILE B 1 80  ? 19.198  30.910  15.290 1.00 44.11  ? 106 ILE B CB    1 
ATOM   3999 C  CG1   . ILE B 1 80  ? 18.051  31.028  14.283 1.00 41.60  ? 106 ILE B CG1   1 
ATOM   4000 C  CG2   . ILE B 1 80  ? 20.298  31.953  15.071 1.00 40.26  ? 106 ILE B CG2   1 
ATOM   4001 C  CD1   . ILE B 1 80  ? 18.262  32.068  13.192 1.00 46.52  ? 106 ILE B CD1   1 
ATOM   4002 N  N     . ASP B 1 81  ? 21.226  29.103  17.162 1.00 32.50  ? 107 ASP B N     1 
ATOM   4003 C  CA    . ASP B 1 81  ? 21.635  28.613  18.463 1.00 41.95  ? 107 ASP B CA    1 
ATOM   4004 C  C     . ASP B 1 81  ? 22.565  29.630  19.110 1.00 46.64  ? 107 ASP B C     1 
ATOM   4005 O  O     . ASP B 1 81  ? 23.697  29.802  18.657 1.00 49.68  ? 107 ASP B O     1 
ATOM   4006 C  CB    . ASP B 1 81  ? 22.338  27.263  18.309 1.00 54.09  ? 107 ASP B CB    1 
ATOM   4007 C  CG    . ASP B 1 81  ? 22.346  26.449  19.584 1.00 54.30  ? 107 ASP B CG    1 
ATOM   4008 O  OD1   . ASP B 1 81  ? 22.483  27.039  20.678 1.00 51.04  ? 107 ASP B OD1   1 
ATOM   4009 O  OD2   . ASP B 1 81  ? 22.249  25.204  19.473 1.00 59.41  ? 107 ASP B OD2   1 
ATOM   4010 N  N     . MET B 1 82  ? 22.081  30.308  20.150 1.00 43.29  ? 108 MET B N     1 
ATOM   4011 C  CA    . MET B 1 82  ? 22.871  31.312  20.861 1.00 39.96  ? 108 MET B CA    1 
ATOM   4012 C  C     . MET B 1 82  ? 24.152  30.738  21.456 1.00 44.71  ? 108 MET B C     1 
ATOM   4013 O  O     . MET B 1 82  ? 24.138  29.671  22.062 1.00 51.79  ? 108 MET B O     1 
ATOM   4014 C  CB    . MET B 1 82  ? 22.037  31.958  21.965 1.00 43.30  ? 108 MET B CB    1 
ATOM   4015 C  CG    . MET B 1 82  ? 20.843  32.750  21.457 1.00 43.25  ? 108 MET B CG    1 
ATOM   4016 S  SD    . MET B 1 82  ? 21.329  34.224  20.522 1.00 53.19  ? 108 MET B SD    1 
ATOM   4017 C  CE    . MET B 1 82  ? 22.574  34.943  21.590 1.00 46.89  ? 108 MET B CE    1 
ATOM   4018 N  N     . ASP B 1 83  ? 25.254  31.465  21.308 1.00 44.32  ? 109 ASP B N     1 
ATOM   4019 C  CA    . ASP B 1 83  ? 26.550  30.955  21.739 1.00 46.10  ? 109 ASP B CA    1 
ATOM   4020 C  C     . ASP B 1 83  ? 26.778  31.098  23.238 1.00 47.53  ? 109 ASP B C     1 
ATOM   4021 O  O     . ASP B 1 83  ? 26.582  32.173  23.803 1.00 53.17  ? 109 ASP B O     1 
ATOM   4022 C  CB    . ASP B 1 83  ? 27.669  31.670  20.982 1.00 46.81  ? 109 ASP B CB    1 
ATOM   4023 C  CG    . ASP B 1 83  ? 27.578  31.473  19.473 1.00 54.54  ? 109 ASP B CG    1 
ATOM   4024 O  OD1   . ASP B 1 83  ? 27.183  30.369  19.024 1.00 54.76  ? 109 ASP B OD1   1 
ATOM   4025 O  OD2   . ASP B 1 83  ? 27.895  32.432  18.735 1.00 57.74  ? 109 ASP B OD2   1 
ATOM   4026 N  N     . ALA B 1 84  ? 27.205  30.004  23.868 1.00 49.66  ? 110 ALA B N     1 
ATOM   4027 C  CA    . ALA B 1 84  ? 27.434  29.933  25.316 1.00 49.27  ? 110 ALA B CA    1 
ATOM   4028 C  C     . ALA B 1 84  ? 26.390  30.681  26.151 1.00 50.87  ? 110 ALA B C     1 
ATOM   4029 O  O     . ALA B 1 84  ? 26.680  31.083  27.278 1.00 55.72  ? 110 ALA B O     1 
ATOM   4030 C  CB    . ALA B 1 84  ? 28.823  30.456  25.645 1.00 49.37  ? 110 ALA B CB    1 
ATOM   4031 N  N     . PHE B 1 85  ? 25.186  30.822  25.591 1.00 46.89  ? 111 PHE B N     1 
ATOM   4032 C  CA    . PHE B 1 85  ? 24.107  31.687  26.091 1.00 49.45  ? 111 PHE B CA    1 
ATOM   4033 C  C     . PHE B 1 85  ? 24.239  32.265  27.504 1.00 49.74  ? 111 PHE B C     1 
ATOM   4034 O  O     . PHE B 1 85  ? 24.699  33.393  27.657 1.00 50.48  ? 111 PHE B O     1 
ATOM   4035 C  CB    . PHE B 1 85  ? 22.768  30.953  26.011 1.00 48.42  ? 111 PHE B CB    1 
ATOM   4036 C  CG    . PHE B 1 85  ? 21.583  31.877  26.055 1.00 50.32  ? 111 PHE B CG    1 
ATOM   4037 C  CD1   . PHE B 1 85  ? 21.709  33.192  25.638 1.00 40.71  ? 111 PHE B CD1   1 
ATOM   4038 C  CD2   . PHE B 1 85  ? 20.357  31.445  26.531 1.00 51.01  ? 111 PHE B CD2   1 
ATOM   4039 C  CE1   . PHE B 1 85  ? 20.636  34.047  25.676 1.00 39.78  ? 111 PHE B CE1   1 
ATOM   4040 C  CE2   . PHE B 1 85  ? 19.274  32.302  26.570 1.00 41.67  ? 111 PHE B CE2   1 
ATOM   4041 C  CZ    . PHE B 1 85  ? 19.416  33.604  26.142 1.00 42.02  ? 111 PHE B CZ    1 
ATOM   4042 N  N     . TYR B 1 86  ? 23.801  31.511  28.513 1.00 45.40  ? 112 TYR B N     1 
ATOM   4043 C  CA    . TYR B 1 86  ? 23.789  31.981  29.902 1.00 45.29  ? 112 TYR B CA    1 
ATOM   4044 C  C     . TYR B 1 86  ? 25.084  32.717  30.266 1.00 44.71  ? 112 TYR B C     1 
ATOM   4045 O  O     . TYR B 1 86  ? 25.073  33.828  30.827 1.00 46.11  ? 112 TYR B O     1 
ATOM   4046 C  CB    . TYR B 1 86  ? 23.590  30.806  30.872 1.00 44.50  ? 112 TYR B CB    1 
ATOM   4047 C  CG    . TYR B 1 86  ? 22.219  30.141  30.889 1.00 45.13  ? 112 TYR B CG    1 
ATOM   4048 C  CD1   . TYR B 1 86  ? 21.912  29.184  31.861 1.00 47.89  ? 112 TYR B CD1   1 
ATOM   4049 C  CD2   . TYR B 1 86  ? 21.248  30.435  29.936 1.00 42.42  ? 112 TYR B CD2   1 
ATOM   4050 C  CE1   . TYR B 1 86  ? 20.675  28.552  31.898 1.00 41.00  ? 112 TYR B CE1   1 
ATOM   4051 C  CE2   . TYR B 1 86  ? 20.001  29.807  29.964 1.00 43.33  ? 112 TYR B CE2   1 
ATOM   4052 C  CZ    . TYR B 1 86  ? 19.723  28.865  30.950 1.00 46.28  ? 112 TYR B CZ    1 
ATOM   4053 O  OH    . TYR B 1 86  ? 18.495  28.233  30.994 1.00 43.75  ? 112 TYR B OH    1 
ATOM   4054 N  N     . ALA B 1 87  ? 26.200  32.101  29.893 1.00 46.51  ? 113 ALA B N     1 
ATOM   4055 C  CA    . ALA B 1 87  ? 27.518  32.617  30.231 1.00 50.93  ? 113 ALA B CA    1 
ATOM   4056 C  C     . ALA B 1 87  ? 27.837  33.875  29.437 1.00 52.78  ? 113 ALA B C     1 
ATOM   4057 O  O     . ALA B 1 87  ? 28.479  34.794  29.947 1.00 52.74  ? 113 ALA B O     1 
ATOM   4058 C  CB    . ALA B 1 87  ? 28.574  31.555  29.992 1.00 47.66  ? 113 ALA B CB    1 
ATOM   4059 N  N     . ALA B 1 88  ? 27.388  33.906  28.187 1.00 51.34  ? 114 ALA B N     1 
ATOM   4060 C  CA    . ALA B 1 88  ? 27.532  35.087  27.347 1.00 48.94  ? 114 ALA B CA    1 
ATOM   4061 C  C     . ALA B 1 88  ? 26.803  36.280  27.965 1.00 51.90  ? 114 ALA B C     1 
ATOM   4062 O  O     . ALA B 1 88  ? 27.339  37.388  28.014 1.00 56.67  ? 114 ALA B O     1 
ATOM   4063 C  CB    . ALA B 1 88  ? 27.013  34.807  25.949 1.00 48.83  ? 114 ALA B CB    1 
ATOM   4064 N  N     . VAL B 1 89  ? 25.579  36.052  28.436 1.00 47.80  ? 115 VAL B N     1 
ATOM   4065 C  CA    . VAL B 1 89  ? 24.810  37.114  29.076 1.00 43.21  ? 115 VAL B CA    1 
ATOM   4066 C  C     . VAL B 1 89  ? 25.509  37.571  30.344 1.00 47.50  ? 115 VAL B C     1 
ATOM   4067 O  O     . VAL B 1 89  ? 25.619  38.772  30.592 1.00 51.00  ? 115 VAL B O     1 
ATOM   4068 C  CB    . VAL B 1 89  ? 23.378  36.671  29.423 1.00 43.48  ? 115 VAL B CB    1 
ATOM   4069 C  CG1   . VAL B 1 89  ? 22.659  37.755  30.210 1.00 37.27  ? 115 VAL B CG1   1 
ATOM   4070 C  CG2   . VAL B 1 89  ? 22.607  36.335  28.159 1.00 43.63  ? 115 VAL B CG2   1 
ATOM   4071 N  N     . GLU B 1 90  ? 25.986  36.623  31.150 1.00 53.95  ? 116 GLU B N     1 
ATOM   4072 C  CA    . GLU B 1 90  ? 26.723  37.008  32.360 1.00 56.09  ? 116 GLU B CA    1 
ATOM   4073 C  C     . GLU B 1 90  ? 28.023  37.769  32.062 1.00 55.09  ? 116 GLU B C     1 
ATOM   4074 O  O     . GLU B 1 90  ? 28.498  38.548  32.892 1.00 56.94  ? 116 GLU B O     1 
ATOM   4075 C  CB    . GLU B 1 90  ? 27.026  35.779  33.226 1.00 47.01  ? 116 GLU B CB    1 
ATOM   4076 C  CG    . GLU B 1 90  ? 25.802  35.165  33.914 1.00 49.54  ? 116 GLU B CG    1 
ATOM   4077 C  CD    . GLU B 1 90  ? 24.906  36.189  34.609 1.00 51.80  ? 116 GLU B CD    1 
ATOM   4078 O  OE1   . GLU B 1 90  ? 25.425  37.209  35.122 1.00 55.96  ? 116 GLU B OE1   1 
ATOM   4079 O  OE2   . GLU B 1 90  ? 23.673  35.964  34.653 1.00 48.30  ? 116 GLU B OE2   1 
ATOM   4080 N  N     . MET B 1 91  ? 28.594  37.546  30.882 1.00 53.66  ? 117 MET B N     1 
ATOM   4081 C  CA    . MET B 1 91  ? 29.844  38.205  30.511 1.00 56.96  ? 117 MET B CA    1 
ATOM   4082 C  C     . MET B 1 91  ? 29.568  39.608  29.986 1.00 60.24  ? 117 MET B C     1 
ATOM   4083 O  O     . MET B 1 91  ? 30.361  40.531  30.188 1.00 57.78  ? 117 MET B O     1 
ATOM   4084 C  CB    . MET B 1 91  ? 30.610  37.382  29.474 1.00 55.09  ? 117 MET B CB    1 
ATOM   4085 C  CG    . MET B 1 91  ? 31.397  36.233  30.080 1.00 63.59  ? 117 MET B CG    1 
ATOM   4086 S  SD    . MET B 1 91  ? 32.014  35.061  28.863 1.00 58.02  ? 117 MET B SD    1 
ATOM   4087 C  CE    . MET B 1 91  ? 33.252  36.057  28.039 1.00 71.35  ? 117 MET B CE    1 
ATOM   4088 N  N     . ARG B 1 92  ? 28.440  39.752  29.296 1.00 55.60  ? 118 ARG B N     1 
ATOM   4089 C  CA    . ARG B 1 92  ? 28.006  41.038  28.763 1.00 53.90  ? 118 ARG B CA    1 
ATOM   4090 C  C     . ARG B 1 92  ? 27.814  42.088  29.861 1.00 58.38  ? 118 ARG B C     1 
ATOM   4091 O  O     . ARG B 1 92  ? 28.118  43.267  29.665 1.00 59.17  ? 118 ARG B O     1 
ATOM   4092 C  CB    . ARG B 1 92  ? 26.701  40.867  27.982 1.00 50.18  ? 118 ARG B CB    1 
ATOM   4093 C  CG    . ARG B 1 92  ? 26.107  42.162  27.466 1.00 44.63  ? 118 ARG B CG    1 
ATOM   4094 C  CD    . ARG B 1 92  ? 24.723  41.926  26.906 1.00 45.63  ? 118 ARG B CD    1 
ATOM   4095 N  NE    . ARG B 1 92  ? 23.738  41.744  27.966 1.00 46.32  ? 118 ARG B NE    1 
ATOM   4096 C  CZ    . ARG B 1 92  ? 22.428  41.653  27.764 1.00 50.31  ? 118 ARG B CZ    1 
ATOM   4097 N  NH1   . ARG B 1 92  ? 21.933  41.710  26.536 1.00 49.44  ? 118 ARG B NH1   1 
ATOM   4098 N  NH2   . ARG B 1 92  ? 21.608  41.496  28.793 1.00 52.93  ? 118 ARG B NH2   1 
ATOM   4099 N  N     . ASP B 1 93  ? 27.338  41.649  31.024 1.00 60.16  ? 119 ASP B N     1 
ATOM   4100 C  CA    . ASP B 1 93  ? 26.896  42.571  32.065 1.00 56.09  ? 119 ASP B CA    1 
ATOM   4101 C  C     . ASP B 1 93  ? 27.825  42.593  33.274 1.00 61.84  ? 119 ASP B C     1 
ATOM   4102 O  O     . ASP B 1 93  ? 27.525  43.223  34.287 1.00 66.46  ? 119 ASP B O     1 
ATOM   4103 C  CB    . ASP B 1 93  ? 25.475  42.209  32.505 1.00 53.94  ? 119 ASP B CB    1 
ATOM   4104 C  CG    . ASP B 1 93  ? 24.499  42.165  31.339 1.00 56.28  ? 119 ASP B CG    1 
ATOM   4105 O  OD1   . ASP B 1 93  ? 24.634  43.001  30.419 1.00 58.55  ? 119 ASP B OD1   1 
ATOM   4106 O  OD2   . ASP B 1 93  ? 23.602  41.293  31.335 1.00 54.84  ? 119 ASP B OD2   1 
ATOM   4107 N  N     . ASN B 1 94  ? 28.949  41.895  33.167 1.00 66.12  ? 120 ASN B N     1 
ATOM   4108 C  CA    . ASN B 1 94  ? 30.016  41.998  34.154 1.00 67.28  ? 120 ASN B CA    1 
ATOM   4109 C  C     . ASN B 1 94  ? 31.331  41.706  33.444 1.00 73.91  ? 120 ASN B C     1 
ATOM   4110 O  O     . ASN B 1 94  ? 31.795  40.566  33.432 1.00 71.92  ? 120 ASN B O     1 
ATOM   4111 C  CB    . ASN B 1 94  ? 29.787  41.039  35.327 1.00 70.90  ? 120 ASN B CB    1 
ATOM   4112 C  CG    . ASN B 1 94  ? 30.804  41.222  36.450 1.00 73.86  ? 120 ASN B CG    1 
ATOM   4113 O  OD1   . ASN B 1 94  ? 31.711  42.053  36.358 1.00 73.19  ? 120 ASN B OD1   1 
ATOM   4114 N  ND2   . ASN B 1 94  ? 30.652  40.440  37.519 1.00 69.17  ? 120 ASN B ND2   1 
ATOM   4115 N  N     . PRO B 1 95  ? 31.941  42.747  32.854 1.00 80.84  ? 121 PRO B N     1 
ATOM   4116 C  CA    . PRO B 1 95  ? 33.093  42.601  31.954 1.00 81.17  ? 121 PRO B CA    1 
ATOM   4117 C  C     . PRO B 1 95  ? 34.370  42.196  32.685 1.00 79.99  ? 121 PRO B C     1 
ATOM   4118 O  O     . PRO B 1 95  ? 35.352  41.827  32.041 1.00 81.32  ? 121 PRO B O     1 
ATOM   4119 C  CB    . PRO B 1 95  ? 33.235  43.998  31.330 1.00 82.63  ? 121 PRO B CB    1 
ATOM   4120 C  CG    . PRO B 1 95  ? 31.913  44.670  31.579 1.00 73.31  ? 121 PRO B CG    1 
ATOM   4121 C  CD    . PRO B 1 95  ? 31.464  44.137  32.903 1.00 71.40  ? 121 PRO B CD    1 
ATOM   4122 N  N     . GLU B 1 96  ? 34.350  42.249  34.014 1.00 74.51  ? 122 GLU B N     1 
ATOM   4123 C  CA    . GLU B 1 96  ? 35.470  41.771  34.823 1.00 75.96  ? 122 GLU B CA    1 
ATOM   4124 C  C     . GLU B 1 96  ? 35.619  40.248  34.723 1.00 76.18  ? 122 GLU B C     1 
ATOM   4125 O  O     . GLU B 1 96  ? 36.490  39.660  35.363 1.00 76.07  ? 122 GLU B O     1 
ATOM   4126 C  CB    . GLU B 1 96  ? 35.297  42.188  36.286 1.00 77.77  ? 122 GLU B CB    1 
ATOM   4127 N  N     . LEU B 1 97  ? 34.765  39.622  33.914 1.00 78.14  ? 123 LEU B N     1 
ATOM   4128 C  CA    . LEU B 1 97  ? 34.789  38.178  33.686 1.00 73.92  ? 123 LEU B CA    1 
ATOM   4129 C  C     . LEU B 1 97  ? 35.227  37.871  32.265 1.00 75.96  ? 123 LEU B C     1 
ATOM   4130 O  O     . LEU B 1 97  ? 35.615  36.744  31.957 1.00 76.34  ? 123 LEU B O     1 
ATOM   4131 C  CB    . LEU B 1 97  ? 33.409  37.557  33.914 1.00 67.57  ? 123 LEU B CB    1 
ATOM   4132 C  CG    . LEU B 1 97  ? 32.633  37.866  35.192 1.00 68.17  ? 123 LEU B CG    1 
ATOM   4133 C  CD1   . LEU B 1 97  ? 31.183  37.424  35.031 1.00 63.29  ? 123 LEU B CD1   1 
ATOM   4134 C  CD2   . LEU B 1 97  ? 33.274  37.202  36.398 1.00 72.01  ? 123 LEU B CD2   1 
ATOM   4135 N  N     . LYS B 1 98  ? 35.161  38.896  31.416 1.00 77.90  ? 124 LYS B N     1 
ATOM   4136 C  CA    . LYS B 1 98  ? 35.275  38.764  29.959 1.00 79.32  ? 124 LYS B CA    1 
ATOM   4137 C  C     . LYS B 1 98  ? 36.431  37.888  29.465 1.00 82.17  ? 124 LYS B C     1 
ATOM   4138 O  O     . LYS B 1 98  ? 36.300  37.202  28.448 1.00 84.36  ? 124 LYS B O     1 
ATOM   4139 C  CB    . LYS B 1 98  ? 35.406  40.153  29.324 1.00 81.43  ? 124 LYS B CB    1 
ATOM   4140 N  N     . ASP B 1 99  ? 37.554  37.909  30.179 1.00 81.91  ? 125 ASP B N     1 
ATOM   4141 C  CA    . ASP B 1 99  ? 38.729  37.148  29.760 1.00 85.08  ? 125 ASP B CA    1 
ATOM   4142 C  C     . ASP B 1 99  ? 39.022  35.962  30.677 1.00 85.55  ? 125 ASP B C     1 
ATOM   4143 O  O     . ASP B 1 99  ? 40.123  35.405  30.653 1.00 87.02  ? 125 ASP B O     1 
ATOM   4144 C  CB    . ASP B 1 99  ? 39.951  38.063  29.692 1.00 88.38  ? 125 ASP B CB    1 
ATOM   4145 C  CG    . ASP B 1 99  ? 39.913  38.993  28.489 1.00 95.05  ? 125 ASP B CG    1 
ATOM   4146 O  OD1   . ASP B 1 99  ? 40.738  39.933  28.437 1.00 97.34  ? 125 ASP B OD1   1 
ATOM   4147 O  OD2   . ASP B 1 99  ? 39.040  38.801  27.607 1.00 95.76  ? 125 ASP B OD2   1 
ATOM   4148 N  N     . LYS B 1 100 ? 38.030  35.567  31.468 1.00 82.71  ? 126 LYS B N     1 
ATOM   4149 C  CA    . LYS B 1 100 ? 38.235  34.558  32.499 1.00 80.71  ? 126 LYS B CA    1 
ATOM   4150 C  C     . LYS B 1 100 ? 37.381  33.322  32.227 1.00 83.15  ? 126 LYS B C     1 
ATOM   4151 O  O     . LYS B 1 100 ? 36.356  33.404  31.545 1.00 81.35  ? 126 LYS B O     1 
ATOM   4152 C  CB    . LYS B 1 100 ? 37.891  35.149  33.862 1.00 78.78  ? 126 LYS B CB    1 
ATOM   4153 C  CG    . LYS B 1 100 ? 38.771  36.322  34.251 1.00 78.25  ? 126 LYS B CG    1 
ATOM   4154 C  CD    . LYS B 1 100 ? 38.511  36.783  35.671 1.00 77.74  ? 126 LYS B CD    1 
ATOM   4155 C  CE    . LYS B 1 100 ? 39.469  37.907  36.053 1.00 84.87  ? 126 LYS B CE    1 
ATOM   4156 N  NZ    . LYS B 1 100 ? 39.319  38.348  37.476 1.00 79.49  ? 126 LYS B NZ    1 
ATOM   4157 N  N     . PRO B 1 101 ? 37.801  32.162  32.752 1.00 85.87  ? 127 PRO B N     1 
ATOM   4158 C  CA    . PRO B 1 101 ? 36.953  30.974  32.624 1.00 76.71  ? 127 PRO B CA    1 
ATOM   4159 C  C     . PRO B 1 101 ? 35.821  31.020  33.647 1.00 76.08  ? 127 PRO B C     1 
ATOM   4160 O  O     . PRO B 1 101 ? 36.067  31.100  34.851 1.00 77.82  ? 127 PRO B O     1 
ATOM   4161 C  CB    . PRO B 1 101 ? 37.923  29.823  32.897 1.00 76.58  ? 127 PRO B CB    1 
ATOM   4162 C  CG    . PRO B 1 101 ? 38.945  30.411  33.815 1.00 82.97  ? 127 PRO B CG    1 
ATOM   4163 C  CD    . PRO B 1 101 ? 39.087  31.862  33.405 1.00 84.66  ? 127 PRO B CD    1 
ATOM   4164 N  N     . ILE B 1 102 ? 34.585  30.987  33.161 1.00 72.33  ? 128 ILE B N     1 
ATOM   4165 C  CA    . ILE B 1 102 ? 33.421  31.073  34.034 1.00 67.87  ? 128 ILE B CA    1 
ATOM   4166 C  C     . ILE B 1 102 ? 32.426  29.960  33.746 1.00 60.81  ? 128 ILE B C     1 
ATOM   4167 O  O     . ILE B 1 102 ? 32.438  29.354  32.673 1.00 63.07  ? 128 ILE B O     1 
ATOM   4168 C  CB    . ILE B 1 102 ? 32.690  32.436  33.894 1.00 61.61  ? 128 ILE B CB    1 
ATOM   4169 C  CG1   . ILE B 1 102 ? 32.067  32.572  32.501 1.00 57.36  ? 128 ILE B CG1   1 
ATOM   4170 C  CG2   . ILE B 1 102 ? 33.639  33.594  34.174 1.00 59.90  ? 128 ILE B CG2   1 
ATOM   4171 C  CD1   . ILE B 1 102 ? 30.716  33.255  32.491 1.00 56.45  ? 128 ILE B CD1   1 
ATOM   4172 N  N     . ALA B 1 103 ? 31.565  29.692  34.719 1.00 55.91  ? 129 ALA B N     1 
ATOM   4173 C  CA    . ALA B 1 103 ? 30.463  28.764  34.517 1.00 51.98  ? 129 ALA B CA    1 
ATOM   4174 C  C     . ALA B 1 103 ? 29.189  29.259  35.192 1.00 48.39  ? 129 ALA B C     1 
ATOM   4175 O  O     . ALA B 1 103 ? 29.219  29.712  36.335 1.00 48.73  ? 129 ALA B O     1 
ATOM   4176 C  CB    . ALA B 1 103 ? 30.830  27.380  35.034 1.00 56.75  ? 129 ALA B CB    1 
ATOM   4177 N  N     . VAL B 1 104 ? 28.070  29.176  34.483 1.00 45.67  ? 130 VAL B N     1 
ATOM   4178 C  CA    . VAL B 1 104 ? 26.785  29.496  35.079 1.00 46.88  ? 130 VAL B CA    1 
ATOM   4179 C  C     . VAL B 1 104 ? 26.189  28.230  35.677 1.00 43.82  ? 130 VAL B C     1 
ATOM   4180 O  O     . VAL B 1 104 ? 25.892  27.263  34.962 1.00 44.46  ? 130 VAL B O     1 
ATOM   4181 C  CB    . VAL B 1 104 ? 25.822  30.109  34.053 1.00 46.02  ? 130 VAL B CB    1 
ATOM   4182 C  CG1   . VAL B 1 104 ? 24.447  30.329  34.669 1.00 41.85  ? 130 VAL B CG1   1 
ATOM   4183 C  CG2   . VAL B 1 104 ? 26.394  31.412  33.522 1.00 40.32  ? 130 VAL B CG2   1 
ATOM   4184 N  N     . GLY B 1 105 ? 26.036  28.255  36.997 1.00 39.46  ? 131 GLY B N     1 
ATOM   4185 C  CA    . GLY B 1 105 ? 25.525  27.139  37.768 1.00 46.18  ? 131 GLY B CA    1 
ATOM   4186 C  C     . GLY B 1 105 ? 25.881  27.303  39.238 1.00 50.02  ? 131 GLY B C     1 
ATOM   4187 O  O     . GLY B 1 105 ? 26.058  28.424  39.713 1.00 49.87  ? 131 GLY B O     1 
ATOM   4188 N  N     . SER B 1 106 ? 25.969  26.190  39.962 1.00 51.90  ? 132 SER B N     1 
ATOM   4189 C  CA    . SER B 1 106 ? 26.420  26.194  41.354 1.00 51.14  ? 132 SER B CA    1 
ATOM   4190 C  C     . SER B 1 106 ? 27.545  25.192  41.541 1.00 51.91  ? 132 SER B C     1 
ATOM   4191 O  O     . SER B 1 106 ? 28.234  24.819  40.590 1.00 53.79  ? 132 SER B O     1 
ATOM   4192 C  CB    . SER B 1 106 ? 25.285  25.863  42.324 1.00 48.44  ? 132 SER B CB    1 
ATOM   4193 O  OG    . SER B 1 106 ? 24.617  24.672  41.948 1.00 50.41  ? 132 SER B OG    1 
ATOM   4194 N  N     . MET B 1 107 ? 27.733  24.766  42.782 1.00 49.94  ? 133 MET B N     1 
ATOM   4195 C  CA    . MET B 1 107 ? 28.658  23.687  43.077 1.00 52.52  ? 133 MET B CA    1 
ATOM   4196 C  C     . MET B 1 107 ? 27.971  22.375  42.742 1.00 54.69  ? 133 MET B C     1 
ATOM   4197 O  O     . MET B 1 107 ? 28.621  21.379  42.423 1.00 53.37  ? 133 MET B O     1 
ATOM   4198 C  CB    . MET B 1 107 ? 29.091  23.717  44.538 1.00 56.74  ? 133 MET B CB    1 
ATOM   4199 C  CG    . MET B 1 107 ? 30.112  24.800  44.828 1.00 60.09  ? 133 MET B CG    1 
ATOM   4200 S  SD    . MET B 1 107 ? 31.447  24.763  43.618 1.00 56.71  ? 133 MET B SD    1 
ATOM   4201 C  CE    . MET B 1 107 ? 32.809  24.127  44.594 1.00 61.33  ? 133 MET B CE    1 
ATOM   4202 N  N     . SER B 1 108 ? 26.644  22.382  42.819 1.00 51.89  ? 134 SER B N     1 
ATOM   4203 C  CA    . SER B 1 108 ? 25.877  21.177  42.572 1.00 40.96  ? 134 SER B CA    1 
ATOM   4204 C  C     . SER B 1 108 ? 25.882  20.841  41.096 1.00 52.38  ? 134 SER B C     1 
ATOM   4205 O  O     . SER B 1 108 ? 26.240  19.729  40.719 1.00 57.10  ? 134 SER B O     1 
ATOM   4206 C  CB    . SER B 1 108 ? 24.443  21.345  43.059 1.00 43.90  ? 134 SER B CB    1 
ATOM   4207 O  OG    . SER B 1 108 ? 24.409  22.057  44.279 1.00 71.05  ? 134 SER B OG    1 
ATOM   4208 N  N     . MET B 1 109 ? 25.500  21.807  40.263 1.00 49.90  ? 135 MET B N     1 
ATOM   4209 C  CA    . MET B 1 109 ? 25.351  21.567  38.830 1.00 40.84  ? 135 MET B CA    1 
ATOM   4210 C  C     . MET B 1 109 ? 25.661  22.814  38.019 1.00 48.13  ? 135 MET B C     1 
ATOM   4211 O  O     . MET B 1 109 ? 25.437  23.932  38.474 1.00 51.63  ? 135 MET B O     1 
ATOM   4212 C  CB    . MET B 1 109 ? 23.932  21.076  38.513 1.00 35.84  ? 135 MET B CB    1 
ATOM   4213 C  CG    . MET B 1 109 ? 23.741  20.537  37.094 1.00 45.54  ? 135 MET B CG    1 
ATOM   4214 S  SD    . MET B 1 109 ? 24.734  19.068  36.708 1.00 46.73  ? 135 MET B SD    1 
ATOM   4215 C  CE    . MET B 1 109 ? 24.551  18.073  38.186 1.00 41.72  ? 135 MET B CE    1 
ATOM   4216 N  N     . LEU B 1 110 ? 26.188  22.620  36.817 1.00 47.81  ? 136 LEU B N     1 
ATOM   4217 C  CA    . LEU B 1 110 ? 26.446  23.742  35.934 1.00 46.55  ? 136 LEU B CA    1 
ATOM   4218 C  C     . LEU B 1 110 ? 25.449  23.765  34.790 1.00 45.32  ? 136 LEU B C     1 
ATOM   4219 O  O     . LEU B 1 110 ? 25.341  22.802  34.035 1.00 48.04  ? 136 LEU B O     1 
ATOM   4220 C  CB    . LEU B 1 110 ? 27.871  23.690  35.392 1.00 46.75  ? 136 LEU B CB    1 
ATOM   4221 C  CG    . LEU B 1 110 ? 28.963  23.789  36.456 1.00 53.35  ? 136 LEU B CG    1 
ATOM   4222 C  CD1   . LEU B 1 110 ? 30.333  23.799  35.809 1.00 55.42  ? 136 LEU B CD1   1 
ATOM   4223 C  CD2   . LEU B 1 110 ? 28.772  25.021  37.322 1.00 48.08  ? 136 LEU B CD2   1 
ATOM   4224 N  N     . SER B 1 111 ? 24.719  24.871  34.670 1.00 52.93  ? 137 SER B N     1 
ATOM   4225 C  CA    . SER B 1 111 ? 23.853  25.089  33.518 1.00 51.47  ? 137 SER B CA    1 
ATOM   4226 C  C     . SER B 1 111 ? 24.697  25.136  32.251 1.00 52.19  ? 137 SER B C     1 
ATOM   4227 O  O     . SER B 1 111 ? 24.357  24.505  31.248 1.00 51.10  ? 137 SER B O     1 
ATOM   4228 C  CB    . SER B 1 111 ? 23.043  26.381  33.673 1.00 45.06  ? 137 SER B CB    1 
ATOM   4229 O  OG    . SER B 1 111 ? 21.933  26.190  34.531 1.00 53.17  ? 137 SER B OG    1 
ATOM   4230 N  N     . THR B 1 112 ? 25.812  25.860  32.309 1.00 51.83  ? 138 THR B N     1 
ATOM   4231 C  CA    . THR B 1 112 ? 26.705  25.943  31.152 1.00 45.60  ? 138 THR B CA    1 
ATOM   4232 C  C     . THR B 1 112 ? 28.030  26.610  31.493 1.00 47.26  ? 138 THR B C     1 
ATOM   4233 O  O     . THR B 1 112 ? 28.275  26.964  32.641 1.00 53.68  ? 138 THR B O     1 
ATOM   4234 C  CB    . THR B 1 112 ? 26.054  26.705  29.978 1.00 53.34  ? 138 THR B CB    1 
ATOM   4235 O  OG1   . THR B 1 112 ? 26.805  26.464  28.780 1.00 55.15  ? 138 THR B OG1   1 
ATOM   4236 C  CG2   . THR B 1 112 ? 25.997  28.201  30.264 1.00 51.29  ? 138 THR B CG2   1 
ATOM   4237 N  N     . SER B 1 113 ? 28.890  26.756  30.489 1.00 49.00  ? 139 SER B N     1 
ATOM   4238 C  CA    . SER B 1 113 ? 30.209  27.352  30.676 1.00 53.62  ? 139 SER B CA    1 
ATOM   4239 C  C     . SER B 1 113 ? 30.621  28.112  29.424 1.00 56.78  ? 139 SER B C     1 
ATOM   4240 O  O     . SER B 1 113 ? 30.092  27.864  28.341 1.00 56.17  ? 139 SER B O     1 
ATOM   4241 C  CB    . SER B 1 113 ? 31.249  26.278  31.003 1.00 59.39  ? 139 SER B CB    1 
ATOM   4242 O  OG    . SER B 1 113 ? 31.144  25.178  30.110 1.00 52.75  ? 139 SER B OG    1 
ATOM   4243 N  N     . ASN B 1 114 ? 31.555  29.047  29.565 1.00 56.57  ? 140 ASN B N     1 
ATOM   4244 C  CA    . ASN B 1 114 ? 32.093  29.724  28.393 1.00 59.33  ? 140 ASN B CA    1 
ATOM   4245 C  C     . ASN B 1 114 ? 33.124  28.834  27.710 1.00 67.91  ? 140 ASN B C     1 
ATOM   4246 O  O     . ASN B 1 114 ? 33.566  27.832  28.282 1.00 66.69  ? 140 ASN B O     1 
ATOM   4247 C  CB    . ASN B 1 114 ? 32.701  31.086  28.761 1.00 61.60  ? 140 ASN B CB    1 
ATOM   4248 C  CG    . ASN B 1 114 ? 33.885  30.981  29.714 1.00 67.72  ? 140 ASN B CG    1 
ATOM   4249 O  OD1   . ASN B 1 114 ? 34.392  29.898  29.991 1.00 70.77  ? 140 ASN B OD1   1 
ATOM   4250 N  ND2   . ASN B 1 114 ? 34.334  32.127  30.217 1.00 66.08  ? 140 ASN B ND2   1 
ATOM   4251 N  N     . TYR B 1 115 ? 33.499  29.192  26.486 1.00 69.51  ? 141 TYR B N     1 
ATOM   4252 C  CA    . TYR B 1 115 ? 34.447  28.390  25.711 1.00 66.53  ? 141 TYR B CA    1 
ATOM   4253 C  C     . TYR B 1 115 ? 35.826  28.434  26.382 1.00 74.10  ? 141 TYR B C     1 
ATOM   4254 O  O     . TYR B 1 115 ? 36.602  27.460  26.349 1.00 76.37  ? 141 TYR B O     1 
ATOM   4255 C  CB    . TYR B 1 115 ? 34.500  28.883  24.263 1.00 54.96  ? 141 TYR B CB    1 
ATOM   4256 C  CG    . TYR B 1 115 ? 33.245  28.564  23.471 1.00 60.85  ? 141 TYR B CG    1 
ATOM   4257 C  CD1   . TYR B 1 115 ? 32.027  29.155  23.797 1.00 60.97  ? 141 TYR B CD1   1 
ATOM   4258 C  CD2   . TYR B 1 115 ? 33.274  27.666  22.409 1.00 58.55  ? 141 TYR B CD2   1 
ATOM   4259 C  CE1   . TYR B 1 115 ? 30.874  28.870  23.081 1.00 59.20  ? 141 TYR B CE1   1 
ATOM   4260 C  CE2   . TYR B 1 115 ? 32.127  27.374  21.685 1.00 57.20  ? 141 TYR B CE2   1 
ATOM   4261 C  CZ    . TYR B 1 115 ? 30.930  27.978  22.027 1.00 59.85  ? 141 TYR B CZ    1 
ATOM   4262 O  OH    . TYR B 1 115 ? 29.785  27.694  21.312 1.00 56.45  ? 141 TYR B OH    1 
ATOM   4263 N  N     . HIS B 1 116 ? 36.094  29.568  27.025 1.00 73.21  ? 142 HIS B N     1 
ATOM   4264 C  CA    . HIS B 1 116 ? 37.299  29.765  27.824 1.00 74.45  ? 142 HIS B CA    1 
ATOM   4265 C  C     . HIS B 1 116 ? 37.487  28.672  28.877 1.00 72.38  ? 142 HIS B C     1 
ATOM   4266 O  O     . HIS B 1 116 ? 38.609  28.263  29.175 1.00 73.72  ? 142 HIS B O     1 
ATOM   4267 C  CB    . HIS B 1 116 ? 37.245  31.125  28.509 1.00 79.78  ? 142 HIS B CB    1 
ATOM   4268 C  CG    . HIS B 1 116 ? 38.474  31.949  28.313 1.00 90.55  ? 142 HIS B CG    1 
ATOM   4269 N  ND1   . HIS B 1 116 ? 38.476  33.136  27.600 1.00 89.75  ? 142 HIS B ND1   1 
ATOM   4270 C  CD2   . HIS B 1 116 ? 39.749  31.770  28.730 1.00 89.69  ? 142 HIS B CD2   1 
ATOM   4271 C  CE1   . HIS B 1 116 ? 39.689  33.644  27.594 1.00 87.99  ? 142 HIS B CE1   1 
ATOM   4272 N  NE2   . HIS B 1 116 ? 40.487  32.830  28.275 1.00 96.83  ? 142 HIS B NE2   1 
ATOM   4273 N  N     . ALA B 1 117 ? 36.377  28.193  29.429 1.00 68.28  ? 143 ALA B N     1 
ATOM   4274 C  CA    . ALA B 1 117 ? 36.415  27.141  30.437 1.00 70.22  ? 143 ALA B CA    1 
ATOM   4275 C  C     . ALA B 1 117 ? 36.202  25.794  29.772 1.00 72.98  ? 143 ALA B C     1 
ATOM   4276 O  O     . ALA B 1 117 ? 36.619  24.762  30.296 1.00 71.97  ? 143 ALA B O     1 
ATOM   4277 C  CB    . ALA B 1 117 ? 35.372  27.378  31.507 1.00 68.23  ? 143 ALA B CB    1 
ATOM   4278 N  N     . ARG B 1 118 ? 35.540  25.811  28.617 1.00 69.60  ? 144 ARG B N     1 
ATOM   4279 C  CA    . ARG B 1 118 ? 35.344  24.603  27.829 1.00 62.35  ? 144 ARG B CA    1 
ATOM   4280 C  C     . ARG B 1 118 ? 36.703  24.097  27.356 1.00 72.22  ? 144 ARG B C     1 
ATOM   4281 O  O     . ARG B 1 118 ? 36.837  22.960  26.903 1.00 73.75  ? 144 ARG B O     1 
ATOM   4282 C  CB    . ARG B 1 118 ? 34.436  24.876  26.637 1.00 59.97  ? 144 ARG B CB    1 
ATOM   4283 C  CG    . ARG B 1 118 ? 32.970  24.628  26.891 1.00 57.88  ? 144 ARG B CG    1 
ATOM   4284 C  CD    . ARG B 1 118 ? 32.146  25.250  25.765 1.00 58.59  ? 144 ARG B CD    1 
ATOM   4285 N  NE    . ARG B 1 118 ? 30.865  25.781  26.233 1.00 58.13  ? 144 ARG B NE    1 
ATOM   4286 C  CZ    . ARG B 1 118 ? 29.761  25.836  25.493 1.00 54.22  ? 144 ARG B CZ    1 
ATOM   4287 N  NH1   . ARG B 1 118 ? 29.783  25.398  24.245 1.00 47.85  ? 144 ARG B NH1   1 
ATOM   4288 N  NH2   . ARG B 1 118 ? 28.637  26.327  26.000 1.00 53.31  ? 144 ARG B NH2   1 
ATOM   4289 N  N     . ARG B 1 119 ? 37.711  24.963  27.458 1.00 79.61  ? 145 ARG B N     1 
ATOM   4290 C  CA    . ARG B 1 119 ? 39.080  24.587  27.109 1.00 81.94  ? 145 ARG B CA    1 
ATOM   4291 C  C     . ARG B 1 119 ? 39.713  23.782  28.257 1.00 78.52  ? 145 ARG B C     1 
ATOM   4292 O  O     . ARG B 1 119 ? 40.803  23.220  28.113 1.00 83.26  ? 145 ARG B O     1 
ATOM   4293 C  CB    . ARG B 1 119 ? 39.915  25.826  26.777 1.00 73.88  ? 145 ARG B CB    1 
ATOM   4294 N  N     . PHE B 1 120 ? 39.022  23.729  29.396 1.00 74.72  ? 146 PHE B N     1 
ATOM   4295 C  CA    . PHE B 1 120 ? 39.462  22.907  30.527 1.00 76.73  ? 146 PHE B CA    1 
ATOM   4296 C  C     . PHE B 1 120 ? 38.619  21.639  30.676 1.00 75.96  ? 146 PHE B C     1 
ATOM   4297 O  O     . PHE B 1 120 ? 38.743  20.915  31.667 1.00 76.80  ? 146 PHE B O     1 
ATOM   4298 C  CB    . PHE B 1 120 ? 39.405  23.692  31.842 1.00 78.25  ? 146 PHE B CB    1 
ATOM   4299 C  CG    . PHE B 1 120 ? 40.361  24.844  31.917 1.00 77.84  ? 146 PHE B CG    1 
ATOM   4300 C  CD1   . PHE B 1 120 ? 41.454  24.788  32.766 1.00 78.91  ? 146 PHE B CD1   1 
ATOM   4301 C  CD2   . PHE B 1 120 ? 40.164  25.985  31.156 1.00 83.83  ? 146 PHE B CD2   1 
ATOM   4302 C  CE1   . PHE B 1 120 ? 42.337  25.839  32.850 1.00 85.62  ? 146 PHE B CE1   1 
ATOM   4303 C  CE2   . PHE B 1 120 ? 41.050  27.046  31.231 1.00 85.16  ? 146 PHE B CE2   1 
ATOM   4304 C  CZ    . PHE B 1 120 ? 42.139  26.971  32.082 1.00 89.28  ? 146 PHE B CZ    1 
ATOM   4305 N  N     . GLY B 1 121 ? 37.760  21.372  29.696 1.00 73.57  ? 147 GLY B N     1 
ATOM   4306 C  CA    . GLY B 1 121 ? 36.903  20.198  29.736 1.00 74.71  ? 147 GLY B CA    1 
ATOM   4307 C  C     . GLY B 1 121 ? 35.635  20.448  30.539 1.00 75.77  ? 147 GLY B C     1 
ATOM   4308 O  O     . GLY B 1 121 ? 34.764  19.579  30.642 1.00 74.38  ? 147 GLY B O     1 
ATOM   4309 N  N     . VAL B 1 122 ? 35.543  21.646  31.111 1.00 73.01  ? 148 VAL B N     1 
ATOM   4310 C  CA    . VAL B 1 122 ? 34.378  22.082  31.873 1.00 66.78  ? 148 VAL B CA    1 
ATOM   4311 C  C     . VAL B 1 122 ? 33.171  22.240  30.950 1.00 62.44  ? 148 VAL B C     1 
ATOM   4312 O  O     . VAL B 1 122 ? 33.213  23.003  29.988 1.00 65.29  ? 148 VAL B O     1 
ATOM   4313 C  CB    . VAL B 1 122 ? 34.653  23.418  32.608 1.00 67.76  ? 148 VAL B CB    1 
ATOM   4314 C  CG1   . VAL B 1 122 ? 33.362  23.998  33.172 1.00 69.30  ? 148 VAL B CG1   1 
ATOM   4315 C  CG2   . VAL B 1 122 ? 35.680  23.220  33.714 1.00 64.99  ? 148 VAL B CG2   1 
ATOM   4316 N  N     . ARG B 1 123 ? 32.098  21.509  31.234 1.00 61.30  ? 149 ARG B N     1 
ATOM   4317 C  CA    . ARG B 1 123 ? 30.942  21.496  30.342 1.00 58.12  ? 149 ARG B CA    1 
ATOM   4318 C  C     . ARG B 1 123 ? 29.615  21.460  31.095 1.00 52.78  ? 149 ARG B C     1 
ATOM   4319 O  O     . ARG B 1 123 ? 29.571  21.170  32.292 1.00 46.97  ? 149 ARG B O     1 
ATOM   4320 C  CB    . ARG B 1 123 ? 31.023  20.298  29.388 1.00 49.51  ? 149 ARG B CB    1 
ATOM   4321 N  N     . ALA B 1 124 ? 28.540  21.779  30.378 1.00 45.97  ? 150 ALA B N     1 
ATOM   4322 C  CA    . ALA B 1 124 ? 27.184  21.664  30.903 1.00 44.82  ? 150 ALA B CA    1 
ATOM   4323 C  C     . ALA B 1 124 ? 26.917  20.265  31.467 1.00 50.41  ? 150 ALA B C     1 
ATOM   4324 O  O     . ALA B 1 124 ? 27.580  19.296  31.086 1.00 51.56  ? 150 ALA B O     1 
ATOM   4325 C  CB    . ALA B 1 124 ? 26.168  22.004  29.819 1.00 40.05  ? 150 ALA B CB    1 
ATOM   4326 N  N     . ALA B 1 125 ? 25.953  20.186  32.384 1.00 44.64  ? 151 ALA B N     1 
ATOM   4327 C  CA    . ALA B 1 125 ? 25.518  18.935  33.018 1.00 44.22  ? 151 ALA B CA    1 
ATOM   4328 C  C     . ALA B 1 125 ? 26.604  18.319  33.907 1.00 48.05  ? 151 ALA B C     1 
ATOM   4329 O  O     . ALA B 1 125 ? 26.454  17.199  34.404 1.00 44.60  ? 151 ALA B O     1 
ATOM   4330 C  CB    . ALA B 1 125 ? 25.051  17.927  31.964 1.00 40.32  ? 151 ALA B CB    1 
ATOM   4331 N  N     . MET B 1 126 ? 27.686  19.065  34.115 1.00 51.35  ? 152 MET B N     1 
ATOM   4332 C  CA    . MET B 1 126 ? 28.749  18.659  35.031 1.00 51.31  ? 152 MET B CA    1 
ATOM   4333 C  C     . MET B 1 126 ? 28.626  19.359  36.382 1.00 50.81  ? 152 MET B C     1 
ATOM   4334 O  O     . MET B 1 126 ? 28.342  20.556  36.441 1.00 46.65  ? 152 MET B O     1 
ATOM   4335 C  CB    . MET B 1 126 ? 30.125  18.953  34.428 1.00 49.70  ? 152 MET B CB    1 
ATOM   4336 C  CG    . MET B 1 126 ? 31.267  18.770  35.418 1.00 53.66  ? 152 MET B CG    1 
ATOM   4337 S  SD    . MET B 1 126 ? 32.883  19.182  34.753 1.00 72.20  ? 152 MET B SD    1 
ATOM   4338 C  CE    . MET B 1 126 ? 32.835  18.305  33.190 1.00 65.91  ? 152 MET B CE    1 
ATOM   4339 N  N     . PRO B 1 127 ? 28.825  18.609  37.478 1.00 52.03  ? 153 PRO B N     1 
ATOM   4340 C  CA    . PRO B 1 127 ? 28.825  19.220  38.810 1.00 54.54  ? 153 PRO B CA    1 
ATOM   4341 C  C     . PRO B 1 127 ? 29.896  20.303  38.947 1.00 55.45  ? 153 PRO B C     1 
ATOM   4342 O  O     . PRO B 1 127 ? 30.999  20.154  38.420 1.00 53.78  ? 153 PRO B O     1 
ATOM   4343 C  CB    . PRO B 1 127 ? 29.114  18.035  39.740 1.00 50.07  ? 153 PRO B CB    1 
ATOM   4344 C  CG    . PRO B 1 127 ? 28.642  16.849  38.982 1.00 53.02  ? 153 PRO B CG    1 
ATOM   4345 C  CD    . PRO B 1 127 ? 28.946  17.143  37.544 1.00 52.09  ? 153 PRO B CD    1 
ATOM   4346 N  N     . GLY B 1 128 ? 29.557  21.383  39.646 1.00 54.37  ? 154 GLY B N     1 
ATOM   4347 C  CA    . GLY B 1 128 ? 30.475  22.481  39.880 1.00 53.48  ? 154 GLY B CA    1 
ATOM   4348 C  C     . GLY B 1 128 ? 31.785  22.079  40.530 1.00 58.01  ? 154 GLY B C     1 
ATOM   4349 O  O     . GLY B 1 128 ? 32.861  22.423  40.037 1.00 62.67  ? 154 GLY B O     1 
ATOM   4350 N  N     . PHE B 1 129 ? 31.698  21.369  41.652 1.00 57.03  ? 155 PHE B N     1 
ATOM   4351 C  CA    . PHE B 1 129 ? 32.889  21.001  42.416 1.00 63.51  ? 155 PHE B CA    1 
ATOM   4352 C  C     . PHE B 1 129 ? 33.886  20.178  41.600 1.00 65.07  ? 155 PHE B C     1 
ATOM   4353 O  O     . PHE B 1 129 ? 35.078  20.182  41.894 1.00 71.32  ? 155 PHE B O     1 
ATOM   4354 C  CB    . PHE B 1 129 ? 32.509  20.259  43.706 1.00 65.57  ? 155 PHE B CB    1 
ATOM   4355 C  CG    . PHE B 1 129 ? 31.915  18.885  43.497 1.00 68.33  ? 155 PHE B CG    1 
ATOM   4356 C  CD1   . PHE B 1 129 ? 32.692  17.748  43.671 1.00 67.31  ? 155 PHE B CD1   1 
ATOM   4357 C  CD2   . PHE B 1 129 ? 30.578  18.726  43.164 1.00 68.29  ? 155 PHE B CD2   1 
ATOM   4358 C  CE1   . PHE B 1 129 ? 32.153  16.483  43.502 1.00 61.46  ? 155 PHE B CE1   1 
ATOM   4359 C  CE2   . PHE B 1 129 ? 30.034  17.459  42.994 1.00 64.71  ? 155 PHE B CE2   1 
ATOM   4360 C  CZ    . PHE B 1 129 ? 30.823  16.339  43.162 1.00 57.10  ? 155 PHE B CZ    1 
ATOM   4361 N  N     . ILE B 1 130 ? 33.398  19.475  40.584 1.00 59.91  ? 156 ILE B N     1 
ATOM   4362 C  CA    . ILE B 1 130 ? 34.274  18.730  39.685 1.00 62.73  ? 156 ILE B CA    1 
ATOM   4363 C  C     . ILE B 1 130 ? 34.955  19.702  38.721 1.00 69.81  ? 156 ILE B C     1 
ATOM   4364 O  O     . ILE B 1 130 ? 36.171  19.631  38.476 1.00 73.22  ? 156 ILE B O     1 
ATOM   4365 C  CB    . ILE B 1 130 ? 33.498  17.663  38.884 1.00 62.16  ? 156 ILE B CB    1 
ATOM   4366 C  CG1   . ILE B 1 130 ? 32.811  16.676  39.831 1.00 62.02  ? 156 ILE B CG1   1 
ATOM   4367 C  CG2   . ILE B 1 130 ? 34.422  16.947  37.906 1.00 60.83  ? 156 ILE B CG2   1 
ATOM   4368 C  CD1   . ILE B 1 130 ? 32.019  15.591  39.121 1.00 55.06  ? 156 ILE B CD1   1 
ATOM   4369 N  N     . ALA B 1 131 ? 34.153  20.615  38.183 1.00 66.74  ? 157 ALA B N     1 
ATOM   4370 C  CA    . ALA B 1 131 ? 34.641  21.644  37.279 1.00 64.10  ? 157 ALA B CA    1 
ATOM   4371 C  C     . ALA B 1 131 ? 35.721  22.505  37.921 1.00 67.92  ? 157 ALA B C     1 
ATOM   4372 O  O     . ALA B 1 131 ? 36.624  22.981  37.236 1.00 77.14  ? 157 ALA B O     1 
ATOM   4373 C  CB    . ALA B 1 131 ? 33.492  22.509  36.812 1.00 61.98  ? 157 ALA B CB    1 
ATOM   4374 N  N     . LYS B 1 132 ? 35.636  22.712  39.231 1.00 65.74  ? 158 LYS B N     1 
ATOM   4375 C  CA    . LYS B 1 132 ? 36.664  23.493  39.912 1.00 75.72  ? 158 LYS B CA    1 
ATOM   4376 C  C     . LYS B 1 132 ? 37.916  22.650  40.137 1.00 77.95  ? 158 LYS B C     1 
ATOM   4377 O  O     . LYS B 1 132 ? 38.966  23.168  40.510 1.00 83.06  ? 158 LYS B O     1 
ATOM   4378 C  CB    . LYS B 1 132 ? 36.152  24.061  41.243 1.00 73.34  ? 158 LYS B CB    1 
ATOM   4379 C  CG    . LYS B 1 132 ? 35.306  25.320  41.092 1.00 70.84  ? 158 LYS B CG    1 
ATOM   4380 C  CD    . LYS B 1 132 ? 35.006  25.972  42.434 1.00 66.79  ? 158 LYS B CD    1 
ATOM   4381 C  CE    . LYS B 1 132 ? 35.982  27.104  42.738 1.00 70.57  ? 158 LYS B CE    1 
ATOM   4382 N  NZ    . LYS B 1 132 ? 35.897  28.212  41.743 1.00 68.68  ? 158 LYS B NZ    1 
ATOM   4383 N  N     . ARG B 1 133 ? 37.804  21.344  39.922 1.00 74.57  ? 159 ARG B N     1 
ATOM   4384 C  CA    . ARG B 1 133 ? 38.979  20.485  40.014 1.00 76.80  ? 159 ARG B CA    1 
ATOM   4385 C  C     . ARG B 1 133 ? 39.613  20.302  38.639 1.00 72.87  ? 159 ARG B C     1 
ATOM   4386 O  O     . ARG B 1 133 ? 40.800  19.991  38.538 1.00 69.99  ? 159 ARG B O     1 
ATOM   4387 C  CB    . ARG B 1 133 ? 38.635  19.129  40.634 1.00 71.53  ? 159 ARG B CB    1 
ATOM   4388 C  CG    . ARG B 1 133 ? 38.591  19.163  42.146 1.00 72.80  ? 159 ARG B CG    1 
ATOM   4389 C  CD    . ARG B 1 133 ? 38.369  17.788  42.745 1.00 77.86  ? 159 ARG B CD    1 
ATOM   4390 N  NE    . ARG B 1 133 ? 39.141  17.634  43.975 1.00 91.03  ? 159 ARG B NE    1 
ATOM   4391 C  CZ    . ARG B 1 133 ? 39.005  16.628  44.834 1.00 93.35  ? 159 ARG B CZ    1 
ATOM   4392 N  NH1   . ARG B 1 133 ? 38.105  15.678  44.611 1.00 88.21  ? 159 ARG B NH1   1 
ATOM   4393 N  NH2   . ARG B 1 133 ? 39.762  16.582  45.925 1.00 92.33  ? 159 ARG B NH2   1 
ATOM   4394 N  N     . LEU B 1 134 ? 38.831  20.505  37.581 1.00 73.12  ? 160 LEU B N     1 
ATOM   4395 C  CA    . LEU B 1 134 ? 39.418  20.596  36.241 1.00 79.06  ? 160 LEU B CA    1 
ATOM   4396 C  C     . LEU B 1 134 ? 40.055  21.974  36.017 1.00 87.54  ? 160 LEU B C     1 
ATOM   4397 O  O     . LEU B 1 134 ? 40.932  22.144  35.162 1.00 84.41  ? 160 LEU B O     1 
ATOM   4398 C  CB    . LEU B 1 134 ? 38.374  20.319  35.153 1.00 75.87  ? 160 LEU B CB    1 
ATOM   4399 C  CG    . LEU B 1 134 ? 37.720  18.941  35.089 1.00 76.31  ? 160 LEU B CG    1 
ATOM   4400 C  CD1   . LEU B 1 134 ? 36.852  18.844  33.846 1.00 81.31  ? 160 LEU B CD1   1 
ATOM   4401 C  CD2   . LEU B 1 134 ? 38.774  17.842  35.093 1.00 82.20  ? 160 LEU B CD2   1 
ATOM   4402 N  N     . CYS B 1 135 ? 39.616  22.948  36.806 1.00 90.16  ? 161 CYS B N     1 
ATOM   4403 C  CA    . CYS B 1 135 ? 39.988  24.344  36.610 1.00 84.98  ? 161 CYS B CA    1 
ATOM   4404 C  C     . CYS B 1 135 ? 39.695  25.124  37.890 1.00 83.67  ? 161 CYS B C     1 
ATOM   4405 O  O     . CYS B 1 135 ? 38.578  25.595  38.091 1.00 81.51  ? 161 CYS B O     1 
ATOM   4406 C  CB    . CYS B 1 135 ? 39.233  24.941  35.418 1.00 82.60  ? 161 CYS B CB    1 
ATOM   4407 S  SG    . CYS B 1 135 ? 39.413  26.728  35.216 1.00 102.74 ? 161 CYS B SG    1 
ATOM   4408 N  N     . PRO B 1 136 ? 40.699  25.249  38.771 1.00 87.91  ? 162 PRO B N     1 
ATOM   4409 C  CA    . PRO B 1 136 ? 40.519  25.891  40.083 1.00 94.03  ? 162 PRO B CA    1 
ATOM   4410 C  C     . PRO B 1 136 ? 40.336  27.405  40.010 1.00 91.64  ? 162 PRO B C     1 
ATOM   4411 O  O     . PRO B 1 136 ? 39.896  28.017  40.985 1.00 92.37  ? 162 PRO B O     1 
ATOM   4412 C  CB    . PRO B 1 136 ? 41.815  25.546  40.824 1.00 92.55  ? 162 PRO B CB    1 
ATOM   4413 C  CG    . PRO B 1 136 ? 42.819  25.336  39.741 1.00 97.38  ? 162 PRO B CG    1 
ATOM   4414 C  CD    . PRO B 1 136 ? 42.064  24.730  38.585 1.00 87.84  ? 162 PRO B CD    1 
ATOM   4415 N  N     . GLN B 1 137 ? 40.673  27.997  38.869 1.00 87.13  ? 163 GLN B N     1 
ATOM   4416 C  CA    . GLN B 1 137 ? 40.539  29.440  38.685 1.00 91.23  ? 163 GLN B CA    1 
ATOM   4417 C  C     . GLN B 1 137 ? 39.139  29.801  38.198 1.00 90.44  ? 163 GLN B C     1 
ATOM   4418 O  O     . GLN B 1 137 ? 38.871  30.938  37.799 1.00 88.10  ? 163 GLN B O     1 
ATOM   4419 C  CB    . GLN B 1 137 ? 41.585  29.959  37.696 1.00 92.79  ? 163 GLN B CB    1 
ATOM   4420 N  N     . LEU B 1 138 ? 38.247  28.819  38.242 1.00 86.27  ? 164 LEU B N     1 
ATOM   4421 C  CA    . LEU B 1 138 ? 36.915  28.954  37.671 1.00 80.21  ? 164 LEU B CA    1 
ATOM   4422 C  C     . LEU B 1 138 ? 36.030  29.917  38.453 1.00 75.35  ? 164 LEU B C     1 
ATOM   4423 O  O     . LEU B 1 138 ? 36.044  29.945  39.682 1.00 70.04  ? 164 LEU B O     1 
ATOM   4424 C  CB    . LEU B 1 138 ? 36.235  27.583  37.581 1.00 77.16  ? 164 LEU B CB    1 
ATOM   4425 C  CG    . LEU B 1 138 ? 34.897  27.565  36.845 1.00 71.45  ? 164 LEU B CG    1 
ATOM   4426 C  CD1   . LEU B 1 138 ? 35.086  27.999  35.402 1.00 67.64  ? 164 LEU B CD1   1 
ATOM   4427 C  CD2   . LEU B 1 138 ? 34.263  26.186  36.924 1.00 67.43  ? 164 LEU B CD2   1 
ATOM   4428 N  N     . ILE B 1 139 ? 35.264  30.712  37.716 1.00 69.39  ? 165 ILE B N     1 
ATOM   4429 C  CA    . ILE B 1 139 ? 34.278  31.601  38.305 1.00 67.68  ? 165 ILE B CA    1 
ATOM   4430 C  C     . ILE B 1 139 ? 32.895  30.989  38.137 1.00 57.78  ? 165 ILE B C     1 
ATOM   4431 O  O     . ILE B 1 139 ? 32.408  30.855  37.019 1.00 55.04  ? 165 ILE B O     1 
ATOM   4432 C  CB    . ILE B 1 139 ? 34.293  32.994  37.646 1.00 71.77  ? 165 ILE B CB    1 
ATOM   4433 C  CG1   . ILE B 1 139 ? 35.685  33.626  37.719 1.00 76.24  ? 165 ILE B CG1   1 
ATOM   4434 C  CG2   . ILE B 1 139 ? 33.206  33.881  38.242 1.00 67.27  ? 165 ILE B CG2   1 
ATOM   4435 C  CD1   . ILE B 1 139 ? 36.082  34.103  39.095 1.00 77.58  ? 165 ILE B CD1   1 
ATOM   4436 N  N     . ILE B 1 140 ? 32.261  30.607  39.236 1.00 58.38  ? 166 ILE B N     1 
ATOM   4437 C  CA    . ILE B 1 140 ? 30.904  30.085  39.143 1.00 54.71  ? 166 ILE B CA    1 
ATOM   4438 C  C     . ILE B 1 140 ? 29.897  31.167  39.493 1.00 44.64  ? 166 ILE B C     1 
ATOM   4439 O  O     . ILE B 1 140 ? 29.732  31.528  40.659 1.00 50.12  ? 166 ILE B O     1 
ATOM   4440 C  CB    . ILE B 1 140 ? 30.688  28.869  40.059 1.00 58.61  ? 166 ILE B CB    1 
ATOM   4441 C  CG1   . ILE B 1 140 ? 31.620  27.731  39.650 1.00 56.78  ? 166 ILE B CG1   1 
ATOM   4442 C  CG2   . ILE B 1 140 ? 29.244  28.403  39.984 1.00 56.79  ? 166 ILE B CG2   1 
ATOM   4443 C  CD1   . ILE B 1 140 ? 31.535  26.524  40.549 1.00 53.57  ? 166 ILE B CD1   1 
ATOM   4444 N  N     . VAL B 1 141 ? 29.219  31.678  38.472 1.00 41.44  ? 167 VAL B N     1 
ATOM   4445 C  CA    . VAL B 1 141 ? 28.238  32.735  38.667 1.00 45.73  ? 167 VAL B CA    1 
ATOM   4446 C  C     . VAL B 1 141 ? 26.826  32.165  38.621 1.00 42.24  ? 167 VAL B C     1 
ATOM   4447 O  O     . VAL B 1 141 ? 26.471  31.440  37.693 1.00 37.99  ? 167 VAL B O     1 
ATOM   4448 C  CB    . VAL B 1 141 ? 28.400  33.866  37.617 1.00 42.41  ? 167 VAL B CB    1 
ATOM   4449 C  CG1   . VAL B 1 141 ? 28.806  33.305  36.266 1.00 45.58  ? 167 VAL B CG1   1 
ATOM   4450 C  CG2   . VAL B 1 141 ? 27.128  34.691  37.509 1.00 41.96  ? 167 VAL B CG2   1 
ATOM   4451 N  N     . PRO B 1 142 ? 26.019  32.480  39.646 1.00 45.70  ? 168 PRO B N     1 
ATOM   4452 C  CA    . PRO B 1 142 ? 24.653  31.957  39.757 1.00 42.85  ? 168 PRO B CA    1 
ATOM   4453 C  C     . PRO B 1 142 ? 23.797  32.376  38.567 1.00 36.73  ? 168 PRO B C     1 
ATOM   4454 O  O     . PRO B 1 142 ? 24.021  33.445  38.009 1.00 38.78  ? 168 PRO B O     1 
ATOM   4455 C  CB    . PRO B 1 142 ? 24.138  32.589  41.057 1.00 36.69  ? 168 PRO B CB    1 
ATOM   4456 C  CG    . PRO B 1 142 ? 25.369  32.953  41.819 1.00 35.33  ? 168 PRO B CG    1 
ATOM   4457 C  CD    . PRO B 1 142 ? 26.385  33.326  40.796 1.00 29.71  ? 168 PRO B CD    1 
ATOM   4458 N  N     . PRO B 1 143 ? 22.831  31.539  38.176 1.00 37.60  ? 169 PRO B N     1 
ATOM   4459 C  CA    . PRO B 1 143 ? 21.975  31.884  37.038 1.00 38.95  ? 169 PRO B CA    1 
ATOM   4460 C  C     . PRO B 1 143 ? 20.994  33.017  37.345 1.00 37.26  ? 169 PRO B C     1 
ATOM   4461 O  O     . PRO B 1 143 ? 20.544  33.160  38.482 1.00 33.96  ? 169 PRO B O     1 
ATOM   4462 C  CB    . PRO B 1 143 ? 21.232  30.570  36.756 1.00 38.24  ? 169 PRO B CB    1 
ATOM   4463 C  CG    . PRO B 1 143 ? 21.170  29.895  38.076 1.00 44.76  ? 169 PRO B CG    1 
ATOM   4464 C  CD    . PRO B 1 143 ? 22.477  30.231  38.758 1.00 44.41  ? 169 PRO B CD    1 
ATOM   4465 N  N     . ASN B 1 144 ? 20.672  33.804  36.321 1.00 43.72  ? 170 ASN B N     1 
ATOM   4466 C  CA    . ASN B 1 144 ? 19.648  34.841  36.407 1.00 40.98  ? 170 ASN B CA    1 
ATOM   4467 C  C     . ASN B 1 144 ? 18.601  34.612  35.331 1.00 37.61  ? 170 ASN B C     1 
ATOM   4468 O  O     . ASN B 1 144 ? 18.587  35.289  34.310 1.00 42.61  ? 170 ASN B O     1 
ATOM   4469 C  CB    . ASN B 1 144 ? 20.263  36.235  36.275 1.00 41.36  ? 170 ASN B CB    1 
ATOM   4470 C  CG    . ASN B 1 144 ? 21.150  36.594  37.455 1.00 46.47  ? 170 ASN B CG    1 
ATOM   4471 O  OD1   . ASN B 1 144 ? 20.668  36.777  38.578 1.00 44.13  ? 170 ASN B OD1   1 
ATOM   4472 N  ND2   . ASN B 1 144 ? 22.452  36.690  37.209 1.00 45.15  ? 170 ASN B ND2   1 
ATOM   4473 N  N     . PHE B 1 145 ? 17.735  33.637  35.588 1.00 41.04  ? 171 PHE B N     1 
ATOM   4474 C  CA    . PHE B 1 145 ? 16.824  33.064  34.600 1.00 43.13  ? 171 PHE B CA    1 
ATOM   4475 C  C     . PHE B 1 145 ? 15.938  34.092  33.890 1.00 44.22  ? 171 PHE B C     1 
ATOM   4476 O  O     . PHE B 1 145 ? 15.673  33.977  32.684 1.00 48.82  ? 171 PHE B O     1 
ATOM   4477 C  CB    . PHE B 1 145 ? 15.971  31.985  35.283 1.00 44.70  ? 171 PHE B CB    1 
ATOM   4478 C  CG    . PHE B 1 145 ? 15.186  31.126  34.330 1.00 57.78  ? 171 PHE B CG    1 
ATOM   4479 C  CD1   . PHE B 1 145 ? 15.834  30.233  33.486 1.00 57.43  ? 171 PHE B CD1   1 
ATOM   4480 C  CD2   . PHE B 1 145 ? 13.800  31.167  34.315 1.00 60.00  ? 171 PHE B CD2   1 
ATOM   4481 C  CE1   . PHE B 1 145 ? 15.117  29.429  32.610 1.00 57.20  ? 171 PHE B CE1   1 
ATOM   4482 C  CE2   . PHE B 1 145 ? 13.076  30.357  33.446 1.00 64.75  ? 171 PHE B CE2   1 
ATOM   4483 C  CZ    . PHE B 1 145 ? 13.736  29.489  32.592 1.00 58.10  ? 171 PHE B CZ    1 
ATOM   4484 N  N     . ASP B 1 146 ? 15.502  35.106  34.627 1.00 39.47  ? 172 ASP B N     1 
ATOM   4485 C  CA    . ASP B 1 146 ? 14.609  36.117  34.074 1.00 47.40  ? 172 ASP B CA    1 
ATOM   4486 C  C     . ASP B 1 146 ? 15.293  37.028  33.044 1.00 48.47  ? 172 ASP B C     1 
ATOM   4487 O  O     . ASP B 1 146 ? 14.672  37.428  32.048 1.00 50.59  ? 172 ASP B O     1 
ATOM   4488 C  CB    . ASP B 1 146 ? 14.017  36.948  35.203 1.00 51.06  ? 172 ASP B CB    1 
ATOM   4489 C  CG    . ASP B 1 146 ? 13.118  36.133  36.105 1.00 52.53  ? 172 ASP B CG    1 
ATOM   4490 O  OD1   . ASP B 1 146 ? 11.943  35.907  35.738 1.00 50.01  ? 172 ASP B OD1   1 
ATOM   4491 O  OD2   . ASP B 1 146 ? 13.596  35.708  37.177 1.00 58.58  ? 172 ASP B OD2   1 
ATOM   4492 N  N     . LYS B 1 147 ? 16.563  37.352  33.277 1.00 41.89  ? 173 LYS B N     1 
ATOM   4493 C  CA    . LYS B 1 147 ? 17.365  38.020  32.255 1.00 44.54  ? 173 LYS B CA    1 
ATOM   4494 C  C     . LYS B 1 147 ? 17.382  37.199  30.972 1.00 49.96  ? 173 LYS B C     1 
ATOM   4495 O  O     . LYS B 1 147 ? 17.159  37.731  29.879 1.00 54.60  ? 173 LYS B O     1 
ATOM   4496 C  CB    . LYS B 1 147 ? 18.799  38.261  32.728 1.00 40.19  ? 173 LYS B CB    1 
ATOM   4497 C  CG    . LYS B 1 147 ? 18.930  39.210  33.889 1.00 42.01  ? 173 LYS B CG    1 
ATOM   4498 C  CD    . LYS B 1 147 ? 20.385  39.401  34.264 1.00 43.20  ? 173 LYS B CD    1 
ATOM   4499 C  CE    . LYS B 1 147 ? 21.151  40.090  33.150 1.00 38.90  ? 173 LYS B CE    1 
ATOM   4500 N  NZ    . LYS B 1 147 ? 22.573  40.343  33.512 1.00 45.42  ? 173 LYS B NZ    1 
ATOM   4501 N  N     . TYR B 1 148 ? 17.662  35.904  31.114 1.00 43.05  ? 174 TYR B N     1 
ATOM   4502 C  CA    . TYR B 1 148 ? 17.749  35.000  29.973 1.00 44.03  ? 174 TYR B CA    1 
ATOM   4503 C  C     . TYR B 1 148 ? 16.419  34.986  29.235 1.00 48.81  ? 174 TYR B C     1 
ATOM   4504 O  O     . TYR B 1 148 ? 16.381  34.918  28.004 1.00 54.23  ? 174 TYR B O     1 
ATOM   4505 C  CB    . TYR B 1 148 ? 18.126  33.583  30.420 1.00 45.45  ? 174 TYR B CB    1 
ATOM   4506 C  CG    . TYR B 1 148 ? 19.333  33.524  31.325 1.00 43.77  ? 174 TYR B CG    1 
ATOM   4507 C  CD1   . TYR B 1 148 ? 19.438  32.549  32.311 1.00 43.83  ? 174 TYR B CD1   1 
ATOM   4508 C  CD2   . TYR B 1 148 ? 20.359  34.449  31.204 1.00 40.20  ? 174 TYR B CD2   1 
ATOM   4509 C  CE1   . TYR B 1 148 ? 20.532  32.497  33.149 1.00 42.10  ? 174 TYR B CE1   1 
ATOM   4510 C  CE2   . TYR B 1 148 ? 21.459  34.404  32.031 1.00 42.29  ? 174 TYR B CE2   1 
ATOM   4511 C  CZ    . TYR B 1 148 ? 21.543  33.426  33.005 1.00 46.06  ? 174 TYR B CZ    1 
ATOM   4512 O  OH    . TYR B 1 148 ? 22.640  33.381  33.838 1.00 44.77  ? 174 TYR B OH    1 
ATOM   4513 N  N     . ARG B 1 149 ? 15.329  35.104  29.991 1.00 49.48  ? 175 ARG B N     1 
ATOM   4514 C  CA    . ARG B 1 149 ? 14.000  35.155  29.387 1.00 49.26  ? 175 ARG B CA    1 
ATOM   4515 C  C     . ARG B 1 149 ? 13.774  36.455  28.611 1.00 51.10  ? 175 ARG B C     1 
ATOM   4516 O  O     . ARG B 1 149 ? 13.160  36.455  27.536 1.00 53.17  ? 175 ARG B O     1 
ATOM   4517 C  CB    . ARG B 1 149 ? 12.929  35.003  30.465 1.00 50.48  ? 175 ARG B CB    1 
ATOM   4518 C  CG    . ARG B 1 149 ? 12.098  33.745  30.329 1.00 55.57  ? 175 ARG B CG    1 
ATOM   4519 C  CD    . ARG B 1 149 ? 11.999  33.007  31.661 1.00 57.78  ? 175 ARG B CD    1 
ATOM   4520 N  NE    . ARG B 1 149 ? 11.296  33.786  32.677 1.00 62.35  ? 175 ARG B NE    1 
ATOM   4521 C  CZ    . ARG B 1 149 ? 9.985   34.010  32.667 1.00 68.54  ? 175 ARG B CZ    1 
ATOM   4522 N  NH1   . ARG B 1 149 ? 9.244   33.508  31.684 1.00 71.92  ? 175 ARG B NH1   1 
ATOM   4523 N  NH2   . ARG B 1 149 ? 9.420   34.737  33.631 1.00 61.42  ? 175 ARG B NH2   1 
ATOM   4524 N  N     . ALA B 1 150 ? 14.287  37.559  29.144 1.00 51.17  ? 176 ALA B N     1 
ATOM   4525 C  CA    . ALA B 1 150 ? 14.133  38.853  28.484 1.00 52.64  ? 176 ALA B CA    1 
ATOM   4526 C  C     . ALA B 1 150 ? 14.911  38.889  27.167 1.00 55.31  ? 176 ALA B C     1 
ATOM   4527 O  O     . ALA B 1 150 ? 14.376  39.260  26.103 1.00 58.98  ? 176 ALA B O     1 
ATOM   4528 C  CB    . ALA B 1 150 ? 14.592  39.964  29.401 1.00 49.99  ? 176 ALA B CB    1 
ATOM   4529 N  N     . VAL B 1 151 ? 16.180  38.499  27.253 1.00 49.36  ? 177 VAL B N     1 
ATOM   4530 C  CA    . VAL B 1 151 ? 17.043  38.419  26.084 1.00 46.89  ? 177 VAL B CA    1 
ATOM   4531 C  C     . VAL B 1 151 ? 16.407  37.509  25.037 1.00 46.81  ? 177 VAL B C     1 
ATOM   4532 O  O     . VAL B 1 151 ? 16.362  37.838  23.836 1.00 49.08  ? 177 VAL B O     1 
ATOM   4533 C  CB    . VAL B 1 151 ? 18.440  37.902  26.460 1.00 42.98  ? 177 VAL B CB    1 
ATOM   4534 C  CG1   . VAL B 1 151 ? 19.233  37.567  25.221 1.00 45.25  ? 177 VAL B CG1   1 
ATOM   4535 C  CG2   . VAL B 1 151 ? 19.175  38.940  27.288 1.00 43.11  ? 177 VAL B CG2   1 
ATOM   4536 N  N     . SER B 1 152 ? 15.895  36.373  25.506 1.00 50.11  ? 178 SER B N     1 
ATOM   4537 C  CA    . SER B 1 152 ? 15.158  35.461  24.636 1.00 53.85  ? 178 SER B CA    1 
ATOM   4538 C  C     . SER B 1 152 ? 14.010  36.186  23.932 1.00 50.36  ? 178 SER B C     1 
ATOM   4539 O  O     . SER B 1 152 ? 13.786  35.987  22.739 1.00 48.39  ? 178 SER B O     1 
ATOM   4540 C  CB    . SER B 1 152 ? 14.627  34.265  25.429 1.00 47.96  ? 178 SER B CB    1 
ATOM   4541 O  OG    . SER B 1 152 ? 14.003  33.326  24.575 1.00 46.97  ? 178 SER B OG    1 
ATOM   4542 N  N     . LYS B 1 153 ? 13.296  37.037  24.666 1.00 53.23  ? 179 LYS B N     1 
ATOM   4543 C  CA    . LYS B 1 153 ? 12.199  37.799  24.071 1.00 51.52  ? 179 LYS B CA    1 
ATOM   4544 C  C     . LYS B 1 153 ? 12.705  38.713  22.948 1.00 50.52  ? 179 LYS B C     1 
ATOM   4545 O  O     . LYS B 1 153 ? 12.109  38.765  21.861 1.00 46.48  ? 179 LYS B O     1 
ATOM   4546 C  CB    . LYS B 1 153 ? 11.474  38.618  25.144 1.00 48.48  ? 179 LYS B CB    1 
ATOM   4547 C  CG    . LYS B 1 153 ? 10.309  39.444  24.629 1.00 59.96  ? 179 LYS B CG    1 
ATOM   4548 C  CD    . LYS B 1 153 ? 10.105  40.685  25.487 1.00 71.07  ? 179 LYS B CD    1 
ATOM   4549 C  CE    . LYS B 1 153 ? 9.057   41.624  24.897 1.00 78.47  ? 179 LYS B CE    1 
ATOM   4550 N  NZ    . LYS B 1 153 ? 7.680   41.313  25.383 1.00 79.60  ? 179 LYS B NZ    1 
ATOM   4551 N  N     . GLU B 1 154 ? 13.803  39.423  23.204 1.00 48.42  ? 180 GLU B N     1 
ATOM   4552 C  CA    . GLU B 1 154 ? 14.424  40.263  22.168 1.00 46.49  ? 180 GLU B CA    1 
ATOM   4553 C  C     . GLU B 1 154 ? 14.772  39.486  20.885 1.00 46.58  ? 180 GLU B C     1 
ATOM   4554 O  O     . GLU B 1 154 ? 14.362  39.856  19.754 1.00 50.61  ? 180 GLU B O     1 
ATOM   4555 C  CB    . GLU B 1 154 ? 15.679  40.937  22.732 1.00 45.12  ? 180 GLU B CB    1 
ATOM   4556 C  CG    . GLU B 1 154 ? 15.372  42.028  23.752 1.00 47.46  ? 180 GLU B CG    1 
ATOM   4557 C  CD    . GLU B 1 154 ? 16.619  42.645  24.359 1.00 52.42  ? 180 GLU B CD    1 
ATOM   4558 O  OE1   . GLU B 1 154 ? 17.413  41.913  24.981 1.00 54.45  ? 180 GLU B OE1   1 
ATOM   4559 O  OE2   . GLU B 1 154 ? 16.808  43.869  24.222 1.00 61.39  ? 180 GLU B OE2   1 
ATOM   4560 N  N     . VAL B 1 155 ? 15.519  38.399  21.064 1.00 50.33  ? 181 VAL B N     1 
ATOM   4561 C  CA    . VAL B 1 155 ? 15.905  37.562  19.931 1.00 41.91  ? 181 VAL B CA    1 
ATOM   4562 C  C     . VAL B 1 155 ? 14.694  37.027  19.166 1.00 39.31  ? 181 VAL B C     1 
ATOM   4563 O  O     . VAL B 1 155 ? 14.663  37.083  17.941 1.00 37.27  ? 181 VAL B O     1 
ATOM   4564 C  CB    . VAL B 1 155 ? 16.777  36.376  20.376 1.00 40.52  ? 181 VAL B CB    1 
ATOM   4565 C  CG1   . VAL B 1 155 ? 17.105  35.480  19.185 1.00 34.62  ? 181 VAL B CG1   1 
ATOM   4566 C  CG2   . VAL B 1 155 ? 18.051  36.880  21.040 1.00 37.69  ? 181 VAL B CG2   1 
ATOM   4567 N  N     . LYS B 1 156 ? 13.693  36.527  19.887 1.00 43.09  ? 182 LYS B N     1 
ATOM   4568 C  CA    . LYS B 1 156 ? 12.480  36.028  19.241 1.00 46.19  ? 182 LYS B CA    1 
ATOM   4569 C  C     . LYS B 1 156 ? 11.798  37.136  18.443 1.00 43.25  ? 182 LYS B C     1 
ATOM   4570 O  O     . LYS B 1 156 ? 11.241  36.888  17.362 1.00 41.37  ? 182 LYS B O     1 
ATOM   4571 C  CB    . LYS B 1 156 ? 11.506  35.455  20.275 1.00 46.12  ? 182 LYS B CB    1 
ATOM   4572 C  CG    . LYS B 1 156 ? 11.954  34.150  20.905 1.00 44.85  ? 182 LYS B CG    1 
ATOM   4573 C  CD    . LYS B 1 156 ? 11.020  33.731  22.034 1.00 46.53  ? 182 LYS B CD    1 
ATOM   4574 N  N     . GLU B 1 157 ? 11.869  38.359  18.975 1.00 48.56  ? 183 GLU B N     1 
ATOM   4575 C  CA    . GLU B 1 157 ? 11.348  39.535  18.277 1.00 46.59  ? 183 GLU B CA    1 
ATOM   4576 C  C     . GLU B 1 157 ? 12.035  39.683  16.932 1.00 42.96  ? 183 GLU B C     1 
ATOM   4577 O  O     . GLU B 1 157 ? 11.367  39.836  15.906 1.00 37.51  ? 183 GLU B O     1 
ATOM   4578 C  CB    . GLU B 1 157 ? 11.539  40.814  19.095 1.00 48.79  ? 183 GLU B CB    1 
ATOM   4579 C  CG    . GLU B 1 157 ? 10.373  41.182  19.997 1.00 58.69  ? 183 GLU B CG    1 
ATOM   4580 C  CD    . GLU B 1 157 ? 10.715  42.322  20.933 1.00 59.99  ? 183 GLU B CD    1 
ATOM   4581 O  OE1   . GLU B 1 157 ? 11.631  43.105  20.593 1.00 57.48  ? 183 GLU B OE1   1 
ATOM   4582 O  OE2   . GLU B 1 157 ? 10.082  42.428  22.007 1.00 66.69  ? 183 GLU B OE2   1 
ATOM   4583 N  N     . ILE B 1 158 ? 13.365  39.646  16.926 1.00 40.97  ? 184 ILE B N     1 
ATOM   4584 C  CA    . ILE B 1 158 ? 14.061  39.610  15.633 1.00 37.07  ? 184 ILE B CA    1 
ATOM   4585 C  C     . ILE B 1 158 ? 13.620  38.446  14.715 1.00 42.74  ? 184 ILE B C     1 
ATOM   4586 O  O     . ILE B 1 158 ? 13.286  38.662  13.549 1.00 41.15  ? 184 ILE B O     1 
ATOM   4587 C  CB    . ILE B 1 158 ? 15.580  39.527  15.816 1.00 38.51  ? 184 ILE B CB    1 
ATOM   4588 C  CG1   . ILE B 1 158 ? 16.103  40.829  16.414 1.00 33.11  ? 184 ILE B CG1   1 
ATOM   4589 C  CG2   . ILE B 1 158 ? 16.267  39.257  14.482 1.00 35.58  ? 184 ILE B CG2   1 
ATOM   4590 C  CD1   . ILE B 1 158 ? 17.575  40.815  16.683 1.00 36.30  ? 184 ILE B CD1   1 
ATOM   4591 N  N     . LEU B 1 159 ? 13.627  37.223  15.242 1.00 43.69  ? 185 LEU B N     1 
ATOM   4592 C  CA    . LEU B 1 159 ? 13.273  36.024  14.469 1.00 43.27  ? 185 LEU B CA    1 
ATOM   4593 C  C     . LEU B 1 159 ? 11.881  36.054  13.833 1.00 44.72  ? 185 LEU B C     1 
ATOM   4594 O  O     . LEU B 1 159 ? 11.654  35.410  12.809 1.00 43.79  ? 185 LEU B O     1 
ATOM   4595 C  CB    . LEU B 1 159 ? 13.383  34.775  15.346 1.00 45.54  ? 185 LEU B CB    1 
ATOM   4596 C  CG    . LEU B 1 159 ? 14.781  34.460  15.885 1.00 40.77  ? 185 LEU B CG    1 
ATOM   4597 C  CD1   . LEU B 1 159 ? 14.736  33.252  16.811 1.00 44.59  ? 185 LEU B CD1   1 
ATOM   4598 C  CD2   . LEU B 1 159 ? 15.789  34.260  14.764 1.00 35.98  ? 185 LEU B CD2   1 
ATOM   4599 N  N     . ALA B 1 160 ? 10.947  36.777  14.444 1.00 46.31  ? 186 ALA B N     1 
ATOM   4600 C  CA    . ALA B 1 160 ? 9.574   36.798  13.935 1.00 49.15  ? 186 ALA B CA    1 
ATOM   4601 C  C     . ALA B 1 160 ? 9.447   37.554  12.603 1.00 52.32  ? 186 ALA B C     1 
ATOM   4602 O  O     . ALA B 1 160 ? 8.445   37.418  11.896 1.00 54.08  ? 186 ALA B O     1 
ATOM   4603 C  CB    . ALA B 1 160 ? 8.641   37.400  14.971 1.00 49.24  ? 186 ALA B CB    1 
ATOM   4604 N  N     . ASP B 1 161 ? 10.468  38.335  12.261 1.00 45.29  ? 187 ASP B N     1 
ATOM   4605 C  CA    . ASP B 1 161 ? 10.490  39.077  10.998 1.00 49.60  ? 187 ASP B CA    1 
ATOM   4606 C  C     . ASP B 1 161 ? 10.589  38.177  9.770  1.00 53.94  ? 187 ASP B C     1 
ATOM   4607 O  O     . ASP B 1 161 ? 10.095  38.517  8.694  1.00 58.95  ? 187 ASP B O     1 
ATOM   4608 C  CB    . ASP B 1 161 ? 11.656  40.065  10.986 1.00 46.24  ? 187 ASP B CB    1 
ATOM   4609 C  CG    . ASP B 1 161 ? 11.301  41.388  11.625 1.00 44.54  ? 187 ASP B CG    1 
ATOM   4610 O  OD1   . ASP B 1 161 ? 10.100  41.603  11.904 1.00 42.01  ? 187 ASP B OD1   1 
ATOM   4611 O  OD2   . ASP B 1 161 ? 12.224  42.202  11.854 1.00 38.81  ? 187 ASP B OD2   1 
ATOM   4612 N  N     . TYR B 1 162 ? 11.245  37.036  9.938  1.00 49.84  ? 188 TYR B N     1 
ATOM   4613 C  CA    . TYR B 1 162 ? 11.595  36.179  8.819  1.00 45.07  ? 188 TYR B CA    1 
ATOM   4614 C  C     . TYR B 1 162 ? 10.660  34.986  8.765  1.00 47.73  ? 188 TYR B C     1 
ATOM   4615 O  O     . TYR B 1 162 ? 10.318  34.492  7.691  1.00 56.95  ? 188 TYR B O     1 
ATOM   4616 C  CB    . TYR B 1 162 ? 13.055  35.743  8.935  1.00 43.78  ? 188 TYR B CB    1 
ATOM   4617 C  CG    . TYR B 1 162 ? 13.993  36.929  9.030  1.00 51.01  ? 188 TYR B CG    1 
ATOM   4618 C  CD1   . TYR B 1 162 ? 14.579  37.474  7.893  1.00 55.64  ? 188 TYR B CD1   1 
ATOM   4619 C  CD2   . TYR B 1 162 ? 14.246  37.540  10.252 1.00 46.80  ? 188 TYR B CD2   1 
ATOM   4620 C  CE1   . TYR B 1 162 ? 15.418  38.575  7.977  1.00 55.71  ? 188 TYR B CE1   1 
ATOM   4621 C  CE2   . TYR B 1 162 ? 15.082  38.636  10.347 1.00 49.41  ? 188 TYR B CE2   1 
ATOM   4622 C  CZ    . TYR B 1 162 ? 15.666  39.152  9.209  1.00 56.52  ? 188 TYR B CZ    1 
ATOM   4623 O  OH    . TYR B 1 162 ? 16.499  40.246  9.310  1.00 52.20  ? 188 TYR B OH    1 
ATOM   4624 N  N     . ASP B 1 163 ? 10.247  34.531  9.939  1.00 49.29  ? 189 ASP B N     1 
ATOM   4625 C  CA    . ASP B 1 163 ? 9.239   33.491  10.048 1.00 51.97  ? 189 ASP B CA    1 
ATOM   4626 C  C     . ASP B 1 163 ? 8.329   33.820  11.223 1.00 55.06  ? 189 ASP B C     1 
ATOM   4627 O  O     . ASP B 1 163 ? 8.730   33.702  12.378 1.00 55.85  ? 189 ASP B O     1 
ATOM   4628 C  CB    . ASP B 1 163 ? 9.885   32.112  10.224 1.00 50.57  ? 189 ASP B CB    1 
ATOM   4629 C  CG    . ASP B 1 163 ? 8.879   30.973  10.136 1.00 53.00  ? 189 ASP B CG    1 
ATOM   4630 O  OD1   . ASP B 1 163 ? 7.662   31.243  10.021 1.00 54.01  ? 189 ASP B OD1   1 
ATOM   4631 O  OD2   . ASP B 1 163 ? 9.309   29.800  10.188 1.00 52.16  ? 189 ASP B OD2   1 
ATOM   4632 N  N     . PRO B 1 164 ? 7.108   34.275  10.927 1.00 55.77  ? 190 PRO B N     1 
ATOM   4633 C  CA    . PRO B 1 164 ? 6.102   34.512  11.967 1.00 55.72  ? 190 PRO B CA    1 
ATOM   4634 C  C     . PRO B 1 164 ? 5.709   33.223  12.690 1.00 59.77  ? 190 PRO B C     1 
ATOM   4635 O  O     . PRO B 1 164 ? 5.563   33.218  13.912 1.00 59.33  ? 190 PRO B O     1 
ATOM   4636 C  CB    . PRO B 1 164 ? 4.910   35.078  11.186 1.00 56.47  ? 190 PRO B CB    1 
ATOM   4637 C  CG    . PRO B 1 164 ? 5.154   34.691  9.759  1.00 55.72  ? 190 PRO B CG    1 
ATOM   4638 C  CD    . PRO B 1 164 ? 6.634   34.662  9.589  1.00 52.03  ? 190 PRO B CD    1 
ATOM   4639 N  N     . ASN B 1 165 ? 5.535   32.144  11.932 1.00 52.36  ? 191 ASN B N     1 
ATOM   4640 C  CA    . ASN B 1 165 ? 5.125   30.865  12.497 1.00 49.47  ? 191 ASN B CA    1 
ATOM   4641 C  C     . ASN B 1 165 ? 6.312   29.966  12.831 1.00 52.97  ? 191 ASN B C     1 
ATOM   4642 O  O     . ASN B 1 165 ? 6.213   28.744  12.737 1.00 58.36  ? 191 ASN B O     1 
ATOM   4643 C  CB    . ASN B 1 165 ? 4.178   30.145  11.534 1.00 52.64  ? 191 ASN B CB    1 
ATOM   4644 N  N     . PHE B 1 166 ? 7.429   30.573  13.227 1.00 48.65  ? 192 PHE B N     1 
ATOM   4645 C  CA    . PHE B 1 166 ? 8.637   29.821  13.564 1.00 48.85  ? 192 PHE B CA    1 
ATOM   4646 C  C     . PHE B 1 166 ? 8.473   29.007  14.847 1.00 59.61  ? 192 PHE B C     1 
ATOM   4647 O  O     . PHE B 1 166 ? 7.476   29.148  15.556 1.00 62.53  ? 192 PHE B O     1 
ATOM   4648 C  CB    . PHE B 1 166 ? 9.834   30.766  13.690 1.00 48.62  ? 192 PHE B CB    1 
ATOM   4649 C  CG    . PHE B 1 166 ? 9.890   31.518  14.995 1.00 53.68  ? 192 PHE B CG    1 
ATOM   4650 C  CD1   . PHE B 1 166 ? 10.843  31.204  15.953 1.00 54.57  ? 192 PHE B CD1   1 
ATOM   4651 C  CD2   . PHE B 1 166 ? 9.000   32.549  15.258 1.00 51.97  ? 192 PHE B CD2   1 
ATOM   4652 C  CE1   . PHE B 1 166 ? 10.905  31.904  17.151 1.00 52.02  ? 192 PHE B CE1   1 
ATOM   4653 C  CE2   . PHE B 1 166 ? 9.057   33.248  16.453 1.00 54.49  ? 192 PHE B CE2   1 
ATOM   4654 C  CZ    . PHE B 1 166 ? 10.009  32.924  17.400 1.00 49.13  ? 192 PHE B CZ    1 
ATOM   4655 N  N     . MET B 1 167 ? 9.456   28.158  15.140 1.00 62.01  ? 193 MET B N     1 
ATOM   4656 C  CA    . MET B 1 167 ? 9.335   27.182  16.219 1.00 51.54  ? 193 MET B CA    1 
ATOM   4657 C  C     . MET B 1 167 ? 10.511  27.294  17.189 1.00 53.42  ? 193 MET B C     1 
ATOM   4658 O  O     . MET B 1 167 ? 11.641  26.924  16.869 1.00 48.45  ? 193 MET B O     1 
ATOM   4659 C  CB    . MET B 1 167 ? 9.242   25.763  15.644 1.00 57.43  ? 193 MET B CB    1 
ATOM   4660 C  CG    . MET B 1 167 ? 8.709   24.713  16.616 1.00 69.19  ? 193 MET B CG    1 
ATOM   4661 S  SD    . MET B 1 167 ? 8.157   23.210  15.773 1.00 84.26  ? 193 MET B SD    1 
ATOM   4662 C  CE    . MET B 1 167 ? 9.725   22.447  15.363 1.00 63.00  ? 193 MET B CE    1 
ATOM   4663 N  N     . ALA B 1 168 ? 10.234  27.812  18.380 1.00 59.56  ? 194 ALA B N     1 
ATOM   4664 C  CA    . ALA B 1 168 ? 11.264  27.985  19.395 1.00 54.61  ? 194 ALA B CA    1 
ATOM   4665 C  C     . ALA B 1 168 ? 11.419  26.746  20.269 1.00 62.21  ? 194 ALA B C     1 
ATOM   4666 O  O     . ALA B 1 168 ? 10.455  26.270  20.866 1.00 61.10  ? 194 ALA B O     1 
ATOM   4667 C  CB    . ALA B 1 168 ? 10.956  29.197  20.253 1.00 52.68  ? 194 ALA B CB    1 
ATOM   4668 N  N     . MET B 1 169 ? 12.641  26.226  20.320 1.00 63.88  ? 195 MET B N     1 
ATOM   4669 C  CA    . MET B 1 169 ? 12.968  25.065  21.135 1.00 57.77  ? 195 MET B CA    1 
ATOM   4670 C  C     . MET B 1 169 ? 13.085  25.447  22.603 1.00 58.14  ? 195 MET B C     1 
ATOM   4671 O  O     . MET B 1 169 ? 12.221  25.116  23.413 1.00 59.64  ? 195 MET B O     1 
ATOM   4672 C  CB    . MET B 1 169 ? 14.273  24.433  20.654 1.00 56.72  ? 195 MET B CB    1 
ATOM   4673 C  CG    . MET B 1 169 ? 14.228  23.912  19.226 1.00 56.28  ? 195 MET B CG    1 
ATOM   4674 S  SD    . MET B 1 169 ? 13.053  22.557  19.030 1.00 81.72  ? 195 MET B SD    1 
ATOM   4675 C  CE    . MET B 1 169 ? 11.658  23.383  18.272 1.00 67.76  ? 195 MET B CE    1 
ATOM   4676 N  N     . SER B 1 170 ? 14.153  26.165  22.933 1.00 58.53  ? 196 SER B N     1 
ATOM   4677 C  CA    . SER B 1 170 ? 14.384  26.635  24.291 1.00 51.45  ? 196 SER B CA    1 
ATOM   4678 C  C     . SER B 1 170 ? 14.446  28.155  24.322 1.00 52.84  ? 196 SER B C     1 
ATOM   4679 O  O     . SER B 1 170 ? 13.770  28.825  23.545 1.00 56.55  ? 196 SER B O     1 
ATOM   4680 C  CB    . SER B 1 170 ? 15.682  26.050  24.844 1.00 59.49  ? 196 SER B CB    1 
ATOM   4681 O  OG    . SER B 1 170 ? 16.730  26.168  23.895 1.00 55.51  ? 196 SER B OG    1 
ATOM   4682 N  N     . LEU B 1 171 ? 15.261  28.701  25.219 1.00 53.78  ? 197 LEU B N     1 
ATOM   4683 C  CA    . LEU B 1 171 ? 15.446  30.145  25.274 1.00 48.82  ? 197 LEU B CA    1 
ATOM   4684 C  C     . LEU B 1 171 ? 16.509  30.580  24.271 1.00 46.91  ? 197 LEU B C     1 
ATOM   4685 O  O     . LEU B 1 171 ? 16.584  31.756  23.919 1.00 46.66  ? 197 LEU B O     1 
ATOM   4686 C  CB    . LEU B 1 171 ? 15.830  30.609  26.682 1.00 42.43  ? 197 LEU B CB    1 
ATOM   4687 C  CG    . LEU B 1 171 ? 14.759  30.566  27.775 1.00 44.48  ? 197 LEU B CG    1 
ATOM   4688 C  CD1   . LEU B 1 171 ? 15.337  31.064  29.087 1.00 45.92  ? 197 LEU B CD1   1 
ATOM   4689 C  CD2   . LEU B 1 171 ? 13.515  31.356  27.393 1.00 46.40  ? 197 LEU B CD2   1 
ATOM   4690 N  N     . ASP B 1 172 ? 17.358  29.662  23.860 1.00 55.86  ? 198 ASP B N     1 
ATOM   4691 C  CA    . ASP B 1 172 ? 18.453  29.986  22.955 1.00 54.74  ? 198 ASP B CA    1 
ATOM   4692 C  C     . ASP B 1 172 ? 18.512  29.223  21.652 1.00 47.16  ? 198 ASP B C     1 
ATOM   4693 O  O     . ASP B 1 172 ? 19.514  29.220  21.010 1.00 50.88  ? 198 ASP B O     1 
ATOM   4694 C  CB    . ASP B 1 172 ? 19.801  29.905  23.702 1.00 50.34  ? 198 ASP B CB    1 
ATOM   4695 C  CG    . ASP B 1 172 ? 20.458  28.562  23.611 1.00 54.32  ? 198 ASP B CG    1 
ATOM   4696 O  OD1   . ASP B 1 172 ? 19.782  27.582  23.369 1.00 59.69  ? 198 ASP B OD1   1 
ATOM   4697 O  OD2   . ASP B 1 172 ? 21.666  28.467  23.770 1.00 52.57  ? 198 ASP B OD2   1 
ATOM   4698 N  N     . GLU B 1 173 ? 17.439  28.573  21.287 1.00 46.92  ? 199 GLU B N     1 
ATOM   4699 C  CA    . GLU B 1 173 ? 17.417  27.789  20.062 1.00 47.16  ? 199 GLU B CA    1 
ATOM   4700 C  C     . GLU B 1 173 ? 16.111  28.013  19.333 1.00 49.22  ? 199 GLU B C     1 
ATOM   4701 O  O     . GLU B 1 173 ? 15.066  28.209  19.961 1.00 42.62  ? 199 GLU B O     1 
ATOM   4702 C  CB    . GLU B 1 173 ? 17.583  26.293  20.345 1.00 52.47  ? 199 GLU B CB    1 
ATOM   4703 C  CG    . GLU B 1 173 ? 19.019  25.778  20.424 1.00 55.37  ? 199 GLU B CG    1 
ATOM   4704 C  CD    . GLU B 1 173 ? 19.088  24.246  20.472 1.00 64.79  ? 199 GLU B CD    1 
ATOM   4705 O  OE1   . GLU B 1 173 ? 18.170  23.590  19.922 1.00 57.75  ? 199 GLU B OE1   1 
ATOM   4706 O  OE2   . GLU B 1 173 ? 20.058  23.698  21.051 1.00 61.72  ? 199 GLU B OE2   1 
ATOM   4707 N  N     . ALA B 1 174 ? 16.172  27.981  18.004 1.00 48.80  ? 200 ALA B N     1 
ATOM   4708 C  CA    . ALA B 1 174 ? 14.950  28.071  17.210 1.00 42.32  ? 200 ALA B CA    1 
ATOM   4709 C  C     . ALA B 1 174 ? 15.136  27.581  15.788 1.00 46.33  ? 200 ALA B C     1 
ATOM   4710 O  O     . ALA B 1 174 ? 16.227  27.680  15.227 1.00 52.23  ? 200 ALA B O     1 
ATOM   4711 C  CB    . ALA B 1 174 ? 14.439  29.500  17.191 1.00 52.63  ? 200 ALA B CB    1 
ATOM   4712 N  N     . TYR B 1 175 ? 14.046  27.078  15.209 1.00 51.68  ? 201 TYR B N     1 
ATOM   4713 C  CA    . TYR B 1 175 ? 14.000  26.702  13.795 1.00 45.28  ? 201 TYR B CA    1 
ATOM   4714 C  C     . TYR B 1 175 ? 13.158  27.715  13.019 1.00 41.31  ? 201 TYR B C     1 
ATOM   4715 O  O     . TYR B 1 175 ? 12.108  28.148  13.490 1.00 42.12  ? 201 TYR B O     1 
ATOM   4716 C  CB    . TYR B 1 175 ? 13.408  25.298  13.598 1.00 50.13  ? 201 TYR B CB    1 
ATOM   4717 C  CG    . TYR B 1 175 ? 14.229  24.124  14.104 1.00 44.88  ? 201 TYR B CG    1 
ATOM   4718 C  CD1   . TYR B 1 175 ? 15.309  23.640  13.378 1.00 47.72  ? 201 TYR B CD1   1 
ATOM   4719 C  CD2   . TYR B 1 175 ? 13.869  23.448  15.262 1.00 48.23  ? 201 TYR B CD2   1 
ATOM   4720 C  CE1   . TYR B 1 175 ? 16.044  22.549  13.819 1.00 49.04  ? 201 TYR B CE1   1 
ATOM   4721 C  CE2   . TYR B 1 175 ? 14.595  22.355  15.713 1.00 52.10  ? 201 TYR B CE2   1 
ATOM   4722 C  CZ    . TYR B 1 175 ? 15.683  21.908  14.988 1.00 52.36  ? 201 TYR B CZ    1 
ATOM   4723 O  OH    . TYR B 1 175 ? 16.411  20.818  15.427 1.00 42.57  ? 201 TYR B OH    1 
ATOM   4724 N  N     . LEU B 1 176 ? 13.603  28.058  11.816 1.00 47.69  ? 202 LEU B N     1 
ATOM   4725 C  CA    . LEU B 1 176 ? 12.889  28.986  10.945 1.00 42.26  ? 202 LEU B CA    1 
ATOM   4726 C  C     . LEU B 1 176 ? 12.710  28.419  9.551  1.00 41.82  ? 202 LEU B C     1 
ATOM   4727 O  O     . LEU B 1 176 ? 13.625  27.813  8.999  1.00 43.11  ? 202 LEU B O     1 
ATOM   4728 C  CB    . LEU B 1 176 ? 13.633  30.318  10.841 1.00 36.71  ? 202 LEU B CB    1 
ATOM   4729 C  CG    . LEU B 1 176 ? 13.775  31.236  12.049 1.00 37.85  ? 202 LEU B CG    1 
ATOM   4730 C  CD1   . LEU B 1 176 ? 14.809  30.712  13.023 1.00 47.28  ? 202 LEU B CD1   1 
ATOM   4731 C  CD2   . LEU B 1 176 ? 14.167  32.614  11.567 1.00 36.49  ? 202 LEU B CD2   1 
ATOM   4732 N  N     . ASN B 1 177 ? 11.533  28.637  8.979  1.00 46.45  ? 203 ASN B N     1 
ATOM   4733 C  CA    . ASN B 1 177 ? 11.299  28.324  7.579  1.00 47.23  ? 203 ASN B CA    1 
ATOM   4734 C  C     . ASN B 1 177 ? 11.276  29.622  6.777  1.00 47.48  ? 203 ASN B C     1 
ATOM   4735 O  O     . ASN B 1 177 ? 10.234  30.278  6.659  1.00 48.15  ? 203 ASN B O     1 
ATOM   4736 C  CB    . ASN B 1 177 ? 9.990   27.552  7.408  1.00 47.49  ? 203 ASN B CB    1 
ATOM   4737 C  CG    . ASN B 1 177 ? 9.872   26.892  6.048  1.00 50.80  ? 203 ASN B CG    1 
ATOM   4738 O  OD1   . ASN B 1 177 ? 10.676  27.141  5.148  1.00 44.99  ? 203 ASN B OD1   1 
ATOM   4739 N  ND2   . ASN B 1 177 ? 8.862   26.042  5.893  1.00 53.04  ? 203 ASN B ND2   1 
ATOM   4740 N  N     . ILE B 1 178 ? 12.433  30.001  6.244  1.00 46.45  ? 204 ILE B N     1 
ATOM   4741 C  CA    . ILE B 1 178 ? 12.574  31.291  5.582  1.00 50.03  ? 204 ILE B CA    1 
ATOM   4742 C  C     . ILE B 1 178 ? 12.381  31.211  4.073  1.00 50.69  ? 204 ILE B C     1 
ATOM   4743 O  O     . ILE B 1 178 ? 13.003  31.954  3.319  1.00 56.57  ? 204 ILE B O     1 
ATOM   4744 C  CB    . ILE B 1 178 ? 13.951  31.908  5.877  1.00 48.69  ? 204 ILE B CB    1 
ATOM   4745 C  CG1   . ILE B 1 178 ? 15.073  31.064  5.264  1.00 41.58  ? 204 ILE B CG1   1 
ATOM   4746 C  CG2   . ILE B 1 178 ? 14.144  32.037  7.377  1.00 35.33  ? 204 ILE B CG2   1 
ATOM   4747 C  CD1   . ILE B 1 178 ? 16.407  31.778  5.215  1.00 38.26  ? 204 ILE B CD1   1 
ATOM   4748 N  N     . THR B 1 179 ? 11.497  30.322  3.638  1.00 46.14  ? 205 THR B N     1 
ATOM   4749 C  CA    . THR B 1 179 ? 11.239  30.157  2.213  1.00 51.33  ? 205 THR B CA    1 
ATOM   4750 C  C     . THR B 1 179 ? 10.406  31.328  1.690  1.00 62.34  ? 205 THR B C     1 
ATOM   4751 O  O     . THR B 1 179 ? 10.764  31.974  0.690  1.00 62.10  ? 205 THR B O     1 
ATOM   4752 C  CB    . THR B 1 179 ? 10.524  28.825  1.926  1.00 51.38  ? 205 THR B CB    1 
ATOM   4753 O  OG1   . THR B 1 179 ? 11.370  27.740  2.322  1.00 57.27  ? 205 THR B OG1   1 
ATOM   4754 C  CG2   . THR B 1 179 ? 10.208  28.692  0.453  1.00 54.30  ? 205 THR B CG2   1 
ATOM   4755 N  N     . LYS B 1 180 ? 9.306   31.605  2.388  1.00 61.02  ? 206 LYS B N     1 
ATOM   4756 C  CA    . LYS B 1 180 ? 8.430   32.728  2.072  1.00 63.77  ? 206 LYS B CA    1 
ATOM   4757 C  C     . LYS B 1 180 ? 9.237   34.014  2.026  1.00 62.08  ? 206 LYS B C     1 
ATOM   4758 O  O     . LYS B 1 180 ? 9.153   34.800  1.075  1.00 66.32  ? 206 LYS B O     1 
ATOM   4759 C  CB    . LYS B 1 180 ? 7.308   32.843  3.108  1.00 58.92  ? 206 LYS B CB    1 
ATOM   4760 C  CG    . LYS B 1 180 ? 6.027   32.105  2.727  1.00 67.88  ? 206 LYS B CG    1 
ATOM   4761 C  CD    . LYS B 1 180 ? 5.376   32.769  1.524  1.00 82.08  ? 206 LYS B CD    1 
ATOM   4762 C  CE    . LYS B 1 180 ? 5.006   34.210  1.860  1.00 77.95  ? 206 LYS B CE    1 
ATOM   4763 N  NZ    . LYS B 1 180 ? 4.561   34.978  0.665  1.00 70.09  ? 206 LYS B NZ    1 
ATOM   4764 N  N     . HIS B 1 181 ? 10.036  34.218  3.063  1.00 58.47  ? 207 HIS B N     1 
ATOM   4765 C  CA    . HIS B 1 181 ? 10.846  35.419  3.148  1.00 57.25  ? 207 HIS B CA    1 
ATOM   4766 C  C     . HIS B 1 181 ? 11.859  35.540  2.019  1.00 61.45  ? 207 HIS B C     1 
ATOM   4767 O  O     . HIS B 1 181 ? 12.000  36.609  1.454  1.00 64.15  ? 207 HIS B O     1 
ATOM   4768 C  CB    . HIS B 1 181 ? 11.580  35.476  4.477  1.00 58.75  ? 207 HIS B CB    1 
ATOM   4769 C  CG    . HIS B 1 181 ? 12.581  36.582  4.554  1.00 54.64  ? 207 HIS B CG    1 
ATOM   4770 N  ND1   . HIS B 1 181 ? 12.243  37.869  4.911  1.00 59.95  ? 207 HIS B ND1   1 
ATOM   4771 C  CD2   . HIS B 1 181 ? 13.916  36.593  4.320  1.00 52.05  ? 207 HIS B CD2   1 
ATOM   4772 C  CE1   . HIS B 1 181 ? 13.323  38.627  4.891  1.00 60.40  ? 207 HIS B CE1   1 
ATOM   4773 N  NE2   . HIS B 1 181 ? 14.353  37.878  4.539  1.00 58.03  ? 207 HIS B NE2   1 
ATOM   4774 N  N     . LEU B 1 182 ? 12.575  34.461  1.706  1.00 59.11  ? 208 LEU B N     1 
ATOM   4775 C  CA    . LEU B 1 182 ? 13.543  34.488  0.608  1.00 56.74  ? 208 LEU B CA    1 
ATOM   4776 C  C     . LEU B 1 182 ? 12.841  34.893  -0.685 1.00 60.00  ? 208 LEU B C     1 
ATOM   4777 O  O     . LEU B 1 182 ? 13.307  35.776  -1.434 1.00 57.85  ? 208 LEU B O     1 
ATOM   4778 C  CB    . LEU B 1 182 ? 14.216  33.125  0.449  1.00 46.84  ? 208 LEU B CB    1 
ATOM   4779 C  CG    . LEU B 1 182 ? 15.463  32.900  1.302  1.00 47.89  ? 208 LEU B CG    1 
ATOM   4780 C  CD1   . LEU B 1 182 ? 15.926  31.456  1.187  1.00 48.09  ? 208 LEU B CD1   1 
ATOM   4781 C  CD2   . LEU B 1 182 ? 16.566  33.840  0.879  1.00 40.28  ? 208 LEU B CD2   1 
ATOM   4782 N  N     . GLU B 1 183 ? 11.704  34.237  -0.911 1.00 63.47  ? 209 GLU B N     1 
ATOM   4783 C  CA    . GLU B 1 183 ? 10.823  34.520  -2.036 1.00 63.53  ? 209 GLU B CA    1 
ATOM   4784 C  C     . GLU B 1 183 ? 10.548  36.004  -2.166 1.00 65.68  ? 209 GLU B C     1 
ATOM   4785 O  O     . GLU B 1 183 ? 10.846  36.614  -3.193 1.00 71.35  ? 209 GLU B O     1 
ATOM   4786 C  CB    . GLU B 1 183 ? 9.502   33.781  -1.869 1.00 69.04  ? 209 GLU B CB    1 
ATOM   4787 C  CG    . GLU B 1 183 ? 9.150   32.820  -2.973 1.00 76.98  ? 209 GLU B CG    1 
ATOM   4788 C  CD    . GLU B 1 183 ? 7.854   32.081  -2.672 1.00 94.14  ? 209 GLU B CD    1 
ATOM   4789 O  OE1   . GLU B 1 183 ? 6.841   32.777  -2.403 1.00 90.07  ? 209 GLU B OE1   1 
ATOM   4790 O  OE2   . GLU B 1 183 ? 7.859   30.821  -2.678 1.00 92.03  ? 209 GLU B OE2   1 
ATOM   4791 N  N     . GLU B 1 184 ? 9.979   36.586  -1.116 1.00 69.47  ? 210 GLU B N     1 
ATOM   4792 C  CA    . GLU B 1 184 ? 9.630   38.003  -1.164 1.00 65.36  ? 210 GLU B CA    1 
ATOM   4793 C  C     . GLU B 1 184 ? 10.844  38.924  -1.105 1.00 60.92  ? 210 GLU B C     1 
ATOM   4794 O  O     . GLU B 1 184 ? 10.722  40.117  -1.348 1.00 70.63  ? 210 GLU B O     1 
ATOM   4795 C  CB    . GLU B 1 184 ? 8.662   38.348  -0.036 1.00 59.53  ? 210 GLU B CB    1 
ATOM   4796 C  CG    . GLU B 1 184 ? 7.270   37.775  -0.249 1.00 77.29  ? 210 GLU B CG    1 
ATOM   4797 C  CD    . GLU B 1 184 ? 6.415   37.820  1.003  1.00 91.05  ? 210 GLU B CD    1 
ATOM   4798 O  OE1   . GLU B 1 184 ? 6.891   38.362  2.028  1.00 92.38  ? 210 GLU B OE1   1 
ATOM   4799 O  OE2   . GLU B 1 184 ? 5.269   37.313  0.956  1.00 97.41  ? 210 GLU B OE2   1 
ATOM   4800 N  N     . ARG B 1 185 ? 12.013  38.367  -0.812 1.00 59.42  ? 211 ARG B N     1 
ATOM   4801 C  CA    . ARG B 1 185 ? 13.215  39.165  -0.608 1.00 59.42  ? 211 ARG B CA    1 
ATOM   4802 C  C     . ARG B 1 185 ? 14.009  39.221  -1.900 1.00 61.66  ? 211 ARG B C     1 
ATOM   4803 O  O     . ARG B 1 185 ? 14.939  40.017  -2.037 1.00 56.85  ? 211 ARG B O     1 
ATOM   4804 C  CB    . ARG B 1 185 ? 14.080  38.582  0.510  1.00 52.43  ? 211 ARG B CB    1 
ATOM   4805 C  CG    . ARG B 1 185 ? 15.231  39.468  0.953  1.00 54.09  ? 211 ARG B CG    1 
ATOM   4806 C  CD    . ARG B 1 185 ? 16.321  38.639  1.594  1.00 52.91  ? 211 ARG B CD    1 
ATOM   4807 N  NE    . ARG B 1 185 ? 17.469  39.431  2.027  1.00 52.02  ? 211 ARG B NE    1 
ATOM   4808 C  CZ    . ARG B 1 185 ? 17.524  40.092  3.179  1.00 52.89  ? 211 ARG B CZ    1 
ATOM   4809 N  NH1   . ARG B 1 185 ? 16.495  40.058  4.014  1.00 51.99  ? 211 ARG B NH1   1 
ATOM   4810 N  NH2   . ARG B 1 185 ? 18.607  40.788  3.496  1.00 51.07  ? 211 ARG B NH2   1 
ATOM   4811 N  N     . GLN B 1 186 ? 13.645  38.364  -2.849 1.00 68.76  ? 212 GLN B N     1 
ATOM   4812 C  CA    . GLN B 1 186 ? 14.294  38.406  -4.158 1.00 70.72  ? 212 GLN B CA    1 
ATOM   4813 C  C     . GLN B 1 186 ? 14.168  39.796  -4.799 1.00 74.90  ? 212 GLN B C     1 
ATOM   4814 O  O     . GLN B 1 186 ? 15.134  40.326  -5.352 1.00 75.02  ? 212 GLN B O     1 
ATOM   4815 C  CB    . GLN B 1 186 ? 13.698  37.350  -5.088 1.00 70.39  ? 212 GLN B CB    1 
ATOM   4816 C  CG    . GLN B 1 186 ? 13.752  35.941  -4.534 1.00 74.91  ? 212 GLN B CG    1 
ATOM   4817 C  CD    . GLN B 1 186 ? 14.626  35.008  -5.362 1.00 85.04  ? 212 GLN B CD    1 
ATOM   4818 O  OE1   . GLN B 1 186 ? 15.790  34.763  -5.029 1.00 85.62  ? 212 GLN B OE1   1 
ATOM   4819 N  NE2   . GLN B 1 186 ? 14.061  34.472  -6.440 1.00 77.59  ? 212 GLN B NE2   1 
ATOM   4820 N  N     . ASN B 1 187 ? 12.972  40.377  -4.724 1.00 75.96  ? 213 ASN B N     1 
ATOM   4821 C  CA    . ASN B 1 187 ? 12.710  41.710  -5.275 1.00 74.69  ? 213 ASN B CA    1 
ATOM   4822 C  C     . ASN B 1 187 ? 12.638  42.834  -4.228 1.00 73.09  ? 213 ASN B C     1 
ATOM   4823 O  O     . ASN B 1 187 ? 11.647  43.566  -4.162 1.00 72.52  ? 213 ASN B O     1 
ATOM   4824 C  CB    . ASN B 1 187 ? 11.415  41.685  -6.092 1.00 76.59  ? 213 ASN B CB    1 
ATOM   4825 C  CG    . ASN B 1 187 ? 10.286  40.954  -5.381 1.00 79.90  ? 213 ASN B CG    1 
ATOM   4826 O  OD1   . ASN B 1 187 ? 10.028  39.778  -5.647 1.00 81.89  ? 213 ASN B OD1   1 
ATOM   4827 N  ND2   . ASN B 1 187 ? 9.612   41.646  -4.466 1.00 77.67  ? 213 ASN B ND2   1 
ATOM   4828 N  N     . TRP B 1 188 ? 13.681  42.973  -3.416 1.00 68.97  ? 214 TRP B N     1 
ATOM   4829 C  CA    . TRP B 1 188 ? 13.669  43.951  -2.328 1.00 68.21  ? 214 TRP B CA    1 
ATOM   4830 C  C     . TRP B 1 188 ? 14.674  45.069  -2.571 1.00 66.45  ? 214 TRP B C     1 
ATOM   4831 O  O     . TRP B 1 188 ? 15.859  44.801  -2.749 1.00 61.57  ? 214 TRP B O     1 
ATOM   4832 C  CB    . TRP B 1 188 ? 13.979  43.274  -0.989 1.00 69.16  ? 214 TRP B CB    1 
ATOM   4833 C  CG    . TRP B 1 188 ? 12.771  42.929  -0.169 1.00 65.89  ? 214 TRP B CG    1 
ATOM   4834 C  CD1   . TRP B 1 188 ? 11.487  42.795  -0.613 1.00 66.46  ? 214 TRP B CD1   1 
ATOM   4835 C  CD2   . TRP B 1 188 ? 12.737  42.670  1.238  1.00 61.14  ? 214 TRP B CD2   1 
ATOM   4836 N  NE1   . TRP B 1 188 ? 10.656  42.461  0.429  1.00 59.74  ? 214 TRP B NE1   1 
ATOM   4837 C  CE2   . TRP B 1 188 ? 11.398  42.384  1.579  1.00 63.09  ? 214 TRP B CE2   1 
ATOM   4838 C  CE3   . TRP B 1 188 ? 13.708  42.658  2.246  1.00 58.66  ? 214 TRP B CE3   1 
ATOM   4839 C  CZ2   . TRP B 1 188 ? 11.004  42.086  2.882  1.00 61.24  ? 214 TRP B CZ2   1 
ATOM   4840 C  CZ3   . TRP B 1 188 ? 13.317  42.361  3.540  1.00 60.46  ? 214 TRP B CZ3   1 
ATOM   4841 C  CH2   . TRP B 1 188 ? 11.975  42.078  3.846  1.00 64.29  ? 214 TRP B CH2   1 
ATOM   4842 N  N     . PRO B 1 189 ? 14.204  46.329  -2.587 1.00 71.10  ? 215 PRO B N     1 
ATOM   4843 C  CA    . PRO B 1 189 ? 15.104  47.486  -2.699 1.00 67.77  ? 215 PRO B CA    1 
ATOM   4844 C  C     . PRO B 1 189 ? 16.136  47.474  -1.574 1.00 65.03  ? 215 PRO B C     1 
ATOM   4845 O  O     . PRO B 1 189 ? 15.864  46.886  -0.528 1.00 70.30  ? 215 PRO B O     1 
ATOM   4846 C  CB    . PRO B 1 189 ? 14.156  48.694  -2.587 1.00 60.75  ? 215 PRO B CB    1 
ATOM   4847 C  CG    . PRO B 1 189 ? 12.910  48.154  -1.961 1.00 65.05  ? 215 PRO B CG    1 
ATOM   4848 C  CD    . PRO B 1 189 ? 12.798  46.739  -2.440 1.00 71.54  ? 215 PRO B CD    1 
ATOM   4849 N  N     . GLU B 1 190 ? 17.291  48.101  -1.782 1.00 57.39  ? 216 GLU B N     1 
ATOM   4850 C  CA    . GLU B 1 190 ? 18.400  47.995  -0.835 1.00 63.18  ? 216 GLU B CA    1 
ATOM   4851 C  C     . GLU B 1 190 ? 18.085  48.488  0.589  1.00 66.12  ? 216 GLU B C     1 
ATOM   4852 O  O     . GLU B 1 190 ? 18.705  48.029  1.551  1.00 66.75  ? 216 GLU B O     1 
ATOM   4853 C  CB    . GLU B 1 190 ? 19.622  48.755  -1.375 1.00 56.12  ? 216 GLU B CB    1 
ATOM   4854 N  N     . ASP B 1 191 ? 17.079  49.347  0.744  1.00 66.07  ? 217 ASP B N     1 
ATOM   4855 C  CA    . ASP B 1 191 ? 16.879  50.019  2.027  1.00 70.95  ? 217 ASP B CA    1 
ATOM   4856 C  C     . ASP B 1 191 ? 15.936  49.242  2.949  1.00 68.31  ? 217 ASP B C     1 
ATOM   4857 O  O     . ASP B 1 191 ? 15.722  49.634  4.102  1.00 62.94  ? 217 ASP B O     1 
ATOM   4858 C  CB    . ASP B 1 191 ? 16.343  51.434  1.804  1.00 65.74  ? 217 ASP B CB    1 
ATOM   4859 N  N     . LYS B 1 192 ? 15.405  48.122  2.456  1.00 63.77  ? 218 LYS B N     1 
ATOM   4860 C  CA    . LYS B 1 192 ? 14.768  47.143  3.336  1.00 58.78  ? 218 LYS B CA    1 
ATOM   4861 C  C     . LYS B 1 192 ? 15.821  46.123  3.734  1.00 57.78  ? 218 LYS B C     1 
ATOM   4862 O  O     . LYS B 1 192 ? 15.545  45.221  4.526  1.00 68.44  ? 218 LYS B O     1 
ATOM   4863 C  CB    . LYS B 1 192 ? 13.594  46.422  2.668  1.00 57.11  ? 218 LYS B CB    1 
ATOM   4864 C  CG    . LYS B 1 192 ? 12.795  47.246  1.667  1.00 57.28  ? 218 LYS B CG    1 
ATOM   4865 C  CD    . LYS B 1 192 ? 11.620  46.435  1.136  1.00 57.71  ? 218 LYS B CD    1 
ATOM   4866 C  CE    . LYS B 1 192 ? 10.618  46.116  2.238  1.00 60.30  ? 218 LYS B CE    1 
ATOM   4867 N  NZ    . LYS B 1 192 ? 9.345   45.559  1.696  1.00 62.97  ? 218 LYS B NZ    1 
ATOM   4868 N  N     . ARG B 1 193 ? 17.022  46.252  3.171  1.00 56.28  ? 219 ARG B N     1 
ATOM   4869 C  CA    . ARG B 1 193 ? 18.107  45.336  3.510  1.00 56.62  ? 219 ARG B CA    1 
ATOM   4870 C  C     . ARG B 1 193 ? 19.255  46.121  4.115  1.00 55.83  ? 219 ARG B C     1 
ATOM   4871 O  O     . ARG B 1 193 ? 20.391  45.654  4.163  1.00 51.21  ? 219 ARG B O     1 
ATOM   4872 C  CB    . ARG B 1 193 ? 18.580  44.555  2.280  1.00 56.17  ? 219 ARG B CB    1 
ATOM   4873 C  CG    . ARG B 1 193 ? 17.502  43.728  1.604  1.00 52.53  ? 219 ARG B CG    1 
ATOM   4874 C  CD    . ARG B 1 193 ? 18.052  42.956  0.415  1.00 57.01  ? 219 ARG B CD    1 
ATOM   4875 N  NE    . ARG B 1 193 ? 17.716  43.595  -0.854 1.00 66.18  ? 219 ARG B NE    1 
ATOM   4876 C  CZ    . ARG B 1 193 ? 18.602  44.187  -1.650 1.00 63.35  ? 219 ARG B CZ    1 
ATOM   4877 N  NH1   . ARG B 1 193 ? 19.886  44.214  -1.318 1.00 59.21  ? 219 ARG B NH1   1 
ATOM   4878 N  NH2   . ARG B 1 193 ? 18.203  44.748  -2.782 1.00 64.00  ? 219 ARG B NH2   1 
ATOM   4879 N  N     . ARG B 1 194 ? 18.942  47.324  4.580  1.00 61.34  ? 220 ARG B N     1 
ATOM   4880 C  CA    . ARG B 1 194 ? 19.958  48.203  5.131  1.00 65.58  ? 220 ARG B CA    1 
ATOM   4881 C  C     . ARG B 1 194 ? 19.757  48.359  6.633  1.00 63.95  ? 220 ARG B C     1 
ATOM   4882 O  O     . ARG B 1 194 ? 18.658  48.682  7.095  1.00 58.28  ? 220 ARG B O     1 
ATOM   4883 C  CB    . ARG B 1 194 ? 19.934  49.570  4.441  1.00 60.97  ? 220 ARG B CB    1 
ATOM   4884 C  CG    . ARG B 1 194 ? 21.173  50.412  4.719  1.00 68.03  ? 220 ARG B CG    1 
ATOM   4885 C  CD    . ARG B 1 194 ? 21.064  51.796  4.106  1.00 73.80  ? 220 ARG B CD    1 
ATOM   4886 N  NE    . ARG B 1 194 ? 20.796  51.713  2.673  1.00 73.42  ? 220 ARG B NE    1 
ATOM   4887 C  CZ    . ARG B 1 194 ? 21.737  51.601  1.739  1.00 67.08  ? 220 ARG B CZ    1 
ATOM   4888 N  NH1   . ARG B 1 194 ? 23.018  51.559  2.082  1.00 65.37  ? 220 ARG B NH1   1 
ATOM   4889 N  NH2   . ARG B 1 194 ? 21.397  51.523  0.459  1.00 58.32  ? 220 ARG B NH2   1 
ATOM   4890 N  N     . TYR B 1 195 ? 20.825  48.121  7.391  1.00 65.49  ? 221 TYR B N     1 
ATOM   4891 C  CA    . TYR B 1 195 ? 20.767  48.252  8.845  1.00 73.99  ? 221 TYR B CA    1 
ATOM   4892 C  C     . TYR B 1 195 ? 21.935  49.084  9.363  1.00 80.33  ? 221 TYR B C     1 
ATOM   4893 O  O     . TYR B 1 195 ? 23.015  49.089  8.779  1.00 79.28  ? 221 TYR B O     1 
ATOM   4894 C  CB    . TYR B 1 195 ? 20.732  46.862  9.506  1.00 63.93  ? 221 TYR B CB    1 
ATOM   4895 C  CG    . TYR B 1 195 ? 19.418  46.146  9.273  1.00 51.77  ? 221 TYR B CG    1 
ATOM   4896 C  CD1   . TYR B 1 195 ? 18.319  46.397  10.082 1.00 49.45  ? 221 TYR B CD1   1 
ATOM   4897 C  CD2   . TYR B 1 195 ? 19.259  45.269  8.214  1.00 49.07  ? 221 TYR B CD2   1 
ATOM   4898 C  CE1   . TYR B 1 195 ? 17.106  45.771  9.864  1.00 40.67  ? 221 TYR B CE1   1 
ATOM   4899 C  CE2   . TYR B 1 195 ? 18.050  44.639  7.987  1.00 50.48  ? 221 TYR B CE2   1 
ATOM   4900 C  CZ    . TYR B 1 195 ? 16.975  44.893  8.815  1.00 47.03  ? 221 TYR B CZ    1 
ATOM   4901 O  OH    . TYR B 1 195 ? 15.767  44.265  8.591  1.00 47.93  ? 221 TYR B OH    1 
ATOM   4902 N  N     . PHE B 1 196 ? 21.711  49.787  10.467 1.00 80.60  ? 222 PHE B N     1 
ATOM   4903 C  CA    . PHE B 1 196 ? 22.726  50.671  11.026 1.00 84.23  ? 222 PHE B CA    1 
ATOM   4904 C  C     . PHE B 1 196 ? 23.541  49.985  12.122 1.00 88.36  ? 222 PHE B C     1 
ATOM   4905 O  O     . PHE B 1 196 ? 23.010  49.188  12.901 1.00 90.26  ? 222 PHE B O     1 
ATOM   4906 C  CB    . PHE B 1 196 ? 22.075  51.945  11.573 1.00 93.89  ? 222 PHE B CB    1 
ATOM   4907 N  N     . ILE B 1 197 ? 24.836  50.293  12.165 1.00 86.45  ? 223 ILE B N     1 
ATOM   4908 C  CA    . ILE B 1 197 ? 25.703  49.839  13.248 1.00 89.66  ? 223 ILE B CA    1 
ATOM   4909 C  C     . ILE B 1 197 ? 25.493  50.725  14.473 1.00 92.82  ? 223 ILE B C     1 
ATOM   4910 O  O     . ILE B 1 197 ? 25.441  51.945  14.356 1.00 94.47  ? 223 ILE B O     1 
ATOM   4911 C  CB    . ILE B 1 197 ? 27.199  49.848  12.838 1.00 84.47  ? 223 ILE B CB    1 
ATOM   4912 C  CG1   . ILE B 1 197 ? 27.457  48.808  11.744 1.00 84.92  ? 223 ILE B CG1   1 
ATOM   4913 C  CG2   . ILE B 1 197 ? 28.090  49.545  14.035 1.00 83.46  ? 223 ILE B CG2   1 
ATOM   4914 C  CD1   . ILE B 1 197 ? 27.344  49.343  10.329 1.00 86.01  ? 223 ILE B CD1   1 
ATOM   4915 N  N     . LYS B 1 198 ? 25.358  50.103  15.641 1.00 89.32  ? 224 LYS B N     1 
ATOM   4916 C  CA    . LYS B 1 198 ? 25.095  50.828  16.878 1.00 83.66  ? 224 LYS B CA    1 
ATOM   4917 C  C     . LYS B 1 198 ? 26.265  51.746  17.236 1.00 94.92  ? 224 LYS B C     1 
ATOM   4918 O  O     . LYS B 1 198 ? 27.062  51.449  18.128 1.00 112.52 ? 224 LYS B O     1 
ATOM   4919 C  CB    . LYS B 1 198 ? 24.817  49.848  18.022 1.00 84.52  ? 224 LYS B CB    1 
ATOM   4920 N  N     . ASN B 1 256 ? 28.646  52.928  10.306 1.00 83.06  ? 282 ASN B N     1 
ATOM   4921 C  CA    . ASN B 1 256 ? 27.534  53.610  9.656  1.00 91.51  ? 282 ASN B CA    1 
ATOM   4922 C  C     . ASN B 1 256 ? 26.411  52.621  9.322  1.00 92.64  ? 282 ASN B C     1 
ATOM   4923 O  O     . ASN B 1 256 ? 25.693  52.165  10.204 1.00 92.41  ? 282 ASN B O     1 
ATOM   4924 C  CB    . ASN B 1 256 ? 28.027  54.328  8.399  1.00 91.70  ? 282 ASN B CB    1 
ATOM   4925 C  CG    . ASN B 1 256 ? 27.320  55.655  8.166  1.00 89.45  ? 282 ASN B CG    1 
ATOM   4926 O  OD1   . ASN B 1 256 ? 26.251  55.700  7.560  1.00 89.87  ? 282 ASN B OD1   1 
ATOM   4927 N  ND2   . ASN B 1 256 ? 27.932  56.750  8.636  1.00 82.14  ? 282 ASN B ND2   1 
ATOM   4928 N  N     . SER B 1 257 ? 26.232  52.309  8.045  1.00 93.39  ? 283 SER B N     1 
ATOM   4929 C  CA    . SER B 1 257 ? 25.212  51.334  7.676  1.00 91.26  ? 283 SER B CA    1 
ATOM   4930 C  C     . SER B 1 257 ? 25.881  50.171  6.948  1.00 85.04  ? 283 SER B C     1 
ATOM   4931 O  O     . SER B 1 257 ? 26.987  50.320  6.427  1.00 80.76  ? 283 SER B O     1 
ATOM   4932 C  CB    . SER B 1 257 ? 24.117  51.970  6.809  1.00 92.39  ? 283 SER B CB    1 
ATOM   4933 N  N     . VAL B 1 258 ? 25.209  49.020  6.928  1.00 83.47  ? 284 VAL B N     1 
ATOM   4934 C  CA    . VAL B 1 258 ? 25.570  47.899  6.062  1.00 76.56  ? 284 VAL B CA    1 
ATOM   4935 C  C     . VAL B 1 258 ? 24.355  47.314  5.344  1.00 65.46  ? 284 VAL B C     1 
ATOM   4936 O  O     . VAL B 1 258 ? 23.207  47.481  5.780  1.00 66.28  ? 284 VAL B O     1 
ATOM   4937 C  CB    . VAL B 1 258 ? 26.278  46.764  6.844  1.00 73.39  ? 284 VAL B CB    1 
ATOM   4938 C  CG1   . VAL B 1 258 ? 27.647  47.223  7.330  1.00 73.12  ? 284 VAL B CG1   1 
ATOM   4939 C  CG2   . VAL B 1 258 ? 25.417  46.289  8.008  1.00 71.32  ? 284 VAL B CG2   1 
ATOM   4940 N  N     . VAL B 1 259 ? 24.627  46.603  4.255  1.00 60.97  ? 285 VAL B N     1 
ATOM   4941 C  CA    . VAL B 1 259 ? 23.581  46.006  3.438  1.00 64.24  ? 285 VAL B CA    1 
ATOM   4942 C  C     . VAL B 1 259 ? 23.794  44.501  3.339  1.00 64.57  ? 285 VAL B C     1 
ATOM   4943 O  O     . VAL B 1 259 ? 24.922  44.013  3.449  1.00 67.25  ? 285 VAL B O     1 
ATOM   4944 C  CB    . VAL B 1 259 ? 23.544  46.616  2.021  1.00 59.20  ? 285 VAL B CB    1 
ATOM   4945 N  N     . PHE B 1 260 ? 22.705  43.765  3.144  1.00 57.22  ? 286 PHE B N     1 
ATOM   4946 C  CA    . PHE B 1 260 ? 22.778  42.312  3.059  1.00 59.15  ? 286 PHE B CA    1 
ATOM   4947 C  C     . PHE B 1 260 ? 22.106  41.840  1.780  1.00 59.85  ? 286 PHE B C     1 
ATOM   4948 O  O     . PHE B 1 260 ? 21.161  42.469  1.301  1.00 61.95  ? 286 PHE B O     1 
ATOM   4949 C  CB    . PHE B 1 260 ? 22.126  41.661  4.285  1.00 58.59  ? 286 PHE B CB    1 
ATOM   4950 C  CG    . PHE B 1 260 ? 22.856  41.928  5.576  1.00 51.78  ? 286 PHE B CG    1 
ATOM   4951 C  CD1   . PHE B 1 260 ? 24.032  41.257  5.874  1.00 48.10  ? 286 PHE B CD1   1 
ATOM   4952 C  CD2   . PHE B 1 260 ? 22.373  42.856  6.483  1.00 51.18  ? 286 PHE B CD2   1 
ATOM   4953 C  CE1   . PHE B 1 260 ? 24.707  41.501  7.052  1.00 47.01  ? 286 PHE B CE1   1 
ATOM   4954 C  CE2   . PHE B 1 260 ? 23.045  43.106  7.665  1.00 55.94  ? 286 PHE B CE2   1 
ATOM   4955 C  CZ    . PHE B 1 260 ? 24.214  42.425  7.950  1.00 53.04  ? 286 PHE B CZ    1 
ATOM   4956 N  N     . GLY B 1 261 ? 22.593  40.724  1.243  1.00 55.20  ? 287 GLY B N     1 
ATOM   4957 C  CA    . GLY B 1 261 ? 22.122  40.204  -0.028 1.00 55.00  ? 287 GLY B CA    1 
ATOM   4958 C  C     . GLY B 1 261 ? 20.740  39.584  0.016  1.00 56.28  ? 287 GLY B C     1 
ATOM   4959 O  O     . GLY B 1 261 ? 19.984  39.768  0.970  1.00 52.85  ? 287 GLY B O     1 
ATOM   4960 N  N     . THR B 1 262 ? 20.410  38.839  -1.033 1.00 57.52  ? 288 THR B N     1 
ATOM   4961 C  CA    . THR B 1 262 ? 19.100  38.206  -1.141 1.00 57.10  ? 288 THR B CA    1 
ATOM   4962 C  C     . THR B 1 262 ? 19.186  36.685  -1.050 1.00 59.47  ? 288 THR B C     1 
ATOM   4963 O  O     . THR B 1 262 ? 18.170  35.990  -1.168 1.00 56.13  ? 288 THR B O     1 
ATOM   4964 C  CB    . THR B 1 262 ? 18.409  38.585  -2.459 1.00 58.55  ? 288 THR B CB    1 
ATOM   4965 O  OG1   . THR B 1 262 ? 19.287  38.308  -3.558 1.00 57.95  ? 288 THR B OG1   1 
ATOM   4966 C  CG2   . THR B 1 262 ? 18.046  40.058  -2.458 1.00 62.97  ? 288 THR B CG2   1 
ATOM   4967 N  N     . SER B 1 263 ? 20.397  36.174  -0.839 1.00 56.52  ? 289 SER B N     1 
ATOM   4968 C  CA    . SER B 1 263 ? 20.609  34.733  -0.723 1.00 56.64  ? 289 SER B CA    1 
ATOM   4969 C  C     . SER B 1 263 ? 20.317  34.300  0.709  1.00 59.30  ? 289 SER B C     1 
ATOM   4970 O  O     . SER B 1 263 ? 20.332  35.125  1.626  1.00 59.97  ? 289 SER B O     1 
ATOM   4971 C  CB    . SER B 1 263 ? 22.037  34.341  -1.125 1.00 51.48  ? 289 SER B CB    1 
ATOM   4972 O  OG    . SER B 1 263 ? 22.990  34.823  -0.196 1.00 54.75  ? 289 SER B OG    1 
ATOM   4973 N  N     . ALA B 1 264 ? 20.046  33.011  0.896  1.00 53.79  ? 290 ALA B N     1 
ATOM   4974 C  CA    . ALA B 1 264 ? 19.757  32.472  2.220  1.00 47.34  ? 290 ALA B CA    1 
ATOM   4975 C  C     . ALA B 1 264 ? 20.892  32.777  3.187  1.00 47.22  ? 290 ALA B C     1 
ATOM   4976 O  O     . ALA B 1 264 ? 20.658  33.223  4.315  1.00 54.12  ? 290 ALA B O     1 
ATOM   4977 C  CB    . ALA B 1 264 ? 19.517  30.975  2.140  1.00 49.65  ? 290 ALA B CB    1 
ATOM   4978 N  N     . GLN B 1 265 ? 22.117  32.544  2.724  1.00 46.49  ? 291 GLN B N     1 
ATOM   4979 C  CA    . GLN B 1 265 ? 23.319  32.834  3.494  1.00 52.14  ? 291 GLN B CA    1 
ATOM   4980 C  C     . GLN B 1 265 ? 23.281  34.259  4.033  1.00 53.36  ? 291 GLN B C     1 
ATOM   4981 O  O     . GLN B 1 265 ? 23.531  34.506  5.225  1.00 55.71  ? 291 GLN B O     1 
ATOM   4982 C  CB    . GLN B 1 265 ? 24.559  32.635  2.620  1.00 54.55  ? 291 GLN B CB    1 
ATOM   4983 C  CG    . GLN B 1 265 ? 25.862  32.488  3.381  1.00 60.80  ? 291 GLN B CG    1 
ATOM   4984 C  CD    . GLN B 1 265 ? 26.250  31.036  3.598  1.00 60.74  ? 291 GLN B CD    1 
ATOM   4985 O  OE1   . GLN B 1 265 ? 25.910  30.164  2.792  1.00 54.12  ? 291 GLN B OE1   1 
ATOM   4986 N  NE2   . GLN B 1 265 ? 26.972  30.768  4.688  1.00 54.40  ? 291 GLN B NE2   1 
ATOM   4987 N  N     . GLU B 1 266 ? 22.901  35.178  3.150  1.00 57.89  ? 292 GLU B N     1 
ATOM   4988 C  CA    . GLU B 1 266 ? 22.854  36.601  3.464  1.00 55.81  ? 292 GLU B CA    1 
ATOM   4989 C  C     . GLU B 1 266 ? 21.750  36.928  4.460  1.00 49.91  ? 292 GLU B C     1 
ATOM   4990 O  O     . GLU B 1 266 ? 21.976  37.675  5.414  1.00 46.24  ? 292 GLU B O     1 
ATOM   4991 C  CB    . GLU B 1 266 ? 22.680  37.424  2.186  1.00 58.77  ? 292 GLU B CB    1 
ATOM   4992 C  CG    . GLU B 1 266 ? 23.946  37.537  1.345  1.00 57.14  ? 292 GLU B CG    1 
ATOM   4993 C  CD    . GLU B 1 266 ? 24.990  38.434  1.988  1.00 60.12  ? 292 GLU B CD    1 
ATOM   4994 O  OE1   . GLU B 1 266 ? 24.730  39.650  2.126  1.00 57.74  ? 292 GLU B OE1   1 
ATOM   4995 O  OE2   . GLU B 1 266 ? 26.070  37.922  2.353  1.00 66.70  ? 292 GLU B OE2   1 
ATOM   4996 N  N     . VAL B 1 267 ? 20.560  36.378  4.232  1.00 47.04  ? 293 VAL B N     1 
ATOM   4997 C  CA    . VAL B 1 267 ? 19.466  36.489  5.193  1.00 50.15  ? 293 VAL B CA    1 
ATOM   4998 C  C     . VAL B 1 267 ? 19.917  36.099  6.598  1.00 50.79  ? 293 VAL B C     1 
ATOM   4999 O  O     . VAL B 1 267 ? 19.691  36.828  7.582  1.00 50.59  ? 293 VAL B O     1 
ATOM   5000 C  CB    . VAL B 1 267 ? 18.278  35.595  4.798  1.00 42.42  ? 293 VAL B CB    1 
ATOM   5001 C  CG1   . VAL B 1 267 ? 17.195  35.649  5.856  1.00 47.37  ? 293 VAL B CG1   1 
ATOM   5002 C  CG2   . VAL B 1 267 ? 17.733  36.001  3.456  1.00 44.44  ? 293 VAL B CG2   1 
ATOM   5003 N  N     . VAL B 1 268 ? 20.590  34.955  6.677  1.00 44.36  ? 294 VAL B N     1 
ATOM   5004 C  CA    . VAL B 1 268 ? 21.078  34.462  7.958  1.00 51.84  ? 294 VAL B CA    1 
ATOM   5005 C  C     . VAL B 1 268 ? 22.141  35.363  8.605  1.00 47.36  ? 294 VAL B C     1 
ATOM   5006 O  O     . VAL B 1 268 ? 22.055  35.639  9.811  1.00 48.17  ? 294 VAL B O     1 
ATOM   5007 C  CB    . VAL B 1 268 ? 21.623  33.018  7.816  1.00 49.12  ? 294 VAL B CB    1 
ATOM   5008 C  CG1   . VAL B 1 268 ? 22.497  32.649  9.004  1.00 44.11  ? 294 VAL B CG1   1 
ATOM   5009 C  CG2   . VAL B 1 268 ? 20.463  32.043  7.690  1.00 38.99  ? 294 VAL B CG2   1 
ATOM   5010 N  N     . LYS B 1 269 ? 23.114  35.861  7.837  1.00 44.18  ? 295 LYS B N     1 
ATOM   5011 C  CA    . LYS B 1 269 ? 24.092  36.753  8.480  1.00 47.51  ? 295 LYS B CA    1 
ATOM   5012 C  C     . LYS B 1 269 ? 23.448  38.084  8.872  1.00 48.22  ? 295 LYS B C     1 
ATOM   5013 O  O     . LYS B 1 269 ? 23.921  38.768  9.788  1.00 44.46  ? 295 LYS B O     1 
ATOM   5014 C  CB    . LYS B 1 269 ? 25.322  37.004  7.603  1.00 46.44  ? 295 LYS B CB    1 
ATOM   5015 C  CG    . LYS B 1 269 ? 25.100  36.910  6.115  1.00 54.03  ? 295 LYS B CG    1 
ATOM   5016 C  CD    . LYS B 1 269 ? 26.428  36.759  5.384  1.00 65.42  ? 295 LYS B CD    1 
ATOM   5017 C  CE    . LYS B 1 269 ? 27.271  35.647  6.014  1.00 70.60  ? 295 LYS B CE    1 
ATOM   5018 N  NZ    . LYS B 1 269 ? 28.562  35.408  5.305  1.00 80.07  ? 295 LYS B NZ    1 
ATOM   5019 N  N     . GLU B 1 270 ? 22.369  38.444  8.183  1.00 44.88  ? 296 GLU B N     1 
ATOM   5020 C  CA    . GLU B 1 270 ? 21.586  39.609  8.574  1.00 47.49  ? 296 GLU B CA    1 
ATOM   5021 C  C     . GLU B 1 270 ? 20.973  39.372  9.939  1.00 43.22  ? 296 GLU B C     1 
ATOM   5022 O  O     . GLU B 1 270 ? 21.103  40.208  10.836 1.00 44.97  ? 296 GLU B O     1 
ATOM   5023 C  CB    . GLU B 1 270 ? 20.499  39.927  7.543  1.00 56.88  ? 296 GLU B CB    1 
ATOM   5024 C  CG    . GLU B 1 270 ? 19.612  41.114  7.923  1.00 50.81  ? 296 GLU B CG    1 
ATOM   5025 C  CD    . GLU B 1 270 ? 18.691  41.555  6.795  1.00 55.35  ? 296 GLU B CD    1 
ATOM   5026 O  OE1   . GLU B 1 270 ? 19.203  41.920  5.716  1.00 52.18  ? 296 GLU B OE1   1 
ATOM   5027 O  OE2   . GLU B 1 270 ? 17.455  41.531  6.985  1.00 59.28  ? 296 GLU B OE2   1 
ATOM   5028 N  N     . ILE B 1 271 ? 20.306  38.230  10.093 1.00 49.36  ? 297 ILE B N     1 
ATOM   5029 C  CA    . ILE B 1 271 ? 19.694  37.879  11.379 1.00 49.68  ? 297 ILE B CA    1 
ATOM   5030 C  C     . ILE B 1 271 ? 20.722  37.858  12.519 1.00 46.54  ? 297 ILE B C     1 
ATOM   5031 O  O     . ILE B 1 271 ? 20.507  38.455  13.586 1.00 42.31  ? 297 ILE B O     1 
ATOM   5032 C  CB    . ILE B 1 271 ? 18.993  36.511  11.320 1.00 38.44  ? 297 ILE B CB    1 
ATOM   5033 C  CG1   . ILE B 1 271 ? 17.918  36.514  10.232 1.00 45.94  ? 297 ILE B CG1   1 
ATOM   5034 C  CG2   . ILE B 1 271 ? 18.360  36.190  12.653 1.00 35.85  ? 297 ILE B CG2   1 
ATOM   5035 C  CD1   . ILE B 1 271 ? 17.121  35.233  10.146 1.00 40.85  ? 297 ILE B CD1   1 
ATOM   5036 N  N     . ARG B 1 272 ? 21.841  37.181  12.285 1.00 43.82  ? 298 ARG B N     1 
ATOM   5037 C  CA    . ARG B 1 272 ? 22.909  37.134  13.276 1.00 45.90  ? 298 ARG B CA    1 
ATOM   5038 C  C     . ARG B 1 272 ? 23.422  38.536  13.621 1.00 45.84  ? 298 ARG B C     1 
ATOM   5039 O  O     . ARG B 1 272 ? 23.674  38.843  14.797 1.00 49.16  ? 298 ARG B O     1 
ATOM   5040 C  CB    . ARG B 1 272 ? 24.048  36.245  12.773 1.00 50.59  ? 298 ARG B CB    1 
ATOM   5041 C  CG    . ARG B 1 272 ? 23.651  34.775  12.656 1.00 45.51  ? 298 ARG B CG    1 
ATOM   5042 C  CD    . ARG B 1 272 ? 24.779  33.911  12.127 1.00 42.40  ? 298 ARG B CD    1 
ATOM   5043 N  NE    . ARG B 1 272 ? 26.031  34.146  12.834 1.00 46.60  ? 298 ARG B NE    1 
ATOM   5044 C  CZ    . ARG B 1 272 ? 27.160  34.514  12.237 1.00 53.52  ? 298 ARG B CZ    1 
ATOM   5045 N  NH1   . ARG B 1 272 ? 27.190  34.686  10.922 1.00 46.87  ? 298 ARG B NH1   1 
ATOM   5046 N  NH2   . ARG B 1 272 ? 28.258  34.711  12.954 1.00 56.21  ? 298 ARG B NH2   1 
ATOM   5047 N  N     . PHE B 1 273 ? 23.532  39.393  12.604 1.00 46.58  ? 299 PHE B N     1 
ATOM   5048 C  CA    . PHE B 1 273 ? 23.967  40.777  12.807 1.00 47.77  ? 299 PHE B CA    1 
ATOM   5049 C  C     . PHE B 1 273 ? 23.010  41.546  13.710 1.00 45.98  ? 299 PHE B C     1 
ATOM   5050 O  O     . PHE B 1 273 ? 23.427  42.117  14.722 1.00 47.38  ? 299 PHE B O     1 
ATOM   5051 C  CB    . PHE B 1 273 ? 24.106  41.522  11.473 1.00 54.28  ? 299 PHE B CB    1 
ATOM   5052 C  CG    . PHE B 1 273 ? 24.431  42.989  11.630 1.00 57.94  ? 299 PHE B CG    1 
ATOM   5053 C  CD1   . PHE B 1 273 ? 25.702  43.399  12.011 1.00 60.64  ? 299 PHE B CD1   1 
ATOM   5054 C  CD2   . PHE B 1 273 ? 23.457  43.956  11.416 1.00 57.16  ? 299 PHE B CD2   1 
ATOM   5055 C  CE1   . PHE B 1 273 ? 25.996  44.745  12.171 1.00 57.60  ? 299 PHE B CE1   1 
ATOM   5056 C  CE2   . PHE B 1 273 ? 23.746  45.301  11.576 1.00 58.42  ? 299 PHE B CE2   1 
ATOM   5057 C  CZ    . PHE B 1 273 ? 25.017  45.694  11.951 1.00 59.60  ? 299 PHE B CZ    1 
ATOM   5058 N  N     . ARG B 1 274 ? 21.734  41.575  13.328 1.00 40.79  ? 300 ARG B N     1 
ATOM   5059 C  CA    . ARG B 1 274 ? 20.702  42.216  14.142 1.00 40.83  ? 300 ARG B CA    1 
ATOM   5060 C  C     . ARG B 1 274 ? 20.710  41.704  15.582 1.00 49.36  ? 300 ARG B C     1 
ATOM   5061 O  O     . ARG B 1 274 ? 20.576  42.492  16.524 1.00 53.86  ? 300 ARG B O     1 
ATOM   5062 C  CB    . ARG B 1 274 ? 19.316  42.023  13.516 1.00 37.41  ? 300 ARG B CB    1 
ATOM   5063 C  CG    . ARG B 1 274 ? 19.183  42.607  12.118 1.00 41.01  ? 300 ARG B CG    1 
ATOM   5064 C  CD    . ARG B 1 274 ? 17.783  42.424  11.538 1.00 39.30  ? 300 ARG B CD    1 
ATOM   5065 N  NE    . ARG B 1 274 ? 16.721  42.845  12.450 1.00 34.80  ? 300 ARG B NE    1 
ATOM   5066 C  CZ    . ARG B 1 274 ? 15.422  42.696  12.202 1.00 34.25  ? 300 ARG B CZ    1 
ATOM   5067 N  NH1   . ARG B 1 274 ? 15.021  42.149  11.063 1.00 35.21  ? 300 ARG B NH1   1 
ATOM   5068 N  NH2   . ARG B 1 274 ? 14.521  43.094  13.090 1.00 31.49  ? 300 ARG B NH2   1 
ATOM   5069 N  N     . ILE B 1 275 ? 20.860  40.391  15.754 1.00 48.59  ? 301 ILE B N     1 
ATOM   5070 C  CA    . ILE B 1 275 ? 20.978  39.822  17.094 1.00 45.80  ? 301 ILE B CA    1 
ATOM   5071 C  C     . ILE B 1 275 ? 22.159  40.436  17.846 1.00 47.82  ? 301 ILE B C     1 
ATOM   5072 O  O     . ILE B 1 275 ? 21.999  40.883  18.984 1.00 54.38  ? 301 ILE B O     1 
ATOM   5073 C  CB    . ILE B 1 275 ? 21.121  38.283  17.057 1.00 47.90  ? 301 ILE B CB    1 
ATOM   5074 C  CG1   . ILE B 1 275 ? 19.759  37.632  16.803 1.00 45.62  ? 301 ILE B CG1   1 
ATOM   5075 C  CG2   . ILE B 1 275 ? 21.707  37.763  18.358 1.00 39.46  ? 301 ILE B CG2   1 
ATOM   5076 C  CD1   . ILE B 1 275 ? 19.835  36.183  16.347 1.00 38.76  ? 301 ILE B CD1   1 
ATOM   5077 N  N     . GLU B 1 276 ? 23.330  40.492  17.216 1.00 43.90  ? 302 GLU B N     1 
ATOM   5078 C  CA    . GLU B 1 276 ? 24.480  41.088  17.898 1.00 48.29  ? 302 GLU B CA    1 
ATOM   5079 C  C     . GLU B 1 276 ? 24.282  42.571  18.225 1.00 51.94  ? 302 GLU B C     1 
ATOM   5080 O  O     . GLU B 1 276 ? 24.750  43.044  19.256 1.00 57.20  ? 302 GLU B O     1 
ATOM   5081 C  CB    . GLU B 1 276 ? 25.757  40.916  17.075 1.00 54.15  ? 302 GLU B CB    1 
ATOM   5082 C  CG    . GLU B 1 276 ? 26.973  41.575  17.726 1.00 62.84  ? 302 GLU B CG    1 
ATOM   5083 C  CD    . GLU B 1 276 ? 28.291  40.930  17.341 1.00 76.64  ? 302 GLU B CD    1 
ATOM   5084 O  OE1   . GLU B 1 276 ? 28.310  40.149  16.360 1.00 74.51  ? 302 GLU B OE1   1 
ATOM   5085 O  OE2   . GLU B 1 276 ? 29.306  41.211  18.023 1.00 78.52  ? 302 GLU B OE2   1 
ATOM   5086 N  N     . GLN B 1 277 ? 23.590  43.306  17.362 1.00 52.25  ? 303 GLN B N     1 
ATOM   5087 C  CA    . GLN B 1 277 ? 23.364  44.724  17.627 1.00 57.37  ? 303 GLN B CA    1 
ATOM   5088 C  C     . GLN B 1 277 ? 22.417  44.914  18.804 1.00 56.16  ? 303 GLN B C     1 
ATOM   5089 O  O     . GLN B 1 277 ? 22.712  45.652  19.746 1.00 54.48  ? 303 GLN B O     1 
ATOM   5090 C  CB    . GLN B 1 277 ? 22.805  45.436  16.392 1.00 58.69  ? 303 GLN B CB    1 
ATOM   5091 C  CG    . GLN B 1 277 ? 23.814  45.621  15.273 1.00 64.59  ? 303 GLN B CG    1 
ATOM   5092 C  CD    . GLN B 1 277 ? 25.120  46.229  15.758 1.00 70.50  ? 303 GLN B CD    1 
ATOM   5093 O  OE1   . GLN B 1 277 ? 25.220  47.441  15.949 1.00 68.64  ? 303 GLN B OE1   1 
ATOM   5094 N  NE2   . GLN B 1 277 ? 26.130  45.384  15.960 1.00 67.95  ? 303 GLN B NE2   1 
ATOM   5095 N  N     . LYS B 1 278 ? 21.287  44.220  18.749 1.00 54.42  ? 304 LYS B N     1 
ATOM   5096 C  CA    . LYS B 1 278 ? 20.220  44.407  19.720 1.00 49.39  ? 304 LYS B CA    1 
ATOM   5097 C  C     . LYS B 1 278 ? 20.575  43.851  21.096 1.00 54.10  ? 304 LYS B C     1 
ATOM   5098 O  O     . LYS B 1 278 ? 20.199  44.432  22.113 1.00 61.74  ? 304 LYS B O     1 
ATOM   5099 C  CB    . LYS B 1 278 ? 18.936  43.754  19.205 1.00 50.74  ? 304 LYS B CB    1 
ATOM   5100 C  CG    . LYS B 1 278 ? 17.670  44.153  19.938 1.00 52.74  ? 304 LYS B CG    1 
ATOM   5101 C  CD    . LYS B 1 278 ? 16.456  43.518  19.269 1.00 54.59  ? 304 LYS B CD    1 
ATOM   5102 C  CE    . LYS B 1 278 ? 15.151  43.919  19.943 1.00 57.63  ? 304 LYS B CE    1 
ATOM   5103 N  NZ    . LYS B 1 278 ? 13.983  43.219  19.328 1.00 53.23  ? 304 LYS B NZ    1 
ATOM   5104 N  N     . THR B 1 279 ? 21.300  42.733  21.133 1.00 59.34  ? 305 THR B N     1 
ATOM   5105 C  CA    . THR B 1 279 ? 21.522  42.030  22.399 1.00 57.53  ? 305 THR B CA    1 
ATOM   5106 C  C     . THR B 1 279 ? 22.980  41.984  22.870 1.00 55.57  ? 305 THR B C     1 
ATOM   5107 O  O     . THR B 1 279 ? 23.243  41.634  24.017 1.00 57.38  ? 305 THR B O     1 
ATOM   5108 C  CB    . THR B 1 279 ? 21.006  40.578  22.327 1.00 45.59  ? 305 THR B CB    1 
ATOM   5109 O  OG1   . THR B 1 279 ? 21.844  39.822  21.446 1.00 48.91  ? 305 THR B OG1   1 
ATOM   5110 C  CG2   . THR B 1 279 ? 19.556  40.529  21.840 1.00 42.83  ? 305 THR B CG2   1 
ATOM   5111 N  N     . THR B 1 280 ? 23.913  42.315  21.981 1.00 54.32  ? 306 THR B N     1 
ATOM   5112 C  CA    . THR B 1 280 ? 25.356  42.233  22.248 1.00 53.07  ? 306 THR B CA    1 
ATOM   5113 C  C     . THR B 1 280 ? 25.807  40.779  22.433 1.00 58.05  ? 306 THR B C     1 
ATOM   5114 O  O     . THR B 1 280 ? 26.784  40.488  23.127 1.00 58.42  ? 306 THR B O     1 
ATOM   5115 C  CB    . THR B 1 280 ? 25.771  43.067  23.485 1.00 50.31  ? 306 THR B CB    1 
ATOM   5116 O  OG1   . THR B 1 280 ? 24.974  44.253  23.553 1.00 64.26  ? 306 THR B OG1   1 
ATOM   5117 C  CG2   . THR B 1 280 ? 27.245  43.455  23.411 1.00 57.84  ? 306 THR B CG2   1 
ATOM   5118 N  N     . LEU B 1 281 ? 25.090  39.859  21.800 1.00 55.92  ? 307 LEU B N     1 
ATOM   5119 C  CA    . LEU B 1 281 ? 25.441  38.448  21.894 1.00 52.99  ? 307 LEU B CA    1 
ATOM   5120 C  C     . LEU B 1 281 ? 25.480  37.783  20.523 1.00 52.75  ? 307 LEU B C     1 
ATOM   5121 O  O     . LEU B 1 281 ? 24.708  38.129  19.625 1.00 50.32  ? 307 LEU B O     1 
ATOM   5122 C  CB    . LEU B 1 281 ? 24.468  37.705  22.816 1.00 49.05  ? 307 LEU B CB    1 
ATOM   5123 C  CG    . LEU B 1 281 ? 24.267  38.290  24.216 1.00 46.18  ? 307 LEU B CG    1 
ATOM   5124 C  CD1   . LEU B 1 281 ? 23.037  37.695  24.873 1.00 42.13  ? 307 LEU B CD1   1 
ATOM   5125 C  CD2   . LEU B 1 281 ? 25.502  38.068  25.071 1.00 42.63  ? 307 LEU B CD2   1 
ATOM   5126 N  N     . THR B 1 282 ? 26.397  36.834  20.369 1.00 55.94  ? 308 THR B N     1 
ATOM   5127 C  CA    . THR B 1 282 ? 26.581  36.134  19.105 1.00 51.41  ? 308 THR B CA    1 
ATOM   5128 C  C     . THR B 1 282 ? 25.776  34.838  19.053 1.00 46.13  ? 308 THR B C     1 
ATOM   5129 O  O     . THR B 1 282 ? 25.527  34.213  20.084 1.00 46.94  ? 308 THR B O     1 
ATOM   5130 C  CB    . THR B 1 282 ? 28.067  35.814  18.863 1.00 51.85  ? 308 THR B CB    1 
ATOM   5131 O  OG1   . THR B 1 282 ? 28.549  34.947  19.898 1.00 52.52  ? 308 THR B OG1   1 
ATOM   5132 C  CG2   . THR B 1 282 ? 28.887  37.089  18.864 1.00 56.36  ? 308 THR B CG2   1 
ATOM   5133 N  N     . ALA B 1 283 ? 25.359  34.455  17.850 1.00 45.79  ? 309 ALA B N     1 
ATOM   5134 C  CA    . ALA B 1 283 ? 24.661  33.190  17.630 1.00 44.50  ? 309 ALA B CA    1 
ATOM   5135 C  C     . ALA B 1 283 ? 25.297  32.432  16.473 1.00 45.91  ? 309 ALA B C     1 
ATOM   5136 O  O     . ALA B 1 283 ? 25.882  33.039  15.577 1.00 51.20  ? 309 ALA B O     1 
ATOM   5137 C  CB    . ALA B 1 283 ? 23.185  33.436  17.352 1.00 37.00  ? 309 ALA B CB    1 
ATOM   5138 N  N     . SER B 1 284 ? 25.188  31.108  16.487 1.00 45.77  ? 310 SER B N     1 
ATOM   5139 C  CA    . SER B 1 284 ? 25.548  30.325  15.313 1.00 42.07  ? 310 SER B CA    1 
ATOM   5140 C  C     . SER B 1 284 ? 24.282  29.900  14.600 1.00 39.37  ? 310 SER B C     1 
ATOM   5141 O  O     . SER B 1 284 ? 23.208  29.873  15.198 1.00 39.05  ? 310 SER B O     1 
ATOM   5142 C  CB    . SER B 1 284 ? 26.389  29.110  15.687 1.00 48.41  ? 310 SER B CB    1 
ATOM   5143 O  OG    . SER B 1 284 ? 27.673  29.511  16.134 1.00 52.35  ? 310 SER B OG    1 
ATOM   5144 N  N     . ALA B 1 285 ? 24.407  29.558  13.324 1.00 39.74  ? 311 ALA B N     1 
ATOM   5145 C  CA    . ALA B 1 285 ? 23.240  29.166  12.547 1.00 39.87  ? 311 ALA B CA    1 
ATOM   5146 C  C     . ALA B 1 285 ? 23.556  28.059  11.556 1.00 40.64  ? 311 ALA B C     1 
ATOM   5147 O  O     . ALA B 1 285 ? 24.714  27.834  11.203 1.00 42.60  ? 311 ALA B O     1 
ATOM   5148 C  CB    . ALA B 1 285 ? 22.656  30.367  11.823 1.00 35.35  ? 311 ALA B CB    1 
ATOM   5149 N  N     . GLY B 1 286 ? 22.513  27.351  11.134 1.00 34.24  ? 312 GLY B N     1 
ATOM   5150 C  CA    . GLY B 1 286 ? 22.654  26.275  10.177 1.00 33.75  ? 312 GLY B CA    1 
ATOM   5151 C  C     . GLY B 1 286 ? 21.589  26.401  9.113  1.00 36.83  ? 312 GLY B C     1 
ATOM   5152 O  O     . GLY B 1 286 ? 20.433  26.679  9.420  1.00 35.68  ? 312 GLY B O     1 
ATOM   5153 N  N     . ILE B 1 287 ? 21.978  26.207  7.859  1.00 36.32  ? 313 ILE B N     1 
ATOM   5154 C  CA    . ILE B 1 287 ? 21.060  26.400  6.747  1.00 38.59  ? 313 ILE B CA    1 
ATOM   5155 C  C     . ILE B 1 287 ? 21.002  25.132  5.919  1.00 40.94  ? 313 ILE B C     1 
ATOM   5156 O  O     . ILE B 1 287 ? 22.018  24.683  5.389  1.00 44.32  ? 313 ILE B O     1 
ATOM   5157 C  CB    . ILE B 1 287 ? 21.491  27.581  5.845  1.00 42.01  ? 313 ILE B CB    1 
ATOM   5158 C  CG1   . ILE B 1 287 ? 22.058  28.729  6.683  1.00 37.54  ? 313 ILE B CG1   1 
ATOM   5159 C  CG2   . ILE B 1 287 ? 20.329  28.054  4.975  1.00 37.20  ? 313 ILE B CG2   1 
ATOM   5160 C  CD1   . ILE B 1 287 ? 22.614  29.865  5.861  1.00 48.68  ? 313 ILE B CD1   1 
ATOM   5161 N  N     . ALA B 1 288 ? 19.812  24.553  5.797  1.00 38.47  ? 314 ALA B N     1 
ATOM   5162 C  CA    . ALA B 1 288 ? 19.687  23.266  5.120  1.00 40.46  ? 314 ALA B CA    1 
ATOM   5163 C  C     . ALA B 1 288 ? 18.242  23.007  4.713  1.00 40.87  ? 314 ALA B C     1 
ATOM   5164 O  O     . ALA B 1 288 ? 17.336  23.695  5.182  1.00 40.51  ? 314 ALA B O     1 
ATOM   5165 C  CB    . ALA B 1 288 ? 20.207  22.153  6.016  1.00 41.58  ? 314 ALA B CB    1 
ATOM   5166 N  N     . PRO B 1 289 ? 18.019  22.013  3.836  1.00 36.80  ? 315 PRO B N     1 
ATOM   5167 C  CA    . PRO B 1 289 ? 16.628  21.814  3.407  1.00 40.63  ? 315 PRO B CA    1 
ATOM   5168 C  C     . PRO B 1 289 ? 15.722  21.124  4.433  1.00 43.03  ? 315 PRO B C     1 
ATOM   5169 O  O     . PRO B 1 289 ? 14.521  21.049  4.179  1.00 45.83  ? 315 PRO B O     1 
ATOM   5170 C  CB    . PRO B 1 289 ? 16.768  20.950  2.143  1.00 37.88  ? 315 PRO B CB    1 
ATOM   5171 C  CG    . PRO B 1 289 ? 18.150  20.397  2.182  1.00 36.29  ? 315 PRO B CG    1 
ATOM   5172 C  CD    . PRO B 1 289 ? 18.985  21.375  2.923  1.00 32.09  ? 315 PRO B CD    1 
ATOM   5173 N  N     . ASN B 1 290 ? 16.264  20.635  5.548  1.00 41.54  ? 316 ASN B N     1 
ATOM   5174 C  CA    . ASN B 1 290 ? 15.413  20.108  6.623  1.00 42.23  ? 316 ASN B CA    1 
ATOM   5175 C  C     . ASN B 1 290 ? 15.965  20.321  8.040  1.00 39.03  ? 316 ASN B C     1 
ATOM   5176 O  O     . ASN B 1 290 ? 17.147  20.633  8.233  1.00 34.62  ? 316 ASN B O     1 
ATOM   5177 C  CB    . ASN B 1 290 ? 15.118  18.613  6.396  1.00 43.85  ? 316 ASN B CB    1 
ATOM   5178 C  CG    . ASN B 1 290 ? 16.360  17.745  6.436  1.00 41.33  ? 316 ASN B CG    1 
ATOM   5179 O  OD1   . ASN B 1 290 ? 16.978  17.565  7.484  1.00 39.60  ? 316 ASN B OD1   1 
ATOM   5180 N  ND2   . ASN B 1 290 ? 16.723  17.189  5.289  1.00 38.10  ? 316 ASN B ND2   1 
ATOM   5181 N  N     . THR B 1 291 ? 15.084  20.149  9.024  1.00 42.01  ? 317 THR B N     1 
ATOM   5182 C  CA    . THR B 1 291 ? 15.377  20.454  10.428 1.00 43.40  ? 317 THR B CA    1 
ATOM   5183 C  C     . THR B 1 291 ? 16.571  19.683  10.981 1.00 39.29  ? 317 THR B C     1 
ATOM   5184 O  O     . THR B 1 291 ? 17.434  20.256  11.640 1.00 38.50  ? 317 THR B O     1 
ATOM   5185 C  CB    . THR B 1 291 ? 14.164  20.155  11.325 1.00 38.31  ? 317 THR B CB    1 
ATOM   5186 O  OG1   . THR B 1 291 ? 13.656  18.853  11.013 1.00 38.44  ? 317 THR B OG1   1 
ATOM   5187 C  CG2   . THR B 1 291 ? 13.073  21.190  11.112 1.00 40.41  ? 317 THR B CG2   1 
ATOM   5188 N  N     . MET B 1 292 ? 16.599  18.381  10.720 1.00 36.54  ? 318 MET B N     1 
ATOM   5189 C  CA    . MET B 1 292 ? 17.691  17.518  11.154 1.00 39.32  ? 318 MET B CA    1 
ATOM   5190 C  C     . MET B 1 292 ? 19.042  18.032  10.646 1.00 38.06  ? 318 MET B C     1 
ATOM   5191 O  O     . MET B 1 292 ? 19.997  18.233  11.415 1.00 36.35  ? 318 MET B O     1 
ATOM   5192 C  CB    . MET B 1 292 ? 17.433  16.092  10.661 1.00 36.03  ? 318 MET B CB    1 
ATOM   5193 C  CG    . MET B 1 292 ? 18.344  15.040  11.249 1.00 41.46  ? 318 MET B CG    1 
ATOM   5194 S  SD    . MET B 1 292 ? 19.798  14.724  10.229 1.00 51.90  ? 318 MET B SD    1 
ATOM   5195 C  CE    . MET B 1 292 ? 19.044  14.013  8.773  1.00 44.18  ? 318 MET B CE    1 
ATOM   5196 N  N     . LEU B 1 293 ? 19.092  18.273  9.342  1.00 41.58  ? 319 LEU B N     1 
ATOM   5197 C  CA    . LEU B 1 293 ? 20.297  18.755  8.684  1.00 40.76  ? 319 LEU B CA    1 
ATOM   5198 C  C     . LEU B 1 293 ? 20.710  20.127  9.193  1.00 41.14  ? 319 LEU B C     1 
ATOM   5199 O  O     . LEU B 1 293 ? 21.866  20.326  9.545  1.00 43.42  ? 319 LEU B O     1 
ATOM   5200 C  CB    . LEU B 1 293 ? 20.102  18.808  7.169  1.00 43.27  ? 319 LEU B CB    1 
ATOM   5201 C  CG    . LEU B 1 293 ? 20.120  17.477  6.418  1.00 41.21  ? 319 LEU B CG    1 
ATOM   5202 C  CD1   . LEU B 1 293 ? 19.866  17.711  4.945  1.00 33.74  ? 319 LEU B CD1   1 
ATOM   5203 C  CD2   . LEU B 1 293 ? 21.440  16.737  6.638  1.00 36.72  ? 319 LEU B CD2   1 
ATOM   5204 N  N     . ALA B 1 294 ? 19.771  21.071  9.206  1.00 39.22  ? 320 ALA B N     1 
ATOM   5205 C  CA    . ALA B 1 294 ? 20.015  22.409  9.742  1.00 37.35  ? 320 ALA B CA    1 
ATOM   5206 C  C     . ALA B 1 294 ? 20.610  22.354  11.141 1.00 40.13  ? 320 ALA B C     1 
ATOM   5207 O  O     . ALA B 1 294 ? 21.567  23.075  11.459 1.00 41.79  ? 320 ALA B O     1 
ATOM   5208 C  CB    . ALA B 1 294 ? 18.731  23.210  9.755  1.00 38.47  ? 320 ALA B CB    1 
ATOM   5209 N  N     . LYS B 1 295 ? 20.026  21.494  11.972 1.00 40.19  ? 321 LYS B N     1 
ATOM   5210 C  CA    . LYS B 1 295 ? 20.470  21.324  13.347 1.00 41.82  ? 321 LYS B CA    1 
ATOM   5211 C  C     . LYS B 1 295 ? 21.891  20.759  13.418 1.00 38.77  ? 321 LYS B C     1 
ATOM   5212 O  O     . LYS B 1 295 ? 22.676  21.171  14.273 1.00 38.63  ? 321 LYS B O     1 
ATOM   5213 C  CB    . LYS B 1 295 ? 19.492  20.426  14.115 1.00 40.48  ? 321 LYS B CB    1 
ATOM   5214 C  CG    . LYS B 1 295 ? 19.534  20.613  15.616 1.00 41.33  ? 321 LYS B CG    1 
ATOM   5215 C  CD    . LYS B 1 295 ? 20.670  19.829  16.233 1.00 53.59  ? 321 LYS B CD    1 
ATOM   5216 C  CE    . LYS B 1 295 ? 20.718  20.022  17.721 1.00 52.44  ? 321 LYS B CE    1 
ATOM   5217 N  NZ    . LYS B 1 295 ? 20.548  21.463  18.085 1.00 50.18  ? 321 LYS B NZ    1 
ATOM   5218 N  N     . VAL B 1 296 ? 22.237  19.833  12.526 1.00 40.30  ? 322 VAL B N     1 
ATOM   5219 C  CA    . VAL B 1 296 ? 23.628  19.371  12.497 1.00 40.40  ? 322 VAL B CA    1 
ATOM   5220 C  C     . VAL B 1 296 ? 24.578  20.488  12.038 1.00 45.14  ? 322 VAL B C     1 
ATOM   5221 O  O     . VAL B 1 296 ? 25.680  20.635  12.566 1.00 51.44  ? 322 VAL B O     1 
ATOM   5222 C  CB    . VAL B 1 296 ? 23.823  18.146  11.581 1.00 45.56  ? 322 VAL B CB    1 
ATOM   5223 C  CG1   . VAL B 1 296 ? 25.229  17.603  11.738 1.00 47.48  ? 322 VAL B CG1   1 
ATOM   5224 C  CG2   . VAL B 1 296 ? 22.799  17.062  11.893 1.00 42.13  ? 322 VAL B CG2   1 
ATOM   5225 N  N     . CYS B 1 297 ? 24.132  21.264  11.051 1.00 49.30  ? 323 CYS B N     1 
ATOM   5226 C  CA    . CYS B 1 297 ? 24.883  22.393  10.497 1.00 49.16  ? 323 CYS B CA    1 
ATOM   5227 C  C     . CYS B 1 297 ? 25.259  23.453  11.515 1.00 50.03  ? 323 CYS B C     1 
ATOM   5228 O  O     . CYS B 1 297 ? 26.429  23.809  11.650 1.00 53.43  ? 323 CYS B O     1 
ATOM   5229 C  CB    . CYS B 1 297 ? 24.075  23.070  9.389  1.00 42.94  ? 323 CYS B CB    1 
ATOM   5230 S  SG    . CYS B 1 297 ? 23.991  22.170  7.852  1.00 56.17  ? 323 CYS B SG    1 
ATOM   5231 N  N     . SER B 1 298 ? 24.248  23.961  12.214 1.00 44.00  ? 324 SER B N     1 
ATOM   5232 C  CA    . SER B 1 298 ? 24.418  25.048  13.174 1.00 42.63  ? 324 SER B CA    1 
ATOM   5233 C  C     . SER B 1 298 ? 25.561  24.846  14.167 1.00 51.92  ? 324 SER B C     1 
ATOM   5234 O  O     . SER B 1 298 ? 26.038  25.807  14.768 1.00 57.95  ? 324 SER B O     1 
ATOM   5235 C  CB    . SER B 1 298 ? 23.113  25.258  13.942 1.00 41.67  ? 324 SER B CB    1 
ATOM   5236 O  OG    . SER B 1 298 ? 23.064  24.453  15.105 1.00 53.34  ? 324 SER B OG    1 
ATOM   5237 N  N     . ASP B 1 299 ? 26.000  23.602  14.333 1.00 58.46  ? 325 ASP B N     1 
ATOM   5238 C  CA    . ASP B 1 299 ? 27.051  23.287  15.293 1.00 61.80  ? 325 ASP B CA    1 
ATOM   5239 C  C     . ASP B 1 299 ? 28.453  23.197  14.683 1.00 60.63  ? 325 ASP B C     1 
ATOM   5240 O  O     . ASP B 1 299 ? 29.444  23.152  15.416 1.00 61.95  ? 325 ASP B O     1 
ATOM   5241 C  CB    . ASP B 1 299 ? 26.722  21.983  16.028 1.00 62.72  ? 325 ASP B CB    1 
ATOM   5242 C  CG    . ASP B 1 299 ? 26.716  22.153  17.546 1.00 75.07  ? 325 ASP B CG    1 
ATOM   5243 O  OD1   . ASP B 1 299 ? 25.751  22.751  18.082 1.00 73.29  ? 325 ASP B OD1   1 
ATOM   5244 O  OD2   . ASP B 1 299 ? 27.673  21.686  18.203 1.00 77.86  ? 325 ASP B OD2   1 
ATOM   5245 N  N     . LYS B 1 300 ? 28.544  23.142  13.357 1.00 57.20  ? 326 LYS B N     1 
ATOM   5246 C  CA    . LYS B 1 300 ? 29.855  23.067  12.719 1.00 59.68  ? 326 LYS B CA    1 
ATOM   5247 C  C     . LYS B 1 300 ? 30.657  24.343  12.961 1.00 65.50  ? 326 LYS B C     1 
ATOM   5248 O  O     . LYS B 1 300 ? 31.725  24.298  13.574 1.00 63.17  ? 326 LYS B O     1 
ATOM   5249 C  CB    . LYS B 1 300 ? 29.743  22.806  11.218 1.00 59.38  ? 326 LYS B CB    1 
ATOM   5250 C  CG    . LYS B 1 300 ? 31.092  22.412  10.618 1.00 65.32  ? 326 LYS B CG    1 
ATOM   5251 C  CD    . LYS B 1 300 ? 31.076  22.364  9.104  1.00 60.72  ? 326 LYS B CD    1 
ATOM   5252 C  CE    . LYS B 1 300 ? 30.418  21.094  8.614  1.00 59.40  ? 326 LYS B CE    1 
ATOM   5253 N  NZ    . LYS B 1 300 ? 31.214  19.879  8.951  1.00 68.63  ? 326 LYS B NZ    1 
ATOM   5254 N  N     . ASN B 1 301 ? 30.144  25.476  12.481 1.00 67.78  ? 327 ASN B N     1 
ATOM   5255 C  CA    . ASN B 1 301 ? 30.807  26.767  12.683 1.00 59.75  ? 327 ASN B CA    1 
ATOM   5256 C  C     . ASN B 1 301 ? 30.403  27.474  13.972 1.00 60.15  ? 327 ASN B C     1 
ATOM   5257 O  O     . ASN B 1 301 ? 29.971  28.626  13.950 1.00 57.89  ? 327 ASN B O     1 
ATOM   5258 C  CB    . ASN B 1 301 ? 30.551  27.698  11.497 1.00 58.50  ? 327 ASN B CB    1 
ATOM   5259 C  CG    . ASN B 1 301 ? 31.306  27.277  10.256 1.00 64.93  ? 327 ASN B CG    1 
ATOM   5260 O  OD1   . ASN B 1 301 ? 32.341  26.616  10.345 1.00 71.08  ? 327 ASN B OD1   1 
ATOM   5261 N  ND2   . ASN B 1 301 ? 30.804  27.669  9.090  1.00 59.80  ? 327 ASN B ND2   1 
ATOM   5262 N  N     . LYS B 1 302 ? 30.610  26.822  15.101 1.00 61.77  ? 328 LYS B N     1 
ATOM   5263 C  CA    . LYS B 1 302 ? 30.317  27.402  16.388 1.00 59.86  ? 328 LYS B CA    1 
ATOM   5264 C  C     . LYS B 1 302 ? 31.638  27.838  16.973 1.00 64.82  ? 328 LYS B C     1 
ATOM   5265 O  O     . LYS B 1 302 ? 32.611  27.114  16.836 1.00 65.77  ? 328 LYS B O     1 
ATOM   5266 C  CB    . LYS B 1 302 ? 29.727  26.345  17.286 1.00 59.44  ? 328 LYS B CB    1 
ATOM   5267 C  CG    . LYS B 1 302 ? 28.231  26.289  17.269 1.00 62.75  ? 328 LYS B CG    1 
ATOM   5268 C  CD    . LYS B 1 302 ? 27.690  26.127  18.670 1.00 65.75  ? 328 LYS B CD    1 
ATOM   5269 C  CE    . LYS B 1 302 ? 26.179  26.281  18.685 1.00 65.31  ? 328 LYS B CE    1 
ATOM   5270 N  NZ    . LYS B 1 302 ? 25.724  27.537  19.340 1.00 51.57  ? 328 LYS B NZ    1 
ATOM   5271 N  N     . PRO B 1 303 ? 31.710  28.993  17.632 1.00 61.90  ? 329 PRO B N     1 
ATOM   5272 C  CA    . PRO B 1 303 ? 30.615  29.944  17.831 1.00 55.85  ? 329 PRO B CA    1 
ATOM   5273 C  C     . PRO B 1 303 ? 30.650  31.087  16.821 1.00 61.20  ? 329 PRO B C     1 
ATOM   5274 O  O     . PRO B 1 303 ? 31.678  31.291  16.169 1.00 59.91  ? 329 PRO B O     1 
ATOM   5275 C  CB    . PRO B 1 303 ? 30.882  30.466  19.237 1.00 57.08  ? 329 PRO B CB    1 
ATOM   5276 C  CG    . PRO B 1 303 ? 32.374  30.518  19.294 1.00 59.85  ? 329 PRO B CG    1 
ATOM   5277 C  CD    . PRO B 1 303 ? 32.871  29.339  18.474 1.00 57.91  ? 329 PRO B CD    1 
ATOM   5278 N  N     . ASN B 1 304 ? 29.553  31.838  16.735 1.00 60.03  ? 330 ASN B N     1 
ATOM   5279 C  CA    . ASN B 1 304 ? 29.442  32.989  15.839 1.00 54.15  ? 330 ASN B CA    1 
ATOM   5280 C  C     . ASN B 1 304 ? 29.916  32.648  14.439 1.00 56.68  ? 330 ASN B C     1 
ATOM   5281 O  O     . ASN B 1 304 ? 30.976  33.089  13.999 1.00 59.34  ? 330 ASN B O     1 
ATOM   5282 C  CB    . ASN B 1 304 ? 30.224  34.188  16.377 1.00 57.19  ? 330 ASN B CB    1 
ATOM   5283 C  CG    . ASN B 1 304 ? 29.806  35.499  15.724 1.00 60.02  ? 330 ASN B CG    1 
ATOM   5284 O  OD1   . ASN B 1 304 ? 28.692  35.629  15.210 1.00 53.65  ? 330 ASN B OD1   1 
ATOM   5285 N  ND2   . ASN B 1 304 ? 30.704  36.478  15.741 1.00 57.16  ? 330 ASN B ND2   1 
ATOM   5286 N  N     . GLY B 1 305 ? 29.117  31.845  13.752 1.00 53.18  ? 331 GLY B N     1 
ATOM   5287 C  CA    . GLY B 1 305 ? 29.435  31.393  12.416 1.00 49.27  ? 331 GLY B CA    1 
ATOM   5288 C  C     . GLY B 1 305 ? 28.236  30.657  11.871 1.00 51.27  ? 331 GLY B C     1 
ATOM   5289 O  O     . GLY B 1 305 ? 27.295  30.357  12.606 1.00 52.19  ? 331 GLY B O     1 
ATOM   5290 N  N     . GLN B 1 306 ? 28.263  30.359  10.582 1.00 42.61  ? 332 GLN B N     1 
ATOM   5291 C  CA    . GLN B 1 306 ? 27.158  29.643  9.979  1.00 44.27  ? 332 GLN B CA    1 
ATOM   5292 C  C     . GLN B 1 306 ? 27.643  28.641  8.944  1.00 48.64  ? 332 GLN B C     1 
ATOM   5293 O  O     . GLN B 1 306 ? 28.832  28.568  8.642  1.00 47.82  ? 332 GLN B O     1 
ATOM   5294 C  CB    . GLN B 1 306 ? 26.176  30.635  9.358  1.00 47.67  ? 332 GLN B CB    1 
ATOM   5295 C  CG    . GLN B 1 306 ? 26.848  31.811  8.659  1.00 50.87  ? 332 GLN B CG    1 
ATOM   5296 C  CD    . GLN B 1 306 ? 25.853  32.871  8.221  1.00 52.24  ? 332 GLN B CD    1 
ATOM   5297 O  OE1   . GLN B 1 306 ? 25.571  33.816  8.960  1.00 46.33  ? 332 GLN B OE1   1 
ATOM   5298 N  NE2   . GLN B 1 306 ? 25.313  32.717  7.014  1.00 55.05  ? 332 GLN B NE2   1 
ATOM   5299 N  N     . TYR B 1 307 ? 26.708  27.867  8.408  1.00 46.98  ? 333 TYR B N     1 
ATOM   5300 C  CA    . TYR B 1 307 ? 27.023  26.867  7.402  1.00 47.62  ? 333 TYR B CA    1 
ATOM   5301 C  C     . TYR B 1 307 ? 25.752  26.490  6.647  1.00 47.93  ? 333 TYR B C     1 
ATOM   5302 O  O     . TYR B 1 307 ? 24.699  26.274  7.252  1.00 44.51  ? 333 TYR B O     1 
ATOM   5303 C  CB    . TYR B 1 307 ? 27.665  25.633  8.052  1.00 49.91  ? 333 TYR B CB    1 
ATOM   5304 C  CG    . TYR B 1 307 ? 28.203  24.612  7.069  1.00 48.39  ? 333 TYR B CG    1 
ATOM   5305 C  CD1   . TYR B 1 307 ? 29.562  24.538  6.794  1.00 46.62  ? 333 TYR B CD1   1 
ATOM   5306 C  CD2   . TYR B 1 307 ? 27.353  23.730  6.412  1.00 45.18  ? 333 TYR B CD2   1 
ATOM   5307 C  CE1   . TYR B 1 307 ? 30.060  23.613  5.895  1.00 48.53  ? 333 TYR B CE1   1 
ATOM   5308 C  CE2   . TYR B 1 307 ? 27.842  22.804  5.512  1.00 51.50  ? 333 TYR B CE2   1 
ATOM   5309 C  CZ    . TYR B 1 307 ? 29.196  22.747  5.256  1.00 53.42  ? 333 TYR B CZ    1 
ATOM   5310 O  OH    . TYR B 1 307 ? 29.684  21.822  4.358  1.00 47.10  ? 333 TYR B OH    1 
ATOM   5311 N  N     . GLN B 1 308 ? 25.852  26.412  5.324  1.00 48.34  ? 334 GLN B N     1 
ATOM   5312 C  CA    . GLN B 1 308 ? 24.713  26.005  4.516  1.00 48.07  ? 334 GLN B CA    1 
ATOM   5313 C  C     . GLN B 1 308 ? 24.930  24.650  3.849  1.00 48.39  ? 334 GLN B C     1 
ATOM   5314 O  O     . GLN B 1 308 ? 26.039  24.315  3.435  1.00 53.36  ? 334 GLN B O     1 
ATOM   5315 C  CB    . GLN B 1 308 ? 24.412  27.051  3.442  1.00 41.34  ? 334 GLN B CB    1 
ATOM   5316 C  CG    . GLN B 1 308 ? 23.134  26.768  2.663  1.00 46.45  ? 334 GLN B CG    1 
ATOM   5317 C  CD    . GLN B 1 308 ? 22.882  27.777  1.568  1.00 48.33  ? 334 GLN B CD    1 
ATOM   5318 O  OE1   . GLN B 1 308 ? 23.757  28.579  1.239  1.00 55.37  ? 334 GLN B OE1   1 
ATOM   5319 N  NE2   . GLN B 1 308 ? 21.684  27.742  0.988  1.00 41.10  ? 334 GLN B NE2   1 
ATOM   5320 N  N     . ILE B 1 309 ? 23.857  23.876  3.746  1.00 39.05  ? 335 ILE B N     1 
ATOM   5321 C  CA    . ILE B 1 309 ? 23.836  22.725  2.860  1.00 45.41  ? 335 ILE B CA    1 
ATOM   5322 C  C     . ILE B 1 309 ? 22.951  23.119  1.698  1.00 44.77  ? 335 ILE B C     1 
ATOM   5323 O  O     . ILE B 1 309 ? 21.752  23.339  1.877  1.00 46.56  ? 335 ILE B O     1 
ATOM   5324 C  CB    . ILE B 1 309 ? 23.289  21.452  3.537  1.00 41.73  ? 335 ILE B CB    1 
ATOM   5325 C  CG1   . ILE B 1 309 ? 24.329  20.853  4.480  1.00 45.43  ? 335 ILE B CG1   1 
ATOM   5326 C  CG2   . ILE B 1 309 ? 22.910  20.412  2.499  1.00 36.37  ? 335 ILE B CG2   1 
ATOM   5327 C  CD1   . ILE B 1 309 ? 23.800  19.705  5.319  1.00 44.06  ? 335 ILE B CD1   1 
ATOM   5328 N  N     . LEU B 1 310 ? 23.540  23.229  0.511  1.00 37.48  ? 336 LEU B N     1 
ATOM   5329 C  CA    . LEU B 1 310 ? 22.794  23.727  -0.634 1.00 40.08  ? 336 LEU B CA    1 
ATOM   5330 C  C     . LEU B 1 310 ? 21.733  22.700  -1.002 1.00 42.42  ? 336 LEU B C     1 
ATOM   5331 O  O     . LEU B 1 310 ? 21.961  21.501  -0.870 1.00 49.24  ? 336 LEU B O     1 
ATOM   5332 C  CB    . LEU B 1 310 ? 23.731  24.005  -1.808 1.00 40.26  ? 336 LEU B CB    1 
ATOM   5333 C  CG    . LEU B 1 310 ? 24.854  24.998  -1.495 1.00 50.22  ? 336 LEU B CG    1 
ATOM   5334 C  CD1   . LEU B 1 310 ? 25.961  24.935  -2.538 1.00 50.11  ? 336 LEU B CD1   1 
ATOM   5335 C  CD2   . LEU B 1 310 ? 24.319  26.425  -1.346 1.00 44.48  ? 336 LEU B CD2   1 
ATOM   5336 N  N     . PRO B 1 311 ? 20.560  23.163  -1.456 1.00 43.81  ? 337 PRO B N     1 
ATOM   5337 C  CA    . PRO B 1 311 ? 19.459  22.220  -1.700 1.00 43.07  ? 337 PRO B CA    1 
ATOM   5338 C  C     . PRO B 1 311 ? 19.634  21.359  -2.962 1.00 50.72  ? 337 PRO B C     1 
ATOM   5339 O  O     . PRO B 1 311 ? 18.801  21.400  -3.868 1.00 56.65  ? 337 PRO B O     1 
ATOM   5340 C  CB    . PRO B 1 311 ? 18.232  23.137  -1.812 1.00 35.48  ? 337 PRO B CB    1 
ATOM   5341 C  CG    . PRO B 1 311 ? 18.774  24.458  -2.247 1.00 36.66  ? 337 PRO B CG    1 
ATOM   5342 C  CD    . PRO B 1 311 ? 20.191  24.561  -1.749 1.00 36.81  ? 337 PRO B CD    1 
ATOM   5343 N  N     . ASN B 1 312 ? 20.711  20.579  -3.001 1.00 50.04  ? 338 ASN B N     1 
ATOM   5344 C  CA    . ASN B 1 312 ? 20.874  19.519  -3.993 1.00 49.29  ? 338 ASN B CA    1 
ATOM   5345 C  C     . ASN B 1 312 ? 21.299  18.224  -3.298 1.00 51.57  ? 338 ASN B C     1 
ATOM   5346 O  O     . ASN B 1 312 ? 22.115  18.248  -2.372 1.00 47.40  ? 338 ASN B O     1 
ATOM   5347 C  CB    . ASN B 1 312 ? 21.889  19.911  -5.079 1.00 42.57  ? 338 ASN B CB    1 
ATOM   5348 C  CG    . ASN B 1 312 ? 23.279  20.190  -4.523 1.00 47.19  ? 338 ASN B CG    1 
ATOM   5349 O  OD1   . ASN B 1 312 ? 24.133  19.301  -4.472 1.00 45.94  ? 338 ASN B OD1   1 
ATOM   5350 N  ND2   . ASN B 1 312 ? 23.514  21.434  -4.118 1.00 43.19  ? 338 ASN B ND2   1 
ATOM   5351 N  N     . ARG B 1 313 ? 20.728  17.107  -3.745 1.00 49.95  ? 339 ARG B N     1 
ATOM   5352 C  CA    . ARG B 1 313 ? 20.929  15.800  -3.118 1.00 45.36  ? 339 ARG B CA    1 
ATOM   5353 C  C     . ARG B 1 313 ? 22.400  15.443  -2.902 1.00 43.80  ? 339 ARG B C     1 
ATOM   5354 O  O     . ARG B 1 313 ? 22.766  14.822  -1.896 1.00 44.95  ? 339 ARG B O     1 
ATOM   5355 C  CB    . ARG B 1 313 ? 20.254  14.721  -3.963 1.00 42.10  ? 339 ARG B CB    1 
ATOM   5356 C  CG    . ARG B 1 313 ? 20.421  13.322  -3.423 1.00 50.23  ? 339 ARG B CG    1 
ATOM   5357 C  CD    . ARG B 1 313 ? 20.725  12.320  -4.536 1.00 51.05  ? 339 ARG B CD    1 
ATOM   5358 N  NE    . ARG B 1 313 ? 21.640  11.275  -4.085 1.00 51.35  ? 339 ARG B NE    1 
ATOM   5359 C  CZ    . ARG B 1 313 ? 21.271  10.215  -3.374 1.00 45.78  ? 339 ARG B CZ    1 
ATOM   5360 N  NH1   . ARG B 1 313 ? 20.002  10.055  -3.029 1.00 39.91  ? 339 ARG B NH1   1 
ATOM   5361 N  NH2   . ARG B 1 313 ? 22.174  9.320   -2.998 1.00 45.15  ? 339 ARG B NH2   1 
ATOM   5362 N  N     . GLN B 1 314 ? 23.243  15.865  -3.836 1.00 47.04  ? 340 GLN B N     1 
ATOM   5363 C  CA    . GLN B 1 314 ? 24.665  15.571  -3.769 1.00 52.23  ? 340 GLN B CA    1 
ATOM   5364 C  C     . GLN B 1 314 ? 25.326  16.231  -2.562 1.00 51.48  ? 340 GLN B C     1 
ATOM   5365 O  O     . GLN B 1 314 ? 26.153  15.608  -1.906 1.00 50.85  ? 340 GLN B O     1 
ATOM   5366 C  CB    . GLN B 1 314 ? 25.367  16.003  -5.054 1.00 60.43  ? 340 GLN B CB    1 
ATOM   5367 C  CG    . GLN B 1 314 ? 26.802  15.518  -5.141 1.00 60.66  ? 340 GLN B CG    1 
ATOM   5368 C  CD    . GLN B 1 314 ? 26.929  14.036  -4.825 1.00 67.51  ? 340 GLN B CD    1 
ATOM   5369 O  OE1   . GLN B 1 314 ? 27.698  13.640  -3.949 1.00 69.53  ? 340 GLN B OE1   1 
ATOM   5370 N  NE2   . GLN B 1 314 ? 26.166  13.208  -5.537 1.00 63.84  ? 340 GLN B NE2   1 
ATOM   5371 N  N     . ALA B 1 315 ? 24.980  17.490  -2.291 1.00 52.73  ? 341 ALA B N     1 
ATOM   5372 C  CA    . ALA B 1 315 ? 25.514  18.211  -1.131 1.00 51.96  ? 341 ALA B CA    1 
ATOM   5373 C  C     . ALA B 1 315 ? 25.127  17.505  0.171  1.00 49.86  ? 341 ALA B C     1 
ATOM   5374 O  O     . ALA B 1 315 ? 25.973  17.273  1.044  1.00 48.96  ? 341 ALA B O     1 
ATOM   5375 C  CB    . ALA B 1 315 ? 25.023  19.648  -1.121 1.00 37.84  ? 341 ALA B CB    1 
ATOM   5376 N  N     . VAL B 1 316 ? 23.841  17.175  0.282  1.00 45.46  ? 342 VAL B N     1 
ATOM   5377 C  CA    . VAL B 1 316 ? 23.309  16.371  1.379  1.00 44.93  ? 342 VAL B CA    1 
ATOM   5378 C  C     . VAL B 1 316 ? 24.162  15.132  1.613  1.00 47.58  ? 342 VAL B C     1 
ATOM   5379 O  O     . VAL B 1 316 ? 24.697  14.927  2.709  1.00 40.29  ? 342 VAL B O     1 
ATOM   5380 C  CB    . VAL B 1 316 ? 21.854  15.929  1.096  1.00 43.24  ? 342 VAL B CB    1 
ATOM   5381 C  CG1   . VAL B 1 316 ? 21.289  15.155  2.270  1.00 39.14  ? 342 VAL B CG1   1 
ATOM   5382 C  CG2   . VAL B 1 316 ? 20.979  17.129  0.770  1.00 44.96  ? 342 VAL B CG2   1 
ATOM   5383 N  N     . MET B 1 317 ? 24.293  14.323  0.564  1.00 48.00  ? 343 MET B N     1 
ATOM   5384 C  CA    . MET B 1 317 ? 25.046  13.074  0.638  1.00 42.67  ? 343 MET B CA    1 
ATOM   5385 C  C     . MET B 1 317 ? 26.523  13.253  0.988  1.00 47.76  ? 343 MET B C     1 
ATOM   5386 O  O     . MET B 1 317 ? 27.091  12.438  1.706  1.00 51.95  ? 343 MET B O     1 
ATOM   5387 C  CB    . MET B 1 317 ? 24.918  12.318  -0.679 1.00 46.02  ? 343 MET B CB    1 
ATOM   5388 C  CG    . MET B 1 317 ? 23.500  11.890  -0.939 1.00 46.55  ? 343 MET B CG    1 
ATOM   5389 S  SD    . MET B 1 317 ? 22.833  11.134  0.550  1.00 61.61  ? 343 MET B SD    1 
ATOM   5390 C  CE    . MET B 1 317 ? 21.086  11.179  0.194  1.00 43.17  ? 343 MET B CE    1 
ATOM   5391 N  N     . ASP B 1 318 ? 27.148  14.302  0.468  1.00 45.65  ? 344 ASP B N     1 
ATOM   5392 C  CA    . ASP B 1 318 ? 28.548  14.569  0.772  1.00 46.45  ? 344 ASP B CA    1 
ATOM   5393 C  C     . ASP B 1 318 ? 28.707  14.909  2.235  1.00 51.88  ? 344 ASP B C     1 
ATOM   5394 O  O     . ASP B 1 318 ? 29.634  14.435  2.894  1.00 54.96  ? 344 ASP B O     1 
ATOM   5395 C  CB    . ASP B 1 318 ? 29.092  15.708  -0.088 1.00 56.40  ? 344 ASP B CB    1 
ATOM   5396 C  CG    . ASP B 1 318 ? 29.199  15.334  -1.556 1.00 70.55  ? 344 ASP B CG    1 
ATOM   5397 O  OD1   . ASP B 1 318 ? 29.405  14.131  -1.847 1.00 64.23  ? 344 ASP B OD1   1 
ATOM   5398 O  OD2   . ASP B 1 318 ? 29.078  16.242  -2.413 1.00 70.76  ? 344 ASP B OD2   1 
ATOM   5399 N  N     . PHE B 1 319 ? 27.801  15.746  2.732  1.00 53.98  ? 345 PHE B N     1 
ATOM   5400 C  CA    . PHE B 1 319 ? 27.856  16.196  4.115  1.00 50.09  ? 345 PHE B CA    1 
ATOM   5401 C  C     . PHE B 1 319 ? 27.669  15.011  5.049  1.00 48.14  ? 345 PHE B C     1 
ATOM   5402 O  O     . PHE B 1 319 ? 28.437  14.814  5.989  1.00 47.53  ? 345 PHE B O     1 
ATOM   5403 C  CB    . PHE B 1 319 ? 26.791  17.255  4.383  1.00 47.47  ? 345 PHE B CB    1 
ATOM   5404 C  CG    . PHE B 1 319 ? 26.848  17.817  5.765  1.00 45.54  ? 345 PHE B CG    1 
ATOM   5405 C  CD1   . PHE B 1 319 ? 27.810  18.750  6.103  1.00 48.24  ? 345 PHE B CD1   1 
ATOM   5406 C  CD2   . PHE B 1 319 ? 25.964  17.389  6.737  1.00 46.50  ? 345 PHE B CD2   1 
ATOM   5407 C  CE1   . PHE B 1 319 ? 27.877  19.262  7.379  1.00 45.39  ? 345 PHE B CE1   1 
ATOM   5408 C  CE2   . PHE B 1 319 ? 26.026  17.900  8.017  1.00 48.39  ? 345 PHE B CE2   1 
ATOM   5409 C  CZ    . PHE B 1 319 ? 26.987  18.838  8.338  1.00 42.89  ? 345 PHE B CZ    1 
ATOM   5410 N  N     . ILE B 1 320 ? 26.626  14.235  4.773  1.00 46.41  ? 346 ILE B N     1 
ATOM   5411 C  CA    . ILE B 1 320 ? 26.317  13.018  5.512  1.00 48.77  ? 346 ILE B CA    1 
ATOM   5412 C  C     . ILE B 1 320 ? 27.444  11.994  5.533  1.00 50.02  ? 346 ILE B C     1 
ATOM   5413 O  O     . ILE B 1 320 ? 27.803  11.485  6.595  1.00 46.78  ? 346 ILE B O     1 
ATOM   5414 C  CB    . ILE B 1 320 ? 25.091  12.326  4.916  1.00 45.32  ? 346 ILE B CB    1 
ATOM   5415 C  CG1   . ILE B 1 320 ? 23.813  12.947  5.444  1.00 38.09  ? 346 ILE B CG1   1 
ATOM   5416 C  CG2   . ILE B 1 320 ? 25.093  10.835  5.215  1.00 44.87  ? 346 ILE B CG2   1 
ATOM   5417 C  CD1   . ILE B 1 320 ? 22.639  12.240  4.913  1.00 42.86  ? 346 ILE B CD1   1 
ATOM   5418 N  N     . LYS B 1 321 ? 27.997  11.721  4.351  1.00 50.48  ? 347 LYS B N     1 
ATOM   5419 C  CA    . LYS B 1 321 ? 28.802  10.527  4.085  1.00 55.79  ? 347 LYS B CA    1 
ATOM   5420 C  C     . LYS B 1 321 ? 29.769  10.148  5.201  1.00 56.84  ? 347 LYS B C     1 
ATOM   5421 O  O     . LYS B 1 321 ? 30.031  8.968   5.424  1.00 65.49  ? 347 LYS B O     1 
ATOM   5422 C  CB    . LYS B 1 321 ? 29.586  10.710  2.785  1.00 49.32  ? 347 LYS B CB    1 
ATOM   5423 N  N     . ASP B 1 322 ? 30.284  11.143  5.913  1.00 54.97  ? 348 ASP B N     1 
ATOM   5424 C  CA    . ASP B 1 322 ? 31.210  10.875  7.004  1.00 58.61  ? 348 ASP B CA    1 
ATOM   5425 C  C     . ASP B 1 322 ? 30.792  11.556  8.309  1.00 54.49  ? 348 ASP B C     1 
ATOM   5426 O  O     . ASP B 1 322 ? 31.605  11.738  9.221  1.00 48.73  ? 348 ASP B O     1 
ATOM   5427 C  CB    . ASP B 1 322 ? 32.613  11.315  6.597  1.00 64.80  ? 348 ASP B CB    1 
ATOM   5428 C  CG    . ASP B 1 322 ? 33.170  10.472  5.469  1.00 69.28  ? 348 ASP B CG    1 
ATOM   5429 O  OD1   . ASP B 1 322 ? 33.008  9.236   5.523  1.00 72.12  ? 348 ASP B OD1   1 
ATOM   5430 O  OD2   . ASP B 1 322 ? 33.752  11.040  4.522  1.00 79.65  ? 348 ASP B OD2   1 
ATOM   5431 N  N     . LEU B 1 323 ? 29.519  11.928  8.390  1.00 48.50  ? 349 LEU B N     1 
ATOM   5432 C  CA    . LEU B 1 323 ? 28.970  12.520  9.602  1.00 50.99  ? 349 LEU B CA    1 
ATOM   5433 C  C     . LEU B 1 323 ? 28.772  11.470  10.695 1.00 50.37  ? 349 LEU B C     1 
ATOM   5434 O  O     . LEU B 1 323 ? 28.017  10.514  10.512 1.00 49.45  ? 349 LEU B O     1 
ATOM   5435 C  CB    . LEU B 1 323 ? 27.641  13.219  9.302  1.00 50.67  ? 349 LEU B CB    1 
ATOM   5436 C  CG    . LEU B 1 323 ? 26.873  13.751  10.515 1.00 51.07  ? 349 LEU B CG    1 
ATOM   5437 C  CD1   . LEU B 1 323 ? 27.593  14.943  11.140 1.00 41.46  ? 349 LEU B CD1   1 
ATOM   5438 C  CD2   . LEU B 1 323 ? 25.442  14.111  10.140 1.00 47.49  ? 349 LEU B CD2   1 
ATOM   5439 N  N     . PRO B 1 324 ? 29.462  11.639  11.834 1.00 47.07  ? 350 PRO B N     1 
ATOM   5440 C  CA    . PRO B 1 324 ? 29.251  10.733  12.966 1.00 45.86  ? 350 PRO B CA    1 
ATOM   5441 C  C     . PRO B 1 324 ? 27.790  10.715  13.403 1.00 46.08  ? 350 PRO B C     1 
ATOM   5442 O  O     . PRO B 1 324 ? 27.131  11.752  13.397 1.00 44.66  ? 350 PRO B O     1 
ATOM   5443 C  CB    . PRO B 1 324 ? 30.142  11.320  14.062 1.00 47.73  ? 350 PRO B CB    1 
ATOM   5444 C  CG    . PRO B 1 324 ? 31.184  12.099  13.333 1.00 49.96  ? 350 PRO B CG    1 
ATOM   5445 C  CD    . PRO B 1 324 ? 30.487  12.656  12.123 1.00 53.22  ? 350 PRO B CD    1 
ATOM   5446 N  N     . ILE B 1 325 ? 27.289  9.537   13.754 1.00 46.89  ? 351 ILE B N     1 
ATOM   5447 C  CA    . ILE B 1 325 ? 25.891  9.377   14.130 1.00 45.07  ? 351 ILE B CA    1 
ATOM   5448 C  C     . ILE B 1 325 ? 25.588  10.081  15.447 1.00 42.37  ? 351 ILE B C     1 
ATOM   5449 O  O     . ILE B 1 325 ? 24.453  10.453  15.720 1.00 43.58  ? 351 ILE B O     1 
ATOM   5450 C  CB    . ILE B 1 325 ? 25.524  7.899   14.261 1.00 45.58  ? 351 ILE B CB    1 
ATOM   5451 C  CG1   . ILE B 1 325 ? 26.523  7.188   15.179 1.00 40.23  ? 351 ILE B CG1   1 
ATOM   5452 C  CG2   . ILE B 1 325 ? 25.492  7.245   12.890 1.00 46.68  ? 351 ILE B CG2   1 
ATOM   5453 C  CD1   . ILE B 1 325 ? 26.082  5.826   15.605 1.00 48.05  ? 351 ILE B CD1   1 
ATOM   5454 N  N     . ARG B 1 326 ? 26.614  10.247  16.269 1.00 39.95  ? 352 ARG B N     1 
ATOM   5455 C  CA    . ARG B 1 326 ? 26.447  10.861  17.576 1.00 43.21  ? 352 ARG B CA    1 
ATOM   5456 C  C     . ARG B 1 326 ? 25.923  12.296  17.459 1.00 44.58  ? 352 ARG B C     1 
ATOM   5457 O  O     . ARG B 1 326 ? 25.256  12.805  18.355 1.00 44.76  ? 352 ARG B O     1 
ATOM   5458 C  CB    . ARG B 1 326 ? 27.783  10.853  18.322 1.00 45.24  ? 352 ARG B CB    1 
ATOM   5459 C  CG    . ARG B 1 326 ? 27.720  11.311  19.761 1.00 42.00  ? 352 ARG B CG    1 
ATOM   5460 C  CD    . ARG B 1 326 ? 26.584  10.676  20.507 1.00 39.36  ? 352 ARG B CD    1 
ATOM   5461 N  NE    . ARG B 1 326 ? 26.801  10.728  21.950 1.00 41.36  ? 352 ARG B NE    1 
ATOM   5462 C  CZ    . ARG B 1 326 ? 26.251  11.622  22.763 1.00 49.61  ? 352 ARG B CZ    1 
ATOM   5463 N  NH1   . ARG B 1 326 ? 25.425  12.533  22.282 1.00 50.40  ? 352 ARG B NH1   1 
ATOM   5464 N  NH2   . ARG B 1 326 ? 26.535  11.605  24.057 1.00 52.71  ? 352 ARG B NH2   1 
ATOM   5465 N  N     . LYS B 1 327 ? 26.237  12.937  16.341 1.00 43.02  ? 353 LYS B N     1 
ATOM   5466 C  CA    . LYS B 1 327 ? 25.917  14.340  16.143 1.00 42.31  ? 353 LYS B CA    1 
ATOM   5467 C  C     . LYS B 1 327 ? 24.499  14.607  15.647 1.00 43.67  ? 353 LYS B C     1 
ATOM   5468 O  O     . LYS B 1 327 ? 24.071  15.759  15.613 1.00 52.09  ? 353 LYS B O     1 
ATOM   5469 C  CB    . LYS B 1 327 ? 26.922  14.967  15.178 1.00 44.50  ? 353 LYS B CB    1 
ATOM   5470 C  CG    . LYS B 1 327 ? 28.270  15.244  15.827 1.00 49.04  ? 353 LYS B CG    1 
ATOM   5471 C  CD    . LYS B 1 327 ? 29.240  15.909  14.861 1.00 56.61  ? 353 LYS B CD    1 
ATOM   5472 C  CE    . LYS B 1 327 ? 30.597  16.105  15.520 1.00 58.43  ? 353 LYS B CE    1 
ATOM   5473 N  NZ    . LYS B 1 327 ? 30.481  16.889  16.783 1.00 55.29  ? 353 LYS B NZ    1 
ATOM   5474 N  N     . VAL B 1 328 ? 23.761  13.574  15.262 1.00 37.18  ? 354 VAL B N     1 
ATOM   5475 C  CA    . VAL B 1 328 ? 22.387  13.811  14.849 1.00 39.31  ? 354 VAL B CA    1 
ATOM   5476 C  C     . VAL B 1 328 ? 21.514  13.803  16.098 1.00 39.99  ? 354 VAL B C     1 
ATOM   5477 O  O     . VAL B 1 328 ? 21.801  13.095  17.059 1.00 42.00  ? 354 VAL B O     1 
ATOM   5478 C  CB    . VAL B 1 328 ? 21.909  12.770  13.811 1.00 35.53  ? 354 VAL B CB    1 
ATOM   5479 C  CG1   . VAL B 1 328 ? 21.911  11.403  14.391 1.00 43.73  ? 354 VAL B CG1   1 
ATOM   5480 C  CG2   . VAL B 1 328 ? 20.529  13.108  13.289 1.00 38.77  ? 354 VAL B CG2   1 
ATOM   5481 N  N     . SER B 1 329 ? 20.467  14.620  16.096 1.00 41.58  ? 355 SER B N     1 
ATOM   5482 C  CA    . SER B 1 329 ? 19.619  14.762  17.273 1.00 40.46  ? 355 SER B CA    1 
ATOM   5483 C  C     . SER B 1 329 ? 18.729  13.537  17.425 1.00 40.73  ? 355 SER B C     1 
ATOM   5484 O  O     . SER B 1 329 ? 17.888  13.272  16.571 1.00 48.59  ? 355 SER B O     1 
ATOM   5485 C  CB    . SER B 1 329 ? 18.768  16.034  17.182 1.00 45.16  ? 355 SER B CB    1 
ATOM   5486 O  OG    . SER B 1 329 ? 17.938  16.181  18.317 1.00 43.17  ? 355 SER B OG    1 
ATOM   5487 N  N     . GLY B 1 330 ? 18.909  12.804  18.523 1.00 41.04  ? 356 GLY B N     1 
ATOM   5488 C  CA    . GLY B 1 330 ? 18.192  11.559  18.747 1.00 38.39  ? 356 GLY B CA    1 
ATOM   5489 C  C     . GLY B 1 330 ? 19.104  10.398  19.108 1.00 40.36  ? 356 GLY B C     1 
ATOM   5490 O  O     . GLY B 1 330 ? 18.658  9.408   19.689 1.00 41.58  ? 356 GLY B O     1 
ATOM   5491 N  N     . ILE B 1 331 ? 20.378  10.506  18.744 1.00 39.19  ? 357 ILE B N     1 
ATOM   5492 C  CA    . ILE B 1 331 ? 21.354  9.457   19.027 1.00 35.17  ? 357 ILE B CA    1 
ATOM   5493 C  C     . ILE B 1 331 ? 22.245  9.857   20.194 1.00 39.60  ? 357 ILE B C     1 
ATOM   5494 O  O     . ILE B 1 331 ? 23.170  10.653  20.031 1.00 44.97  ? 357 ILE B O     1 
ATOM   5495 C  CB    . ILE B 1 331 ? 22.245  9.147   17.810 1.00 37.20  ? 357 ILE B CB    1 
ATOM   5496 C  CG1   . ILE B 1 331 ? 21.397  8.810   16.582 1.00 33.11  ? 357 ILE B CG1   1 
ATOM   5497 C  CG2   . ILE B 1 331 ? 23.211  8.020   18.132 1.00 34.45  ? 357 ILE B CG2   1 
ATOM   5498 C  CD1   . ILE B 1 331 ? 20.351  7.767   16.816 1.00 36.57  ? 357 ILE B CD1   1 
ATOM   5499 N  N     . GLY B 1 332 ? 21.957  9.315   21.372 1.00 38.08  ? 358 GLY B N     1 
ATOM   5500 C  CA    . GLY B 1 332 ? 22.715  9.649   22.562 1.00 34.96  ? 358 GLY B CA    1 
ATOM   5501 C  C     . GLY B 1 332 ? 23.864  8.699   22.837 1.00 33.06  ? 358 GLY B C     1 
ATOM   5502 O  O     . GLY B 1 332 ? 24.313  7.992   21.944 1.00 32.95  ? 358 GLY B O     1 
ATOM   5503 N  N     . LYS B 1 333 ? 24.350  8.707   24.076 1.00 37.08  ? 359 LYS B N     1 
ATOM   5504 C  CA    . LYS B 1 333 ? 25.490  7.892   24.481 1.00 38.20  ? 359 LYS B CA    1 
ATOM   5505 C  C     . LYS B 1 333 ? 25.220  6.412   24.230 1.00 38.36  ? 359 LYS B C     1 
ATOM   5506 O  O     . LYS B 1 333 ? 26.009  5.720   23.559 1.00 42.58  ? 359 LYS B O     1 
ATOM   5507 C  CB    . LYS B 1 333 ? 25.814  8.134   25.959 1.00 35.41  ? 359 LYS B CB    1 
ATOM   5508 C  CG    . LYS B 1 333 ? 27.201  7.680   26.376 1.00 35.38  ? 359 LYS B CG    1 
ATOM   5509 N  N     . VAL B 1 334 ? 24.080  5.949   24.738 1.00 36.80  ? 360 VAL B N     1 
ATOM   5510 C  CA    . VAL B 1 334 ? 23.684  4.547   24.629 1.00 38.58  ? 360 VAL B CA    1 
ATOM   5511 C  C     . VAL B 1 334 ? 23.573  4.075   23.186 1.00 36.53  ? 360 VAL B C     1 
ATOM   5512 O  O     . VAL B 1 334 ? 24.272  3.148   22.792 1.00 41.33  ? 360 VAL B O     1 
ATOM   5513 C  CB    . VAL B 1 334 ? 22.331  4.284   25.322 1.00 38.05  ? 360 VAL B CB    1 
ATOM   5514 C  CG1   . VAL B 1 334 ? 21.857  2.864   25.039 1.00 37.74  ? 360 VAL B CG1   1 
ATOM   5515 C  CG2   . VAL B 1 334 ? 22.435  4.535   26.814 1.00 38.52  ? 360 VAL B CG2   1 
ATOM   5516 N  N     . THR B 1 335 ? 22.678  4.694   22.420 1.00 30.69  ? 361 THR B N     1 
ATOM   5517 C  CA    . THR B 1 335 ? 22.481  4.347   21.018 1.00 30.44  ? 361 THR B CA    1 
ATOM   5518 C  C     . THR B 1 335 ? 23.794  4.382   20.230 1.00 33.29  ? 361 THR B C     1 
ATOM   5519 O  O     . THR B 1 335 ? 24.052  3.504   19.402 1.00 35.70  ? 361 THR B O     1 
ATOM   5520 C  CB    . THR B 1 335 ? 21.456  5.278   20.355 1.00 32.32  ? 361 THR B CB    1 
ATOM   5521 O  OG1   . THR B 1 335 ? 20.229  5.243   21.099 1.00 28.74  ? 361 THR B OG1   1 
ATOM   5522 C  CG2   . THR B 1 335 ? 21.195  4.851   18.917 1.00 27.50  ? 361 THR B CG2   1 
ATOM   5523 N  N     . GLU B 1 336 ? 24.633  5.376   20.509 1.00 34.98  ? 362 GLU B N     1 
ATOM   5524 C  CA    . GLU B 1 336 ? 25.947  5.445   19.879 1.00 38.57  ? 362 GLU B CA    1 
ATOM   5525 C  C     . GLU B 1 336 ? 26.759  4.206   20.194 1.00 39.59  ? 362 GLU B C     1 
ATOM   5526 O  O     . GLU B 1 336 ? 27.399  3.645   19.309 1.00 43.27  ? 362 GLU B O     1 
ATOM   5527 C  CB    . GLU B 1 336 ? 26.733  6.679   20.329 1.00 39.74  ? 362 GLU B CB    1 
ATOM   5528 C  CG    . GLU B 1 336 ? 28.004  6.895   19.515 1.00 39.96  ? 362 GLU B CG    1 
ATOM   5529 C  CD    . GLU B 1 336 ? 28.965  7.884   20.145 1.00 43.15  ? 362 GLU B CD    1 
ATOM   5530 O  OE1   . GLU B 1 336 ? 28.703  8.340   21.275 1.00 42.57  ? 362 GLU B OE1   1 
ATOM   5531 O  OE2   . GLU B 1 336 ? 29.996  8.195   19.512 1.00 53.99  ? 362 GLU B OE2   1 
ATOM   5532 N  N     . LYS B 1 337 ? 26.734  3.781   21.454 1.00 40.23  ? 363 LYS B N     1 
ATOM   5533 C  CA    . LYS B 1 337 ? 27.484  2.584   21.842 1.00 39.37  ? 363 LYS B CA    1 
ATOM   5534 C  C     . LYS B 1 337 ? 26.942  1.293   21.219 1.00 34.99  ? 363 LYS B C     1 
ATOM   5535 O  O     . LYS B 1 337 ? 27.711  0.437   20.770 1.00 37.69  ? 363 LYS B O     1 
ATOM   5536 C  CB    . LYS B 1 337 ? 27.521  2.440   23.365 1.00 35.10  ? 363 LYS B CB    1 
ATOM   5537 C  CG    . LYS B 1 337 ? 28.778  1.742   23.842 1.00 46.30  ? 363 LYS B CG    1 
ATOM   5538 C  CD    . LYS B 1 337 ? 28.770  1.458   25.331 1.00 52.15  ? 363 LYS B CD    1 
ATOM   5539 C  CE    . LYS B 1 337 ? 30.071  0.781   25.741 1.00 51.93  ? 363 LYS B CE    1 
ATOM   5540 N  NZ    . LYS B 1 337 ? 30.247  0.734   27.212 1.00 59.75  ? 363 LYS B NZ    1 
ATOM   5541 N  N     . MET B 1 338 ? 25.623  1.151   21.196 1.00 33.72  ? 364 MET B N     1 
ATOM   5542 C  CA    . MET B 1 338 ? 25.007  -0.025  20.602 1.00 37.01  ? 364 MET B CA    1 
ATOM   5543 C  C     . MET B 1 338 ? 25.309  -0.108  19.115 1.00 40.07  ? 364 MET B C     1 
ATOM   5544 O  O     . MET B 1 338 ? 25.605  -1.184  18.608 1.00 45.82  ? 364 MET B O     1 
ATOM   5545 C  CB    . MET B 1 338 ? 23.494  -0.029  20.817 1.00 35.61  ? 364 MET B CB    1 
ATOM   5546 C  CG    . MET B 1 338 ? 23.062  0.012   22.265 1.00 39.10  ? 364 MET B CG    1 
ATOM   5547 S  SD    . MET B 1 338 ? 21.298  -0.327  22.436 1.00 62.42  ? 364 MET B SD    1 
ATOM   5548 C  CE    . MET B 1 338 ? 21.241  -2.077  22.045 1.00 46.11  ? 364 MET B CE    1 
ATOM   5549 N  N     . LEU B 1 339 ? 25.225  1.016   18.408 1.00 35.76  ? 365 LEU B N     1 
ATOM   5550 C  CA    . LEU B 1 339 ? 25.529  1.007   16.979 1.00 35.01  ? 365 LEU B CA    1 
ATOM   5551 C  C     . LEU B 1 339 ? 27.023  0.822   16.731 1.00 36.69  ? 365 LEU B C     1 
ATOM   5552 O  O     . LEU B 1 339 ? 27.422  0.238   15.729 1.00 40.85  ? 365 LEU B O     1 
ATOM   5553 C  CB    . LEU B 1 339 ? 25.036  2.292   16.310 1.00 34.44  ? 365 LEU B CB    1 
ATOM   5554 C  CG    . LEU B 1 339 ? 23.515  2.462   16.339 1.00 35.17  ? 365 LEU B CG    1 
ATOM   5555 C  CD1   . LEU B 1 339 ? 23.107  3.776   15.711 1.00 31.59  ? 365 LEU B CD1   1 
ATOM   5556 C  CD2   . LEU B 1 339 ? 22.830  1.305   15.630 1.00 30.06  ? 365 LEU B CD2   1 
ATOM   5557 N  N     . LYS B 1 340 ? 27.848  1.308   17.650 1.00 37.18  ? 366 LYS B N     1 
ATOM   5558 C  CA    . LYS B 1 340 ? 29.285  1.122   17.529 1.00 37.95  ? 366 LYS B CA    1 
ATOM   5559 C  C     . LYS B 1 340 ? 29.614  -0.352  17.691 1.00 43.01  ? 366 LYS B C     1 
ATOM   5560 O  O     . LYS B 1 340 ? 30.571  -0.849  17.096 1.00 43.89  ? 366 LYS B O     1 
ATOM   5561 C  CB    . LYS B 1 340 ? 30.038  1.955   18.566 1.00 41.94  ? 366 LYS B CB    1 
ATOM   5562 C  CG    . LYS B 1 340 ? 31.548  1.965   18.376 1.00 45.33  ? 366 LYS B CG    1 
ATOM   5563 C  CD    . LYS B 1 340 ? 32.255  2.729   19.485 1.00 63.33  ? 366 LYS B CD    1 
ATOM   5564 C  CE    . LYS B 1 340 ? 33.765  2.749   19.278 1.00 67.66  ? 366 LYS B CE    1 
ATOM   5565 N  NZ    . LYS B 1 340 ? 34.480  3.453   20.390 1.00 77.79  ? 366 LYS B NZ    1 
ATOM   5566 N  N     . ALA B 1 341 ? 28.809  -1.046  18.493 1.00 42.67  ? 367 ALA B N     1 
ATOM   5567 C  CA    . ALA B 1 341 ? 28.955  -2.490  18.657 1.00 41.22  ? 367 ALA B CA    1 
ATOM   5568 C  C     . ALA B 1 341 ? 28.803  -3.234  17.327 1.00 41.82  ? 367 ALA B C     1 
ATOM   5569 O  O     . ALA B 1 341 ? 29.397  -4.292  17.134 1.00 43.92  ? 367 ALA B O     1 
ATOM   5570 C  CB    . ALA B 1 341 ? 27.947  -3.010  19.669 1.00 37.03  ? 367 ALA B CB    1 
ATOM   5571 N  N     . LEU B 1 342 ? 28.013  -2.677  16.414 1.00 35.42  ? 368 LEU B N     1 
ATOM   5572 C  CA    . LEU B 1 342 ? 27.810  -3.293  15.112 1.00 35.55  ? 368 LEU B CA    1 
ATOM   5573 C  C     . LEU B 1 342 ? 28.803  -2.744  14.103 1.00 42.36  ? 368 LEU B C     1 
ATOM   5574 O  O     . LEU B 1 342 ? 28.691  -3.009  12.907 1.00 46.32  ? 368 LEU B O     1 
ATOM   5575 C  CB    . LEU B 1 342 ? 26.384  -3.062  14.617 1.00 32.48  ? 368 LEU B CB    1 
ATOM   5576 C  CG    . LEU B 1 342 ? 25.267  -3.264  15.633 1.00 37.24  ? 368 LEU B CG    1 
ATOM   5577 C  CD1   . LEU B 1 342 ? 23.915  -2.960  15.004 1.00 36.94  ? 368 LEU B CD1   1 
ATOM   5578 C  CD2   . LEU B 1 342 ? 25.306  -4.687  16.151 1.00 41.30  ? 368 LEU B CD2   1 
ATOM   5579 N  N     . GLY B 1 343 ? 29.783  -1.992  14.598 1.00 41.48  ? 369 GLY B N     1 
ATOM   5580 C  CA    . GLY B 1 343 ? 30.762  -1.337  13.750 1.00 41.63  ? 369 GLY B CA    1 
ATOM   5581 C  C     . GLY B 1 343 ? 30.207  -0.153  12.978 1.00 41.96  ? 369 GLY B C     1 
ATOM   5582 O  O     . GLY B 1 343 ? 30.780  0.255   11.973 1.00 44.88  ? 369 GLY B O     1 
ATOM   5583 N  N     . ILE B 1 344 ? 29.097  0.405   13.451 1.00 42.13  ? 370 ILE B N     1 
ATOM   5584 C  CA    . ILE B 1 344 ? 28.502  1.587   12.830 1.00 39.83  ? 370 ILE B CA    1 
ATOM   5585 C  C     . ILE B 1 344 ? 28.970  2.854   13.539 1.00 38.38  ? 370 ILE B C     1 
ATOM   5586 O  O     . ILE B 1 344 ? 28.771  3.007   14.744 1.00 43.79  ? 370 ILE B O     1 
ATOM   5587 C  CB    . ILE B 1 344 ? 26.961  1.528   12.856 1.00 35.57  ? 370 ILE B CB    1 
ATOM   5588 C  CG1   . ILE B 1 344 ? 26.464  0.289   12.100 1.00 38.60  ? 370 ILE B CG1   1 
ATOM   5589 C  CG2   . ILE B 1 344 ? 26.362  2.811   12.298 1.00 31.59  ? 370 ILE B CG2   1 
ATOM   5590 C  CD1   . ILE B 1 344 ? 24.968  0.049   12.208 1.00 35.23  ? 370 ILE B CD1   1 
ATOM   5591 N  N     . ILE B 1 345 ? 29.612  3.751   12.799 1.00 38.56  ? 371 ILE B N     1 
ATOM   5592 C  CA    . ILE B 1 345 ? 30.077  5.009   13.374 1.00 46.46  ? 371 ILE B CA    1 
ATOM   5593 C  C     . ILE B 1 345 ? 29.468  6.212   12.666 1.00 46.86  ? 371 ILE B C     1 
ATOM   5594 O  O     . ILE B 1 345 ? 29.079  7.190   13.304 1.00 46.87  ? 371 ILE B O     1 
ATOM   5595 C  CB    . ILE B 1 345 ? 31.605  5.135   13.308 1.00 44.01  ? 371 ILE B CB    1 
ATOM   5596 C  CG1   . ILE B 1 345 ? 32.270  3.875   13.850 1.00 40.43  ? 371 ILE B CG1   1 
ATOM   5597 C  CG2   . ILE B 1 345 ? 32.070  6.329   14.120 1.00 44.73  ? 371 ILE B CG2   1 
ATOM   5598 C  CD1   . ILE B 1 345 ? 32.094  3.700   15.330 1.00 38.34  ? 371 ILE B CD1   1 
ATOM   5599 N  N     . THR B 1 346 ? 29.404  6.138   11.343 1.00 44.15  ? 372 THR B N     1 
ATOM   5600 C  CA    . THR B 1 346 ? 28.929  7.255   10.540 1.00 46.50  ? 372 THR B CA    1 
ATOM   5601 C  C     . THR B 1 346 ? 27.632  6.881   9.829  1.00 49.92  ? 372 THR B C     1 
ATOM   5602 O  O     . THR B 1 346 ? 27.185  5.735   9.912  1.00 47.15  ? 372 THR B O     1 
ATOM   5603 C  CB    . THR B 1 346 ? 29.992  7.691   9.533  1.00 45.65  ? 372 THR B CB    1 
ATOM   5604 O  OG1   . THR B 1 346 ? 30.118  6.697   8.517  1.00 55.02  ? 372 THR B OG1   1 
ATOM   5605 C  CG2   . THR B 1 346 ? 31.330  7.824   10.232 1.00 44.66  ? 372 THR B CG2   1 
ATOM   5606 N  N     . CYS B 1 347 ? 27.028  7.833   9.124  1.00 44.02  ? 373 CYS B N     1 
ATOM   5607 C  CA    . CYS B 1 347 ? 25.717  7.576   8.529  1.00 44.93  ? 373 CYS B CA    1 
ATOM   5608 C  C     . CYS B 1 347 ? 25.802  6.715   7.285  1.00 49.51  ? 373 CYS B C     1 
ATOM   5609 O  O     . CYS B 1 347 ? 24.802  6.122   6.869  1.00 52.42  ? 373 CYS B O     1 
ATOM   5610 C  CB    . CYS B 1 347 ? 25.008  8.882   8.184  1.00 44.00  ? 373 CYS B CB    1 
ATOM   5611 S  SG    . CYS B 1 347 ? 24.604  9.909   9.592  1.00 47.50  ? 373 CYS B SG    1 
ATOM   5612 N  N     . THR B 1 348 ? 26.989  6.657   6.687  1.00 50.68  ? 374 THR B N     1 
ATOM   5613 C  CA    . THR B 1 348 ? 27.201  5.783   5.546  1.00 53.17  ? 374 THR B CA    1 
ATOM   5614 C  C     . THR B 1 348 ? 27.019  4.343   6.035  1.00 51.67  ? 374 THR B C     1 
ATOM   5615 O  O     . THR B 1 348 ? 26.265  3.563   5.444  1.00 48.72  ? 374 THR B O     1 
ATOM   5616 C  CB    . THR B 1 348 ? 28.589  6.017   4.846  1.00 53.18  ? 374 THR B CB    1 
ATOM   5617 O  OG1   . THR B 1 348 ? 28.690  5.183   3.686  1.00 61.64  ? 374 THR B OG1   1 
ATOM   5618 C  CG2   . THR B 1 348 ? 29.772  5.738   5.754  1.00 45.56  ? 374 THR B CG2   1 
ATOM   5619 N  N     . GLU B 1 349 ? 27.689  3.998   7.130  1.00 49.12  ? 375 GLU B N     1 
ATOM   5620 C  CA    . GLU B 1 349 ? 27.577  2.665   7.712  1.00 47.41  ? 375 GLU B CA    1 
ATOM   5621 C  C     . GLU B 1 349 ? 26.185  2.415   8.277  1.00 40.91  ? 375 GLU B C     1 
ATOM   5622 O  O     . GLU B 1 349 ? 25.716  1.284   8.304  1.00 45.34  ? 375 GLU B O     1 
ATOM   5623 C  CB    . GLU B 1 349 ? 28.639  2.476   8.792  1.00 39.95  ? 375 GLU B CB    1 
ATOM   5624 C  CG    . GLU B 1 349 ? 29.990  3.020   8.375  1.00 47.03  ? 375 GLU B CG    1 
ATOM   5625 C  CD    . GLU B 1 349 ? 30.978  3.085   9.514  1.00 53.98  ? 375 GLU B CD    1 
ATOM   5626 O  OE1   . GLU B 1 349 ? 30.648  2.589   10.609 1.00 59.33  ? 375 GLU B OE1   1 
ATOM   5627 O  OE2   . GLU B 1 349 ? 32.086  3.632   9.317  1.00 57.69  ? 375 GLU B OE2   1 
ATOM   5628 N  N     . LEU B 1 350 ? 25.527  3.472   8.735  1.00 41.23  ? 376 LEU B N     1 
ATOM   5629 C  CA    . LEU B 1 350 ? 24.135  3.355   9.144  1.00 42.22  ? 376 LEU B CA    1 
ATOM   5630 C  C     . LEU B 1 350 ? 23.250  2.976   7.957  1.00 41.72  ? 376 LEU B C     1 
ATOM   5631 O  O     . LEU B 1 350 ? 22.259  2.266   8.117  1.00 38.12  ? 376 LEU B O     1 
ATOM   5632 C  CB    . LEU B 1 350 ? 23.640  4.656   9.782  1.00 43.57  ? 376 LEU B CB    1 
ATOM   5633 C  CG    . LEU B 1 350 ? 22.328  4.580   10.574 1.00 43.68  ? 376 LEU B CG    1 
ATOM   5634 C  CD1   . LEU B 1 350 ? 22.515  3.795   11.867 1.00 34.44  ? 376 LEU B CD1   1 
ATOM   5635 C  CD2   . LEU B 1 350 ? 21.786  5.973   10.860 1.00 38.96  ? 376 LEU B CD2   1 
ATOM   5636 N  N     . TYR B 1 351 ? 23.602  3.452   6.765  1.00 47.60  ? 377 TYR B N     1 
ATOM   5637 C  CA    . TYR B 1 351 ? 22.831  3.092   5.575  1.00 46.03  ? 377 TYR B CA    1 
ATOM   5638 C  C     . TYR B 1 351 ? 23.147  1.677   5.109  1.00 45.38  ? 377 TYR B C     1 
ATOM   5639 O  O     . TYR B 1 351 ? 22.252  0.932   4.712  1.00 44.41  ? 377 TYR B O     1 
ATOM   5640 C  CB    . TYR B 1 351 ? 23.080  4.065   4.422  1.00 43.72  ? 377 TYR B CB    1 
ATOM   5641 C  CG    . TYR B 1 351 ? 22.357  3.642   3.160  1.00 45.17  ? 377 TYR B CG    1 
ATOM   5642 C  CD1   . TYR B 1 351 ? 20.977  3.775   3.049  1.00 43.62  ? 377 TYR B CD1   1 
ATOM   5643 C  CD2   . TYR B 1 351 ? 23.051  3.092   2.084  1.00 43.60  ? 377 TYR B CD2   1 
ATOM   5644 C  CE1   . TYR B 1 351 ? 20.307  3.376   1.901  1.00 47.09  ? 377 TYR B CE1   1 
ATOM   5645 C  CE2   . TYR B 1 351 ? 22.390  2.694   0.932  1.00 40.12  ? 377 TYR B CE2   1 
ATOM   5646 C  CZ    . TYR B 1 351 ? 21.019  2.836   0.849  1.00 45.74  ? 377 TYR B CZ    1 
ATOM   5647 O  OH    . TYR B 1 351 ? 20.359  2.437   -0.290 1.00 49.62  ? 377 TYR B OH    1 
ATOM   5648 N  N     . GLN B 1 352 ? 24.426  1.320   5.152  1.00 43.63  ? 378 GLN B N     1 
ATOM   5649 C  CA    . GLN B 1 352 ? 24.877  0.002   4.720  1.00 39.48  ? 378 GLN B CA    1 
ATOM   5650 C  C     . GLN B 1 352 ? 24.171  -1.132  5.470  1.00 42.57  ? 378 GLN B C     1 
ATOM   5651 O  O     . GLN B 1 352 ? 23.738  -2.114  4.867  1.00 43.82  ? 378 GLN B O     1 
ATOM   5652 C  CB    . GLN B 1 352 ? 26.389  -0.115  4.900  1.00 37.77  ? 378 GLN B CB    1 
ATOM   5653 C  CG    . GLN B 1 352 ? 27.186  0.809   4.002  1.00 44.47  ? 378 GLN B CG    1 
ATOM   5654 C  CD    . GLN B 1 352 ? 28.664  0.805   4.329  1.00 52.97  ? 378 GLN B CD    1 
ATOM   5655 O  OE1   . GLN B 1 352 ? 29.080  0.277   5.364  1.00 56.51  ? 378 GLN B OE1   1 
ATOM   5656 N  NE2   . GLN B 1 352 ? 29.470  1.386   3.444  1.00 54.26  ? 378 GLN B NE2   1 
ATOM   5657 N  N     . GLN B 1 353 ? 24.062  -0.991  6.786  1.00 36.22  ? 379 GLN B N     1 
ATOM   5658 C  CA    . GLN B 1 353 ? 23.550  -2.056  7.633  1.00 37.10  ? 379 GLN B CA    1 
ATOM   5659 C  C     . GLN B 1 353 ? 22.042  -1.977  7.838  1.00 37.33  ? 379 GLN B C     1 
ATOM   5660 O  O     . GLN B 1 353 ? 21.518  -2.536  8.796  1.00 37.40  ? 379 GLN B O     1 
ATOM   5661 C  CB    . GLN B 1 353 ? 24.253  -2.024  8.988  1.00 38.47  ? 379 GLN B CB    1 
ATOM   5662 C  CG    . GLN B 1 353 ? 25.763  -1.917  8.900  1.00 46.32  ? 379 GLN B CG    1 
ATOM   5663 C  CD    . GLN B 1 353 ? 26.458  -3.230  9.230  1.00 59.89  ? 379 GLN B CD    1 
ATOM   5664 O  OE1   . GLN B 1 353 ? 25.996  -4.305  8.838  1.00 65.62  ? 379 GLN B OE1   1 
ATOM   5665 N  NE2   . GLN B 1 353 ? 27.569  -3.148  9.960  1.00 52.52  ? 379 GLN B NE2   1 
ATOM   5666 N  N     . ARG B 1 354 ? 21.348  -1.294  6.934  1.00 34.49  ? 380 ARG B N     1 
ATOM   5667 C  CA    . ARG B 1 354 ? 19.905  -1.074  7.071  1.00 40.12  ? 380 ARG B CA    1 
ATOM   5668 C  C     . ARG B 1 354 ? 19.050  -2.324  7.341  1.00 39.98  ? 380 ARG B C     1 
ATOM   5669 O  O     . ARG B 1 354 ? 18.142  -2.282  8.169  1.00 42.24  ? 380 ARG B O     1 
ATOM   5670 C  CB    . ARG B 1 354 ? 19.374  -0.353  5.827  1.00 41.79  ? 380 ARG B CB    1 
ATOM   5671 C  CG    . ARG B 1 354 ? 19.761  -0.964  4.499  1.00 44.79  ? 380 ARG B CG    1 
ATOM   5672 C  CD    . ARG B 1 354 ? 19.477  0.016   3.365  1.00 47.07  ? 380 ARG B CD    1 
ATOM   5673 N  NE    . ARG B 1 354 ? 19.711  -0.570  2.047  1.00 51.10  ? 380 ARG B NE    1 
ATOM   5674 C  CZ    . ARG B 1 354 ? 20.909  -0.715  1.489  1.00 48.03  ? 380 ARG B CZ    1 
ATOM   5675 N  NH1   . ARG B 1 354 ? 21.998  -0.306  2.128  1.00 40.45  ? 380 ARG B NH1   1 
ATOM   5676 N  NH2   . ARG B 1 354 ? 21.016  -1.263  0.285  1.00 53.65  ? 380 ARG B NH2   1 
ATOM   5677 N  N     . ALA B 1 355 ? 19.332  -3.425  6.652  1.00 43.71  ? 381 ALA B N     1 
ATOM   5678 C  CA    . ALA B 1 355 ? 18.547  -4.646  6.820  1.00 40.74  ? 381 ALA B CA    1 
ATOM   5679 C  C     . ALA B 1 355 ? 18.763  -5.258  8.198  1.00 39.69  ? 381 ALA B C     1 
ATOM   5680 O  O     . ALA B 1 355 ? 17.804  -5.576  8.922  1.00 41.73  ? 381 ALA B O     1 
ATOM   5681 C  CB    . ALA B 1 355 ? 18.895  -5.643  5.744  1.00 47.21  ? 381 ALA B CB    1 
ATOM   5682 N  N     . LEU B 1 356 ? 20.038  -5.427  8.540  1.00 36.30  ? 382 LEU B N     1 
ATOM   5683 C  CA    . LEU B 1 356 ? 20.453  -5.889  9.859  1.00 36.24  ? 382 LEU B CA    1 
ATOM   5684 C  C     . LEU B 1 356 ? 19.747  -5.100  10.964 1.00 39.56  ? 382 LEU B C     1 
ATOM   5685 O  O     . LEU B 1 356 ? 19.267  -5.673  11.942 1.00 44.04  ? 382 LEU B O     1 
ATOM   5686 C  CB    . LEU B 1 356 ? 21.972  -5.765  9.995  1.00 36.11  ? 382 LEU B CB    1 
ATOM   5687 C  CG    . LEU B 1 356 ? 22.600  -6.061  11.353 1.00 33.95  ? 382 LEU B CG    1 
ATOM   5688 C  CD1   . LEU B 1 356 ? 22.327  -7.500  11.745 1.00 35.22  ? 382 LEU B CD1   1 
ATOM   5689 C  CD2   . LEU B 1 356 ? 24.093  -5.787  11.321 1.00 37.43  ? 382 LEU B CD2   1 
ATOM   5690 N  N     . LEU B 1 357 ? 19.671  -3.784  10.785 1.00 42.44  ? 383 LEU B N     1 
ATOM   5691 C  CA    . LEU B 1 357 ? 18.977  -2.910  11.723 1.00 39.74  ? 383 LEU B CA    1 
ATOM   5692 C  C     . LEU B 1 357 ? 17.469  -3.144  11.699 1.00 42.41  ? 383 LEU B C     1 
ATOM   5693 O  O     . LEU B 1 357 ? 16.805  -3.034  12.727 1.00 47.54  ? 383 LEU B O     1 
ATOM   5694 C  CB    . LEU B 1 357 ? 19.280  -1.445  11.406 1.00 39.03  ? 383 LEU B CB    1 
ATOM   5695 C  CG    . LEU B 1 357 ? 20.750  -1.034  11.514 1.00 41.23  ? 383 LEU B CG    1 
ATOM   5696 C  CD1   . LEU B 1 357 ? 20.984  0.344   10.916 1.00 37.45  ? 383 LEU B CD1   1 
ATOM   5697 C  CD2   . LEU B 1 357 ? 21.233  -1.093  12.959 1.00 37.80  ? 383 LEU B CD2   1 
ATOM   5698 N  N     . SER B 1 358 ? 16.930  -3.470  10.530 1.00 42.28  ? 384 SER B N     1 
ATOM   5699 C  CA    . SER B 1 358 ? 15.520  -3.832  10.430 1.00 45.25  ? 384 SER B CA    1 
ATOM   5700 C  C     . SER B 1 358 ? 15.227  -5.084  11.250 1.00 46.74  ? 384 SER B C     1 
ATOM   5701 O  O     . SER B 1 358 ? 14.116  -5.261  11.754 1.00 47.78  ? 384 SER B O     1 
ATOM   5702 C  CB    . SER B 1 358 ? 15.119  -4.049  8.966  1.00 48.43  ? 384 SER B CB    1 
ATOM   5703 O  OG    . SER B 1 358 ? 14.018  -4.935  8.843  1.00 48.20  ? 384 SER B OG    1 
ATOM   5704 N  N     . LEU B 1 359 ? 16.223  -5.956  11.378 1.00 44.76  ? 385 LEU B N     1 
ATOM   5705 C  CA    . LEU B 1 359 ? 16.041  -7.186  12.160 1.00 46.76  ? 385 LEU B CA    1 
ATOM   5706 C  C     . LEU B 1 359 ? 16.341  -7.032  13.655 1.00 44.56  ? 385 LEU B C     1 
ATOM   5707 O  O     . LEU B 1 359 ? 15.771  -7.739  14.490 1.00 39.48  ? 385 LEU B O     1 
ATOM   5708 C  CB    . LEU B 1 359 ? 16.917  -8.307  11.589 1.00 45.17  ? 385 LEU B CB    1 
ATOM   5709 C  CG    . LEU B 1 359 ? 16.562  -8.814  10.192 1.00 41.67  ? 385 LEU B CG    1 
ATOM   5710 C  CD1   . LEU B 1 359 ? 17.642  -9.746  9.677  1.00 41.51  ? 385 LEU B CD1   1 
ATOM   5711 C  CD2   . LEU B 1 359 ? 15.212  -9.512  10.220 1.00 39.27  ? 385 LEU B CD2   1 
ATOM   5712 N  N     . LEU B 1 360 ? 17.236  -6.109  13.986 1.00 45.56  ? 386 LEU B N     1 
ATOM   5713 C  CA    . LEU B 1 360 ? 17.693  -5.957  15.362 1.00 37.32  ? 386 LEU B CA    1 
ATOM   5714 C  C     . LEU B 1 360 ? 16.843  -4.983  16.204 1.00 38.97  ? 386 LEU B C     1 
ATOM   5715 O  O     . LEU B 1 360 ? 16.709  -5.155  17.417 1.00 39.11  ? 386 LEU B O     1 
ATOM   5716 C  CB    . LEU B 1 360 ? 19.152  -5.511  15.353 1.00 35.57  ? 386 LEU B CB    1 
ATOM   5717 C  CG    . LEU B 1 360 ? 20.133  -6.654  15.073 1.00 31.88  ? 386 LEU B CG    1 
ATOM   5718 C  CD1   . LEU B 1 360 ? 21.559  -6.128  14.976 1.00 34.58  ? 386 LEU B CD1   1 
ATOM   5719 C  CD2   . LEU B 1 360 ? 20.032  -7.790  16.081 1.00 46.70  ? 386 LEU B CD2   1 
ATOM   5720 N  N     . PHE B 1 361 ? 16.254  -3.982  15.555 1.00 38.75  ? 387 PHE B N     1 
ATOM   5721 C  CA    . PHE B 1 361 ? 15.541  -2.914  16.255 1.00 34.23  ? 387 PHE B CA    1 
ATOM   5722 C  C     . PHE B 1 361 ? 14.073  -2.863  15.866 1.00 36.94  ? 387 PHE B C     1 
ATOM   5723 O  O     . PHE B 1 361 ? 13.657  -3.489  14.892 1.00 39.10  ? 387 PHE B O     1 
ATOM   5724 C  CB    . PHE B 1 361 ? 16.166  -1.556  15.959 1.00 34.75  ? 387 PHE B CB    1 
ATOM   5725 C  CG    . PHE B 1 361 ? 17.558  -1.394  16.481 1.00 33.42  ? 387 PHE B CG    1 
ATOM   5726 C  CD1   . PHE B 1 361 ? 17.791  -0.724  17.670 1.00 36.31  ? 387 PHE B CD1   1 
ATOM   5727 C  CD2   . PHE B 1 361 ? 18.638  -1.884  15.772 1.00 34.18  ? 387 PHE B CD2   1 
ATOM   5728 C  CE1   . PHE B 1 361 ? 19.077  -0.559  18.149 1.00 33.02  ? 387 PHE B CE1   1 
ATOM   5729 C  CE2   . PHE B 1 361 ? 19.925  -1.723  16.245 1.00 35.93  ? 387 PHE B CE2   1 
ATOM   5730 C  CZ    . PHE B 1 361 ? 20.145  -1.057  17.436 1.00 31.90  ? 387 PHE B CZ    1 
ATOM   5731 N  N     . SER B 1 362 ? 13.282  -2.121  16.630 1.00 35.22  ? 388 SER B N     1 
ATOM   5732 C  CA    . SER B 1 362 ? 11.865  -2.002  16.328 1.00 38.72  ? 388 SER B CA    1 
ATOM   5733 C  C     . SER B 1 362 ? 11.661  -1.189  15.062 1.00 39.87  ? 388 SER B C     1 
ATOM   5734 O  O     . SER B 1 362 ? 12.584  -0.534  14.579 1.00 40.97  ? 388 SER B O     1 
ATOM   5735 C  CB    . SER B 1 362 ? 11.124  -1.351  17.484 1.00 44.07  ? 388 SER B CB    1 
ATOM   5736 O  OG    . SER B 1 362 ? 11.545  -0.011  17.629 1.00 47.38  ? 388 SER B OG    1 
ATOM   5737 N  N     . GLU B 1 363 ? 10.437  -1.214  14.550 1.00 36.62  ? 389 GLU B N     1 
ATOM   5738 C  CA    . GLU B 1 363 ? 10.091  -0.521  13.318 1.00 44.40  ? 389 GLU B CA    1 
ATOM   5739 C  C     . GLU B 1 363 ? 10.442  0.968   13.365 1.00 44.53  ? 389 GLU B C     1 
ATOM   5740 O  O     . GLU B 1 363 ? 11.039  1.512   12.428 1.00 39.88  ? 389 GLU B O     1 
ATOM   5741 C  CB    . GLU B 1 363 ? 8.598   -0.705  13.045 1.00 45.73  ? 389 GLU B CB    1 
ATOM   5742 C  CG    . GLU B 1 363 ? 8.152   -0.415  11.628 1.00 55.24  ? 389 GLU B CG    1 
ATOM   5743 C  CD    . GLU B 1 363 ? 6.696   -0.792  11.406 1.00 67.83  ? 389 GLU B CD    1 
ATOM   5744 O  OE1   . GLU B 1 363 ? 6.333   -1.953  11.705 1.00 73.96  ? 389 GLU B OE1   1 
ATOM   5745 O  OE2   . GLU B 1 363 ? 5.915   0.076   10.951 1.00 62.65  ? 389 GLU B OE2   1 
ATOM   5746 N  N     . THR B 1 364 ? 10.093  1.602   14.479 1.00 40.27  ? 390 THR B N     1 
ATOM   5747 C  CA    . THR B 1 364 ? 10.288  3.034   14.662 1.00 41.00  ? 390 THR B CA    1 
ATOM   5748 C  C     . THR B 1 364 ? 11.767  3.403   14.636 1.00 38.41  ? 390 THR B C     1 
ATOM   5749 O  O     . THR B 1 364 ? 12.174  4.398   14.028 1.00 39.19  ? 390 THR B O     1 
ATOM   5750 C  CB    . THR B 1 364 ? 9.665   3.497   15.991 1.00 42.94  ? 390 THR B CB    1 
ATOM   5751 O  OG1   . THR B 1 364 ? 8.510   2.698   16.275 1.00 47.04  ? 390 THR B OG1   1 
ATOM   5752 C  CG2   . THR B 1 364 ? 9.259   4.960   15.915 1.00 45.08  ? 390 THR B CG2   1 
ATOM   5753 N  N     . SER B 1 365 ? 12.568  2.581   15.294 1.00 39.06  ? 391 SER B N     1 
ATOM   5754 C  CA    . SER B 1 365 ? 13.989  2.838   15.401 1.00 39.41  ? 391 SER B CA    1 
ATOM   5755 C  C     . SER B 1 365 ? 14.717  2.739   14.064 1.00 36.88  ? 391 SER B C     1 
ATOM   5756 O  O     . SER B 1 365 ? 15.578  3.565   13.776 1.00 37.19  ? 391 SER B O     1 
ATOM   5757 C  CB    . SER B 1 365 ? 14.610  1.871   16.403 1.00 42.73  ? 391 SER B CB    1 
ATOM   5758 O  OG    . SER B 1 365 ? 14.435  2.338   17.727 1.00 42.97  ? 391 SER B OG    1 
ATOM   5759 N  N     . TRP B 1 366 ? 14.401  1.732   13.252 1.00 39.40  ? 392 TRP B N     1 
ATOM   5760 C  CA    . TRP B 1 366 ? 15.142  1.567   12.005 1.00 39.55  ? 392 TRP B CA    1 
ATOM   5761 C  C     . TRP B 1 366 ? 14.543  2.457   10.916 1.00 39.11  ? 392 TRP B C     1 
ATOM   5762 O  O     . TRP B 1 366 ? 15.257  2.883   10.012 1.00 38.42  ? 392 TRP B O     1 
ATOM   5763 C  CB    . TRP B 1 366 ? 15.225  0.083   11.572 1.00 39.76  ? 392 TRP B CB    1 
ATOM   5764 C  CG    . TRP B 1 366 ? 13.975  -0.575  11.050 1.00 43.85  ? 392 TRP B CG    1 
ATOM   5765 C  CD1   . TRP B 1 366 ? 13.145  -1.419  11.735 1.00 44.07  ? 392 TRP B CD1   1 
ATOM   5766 C  CD2   . TRP B 1 366 ? 13.455  -0.503  9.714  1.00 44.39  ? 392 TRP B CD2   1 
ATOM   5767 N  NE1   . TRP B 1 366 ? 12.123  -1.847  10.920 1.00 41.81  ? 392 TRP B NE1   1 
ATOM   5768 C  CE2   . TRP B 1 366 ? 12.290  -1.298  9.675  1.00 44.97  ? 392 TRP B CE2   1 
ATOM   5769 C  CE3   . TRP B 1 366 ? 13.854  0.165   8.553  1.00 35.79  ? 392 TRP B CE3   1 
ATOM   5770 C  CZ2   . TRP B 1 366 ? 11.520  -1.435  8.524  1.00 39.98  ? 392 TRP B CZ2   1 
ATOM   5771 C  CZ3   . TRP B 1 366 ? 13.087  0.028   7.414  1.00 40.89  ? 392 TRP B CZ3   1 
ATOM   5772 C  CH2   . TRP B 1 366 ? 11.934  -0.766  7.407  1.00 40.00  ? 392 TRP B CH2   1 
ATOM   5773 N  N     . HIS B 1 367 ? 13.250  2.758   11.014 1.00 37.77  ? 393 HIS B N     1 
ATOM   5774 C  CA    . HIS B 1 367 ? 12.649  3.795   10.174 1.00 38.92  ? 393 HIS B CA    1 
ATOM   5775 C  C     . HIS B 1 367 ? 13.408  5.101   10.377 1.00 40.82  ? 393 HIS B C     1 
ATOM   5776 O  O     . HIS B 1 367 ? 13.888  5.733   9.421  1.00 41.08  ? 393 HIS B O     1 
ATOM   5777 C  CB    . HIS B 1 367 ? 11.177  4.007   10.527 1.00 40.68  ? 393 HIS B CB    1 
ATOM   5778 C  CG    . HIS B 1 367 ? 10.240  3.084   9.811  1.00 50.02  ? 393 HIS B CG    1 
ATOM   5779 N  ND1   . HIS B 1 367 ? 10.637  1.869   9.305  1.00 50.69  ? 393 HIS B ND1   1 
ATOM   5780 C  CD2   . HIS B 1 367 ? 8.920   3.202   9.529  1.00 55.55  ? 393 HIS B CD2   1 
ATOM   5781 C  CE1   . HIS B 1 367 ? 9.601   1.273   8.734  1.00 53.28  ? 393 HIS B CE1   1 
ATOM   5782 N  NE2   . HIS B 1 367 ? 8.550   2.062   8.855  1.00 57.00  ? 393 HIS B NE2   1 
ATOM   5783 N  N     . TYR B 1 368 ? 13.505  5.492   11.645 1.00 39.45  ? 394 TYR B N     1 
ATOM   5784 C  CA    . TYR B 1 368 ? 14.254  6.674   12.046 1.00 39.71  ? 394 TYR B CA    1 
ATOM   5785 C  C     . TYR B 1 368 ? 15.689  6.631   11.515 1.00 40.02  ? 394 TYR B C     1 
ATOM   5786 O  O     . TYR B 1 368 ? 16.148  7.581   10.870 1.00 43.30  ? 394 TYR B O     1 
ATOM   5787 C  CB    . TYR B 1 368 ? 14.255  6.805   13.568 1.00 37.21  ? 394 TYR B CB    1 
ATOM   5788 C  CG    . TYR B 1 368 ? 15.040  7.982   14.073 1.00 37.32  ? 394 TYR B CG    1 
ATOM   5789 C  CD1   . TYR B 1 368 ? 14.599  9.276   13.851 1.00 37.60  ? 394 TYR B CD1   1 
ATOM   5790 C  CD2   . TYR B 1 368 ? 16.232  7.799   14.757 1.00 40.24  ? 394 TYR B CD2   1 
ATOM   5791 C  CE1   . TYR B 1 368 ? 15.316  10.356  14.302 1.00 45.67  ? 394 TYR B CE1   1 
ATOM   5792 C  CE2   . TYR B 1 368 ? 16.959  8.874   15.215 1.00 40.08  ? 394 TYR B CE2   1 
ATOM   5793 C  CZ    . TYR B 1 368 ? 16.497  10.152  14.986 1.00 44.50  ? 394 TYR B CZ    1 
ATOM   5794 O  OH    . TYR B 1 368 ? 17.220  11.229  15.442 1.00 52.76  ? 394 TYR B OH    1 
ATOM   5795 N  N     . PHE B 1 369 ? 16.390  5.533   11.798 1.00 37.52  ? 395 PHE B N     1 
ATOM   5796 C  CA    . PHE B 1 369 ? 17.767  5.340   11.335 1.00 38.57  ? 395 PHE B CA    1 
ATOM   5797 C  C     . PHE B 1 369 ? 17.912  5.528   9.833  1.00 40.75  ? 395 PHE B C     1 
ATOM   5798 O  O     . PHE B 1 369 ? 18.899  6.082   9.356  1.00 39.67  ? 395 PHE B O     1 
ATOM   5799 C  CB    . PHE B 1 369 ? 18.271  3.939   11.696 1.00 40.04  ? 395 PHE B CB    1 
ATOM   5800 C  CG    . PHE B 1 369 ? 18.652  3.773   13.134 1.00 38.07  ? 395 PHE B CG    1 
ATOM   5801 C  CD1   . PHE B 1 369 ? 18.607  2.527   13.730 1.00 43.25  ? 395 PHE B CD1   1 
ATOM   5802 C  CD2   . PHE B 1 369 ? 19.061  4.855   13.887 1.00 36.17  ? 395 PHE B CD2   1 
ATOM   5803 C  CE1   . PHE B 1 369 ? 18.965  2.362   15.058 1.00 39.05  ? 395 PHE B CE1   1 
ATOM   5804 C  CE2   . PHE B 1 369 ? 19.419  4.701   15.210 1.00 39.38  ? 395 PHE B CE2   1 
ATOM   5805 C  CZ    . PHE B 1 369 ? 19.369  3.452   15.798 1.00 39.76  ? 395 PHE B CZ    1 
ATOM   5806 N  N     . LEU B 1 370 ? 16.915  5.067   9.090  1.00 39.07  ? 396 LEU B N     1 
ATOM   5807 C  CA    . LEU B 1 370 ? 16.960  5.136   7.641  1.00 38.82  ? 396 LEU B CA    1 
ATOM   5808 C  C     . LEU B 1 370 ? 16.763  6.570   7.187  1.00 41.67  ? 396 LEU B C     1 
ATOM   5809 O  O     . LEU B 1 370 ? 17.452  7.042   6.275  1.00 45.63  ? 396 LEU B O     1 
ATOM   5810 C  CB    . LEU B 1 370 ? 15.905  4.219   7.022  1.00 45.27  ? 396 LEU B CB    1 
ATOM   5811 C  CG    . LEU B 1 370 ? 16.001  4.004   5.513  1.00 40.71  ? 396 LEU B CG    1 
ATOM   5812 C  CD1   . LEU B 1 370 ? 17.372  3.464   5.152  1.00 35.09  ? 396 LEU B CD1   1 
ATOM   5813 C  CD2   . LEU B 1 370 ? 14.908  3.048   5.075  1.00 40.05  ? 396 LEU B CD2   1 
ATOM   5814 N  N     . HIS B 1 371 ? 15.821  7.259   7.823  1.00 38.98  ? 397 HIS B N     1 
ATOM   5815 C  CA    . HIS B 1 371 ? 15.647  8.681   7.568  1.00 36.18  ? 397 HIS B CA    1 
ATOM   5816 C  C     . HIS B 1 371 ? 16.963  9.419   7.789  1.00 36.27  ? 397 HIS B C     1 
ATOM   5817 O  O     . HIS B 1 371 ? 17.371  10.225  6.965  1.00 36.83  ? 397 HIS B O     1 
ATOM   5818 C  CB    . HIS B 1 371 ? 14.563  9.260   8.466  1.00 41.67  ? 397 HIS B CB    1 
ATOM   5819 C  CG    . HIS B 1 371 ? 13.174  9.016   7.972  1.00 40.73  ? 397 HIS B CG    1 
ATOM   5820 N  ND1   . HIS B 1 371 ? 12.479  7.857   8.246  1.00 42.56  ? 397 HIS B ND1   1 
ATOM   5821 C  CD2   . HIS B 1 371 ? 12.335  9.794   7.250  1.00 42.61  ? 397 HIS B CD2   1 
ATOM   5822 C  CE1   . HIS B 1 371 ? 11.278  7.927   7.703  1.00 40.92  ? 397 HIS B CE1   1 
ATOM   5823 N  NE2   . HIS B 1 371 ? 11.164  9.094   7.093  1.00 40.65  ? 397 HIS B NE2   1 
ATOM   5824 N  N     . ILE B 1 372 ? 17.629  9.134   8.901  1.00 38.58  ? 398 ILE B N     1 
ATOM   5825 C  CA    . ILE B 1 372 ? 18.929  9.734   9.179  1.00 38.33  ? 398 ILE B CA    1 
ATOM   5826 C  C     . ILE B 1 372 ? 19.971  9.425   8.099  1.00 42.99  ? 398 ILE B C     1 
ATOM   5827 O  O     . ILE B 1 372 ? 20.674  10.319  7.634  1.00 40.11  ? 398 ILE B O     1 
ATOM   5828 C  CB    . ILE B 1 372 ? 19.478  9.260   10.544 1.00 43.09  ? 398 ILE B CB    1 
ATOM   5829 C  CG1   . ILE B 1 372 ? 18.525  9.650   11.681 1.00 42.91  ? 398 ILE B CG1   1 
ATOM   5830 C  CG2   . ILE B 1 372 ? 20.873  9.819   10.785 1.00 40.50  ? 398 ILE B CG2   1 
ATOM   5831 C  CD1   . ILE B 1 372 ? 17.994  11.069  11.587 1.00 48.44  ? 398 ILE B CD1   1 
ATOM   5832 N  N     . SER B 1 373 ? 20.064  8.159   7.701  1.00 46.23  ? 399 SER B N     1 
ATOM   5833 C  CA    . SER B 1 373 ? 21.100  7.720   6.764  1.00 43.54  ? 399 SER B CA    1 
ATOM   5834 C  C     . SER B 1 373 ? 20.844  8.190   5.331  1.00 41.80  ? 399 SER B C     1 
ATOM   5835 O  O     . SER B 1 373 ? 21.754  8.187   4.499  1.00 39.65  ? 399 SER B O     1 
ATOM   5836 C  CB    . SER B 1 373 ? 21.238  6.194   6.802  1.00 47.61  ? 399 SER B CB    1 
ATOM   5837 O  OG    . SER B 1 373 ? 20.025  5.547   6.448  1.00 53.72  ? 399 SER B OG    1 
ATOM   5838 N  N     . LEU B 1 374 ? 19.603  8.573   5.044  1.00 45.44  ? 400 LEU B N     1 
ATOM   5839 C  CA    . LEU B 1 374 ? 19.269  9.198   3.763  1.00 46.25  ? 400 LEU B CA    1 
ATOM   5840 C  C     . LEU B 1 374 ? 19.257  10.733  3.805  1.00 44.48  ? 400 LEU B C     1 
ATOM   5841 O  O     . LEU B 1 374 ? 19.096  11.378  2.773  1.00 49.45  ? 400 LEU B O     1 
ATOM   5842 C  CB    . LEU B 1 374 ? 17.905  8.705   3.279  1.00 43.43  ? 400 LEU B CB    1 
ATOM   5843 C  CG    . LEU B 1 374 ? 17.832  7.271   2.761  1.00 51.25  ? 400 LEU B CG    1 
ATOM   5844 C  CD1   . LEU B 1 374 ? 16.467  7.013   2.142  1.00 51.05  ? 400 LEU B CD1   1 
ATOM   5845 C  CD2   . LEU B 1 374 ? 18.940  7.023   1.750  1.00 50.56  ? 400 LEU B CD2   1 
ATOM   5846 N  N     . GLY B 1 375 ? 19.419  11.314  4.990  1.00 46.85  ? 401 GLY B N     1 
ATOM   5847 C  CA    . GLY B 1 375 ? 19.413  12.760  5.141  1.00 42.06  ? 401 GLY B CA    1 
ATOM   5848 C  C     . GLY B 1 375 ? 18.056  13.413  5.042  1.00 41.41  ? 401 GLY B C     1 
ATOM   5849 O  O     . GLY B 1 375 ? 17.955  14.604  4.756  1.00 45.06  ? 401 GLY B O     1 
ATOM   5850 N  N     . LEU B 1 376 ? 17.010  12.637  5.297  1.00 37.83  ? 402 LEU B N     1 
ATOM   5851 C  CA    . LEU B 1 376 ? 15.662  13.178  5.343  1.00 41.86  ? 402 LEU B CA    1 
ATOM   5852 C  C     . LEU B 1 376 ? 15.374  13.775  6.713  1.00 46.49  ? 402 LEU B C     1 
ATOM   5853 O  O     . LEU B 1 376 ? 16.113  13.556  7.671  1.00 41.24  ? 402 LEU B O     1 
ATOM   5854 C  CB    . LEU B 1 376 ? 14.634  12.097  5.008  1.00 40.79  ? 402 LEU B CB    1 
ATOM   5855 C  CG    . LEU B 1 376 ? 14.296  11.887  3.530  1.00 47.90  ? 402 LEU B CG    1 
ATOM   5856 C  CD1   . LEU B 1 376 ? 15.539  11.606  2.705  1.00 47.67  ? 402 LEU B CD1   1 
ATOM   5857 C  CD2   . LEU B 1 376 ? 13.276  10.764  3.378  1.00 44.92  ? 402 LEU B CD2   1 
ATOM   5858 N  N     . GLY B 1 377 ? 14.286  14.528  6.793  1.00 53.76  ? 403 GLY B N     1 
ATOM   5859 C  CA    . GLY B 1 377 ? 13.888  15.187  8.021  1.00 47.69  ? 403 GLY B CA    1 
ATOM   5860 C  C     . GLY B 1 377 ? 12.704  16.070  7.697  1.00 43.98  ? 403 GLY B C     1 
ATOM   5861 O  O     . GLY B 1 377 ? 12.333  16.190  6.532  1.00 48.48  ? 403 GLY B O     1 
ATOM   5862 N  N     . SER B 1 378 ? 12.107  16.687  8.708  1.00 50.67  ? 404 SER B N     1 
ATOM   5863 C  CA    . SER B 1 378 ? 10.975  17.567  8.459  1.00 53.14  ? 404 SER B CA    1 
ATOM   5864 C  C     . SER B 1 378 ? 11.427  18.825  7.718  1.00 51.60  ? 404 SER B C     1 
ATOM   5865 O  O     . SER B 1 378 ? 12.503  19.370  7.976  1.00 45.03  ? 404 SER B O     1 
ATOM   5866 C  CB    . SER B 1 378 ? 10.277  17.935  9.769  1.00 48.63  ? 404 SER B CB    1 
ATOM   5867 O  OG    . SER B 1 378 ? 11.208  18.373  10.745 1.00 50.47  ? 404 SER B OG    1 
ATOM   5868 N  N     . THR B 1 379 ? 10.586  19.278  6.797  1.00 50.42  ? 405 THR B N     1 
ATOM   5869 C  CA    . THR B 1 379 ? 10.874  20.441  5.977  1.00 48.15  ? 405 THR B CA    1 
ATOM   5870 C  C     . THR B 1 379 ? 9.735   21.415  6.204  1.00 58.48  ? 405 THR B C     1 
ATOM   5871 O  O     . THR B 1 379 ? 9.610   22.455  5.549  1.00 61.12  ? 405 THR B O     1 
ATOM   5872 C  CB    . THR B 1 379 ? 10.983  20.075  4.496  1.00 51.91  ? 405 THR B CB    1 
ATOM   5873 O  OG1   . THR B 1 379 ? 9.743   19.501  4.059  1.00 57.95  ? 405 THR B OG1   1 
ATOM   5874 C  CG2   . THR B 1 379 ? 12.094  19.060  4.282  1.00 45.81  ? 405 THR B CG2   1 
ATOM   5875 N  N     . HIS B 1 380 ? 8.914   21.049  7.177  1.00 65.36  ? 406 HIS B N     1 
ATOM   5876 C  CA    . HIS B 1 380 ? 7.710   21.770  7.525  1.00 69.02  ? 406 HIS B CA    1 
ATOM   5877 C  C     . HIS B 1 380 ? 7.655   21.869  9.051  1.00 67.11  ? 406 HIS B C     1 
ATOM   5878 O  O     . HIS B 1 380 ? 7.492   20.858  9.731  1.00 65.36  ? 406 HIS B O     1 
ATOM   5879 C  CB    . HIS B 1 380 ? 6.506   21.010  6.937  1.00 73.65  ? 406 HIS B CB    1 
ATOM   5880 C  CG    . HIS B 1 380 ? 5.167   21.541  7.336  1.00 85.52  ? 406 HIS B CG    1 
ATOM   5881 N  ND1   . HIS B 1 380 ? 4.091   20.717  7.588  1.00 88.73  ? 406 HIS B ND1   1 
ATOM   5882 C  CD2   . HIS B 1 380 ? 4.716   22.808  7.488  1.00 88.41  ? 406 HIS B CD2   1 
ATOM   5883 C  CE1   . HIS B 1 380 ? 3.039   21.453  7.899  1.00 97.19  ? 406 HIS B CE1   1 
ATOM   5884 N  NE2   . HIS B 1 380 ? 3.391   22.725  7.846  1.00 94.14  ? 406 HIS B NE2   1 
ATOM   5885 N  N     . LEU B 1 381 ? 7.783   23.077  9.592  1.00 71.11  ? 407 LEU B N     1 
ATOM   5886 C  CA    . LEU B 1 381 ? 7.746   23.232  11.043 1.00 68.23  ? 407 LEU B CA    1 
ATOM   5887 C  C     . LEU B 1 381 ? 6.293   23.105  11.429 1.00 72.79  ? 407 LEU B C     1 
ATOM   5888 O  O     . LEU B 1 381 ? 5.447   23.890  10.991 1.00 71.91  ? 407 LEU B O     1 
ATOM   5889 C  CB    . LEU B 1 381 ? 8.345   24.563  11.519 1.00 54.39  ? 407 LEU B CB    1 
ATOM   5890 C  CG    . LEU B 1 381 ? 9.866   24.774  11.543 1.00 50.27  ? 407 LEU B CG    1 
ATOM   5891 C  CD1   . LEU B 1 381 ? 10.589  24.126  10.391 1.00 54.21  ? 407 LEU B CD1   1 
ATOM   5892 C  CD2   . LEU B 1 381 ? 10.157  26.264  11.578 1.00 52.26  ? 407 LEU B CD2   1 
ATOM   5893 N  N     . THR B 1 382 ? 6.011   22.102  12.251 1.00 80.74  ? 408 THR B N     1 
ATOM   5894 C  CA    . THR B 1 382 ? 4.642   21.749  12.568 1.00 81.78  ? 408 THR B CA    1 
ATOM   5895 C  C     . THR B 1 382 ? 4.201   22.615  13.726 1.00 86.12  ? 408 THR B C     1 
ATOM   5896 O  O     . THR B 1 382 ? 4.976   22.850  14.655 1.00 80.64  ? 408 THR B O     1 
ATOM   5897 C  CB    . THR B 1 382 ? 4.493   20.259  12.918 1.00 78.50  ? 408 THR B CB    1 
ATOM   5898 O  OG1   . THR B 1 382 ? 5.339   19.478  12.065 1.00 76.82  ? 408 THR B OG1   1 
ATOM   5899 C  CG2   . THR B 1 382 ? 3.047   19.813  12.744 1.00 75.95  ? 408 THR B CG2   1 
ATOM   5900 N  N     . ARG B 1 383 ? 2.975   23.125  13.633 1.00 90.73  ? 409 ARG B N     1 
ATOM   5901 C  CA    . ARG B 1 383 ? 2.431   24.040  14.632 1.00 99.57  ? 409 ARG B CA    1 
ATOM   5902 C  C     . ARG B 1 383 ? 2.674   23.519  16.046 1.00 98.72  ? 409 ARG B C     1 
ATOM   5903 O  O     . ARG B 1 383 ? 2.331   22.377  16.368 1.00 95.75  ? 409 ARG B O     1 
ATOM   5904 C  CB    . ARG B 1 383 ? 0.931   24.259  14.399 1.00 101.74 ? 409 ARG B CB    1 
ATOM   5905 N  N     . ASP B 1 384 ? 3.278   24.376  16.869 1.00 101.93 ? 410 ASP B N     1 
ATOM   5906 C  CA    . ASP B 1 384 ? 3.674   24.038  18.234 1.00 104.28 ? 410 ASP B CA    1 
ATOM   5907 C  C     . ASP B 1 384 ? 2.552   23.357  19.012 1.00 102.29 ? 410 ASP B C     1 
ATOM   5908 O  O     . ASP B 1 384 ? 1.577   24.007  19.401 1.00 102.41 ? 410 ASP B O     1 
ATOM   5909 C  CB    . ASP B 1 384 ? 4.141   25.299  18.972 1.00 95.13  ? 410 ASP B CB    1 
ATOM   5910 N  N     . GLY B 1 385 ? 2.691   22.048  19.227 1.00 92.95  ? 411 GLY B N     1 
ATOM   5911 C  CA    . GLY B 1 385 ? 1.625   21.279  19.843 1.00 92.99  ? 411 GLY B CA    1 
ATOM   5912 C  C     . GLY B 1 385 ? 1.415   21.620  21.307 1.00 98.18  ? 411 GLY B C     1 
ATOM   5913 O  O     . GLY B 1 385 ? 2.213   22.336  21.912 1.00 98.37  ? 411 GLY B O     1 
ATOM   5914 N  N     . GLU B 1 386 ? 0.334   21.084  21.871 1.00 90.31  ? 412 GLU B N     1 
ATOM   5915 C  CA    . GLU B 1 386 ? -0.016  21.254  23.279 1.00 82.28  ? 412 GLU B CA    1 
ATOM   5916 C  C     . GLU B 1 386 ? 0.701   20.231  24.151 1.00 85.46  ? 412 GLU B C     1 
ATOM   5917 O  O     . GLU B 1 386 ? 1.021   19.132  23.691 1.00 77.37  ? 412 GLU B O     1 
ATOM   5918 C  CB    . GLU B 1 386 ? -1.533  21.156  23.472 1.00 76.46  ? 412 GLU B CB    1 
ATOM   5919 N  N     . ARG B 1 387 ? 0.938   20.586  25.412 1.00 76.63  ? 413 ARG B N     1 
ATOM   5920 C  CA    . ARG B 1 387 ? 1.710   19.722  26.304 1.00 62.20  ? 413 ARG B CA    1 
ATOM   5921 C  C     . ARG B 1 387 ? 0.910   18.491  26.720 1.00 62.30  ? 413 ARG B C     1 
ATOM   5922 O  O     . ARG B 1 387 ? -0.319  18.468  26.619 1.00 59.77  ? 413 ARG B O     1 
ATOM   5923 C  CB    . ARG B 1 387 ? 2.178   20.500  27.536 1.00 62.89  ? 413 ARG B CB    1 
ATOM   5924 C  CG    . ARG B 1 387 ? 1.312   20.316  28.765 1.00 57.12  ? 413 ARG B CG    1 
ATOM   5925 C  CD    . ARG B 1 387 ? 1.582   21.416  29.764 1.00 51.58  ? 413 ARG B CD    1 
ATOM   5926 N  NE    . ARG B 1 387 ? 2.999   21.540  30.095 1.00 47.31  ? 413 ARG B NE    1 
ATOM   5927 C  CZ    . ARG B 1 387 ? 3.622   22.702  30.286 1.00 59.69  ? 413 ARG B CZ    1 
ATOM   5928 N  NH1   . ARG B 1 387 ? 2.954   23.849  30.195 1.00 57.64  ? 413 ARG B NH1   1 
ATOM   5929 N  NH2   . ARG B 1 387 ? 4.917   22.725  30.581 1.00 58.63  ? 413 ARG B NH2   1 
ATOM   5930 N  N     . LYS B 1 388 ? 1.625   17.474  27.197 1.00 55.99  ? 414 LYS B N     1 
ATOM   5931 C  CA    . LYS B 1 388 ? 1.039   16.166  27.486 1.00 53.64  ? 414 LYS B CA    1 
ATOM   5932 C  C     . LYS B 1 388 ? 1.276   15.714  28.926 1.00 54.62  ? 414 LYS B C     1 
ATOM   5933 O  O     . LYS B 1 388 ? 0.651   14.762  29.394 1.00 49.38  ? 414 LYS B O     1 
ATOM   5934 C  CB    . LYS B 1 388 ? 1.602   15.134  26.515 1.00 54.32  ? 414 LYS B CB    1 
ATOM   5935 C  CG    . LYS B 1 388 ? 1.303   15.482  25.069 1.00 63.08  ? 414 LYS B CG    1 
ATOM   5936 C  CD    . LYS B 1 388 ? 2.267   14.819  24.105 1.00 62.59  ? 414 LYS B CD    1 
ATOM   5937 C  CE    . LYS B 1 388 ? 2.260   15.544  22.768 1.00 64.01  ? 414 LYS B CE    1 
ATOM   5938 N  NZ    . LYS B 1 388 ? 3.285   15.016  21.834 1.00 67.70  ? 414 LYS B NZ    1 
ATOM   5939 N  N     . SER B 1 389 ? 2.181   16.396  29.620 1.00 54.42  ? 415 SER B N     1 
ATOM   5940 C  CA    . SER B 1 389 ? 2.464   16.098  31.018 1.00 42.13  ? 415 SER B CA    1 
ATOM   5941 C  C     . SER B 1 389 ? 2.949   17.350  31.732 1.00 39.97  ? 415 SER B C     1 
ATOM   5942 O  O     . SER B 1 389 ? 3.378   18.306  31.093 1.00 45.40  ? 415 SER B O     1 
ATOM   5943 C  CB    . SER B 1 389 ? 3.510   14.989  31.134 1.00 39.50  ? 415 SER B CB    1 
ATOM   5944 O  OG    . SER B 1 389 ? 4.823   15.526  31.152 1.00 35.68  ? 415 SER B OG    1 
ATOM   5945 N  N     . MET B 1 390 ? 2.897   17.335  33.059 1.00 39.60  ? 416 MET B N     1 
ATOM   5946 C  CA    . MET B 1 390 ? 3.460   18.425  33.845 1.00 35.60  ? 416 MET B CA    1 
ATOM   5947 C  C     . MET B 1 390 ? 3.968   17.885  35.172 1.00 36.17  ? 416 MET B C     1 
ATOM   5948 O  O     . MET B 1 390 ? 3.351   17.003  35.760 1.00 34.35  ? 416 MET B O     1 
ATOM   5949 C  CB    . MET B 1 390 ? 2.428   19.524  34.075 1.00 38.34  ? 416 MET B CB    1 
ATOM   5950 C  CG    . MET B 1 390 ? 3.022   20.800  34.632 1.00 48.77  ? 416 MET B CG    1 
ATOM   5951 S  SD    . MET B 1 390 ? 1.828   22.133  34.788 1.00 60.20  ? 416 MET B SD    1 
ATOM   5952 C  CE    . MET B 1 390 ? 1.329   22.362  33.092 1.00 50.67  ? 416 MET B CE    1 
ATOM   5953 N  N     . SER B 1 391 ? 5.085   18.417  35.655 1.00 33.40  ? 417 SER B N     1 
ATOM   5954 C  CA    . SER B 1 391 ? 5.763   17.786  36.774 1.00 24.85  ? 417 SER B CA    1 
ATOM   5955 C  C     . SER B 1 391 ? 6.692   18.710  37.532 1.00 25.28  ? 417 SER B C     1 
ATOM   5956 O  O     . SER B 1 391 ? 7.352   19.563  36.949 1.00 30.30  ? 417 SER B O     1 
ATOM   5957 C  CB    . SER B 1 391 ? 6.569   16.592  36.278 1.00 29.45  ? 417 SER B CB    1 
ATOM   5958 O  OG    . SER B 1 391 ? 7.666   17.026  35.497 1.00 27.24  ? 417 SER B OG    1 
ATOM   5959 N  N     . VAL B 1 392 ? 6.751   18.514  38.844 1.00 28.00  ? 418 VAL B N     1 
ATOM   5960 C  CA    . VAL B 1 392 ? 7.713   19.214  39.678 1.00 24.58  ? 418 VAL B CA    1 
ATOM   5961 C  C     . VAL B 1 392 ? 8.566   18.185  40.393 1.00 22.99  ? 418 VAL B C     1 
ATOM   5962 O  O     . VAL B 1 392 ? 8.044   17.188  40.883 1.00 24.55  ? 418 VAL B O     1 
ATOM   5963 C  CB    . VAL B 1 392 ? 7.031   20.124  40.716 1.00 25.05  ? 418 VAL B CB    1 
ATOM   5964 C  CG1   . VAL B 1 392 ? 8.072   20.906  41.488 1.00 28.75  ? 418 VAL B CG1   1 
ATOM   5965 C  CG2   . VAL B 1 392 ? 6.048   21.066  40.042 1.00 35.31  ? 418 VAL B CG2   1 
ATOM   5966 N  N     . GLU B 1 393 ? 9.874   18.404  40.441 1.00 21.72  ? 419 GLU B N     1 
ATOM   5967 C  CA    . GLU B 1 393 ? 10.724  17.528  41.232 1.00 22.98  ? 419 GLU B CA    1 
ATOM   5968 C  C     . GLU B 1 393 ? 11.885  18.295  41.837 1.00 24.23  ? 419 GLU B C     1 
ATOM   5969 O  O     . GLU B 1 393 ? 12.370  19.264  41.268 1.00 24.73  ? 419 GLU B O     1 
ATOM   5970 C  CB    . GLU B 1 393 ? 11.229  16.346  40.394 1.00 24.72  ? 419 GLU B CB    1 
ATOM   5971 C  CG    . GLU B 1 393 ? 12.359  16.639  39.426 1.00 22.93  ? 419 GLU B CG    1 
ATOM   5972 C  CD    . GLU B 1 393 ? 12.574  15.490  38.466 1.00 27.65  ? 419 GLU B CD    1 
ATOM   5973 O  OE1   . GLU B 1 393 ? 13.721  15.003  38.350 1.00 27.80  ? 419 GLU B OE1   1 
ATOM   5974 O  OE2   . GLU B 1 393 ? 11.582  15.061  37.839 1.00 27.63  ? 419 GLU B OE2   1 
ATOM   5975 N  N     . ARG B 1 394 ? 12.317  17.848  43.008 1.00 28.95  ? 420 ARG B N     1 
ATOM   5976 C  CA    . ARG B 1 394 ? 13.302  18.577  43.781 1.00 27.92  ? 420 ARG B CA    1 
ATOM   5977 C  C     . ARG B 1 394 ? 14.322  17.628  44.399 1.00 25.46  ? 420 ARG B C     1 
ATOM   5978 O  O     . ARG B 1 394 ? 13.962  16.563  44.921 1.00 27.17  ? 420 ARG B O     1 
ATOM   5979 C  CB    . ARG B 1 394 ? 12.597  19.402  44.861 1.00 27.92  ? 420 ARG B CB    1 
ATOM   5980 C  CG    . ARG B 1 394 ? 13.457  20.455  45.528 1.00 32.40  ? 420 ARG B CG    1 
ATOM   5981 C  CD    . ARG B 1 394 ? 12.601  21.668  45.838 1.00 42.04  ? 420 ARG B CD    1 
ATOM   5982 N  NE    . ARG B 1 394 ? 11.983  22.179  44.617 1.00 45.91  ? 420 ARG B NE    1 
ATOM   5983 C  CZ    . ARG B 1 394 ? 10.852  22.876  44.573 1.00 44.86  ? 420 ARG B CZ    1 
ATOM   5984 N  NH1   . ARG B 1 394 ? 10.196  23.159  45.691 1.00 41.87  ? 420 ARG B NH1   1 
ATOM   5985 N  NH2   . ARG B 1 394 ? 10.376  23.287  43.402 1.00 48.60  ? 420 ARG B NH2   1 
ATOM   5986 N  N     . THR B 1 395 ? 15.593  18.011  44.289 1.00 22.78  ? 421 THR B N     1 
ATOM   5987 C  CA    . THR B 1 395 ? 16.695  17.334  44.961 1.00 25.22  ? 421 THR B CA    1 
ATOM   5988 C  C     . THR B 1 395 ? 16.994  18.016  46.289 1.00 26.90  ? 421 THR B C     1 
ATOM   5989 O  O     . THR B 1 395 ? 16.993  19.245  46.382 1.00 30.05  ? 421 THR B O     1 
ATOM   5990 C  CB    . THR B 1 395 ? 17.964  17.313  44.084 1.00 26.48  ? 421 THR B CB    1 
ATOM   5991 O  OG1   . THR B 1 395 ? 17.741  16.468  42.952 1.00 29.58  ? 421 THR B OG1   1 
ATOM   5992 C  CG2   . THR B 1 395 ? 19.174  16.794  44.851 1.00 26.53  ? 421 THR B CG2   1 
ATOM   5993 N  N     . PHE B 1 396 ? 17.247  17.205  47.312 1.00 28.38  ? 422 PHE B N     1 
ATOM   5994 C  CA    . PHE B 1 396 ? 17.550  17.694  48.650 1.00 27.08  ? 422 PHE B CA    1 
ATOM   5995 C  C     . PHE B 1 396 ? 18.526  16.776  49.374 1.00 27.15  ? 422 PHE B C     1 
ATOM   5996 O  O     . PHE B 1 396 ? 18.790  15.664  48.928 1.00 27.82  ? 422 PHE B O     1 
ATOM   5997 C  CB    . PHE B 1 396 ? 16.262  17.815  49.454 1.00 26.87  ? 422 PHE B CB    1 
ATOM   5998 C  CG    . PHE B 1 396 ? 15.252  16.765  49.113 1.00 28.25  ? 422 PHE B CG    1 
ATOM   5999 C  CD1   . PHE B 1 396 ? 15.433  15.454  49.511 1.00 24.78  ? 422 PHE B CD1   1 
ATOM   6000 C  CD2   . PHE B 1 396 ? 14.129  17.085  48.371 1.00 30.40  ? 422 PHE B CD2   1 
ATOM   6001 C  CE1   . PHE B 1 396 ? 14.506  14.488  49.187 1.00 23.77  ? 422 PHE B CE1   1 
ATOM   6002 C  CE2   . PHE B 1 396 ? 13.202  16.119  48.045 1.00 25.43  ? 422 PHE B CE2   1 
ATOM   6003 C  CZ    . PHE B 1 396 ? 13.389  14.825  48.457 1.00 24.33  ? 422 PHE B CZ    1 
ATOM   6004 N  N     . SER B 1 397 ? 19.063  17.246  50.492 1.00 26.78  ? 423 SER B N     1 
ATOM   6005 C  CA    . SER B 1 397 ? 19.860  16.392  51.351 1.00 27.11  ? 423 SER B CA    1 
ATOM   6006 C  C     . SER B 1 397 ? 18.929  15.344  51.952 1.00 30.23  ? 423 SER B C     1 
ATOM   6007 O  O     . SER B 1 397 ? 17.718  15.555  51.994 1.00 29.09  ? 423 SER B O     1 
ATOM   6008 C  CB    . SER B 1 397 ? 20.560  17.209  52.435 1.00 31.17  ? 423 SER B CB    1 
ATOM   6009 O  OG    . SER B 1 397 ? 19.660  18.083  53.099 1.00 32.33  ? 423 SER B OG    1 
ATOM   6010 N  N     . GLU B 1 398 ? 19.500  14.225  52.398 1.00 27.53  ? 424 GLU B N     1 
ATOM   6011 C  CA    . GLU B 1 398 ? 18.745  13.014  52.731 1.00 23.62  ? 424 GLU B CA    1 
ATOM   6012 C  C     . GLU B 1 398 ? 17.459  13.247  53.518 1.00 27.31  ? 424 GLU B C     1 
ATOM   6013 O  O     . GLU B 1 398 ? 17.414  14.100  54.400 1.00 36.43  ? 424 GLU B O     1 
ATOM   6014 C  CB    . GLU B 1 398 ? 19.638  12.052  53.516 1.00 30.05  ? 424 GLU B CB    1 
ATOM   6015 C  CG    . GLU B 1 398 ? 19.053  10.657  53.666 1.00 32.02  ? 424 GLU B CG    1 
ATOM   6016 C  CD    . GLU B 1 398 ? 20.078  9.615   54.079 1.00 36.95  ? 424 GLU B CD    1 
ATOM   6017 O  OE1   . GLU B 1 398 ? 21.287  9.833   53.853 1.00 46.96  ? 424 GLU B OE1   1 
ATOM   6018 O  OE2   . GLU B 1 398 ? 19.666  8.569   54.621 1.00 35.36  ? 424 GLU B OE2   1 
ATOM   6019 N  N     . ILE B 1 399 ? 16.412  12.497  53.190 1.00 25.32  ? 425 ILE B N     1 
ATOM   6020 C  CA    . ILE B 1 399 ? 15.183  12.511  53.982 1.00 32.93  ? 425 ILE B CA    1 
ATOM   6021 C  C     . ILE B 1 399 ? 14.727  11.093  54.366 1.00 32.00  ? 425 ILE B C     1 
ATOM   6022 O  O     . ILE B 1 399 ? 14.390  10.285  53.500 1.00 31.38  ? 425 ILE B O     1 
ATOM   6023 C  CB    . ILE B 1 399 ? 14.055  13.249  53.239 1.00 25.30  ? 425 ILE B CB    1 
ATOM   6024 C  CG1   . ILE B 1 399 ? 14.437  14.712  53.056 1.00 24.64  ? 425 ILE B CG1   1 
ATOM   6025 C  CG2   . ILE B 1 399 ? 12.769  13.216  54.034 1.00 30.09  ? 425 ILE B CG2   1 
ATOM   6026 C  CD1   . ILE B 1 399 ? 13.383  15.519  52.380 1.00 26.83  ? 425 ILE B CD1   1 
ATOM   6027 N  N     . ASN B 1 400 ? 14.733  10.818  55.674 1.00 37.62  ? 426 ASN B N     1 
ATOM   6028 C  CA    . ASN B 1 400 ? 14.417  9.505   56.246 1.00 31.20  ? 426 ASN B CA    1 
ATOM   6029 C  C     . ASN B 1 400 ? 13.018  9.386   56.822 1.00 28.68  ? 426 ASN B C     1 
ATOM   6030 O  O     . ASN B 1 400 ? 12.372  8.351   56.716 1.00 34.76  ? 426 ASN B O     1 
ATOM   6031 C  CB    . ASN B 1 400 ? 15.409  9.183   57.359 1.00 30.88  ? 426 ASN B CB    1 
ATOM   6032 C  CG    . ASN B 1 400 ? 16.838  9.346   56.919 1.00 37.78  ? 426 ASN B CG    1 
ATOM   6033 O  OD1   . ASN B 1 400 ? 17.106  9.526   55.736 1.00 45.04  ? 426 ASN B OD1   1 
ATOM   6034 N  ND2   . ASN B 1 400 ? 17.765  9.332   57.872 1.00 37.11  ? 426 ASN B ND2   1 
ATOM   6035 N  N     . LYS B 1 401 ? 12.565  10.454  57.458 1.00 35.23  ? 427 LYS B N     1 
ATOM   6036 C  CA    . LYS B 1 401 ? 11.338  10.417  58.232 1.00 37.84  ? 427 LYS B CA    1 
ATOM   6037 C  C     . LYS B 1 401 ? 10.106  10.437  57.341 1.00 31.22  ? 427 LYS B C     1 
ATOM   6038 O  O     . LYS B 1 401 ? 9.934   11.343  56.537 1.00 35.33  ? 427 LYS B O     1 
ATOM   6039 C  CB    . LYS B 1 401 ? 11.333  11.583  59.219 1.00 37.25  ? 427 LYS B CB    1 
ATOM   6040 C  CG    . LYS B 1 401 ? 12.493  11.505  60.218 1.00 39.45  ? 427 LYS B CG    1 
ATOM   6041 C  CD    . LYS B 1 401 ? 12.490  12.660  61.218 1.00 43.99  ? 427 LYS B CD    1 
ATOM   6042 C  CE    . LYS B 1 401 ? 13.540  12.447  62.313 1.00 42.67  ? 427 LYS B CE    1 
ATOM   6043 N  NZ    . LYS B 1 401 ? 14.931  12.284  61.788 1.00 33.54  ? 427 LYS B NZ    1 
ATOM   6044 N  N     . ALA B 1 402 ? 9.271   9.412   57.480 1.00 31.74  ? 428 ALA B N     1 
ATOM   6045 C  CA    . ALA B 1 402 ? 8.063   9.261   56.673 1.00 33.48  ? 428 ALA B CA    1 
ATOM   6046 C  C     . ALA B 1 402 ? 7.187   10.511  56.633 1.00 36.39  ? 428 ALA B C     1 
ATOM   6047 O  O     . ALA B 1 402 ? 6.747   10.925  55.560 1.00 35.83  ? 428 ALA B O     1 
ATOM   6048 C  CB    . ALA B 1 402 ? 7.249   8.081   57.180 1.00 33.76  ? 428 ALA B CB    1 
ATOM   6049 N  N     . GLU B 1 403 ? 6.943   11.117  57.790 1.00 35.32  ? 429 GLU B N     1 
ATOM   6050 C  CA    . GLU B 1 403 ? 6.073   12.291  57.856 1.00 39.14  ? 429 GLU B CA    1 
ATOM   6051 C  C     . GLU B 1 403 ? 6.614   13.464  57.029 1.00 33.60  ? 429 GLU B C     1 
ATOM   6052 O  O     . GLU B 1 403 ? 5.851   14.212  56.394 1.00 29.76  ? 429 GLU B O     1 
ATOM   6053 C  CB    . GLU B 1 403 ? 5.878   12.722  59.311 1.00 45.17  ? 429 GLU B CB    1 
ATOM   6054 C  CG    . GLU B 1 403 ? 4.796   13.767  59.491 1.00 49.40  ? 429 GLU B CG    1 
ATOM   6055 C  CD    . GLU B 1 403 ? 4.640   14.201  60.926 1.00 44.79  ? 429 GLU B CD    1 
ATOM   6056 O  OE1   . GLU B 1 403 ? 4.834   13.364  61.832 1.00 52.44  ? 429 GLU B OE1   1 
ATOM   6057 O  OE2   . GLU B 1 403 ? 4.335   15.388  61.144 1.00 50.19  ? 429 GLU B OE2   1 
ATOM   6058 N  N     . GLU B 1 404 ? 7.936   13.602  57.028 1.00 30.76  ? 430 GLU B N     1 
ATOM   6059 C  CA    . GLU B 1 404 ? 8.602   14.625  56.237 1.00 31.51  ? 430 GLU B CA    1 
ATOM   6060 C  C     . GLU B 1 404 ? 8.426   14.342  54.748 1.00 32.90  ? 430 GLU B C     1 
ATOM   6061 O  O     . GLU B 1 404 ? 8.172   15.251  53.967 1.00 30.86  ? 430 GLU B O     1 
ATOM   6062 C  CB    . GLU B 1 404 ? 10.090  14.700  56.590 1.00 33.08  ? 430 GLU B CB    1 
ATOM   6063 C  CG    . GLU B 1 404 ? 10.406  15.426  57.900 1.00 42.92  ? 430 GLU B CG    1 
ATOM   6064 C  CD    . GLU B 1 404 ? 11.872  15.302  58.309 1.00 46.27  ? 430 GLU B CD    1 
ATOM   6065 O  OE1   . GLU B 1 404 ? 12.664  14.719  57.530 1.00 42.08  ? 430 GLU B OE1   1 
ATOM   6066 O  OE2   . GLU B 1 404 ? 12.230  15.793  59.407 1.00 39.29  ? 430 GLU B OE2   1 
ATOM   6067 N  N     . GLN B 1 405 ? 8.548   13.077  54.362 1.00 30.79  ? 431 GLN B N     1 
ATOM   6068 C  CA    . GLN B 1 405 ? 8.330   12.676  52.980 1.00 24.79  ? 431 GLN B CA    1 
ATOM   6069 C  C     . GLN B 1 405 ? 6.894   12.964  52.533 1.00 27.10  ? 431 GLN B C     1 
ATOM   6070 O  O     . GLN B 1 405 ? 6.673   13.491  51.438 1.00 33.51  ? 431 GLN B O     1 
ATOM   6071 C  CB    . GLN B 1 405 ? 8.685   11.199  52.809 1.00 27.41  ? 431 GLN B CB    1 
ATOM   6072 C  CG    . GLN B 1 405 ? 10.185  10.917  52.953 1.00 28.08  ? 431 GLN B CG    1 
ATOM   6073 C  CD    . GLN B 1 405 ? 10.498  9.460   53.273 1.00 33.89  ? 431 GLN B CD    1 
ATOM   6074 O  OE1   . GLN B 1 405 ? 9.603   8.675   53.580 1.00 37.54  ? 431 GLN B OE1   1 
ATOM   6075 N  NE2   . GLN B 1 405 ? 11.776  9.096   53.205 1.00 29.31  ? 431 GLN B NE2   1 
ATOM   6076 N  N     . TYR B 1 406 ? 5.920   12.651  53.379 1.00 29.80  ? 432 TYR B N     1 
ATOM   6077 C  CA    . TYR B 1 406 ? 4.537   12.998  53.066 1.00 33.22  ? 432 TYR B CA    1 
ATOM   6078 C  C     . TYR B 1 406 ? 4.363   14.501  52.899 1.00 32.13  ? 432 TYR B C     1 
ATOM   6079 O  O     . TYR B 1 406 ? 3.698   14.950  51.966 1.00 35.02  ? 432 TYR B O     1 
ATOM   6080 C  CB    . TYR B 1 406 ? 3.579   12.500  54.148 1.00 39.65  ? 432 TYR B CB    1 
ATOM   6081 C  CG    . TYR B 1 406 ? 3.325   11.012  54.141 1.00 39.03  ? 432 TYR B CG    1 
ATOM   6082 C  CD1   . TYR B 1 406 ? 2.479   10.438  53.200 1.00 49.96  ? 432 TYR B CD1   1 
ATOM   6083 C  CD2   . TYR B 1 406 ? 3.913   10.181  55.082 1.00 37.01  ? 432 TYR B CD2   1 
ATOM   6084 C  CE1   . TYR B 1 406 ? 2.235   9.075   53.189 1.00 50.47  ? 432 TYR B CE1   1 
ATOM   6085 C  CE2   . TYR B 1 406 ? 3.677   8.814   55.076 1.00 49.55  ? 432 TYR B CE2   1 
ATOM   6086 C  CZ    . TYR B 1 406 ? 2.837   8.267   54.125 1.00 50.42  ? 432 TYR B CZ    1 
ATOM   6087 O  OH    . TYR B 1 406 ? 2.594   6.911   54.111 1.00 52.15  ? 432 TYR B OH    1 
ATOM   6088 N  N     . SER B 1 407 ? 4.965   15.275  53.800 1.00 33.64  ? 433 SER B N     1 
ATOM   6089 C  CA    . SER B 1 407 ? 4.843   16.734  53.730 1.00 38.43  ? 433 SER B CA    1 
ATOM   6090 C  C     . SER B 1 407 ? 5.423   17.279  52.436 1.00 32.35  ? 433 SER B C     1 
ATOM   6091 O  O     . SER B 1 407 ? 4.818   18.126  51.772 1.00 38.14  ? 433 SER B O     1 
ATOM   6092 C  CB    . SER B 1 407 ? 5.541   17.397  54.919 1.00 34.35  ? 433 SER B CB    1 
ATOM   6093 O  OG    . SER B 1 407 ? 4.910   17.047  56.132 1.00 39.61  ? 433 SER B OG    1 
ATOM   6094 N  N     . LEU B 1 408 ? 6.606   16.794  52.090 1.00 29.69  ? 434 LEU B N     1 
ATOM   6095 C  CA    . LEU B 1 408 ? 7.234   17.150  50.834 1.00 32.48  ? 434 LEU B CA    1 
ATOM   6096 C  C     . LEU B 1 408 ? 6.320   16.856  49.665 1.00 32.12  ? 434 LEU B C     1 
ATOM   6097 O  O     . LEU B 1 408 ? 6.146   17.689  48.767 1.00 30.87  ? 434 LEU B O     1 
ATOM   6098 C  CB    . LEU B 1 408 ? 8.549   16.419  50.669 1.00 28.42  ? 434 LEU B CB    1 
ATOM   6099 C  CG    . LEU B 1 408 ? 9.587   17.496  50.398 1.00 38.69  ? 434 LEU B CG    1 
ATOM   6100 C  CD1   . LEU B 1 408 ? 10.663  17.470  51.475 1.00 31.54  ? 434 LEU B CD1   1 
ATOM   6101 C  CD2   . LEU B 1 408 ? 10.153  17.367  48.988 1.00 26.20  ? 434 LEU B CD2   1 
ATOM   6102 N  N     . CYS B 1 409 ? 5.736   15.662  49.692 1.00 32.45  ? 435 CYS B N     1 
ATOM   6103 C  CA    . CYS B 1 409 ? 4.764   15.268  48.685 1.00 32.57  ? 435 CYS B CA    1 
ATOM   6104 C  C     . CYS B 1 409 ? 3.642   16.292  48.576 1.00 34.88  ? 435 CYS B C     1 
ATOM   6105 O  O     . CYS B 1 409 ? 3.243   16.684  47.478 1.00 37.80  ? 435 CYS B O     1 
ATOM   6106 C  CB    . CYS B 1 409 ? 4.181   13.906  49.028 1.00 38.16  ? 435 CYS B CB    1 
ATOM   6107 S  SG    . CYS B 1 409 ? 3.291   13.132  47.688 1.00 36.24  ? 435 CYS B SG    1 
ATOM   6108 N  N     . GLN B 1 410 ? 3.134   16.715  49.728 1.00 35.11  ? 436 GLN B N     1 
ATOM   6109 C  CA    . GLN B 1 410 ? 2.042   17.671  49.780 1.00 34.52  ? 436 GLN B CA    1 
ATOM   6110 C  C     . GLN B 1 410 ? 2.457   18.996  49.143 1.00 37.23  ? 436 GLN B C     1 
ATOM   6111 O  O     . GLN B 1 410 ? 1.700   19.574  48.353 1.00 41.18  ? 436 GLN B O     1 
ATOM   6112 C  CB    . GLN B 1 410 ? 1.596   17.868  51.230 1.00 46.61  ? 436 GLN B CB    1 
ATOM   6113 C  CG    . GLN B 1 410 ? 0.342   18.700  51.419 1.00 50.97  ? 436 GLN B CG    1 
ATOM   6114 C  CD    . GLN B 1 410 ? -0.276  18.496  52.797 1.00 61.79  ? 436 GLN B CD    1 
ATOM   6115 O  OE1   . GLN B 1 410 ? 0.224   17.711  53.608 1.00 62.38  ? 436 GLN B OE1   1 
ATOM   6116 N  NE2   . GLN B 1 410 ? -1.366  19.205  53.068 1.00 73.35  ? 436 GLN B NE2   1 
ATOM   6117 N  N     . GLU B 1 411 ? 3.665   19.465  49.454 1.00 35.73  ? 437 GLU B N     1 
ATOM   6118 C  CA    . GLU B 1 411 ? 4.155   20.700  48.832 1.00 42.39  ? 437 GLU B CA    1 
ATOM   6119 C  C     . GLU B 1 411 ? 4.276   20.590  47.319 1.00 36.34  ? 437 GLU B C     1 
ATOM   6120 O  O     . GLU B 1 411 ? 3.793   21.471  46.596 1.00 41.93  ? 437 GLU B O     1 
ATOM   6121 C  CB    . GLU B 1 411 ? 5.487   21.153  49.453 1.00 49.70  ? 437 GLU B CB    1 
ATOM   6122 C  CG    . GLU B 1 411 ? 5.320   21.785  50.849 1.00 54.61  ? 437 GLU B CG    1 
ATOM   6123 C  CD    . GLU B 1 411 ? 6.211   21.202  51.939 1.00 52.00  ? 437 GLU B CD    1 
ATOM   6124 O  OE1   . GLU B 1 411 ? 7.451   21.148  51.765 1.00 44.72  ? 437 GLU B OE1   1 
ATOM   6125 O  OE2   . GLU B 1 411 ? 5.650   20.811  52.989 1.00 47.11  ? 437 GLU B OE2   1 
ATOM   6126 N  N     . LEU B 1 412 ? 4.920   19.530  46.838 1.00 34.16  ? 438 LEU B N     1 
ATOM   6127 C  CA    . LEU B 1 412 ? 5.056   19.336  45.394 1.00 32.23  ? 438 LEU B CA    1 
ATOM   6128 C  C     . LEU B 1 412 ? 3.694   19.301  44.708 1.00 34.63  ? 438 LEU B C     1 
ATOM   6129 O  O     . LEU B 1 412 ? 3.484   19.967  43.688 1.00 36.36  ? 438 LEU B O     1 
ATOM   6130 C  CB    . LEU B 1 412 ? 5.827   18.054  45.092 1.00 25.22  ? 438 LEU B CB    1 
ATOM   6131 C  CG    . LEU B 1 412 ? 7.302   18.112  45.478 1.00 23.95  ? 438 LEU B CG    1 
ATOM   6132 C  CD1   . LEU B 1 412 ? 7.959   16.763  45.302 1.00 20.95  ? 438 LEU B CD1   1 
ATOM   6133 C  CD2   . LEU B 1 412 ? 8.017   19.171  44.661 1.00 28.21  ? 438 LEU B CD2   1 
ATOM   6134 N  N     . CYS B 1 413 ? 2.766   18.539  45.278 1.00 30.59  ? 439 CYS B N     1 
ATOM   6135 C  CA    . CYS B 1 413 ? 1.404   18.517  44.767 1.00 32.16  ? 439 CYS B CA    1 
ATOM   6136 C  C     . CYS B 1 413 ? 0.817   19.920  44.704 1.00 40.15  ? 439 CYS B C     1 
ATOM   6137 O  O     . CYS B 1 413 ? 0.135   20.262  43.737 1.00 36.34  ? 439 CYS B O     1 
ATOM   6138 C  CB    . CYS B 1 413 ? 0.520   17.620  45.623 1.00 32.38  ? 439 CYS B CB    1 
ATOM   6139 S  SG    . CYS B 1 413 ? 0.957   15.879  45.540 1.00 43.67  ? 439 CYS B SG    1 
ATOM   6140 N  N     . SER B 1 414 ? 1.082   20.725  45.733 1.00 39.34  ? 440 SER B N     1 
ATOM   6141 C  CA    . SER B 1 414 ? 0.623   22.111  45.742 1.00 35.28  ? 440 SER B CA    1 
ATOM   6142 C  C     . SER B 1 414 ? 1.159   22.889  44.542 1.00 39.24  ? 440 SER B C     1 
ATOM   6143 O  O     . SER B 1 414 ? 0.375   23.454  43.764 1.00 41.82  ? 440 SER B O     1 
ATOM   6144 C  CB    . SER B 1 414 ? 1.036   22.811  47.038 1.00 43.21  ? 440 SER B CB    1 
ATOM   6145 O  OG    . SER B 1 414 ? 0.288   22.341  48.143 1.00 54.56  ? 440 SER B OG    1 
ATOM   6146 N  N     . GLU B 1 415 ? 2.486   22.920  44.390 1.00 37.37  ? 441 GLU B N     1 
ATOM   6147 C  CA    . GLU B 1 415 ? 3.090   23.649  43.266 1.00 35.87  ? 441 GLU B CA    1 
ATOM   6148 C  C     . GLU B 1 415 ? 2.506   23.193  41.933 1.00 41.21  ? 441 GLU B C     1 
ATOM   6149 O  O     . GLU B 1 415 ? 2.219   24.008  41.041 1.00 43.71  ? 441 GLU B O     1 
ATOM   6150 C  CB    . GLU B 1 415 ? 4.609   23.474  43.234 1.00 33.56  ? 441 GLU B CB    1 
ATOM   6151 C  CG    . GLU B 1 415 ? 5.293   23.464  44.588 1.00 42.21  ? 441 GLU B CG    1 
ATOM   6152 C  CD    . GLU B 1 415 ? 6.812   23.499  44.467 1.00 49.57  ? 441 GLU B CD    1 
ATOM   6153 O  OE1   . GLU B 1 415 ? 7.316   23.671  43.329 1.00 42.24  ? 441 GLU B OE1   1 
ATOM   6154 O  OE2   . GLU B 1 415 ? 7.497   23.345  45.506 1.00 47.93  ? 441 GLU B OE2   1 
ATOM   6155 N  N     . LEU B 1 416 ? 2.321   21.882  41.810 1.00 40.90  ? 442 LEU B N     1 
ATOM   6156 C  CA    . LEU B 1 416 ? 1.799   21.313  40.577 1.00 40.52  ? 442 LEU B CA    1 
ATOM   6157 C  C     . LEU B 1 416 ? 0.388   21.806  40.299 1.00 43.17  ? 442 LEU B C     1 
ATOM   6158 O  O     . LEU B 1 416 ? 0.077   22.229  39.184 1.00 48.49  ? 442 LEU B O     1 
ATOM   6159 C  CB    . LEU B 1 416 ? 1.812   19.790  40.637 1.00 42.10  ? 442 LEU B CB    1 
ATOM   6160 C  CG    . LEU B 1 416 ? 1.617   19.135  39.273 1.00 37.18  ? 442 LEU B CG    1 
ATOM   6161 C  CD1   . LEU B 1 416 ? 2.721   19.586  38.332 1.00 36.63  ? 442 LEU B CD1   1 
ATOM   6162 C  CD2   . LEU B 1 416 ? 1.581   17.623  39.405 1.00 35.82  ? 442 LEU B CD2   1 
ATOM   6163 N  N     . ALA B 1 417 ? -0.463  21.741  41.318 1.00 40.80  ? 443 ALA B N     1 
ATOM   6164 C  CA    . ALA B 1 417 ? -1.822  22.250  41.213 1.00 42.58  ? 443 ALA B CA    1 
ATOM   6165 C  C     . ALA B 1 417 ? -1.806  23.714  40.793 1.00 45.35  ? 443 ALA B C     1 
ATOM   6166 O  O     . ALA B 1 417 ? -2.674  24.170  40.043 1.00 46.84  ? 443 ALA B O     1 
ATOM   6167 C  CB    . ALA B 1 417 ? -2.555  22.077  42.526 1.00 40.89  ? 443 ALA B CB    1 
ATOM   6168 N  N     . GLN B 1 418 ? -0.803  24.442  41.274 1.00 46.68  ? 444 GLN B N     1 
ATOM   6169 C  CA    . GLN B 1 418 ? -0.633  25.839  40.897 1.00 50.57  ? 444 GLN B CA    1 
ATOM   6170 C  C     . GLN B 1 418 ? -0.322  26.006  39.413 1.00 51.90  ? 444 GLN B C     1 
ATOM   6171 O  O     . GLN B 1 418 ? -0.935  26.834  38.738 1.00 61.24  ? 444 GLN B O     1 
ATOM   6172 C  CB    . GLN B 1 418 ? 0.464   26.487  41.741 1.00 52.52  ? 444 GLN B CB    1 
ATOM   6173 C  CG    . GLN B 1 418 ? -0.068  27.315  42.892 1.00 60.56  ? 444 GLN B CG    1 
ATOM   6174 C  CD    . GLN B 1 418 ? -0.742  28.588  42.410 1.00 70.34  ? 444 GLN B CD    1 
ATOM   6175 O  OE1   . GLN B 1 418 ? -0.078  29.503  41.921 1.00 72.06  ? 444 GLN B OE1   1 
ATOM   6176 N  NE2   . GLN B 1 418 ? -2.066  28.647  42.530 1.00 70.59  ? 444 GLN B NE2   1 
ATOM   6177 N  N     . ASP B 1 419 ? 0.624   25.230  38.896 1.00 48.41  ? 445 ASP B N     1 
ATOM   6178 C  CA    . ASP B 1 419 ? 0.962   25.347  37.475 1.00 49.16  ? 445 ASP B CA    1 
ATOM   6179 C  C     . ASP B 1 419 ? -0.220  24.934  36.574 1.00 47.95  ? 445 ASP B C     1 
ATOM   6180 O  O     . ASP B 1 419 ? -0.538  25.597  35.564 1.00 52.84  ? 445 ASP B O     1 
ATOM   6181 C  CB    . ASP B 1 419 ? 2.207   24.521  37.165 1.00 47.48  ? 445 ASP B CB    1 
ATOM   6182 C  CG    . ASP B 1 419 ? 3.387   24.893  38.046 1.00 48.55  ? 445 ASP B CG    1 
ATOM   6183 O  OD1   . ASP B 1 419 ? 3.376   26.005  38.611 1.00 51.15  ? 445 ASP B OD1   1 
ATOM   6184 O  OD2   . ASP B 1 419 ? 4.331   24.081  38.167 1.00 48.88  ? 445 ASP B OD2   1 
ATOM   6185 N  N     . LEU B 1 420 ? -0.863  23.831  36.948 1.00 49.73  ? 446 LEU B N     1 
ATOM   6186 C  CA    . LEU B 1 420 ? -2.094  23.396  36.300 1.00 50.65  ? 446 LEU B CA    1 
ATOM   6187 C  C     . LEU B 1 420 ? -3.091  24.544  36.244 1.00 56.04  ? 446 LEU B C     1 
ATOM   6188 O  O     . LEU B 1 420 ? -3.691  24.812  35.200 1.00 57.95  ? 446 LEU B O     1 
ATOM   6189 C  CB    . LEU B 1 420 ? -2.713  22.220  37.049 1.00 44.85  ? 446 LEU B CB    1 
ATOM   6190 C  CG    . LEU B 1 420 ? -1.930  20.918  37.069 1.00 45.79  ? 446 LEU B CG    1 
ATOM   6191 C  CD1   . LEU B 1 420 ? -2.752  19.841  37.749 1.00 47.83  ? 446 LEU B CD1   1 
ATOM   6192 C  CD2   . LEU B 1 420 ? -1.554  20.505  35.659 1.00 52.88  ? 446 LEU B CD2   1 
ATOM   6193 N  N     . GLN B 1 421 ? -3.251  25.218  37.382 1.00 57.56  ? 447 GLN B N     1 
ATOM   6194 C  CA    . GLN B 1 421 ? -4.094  26.404  37.481 1.00 57.54  ? 447 GLN B CA    1 
ATOM   6195 C  C     . GLN B 1 421 ? -3.691  27.446  36.438 1.00 61.27  ? 447 GLN B C     1 
ATOM   6196 O  O     . GLN B 1 421 ? -4.543  27.960  35.704 1.00 56.64  ? 447 GLN B O     1 
ATOM   6197 C  CB    . GLN B 1 421 ? -4.016  26.987  38.898 1.00 60.56  ? 447 GLN B CB    1 
ATOM   6198 C  CG    . GLN B 1 421 ? -4.115  28.503  38.981 1.00 66.24  ? 447 GLN B CG    1 
ATOM   6199 C  CD    . GLN B 1 421 ? -5.527  29.004  38.786 1.00 72.91  ? 447 GLN B CD    1 
ATOM   6200 O  OE1   . GLN B 1 421 ? -6.475  28.464  39.365 1.00 65.04  ? 447 GLN B OE1   1 
ATOM   6201 N  NE2   . GLN B 1 421 ? -5.681  30.040  37.959 1.00 71.48  ? 447 GLN B NE2   1 
ATOM   6202 N  N     . LYS B 1 422 ? -2.391  27.739  36.369 1.00 61.88  ? 448 LYS B N     1 
ATOM   6203 C  CA    . LYS B 1 422 ? -1.859  28.650  35.353 1.00 58.14  ? 448 LYS B CA    1 
ATOM   6204 C  C     . LYS B 1 422 ? -2.324  28.306  33.946 1.00 59.35  ? 448 LYS B C     1 
ATOM   6205 O  O     . LYS B 1 422 ? -2.746  29.188  33.194 1.00 56.89  ? 448 LYS B O     1 
ATOM   6206 C  CB    . LYS B 1 422 ? -0.328  28.663  35.374 1.00 59.23  ? 448 LYS B CB    1 
ATOM   6207 C  CG    . LYS B 1 422 ? 0.286   29.951  35.884 1.00 65.05  ? 448 LYS B CG    1 
ATOM   6208 C  CD    . LYS B 1 422 ? 1.798   29.968  35.687 1.00 66.89  ? 448 LYS B CD    1 
ATOM   6209 C  CE    . LYS B 1 422 ? 2.474   28.863  36.488 1.00 63.81  ? 448 LYS B CE    1 
ATOM   6210 N  NZ    . LYS B 1 422 ? 2.463   29.142  37.960 1.00 69.86  ? 448 LYS B NZ    1 
ATOM   6211 N  N     . GLU B 1 423 ? -2.243  27.031  33.574 1.00 61.03  ? 449 GLU B N     1 
ATOM   6212 C  CA    . GLU B 1 423 ? -2.689  26.678  32.220 1.00 60.61  ? 449 GLU B CA    1 
ATOM   6213 C  C     . GLU B 1 423 ? -4.104  26.089  32.149 1.00 61.71  ? 449 GLU B C     1 
ATOM   6214 O  O     . GLU B 1 423 ? -4.519  25.587  31.101 1.00 61.54  ? 449 GLU B O     1 
ATOM   6215 C  CB    . GLU B 1 423 ? -1.700  25.713  31.572 1.00 64.25  ? 449 GLU B CB    1 
ATOM   6216 C  CG    . GLU B 1 423 ? -0.465  26.410  31.029 1.00 62.19  ? 449 GLU B CG    1 
ATOM   6217 C  CD    . GLU B 1 423 ? 0.355   25.531  30.107 1.00 67.31  ? 449 GLU B CD    1 
ATOM   6218 O  OE1   . GLU B 1 423 ? 0.085   24.312  30.046 1.00 62.40  ? 449 GLU B OE1   1 
ATOM   6219 O  OE2   . GLU B 1 423 ? 1.270   26.063  29.439 1.00 72.83  ? 449 GLU B OE2   1 
ATOM   6220 N  N     . ARG B 1 424 ? -4.835  26.164  33.259 1.00 63.03  ? 450 ARG B N     1 
ATOM   6221 C  CA    . ARG B 1 424 ? -6.219  25.687  33.337 1.00 61.31  ? 450 ARG B CA    1 
ATOM   6222 C  C     . ARG B 1 424 ? -6.350  24.215  32.962 1.00 56.20  ? 450 ARG B C     1 
ATOM   6223 O  O     . ARG B 1 424 ? -7.363  23.803  32.404 1.00 60.51  ? 450 ARG B O     1 
ATOM   6224 C  CB    . ARG B 1 424 ? -7.134  26.530  32.439 1.00 59.34  ? 450 ARG B CB    1 
ATOM   6225 C  CG    . ARG B 1 424 ? -7.172  28.010  32.799 1.00 65.97  ? 450 ARG B CG    1 
ATOM   6226 N  N     . LEU B 1 425 ? -5.325  23.430  33.279 1.00 55.46  ? 451 LEU B N     1 
ATOM   6227 C  CA    . LEU B 1 425 ? -5.252  22.037  32.843 1.00 61.05  ? 451 LEU B CA    1 
ATOM   6228 C  C     . LEU B 1 425 ? -5.681  21.031  33.900 1.00 56.11  ? 451 LEU B C     1 
ATOM   6229 O  O     . LEU B 1 425 ? -5.459  21.232  35.092 1.00 58.54  ? 451 LEU B O     1 
ATOM   6230 C  CB    . LEU B 1 425 ? -3.833  21.705  32.383 1.00 63.51  ? 451 LEU B CB    1 
ATOM   6231 C  CG    . LEU B 1 425 ? -3.423  22.321  31.045 1.00 62.66  ? 451 LEU B CG    1 
ATOM   6232 C  CD1   . LEU B 1 425 ? -1.982  21.988  30.715 1.00 61.78  ? 451 LEU B CD1   1 
ATOM   6233 C  CD2   . LEU B 1 425 ? -4.350  21.831  29.944 1.00 57.08  ? 451 LEU B CD2   1 
ATOM   6234 N  N     . LYS B 1 426 ? -6.309  19.953  33.442 1.00 51.91  ? 452 LYS B N     1 
ATOM   6235 C  CA    . LYS B 1 426 ? -6.799  18.897  34.321 1.00 54.93  ? 452 LYS B CA    1 
ATOM   6236 C  C     . LYS B 1 426 ? -6.543  17.524  33.700 1.00 57.62  ? 452 LYS B C     1 
ATOM   6237 O  O     . LYS B 1 426 ? -6.913  17.284  32.554 1.00 65.76  ? 452 LYS B O     1 
ATOM   6238 C  CB    . LYS B 1 426 ? -8.293  19.081  34.615 1.00 55.58  ? 452 LYS B CB    1 
ATOM   6239 C  CG    . LYS B 1 426 ? -8.644  20.437  35.228 1.00 64.45  ? 452 LYS B CG    1 
ATOM   6240 C  CD    . LYS B 1 426 ? -9.946  20.397  36.018 1.00 73.36  ? 452 LYS B CD    1 
ATOM   6241 C  CE    . LYS B 1 426 ? -11.166 20.351  35.109 1.00 83.46  ? 452 LYS B CE    1 
ATOM   6242 N  NZ    . LYS B 1 426 ? -12.432 20.379  35.904 1.00 84.40  ? 452 LYS B NZ    1 
ATOM   6243 N  N     . GLY B 1 427 ? -5.909  16.628  34.449 1.00 51.21  ? 453 GLY B N     1 
ATOM   6244 C  CA    . GLY B 1 427 ? -5.589  15.304  33.939 1.00 51.70  ? 453 GLY B CA    1 
ATOM   6245 C  C     . GLY B 1 427 ? -5.927  14.221  34.942 1.00 50.61  ? 453 GLY B C     1 
ATOM   6246 O  O     . GLY B 1 427 ? -6.349  14.529  36.055 1.00 50.70  ? 453 GLY B O     1 
ATOM   6247 N  N     . ARG B 1 428 ? -5.763  12.955  34.562 1.00 46.52  ? 454 ARG B N     1 
ATOM   6248 C  CA    . ARG B 1 428 ? -6.230  11.874  35.425 1.00 46.05  ? 454 ARG B CA    1 
ATOM   6249 C  C     . ARG B 1 428 ? -5.199  10.778  35.713 1.00 42.04  ? 454 ARG B C     1 
ATOM   6250 O  O     . ARG B 1 428 ? -5.545  9.719   36.234 1.00 41.51  ? 454 ARG B O     1 
ATOM   6251 C  CB    . ARG B 1 428 ? -7.486  11.245  34.820 1.00 51.31  ? 454 ARG B CB    1 
ATOM   6252 C  CG    . ARG B 1 428 ? -7.426  11.045  33.320 1.00 57.74  ? 454 ARG B CG    1 
ATOM   6253 C  CD    . ARG B 1 428 ? -8.632  10.252  32.817 1.00 61.55  ? 454 ARG B CD    1 
ATOM   6254 N  NE    . ARG B 1 428 ? -8.387  9.638   31.513 1.00 65.75  ? 454 ARG B NE    1 
ATOM   6255 C  CZ    . ARG B 1 428 ? -8.118  8.348   31.329 1.00 67.08  ? 454 ARG B CZ    1 
ATOM   6256 N  NH1   . ARG B 1 428 ? -8.102  7.516   32.358 1.00 59.35  ? 454 ARG B NH1   1 
ATOM   6257 N  NH2   . ARG B 1 428 ? -7.899  7.884   30.106 1.00 74.84  ? 454 ARG B NH2   1 
ATOM   6258 N  N     . THR B 1 429 ? -3.936  11.031  35.393 1.00 38.15  ? 455 THR B N     1 
ATOM   6259 C  CA    . THR B 1 429 ? -2.878  10.108  35.777 1.00 41.96  ? 455 THR B CA    1 
ATOM   6260 C  C     . THR B 1 429 ? -1.842  10.838  36.615 1.00 41.03  ? 455 THR B C     1 
ATOM   6261 O  O     . THR B 1 429 ? -1.302  11.854  36.186 1.00 42.86  ? 455 THR B O     1 
ATOM   6262 C  CB    . THR B 1 429 ? -2.196  9.473   34.545 1.00 44.96  ? 455 THR B CB    1 
ATOM   6263 O  OG1   . THR B 1 429 ? -3.121  8.609   33.874 1.00 44.95  ? 455 THR B OG1   1 
ATOM   6264 C  CG2   . THR B 1 429 ? -0.966  8.667   34.950 1.00 35.76  ? 455 THR B CG2   1 
ATOM   6265 N  N     . VAL B 1 430 ? -1.574  10.329  37.813 1.00 37.01  ? 456 VAL B N     1 
ATOM   6266 C  CA    . VAL B 1 430 ? -0.585  10.952  38.684 1.00 34.04  ? 456 VAL B CA    1 
ATOM   6267 C  C     . VAL B 1 430 ? 0.569   9.994   38.936 1.00 33.09  ? 456 VAL B C     1 
ATOM   6268 O  O     . VAL B 1 430 ? 0.360   8.848   39.340 1.00 34.81  ? 456 VAL B O     1 
ATOM   6269 C  CB    . VAL B 1 430 ? -1.201  11.383  40.033 1.00 38.16  ? 456 VAL B CB    1 
ATOM   6270 C  CG1   . VAL B 1 430 ? -0.119  11.799  41.016 1.00 36.36  ? 456 VAL B CG1   1 
ATOM   6271 C  CG2   . VAL B 1 430 ? -2.203  12.519  39.838 1.00 34.86  ? 456 VAL B CG2   1 
ATOM   6272 N  N     . THR B 1 431 ? 1.786   10.464  38.684 1.00 31.45  ? 457 THR B N     1 
ATOM   6273 C  CA    . THR B 1 431 ? 2.980   9.655   38.904 1.00 32.00  ? 457 THR B CA    1 
ATOM   6274 C  C     . THR B 1 431 ? 3.904   10.328  39.909 1.00 32.45  ? 457 THR B C     1 
ATOM   6275 O  O     . THR B 1 431 ? 4.216   11.513  39.777 1.00 33.55  ? 457 THR B O     1 
ATOM   6276 C  CB    . THR B 1 431 ? 3.769   9.420   37.599 1.00 32.91  ? 457 THR B CB    1 
ATOM   6277 O  OG1   . THR B 1 431 ? 2.874   9.036   36.549 1.00 36.14  ? 457 THR B OG1   1 
ATOM   6278 C  CG2   . THR B 1 431 ? 4.830   8.336   37.791 1.00 28.68  ? 457 THR B CG2   1 
ATOM   6279 N  N     . ILE B 1 432 ? 4.366   9.565   40.895 1.00 28.46  ? 458 ILE B N     1 
ATOM   6280 C  CA    . ILE B 1 432 ? 5.391   10.051  41.805 1.00 26.64  ? 458 ILE B CA    1 
ATOM   6281 C  C     . ILE B 1 432 ? 6.744   9.484   41.401 1.00 25.70  ? 458 ILE B C     1 
ATOM   6282 O  O     . ILE B 1 432 ? 6.832   8.392   40.834 1.00 25.00  ? 458 ILE B O     1 
ATOM   6283 C  CB    . ILE B 1 432 ? 5.093   9.676   43.268 1.00 30.57  ? 458 ILE B CB    1 
ATOM   6284 C  CG1   . ILE B 1 432 ? 5.253   8.166   43.484 1.00 31.85  ? 458 ILE B CG1   1 
ATOM   6285 C  CG2   . ILE B 1 432 ? 3.697   10.141  43.649 1.00 31.35  ? 458 ILE B CG2   1 
ATOM   6286 C  CD1   . ILE B 1 432 ? 5.391   7.751   44.928 1.00 24.90  ? 458 ILE B CD1   1 
ATOM   6287 N  N     . LYS B 1 433 ? 7.793   10.236  41.705 1.00 23.94  ? 459 LYS B N     1 
ATOM   6288 C  CA    . LYS B 1 433 ? 9.149   9.864   41.342 1.00 25.41  ? 459 LYS B CA    1 
ATOM   6289 C  C     . LYS B 1 433 ? 9.991   9.842   42.605 1.00 26.77  ? 459 LYS B C     1 
ATOM   6290 O  O     . LYS B 1 433 ? 9.883   10.733  43.443 1.00 25.44  ? 459 LYS B O     1 
ATOM   6291 C  CB    . LYS B 1 433 ? 9.715   10.842  40.303 1.00 26.79  ? 459 LYS B CB    1 
ATOM   6292 C  CG    . LYS B 1 433 ? 11.172  10.605  39.918 1.00 24.67  ? 459 LYS B CG    1 
ATOM   6293 C  CD    . LYS B 1 433 ? 11.546  11.409  38.682 1.00 22.45  ? 459 LYS B CD    1 
ATOM   6294 C  CE    . LYS B 1 433 ? 13.024  11.295  38.355 1.00 27.24  ? 459 LYS B CE    1 
ATOM   6295 N  NZ    . LYS B 1 433 ? 13.363  12.101  37.148 1.00 35.70  ? 459 LYS B NZ    1 
ATOM   6296 N  N     . LEU B 1 434 ? 10.817  8.813   42.747 1.00 27.16  ? 460 LEU B N     1 
ATOM   6297 C  CA    . LEU B 1 434 ? 11.609  8.653   43.950 1.00 22.41  ? 460 LEU B CA    1 
ATOM   6298 C  C     . LEU B 1 434 ? 13.028  8.254   43.598 1.00 23.78  ? 460 LEU B C     1 
ATOM   6299 O  O     . LEU B 1 434 ? 13.253  7.295   42.867 1.00 35.84  ? 460 LEU B O     1 
ATOM   6300 C  CB    . LEU B 1 434 ? 10.973  7.607   44.865 1.00 24.27  ? 460 LEU B CB    1 
ATOM   6301 C  CG    . LEU B 1 434 ? 9.528   7.868   45.300 1.00 25.78  ? 460 LEU B CG    1 
ATOM   6302 C  CD1   . LEU B 1 434 ? 8.878   6.602   45.842 1.00 27.04  ? 460 LEU B CD1   1 
ATOM   6303 C  CD2   . LEU B 1 434 ? 9.468   8.977   46.329 1.00 27.72  ? 460 LEU B CD2   1 
ATOM   6304 N  N     . LYS B 1 435 ? 13.982  9.010   44.112 1.00 18.57  ? 461 LYS B N     1 
ATOM   6305 C  CA    . LYS B 1 435 ? 15.386  8.769   43.848 1.00 22.50  ? 461 LYS B CA    1 
ATOM   6306 C  C     . LYS B 1 435 ? 16.044  8.585   45.194 1.00 23.77  ? 461 LYS B C     1 
ATOM   6307 O  O     . LYS B 1 435 ? 16.024  9.503   46.002 1.00 30.64  ? 461 LYS B O     1 
ATOM   6308 C  CB    . LYS B 1 435 ? 15.986  9.949   43.078 1.00 22.64  ? 461 LYS B CB    1 
ATOM   6309 C  CG    . LYS B 1 435 ? 17.416  9.804   42.579 1.00 19.95  ? 461 LYS B CG    1 
ATOM   6310 C  CD    . LYS B 1 435 ? 17.620  10.756  41.395 1.00 27.38  ? 461 LYS B CD    1 
ATOM   6311 C  CE    . LYS B 1 435 ? 19.084  11.057  41.112 1.00 30.94  ? 461 LYS B CE    1 
ATOM   6312 N  NZ    . LYS B 1 435 ? 19.247  12.061  40.018 1.00 18.48  ? 461 LYS B NZ    1 
ATOM   6313 N  N     . ASN B 1 436 ? 16.596  7.411   45.473 1.00 26.00  ? 462 ASN B N     1 
ATOM   6314 C  CA    . ASN B 1 436 ? 17.202  7.220   46.783 1.00 25.86  ? 462 ASN B CA    1 
ATOM   6315 C  C     . ASN B 1 436 ? 18.660  7.653   46.764 1.00 26.96  ? 462 ASN B C     1 
ATOM   6316 O  O     . ASN B 1 436 ? 19.166  8.063   45.725 1.00 25.91  ? 462 ASN B O     1 
ATOM   6317 C  CB    . ASN B 1 436 ? 17.034  5.769   47.258 1.00 26.74  ? 462 ASN B CB    1 
ATOM   6318 C  CG    . ASN B 1 436 ? 17.770  4.747   46.391 1.00 31.67  ? 462 ASN B CG    1 
ATOM   6319 O  OD1   . ASN B 1 436 ? 18.702  5.064   45.654 1.00 35.32  ? 462 ASN B OD1   1 
ATOM   6320 N  ND2   . ASN B 1 436 ? 17.334  3.497   46.484 1.00 34.50  ? 462 ASN B ND2   1 
ATOM   6321 N  N     . VAL B 1 437 ? 19.333  7.562   47.903 1.00 29.31  ? 463 VAL B N     1 
ATOM   6322 C  CA    . VAL B 1 437 ? 20.660  8.154   48.039 1.00 33.25  ? 463 VAL B CA    1 
ATOM   6323 C  C     . VAL B 1 437 ? 21.753  7.394   47.288 1.00 39.71  ? 463 VAL B C     1 
ATOM   6324 O  O     . VAL B 1 437 ? 22.894  7.854   47.222 1.00 40.37  ? 463 VAL B O     1 
ATOM   6325 C  CB    . VAL B 1 437 ? 21.061  8.274   49.521 1.00 40.42  ? 463 VAL B CB    1 
ATOM   6326 C  CG1   . VAL B 1 437 ? 20.037  9.110   50.277 1.00 34.76  ? 463 VAL B CG1   1 
ATOM   6327 C  CG2   . VAL B 1 437 ? 21.240  6.892   50.153 1.00 39.87  ? 463 VAL B CG2   1 
ATOM   6328 N  N     . ASN B 1 438 ? 21.401  6.246   46.715 1.00 41.61  ? 464 ASN B N     1 
ATOM   6329 C  CA    . ASN B 1 438 ? 22.320  5.513   45.853 1.00 37.34  ? 464 ASN B CA    1 
ATOM   6330 C  C     . ASN B 1 438 ? 22.014  5.808   44.394 1.00 36.81  ? 464 ASN B C     1 
ATOM   6331 O  O     . ASN B 1 438 ? 22.564  5.171   43.495 1.00 45.47  ? 464 ASN B O     1 
ATOM   6332 C  CB    . ASN B 1 438 ? 22.249  4.012   46.126 1.00 38.15  ? 464 ASN B CB    1 
ATOM   6333 C  CG    . ASN B 1 438 ? 22.783  3.646   47.499 1.00 50.58  ? 464 ASN B CG    1 
ATOM   6334 O  OD1   . ASN B 1 438 ? 23.995  3.615   47.717 1.00 48.95  ? 464 ASN B OD1   1 
ATOM   6335 N  ND2   . ASN B 1 438 ? 21.879  3.377   48.437 1.00 50.90  ? 464 ASN B ND2   1 
ATOM   6336 N  N     . PHE B 1 439 ? 21.101  6.759   44.193 1.00 36.44  ? 465 PHE B N     1 
ATOM   6337 C  CA    . PHE B 1 439 ? 20.752  7.343   42.890 1.00 34.27  ? 465 PHE B CA    1 
ATOM   6338 C  C     . PHE B 1 439 ? 19.871  6.440   42.043 1.00 31.50  ? 465 PHE B C     1 
ATOM   6339 O  O     . PHE B 1 439 ? 19.719  6.663   40.845 1.00 32.93  ? 465 PHE B O     1 
ATOM   6340 C  CB    . PHE B 1 439 ? 22.005  7.736   42.107 1.00 37.48  ? 465 PHE B CB    1 
ATOM   6341 C  CG    . PHE B 1 439 ? 22.694  8.947   42.653 1.00 34.31  ? 465 PHE B CG    1 
ATOM   6342 C  CD1   . PHE B 1 439 ? 22.276  10.214  42.289 1.00 31.28  ? 465 PHE B CD1   1 
ATOM   6343 C  CD2   . PHE B 1 439 ? 23.753  8.822   43.533 1.00 37.21  ? 465 PHE B CD2   1 
ATOM   6344 C  CE1   . PHE B 1 439 ? 22.905  11.332  42.787 1.00 34.28  ? 465 PHE B CE1   1 
ATOM   6345 C  CE2   . PHE B 1 439 ? 24.385  9.937   44.035 1.00 41.36  ? 465 PHE B CE2   1 
ATOM   6346 C  CZ    . PHE B 1 439 ? 23.959  11.197  43.659 1.00 38.41  ? 465 PHE B CZ    1 
ATOM   6347 N  N     . GLU B 1 440 ? 19.283  5.431   42.673 1.00 31.57  ? 466 GLU B N     1 
ATOM   6348 C  CA    . GLU B 1 440 ? 18.357  4.554   41.985 1.00 34.53  ? 466 GLU B CA    1 
ATOM   6349 C  C     . GLU B 1 440 ? 16.992  5.226   41.888 1.00 31.62  ? 466 GLU B C     1 
ATOM   6350 O  O     . GLU B 1 440 ? 16.422  5.641   42.893 1.00 31.49  ? 466 GLU B O     1 
ATOM   6351 C  CB    . GLU B 1 440 ? 18.270  3.209   42.702 1.00 35.86  ? 466 GLU B CB    1 
ATOM   6352 C  CG    . GLU B 1 440 ? 19.586  2.436   42.671 1.00 43.81  ? 466 GLU B CG    1 
ATOM   6353 C  CD    . GLU B 1 440 ? 19.749  1.473   43.838 1.00 49.59  ? 466 GLU B CD    1 
ATOM   6354 O  OE1   . GLU B 1 440 ? 18.844  1.406   44.702 1.00 44.90  ? 466 GLU B OE1   1 
ATOM   6355 O  OE2   . GLU B 1 440 ? 20.793  0.787   43.886 1.00 45.05  ? 466 GLU B OE2   1 
ATOM   6356 N  N     . VAL B 1 441 ? 16.481  5.337   40.667 1.00 31.07  ? 467 VAL B N     1 
ATOM   6357 C  CA    . VAL B 1 441 ? 15.230  6.039   40.410 1.00 29.37  ? 467 VAL B CA    1 
ATOM   6358 C  C     . VAL B 1 441 ? 14.099  5.044   40.188 1.00 30.95  ? 467 VAL B C     1 
ATOM   6359 O  O     . VAL B 1 441 ? 14.285  4.030   39.512 1.00 32.91  ? 467 VAL B O     1 
ATOM   6360 C  CB    . VAL B 1 441 ? 15.343  6.953   39.162 1.00 26.83  ? 467 VAL B CB    1 
ATOM   6361 C  CG1   . VAL B 1 441 ? 14.018  7.633   38.861 1.00 23.07  ? 467 VAL B CG1   1 
ATOM   6362 C  CG2   . VAL B 1 441 ? 16.451  7.984   39.335 1.00 26.80  ? 467 VAL B CG2   1 
ATOM   6363 N  N     . LYS B 1 442 ? 12.927  5.330   40.748 1.00 26.17  ? 468 LYS B N     1 
ATOM   6364 C  CA    . LYS B 1 442 ? 11.732  4.568   40.403 1.00 29.95  ? 468 LYS B CA    1 
ATOM   6365 C  C     . LYS B 1 442 ? 10.492  5.442   40.414 1.00 28.04  ? 468 LYS B C     1 
ATOM   6366 O  O     . LYS B 1 442 ? 10.405  6.395   41.181 1.00 29.35  ? 468 LYS B O     1 
ATOM   6367 C  CB    . LYS B 1 442 ? 11.548  3.378   41.347 1.00 35.54  ? 468 LYS B CB    1 
ATOM   6368 C  CG    . LYS B 1 442 ? 11.571  3.708   42.823 1.00 32.07  ? 468 LYS B CG    1 
ATOM   6369 C  CD    . LYS B 1 442 ? 11.095  2.515   43.643 1.00 38.60  ? 468 LYS B CD    1 
ATOM   6370 C  CE    . LYS B 1 442 ? 12.213  1.501   43.867 1.00 52.01  ? 468 LYS B CE    1 
ATOM   6371 N  NZ    . LYS B 1 442 ? 11.952  0.557   45.010 1.00 48.08  ? 468 LYS B NZ    1 
ATOM   6372 N  N     . THR B 1 443 ? 9.536   5.116   39.551 1.00 25.56  ? 469 THR B N     1 
ATOM   6373 C  CA    . THR B 1 443 ? 8.312   5.896   39.450 1.00 27.54  ? 469 THR B CA    1 
ATOM   6374 C  C     . THR B 1 443 ? 7.117   5.014   39.740 1.00 28.36  ? 469 THR B C     1 
ATOM   6375 O  O     . THR B 1 443 ? 7.187   3.806   39.567 1.00 37.55  ? 469 THR B O     1 
ATOM   6376 C  CB    . THR B 1 443 ? 8.145   6.548   38.058 1.00 30.65  ? 469 THR B CB    1 
ATOM   6377 O  OG1   . THR B 1 443 ? 8.155   5.533   37.051 1.00 45.01  ? 469 THR B OG1   1 
ATOM   6378 C  CG2   . THR B 1 443 ? 9.272   7.532   37.781 1.00 28.04  ? 469 THR B CG2   1 
ATOM   6379 N  N     . ARG B 1 444 ? 6.026   5.617   40.200 1.00 29.86  ? 470 ARG B N     1 
ATOM   6380 C  CA    . ARG B 1 444 ? 4.801   4.866   40.469 1.00 30.68  ? 470 ARG B CA    1 
ATOM   6381 C  C     . ARG B 1 444 ? 3.602   5.698   40.060 1.00 30.01  ? 470 ARG B C     1 
ATOM   6382 O  O     . ARG B 1 444 ? 3.497   6.852   40.444 1.00 31.35  ? 470 ARG B O     1 
ATOM   6383 C  CB    . ARG B 1 444 ? 4.695   4.485   41.950 1.00 33.82  ? 470 ARG B CB    1 
ATOM   6384 C  CG    . ARG B 1 444 ? 5.833   3.626   42.495 1.00 33.48  ? 470 ARG B CG    1 
ATOM   6385 C  CD    . ARG B 1 444 ? 5.727   2.184   42.033 1.00 38.88  ? 470 ARG B CD    1 
ATOM   6386 N  NE    . ARG B 1 444 ? 6.761   1.335   42.628 1.00 43.71  ? 470 ARG B NE    1 
ATOM   6387 C  CZ    . ARG B 1 444 ? 7.751   0.768   41.944 1.00 43.65  ? 470 ARG B CZ    1 
ATOM   6388 N  NH1   . ARG B 1 444 ? 7.843   0.953   40.635 1.00 49.90  ? 470 ARG B NH1   1 
ATOM   6389 N  NH2   . ARG B 1 444 ? 8.645   0.010   42.564 1.00 38.14  ? 470 ARG B NH2   1 
ATOM   6390 N  N     . ALA B 1 445 ? 2.694   5.122   39.285 1.00 30.99  ? 471 ALA B N     1 
ATOM   6391 C  CA    . ALA B 1 445 ? 1.584   5.910   38.778 1.00 29.70  ? 471 ALA B CA    1 
ATOM   6392 C  C     . ALA B 1 445 ? 0.221   5.375   39.189 1.00 30.10  ? 471 ALA B C     1 
ATOM   6393 O  O     . ALA B 1 445 ? 0.091   4.248   39.661 1.00 29.44  ? 471 ALA B O     1 
ATOM   6394 C  CB    . ALA B 1 445 ? 1.666   5.991   37.274 1.00 32.91  ? 471 ALA B CB    1 
ATOM   6395 N  N     . SER B 1 446 ? -0.795  6.205   38.993 1.00 30.12  ? 472 SER B N     1 
ATOM   6396 C  CA    . SER B 1 446 ? -2.178  5.811   39.206 1.00 35.31  ? 472 SER B CA    1 
ATOM   6397 C  C     . SER B 1 446 ? -3.057  6.608   38.280 1.00 45.54  ? 472 SER B C     1 
ATOM   6398 O  O     . SER B 1 446 ? -3.009  7.842   38.276 1.00 49.18  ? 472 SER B O     1 
ATOM   6399 C  CB    . SER B 1 446 ? -2.615  6.033   40.646 1.00 38.76  ? 472 SER B CB    1 
ATOM   6400 O  OG    . SER B 1 446 ? -1.993  5.112   41.516 1.00 43.28  ? 472 SER B OG    1 
ATOM   6401 N  N     . THR B 1 447 ? -3.855  5.899   37.491 1.00 47.69  ? 473 THR B N     1 
ATOM   6402 C  CA    . THR B 1 447 ? -4.829  6.540   36.628 1.00 50.62  ? 473 THR B CA    1 
ATOM   6403 C  C     . THR B 1 447 ? -6.211  6.406   37.258 1.00 54.52  ? 473 THR B C     1 
ATOM   6404 O  O     . THR B 1 447 ? -6.593  5.325   37.717 1.00 50.95  ? 473 THR B O     1 
ATOM   6405 C  CB    . THR B 1 447 ? -4.812  5.926   35.220 1.00 46.96  ? 473 THR B CB    1 
ATOM   6406 O  OG1   . THR B 1 447 ? -3.475  5.953   34.705 1.00 47.96  ? 473 THR B OG1   1 
ATOM   6407 C  CG2   . THR B 1 447 ? -5.724  6.694   34.288 1.00 50.63  ? 473 THR B CG2   1 
ATOM   6408 N  N     . VAL B 1 448 ? -6.955  7.509   37.275 1.00 51.93  ? 474 VAL B N     1 
ATOM   6409 C  CA    . VAL B 1 448 ? -8.271  7.537   37.900 1.00 52.36  ? 474 VAL B CA    1 
ATOM   6410 C  C     . VAL B 1 448 ? -9.360  7.955   36.921 1.00 56.54  ? 474 VAL B C     1 
ATOM   6411 O  O     . VAL B 1 448 ? -9.078  8.480   35.845 1.00 57.78  ? 474 VAL B O     1 
ATOM   6412 C  CB    . VAL B 1 448 ? -8.290  8.476   39.113 1.00 57.01  ? 474 VAL B CB    1 
ATOM   6413 C  CG1   . VAL B 1 448 ? -7.179  8.096   40.089 1.00 52.02  ? 474 VAL B CG1   1 
ATOM   6414 C  CG2   . VAL B 1 448 ? -8.154  9.921   38.672 1.00 57.15  ? 474 VAL B CG2   1 
ATOM   6415 N  N     . SER B 1 449 ? -10.604 7.690   37.305 1.00 61.07  ? 475 SER B N     1 
ATOM   6416 C  CA    . SER B 1 449 ? -11.759 7.853   36.431 1.00 61.72  ? 475 SER B CA    1 
ATOM   6417 C  C     . SER B 1 449 ? -11.907 9.266   35.878 1.00 64.06  ? 475 SER B C     1 
ATOM   6418 O  O     . SER B 1 449 ? -11.832 9.477   34.665 1.00 61.58  ? 475 SER B O     1 
ATOM   6419 C  CB    . SER B 1 449 ? -13.025 7.462   37.188 1.00 64.05  ? 475 SER B CB    1 
ATOM   6420 O  OG    . SER B 1 449 ? -12.766 6.371   38.061 1.00 56.53  ? 475 SER B OG    1 
ATOM   6421 N  N     . SER B 1 450 ? -12.126 10.224  36.776 1.00 64.91  ? 476 SER B N     1 
ATOM   6422 C  CA    . SER B 1 450 ? -12.360 11.616  36.398 1.00 59.02  ? 476 SER B CA    1 
ATOM   6423 C  C     . SER B 1 450 ? -11.080 12.436  36.496 1.00 59.05  ? 476 SER B C     1 
ATOM   6424 O  O     . SER B 1 450 ? -10.192 12.110  37.281 1.00 58.41  ? 476 SER B O     1 
ATOM   6425 C  CB    . SER B 1 450 ? -13.439 12.241  37.284 1.00 64.92  ? 476 SER B CB    1 
ATOM   6426 O  OG    . SER B 1 450 ? -14.446 11.298  37.603 1.00 72.33  ? 476 SER B OG    1 
ATOM   6427 N  N     . VAL B 1 451 ? -10.979 13.493  35.695 1.00 63.80  ? 477 VAL B N     1 
ATOM   6428 C  CA    . VAL B 1 451 ? -9.813  14.370  35.759 1.00 61.02  ? 477 VAL B CA    1 
ATOM   6429 C  C     . VAL B 1 451 ? -9.669  15.022  37.130 1.00 54.16  ? 477 VAL B C     1 
ATOM   6430 O  O     . VAL B 1 451 ? -10.630 15.148  37.887 1.00 53.21  ? 477 VAL B O     1 
ATOM   6431 C  CB    . VAL B 1 451 ? -9.858  15.477  34.683 1.00 57.04  ? 477 VAL B CB    1 
ATOM   6432 C  CG1   . VAL B 1 451 ? -10.023 14.871  33.306 1.00 54.94  ? 477 VAL B CG1   1 
ATOM   6433 C  CG2   . VAL B 1 451 ? -10.970 16.480  34.976 1.00 62.11  ? 477 VAL B CG2   1 
ATOM   6434 N  N     . VAL B 1 452 ? -8.444  15.438  37.427 1.00 54.34  ? 478 VAL B N     1 
ATOM   6435 C  CA    . VAL B 1 452 ? -8.060  15.922  38.747 1.00 50.96  ? 478 VAL B CA    1 
ATOM   6436 C  C     . VAL B 1 452 ? -7.238  17.206  38.572 1.00 50.88  ? 478 VAL B C     1 
ATOM   6437 O  O     . VAL B 1 452 ? -6.548  17.358  37.564 1.00 54.92  ? 478 VAL B O     1 
ATOM   6438 C  CB    . VAL B 1 452 ? -7.270  14.818  39.509 1.00 50.70  ? 478 VAL B CB    1 
ATOM   6439 C  CG1   . VAL B 1 452 ? -6.147  15.389  40.341 1.00 51.66  ? 478 VAL B CG1   1 
ATOM   6440 C  CG2   . VAL B 1 452 ? -8.217  13.945  40.333 1.00 44.76  ? 478 VAL B CG2   1 
ATOM   6441 N  N     . SER B 1 453 ? -7.293  18.128  39.534 1.00 54.81  ? 479 SER B N     1 
ATOM   6442 C  CA    . SER B 1 453 ? -6.638  19.420  39.335 1.00 57.04  ? 479 SER B CA    1 
ATOM   6443 C  C     . SER B 1 453 ? -6.153  20.118  40.608 1.00 50.51  ? 479 SER B C     1 
ATOM   6444 O  O     . SER B 1 453 ? -5.163  20.848  40.566 1.00 53.67  ? 479 SER B O     1 
ATOM   6445 C  CB    . SER B 1 453 ? -7.576  20.361  38.576 1.00 56.48  ? 479 SER B CB    1 
ATOM   6446 O  OG    . SER B 1 453 ? -7.163  21.712  38.710 1.00 60.87  ? 479 SER B OG    1 
ATOM   6447 N  N     . THR B 1 454 ? -6.834  19.912  41.730 1.00 46.73  ? 480 THR B N     1 
ATOM   6448 C  CA    . THR B 1 454 ? -6.474  20.645  42.941 1.00 49.17  ? 480 THR B CA    1 
ATOM   6449 C  C     . THR B 1 454 ? -5.411  19.893  43.725 1.00 46.75  ? 480 THR B C     1 
ATOM   6450 O  O     . THR B 1 454 ? -5.164  18.718  43.475 1.00 50.48  ? 480 THR B O     1 
ATOM   6451 C  CB    . THR B 1 454 ? -7.687  20.884  43.859 1.00 43.38  ? 480 THR B CB    1 
ATOM   6452 O  OG1   . THR B 1 454 ? -7.929  19.717  44.654 1.00 48.78  ? 480 THR B OG1   1 
ATOM   6453 C  CG2   . THR B 1 454 ? -8.919  21.211  43.040 1.00 43.58  ? 480 THR B CG2   1 
ATOM   6454 N  N     . ALA B 1 455 ? -4.781  20.575  44.673 1.00 43.19  ? 481 ALA B N     1 
ATOM   6455 C  CA    . ALA B 1 455 ? -3.697  19.974  45.435 1.00 42.98  ? 481 ALA B CA    1 
ATOM   6456 C  C     . ALA B 1 455 ? -4.224  18.838  46.304 1.00 48.16  ? 481 ALA B C     1 
ATOM   6457 O  O     . ALA B 1 455 ? -3.504  17.887  46.612 1.00 46.59  ? 481 ALA B O     1 
ATOM   6458 C  CB    . ALA B 1 455 ? -3.003  21.021  46.282 1.00 40.74  ? 481 ALA B CB    1 
ATOM   6459 N  N     . GLU B 1 456 ? -5.495  18.936  46.679 1.00 48.00  ? 482 GLU B N     1 
ATOM   6460 C  CA    . GLU B 1 456 ? -6.112  17.945  47.547 1.00 45.23  ? 482 GLU B CA    1 
ATOM   6461 C  C     . GLU B 1 456 ? -6.228  16.605  46.830 1.00 48.19  ? 482 GLU B C     1 
ATOM   6462 O  O     . GLU B 1 456 ? -6.020  15.554  47.428 1.00 47.27  ? 482 GLU B O     1 
ATOM   6463 C  CB    . GLU B 1 456 ? -7.494  18.407  48.015 1.00 48.03  ? 482 GLU B CB    1 
ATOM   6464 C  CG    . GLU B 1 456 ? -7.480  19.584  48.977 1.00 54.24  ? 482 GLU B CG    1 
ATOM   6465 C  CD    . GLU B 1 456 ? -7.196  20.914  48.291 1.00 59.14  ? 482 GLU B CD    1 
ATOM   6466 O  OE1   . GLU B 1 456 ? -7.738  21.151  47.188 1.00 52.60  ? 482 GLU B OE1   1 
ATOM   6467 O  OE2   . GLU B 1 456 ? -6.436  21.728  48.864 1.00 62.97  ? 482 GLU B OE2   1 
ATOM   6468 N  N     . GLU B 1 457 ? -6.591  16.652  45.553 1.00 49.12  ? 483 GLU B N     1 
ATOM   6469 C  CA    . GLU B 1 457 ? -6.775  15.444  44.750 1.00 47.22  ? 483 GLU B CA    1 
ATOM   6470 C  C     . GLU B 1 457 ? -5.438  14.767  44.427 1.00 45.94  ? 483 GLU B C     1 
ATOM   6471 O  O     . GLU B 1 457 ? -5.222  13.565  44.700 1.00 48.54  ? 483 GLU B O     1 
ATOM   6472 C  CB    . GLU B 1 457 ? -7.501  15.793  43.456 1.00 43.95  ? 483 GLU B CB    1 
ATOM   6473 C  CG    . GLU B 1 457 ? -8.818  16.520  43.640 1.00 44.96  ? 483 GLU B CG    1 
ATOM   6474 C  CD    . GLU B 1 457 ? -9.078  17.528  42.529 1.00 54.32  ? 483 GLU B CD    1 
ATOM   6475 O  OE1   . GLU B 1 457 ? -8.154  17.776  41.722 1.00 55.83  ? 483 GLU B OE1   1 
ATOM   6476 O  OE2   . GLU B 1 457 ? -10.196 18.085  42.469 1.00 58.63  ? 483 GLU B OE2   1 
ATOM   6477 N  N     . ILE B 1 458 ? -4.550  15.560  43.832 1.00 38.00  ? 484 ILE B N     1 
ATOM   6478 C  CA    . ILE B 1 458 ? -3.213  15.108  43.483 1.00 37.63  ? 484 ILE B CA    1 
ATOM   6479 C  C     . ILE B 1 458 ? -2.540  14.511  44.708 1.00 38.98  ? 484 ILE B C     1 
ATOM   6480 O  O     . ILE B 1 458 ? -1.978  13.412  44.639 1.00 37.45  ? 484 ILE B O     1 
ATOM   6481 C  CB    . ILE B 1 458 ? -2.354  16.258  42.913 1.00 38.09  ? 484 ILE B CB    1 
ATOM   6482 C  CG1   . ILE B 1 458 ? -3.085  16.947  41.761 1.00 36.00  ? 484 ILE B CG1   1 
ATOM   6483 C  CG2   . ILE B 1 458 ? -0.999  15.747  42.442 1.00 34.64  ? 484 ILE B CG2   1 
ATOM   6484 C  CD1   . ILE B 1 458 ? -2.332  18.115  41.181 1.00 38.48  ? 484 ILE B CD1   1 
ATOM   6485 N  N     . PHE B 1 459 ? -2.624  15.215  45.837 1.00 43.31  ? 485 PHE B N     1 
ATOM   6486 C  CA    . PHE B 1 459 ? -2.060  14.684  47.071 1.00 39.25  ? 485 PHE B CA    1 
ATOM   6487 C  C     . PHE B 1 459 ? -2.808  13.447  47.521 1.00 37.08  ? 485 PHE B C     1 
ATOM   6488 O  O     . PHE B 1 459 ? -2.206  12.553  48.063 1.00 37.56  ? 485 PHE B O     1 
ATOM   6489 C  CB    . PHE B 1 459 ? -2.057  15.709  48.199 1.00 41.24  ? 485 PHE B CB    1 
ATOM   6490 C  CG    . PHE B 1 459 ? -1.344  15.231  49.433 1.00 42.49  ? 485 PHE B CG    1 
ATOM   6491 C  CD1   . PHE B 1 459 ? -0.021  14.825  49.370 1.00 44.88  ? 485 PHE B CD1   1 
ATOM   6492 C  CD2   . PHE B 1 459 ? -1.997  15.166  50.652 1.00 42.77  ? 485 PHE B CD2   1 
ATOM   6493 C  CE1   . PHE B 1 459 ? 0.639   14.373  50.506 1.00 41.80  ? 485 PHE B CE1   1 
ATOM   6494 C  CE2   . PHE B 1 459 ? -1.345  14.710  51.784 1.00 44.06  ? 485 PHE B CE2   1 
ATOM   6495 C  CZ    . PHE B 1 459 ? -0.025  14.314  51.710 1.00 40.71  ? 485 PHE B CZ    1 
ATOM   6496 N  N     . ALA B 1 460 ? -4.118  13.401  47.308 1.00 40.85  ? 486 ALA B N     1 
ATOM   6497 C  CA    . ALA B 1 460 ? -4.901  12.223  47.677 1.00 44.21  ? 486 ALA B CA    1 
ATOM   6498 C  C     . ALA B 1 460 ? -4.302  10.976  47.039 1.00 42.32  ? 486 ALA B C     1 
ATOM   6499 O  O     . ALA B 1 460 ? -4.107  9.959   47.704 1.00 43.01  ? 486 ALA B O     1 
ATOM   6500 C  CB    . ALA B 1 460 ? -6.360  12.383  47.268 1.00 40.39  ? 486 ALA B CB    1 
ATOM   6501 N  N     . ILE B 1 461 ? -4.014  11.061  45.744 1.00 38.98  ? 487 ILE B N     1 
ATOM   6502 C  CA    . ILE B 1 461 ? -3.412  9.930   45.029 1.00 38.38  ? 487 ILE B CA    1 
ATOM   6503 C  C     . ILE B 1 461 ? -1.940  9.651   45.414 1.00 39.03  ? 487 ILE B C     1 
ATOM   6504 O  O     . ILE B 1 461 ? -1.544  8.513   45.788 1.00 40.34  ? 487 ILE B O     1 
ATOM   6505 C  CB    . ILE B 1 461 ? -3.489  10.175  43.512 1.00 38.06  ? 487 ILE B CB    1 
ATOM   6506 C  CG1   . ILE B 1 461 ? -4.900  10.621  43.124 1.00 37.24  ? 487 ILE B CG1   1 
ATOM   6507 C  CG2   . ILE B 1 461 ? -3.054  8.943   42.751 1.00 41.85  ? 487 ILE B CG2   1 
ATOM   6508 C  CD1   . ILE B 1 461 ? -5.047  11.005  41.678 1.00 41.80  ? 487 ILE B CD1   1 
ATOM   6509 N  N     . ALA B 1 462 ? -1.131  10.704  45.310 1.00 36.46  ? 488 ALA B N     1 
ATOM   6510 C  CA    . ALA B 1 462 ? 0.308   10.607  45.536 1.00 34.86  ? 488 ALA B CA    1 
ATOM   6511 C  C     . ALA B 1 462 ? 0.612   10.074  46.933 1.00 40.02  ? 488 ALA B C     1 
ATOM   6512 O  O     . ALA B 1 462 ? 1.554   9.304   47.136 1.00 36.62  ? 488 ALA B O     1 
ATOM   6513 C  CB    . ALA B 1 462 ? 0.958   11.948  45.329 1.00 30.05  ? 488 ALA B CB    1 
ATOM   6514 N  N     . LYS B 1 463 ? -0.203  10.508  47.887 1.00 43.22  ? 489 LYS B N     1 
ATOM   6515 C  CA    . LYS B 1 463 ? -0.161  10.062  49.278 1.00 42.31  ? 489 LYS B CA    1 
ATOM   6516 C  C     . LYS B 1 463 ? -0.183  8.551   49.409 1.00 42.65  ? 489 LYS B C     1 
ATOM   6517 O  O     . LYS B 1 463 ? 0.588   7.971   50.169 1.00 43.45  ? 489 LYS B O     1 
ATOM   6518 C  CB    . LYS B 1 463 ? -1.354  10.653  50.028 1.00 42.15  ? 489 LYS B CB    1 
ATOM   6519 C  CG    . LYS B 1 463 ? -1.498  10.327  51.490 1.00 53.17  ? 489 LYS B CG    1 
ATOM   6520 C  CD    . LYS B 1 463 ? -2.965  10.464  51.857 1.00 62.78  ? 489 LYS B CD    1 
ATOM   6521 C  CE    . LYS B 1 463 ? -3.183  11.211  53.155 1.00 66.45  ? 489 LYS B CE    1 
ATOM   6522 N  NZ    . LYS B 1 463 ? -4.615  11.619  53.289 1.00 66.61  ? 489 LYS B NZ    1 
ATOM   6523 N  N     . GLU B 1 464 ? -1.072  7.912   48.662 1.00 35.72  ? 490 GLU B N     1 
ATOM   6524 C  CA    . GLU B 1 464 ? -1.219  6.476   48.789 1.00 39.94  ? 490 GLU B CA    1 
ATOM   6525 C  C     . GLU B 1 464 ? -0.184  5.739   47.939 1.00 40.60  ? 490 GLU B C     1 
ATOM   6526 O  O     . GLU B 1 464 ? 0.216   4.620   48.288 1.00 36.18  ? 490 GLU B O     1 
ATOM   6527 C  CB    . GLU B 1 464 ? -2.642  6.041   48.419 1.00 38.74  ? 490 GLU B CB    1 
ATOM   6528 C  CG    . GLU B 1 464 ? -2.920  5.934   46.933 1.00 47.84  ? 490 GLU B CG    1 
ATOM   6529 N  N     . LEU B 1 465 ? 0.270   6.354   46.845 1.00 34.52  ? 491 LEU B N     1 
ATOM   6530 C  CA    . LEU B 1 465 ? 1.419   5.771   46.136 1.00 29.95  ? 491 LEU B CA    1 
ATOM   6531 C  C     . LEU B 1 465 ? 2.676   5.707   47.022 1.00 33.14  ? 491 LEU B C     1 
ATOM   6532 O  O     . LEU B 1 465 ? 3.360   4.662   47.146 1.00 36.73  ? 491 LEU B O     1 
ATOM   6533 C  CB    . LEU B 1 465 ? 1.702   6.569   44.866 1.00 32.78  ? 491 LEU B CB    1 
ATOM   6534 C  CG    . LEU B 1 465 ? 0.625   6.412   43.787 1.00 34.21  ? 491 LEU B CG    1 
ATOM   6535 C  CD1   . LEU B 1 465 ? 0.621   7.583   42.825 1.00 33.23  ? 491 LEU B CD1   1 
ATOM   6536 C  CD2   . LEU B 1 465 ? 0.832   5.109   43.034 1.00 31.72  ? 491 LEU B CD2   1 
ATOM   6537 N  N     . LEU B 1 466 ? 2.941   6.828   47.680 1.00 36.67  ? 492 LEU B N     1 
ATOM   6538 C  CA    . LEU B 1 466 ? 4.079   6.952   48.571 1.00 34.21  ? 492 LEU B CA    1 
ATOM   6539 C  C     . LEU B 1 466 ? 3.912   6.016   49.749 1.00 33.88  ? 492 LEU B C     1 
ATOM   6540 O  O     . LEU B 1 466 ? 4.855   5.342   50.149 1.00 33.51  ? 492 LEU B O     1 
ATOM   6541 C  CB    . LEU B 1 466 ? 4.229   8.387   49.052 1.00 33.97  ? 492 LEU B CB    1 
ATOM   6542 C  CG    . LEU B 1 466 ? 5.414   8.634   49.978 1.00 36.89  ? 492 LEU B CG    1 
ATOM   6543 C  CD1   . LEU B 1 466 ? 6.687   8.057   49.376 1.00 32.07  ? 492 LEU B CD1   1 
ATOM   6544 C  CD2   . LEU B 1 466 ? 5.566   10.122  50.264 1.00 35.67  ? 492 LEU B CD2   1 
ATOM   6545 N  N     . LYS B 1 467 ? 2.706   5.999   50.306 1.00 36.21  ? 493 LYS B N     1 
ATOM   6546 C  CA    . LYS B 1 467 ? 2.335   5.052   51.355 1.00 41.73  ? 493 LYS B CA    1 
ATOM   6547 C  C     . LYS B 1 467 ? 2.732   3.631   50.965 1.00 41.96  ? 493 LYS B C     1 
ATOM   6548 O  O     . LYS B 1 467 ? 3.407   2.914   51.722 1.00 36.89  ? 493 LYS B O     1 
ATOM   6549 C  CB    . LYS B 1 467 ? 0.831   5.119   51.618 1.00 43.96  ? 493 LYS B CB    1 
ATOM   6550 C  CG    . LYS B 1 467 ? 0.342   4.163   52.685 1.00 43.84  ? 493 LYS B CG    1 
ATOM   6551 C  CD    . LYS B 1 467 ? 0.295   4.834   54.043 1.00 56.60  ? 493 LYS B CD    1 
ATOM   6552 C  CE    . LYS B 1 467 ? 0.372   3.814   55.165 1.00 68.34  ? 493 LYS B CE    1 
ATOM   6553 N  NZ    . LYS B 1 467 ? -0.506  2.636   54.899 1.00 72.13  ? 493 LYS B NZ    1 
ATOM   6554 N  N     . THR B 1 468 ? 2.311   3.240   49.766 1.00 39.46  ? 494 THR B N     1 
ATOM   6555 C  CA    . THR B 1 468 ? 2.664   1.941   49.220 1.00 38.33  ? 494 THR B CA    1 
ATOM   6556 C  C     . THR B 1 468 ? 4.169   1.724   49.189 1.00 39.25  ? 494 THR B C     1 
ATOM   6557 O  O     . THR B 1 468 ? 4.632   0.639   49.527 1.00 45.30  ? 494 THR B O     1 
ATOM   6558 C  CB    . THR B 1 468 ? 2.101   1.754   47.801 1.00 39.90  ? 494 THR B CB    1 
ATOM   6559 O  OG1   . THR B 1 468 ? 0.680   1.937   47.820 1.00 42.78  ? 494 THR B OG1   1 
ATOM   6560 C  CG2   . THR B 1 468 ? 2.412   0.366   47.282 1.00 32.53  ? 494 THR B CG2   1 
ATOM   6561 N  N     . GLU B 1 469 ? 4.948   2.735   48.815 1.00 42.03  ? 495 GLU B N     1 
ATOM   6562 C  CA    . GLU B 1 469 ? 6.399   2.490   48.804 1.00 43.00  ? 495 GLU B CA    1 
ATOM   6563 C  C     . GLU B 1 469 ? 7.023   2.342   50.204 1.00 44.76  ? 495 GLU B C     1 
ATOM   6564 O  O     . GLU B 1 469 ? 7.867   1.445   50.462 1.00 48.72  ? 495 GLU B O     1 
ATOM   6565 C  CB    . GLU B 1 469 ? 7.106   3.609   48.051 1.00 36.73  ? 495 GLU B CB    1 
ATOM   6566 C  CG    . GLU B 1 469 ? 6.711   3.674   46.588 1.00 38.26  ? 495 GLU B CG    1 
ATOM   6567 C  CD    . GLU B 1 469 ? 6.811   2.322   45.902 1.00 44.11  ? 495 GLU B CD    1 
ATOM   6568 O  OE1   . GLU B 1 469 ? 5.782   1.859   45.365 1.00 41.76  ? 495 GLU B OE1   1 
ATOM   6569 O  OE2   . GLU B 1 469 ? 7.912   1.728   45.888 1.00 45.04  ? 495 GLU B OE2   1 
ATOM   6570 N  N     . ILE B 1 470 ? 6.576   3.213   51.104 1.00 45.34  ? 496 ILE B N     1 
ATOM   6571 C  CA    . ILE B 1 470 ? 7.055   3.242   52.480 1.00 48.37  ? 496 ILE B CA    1 
ATOM   6572 C  C     . ILE B 1 470 ? 6.787   1.911   53.154 1.00 48.16  ? 496 ILE B C     1 
ATOM   6573 O  O     . ILE B 1 470 ? 7.673   1.350   53.804 1.00 51.13  ? 496 ILE B O     1 
ATOM   6574 C  CB    . ILE B 1 470 ? 6.400   4.376   53.297 1.00 47.18  ? 496 ILE B CB    1 
ATOM   6575 C  CG1   . ILE B 1 470 ? 6.767   5.734   52.692 1.00 42.36  ? 496 ILE B CG1   1 
ATOM   6576 C  CG2   . ILE B 1 470 ? 6.816   4.282   54.764 1.00 43.22  ? 496 ILE B CG2   1 
ATOM   6577 C  CD1   . ILE B 1 470 ? 6.981   6.841   53.703 1.00 44.66  ? 496 ILE B CD1   1 
ATOM   6578 N  N     . ASP B 1 471 ? 5.560   1.419   53.005 1.00 46.15  ? 497 ASP B N     1 
ATOM   6579 C  CA    . ASP B 1 471 ? 5.197   0.112   53.544 1.00 51.70  ? 497 ASP B CA    1 
ATOM   6580 C  C     . ASP B 1 471 ? 6.016   -0.977  52.855 1.00 47.65  ? 497 ASP B C     1 
ATOM   6581 O  O     . ASP B 1 471 ? 6.588   -1.839  53.515 1.00 50.44  ? 497 ASP B O     1 
ATOM   6582 C  CB    . ASP B 1 471 ? 3.695   -0.155  53.388 1.00 50.03  ? 497 ASP B CB    1 
ATOM   6583 C  CG    . ASP B 1 471 ? 2.837   0.796   54.215 1.00 59.82  ? 497 ASP B CG    1 
ATOM   6584 O  OD1   . ASP B 1 471 ? 3.382   1.491   55.105 1.00 58.00  ? 497 ASP B OD1   1 
ATOM   6585 O  OD2   . ASP B 1 471 ? 1.609   0.834   53.981 1.00 59.49  ? 497 ASP B OD2   1 
ATOM   6586 N  N     . ALA B 1 472 ? 6.054   -0.940  51.525 1.00 49.82  ? 498 ALA B N     1 
ATOM   6587 C  CA    . ALA B 1 472 ? 6.861   -1.877  50.745 1.00 48.98  ? 498 ALA B CA    1 
ATOM   6588 C  C     . ALA B 1 472 ? 8.284   -2.055  51.273 1.00 52.77  ? 498 ALA B C     1 
ATOM   6589 O  O     . ALA B 1 472 ? 8.853   -3.135  51.143 1.00 57.03  ? 498 ALA B O     1 
ATOM   6590 C  CB    . ALA B 1 472 ? 6.913   -1.434  49.299 1.00 48.30  ? 498 ALA B CB    1 
ATOM   6591 N  N     . ASP B 1 473 ? 8.872   -1.018  51.863 1.00 55.33  ? 499 ASP B N     1 
ATOM   6592 C  CA    . ASP B 1 473 ? 10.225  -1.206  52.412 1.00 55.46  ? 499 ASP B CA    1 
ATOM   6593 C  C     . ASP B 1 473 ? 10.285  -1.543  53.907 1.00 61.65  ? 499 ASP B C     1 
ATOM   6594 O  O     . ASP B 1 473 ? 11.342  -1.937  54.405 1.00 62.53  ? 499 ASP B O     1 
ATOM   6595 C  CB    . ASP B 1 473 ? 11.082  0.029   52.146 1.00 63.97  ? 499 ASP B CB    1 
ATOM   6596 C  CG    . ASP B 1 473 ? 11.842  -0.060  50.830 1.00 77.27  ? 499 ASP B CG    1 
ATOM   6597 O  OD1   . ASP B 1 473 ? 11.191  -0.198  49.766 1.00 73.00  ? 499 ASP B OD1   1 
ATOM   6598 O  OD2   . ASP B 1 473 ? 13.095  -0.007  50.861 1.00 76.62  ? 499 ASP B OD2   1 
ATOM   6599 N  N     . PHE B 1 474 ? 9.161   -1.369  54.605 1.00 63.39  ? 500 PHE B N     1 
ATOM   6600 C  CA    . PHE B 1 474 ? 9.035   -1.621  56.049 1.00 58.63  ? 500 PHE B CA    1 
ATOM   6601 C  C     . PHE B 1 474 ? 9.782   -2.873  56.526 1.00 64.61  ? 500 PHE B C     1 
ATOM   6602 O  O     . PHE B 1 474 ? 9.746   -3.916  55.867 1.00 63.28  ? 500 PHE B O     1 
ATOM   6603 C  CB    . PHE B 1 474 ? 7.552   -1.734  56.416 1.00 60.56  ? 500 PHE B CB    1 
ATOM   6604 C  CG    . PHE B 1 474 ? 7.237   -1.353  57.835 1.00 73.89  ? 500 PHE B CG    1 
ATOM   6605 C  CD1   . PHE B 1 474 ? 6.795   -2.306  58.738 1.00 71.79  ? 500 PHE B CD1   1 
ATOM   6606 C  CD2   . PHE B 1 474 ? 7.377   -0.039  58.265 1.00 78.56  ? 500 PHE B CD2   1 
ATOM   6607 C  CE1   . PHE B 1 474 ? 6.499   -1.963  60.040 1.00 72.83  ? 500 PHE B CE1   1 
ATOM   6608 C  CE2   . PHE B 1 474 ? 7.086   0.313   59.570 1.00 78.73  ? 500 PHE B CE2   1 
ATOM   6609 C  CZ    . PHE B 1 474 ? 6.645   -0.652  60.459 1.00 82.89  ? 500 PHE B CZ    1 
ATOM   6610 N  N     . PRO B 1 475 ? 10.466  -2.775  57.678 1.00 62.16  ? 501 PRO B N     1 
ATOM   6611 C  CA    . PRO B 1 475 ? 10.459  -1.645  58.613 1.00 71.33  ? 501 PRO B CA    1 
ATOM   6612 C  C     . PRO B 1 475 ? 11.510  -0.589  58.286 1.00 66.07  ? 501 PRO B C     1 
ATOM   6613 O  O     . PRO B 1 475 ? 11.860  0.226   59.143 1.00 56.27  ? 501 PRO B O     1 
ATOM   6614 C  CB    . PRO B 1 475 ? 10.781  -2.317  59.943 1.00 70.56  ? 501 PRO B CB    1 
ATOM   6615 C  CG    . PRO B 1 475 ? 11.776  -3.371  59.537 1.00 69.34  ? 501 PRO B CG    1 
ATOM   6616 C  CD    . PRO B 1 475 ? 11.340  -3.858  58.162 1.00 59.67  ? 501 PRO B CD    1 
ATOM   6617 N  N     . HIS B 1 476 ? 12.007  -0.612  57.055 1.00 61.01  ? 502 HIS B N     1 
ATOM   6618 C  CA    . HIS B 1 476 ? 13.077  0.287   56.659 1.00 59.59  ? 502 HIS B CA    1 
ATOM   6619 C  C     . HIS B 1 476 ? 12.543  1.631   56.177 1.00 56.62  ? 502 HIS B C     1 
ATOM   6620 O  O     . HIS B 1 476 ? 11.494  1.702   55.529 1.00 49.70  ? 502 HIS B O     1 
ATOM   6621 C  CB    . HIS B 1 476 ? 13.926  -0.369  55.574 1.00 61.65  ? 502 HIS B CB    1 
ATOM   6622 C  CG    . HIS B 1 476 ? 14.674  -1.577  56.046 1.00 71.94  ? 502 HIS B CG    1 
ATOM   6623 N  ND1   . HIS B 1 476 ? 14.669  -1.986  57.363 1.00 71.99  ? 502 HIS B ND1   1 
ATOM   6624 C  CD2   . HIS B 1 476 ? 15.444  -2.468  55.379 1.00 80.42  ? 502 HIS B CD2   1 
ATOM   6625 C  CE1   . HIS B 1 476 ? 15.409  -3.074  57.488 1.00 63.83  ? 502 HIS B CE1   1 
ATOM   6626 N  NE2   . HIS B 1 476 ? 15.891  -3.387  56.298 1.00 74.12  ? 502 HIS B NE2   1 
ATOM   6627 N  N     . PRO B 1 477 ? 13.274  2.708   56.491 1.00 52.77  ? 503 PRO B N     1 
ATOM   6628 C  CA    . PRO B 1 477 ? 12.941  4.040   55.982 1.00 53.39  ? 503 PRO B CA    1 
ATOM   6629 C  C     . PRO B 1 477 ? 13.451  4.249   54.559 1.00 43.65  ? 503 PRO B C     1 
ATOM   6630 O  O     . PRO B 1 477 ? 14.528  3.764   54.212 1.00 43.74  ? 503 PRO B O     1 
ATOM   6631 C  CB    . PRO B 1 477 ? 13.654  4.973   56.965 1.00 43.85  ? 503 PRO B CB    1 
ATOM   6632 C  CG    . PRO B 1 477 ? 14.855  4.194   57.387 1.00 47.88  ? 503 PRO B CG    1 
ATOM   6633 C  CD    . PRO B 1 477 ? 14.419  2.744   57.419 1.00 51.55  ? 503 PRO B CD    1 
ATOM   6634 N  N     . LEU B 1 478 ? 12.680  4.956   53.743 1.00 36.65  ? 504 LEU B N     1 
ATOM   6635 C  CA    . LEU B 1 478 ? 13.171  5.379   52.444 1.00 36.46  ? 504 LEU B CA    1 
ATOM   6636 C  C     . LEU B 1 478 ? 14.222  6.454   52.666 1.00 31.27  ? 504 LEU B C     1 
ATOM   6637 O  O     . LEU B 1 478 ? 13.978  7.428   53.377 1.00 31.40  ? 504 LEU B O     1 
ATOM   6638 C  CB    . LEU B 1 478 ? 12.034  5.918   51.576 1.00 36.81  ? 504 LEU B CB    1 
ATOM   6639 C  CG    . LEU B 1 478 ? 10.962  4.920   51.148 1.00 38.21  ? 504 LEU B CG    1 
ATOM   6640 C  CD1   . LEU B 1 478 ? 9.788   5.665   50.541 1.00 39.57  ? 504 LEU B CD1   1 
ATOM   6641 C  CD2   . LEU B 1 478 ? 11.528  3.911   50.173 1.00 44.16  ? 504 LEU B CD2   1 
ATOM   6642 N  N     . ARG B 1 479 ? 15.385  6.284   52.057 1.00 23.25  ? 505 ARG B N     1 
ATOM   6643 C  CA    . ARG B 1 479 ? 16.418  7.297   52.141 1.00 27.98  ? 505 ARG B CA    1 
ATOM   6644 C  C     . ARG B 1 479 ? 16.457  8.074   50.833 1.00 33.52  ? 505 ARG B C     1 
ATOM   6645 O  O     . ARG B 1 479 ? 17.174  7.707   49.906 1.00 32.23  ? 505 ARG B O     1 
ATOM   6646 C  CB    . ARG B 1 479 ? 17.774  6.668   52.443 1.00 30.40  ? 505 ARG B CB    1 
ATOM   6647 C  CG    . ARG B 1 479 ? 17.845  5.953   53.784 1.00 28.59  ? 505 ARG B CG    1 
ATOM   6648 C  CD    . ARG B 1 479 ? 19.206  5.303   53.982 1.00 27.66  ? 505 ARG B CD    1 
ATOM   6649 N  NE    . ARG B 1 479 ? 20.238  6.298   54.255 1.00 34.46  ? 505 ARG B NE    1 
ATOM   6650 C  CZ    . ARG B 1 479 ? 21.540  6.120   54.050 1.00 34.86  ? 505 ARG B CZ    1 
ATOM   6651 N  NH1   . ARG B 1 479 ? 22.000  4.976   53.564 1.00 35.52  ? 505 ARG B NH1   1 
ATOM   6652 N  NH2   . ARG B 1 479 ? 22.389  7.097   54.328 1.00 37.68  ? 505 ARG B NH2   1 
ATOM   6653 N  N     . LEU B 1 480 ? 15.672  9.144   50.760 1.00 29.04  ? 506 LEU B N     1 
ATOM   6654 C  CA    . LEU B 1 480 ? 15.477  9.859   49.509 1.00 26.83  ? 506 LEU B CA    1 
ATOM   6655 C  C     . LEU B 1 480 ? 16.445  11.028  49.337 1.00 26.46  ? 506 LEU B C     1 
ATOM   6656 O  O     . LEU B 1 480 ? 16.838  11.671  50.305 1.00 26.12  ? 506 LEU B O     1 
ATOM   6657 C  CB    . LEU B 1 480 ? 14.037  10.362  49.417 1.00 23.25  ? 506 LEU B CB    1 
ATOM   6658 C  CG    . LEU B 1 480 ? 12.936  9.314   49.507 1.00 24.20  ? 506 LEU B CG    1 
ATOM   6659 C  CD1   . LEU B 1 480 ? 11.604  9.913   49.093 1.00 22.39  ? 506 LEU B CD1   1 
ATOM   6660 C  CD2   . LEU B 1 480 ? 13.285  8.116   48.643 1.00 30.17  ? 506 LEU B CD2   1 
ATOM   6661 N  N     . ARG B 1 481 ? 16.809  11.298  48.088 1.00 27.80  ? 507 ARG B N     1 
ATOM   6662 C  CA    . ARG B 1 481 ? 17.627  12.447  47.745 1.00 26.62  ? 507 ARG B CA    1 
ATOM   6663 C  C     . ARG B 1 481 ? 16.865  13.313  46.751 1.00 27.02  ? 507 ARG B C     1 
ATOM   6664 O  O     . ARG B 1 481 ? 17.231  14.457  46.492 1.00 27.58  ? 507 ARG B O     1 
ATOM   6665 C  CB    . ARG B 1 481 ? 18.963  12.008  47.157 1.00 25.40  ? 507 ARG B CB    1 
ATOM   6666 C  CG    . ARG B 1 481 ? 18.903  11.746  45.675 1.00 29.23  ? 507 ARG B CG    1 
ATOM   6667 C  CD    . ARG B 1 481 ? 20.277  11.443  45.135 1.00 35.39  ? 507 ARG B CD    1 
ATOM   6668 N  NE    . ARG B 1 481 ? 21.288  12.292  45.750 1.00 36.93  ? 507 ARG B NE    1 
ATOM   6669 C  CZ    . ARG B 1 481 ? 21.706  13.443  45.240 1.00 38.09  ? 507 ARG B CZ    1 
ATOM   6670 N  NH1   . ARG B 1 481 ? 21.204  13.894  44.099 1.00 33.35  ? 507 ARG B NH1   1 
ATOM   6671 N  NH2   . ARG B 1 481 ? 22.630  14.140  45.876 1.00 43.55  ? 507 ARG B NH2   1 
ATOM   6672 N  N     . LEU B 1 482 ? 15.796  12.757  46.199 1.00 20.74  ? 508 LEU B N     1 
ATOM   6673 C  CA    . LEU B 1 482 ? 14.971  13.494  45.265 1.00 21.76  ? 508 LEU B CA    1 
ATOM   6674 C  C     . LEU B 1 482 ? 13.548  12.994  45.341 1.00 20.11  ? 508 LEU B C     1 
ATOM   6675 O  O     . LEU B 1 482 ? 13.304  11.840  45.664 1.00 23.34  ? 508 LEU B O     1 
ATOM   6676 C  CB    . LEU B 1 482 ? 15.515  13.358  43.839 1.00 28.13  ? 508 LEU B CB    1 
ATOM   6677 C  CG    . LEU B 1 482 ? 14.724  13.915  42.648 1.00 24.15  ? 508 LEU B CG    1 
ATOM   6678 C  CD1   . LEU B 1 482 ? 15.684  14.369  41.573 1.00 25.40  ? 508 LEU B CD1   1 
ATOM   6679 C  CD2   . LEU B 1 482 ? 13.756  12.889  42.085 1.00 19.22  ? 508 LEU B CD2   1 
ATOM   6680 N  N     . MET B 1 483 ? 12.602  13.871  45.043 1.00 24.67  ? 509 MET B N     1 
ATOM   6681 C  CA    . MET B 1 483 ? 11.209  13.459  44.994 1.00 21.10  ? 509 MET B CA    1 
ATOM   6682 C  C     . MET B 1 483 ? 10.489  14.293  43.936 1.00 26.90  ? 509 MET B C     1 
ATOM   6683 O  O     . MET B 1 483 ? 10.841  15.450  43.703 1.00 22.54  ? 509 MET B O     1 
ATOM   6684 C  CB    . MET B 1 483 ? 10.561  13.607  46.367 1.00 25.33  ? 509 MET B CB    1 
ATOM   6685 C  CG    . MET B 1 483 ? 9.066   13.389  46.399 1.00 28.46  ? 509 MET B CG    1 
ATOM   6686 S  SD    . MET B 1 483 ? 8.541   13.003  48.077 1.00 37.24  ? 509 MET B SD    1 
ATOM   6687 C  CE    . MET B 1 483 ? 6.918   12.347  47.739 1.00 43.62  ? 509 MET B CE    1 
ATOM   6688 N  N     . GLY B 1 484 ? 9.527   13.692  43.250 1.00 26.70  ? 510 GLY B N     1 
ATOM   6689 C  CA    . GLY B 1 484 ? 8.813   14.393  42.206 1.00 18.30  ? 510 GLY B CA    1 
ATOM   6690 C  C     . GLY B 1 484 ? 7.364   13.978  42.154 1.00 21.31  ? 510 GLY B C     1 
ATOM   6691 O  O     . GLY B 1 484 ? 7.007   12.893  42.589 1.00 28.57  ? 510 GLY B O     1 
ATOM   6692 N  N     . VAL B 1 485 ? 6.523   14.851  41.625 1.00 23.12  ? 511 VAL B N     1 
ATOM   6693 C  CA    . VAL B 1 485 ? 5.147   14.497  41.341 1.00 25.14  ? 511 VAL B CA    1 
ATOM   6694 C  C     . VAL B 1 485 ? 4.856   14.979  39.932 1.00 28.65  ? 511 VAL B C     1 
ATOM   6695 O  O     . VAL B 1 485 ? 5.324   16.037  39.511 1.00 24.36  ? 511 VAL B O     1 
ATOM   6696 C  CB    . VAL B 1 485 ? 4.159   15.105  42.348 1.00 26.04  ? 511 VAL B CB    1 
ATOM   6697 C  CG1   . VAL B 1 485 ? 2.724   14.856  41.916 1.00 28.69  ? 511 VAL B CG1   1 
ATOM   6698 C  CG2   . VAL B 1 485 ? 4.393   14.525  43.726 1.00 30.01  ? 511 VAL B CG2   1 
ATOM   6699 N  N     . ARG B 1 486 ? 4.115   14.158  39.201 1.00 33.51  ? 512 ARG B N     1 
ATOM   6700 C  CA    . ARG B 1 486 ? 3.875   14.352  37.790 1.00 28.35  ? 512 ARG B CA    1 
ATOM   6701 C  C     . ARG B 1 486 ? 2.434   13.993  37.480 1.00 31.07  ? 512 ARG B C     1 
ATOM   6702 O  O     . ARG B 1 486 ? 1.908   13.024  38.020 1.00 31.92  ? 512 ARG B O     1 
ATOM   6703 C  CB    . ARG B 1 486 ? 4.837   13.488  36.983 1.00 32.77  ? 512 ARG B CB    1 
ATOM   6704 C  CG    . ARG B 1 486 ? 4.589   13.458  35.494 1.00 36.88  ? 512 ARG B CG    1 
ATOM   6705 C  CD    . ARG B 1 486 ? 5.846   12.998  34.794 1.00 34.30  ? 512 ARG B CD    1 
ATOM   6706 N  NE    . ARG B 1 486 ? 5.550   12.188  33.620 1.00 49.84  ? 512 ARG B NE    1 
ATOM   6707 C  CZ    . ARG B 1 486 ? 6.152   12.332  32.445 1.00 61.10  ? 512 ARG B CZ    1 
ATOM   6708 N  NH1   . ARG B 1 486 ? 7.099   13.252  32.286 1.00 59.91  ? 512 ARG B NH1   1 
ATOM   6709 N  NH2   . ARG B 1 486 ? 5.819   11.543  31.431 1.00 50.82  ? 512 ARG B NH2   1 
ATOM   6710 N  N     . ILE B 1 487 ? 1.801   14.766  36.609 1.00 33.07  ? 513 ILE B N     1 
ATOM   6711 C  CA    . ILE B 1 487 ? 0.431   14.501  36.220 1.00 33.82  ? 513 ILE B CA    1 
ATOM   6712 C  C     . ILE B 1 487 ? 0.320   14.515  34.699 1.00 39.51  ? 513 ILE B C     1 
ATOM   6713 O  O     . ILE B 1 487 ? 1.027   15.271  34.018 1.00 38.27  ? 513 ILE B O     1 
ATOM   6714 C  CB    . ILE B 1 487 ? -0.538  15.524  36.840 1.00 35.30  ? 513 ILE B CB    1 
ATOM   6715 C  CG1   . ILE B 1 487 ? -1.988  15.096  36.614 1.00 40.19  ? 513 ILE B CG1   1 
ATOM   6716 C  CG2   . ILE B 1 487 ? -0.296  16.911  36.270 1.00 39.93  ? 513 ILE B CG2   1 
ATOM   6717 C  CD1   . ILE B 1 487 ? -2.998  16.160  36.977 1.00 43.34  ? 513 ILE B CD1   1 
ATOM   6718 N  N     . SER B 1 488 ? -0.559  13.660  34.176 1.00 43.53  ? 514 SER B N     1 
ATOM   6719 C  CA    . SER B 1 488 ? -0.735  13.493  32.739 1.00 43.42  ? 514 SER B CA    1 
ATOM   6720 C  C     . SER B 1 488 ? -2.147  13.014  32.386 1.00 46.66  ? 514 SER B C     1 
ATOM   6721 O  O     . SER B 1 488 ? -3.048  13.068  33.224 1.00 49.22  ? 514 SER B O     1 
ATOM   6722 C  CB    . SER B 1 488 ? 0.307   12.513  32.200 1.00 42.88  ? 514 SER B CB    1 
ATOM   6723 O  OG    . SER B 1 488 ? 0.624   11.525  33.165 1.00 44.19  ? 514 SER B OG    1 
ATOM   6724 N  N     . SER B 1 489 ? -2.319  12.555  31.145 1.00 46.75  ? 515 SER B N     1 
ATOM   6725 C  CA    . SER B 1 489 ? -3.601  12.078  30.616 1.00 47.49  ? 515 SER B CA    1 
ATOM   6726 C  C     . SER B 1 489 ? -4.646  13.189  30.524 1.00 54.71  ? 515 SER B C     1 
ATOM   6727 O  O     . SER B 1 489 ? -5.755  13.056  31.043 1.00 56.94  ? 515 SER B O     1 
ATOM   6728 C  CB    . SER B 1 489 ? -4.147  10.922  31.455 1.00 44.90  ? 515 SER B CB    1 
ATOM   6729 O  OG    . SER B 1 489 ? -3.246  9.835   31.450 1.00 46.85  ? 515 SER B OG    1 
ATOM   6730 N  N     . PHE B 1 490 ? -4.282  14.284  29.863 1.00 53.75  ? 516 PHE B N     1 
ATOM   6731 C  CA    . PHE B 1 490 ? -5.203  15.389  29.621 1.00 56.79  ? 516 PHE B CA    1 
ATOM   6732 C  C     . PHE B 1 490 ? -6.203  15.041  28.510 1.00 64.22  ? 516 PHE B C     1 
ATOM   6733 O  O     . PHE B 1 490 ? -5.949  14.143  27.712 1.00 63.46  ? 516 PHE B O     1 
ATOM   6734 C  CB    . PHE B 1 490 ? -4.425  16.654  29.244 1.00 62.48  ? 516 PHE B CB    1 
ATOM   6735 C  CG    . PHE B 1 490 ? -3.351  17.033  30.225 1.00 55.87  ? 516 PHE B CG    1 
ATOM   6736 C  CD1   . PHE B 1 490 ? -2.087  16.475  30.143 1.00 57.22  ? 516 PHE B CD1   1 
ATOM   6737 C  CD2   . PHE B 1 490 ? -3.602  17.955  31.222 1.00 65.95  ? 516 PHE B CD2   1 
ATOM   6738 C  CE1   . PHE B 1 490 ? -1.097  16.828  31.040 1.00 53.01  ? 516 PHE B CE1   1 
ATOM   6739 C  CE2   . PHE B 1 490 ? -2.614  18.312  32.120 1.00 65.61  ? 516 PHE B CE2   1 
ATOM   6740 C  CZ    . PHE B 1 490 ? -1.361  17.744  32.028 1.00 54.44  ? 516 PHE B CZ    1 
ATOM   6741 N  N     . PRO B 1 491 ? -7.349  15.750  28.461 1.00 73.97  ? 517 PRO B N     1 
ATOM   6742 C  CA    . PRO B 1 491 ? -8.375  15.558  27.421 1.00 81.18  ? 517 PRO B CA    1 
ATOM   6743 C  C     . PRO B 1 491 ? -7.934  15.886  25.984 1.00 80.37  ? 517 PRO B C     1 
ATOM   6744 O  O     . PRO B 1 491 ? -6.843  16.411  25.757 1.00 80.91  ? 517 PRO B O     1 
ATOM   6745 C  CB    . PRO B 1 491 ? -9.488  16.519  27.855 1.00 78.94  ? 517 PRO B CB    1 
ATOM   6746 C  CG    . PRO B 1 491 ? -9.332  16.629  29.325 1.00 69.36  ? 517 PRO B CG    1 
ATOM   6747 C  CD    . PRO B 1 491 ? -7.848  16.596  29.560 1.00 69.86  ? 517 PRO B CD    1 
ATOM   6748 P  P     . DG  C 2 1   ? -5.071  54.850  49.856 1.00 84.09  ? 5   DG  C P     1 
ATOM   6749 O  OP1   . DG  C 2 1   ? -6.327  55.406  49.296 1.00 61.24  ? 5   DG  C OP1   1 
ATOM   6750 O  OP2   . DG  C 2 1   ? -5.009  54.319  51.239 1.00 58.86  ? 5   DG  C OP2   1 
ATOM   6751 O  "O5'" . DG  C 2 1   ? -3.900  55.927  49.696 1.00 55.85  ? 5   DG  C "O5'" 1 
ATOM   6752 C  "C5'" . DG  C 2 1   ? -4.171  57.152  49.070 1.00 43.70  ? 5   DG  C "C5'" 1 
ATOM   6753 C  "C4'" . DG  C 2 1   ? -2.910  57.847  48.579 1.00 51.88  ? 5   DG  C "C4'" 1 
ATOM   6754 O  "O4'" . DG  C 2 1   ? -2.416  58.775  49.582 1.00 55.09  ? 5   DG  C "O4'" 1 
ATOM   6755 C  "C3'" . DG  C 2 1   ? -1.741  56.932  48.239 1.00 51.37  ? 5   DG  C "C3'" 1 
ATOM   6756 O  "O3'" . DG  C 2 1   ? -1.091  57.476  47.086 1.00 53.59  ? 5   DG  C "O3'" 1 
ATOM   6757 C  "C2'" . DG  C 2 1   ? -0.866  57.010  49.494 1.00 44.66  ? 5   DG  C "C2'" 1 
ATOM   6758 C  "C1'" . DG  C 2 1   ? -1.098  58.441  49.966 1.00 42.16  ? 5   DG  C "C1'" 1 
ATOM   6759 N  N9    . DG  C 2 1   ? -0.995  58.650  51.414 1.00 42.55  ? 5   DG  C N9    1 
ATOM   6760 C  C8    . DG  C 2 1   ? -1.708  58.031  52.413 1.00 40.89  ? 5   DG  C C8    1 
ATOM   6761 N  N7    . DG  C 2 1   ? -1.397  58.425  53.619 1.00 39.94  ? 5   DG  C N7    1 
ATOM   6762 C  C5    . DG  C 2 1   ? -0.401  59.375  53.415 1.00 36.69  ? 5   DG  C C5    1 
ATOM   6763 C  C6    . DG  C 2 1   ? 0.334   60.155  54.347 1.00 34.37  ? 5   DG  C C6    1 
ATOM   6764 O  O6    . DG  C 2 1   ? 0.255   60.166  55.588 1.00 38.35  ? 5   DG  C O6    1 
ATOM   6765 N  N1    . DG  C 2 1   ? 1.250   60.985  53.705 1.00 29.51  ? 5   DG  C N1    1 
ATOM   6766 C  C2    . DG  C 2 1   ? 1.427   61.053  52.342 1.00 33.76  ? 5   DG  C C2    1 
ATOM   6767 N  N2    . DG  C 2 1   ? 2.349   61.915  51.889 1.00 37.66  ? 5   DG  C N2    1 
ATOM   6768 N  N3    . DG  C 2 1   ? 0.746   60.333  51.465 1.00 31.73  ? 5   DG  C N3    1 
ATOM   6769 C  C4    . DG  C 2 1   ? -0.149  59.519  52.066 1.00 35.06  ? 5   DG  C C4    1 
ATOM   6770 P  P     . DC  C 2 2   ? 0.010   56.616  46.292 1.00 55.29  ? 6   DC  C P     1 
ATOM   6771 O  OP1   . DC  C 2 2   ? -0.598  56.328  44.980 1.00 58.79  ? 6   DC  C OP1   1 
ATOM   6772 O  OP2   . DC  C 2 2   ? 0.493   55.504  47.157 1.00 46.91  ? 6   DC  C OP2   1 
ATOM   6773 O  "O5'" . DC  C 2 2   ? 1.217   57.641  46.086 1.00 34.12  ? 6   DC  C "O5'" 1 
ATOM   6774 C  "C5'" . DC  C 2 2   ? 1.355   58.688  47.027 1.00 41.29  ? 6   DC  C "C5'" 1 
ATOM   6775 C  "C4'" . DC  C 2 2   ? 2.795   59.143  47.137 1.00 41.96  ? 6   DC  C "C4'" 1 
ATOM   6776 O  "O4'" . DC  C 2 2   ? 3.063   59.548  48.501 1.00 46.26  ? 6   DC  C "O4'" 1 
ATOM   6777 C  "C3'" . DC  C 2 2   ? 3.829   58.094  46.771 1.00 37.60  ? 6   DC  C "C3'" 1 
ATOM   6778 O  "O3'" . DC  C 2 2   ? 4.944   58.738  46.180 1.00 35.99  ? 6   DC  C "O3'" 1 
ATOM   6779 C  "C2'" . DC  C 2 2   ? 4.174   57.519  48.144 1.00 41.20  ? 6   DC  C "C2'" 1 
ATOM   6780 C  "C1'" . DC  C 2 2   ? 4.068   58.739  49.056 1.00 36.01  ? 6   DC  C "C1'" 1 
ATOM   6781 N  N1    . DC  C 2 2   ? 3.636   58.439  50.437 1.00 34.70  ? 6   DC  C N1    1 
ATOM   6782 C  C2    . DC  C 2 2   ? 4.280   59.075  51.503 1.00 32.70  ? 6   DC  C C2    1 
ATOM   6783 O  O2    . DC  C 2 2   ? 5.186   59.879  51.259 1.00 33.91  ? 6   DC  C O2    1 
ATOM   6784 N  N3    . DC  C 2 2   ? 3.883   58.793  52.770 1.00 30.92  ? 6   DC  C N3    1 
ATOM   6785 C  C4    . DC  C 2 2   ? 2.896   57.916  52.982 1.00 32.78  ? 6   DC  C C4    1 
ATOM   6786 N  N4    . DC  C 2 2   ? 2.530   57.656  54.240 1.00 35.59  ? 6   DC  C N4    1 
ATOM   6787 C  C5    . DC  C 2 2   ? 2.234   57.255  51.907 1.00 32.60  ? 6   DC  C C5    1 
ATOM   6788 C  C6    . DC  C 2 2   ? 2.632   57.545  50.660 1.00 37.80  ? 6   DC  C C6    1 
ATOM   6789 P  P     . DG  C 2 3   ? 6.076   57.880  45.432 1.00 40.16  ? 7   DG  C P     1 
ATOM   6790 O  OP1   . DG  C 2 3   ? 6.371   58.548  44.148 1.00 46.52  ? 7   DG  C OP1   1 
ATOM   6791 O  OP2   . DG  C 2 3   ? 5.641   56.466  45.448 1.00 43.90  ? 7   DG  C OP2   1 
ATOM   6792 O  "O5'" . DG  C 2 3   ? 7.355   58.038  46.368 1.00 36.54  ? 7   DG  C "O5'" 1 
ATOM   6793 C  "C5'" . DG  C 2 3   ? 7.710   59.299  46.864 1.00 37.30  ? 7   DG  C "C5'" 1 
ATOM   6794 C  "C4'" . DG  C 2 3   ? 8.876   59.177  47.828 1.00 41.33  ? 7   DG  C "C4'" 1 
ATOM   6795 O  "O4'" . DG  C 2 3   ? 8.368   59.025  49.183 1.00 36.26  ? 7   DG  C "O4'" 1 
ATOM   6796 C  "C3'" . DG  C 2 3   ? 9.815   58.004  47.563 1.00 48.42  ? 7   DG  C "C3'" 1 
ATOM   6797 O  "O3'" . DG  C 2 3   ? 11.137  58.427  47.860 1.00 49.23  ? 7   DG  C "O3'" 1 
ATOM   6798 C  "C2'" . DG  C 2 3   ? 9.314   56.958  48.566 1.00 37.72  ? 7   DG  C "C2'" 1 
ATOM   6799 C  "C1'" . DG  C 2 3   ? 8.849   57.816  49.737 1.00 36.12  ? 7   DG  C "C1'" 1 
ATOM   6800 N  N9    . DG  C 2 3   ? 7.806   57.205  50.556 1.00 34.89  ? 7   DG  C N9    1 
ATOM   6801 C  C8    . DG  C 2 3   ? 6.791   56.355  50.184 1.00 34.99  ? 7   DG  C C8    1 
ATOM   6802 N  N7    . DG  C 2 3   ? 6.028   55.991  51.185 1.00 31.37  ? 7   DG  C N7    1 
ATOM   6803 C  C5    . DG  C 2 3   ? 6.570   56.647  52.282 1.00 29.02  ? 7   DG  C C5    1 
ATOM   6804 C  C6    . DG  C 2 3   ? 6.176   56.653  53.638 1.00 30.63  ? 7   DG  C C6    1 
ATOM   6805 O  O6    . DG  C 2 3   ? 5.229   56.050  54.158 1.00 34.68  ? 7   DG  C O6    1 
ATOM   6806 N  N1    . DG  C 2 3   ? 7.011   57.460  54.408 1.00 30.94  ? 7   DG  C N1    1 
ATOM   6807 C  C2    . DG  C 2 3   ? 8.088   58.171  53.929 1.00 34.37  ? 7   DG  C C2    1 
ATOM   6808 N  N2    . DG  C 2 3   ? 8.790   58.903  54.802 1.00 33.75  ? 7   DG  C N2    1 
ATOM   6809 N  N3    . DG  C 2 3   ? 8.465   58.175  52.662 1.00 29.54  ? 7   DG  C N3    1 
ATOM   6810 C  C4    . DG  C 2 3   ? 7.661   57.395  51.905 1.00 31.54  ? 7   DG  C C4    1 
ATOM   6811 P  P     . DG  C 2 4   ? 12.385  57.429  47.681 1.00 48.40  ? 8   DG  C P     1 
ATOM   6812 O  OP1   . DG  C 2 4   ? 13.222  58.007  46.611 1.00 49.01  ? 8   DG  C OP1   1 
ATOM   6813 O  OP2   . DG  C 2 4   ? 11.938  56.018  47.590 1.00 42.86  ? 8   DG  C OP2   1 
ATOM   6814 O  "O5'" . DG  C 2 4   ? 13.183  57.587  49.050 1.00 52.27  ? 8   DG  C "O5'" 1 
ATOM   6815 C  "C5'" . DG  C 2 4   ? 13.054  58.774  49.827 1.00 48.45  ? 8   DG  C "C5'" 1 
ATOM   6816 C  "C4'" . DG  C 2 4   ? 13.504  58.559  51.264 1.00 47.89  ? 8   DG  C "C4'" 1 
ATOM   6817 O  "O4'" . DG  C 2 4   ? 12.376  58.115  52.067 1.00 46.36  ? 8   DG  C "O4'" 1 
ATOM   6818 C  "C3'" . DG  C 2 4   ? 14.612  57.522  51.439 1.00 46.61  ? 8   DG  C "C3'" 1 
ATOM   6819 O  "O3'" . DG  C 2 4   ? 15.511  57.936  52.474 1.00 51.60  ? 8   DG  C "O3'" 1 
ATOM   6820 C  "C2'" . DG  C 2 4   ? 13.829  56.264  51.833 1.00 36.44  ? 8   DG  C "C2'" 1 
ATOM   6821 C  "C1'" . DG  C 2 4   ? 12.670  56.853  52.635 1.00 36.32  ? 8   DG  C "C1'" 1 
ATOM   6822 N  N9    . DG  C 2 4   ? 11.464  56.027  52.688 1.00 30.66  ? 8   DG  C N9    1 
ATOM   6823 C  C8    . DG  C 2 4   ? 10.826  55.356  51.672 1.00 32.56  ? 8   DG  C C8    1 
ATOM   6824 N  N7    . DG  C 2 4   ? 9.760   54.705  52.065 1.00 28.56  ? 8   DG  C N7    1 
ATOM   6825 C  C5    . DG  C 2 4   ? 9.687   54.961  53.431 1.00 28.73  ? 8   DG  C C5    1 
ATOM   6826 C  C6    . DG  C 2 4   ? 8.751   54.527  54.405 1.00 28.09  ? 8   DG  C C6    1 
ATOM   6827 O  O6    . DG  C 2 4   ? 7.756   53.804  54.257 1.00 24.67  ? 8   DG  C O6    1 
ATOM   6828 N  N1    . DG  C 2 4   ? 9.055   55.026  55.671 1.00 31.25  ? 8   DG  C N1    1 
ATOM   6829 C  C2    . DG  C 2 4   ? 10.129  55.842  55.959 1.00 33.86  ? 8   DG  C C2    1 
ATOM   6830 N  N2    . DG  C 2 4   ? 10.269  56.225  57.237 1.00 32.41  ? 8   DG  C N2    1 
ATOM   6831 N  N3    . DG  C 2 4   ? 11.012  56.255  55.059 1.00 29.34  ? 8   DG  C N3    1 
ATOM   6832 C  C4    . DG  C 2 4   ? 10.729  55.775  53.823 1.00 30.00  ? 8   DG  C C4    1 
ATOM   6833 P  P     . DA  C 2 5   ? 16.795  57.041  52.841 1.00 56.85  ? 9   DA  C P     1 
ATOM   6834 O  OP1   . DA  C 2 5   ? 17.843  57.960  53.334 1.00 61.27  ? 9   DA  C OP1   1 
ATOM   6835 O  OP2   . DA  C 2 5   ? 17.101  56.137  51.714 1.00 49.49  ? 9   DA  C OP2   1 
ATOM   6836 O  "O5'" . DA  C 2 5   ? 16.301  56.189  54.100 1.00 44.32  ? 9   DA  C "O5'" 1 
ATOM   6837 C  "C5'" . DA  C 2 5   ? 15.310  56.759  54.928 1.00 43.42  ? 9   DA  C "C5'" 1 
ATOM   6838 C  "C4'" . DA  C 2 5   ? 15.244  56.105  56.285 1.00 50.35  ? 9   DA  C "C4'" 1 
ATOM   6839 O  "O4'" . DA  C 2 5   ? 13.935  55.471  56.363 1.00 39.66  ? 9   DA  C "O4'" 1 
ATOM   6840 C  "C3'" . DA  C 2 5   ? 16.259  54.995  56.533 1.00 49.81  ? 9   DA  C "C3'" 1 
ATOM   6841 O  "O3'" . DA  C 2 5   ? 16.608  54.973  57.921 1.00 67.18  ? 9   DA  C "O3'" 1 
ATOM   6842 C  "C2'" . DA  C 2 5   ? 15.497  53.744  56.120 1.00 47.29  ? 9   DA  C "C2'" 1 
ATOM   6843 C  "C1'" . DA  C 2 5   ? 14.071  54.063  56.512 1.00 39.50  ? 9   DA  C "C1'" 1 
ATOM   6844 N  N9    . DA  C 2 5   ? 13.063  53.393  55.677 1.00 32.73  ? 9   DA  C N9    1 
ATOM   6845 C  C8    . DA  C 2 5   ? 13.102  53.138  54.336 1.00 32.81  ? 9   DA  C C8    1 
ATOM   6846 N  N7    . DA  C 2 5   ? 12.069  52.455  53.899 1.00 30.34  ? 9   DA  C N7    1 
ATOM   6847 C  C5    . DA  C 2 5   ? 11.308  52.229  55.030 1.00 27.47  ? 9   DA  C C5    1 
ATOM   6848 C  C6    . DA  C 2 5   ? 10.084  51.564  55.253 1.00 27.30  ? 9   DA  C C6    1 
ATOM   6849 N  N6    . DA  C 2 5   ? 9.340   50.965  54.316 1.00 26.46  ? 9   DA  C N6    1 
ATOM   6850 N  N1    . DA  C 2 5   ? 9.633   51.538  56.516 1.00 27.85  ? 9   DA  C N1    1 
ATOM   6851 C  C2    . DA  C 2 5   ? 10.329  52.121  57.491 1.00 32.35  ? 9   DA  C C2    1 
ATOM   6852 N  N3    . DA  C 2 5   ? 11.483  52.771  57.405 1.00 32.39  ? 9   DA  C N3    1 
ATOM   6853 C  C4    . DA  C 2 5   ? 11.919  52.788  56.137 1.00 29.66  ? 9   DA  C C4    1 
ATOM   6854 P  P     . DT  C 2 6   ? 17.633  53.875  58.471 1.00 67.32  ? 10  DT  C P     1 
ATOM   6855 O  OP1   . DT  C 2 6   ? 18.710  54.580  59.211 1.00 63.76  ? 10  DT  C OP1   1 
ATOM   6856 O  OP2   . DT  C 2 6   ? 17.985  52.970  57.347 1.00 54.54  ? 10  DT  C OP2   1 
ATOM   6857 O  "O5'" . DT  C 2 6   ? 16.756  53.058  59.521 1.00 56.34  ? 10  DT  C "O5'" 1 
ATOM   6858 C  "C5'" . DT  C 2 6   ? 15.628  53.669  60.175 1.00 52.69  ? 10  DT  C "C5'" 1 
ATOM   6859 C  "C4'" . DT  C 2 6   ? 14.975  52.684  61.117 1.00 48.19  ? 10  DT  C "C4'" 1 
ATOM   6860 O  "O4'" . DT  C 2 6   ? 13.871  52.034  60.443 1.00 46.52  ? 10  DT  C "O4'" 1 
ATOM   6861 C  "C3'" . DT  C 2 6   ? 15.890  51.559  61.598 1.00 42.62  ? 10  DT  C "C3'" 1 
ATOM   6862 O  "O3'" . DT  C 2 6   ? 15.560  51.191  62.942 1.00 40.64  ? 10  DT  C "O3'" 1 
ATOM   6863 C  "C2'" . DT  C 2 6   ? 15.575  50.425  60.642 1.00 43.10  ? 10  DT  C "C2'" 1 
ATOM   6864 C  "C1'" . DT  C 2 6   ? 14.094  50.633  60.368 1.00 39.08  ? 10  DT  C "C1'" 1 
ATOM   6865 N  N1    . DT  C 2 6   ? 13.657  50.178  59.037 1.00 36.85  ? 10  DT  C N1    1 
ATOM   6866 C  C2    . DT  C 2 6   ? 12.453  49.518  58.938 1.00 33.59  ? 10  DT  C C2    1 
ATOM   6867 O  O2    . DT  C 2 6   ? 11.735  49.294  59.898 1.00 39.94  ? 10  DT  C O2    1 
ATOM   6868 N  N3    . DT  C 2 6   ? 12.119  49.128  57.664 1.00 25.74  ? 10  DT  C N3    1 
ATOM   6869 C  C4    . DT  C 2 6   ? 12.852  49.328  56.510 1.00 31.18  ? 10  DT  C C4    1 
ATOM   6870 O  O4    . DT  C 2 6   ? 12.423  48.920  55.434 1.00 31.91  ? 10  DT  C O4    1 
ATOM   6871 C  C5    . DT  C 2 6   ? 14.104  50.027  56.689 1.00 30.79  ? 10  DT  C C5    1 
ATOM   6872 C  C7    . DT  C 2 6   ? 14.967  50.289  55.495 1.00 29.03  ? 10  DT  C C7    1 
ATOM   6873 C  C6    . DT  C 2 6   ? 14.439  50.411  57.927 1.00 34.40  ? 10  DT  C C6    1 
ATOM   6874 P  P     . DC  C 2 7   ? 16.520  50.208  63.761 1.00 37.28  ? 11  DC  C P     1 
ATOM   6875 O  OP1   . DC  C 2 7   ? 16.880  50.875  65.038 1.00 37.52  ? 11  DC  C OP1   1 
ATOM   6876 O  OP2   . DC  C 2 7   ? 17.594  49.746  62.845 1.00 37.36  ? 11  DC  C OP2   1 
ATOM   6877 O  "O5'" . DC  C 2 7   ? 15.571  48.972  64.091 1.00 36.03  ? 11  DC  C "O5'" 1 
ATOM   6878 C  "C5'" . DC  C 2 7   ? 14.322  48.793  63.398 1.00 41.43  ? 11  DC  C "C5'" 1 
ATOM   6879 C  "C4'" . DC  C 2 7   ? 13.782  47.404  63.645 1.00 39.26  ? 11  DC  C "C4'" 1 
ATOM   6880 O  "O4'" . DC  C 2 7   ? 13.041  46.962  62.482 1.00 43.88  ? 11  DC  C "O4'" 1 
ATOM   6881 C  "C3'" . DC  C 2 7   ? 14.850  46.338  63.888 1.00 36.98  ? 11  DC  C "C3'" 1 
ATOM   6882 O  "O3'" . DC  C 2 7   ? 14.375  45.363  64.821 1.00 35.66  ? 11  DC  C "O3'" 1 
ATOM   6883 C  "C2'" . DC  C 2 7   ? 15.037  45.718  62.517 1.00 39.14  ? 11  DC  C "C2'" 1 
ATOM   6884 C  "C1'" . DC  C 2 7   ? 13.637  45.796  61.931 1.00 41.26  ? 11  DC  C "C1'" 1 
ATOM   6885 N  N1    . DC  C 2 7   ? 13.602  45.922  60.467 1.00 33.38  ? 11  DC  C N1    1 
ATOM   6886 C  C2    . DC  C 2 7   ? 12.475  45.466  59.779 1.00 32.93  ? 11  DC  C C2    1 
ATOM   6887 O  O2    . DC  C 2 7   ? 11.539  44.970  60.424 1.00 31.34  ? 11  DC  C O2    1 
ATOM   6888 N  N3    . DC  C 2 7   ? 12.433  45.578  58.431 1.00 34.63  ? 11  DC  C N3    1 
ATOM   6889 C  C4    . DC  C 2 7   ? 13.463  46.119  57.775 1.00 32.84  ? 11  DC  C C4    1 
ATOM   6890 N  N4    . DC  C 2 7   ? 13.379  46.209  56.446 1.00 23.81  ? 11  DC  C N4    1 
ATOM   6891 C  C5    . DC  C 2 7   ? 14.624  46.591  58.453 1.00 34.44  ? 11  DC  C C5    1 
ATOM   6892 C  C6    . DC  C 2 7   ? 14.651  46.474  59.786 1.00 34.38  ? 11  DC  C C6    1 
ATOM   6893 P  P     . DA  C 2 8   ? 15.285  44.100  65.192 1.00 35.41  ? 12  DA  C P     1 
ATOM   6894 O  OP1   . DA  C 2 8   ? 15.434  44.058  66.669 1.00 38.11  ? 12  DA  C OP1   1 
ATOM   6895 O  OP2   . DA  C 2 8   ? 16.495  44.138  64.332 1.00 34.57  ? 12  DA  C OP2   1 
ATOM   6896 O  "O5'" . DA  C 2 8   ? 14.385  42.865  64.743 1.00 39.39  ? 12  DA  C "O5'" 1 
ATOM   6897 C  "C5'" . DA  C 2 8   ? 12.953  42.989  64.651 1.00 40.99  ? 12  DA  C "C5'" 1 
ATOM   6898 C  "C4'" . DA  C 2 8   ? 12.355  41.722  64.084 1.00 36.16  ? 12  DA  C "C4'" 1 
ATOM   6899 O  "O4'" . DA  C 2 8   ? 12.173  41.873  62.656 1.00 44.25  ? 12  DA  C "O4'" 1 
ATOM   6900 C  "C3'" . DA  C 2 8   ? 13.217  40.473  64.265 1.00 44.17  ? 12  DA  C "C3'" 1 
ATOM   6901 O  "O3'" . DA  C 2 8   ? 12.388  39.323  64.461 1.00 46.61  ? 12  DA  C "O3'" 1 
ATOM   6902 C  "C2'" . DA  C 2 8   ? 13.962  40.375  62.947 1.00 41.93  ? 12  DA  C "C2'" 1 
ATOM   6903 C  "C1'" . DA  C 2 8   ? 12.939  40.903  61.956 1.00 44.78  ? 12  DA  C "C1'" 1 
ATOM   6904 N  N9    . DA  C 2 8   ? 13.521  41.553  60.783 1.00 35.97  ? 12  DA  C N9    1 
ATOM   6905 C  C8    . DA  C 2 8   ? 14.659  42.320  60.724 1.00 34.84  ? 12  DA  C C8    1 
ATOM   6906 N  N7    . DA  C 2 8   ? 14.931  42.772  59.524 1.00 31.93  ? 12  DA  C N7    1 
ATOM   6907 C  C5    . DA  C 2 8   ? 13.903  42.269  58.739 1.00 34.40  ? 12  DA  C C5    1 
ATOM   6908 C  C6    . DA  C 2 8   ? 13.615  42.389  57.368 1.00 33.87  ? 12  DA  C C6    1 
ATOM   6909 N  N6    . DA  C 2 8   ? 14.367  43.081  56.510 1.00 26.18  ? 12  DA  C N6    1 
ATOM   6910 N  N1    . DA  C 2 8   ? 12.511  41.764  56.902 1.00 29.29  ? 12  DA  C N1    1 
ATOM   6911 C  C2    . DA  C 2 8   ? 11.757  41.070  57.762 1.00 31.38  ? 12  DA  C C2    1 
ATOM   6912 N  N3    . DA  C 2 8   ? 11.923  40.884  59.070 1.00 34.44  ? 12  DA  C N3    1 
ATOM   6913 C  C4    . DA  C 2 8   ? 13.028  41.517  59.501 1.00 33.26  ? 12  DA  C C4    1 
ATOM   6914 P  P     . DG  C 2 9   ? 12.986  38.016  65.164 1.00 53.07  ? 13  DG  C P     1 
ATOM   6915 O  OP1   . DG  C 2 9   ? 12.414  37.926  66.488 1.00 54.91  ? 13  DG  C OP1   1 
ATOM   6916 O  OP2   . DG  C 2 9   ? 14.444  38.027  64.968 1.00 47.83  ? 13  DG  C OP2   1 
ATOM   6917 O  "O5'" . DG  C 2 9   ? 12.357  36.842  64.315 1.00 52.85  ? 13  DG  C "O5'" 1 
ATOM   6918 C  "C5'" . DG  C 2 9   ? 11.586  37.097  63.134 1.00 50.10  ? 13  DG  C "C5'" 1 
ATOM   6919 C  "C4'" . DG  C 2 9   ? 12.004  36.190  62.001 1.00 39.96  ? 13  DG  C "C4'" 1 
ATOM   6920 O  "O4'" . DG  C 2 9   ? 12.489  36.991  60.910 1.00 39.55  ? 13  DG  C "O4'" 1 
ATOM   6921 C  "C3'" . DG  C 2 9   ? 13.120  35.198  62.314 1.00 46.98  ? 13  DG  C "C3'" 1 
ATOM   6922 O  "O3'" . DG  C 2 9   ? 12.855  33.978  61.646 1.00 44.48  ? 13  DG  C "O3'" 1 
ATOM   6923 C  "C2'" . DG  C 2 9   ? 14.318  35.795  61.623 1.00 42.61  ? 13  DG  C "C2'" 1 
ATOM   6924 C  "C1'" . DG  C 2 9   ? 13.650  36.382  60.418 1.00 45.12  ? 13  DG  C "C1'" 1 
ATOM   6925 N  N9    . DG  C 2 9   ? 14.432  37.386  59.721 1.00 38.40  ? 13  DG  C N9    1 
ATOM   6926 C  C8    . DG  C 2 9   ? 15.536  38.049  60.184 1.00 40.29  ? 13  DG  C C8    1 
ATOM   6927 N  N7    . DG  C 2 9   ? 16.045  38.869  59.309 1.00 41.16  ? 13  DG  C N7    1 
ATOM   6928 C  C5    . DG  C 2 9   ? 15.240  38.716  58.192 1.00 36.90  ? 13  DG  C C5    1 
ATOM   6929 C  C6    . DG  C 2 9   ? 15.308  39.333  56.927 1.00 35.34  ? 13  DG  C C6    1 
ATOM   6930 O  O6    . DG  C 2 9   ? 16.123  40.157  56.521 1.00 38.58  ? 13  DG  C O6    1 
ATOM   6931 N  N1    . DG  C 2 9   ? 14.299  38.888  56.087 1.00 34.67  ? 13  DG  C N1    1 
ATOM   6932 C  C2    . DG  C 2 9   ? 13.344  37.968  56.422 1.00 40.07  ? 13  DG  C C2    1 
ATOM   6933 N  N2    . DG  C 2 9   ? 12.458  37.663  55.472 1.00 34.22  ? 13  DG  C N2    1 
ATOM   6934 N  N3    . DG  C 2 9   ? 13.270  37.382  57.599 1.00 42.49  ? 13  DG  C N3    1 
ATOM   6935 C  C4    . DG  C 2 9   ? 14.249  37.795  58.428 1.00 37.99  ? 13  DG  C C4    1 
ATOM   6936 C  "C5'" . DA  D 3 1   ? 35.705  40.497  39.387 1.00 78.78  ? 2   DA  D "C5'" 1 
ATOM   6937 C  "C4'" . DA  D 3 1   ? 34.257  40.032  39.462 1.00 78.32  ? 2   DA  D "C4'" 1 
ATOM   6938 O  "O4'" . DA  D 3 1   ? 34.190  38.586  39.422 1.00 78.22  ? 2   DA  D "O4'" 1 
ATOM   6939 C  "C3'" . DA  D 3 1   ? 33.454  40.455  40.693 1.00 73.73  ? 2   DA  D "C3'" 1 
ATOM   6940 O  "O3'" . DA  D 3 1   ? 32.234  40.997  40.190 1.00 73.31  ? 2   DA  D "O3'" 1 
ATOM   6941 C  "C2'" . DA  D 3 1   ? 33.216  39.186  41.514 1.00 75.94  ? 2   DA  D "C2'" 1 
ATOM   6942 C  "C1'" . DA  D 3 1   ? 33.535  38.054  40.553 1.00 72.36  ? 2   DA  D "C1'" 1 
ATOM   6943 N  N9    . DA  D 3 1   ? 34.454  37.094  41.126 1.00 81.21  ? 2   DA  D N9    1 
ATOM   6944 C  C8    . DA  D 3 1   ? 35.810  37.233  41.177 1.00 86.05  ? 2   DA  D C8    1 
ATOM   6945 N  N7    . DA  D 3 1   ? 36.412  36.215  41.753 1.00 89.80  ? 2   DA  D N7    1 
ATOM   6946 C  C5    . DA  D 3 1   ? 35.370  35.367  42.105 1.00 81.78  ? 2   DA  D C5    1 
ATOM   6947 C  C6    . DA  D 3 1   ? 35.335  34.118  42.745 1.00 86.94  ? 2   DA  D C6    1 
ATOM   6948 N  N6    . DA  D 3 1   ? 36.431  33.483  43.165 1.00 91.74  ? 2   DA  D N6    1 
ATOM   6949 N  N1    . DA  D 3 1   ? 34.129  33.548  42.940 1.00 88.36  ? 2   DA  D N1    1 
ATOM   6950 C  C2    . DA  D 3 1   ? 33.030  34.179  42.516 1.00 78.15  ? 2   DA  D C2    1 
ATOM   6951 N  N3    . DA  D 3 1   ? 32.931  35.354  41.903 1.00 79.05  ? 2   DA  D N3    1 
ATOM   6952 C  C4    . DA  D 3 1   ? 34.151  35.895  41.724 1.00 80.77  ? 2   DA  D C4    1 
ATOM   6953 P  P     . DT  D 3 2   ? 31.106  41.568  41.182 1.00 62.44  ? 3   DT  D P     1 
ATOM   6954 O  OP1   . DT  D 3 2   ? 29.995  42.113  40.358 1.00 73.56  ? 3   DT  D OP1   1 
ATOM   6955 O  OP2   . DT  D 3 2   ? 31.793  42.424  42.175 1.00 82.82  ? 3   DT  D OP2   1 
ATOM   6956 O  "O5'" . DT  D 3 2   ? 30.568  40.266  41.930 1.00 69.64  ? 3   DT  D "O5'" 1 
ATOM   6957 C  "C5'" . DT  D 3 2   ? 29.298  39.739  41.693 1.00 68.86  ? 3   DT  D "C5'" 1 
ATOM   6958 C  "C4'" . DT  D 3 2   ? 29.083  38.600  42.661 1.00 60.72  ? 3   DT  D "C4'" 1 
ATOM   6959 O  "O4'" . DT  D 3 2   ? 30.316  37.864  42.841 1.00 63.26  ? 3   DT  D "O4'" 1 
ATOM   6960 C  "C3'" . DT  D 3 2   ? 28.733  39.089  44.047 1.00 61.54  ? 3   DT  D "C3'" 1 
ATOM   6961 O  "O3'" . DT  D 3 2   ? 27.332  39.174  44.144 1.00 55.29  ? 3   DT  D "O3'" 1 
ATOM   6962 C  "C2'" . DT  D 3 2   ? 29.240  37.968  44.952 1.00 65.19  ? 3   DT  D "C2'" 1 
ATOM   6963 C  "C1'" . DT  D 3 2   ? 30.312  37.269  44.122 1.00 67.07  ? 3   DT  D "C1'" 1 
ATOM   6964 N  N1    . DT  D 3 2   ? 31.684  37.350  44.710 1.00 71.98  ? 3   DT  D N1    1 
ATOM   6965 C  C2    . DT  D 3 2   ? 32.280  36.185  45.132 1.00 75.56  ? 3   DT  D C2    1 
ATOM   6966 O  O2    . DT  D 3 2   ? 31.737  35.097  45.049 1.00 78.20  ? 3   DT  D O2    1 
ATOM   6967 N  N3    . DT  D 3 2   ? 33.537  36.339  45.654 1.00 72.35  ? 3   DT  D N3    1 
ATOM   6968 C  C4    . DT  D 3 2   ? 34.245  37.516  45.793 1.00 71.16  ? 3   DT  D C4    1 
ATOM   6969 O  O4    . DT  D 3 2   ? 35.372  37.542  46.278 1.00 72.54  ? 3   DT  D O4    1 
ATOM   6970 C  C5    . DT  D 3 2   ? 33.563  38.701  45.329 1.00 74.67  ? 3   DT  D C5    1 
ATOM   6971 C  C7    . DT  D 3 2   ? 34.227  40.043  45.426 1.00 80.37  ? 3   DT  D C7    1 
ATOM   6972 C  C6    . DT  D 3 2   ? 32.331  38.564  44.818 1.00 71.59  ? 3   DT  D C6    1 
ATOM   6973 P  P     . DG  D 3 3   ? 26.652  40.562  44.566 1.00 57.48  ? 4   DG  D P     1 
ATOM   6974 O  OP1   . DG  D 3 3   ? 25.211  40.442  44.239 1.00 56.73  ? 4   DG  D OP1   1 
ATOM   6975 O  OP2   . DG  D 3 3   ? 27.469  41.652  43.983 1.00 57.59  ? 4   DG  D OP2   1 
ATOM   6976 O  "O5'" . DG  D 3 3   ? 26.852  40.619  46.145 1.00 45.30  ? 4   DG  D "O5'" 1 
ATOM   6977 C  "C5'" . DG  D 3 3   ? 26.357  39.560  46.927 1.00 45.32  ? 4   DG  D "C5'" 1 
ATOM   6978 C  "C4'" . DG  D 3 3   ? 25.787  40.107  48.214 1.00 45.49  ? 4   DG  D "C4'" 1 
ATOM   6979 O  "O4'" . DG  D 3 3   ? 26.872  40.649  48.992 1.00 50.02  ? 4   DG  D "O4'" 1 
ATOM   6980 C  "C3'" . DG  D 3 3   ? 24.781  41.231  48.039 1.00 42.34  ? 4   DG  D "C3'" 1 
ATOM   6981 O  "O3'" . DG  D 3 3   ? 23.771  41.047  48.993 1.00 41.49  ? 4   DG  D "O3'" 1 
ATOM   6982 C  "C2'" . DG  D 3 3   ? 25.579  42.489  48.348 1.00 48.08  ? 4   DG  D "C2'" 1 
ATOM   6983 C  "C1'" . DG  D 3 3   ? 26.572  41.969  49.376 1.00 45.15  ? 4   DG  D "C1'" 1 
ATOM   6984 N  N9    . DG  D 3 3   ? 27.833  42.690  49.352 1.00 47.63  ? 4   DG  D N9    1 
ATOM   6985 C  C8    . DG  D 3 3   ? 28.549  43.055  48.235 1.00 48.97  ? 4   DG  D C8    1 
ATOM   6986 N  N7    . DG  D 3 3   ? 29.650  43.694  48.513 1.00 47.94  ? 4   DG  D N7    1 
ATOM   6987 C  C5    . DG  D 3 3   ? 29.657  43.751  49.903 1.00 48.89  ? 4   DG  D C5    1 
ATOM   6988 C  C6    . DG  D 3 3   ? 30.603  44.321  50.782 1.00 52.44  ? 4   DG  D C6    1 
ATOM   6989 O  O6    . DG  D 3 3   ? 31.653  44.908  50.484 1.00 57.71  ? 4   DG  D O6    1 
ATOM   6990 N  N1    . DG  D 3 3   ? 30.240  44.156  52.120 1.00 50.47  ? 4   DG  D N1    1 
ATOM   6991 C  C2    . DG  D 3 3   ? 29.098  43.519  52.551 1.00 43.14  ? 4   DG  D C2    1 
ATOM   6992 N  N2    . DG  D 3 3   ? 28.907  43.461  53.874 1.00 33.73  ? 4   DG  D N2    1 
ATOM   6993 N  N3    . DG  D 3 3   ? 28.200  42.980  51.737 1.00 45.85  ? 4   DG  D N3    1 
ATOM   6994 C  C4    . DG  D 3 3   ? 28.548  43.134  50.435 1.00 46.99  ? 4   DG  D C4    1 
HETATM 6995 O  O1    . VKJ D 3 4   ? 19.357  38.674  55.545 1.00 40.82  ? 5   VKJ D O1    1 
HETATM 6996 C  C1    . VKJ D 3 4   ? 18.871  38.187  54.531 1.00 41.27  ? 5   VKJ D C1    1 
HETATM 6997 N  N1    . VKJ D 3 4   ? 17.965  37.220  54.612 1.00 39.49  ? 5   VKJ D N1    1 
HETATM 6998 C  C2    . VKJ D 3 4   ? 17.434  36.690  53.526 1.00 37.17  ? 5   VKJ D C2    1 
HETATM 6999 N  N2    . VKJ D 3 4   ? 16.556  35.711  53.697 1.00 37.77  ? 5   VKJ D N2    1 
HETATM 7000 N  N3    . VKJ D 3 4   ? 17.801  37.114  52.325 1.00 36.96  ? 5   VKJ D N3    1 
HETATM 7001 C  C3    . VKJ D 3 4   ? 18.708  38.107  52.218 1.00 35.22  ? 5   VKJ D C3    1 
HETATM 7002 C  C4    . VKJ D 3 4   ? 19.250  38.650  53.324 1.00 37.68  ? 5   VKJ D C4    1 
HETATM 7003 N  N4    . VKJ D 3 4   ? 20.103  39.577  52.956 1.00 36.50  ? 5   VKJ D N4    1 
HETATM 7004 C  C5    . VKJ D 3 4   ? 20.093  39.605  51.641 1.00 34.93  ? 5   VKJ D C5    1 
HETATM 7005 N  N5    . VKJ D 3 4   ? 19.235  38.727  51.211 1.00 30.19  ? 5   VKJ D N5    1 
HETATM 7006 C  C6    . VKJ D 3 4   ? 18.979  38.422  49.838 1.00 33.56  ? 5   VKJ D C6    1 
HETATM 7007 O  O2    . VKJ D 3 4   ? 20.204  38.175  49.223 1.00 35.93  ? 5   VKJ D O2    1 
HETATM 7008 C  C7    . VKJ D 3 4   ? 18.407  39.563  49.091 1.00 35.28  ? 5   VKJ D C7    1 
HETATM 7009 C  C8    . VKJ D 3 4   ? 18.849  39.261  47.711 1.00 31.94  ? 5   VKJ D C8    1 
HETATM 7010 O  O3    . VKJ D 3 4   ? 17.959  38.301  47.189 1.00 32.49  ? 5   VKJ D O3    1 
HETATM 7011 C  C9    . VKJ D 3 4   ? 20.175  38.623  47.913 1.00 32.67  ? 5   VKJ D C9    1 
HETATM 7012 C  C10   . VKJ D 3 4   ? 21.287  39.606  47.758 1.00 37.76  ? 5   VKJ D C10   1 
HETATM 7013 O  O4    . VKJ D 3 4   ? 21.447  40.381  48.908 1.00 40.58  ? 5   VKJ D O4    1 
HETATM 7014 P  P1    . VKJ D 3 4   ? 22.391  41.652  48.810 1.00 46.28  ? 5   VKJ D P1    1 
HETATM 7015 O  O5    . VKJ D 3 4   ? 22.330  42.185  47.450 1.00 44.70  ? 5   VKJ D O5    1 
HETATM 7016 O  O6    . VKJ D 3 4   ? 22.137  42.538  49.948 1.00 42.21  ? 5   VKJ D O6    1 
HETATM 7017 O  O7    . VKJ D 3 4   ? 13.541  35.034  52.102 1.00 46.71  ? 5   VKJ D O7    1 
HETATM 7018 C  C11   . VKJ D 3 4   ? 14.437  35.298  53.130 1.00 41.74  ? 5   VKJ D C11   1 
HETATM 7019 C  C12   . VKJ D 3 4   ? 15.837  35.060  52.639 1.00 43.67  ? 5   VKJ D C12   1 
HETATM 7020 C  C13   . VKJ D 3 4   ? 16.203  33.579  52.589 1.00 49.94  ? 5   VKJ D C13   1 
HETATM 7021 C  C14   . VKJ D 3 4   ? 14.026  34.403  54.257 1.00 47.31  ? 5   VKJ D C14   1 
HETATM 7022 O  O8    . VKJ D 3 4   ? 12.628  34.472  54.338 1.00 53.74  ? 5   VKJ D O8    1 
HETATM 7023 C  C15   . VKJ D 3 4   ? 14.355  32.938  54.129 1.00 48.77  ? 5   VKJ D C15   1 
HETATM 7024 O  O9    . VKJ D 3 4   ? 14.811  32.424  55.356 1.00 61.28  ? 5   VKJ D O9    1 
HETATM 7025 C  C16   . VKJ D 3 4   ? 15.197  32.586  53.028 1.00 46.80  ? 5   VKJ D C16   1 
HETATM 7026 C  C17   . VKJ D 3 4   ? 14.925  31.383  52.434 1.00 54.27  ? 5   VKJ D C17   1 
HETATM 7027 C  C18   . VKJ D 3 4   ? 15.620  30.950  51.367 1.00 60.57  ? 5   VKJ D C18   1 
HETATM 7028 C  C19   . VKJ D 3 4   ? 16.660  31.793  50.852 1.00 61.64  ? 5   VKJ D C19   1 
HETATM 7029 C  C20   . VKJ D 3 4   ? 16.959  33.085  51.454 1.00 60.36  ? 5   VKJ D C20   1 
HETATM 7030 C  C21   . VKJ D 3 4   ? 17.957  33.841  50.891 1.00 55.14  ? 5   VKJ D C21   1 
HETATM 7031 C  C22   . VKJ D 3 4   ? 18.664  33.373  49.796 1.00 63.05  ? 5   VKJ D C22   1 
HETATM 7032 C  C23   . VKJ D 3 4   ? 17.408  31.337  49.717 1.00 67.70  ? 5   VKJ D C23   1 
HETATM 7033 C  C24   . VKJ D 3 4   ? 17.111  30.115  49.164 1.00 69.74  ? 5   VKJ D C24   1 
HETATM 7034 C  C25   . VKJ D 3 4   ? 16.094  29.328  49.689 1.00 60.76  ? 5   VKJ D C25   1 
HETATM 7035 C  C26   . VKJ D 3 4   ? 15.352  29.739  50.778 1.00 58.07  ? 5   VKJ D C26   1 
HETATM 7036 C  C27   . VKJ D 3 4   ? 17.822  29.676  48.075 1.00 67.55  ? 5   VKJ D C27   1 
HETATM 7037 C  C28   . VKJ D 3 4   ? 18.392  32.136  49.215 1.00 72.51  ? 5   VKJ D C28   1 
HETATM 7038 C  C29   . VKJ D 3 4   ? 19.112  31.694  48.124 1.00 78.93  ? 5   VKJ D C29   1 
HETATM 7039 C  C30   . VKJ D 3 4   ? 18.820  30.464  47.552 1.00 72.38  ? 5   VKJ D C30   1 
ATOM   7040 P  P     . DC  D 3 5   ? 17.065  38.806  46.090 1.00 31.72  ? 6   DC  D P     1 
ATOM   7041 O  OP1   . DC  D 3 5   ? 17.324  38.027  44.865 1.00 30.41  ? 6   DC  D OP1   1 
ATOM   7042 O  OP2   . DC  D 3 5   ? 17.115  40.280  46.105 1.00 41.82  ? 6   DC  D OP2   1 
ATOM   7043 O  "O5'" . DC  D 3 5   ? 15.651  38.390  46.690 1.00 30.27  ? 6   DC  D "O5'" 1 
ATOM   7044 C  "C5'" . DC  D 3 5   ? 15.641  37.180  47.418 1.00 31.42  ? 6   DC  D "C5'" 1 
ATOM   7045 C  "C4'" . DC  D 3 5   ? 14.432  37.098  48.319 1.00 30.47  ? 6   DC  D "C4'" 1 
ATOM   7046 O  "O4'" . DC  D 3 5   ? 14.757  37.348  49.692 1.00 35.95  ? 6   DC  D "O4'" 1 
ATOM   7047 C  "C3'" . DC  D 3 5   ? 13.262  37.988  47.944 1.00 29.11  ? 6   DC  D "C3'" 1 
ATOM   7048 O  "O3'" . DC  D 3 5   ? 12.156  37.095  47.829 1.00 29.26  ? 6   DC  D "O3'" 1 
ATOM   7049 C  "C2'" . DC  D 3 5   ? 13.164  38.984  49.102 1.00 35.68  ? 6   DC  D "C2'" 1 
ATOM   7050 C  "C1'" . DC  D 3 5   ? 13.832  38.239  50.262 1.00 32.04  ? 6   DC  D "C1'" 1 
ATOM   7051 N  N1    . DC  D 3 5   ? 14.586  39.050  51.222 1.00 29.14  ? 6   DC  D N1    1 
ATOM   7052 C  C2    . DC  D 3 5   ? 14.206  39.057  52.557 1.00 35.69  ? 6   DC  D C2    1 
ATOM   7053 O  O2    . DC  D 3 5   ? 13.204  38.410  52.862 1.00 38.20  ? 6   DC  D O2    1 
ATOM   7054 N  N3    . DC  D 3 5   ? 14.927  39.783  53.450 1.00 31.14  ? 6   DC  D N3    1 
ATOM   7055 C  C4    . DC  D 3 5   ? 16.001  40.460  53.037 1.00 30.99  ? 6   DC  D C4    1 
ATOM   7056 N  N4    . DC  D 3 5   ? 16.686  41.153  53.951 1.00 33.12  ? 6   DC  D N4    1 
ATOM   7057 C  C5    . DC  D 3 5   ? 16.415  40.449  51.673 1.00 27.63  ? 6   DC  D C5    1 
ATOM   7058 C  C6    . DC  D 3 5   ? 15.686  39.731  50.815 1.00 29.62  ? 6   DC  D C6    1 
ATOM   7059 P  P     . DT  D 3 6   ? 10.660  37.647  47.650 1.00 33.61  ? 7   DT  D P     1 
ATOM   7060 O  OP1   . DT  D 3 6   ? 9.864   36.573  47.012 1.00 31.27  ? 7   DT  D OP1   1 
ATOM   7061 O  OP2   . DT  D 3 6   ? 10.729  38.970  46.992 1.00 34.71  ? 7   DT  D OP2   1 
ATOM   7062 O  "O5'" . DT  D 3 6   ? 10.152  37.834  49.145 1.00 30.99  ? 7   DT  D "O5'" 1 
ATOM   7063 C  "C5'" . DT  D 3 6   ? 9.067   37.090  49.620 1.00 32.85  ? 7   DT  D "C5'" 1 
ATOM   7064 C  "C4'" . DT  D 3 6   ? 8.641   37.654  50.952 1.00 33.15  ? 7   DT  D "C4'" 1 
ATOM   7065 O  "O4'" . DT  D 3 6   ? 9.768   38.295  51.589 1.00 31.10  ? 7   DT  D "O4'" 1 
ATOM   7066 C  "C3'" . DT  D 3 6   ? 7.542   38.698  50.845 1.00 29.82  ? 7   DT  D "C3'" 1 
ATOM   7067 O  "O3'" . DT  D 3 6   ? 6.404   38.164  51.470 1.00 31.10  ? 7   DT  D "O3'" 1 
ATOM   7068 C  "C2'" . DT  D 3 6   ? 8.106   39.917  51.577 1.00 32.54  ? 7   DT  D "C2'" 1 
ATOM   7069 C  "C1'" . DT  D 3 6   ? 9.238   39.315  52.398 1.00 29.19  ? 7   DT  D "C1'" 1 
ATOM   7070 N  N1    . DT  D 3 6   ? 10.357  40.234  52.748 1.00 31.04  ? 7   DT  D N1    1 
ATOM   7071 C  C2    . DT  D 3 6   ? 10.633  40.428  54.078 1.00 31.29  ? 7   DT  D C2    1 
ATOM   7072 O  O2    . DT  D 3 6   ? 9.993   39.893  54.960 1.00 34.90  ? 7   DT  D O2    1 
ATOM   7073 N  N3    . DT  D 3 6   ? 11.676  41.277  54.341 1.00 30.75  ? 7   DT  D N3    1 
ATOM   7074 C  C4    . DT  D 3 6   ? 12.466  41.938  53.419 1.00 31.26  ? 7   DT  D C4    1 
ATOM   7075 O  O4    . DT  D 3 6   ? 13.390  42.682  53.743 1.00 29.27  ? 7   DT  D O4    1 
ATOM   7076 C  C5    . DT  D 3 6   ? 12.126  41.689  52.043 1.00 29.61  ? 7   DT  D C5    1 
ATOM   7077 C  C7    . DT  D 3 6   ? 12.925  42.362  50.973 1.00 33.68  ? 7   DT  D C7    1 
ATOM   7078 C  C6    . DT  D 3 6   ? 11.105  40.857  51.767 1.00 31.25  ? 7   DT  D C6    1 
ATOM   7079 P  P     . DG  D 3 7   ? 4.956   38.746  51.114 1.00 34.42  ? 8   DG  D P     1 
ATOM   7080 O  OP1   . DG  D 3 7   ? 4.056   37.599  50.884 1.00 41.53  ? 8   DG  D OP1   1 
ATOM   7081 O  OP2   . DG  D 3 7   ? 5.141   39.776  50.071 1.00 43.28  ? 8   DG  D OP2   1 
ATOM   7082 O  "O5'" . DG  D 3 7   ? 4.503   39.496  52.441 1.00 45.15  ? 8   DG  D "O5'" 1 
ATOM   7083 C  "C5'" . DG  D 3 7   ? 4.695   38.905  53.712 1.00 43.07  ? 8   DG  D "C5'" 1 
ATOM   7084 C  "C4'" . DG  D 3 7   ? 4.906   39.973  54.771 1.00 37.23  ? 8   DG  D "C4'" 1 
ATOM   7085 O  "O4'" . DG  D 3 7   ? 6.242   40.526  54.687 1.00 34.63  ? 8   DG  D "O4'" 1 
ATOM   7086 C  "C3'" . DG  D 3 7   ? 3.952   41.163  54.719 1.00 39.23  ? 8   DG  D "C3'" 1 
ATOM   7087 O  "O3'" . DG  D 3 7   ? 3.218   41.174  55.926 1.00 45.49  ? 8   DG  D "O3'" 1 
ATOM   7088 C  "C2'" . DG  D 3 7   ? 4.871   42.385  54.607 1.00 33.54  ? 8   DG  D "C2'" 1 
ATOM   7089 C  "C1'" . DG  D 3 7   ? 6.167   41.836  55.195 1.00 33.48  ? 8   DG  D "C1'" 1 
ATOM   7090 N  N9    . DG  D 3 7   ? 7.401   42.543  54.850 1.00 28.40  ? 8   DG  D N9    1 
ATOM   7091 C  C8    . DG  D 3 7   ? 7.861   42.882  53.606 1.00 30.02  ? 8   DG  D C8    1 
ATOM   7092 N  N7    . DG  D 3 7   ? 9.003   43.514  53.630 1.00 29.00  ? 8   DG  D N7    1 
ATOM   7093 C  C5    . DG  D 3 7   ? 9.327   43.598  54.972 1.00 25.56  ? 8   DG  D C5    1 
ATOM   7094 C  C6    . DG  D 3 7   ? 10.449  44.179  55.609 1.00 27.66  ? 8   DG  D C6    1 
ATOM   7095 O  O6    . DG  D 3 7   ? 11.415  44.748  55.088 1.00 29.39  ? 8   DG  D O6    1 
ATOM   7096 N  N1    . DG  D 3 7   ? 10.382  44.052  56.994 1.00 29.13  ? 8   DG  D N1    1 
ATOM   7097 C  C2    . DG  D 3 7   ? 9.351   43.431  57.665 1.00 32.75  ? 8   DG  D C2    1 
ATOM   7098 N  N2    . DG  D 3 7   ? 9.444   43.389  58.998 1.00 33.42  ? 8   DG  D N2    1 
ATOM   7099 N  N3    . DG  D 3 7   ? 8.295   42.884  57.081 1.00 32.28  ? 8   DG  D N3    1 
ATOM   7100 C  C4    . DG  D 3 7   ? 8.349   43.005  55.735 1.00 28.76  ? 8   DG  D C4    1 
ATOM   7101 P  P     . DA  D 3 8   ? 1.870   42.036  56.053 1.00 62.52  ? 9   DA  D P     1 
ATOM   7102 O  OP1   . DA  D 3 8   ? 0.804   41.084  56.441 1.00 57.63  ? 9   DA  D OP1   1 
ATOM   7103 O  OP2   . DA  D 3 8   ? 1.744   42.878  54.843 1.00 48.09  ? 9   DA  D OP2   1 
ATOM   7104 O  "O5'" . DA  D 3 8   ? 2.160   43.004  57.289 1.00 55.45  ? 9   DA  D "O5'" 1 
ATOM   7105 C  "C5'" . DA  D 3 8   ? 2.909   42.485  58.380 1.00 47.61  ? 9   DA  D "C5'" 1 
ATOM   7106 C  "C4'" . DA  D 3 8   ? 3.670   43.587  59.078 1.00 38.51  ? 9   DA  D "C4'" 1 
ATOM   7107 O  "O4'" . DA  D 3 8   ? 4.896   43.856  58.348 1.00 35.61  ? 9   DA  D "O4'" 1 
ATOM   7108 C  "C3'" . DA  D 3 8   ? 2.918   44.911  59.136 1.00 47.21  ? 9   DA  D "C3'" 1 
ATOM   7109 O  "O3'" . DA  D 3 8   ? 2.553   45.192  60.484 1.00 52.35  ? 9   DA  D "O3'" 1 
ATOM   7110 C  "C2'" . DA  D 3 8   ? 3.898   45.943  58.573 1.00 42.35  ? 9   DA  D "C2'" 1 
ATOM   7111 C  "C1'" . DA  D 3 8   ? 5.229   45.205  58.558 1.00 35.41  ? 9   DA  D "C1'" 1 
ATOM   7112 N  N9    . DA  D 3 8   ? 6.120   45.665  57.499 1.00 30.28  ? 9   DA  D N9    1 
ATOM   7113 C  C8    . DA  D 3 8   ? 5.927   45.615  56.150 1.00 30.18  ? 9   DA  D C8    1 
ATOM   7114 N  N7    . DA  D 3 8   ? 6.910   46.136  55.450 1.00 28.99  ? 9   DA  D N7    1 
ATOM   7115 C  C5    . DA  D 3 8   ? 7.811   46.572  56.406 1.00 26.49  ? 9   DA  D C5    1 
ATOM   7116 C  C6    . DA  D 3 8   ? 9.068   47.216  56.328 1.00 25.71  ? 9   DA  D C6    1 
ATOM   7117 N  N6    . DA  D 3 8   ? 9.701   47.571  55.199 1.00 20.43  ? 9   DA  D N6    1 
ATOM   7118 N  N1    . DA  D 3 8   ? 9.669   47.497  57.496 1.00 29.42  ? 9   DA  D N1    1 
ATOM   7119 C  C2    . DA  D 3 8   ? 9.081   47.170  58.651 1.00 31.20  ? 9   DA  D C2    1 
ATOM   7120 N  N3    . DA  D 3 8   ? 7.913   46.567  58.846 1.00 32.28  ? 9   DA  D N3    1 
ATOM   7121 C  C4    . DA  D 3 8   ? 7.328   46.291  57.674 1.00 30.24  ? 9   DA  D C4    1 
ATOM   7122 P  P     . DT  D 3 9   ? 1.554   46.406  60.826 1.00 54.19  ? 10  DT  D P     1 
ATOM   7123 O  OP1   . DT  D 3 9   ? 0.707   46.016  61.978 1.00 47.13  ? 10  DT  D OP1   1 
ATOM   7124 O  OP2   . DT  D 3 9   ? 0.911   46.828  59.561 1.00 52.28  ? 10  DT  D OP2   1 
ATOM   7125 O  "O5'" . DT  D 3 9   ? 2.540   47.578  61.267 1.00 45.53  ? 10  DT  D "O5'" 1 
ATOM   7126 C  "C5'" . DT  D 3 9   ? 3.559   47.295  62.200 1.00 43.74  ? 10  DT  D "C5'" 1 
ATOM   7127 C  "C4'" . DT  D 3 9   ? 4.567   48.417  62.153 1.00 43.78  ? 10  DT  D "C4'" 1 
ATOM   7128 O  "O4'" . DT  D 3 9   ? 5.312   48.367  60.912 1.00 44.55  ? 10  DT  D "O4'" 1 
ATOM   7129 C  "C3'" . DT  D 3 9   ? 3.963   49.812  62.224 1.00 46.62  ? 10  DT  D "C3'" 1 
ATOM   7130 O  "O3'" . DT  D 3 9   ? 4.594   50.482  63.306 1.00 58.08  ? 10  DT  D "O3'" 1 
ATOM   7131 C  "C2'" . DT  D 3 9   ? 4.293   50.451  60.874 1.00 45.83  ? 10  DT  D "C2'" 1 
ATOM   7132 C  "C1'" . DT  D 3 9   ? 5.563   49.696  60.516 1.00 37.30  ? 10  DT  D "C1'" 1 
ATOM   7133 N  N1    . DT  D 3 9   ? 5.889   49.696  59.071 1.00 34.01  ? 10  DT  D N1    1 
ATOM   7134 C  C2    . DT  D 3 9   ? 7.131   50.134  58.690 1.00 36.32  ? 10  DT  D C2    1 
ATOM   7135 O  O2    . DT  D 3 9   ? 7.972   50.537  59.473 1.00 39.43  ? 10  DT  D O2    1 
ATOM   7136 N  N3    . DT  D 3 9   ? 7.349   50.094  57.342 1.00 30.18  ? 10  DT  D N3    1 
ATOM   7137 C  C4    . DT  D 3 9   ? 6.497   49.663  56.350 1.00 27.46  ? 10  DT  D C4    1 
ATOM   7138 O  O4    . DT  D 3 9   ? 6.834   49.680  55.167 1.00 26.62  ? 10  DT  D O4    1 
ATOM   7139 C  C5    . DT  D 3 9   ? 5.212   49.205  56.822 1.00 28.55  ? 10  DT  D C5    1 
ATOM   7140 C  C7    . DT  D 3 9   ? 4.182   48.708  55.855 1.00 27.00  ? 10  DT  D C7    1 
ATOM   7141 C  C6    . DT  D 3 9   ? 4.973   49.241  58.143 1.00 32.67  ? 10  DT  D C6    1 
ATOM   7142 P  P     . DC  D 3 10  ? 3.915   51.767  63.982 1.00 64.27  ? 11  DC  D P     1 
ATOM   7143 O  OP1   . DC  D 3 10  ? 3.522   51.351  65.346 1.00 69.88  ? 11  DC  D OP1   1 
ATOM   7144 O  OP2   . DC  D 3 10  ? 2.904   52.324  63.060 1.00 61.51  ? 11  DC  D OP2   1 
ATOM   7145 O  "O5'" . DC  D 3 10  ? 5.122   52.814  64.058 1.00 52.15  ? 11  DC  D "O5'" 1 
ATOM   7146 C  "C5'" . DC  D 3 10  ? 6.461   52.340  63.915 1.00 47.83  ? 11  DC  D "C5'" 1 
ATOM   7147 C  "C4'" . DC  D 3 10  ? 7.355   53.474  63.467 1.00 48.53  ? 11  DC  D "C4'" 1 
ATOM   7148 O  "O4'" . DC  D 3 10  ? 7.712   53.348  62.065 1.00 48.96  ? 11  DC  D "O4'" 1 
ATOM   7149 C  "C3'" . DC  D 3 10  ? 6.725   54.850  63.577 1.00 52.26  ? 11  DC  D "C3'" 1 
ATOM   7150 O  "O3'" . DC  D 3 10  ? 7.760   55.768  63.775 1.00 57.51  ? 11  DC  D "O3'" 1 
ATOM   7151 C  "C2'" . DC  D 3 10  ? 6.124   55.072  62.200 1.00 49.63  ? 11  DC  D "C2'" 1 
ATOM   7152 C  "C1'" . DC  D 3 10  ? 7.245   54.487  61.354 1.00 45.89  ? 11  DC  D "C1'" 1 
ATOM   7153 N  N1    . DC  D 3 10  ? 6.827   54.092  59.986 1.00 38.34  ? 11  DC  D N1    1 
ATOM   7154 C  C2    . DC  D 3 10  ? 7.748   54.190  58.945 1.00 37.96  ? 11  DC  D C2    1 
ATOM   7155 O  O2    . DC  D 3 10  ? 8.881   54.622  59.202 1.00 38.87  ? 11  DC  D O2    1 
ATOM   7156 N  N3    . DC  D 3 10  ? 7.361   53.819  57.694 1.00 37.85  ? 11  DC  D N3    1 
ATOM   7157 C  C4    . DC  D 3 10  ? 6.122   53.357  57.485 1.00 39.83  ? 11  DC  D C4    1 
ATOM   7158 N  N4    . DC  D 3 10  ? 5.784   53.004  56.237 1.00 33.15  ? 11  DC  D N4    1 
ATOM   7159 C  C5    . DC  D 3 10  ? 5.173   53.247  58.545 1.00 34.57  ? 11  DC  D C5    1 
ATOM   7160 C  C6    . DC  D 3 10  ? 5.567   53.622  59.767 1.00 39.41  ? 11  DC  D C6    1 
ATOM   7161 P  P     . DC  D 3 11  ? 7.534   57.079  64.668 1.00 58.56  ? 12  DC  D P     1 
ATOM   7162 O  OP1   . DC  D 3 11  ? 8.249   56.855  65.943 1.00 54.42  ? 12  DC  D OP1   1 
ATOM   7163 O  OP2   . DC  D 3 11  ? 6.093   57.429  64.659 1.00 41.82  ? 12  DC  D OP2   1 
ATOM   7164 O  "O5'" . DC  D 3 11  ? 8.315   58.202  63.846 1.00 51.51  ? 12  DC  D "O5'" 1 
ATOM   7165 C  "C5'" . DC  D 3 11  ? 9.604   57.927  63.299 1.00 47.00  ? 12  DC  D "C5'" 1 
ATOM   7166 C  "C4'" . DC  D 3 11  ? 9.897   58.941  62.209 1.00 54.62  ? 12  DC  D "C4'" 1 
ATOM   7167 O  "O4'" . DC  D 3 11  ? 9.508   58.462  60.892 1.00 51.65  ? 12  DC  D "O4'" 1 
ATOM   7168 C  "C3'" . DC  D 3 11  ? 9.134   60.244  62.412 1.00 58.55  ? 12  DC  D "C3'" 1 
ATOM   7169 O  "O3'" . DC  D 3 11  ? 9.958   61.349  62.088 1.00 61.58  ? 12  DC  D "O3'" 1 
ATOM   7170 C  "C2'" . DC  D 3 11  ? 7.948   60.125  61.453 1.00 50.61  ? 12  DC  D "C2'" 1 
ATOM   7171 C  "C1'" . DC  D 3 11  ? 8.617   59.396  60.298 1.00 48.92  ? 12  DC  D "C1'" 1 
ATOM   7172 N  N1    . DC  D 3 11  ? 7.661   58.679  59.422 1.00 38.97  ? 12  DC  D N1    1 
ATOM   7173 C  C2    . DC  D 3 11  ? 7.935   58.616  58.059 1.00 37.26  ? 12  DC  D C2    1 
ATOM   7174 O  O2    . DC  D 3 11  ? 8.962   59.172  57.647 1.00 37.28  ? 12  DC  D O2    1 
ATOM   7175 N  N3    . DC  D 3 11  ? 7.064   57.960  57.254 1.00 35.17  ? 12  DC  D N3    1 
ATOM   7176 C  C4    . DC  D 3 11  ? 5.974   57.389  57.774 1.00 36.97  ? 12  DC  D C4    1 
ATOM   7177 N  N4    . DC  D 3 11  ? 5.143   56.745  56.950 1.00 36.01  ? 12  DC  D N4    1 
ATOM   7178 C  C5    . DC  D 3 11  ? 5.682   57.446  59.166 1.00 35.53  ? 12  DC  D C5    1 
ATOM   7179 C  C6    . DC  D 3 11  ? 6.548   58.095  59.946 1.00 38.54  ? 12  DC  D C6    1 
ATOM   7180 P  P     . DG  D 3 12  ? 9.644   62.777  62.750 1.00 72.45  ? 13  DG  D P     1 
ATOM   7181 O  OP1   . DG  D 3 12  ? 10.714  63.723  62.354 1.00 66.49  ? 13  DG  D OP1   1 
ATOM   7182 O  OP2   . DG  D 3 12  ? 9.380   62.544  64.189 1.00 62.62  ? 13  DG  D OP2   1 
ATOM   7183 O  "O5'" . DG  D 3 12  ? 8.233   63.164  62.097 1.00 58.02  ? 13  DG  D "O5'" 1 
ATOM   7184 C  "C5'" . DG  D 3 12  ? 8.066   64.368  61.387 1.00 64.91  ? 13  DG  D "C5'" 1 
ATOM   7185 C  "C4'" . DG  D 3 12  ? 8.757   64.342  60.030 1.00 57.32  ? 13  DG  D "C4'" 1 
ATOM   7186 O  "O4'" . DG  D 3 12  ? 8.463   63.049  59.393 1.00 56.08  ? 13  DG  D "O4'" 1 
ATOM   7187 C  "C3'" . DG  D 3 12  ? 8.181   65.406  59.120 1.00 62.36  ? 13  DG  D "C3'" 1 
ATOM   7188 O  "O3'" . DG  D 3 12  ? 9.161   65.992  58.260 1.00 73.22  ? 13  DG  D "O3'" 1 
ATOM   7189 C  "C2'" . DG  D 3 12  ? 7.169   64.593  58.341 1.00 53.73  ? 13  DG  D "C2'" 1 
ATOM   7190 C  "C1'" . DG  D 3 12  ? 7.818   63.265  58.140 1.00 44.08  ? 13  DG  D "C1'" 1 
ATOM   7191 N  N9    . DG  D 3 12  ? 6.767   62.257  57.941 1.00 37.08  ? 13  DG  D N9    1 
ATOM   7192 C  C8    . DG  D 3 12  ? 5.850   61.873  58.884 1.00 39.71  ? 13  DG  D C8    1 
ATOM   7193 N  N7    . DG  D 3 12  ? 4.948   61.052  58.430 1.00 38.41  ? 13  DG  D N7    1 
ATOM   7194 C  C5    . DG  D 3 12  ? 5.259   60.919  57.089 1.00 32.84  ? 13  DG  D C5    1 
ATOM   7195 C  C6    . DG  D 3 12  ? 4.622   60.143  56.101 1.00 32.93  ? 13  DG  D C6    1 
ATOM   7196 O  O6    . DG  D 3 12  ? 3.632   59.413  56.245 1.00 32.20  ? 13  DG  D O6    1 
ATOM   7197 N  N1    . DG  D 3 12  ? 5.241   60.282  54.861 1.00 32.38  ? 13  DG  D N1    1 
ATOM   7198 C  C2    . DG  D 3 12  ? 6.342   61.076  54.617 1.00 34.50  ? 13  DG  D C2    1 
ATOM   7199 N  N2    . DG  D 3 12  ? 6.803   61.088  53.355 1.00 27.47  ? 13  DG  D N2    1 
ATOM   7200 N  N3    . DG  D 3 12  ? 6.947   61.810  55.547 1.00 37.08  ? 13  DG  D N3    1 
ATOM   7201 C  C4    . DG  D 3 12  ? 6.356   61.683  56.760 1.00 34.27  ? 13  DG  D C4    1 
ATOM   7202 P  P     . DC  D 3 13  ? 9.333   67.589  58.195 1.00 62.55  ? 14  DC  D P     1 
ATOM   7203 O  OP1   . DC  D 3 13  ? 10.743  67.864  57.854 1.00 70.14  ? 14  DC  D OP1   1 
ATOM   7204 O  OP2   . DC  D 3 13  ? 8.724   68.160  59.416 1.00 63.70  ? 14  DC  D OP2   1 
ATOM   7205 O  "O5'" . DC  D 3 13  ? 8.451   68.041  56.947 1.00 59.59  ? 14  DC  D "O5'" 1 
ATOM   7206 C  "C5'" . DC  D 3 13  ? 7.152   67.561  56.718 1.00 53.91  ? 14  DC  D "C5'" 1 
ATOM   7207 C  "C4'" . DC  D 3 13  ? 7.238   66.721  55.465 1.00 49.77  ? 14  DC  D "C4'" 1 
ATOM   7208 O  "O4'" . DC  D 3 13  ? 6.625   65.426  55.639 1.00 43.43  ? 14  DC  D "O4'" 1 
ATOM   7209 C  "C3'" . DC  D 3 13  ? 6.562   67.306  54.254 1.00 54.55  ? 14  DC  D "C3'" 1 
ATOM   7210 O  "O3'" . DC  D 3 13  ? 7.329   66.865  53.138 1.00 61.62  ? 14  DC  D "O3'" 1 
ATOM   7211 C  "C2'" . DC  D 3 13  ? 5.175   66.680  54.325 1.00 47.48  ? 14  DC  D "C2'" 1 
ATOM   7212 C  "C1'" . DC  D 3 13  ? 5.528   65.275  54.777 1.00 40.22  ? 14  DC  D "C1'" 1 
ATOM   7213 N  N1    . DC  D 3 13  ? 4.460   64.514  55.486 1.00 37.39  ? 14  DC  D N1    1 
ATOM   7214 C  C2    . DC  D 3 13  ? 3.794   63.542  54.746 1.00 35.73  ? 14  DC  D C2    1 
ATOM   7215 O  O2    . DC  D 3 13  ? 4.138   63.392  53.567 1.00 36.84  ? 14  DC  D O2    1 
ATOM   7216 N  N3    . DC  D 3 13  ? 2.816   62.810  55.339 1.00 34.76  ? 14  DC  D N3    1 
ATOM   7217 C  C4    . DC  D 3 13  ? 2.502   63.028  56.623 1.00 37.83  ? 14  DC  D C4    1 
ATOM   7218 N  N4    . DC  D 3 13  ? 1.530   62.279  57.166 1.00 31.22  ? 14  DC  D N4    1 
ATOM   7219 C  C5    . DC  D 3 13  ? 3.178   64.025  57.397 1.00 36.99  ? 14  DC  D C5    1 
ATOM   7220 C  C6    . DC  D 3 13  ? 4.138   64.740  56.793 1.00 37.76  ? 14  DC  D C6    1 
ATOM   7221 P  P     . DG  E 2 1   ? -5.896  4.792   30.892 1.00 71.02  ? 5   DG  P P     1 
ATOM   7222 O  OP1   . DG  E 2 1   ? -7.279  4.351   31.190 1.00 59.73  ? 5   DG  P OP1   1 
ATOM   7223 O  OP2   . DG  E 2 1   ? -5.496  5.072   29.497 1.00 55.08  ? 5   DG  P OP2   1 
ATOM   7224 O  "O5'" . DG  E 2 1   ? -4.859  3.709   31.453 1.00 50.23  ? 5   DG  P "O5'" 1 
ATOM   7225 C  "C5'" . DG  E 2 1   ? -5.325  2.566   32.137 1.00 43.59  ? 5   DG  P "C5'" 1 
ATOM   7226 C  "C4'" . DG  E 2 1   ? -4.232  1.910   32.958 1.00 51.67  ? 5   DG  P "C4'" 1 
ATOM   7227 O  "O4'" . DG  E 2 1   ? -3.545  0.904   32.159 1.00 56.24  ? 5   DG  P "O4'" 1 
ATOM   7228 C  "C3'" . DG  E 2 1   ? -3.150  2.852   33.452 1.00 49.50  ? 5   DG  P "C3'" 1 
ATOM   7229 O  "O3'" . DG  E 2 1   ? -2.804  2.382   34.749 1.00 50.88  ? 5   DG  P "O3'" 1 
ATOM   7230 C  "C2'" . DG  E 2 1   ? -2.026  2.682   32.425 1.00 43.42  ? 5   DG  P "C2'" 1 
ATOM   7231 C  "C1'" . DG  E 2 1   ? -2.164  1.210   32.047 1.00 46.46  ? 5   DG  P "C1'" 1 
ATOM   7232 N  N9    . DG  E 2 1   ? -1.649  0.854   30.717 1.00 42.36  ? 5   DG  P N9    1 
ATOM   7233 C  C8    . DG  E 2 1   ? -2.022  1.351   29.491 1.00 36.28  ? 5   DG  P C8    1 
ATOM   7234 N  N7    . DG  E 2 1   ? -1.372  0.826   28.486 1.00 30.05  ? 5   DG  P N7    1 
ATOM   7235 C  C5    . DG  E 2 1   ? -0.505  -0.087  29.076 1.00 32.69  ? 5   DG  P C5    1 
ATOM   7236 C  C6    . DG  E 2 1   ? 0.453   -0.965  28.501 1.00 34.35  ? 5   DG  P C6    1 
ATOM   7237 O  O6    . DG  E 2 1   ? 0.750   -1.130  27.309 1.00 36.82  ? 5   DG  P O6    1 
ATOM   7238 N  N1    . DG  E 2 1   ? 1.115   -1.714  29.469 1.00 30.14  ? 5   DG  P N1    1 
ATOM   7239 C  C2    . DG  E 2 1   ? 0.876   -1.627  30.817 1.00 31.03  ? 5   DG  P C2    1 
ATOM   7240 N  N2    . DG  E 2 1   ? 1.604   -2.423  31.605 1.00 33.90  ? 5   DG  P N2    1 
ATOM   7241 N  N3    . DG  E 2 1   ? -0.018  -0.823  31.370 1.00 31.53  ? 5   DG  P N3    1 
ATOM   7242 C  C4    . DG  E 2 1   ? -0.670  -0.082  30.445 1.00 35.51  ? 5   DG  P C4    1 
ATOM   7243 P  P     . DC  E 2 2   ? -1.872  3.259   35.718 1.00 51.50  ? 6   DC  P P     1 
ATOM   7244 O  OP1   . DC  E 2 2   ? -2.744  3.659   36.838 1.00 45.31  ? 6   DC  P OP1   1 
ATOM   7245 O  OP2   . DC  E 2 2   ? -1.156  4.293   34.924 1.00 38.97  ? 6   DC  P OP2   1 
ATOM   7246 O  "O5'" . DC  E 2 2   ? -0.798  2.200   36.251 1.00 40.47  ? 6   DC  P "O5'" 1 
ATOM   7247 C  "C5'" . DC  E 2 2   ? -0.493  1.095   35.431 1.00 35.97  ? 6   DC  P "C5'" 1 
ATOM   7248 C  "C4'" . DC  E 2 2   ? 0.896   0.564   35.719 1.00 36.77  ? 6   DC  P "C4'" 1 
ATOM   7249 O  "O4'" . DC  E 2 2   ? 1.500   0.087   34.493 1.00 45.63  ? 6   DC  P "O4'" 1 
ATOM   7250 C  "C3'" . DC  E 2 2   ? 1.871   1.561   36.312 1.00 30.86  ? 6   DC  P "C3'" 1 
ATOM   7251 O  "O3'" . DC  E 2 2   ? 2.737   0.849   37.166 1.00 32.70  ? 6   DC  P "O3'" 1 
ATOM   7252 C  "C2'" . DC  E 2 2   ? 2.597   2.073   35.076 1.00 38.81  ? 6   DC  P "C2'" 1 
ATOM   7253 C  "C1'" . DC  E 2 2   ? 2.667   0.822   34.210 1.00 34.76  ? 6   DC  P "C1'" 1 
ATOM   7254 N  N1    . DC  E 2 2   ? 2.666   1.047   32.742 1.00 31.92  ? 6   DC  P N1    1 
ATOM   7255 C  C2    . DC  E 2 2   ? 3.572   0.327   31.954 1.00 33.03  ? 6   DC  P C2    1 
ATOM   7256 O  O2    . DC  E 2 2   ? 4.351   -0.459  32.504 1.00 31.24  ? 6   DC  P O2    1 
ATOM   7257 N  N3    . DC  E 2 2   ? 3.575   0.521   30.611 1.00 32.83  ? 6   DC  P N3    1 
ATOM   7258 C  C4    . DC  E 2 2   ? 2.709   1.382   30.067 1.00 31.80  ? 6   DC  P C4    1 
ATOM   7259 N  N4    . DC  E 2 2   ? 2.737   1.542   28.742 1.00 32.79  ? 6   DC  P N4    1 
ATOM   7260 C  C5    . DC  E 2 2   ? 1.773   2.121   30.852 1.00 26.35  ? 6   DC  P C5    1 
ATOM   7261 C  C6    . DC  E 2 2   ? 1.782   1.920   32.176 1.00 29.33  ? 6   DC  P C6    1 
ATOM   7262 P  P     . DG  E 2 3   ? 3.710   1.628   38.176 1.00 51.98  ? 7   DG  P P     1 
ATOM   7263 O  OP1   . DG  E 2 3   ? 3.572   0.973   39.495 1.00 45.36  ? 7   DG  P OP1   1 
ATOM   7264 O  OP2   . DG  E 2 3   ? 3.458   3.080   38.024 1.00 49.79  ? 7   DG  P OP2   1 
ATOM   7265 O  "O5'" . DG  E 2 3   ? 5.179   1.316   37.638 1.00 40.63  ? 7   DG  P "O5'" 1 
ATOM   7266 C  "C5'" . DG  E 2 3   ? 5.544   0.011   37.291 1.00 34.36  ? 7   DG  P "C5'" 1 
ATOM   7267 C  "C4'" . DG  E 2 3   ? 6.958   -0.019  36.742 1.00 37.47  ? 7   DG  P "C4'" 1 
ATOM   7268 O  "O4'" . DG  E 2 3   ? 6.918   0.148   35.300 1.00 40.72  ? 7   DG  P "O4'" 1 
ATOM   7269 C  "C3'" . DG  E 2 3   ? 7.910   1.046   37.271 1.00 35.30  ? 7   DG  P "C3'" 1 
ATOM   7270 O  "O3'" . DG  E 2 3   ? 9.181   0.414   37.387 1.00 39.39  ? 7   DG  P "O3'" 1 
ATOM   7271 C  "C2'" . DG  E 2 3   ? 7.862   2.110   36.169 1.00 32.06  ? 7   DG  P "C2'" 1 
ATOM   7272 C  "C1'" . DG  E 2 3   ? 7.675   1.273   34.911 1.00 30.97  ? 7   DG  P "C1'" 1 
ATOM   7273 N  N9    . DG  E 2 3   ? 6.952   1.912   33.810 1.00 32.93  ? 7   DG  P N9    1 
ATOM   7274 C  C8    . DG  E 2 3   ? 5.941   2.840   33.866 1.00 32.91  ? 7   DG  P C8    1 
ATOM   7275 N  N7    . DG  E 2 3   ? 5.503   3.208   32.692 1.00 28.08  ? 7   DG  P N7    1 
ATOM   7276 C  C5    . DG  E 2 3   ? 6.269   2.471   31.795 1.00 30.07  ? 7   DG  P C5    1 
ATOM   7277 C  C6    . DG  E 2 3   ? 6.254   2.439   30.376 1.00 32.95  ? 7   DG  P C6    1 
ATOM   7278 O  O6    . DG  E 2 3   ? 5.529   3.080   29.598 1.00 31.93  ? 7   DG  P O6    1 
ATOM   7279 N  N1    . DG  E 2 3   ? 7.206   1.548   29.876 1.00 32.22  ? 7   DG  P N1    1 
ATOM   7280 C  C2    . DG  E 2 3   ? 8.058   0.786   30.647 1.00 31.97  ? 7   DG  P C2    1 
ATOM   7281 N  N2    . DG  E 2 3   ? 8.915   -0.023  30.008 1.00 32.59  ? 7   DG  P N2    1 
ATOM   7282 N  N3    . DG  E 2 3   ? 8.080   0.809   31.968 1.00 29.31  ? 7   DG  P N3    1 
ATOM   7283 C  C4    . DG  E 2 3   ? 7.163   1.671   32.471 1.00 33.14  ? 7   DG  P C4    1 
ATOM   7284 P  P     . DG  E 2 4   ? 10.453  1.258   37.865 1.00 42.27  ? 8   DG  P P     1 
ATOM   7285 O  OP1   . DG  E 2 4   ? 10.878  0.740   39.190 1.00 38.56  ? 8   DG  P OP1   1 
ATOM   7286 O  OP2   . DG  E 2 4   ? 10.134  2.700   37.708 1.00 35.91  ? 8   DG  P OP2   1 
ATOM   7287 O  "O5'" . DG  E 2 4   ? 11.567  0.867   36.794 1.00 44.87  ? 8   DG  P "O5'" 1 
ATOM   7288 C  "C5'" . DG  E 2 4   ? 11.549  -0.418  36.145 1.00 40.37  ? 8   DG  P "C5'" 1 
ATOM   7289 C  "C4'" . DG  E 2 4   ? 12.474  -0.412  34.951 1.00 35.03  ? 8   DG  P "C4'" 1 
ATOM   7290 O  "O4'" . DG  E 2 4   ? 11.781  0.148   33.809 1.00 39.06  ? 8   DG  P "O4'" 1 
ATOM   7291 C  "C3'" . DG  E 2 4   ? 13.737  0.431   35.125 1.00 37.34  ? 8   DG  P "C3'" 1 
ATOM   7292 O  "O3'" . DG  E 2 4   ? 14.834  -0.169  34.429 1.00 42.16  ? 8   DG  P "O3'" 1 
ATOM   7293 C  "C2'" . DG  E 2 4   ? 13.359  1.754   34.488 1.00 37.88  ? 8   DG  P "C2'" 1 
ATOM   7294 C  "C1'" . DG  E 2 4   ? 12.444  1.320   33.356 1.00 35.96  ? 8   DG  P "C1'" 1 
ATOM   7295 N  N9    . DG  E 2 4   ? 11.423  2.301   33.003 1.00 33.77  ? 8   DG  P N9    1 
ATOM   7296 C  C8    . DG  E 2 4   ? 10.645  3.033   33.867 1.00 34.57  ? 8   DG  P C8    1 
ATOM   7297 N  N7    . DG  E 2 4   ? 9.815   3.835   33.256 1.00 28.93  ? 8   DG  P N7    1 
ATOM   7298 C  C5    . DG  E 2 4   ? 10.060  3.618   31.906 1.00 30.66  ? 8   DG  P C5    1 
ATOM   7299 C  C6    . DG  E 2 4   ? 9.464   4.203   30.759 1.00 29.84  ? 8   DG  P C6    1 
ATOM   7300 O  O6    . DG  E 2 4   ? 8.571   5.058   30.704 1.00 31.24  ? 8   DG  P O6    1 
ATOM   7301 N  N1    . DG  E 2 4   ? 10.012  3.696   29.585 1.00 29.93  ? 8   DG  P N1    1 
ATOM   7302 C  C2    . DG  E 2 4   ? 11.003  2.748   29.521 1.00 33.93  ? 8   DG  P C2    1 
ATOM   7303 N  N2    . DG  E 2 4   ? 11.398  2.388   28.291 1.00 32.07  ? 8   DG  P N2    1 
ATOM   7304 N  N3    . DG  E 2 4   ? 11.567  2.196   30.582 1.00 32.27  ? 8   DG  P N3    1 
ATOM   7305 C  C4    . DG  E 2 4   ? 11.050  2.674   31.734 1.00 30.97  ? 8   DG  P C4    1 
ATOM   7306 P  P     . DA  E 2 5   ? 16.301  0.458   34.555 1.00 54.75  ? 9   DA  P P     1 
ATOM   7307 O  OP1   . DA  E 2 5   ? 17.274  -0.661  34.632 1.00 69.56  ? 9   DA  P OP1   1 
ATOM   7308 O  OP2   . DA  E 2 5   ? 16.272  1.482   35.630 1.00 52.62  ? 9   DA  P OP2   1 
ATOM   7309 O  "O5'" . DA  E 2 5   ? 16.497  1.198   33.158 1.00 41.30  ? 9   DA  P "O5'" 1 
ATOM   7310 C  "C5'" . DA  E 2 5   ? 15.396  1.353   32.242 1.00 41.13  ? 9   DA  P "C5'" 1 
ATOM   7311 C  "C4'" . DA  E 2 5   ? 15.882  1.936   30.936 1.00 45.10  ? 9   DA  P "C4'" 1 
ATOM   7312 O  "O4'" . DA  E 2 5   ? 14.836  2.750   30.354 1.00 40.85  ? 9   DA  P "O4'" 1 
ATOM   7313 C  "C3'" . DA  E 2 5   ? 17.102  2.848   31.058 1.00 43.37  ? 9   DA  P "C3'" 1 
ATOM   7314 O  "O3'" . DA  E 2 5   ? 17.934  2.722   29.901 1.00 54.71  ? 9   DA  P "O3'" 1 
ATOM   7315 C  "C2'" . DA  E 2 5   ? 16.490  4.234   31.127 1.00 46.76  ? 9   DA  P "C2'" 1 
ATOM   7316 C  "C1'" . DA  E 2 5   ? 15.272  4.097   30.227 1.00 36.42  ? 9   DA  P "C1'" 1 
ATOM   7317 N  N9    . DA  E 2 5   ? 14.155  4.964   30.595 1.00 38.04  ? 9   DA  P N9    1 
ATOM   7318 C  C8    . DA  E 2 5   ? 13.807  5.404   31.848 1.00 33.39  ? 9   DA  P C8    1 
ATOM   7319 N  N7    . DA  E 2 5   ? 12.749  6.177   31.863 1.00 31.52  ? 9   DA  P N7    1 
ATOM   7320 C  C5    . DA  E 2 5   ? 12.372  6.252   30.529 1.00 31.38  ? 9   DA  P C5    1 
ATOM   7321 C  C6    . DA  E 2 5   ? 11.320  6.920   29.879 1.00 33.99  ? 9   DA  P C6    1 
ATOM   7322 N  N6    . DA  E 2 5   ? 10.417  7.672   30.512 1.00 30.96  ? 9   DA  P N6    1 
ATOM   7323 N  N1    . DA  E 2 5   ? 11.227  6.788   28.538 1.00 32.55  ? 9   DA  P N1    1 
ATOM   7324 C  C2    . DA  E 2 5   ? 12.133  6.034   27.904 1.00 32.30  ? 9   DA  P C2    1 
ATOM   7325 N  N3    . DA  E 2 5   ? 13.165  5.358   28.403 1.00 31.68  ? 9   DA  P N3    1 
ATOM   7326 C  C4    . DA  E 2 5   ? 13.230  5.510   29.737 1.00 32.92  ? 9   DA  P C4    1 
ATOM   7327 P  P     . DT  E 2 6   ? 19.181  3.704   29.702 1.00 58.80  ? 10  DT  P P     1 
ATOM   7328 O  OP1   . DT  E 2 6   ? 20.364  2.880   29.348 1.00 62.50  ? 10  DT  P OP1   1 
ATOM   7329 O  OP2   . DT  E 2 6   ? 19.243  4.613   30.875 1.00 48.99  ? 10  DT  P OP2   1 
ATOM   7330 O  "O5'" . DT  E 2 6   ? 18.765  4.559   28.423 1.00 51.35  ? 10  DT  P "O5'" 1 
ATOM   7331 C  "C5'" . DT  E 2 6   ? 17.983  3.973   27.366 1.00 46.77  ? 10  DT  P "C5'" 1 
ATOM   7332 C  "C4'" . DT  E 2 6   ? 17.794  4.968   26.244 1.00 37.19  ? 10  DT  P "C4'" 1 
ATOM   7333 O  "O4'" . DT  E 2 6   ? 16.606  5.755   26.496 1.00 34.10  ? 10  DT  P "O4'" 1 
ATOM   7334 C  "C3'" . DT  E 2 6   ? 18.934  5.973   26.084 1.00 33.09  ? 10  DT  P "C3'" 1 
ATOM   7335 O  "O3'" . DT  E 2 6   ? 19.113  6.303   24.703 1.00 31.33  ? 10  DT  P "O3'" 1 
ATOM   7336 C  "C2'" . DT  E 2 6   ? 18.442  7.179   26.862 1.00 34.54  ? 10  DT  P "C2'" 1 
ATOM   7337 C  "C1'" . DT  E 2 6   ? 16.942  7.130   26.623 1.00 30.79  ? 10  DT  P "C1'" 1 
ATOM   7338 N  N1    . DT  E 2 6   ? 16.137  7.692   27.721 1.00 29.61  ? 10  DT  P N1    1 
ATOM   7339 C  C2    . DT  E 2 6   ? 15.048  8.468   27.400 1.00 27.75  ? 10  DT  P C2    1 
ATOM   7340 O  O2    . DT  E 2 6   ? 14.720  8.713   26.250 1.00 24.80  ? 10  DT  P O2    1 
ATOM   7341 N  N3    . DT  E 2 6   ? 14.353  8.952   28.480 1.00 28.02  ? 10  DT  P N3    1 
ATOM   7342 C  C4    . DT  E 2 6   ? 14.632  8.740   29.817 1.00 29.02  ? 10  DT  P C4    1 
ATOM   7343 O  O4    . DT  E 2 6   ? 13.916  9.241   30.679 1.00 33.57  ? 10  DT  P O4    1 
ATOM   7344 C  C5    . DT  E 2 6   ? 15.789  7.916   30.081 1.00 27.02  ? 10  DT  P C5    1 
ATOM   7345 C  C7    . DT  E 2 6   ? 16.170  7.631   31.499 1.00 24.92  ? 10  DT  P C7    1 
ATOM   7346 C  C6    . DT  E 2 6   ? 16.474  7.439   29.033 1.00 30.68  ? 10  DT  P C6    1 
ATOM   7347 P  P     . DC  E 2 7   ? 20.338  7.230   24.255 1.00 31.84  ? 11  DC  P P     1 
ATOM   7348 O  OP1   . DC  E 2 7   ? 21.135  6.484   23.248 1.00 37.26  ? 11  DC  P OP1   1 
ATOM   7349 O  OP2   . DC  E 2 7   ? 21.000  7.743   25.481 1.00 31.62  ? 11  DC  P OP2   1 
ATOM   7350 O  "O5'" . DC  E 2 7   ? 19.619  8.447   23.522 1.00 33.58  ? 11  DC  P "O5'" 1 
ATOM   7351 C  "C5'" . DC  E 2 7   ? 18.218  8.711   23.729 1.00 31.50  ? 11  DC  P "C5'" 1 
ATOM   7352 C  "C4'" . DC  E 2 7   ? 17.874  10.104  23.254 1.00 40.05  ? 11  DC  P "C4'" 1 
ATOM   7353 O  "O4'" . DC  E 2 7   ? 16.910  10.695  24.157 1.00 37.77  ? 11  DC  P "O4'" 1 
ATOM   7354 C  "C3'" . DC  E 2 7   ? 19.053  11.074  23.211 1.00 40.64  ? 11  DC  P "C3'" 1 
ATOM   7355 O  "O3'" . DC  E 2 7   ? 18.902  11.992  22.124 1.00 40.43  ? 11  DC  P "O3'" 1 
ATOM   7356 C  "C2'" . DC  E 2 7   ? 18.952  11.799  24.539 1.00 37.30  ? 11  DC  P "C2'" 1 
ATOM   7357 C  "C1'" . DC  E 2 7   ? 17.449  11.862  24.761 1.00 34.89  ? 11  DC  P "C1'" 1 
ATOM   7358 N  N1    . DC  E 2 7   ? 17.049  11.864  26.175 1.00 36.58  ? 11  DC  P N1    1 
ATOM   7359 C  C2    . DC  E 2 7   ? 15.856  12.494  26.537 1.00 34.04  ? 11  DC  P C2    1 
ATOM   7360 O  O2    . DC  E 2 7   ? 15.172  13.034  25.654 1.00 32.14  ? 11  DC  P O2    1 
ATOM   7361 N  N3    . DC  E 2 7   ? 15.478  12.501  27.836 1.00 30.17  ? 11  DC  P N3    1 
ATOM   7362 C  C4    . DC  E 2 7   ? 16.243  11.909  28.755 1.00 30.07  ? 11  DC  P C4    1 
ATOM   7363 N  N4    . DC  E 2 7   ? 15.833  11.939  30.025 1.00 26.91  ? 11  DC  P N4    1 
ATOM   7364 C  C5    . DC  E 2 7   ? 17.465  11.258  28.414 1.00 32.35  ? 11  DC  P C5    1 
ATOM   7365 C  C6    . DC  E 2 7   ? 17.825  11.260  27.124 1.00 35.97  ? 11  DC  P C6    1 
ATOM   7366 P  P     . DA  E 2 8   ? 19.825  13.296  22.043 1.00 38.07  ? 12  DA  P P     1 
ATOM   7367 O  OP1   . DA  E 2 8   ? 20.069  13.599  20.609 1.00 38.83  ? 12  DA  P OP1   1 
ATOM   7368 O  OP2   . DA  E 2 8   ? 20.977  13.101  22.959 1.00 38.12  ? 12  DA  P OP2   1 
ATOM   7369 O  "O5'" . DA  E 2 8   ? 18.889  14.437  22.643 1.00 38.81  ? 12  DA  P "O5'" 1 
ATOM   7370 C  "C5'" . DA  E 2 8   ? 17.738  14.907  21.917 1.00 38.99  ? 12  DA  P "C5'" 1 
ATOM   7371 C  "C4'" . DA  E 2 8   ? 17.440  16.342  22.284 1.00 46.39  ? 12  DA  P "C4'" 1 
ATOM   7372 O  "O4'" . DA  E 2 8   ? 16.822  16.385  23.592 1.00 41.51  ? 12  DA  P "O4'" 1 
ATOM   7373 C  "C3'" . DA  E 2 8   ? 18.668  17.246  22.374 1.00 46.38  ? 12  DA  P "C3'" 1 
ATOM   7374 O  "O3'" . DA  E 2 8   ? 18.341  18.572  21.946 1.00 49.90  ? 12  DA  P "O3'" 1 
ATOM   7375 C  "C2'" . DA  E 2 8   ? 19.002  17.229  23.853 1.00 47.05  ? 12  DA  P "C2'" 1 
ATOM   7376 C  "C1'" . DA  E 2 8   ? 17.628  17.130  24.495 1.00 47.01  ? 12  DA  P "C1'" 1 
ATOM   7377 N  N9    . DA  E 2 8   ? 17.616  16.437  25.782 1.00 42.69  ? 12  DA  P N9    1 
ATOM   7378 C  C8    . DA  E 2 8   ? 18.553  15.564  26.276 1.00 40.37  ? 12  DA  P C8    1 
ATOM   7379 N  N7    . DA  E 2 8   ? 18.266  15.100  27.468 1.00 40.96  ? 12  DA  P N7    1 
ATOM   7380 C  C5    . DA  E 2 8   ? 17.059  15.708  27.781 1.00 40.01  ? 12  DA  P C5    1 
ATOM   7381 C  C6    . DA  E 2 8   ? 16.225  15.630  28.910 1.00 36.70  ? 12  DA  P C6    1 
ATOM   7382 N  N6    . DA  E 2 8   ? 16.493  14.876  29.978 1.00 31.75  ? 12  DA  P N6    1 
ATOM   7383 N  N1    . DA  E 2 8   ? 15.091  16.365  28.905 1.00 31.93  ? 12  DA  P N1    1 
ATOM   7384 C  C2    . DA  E 2 8   ? 14.823  17.121  27.833 1.00 30.77  ? 12  DA  P C2    1 
ATOM   7385 N  N3    . DA  E 2 8   ? 15.527  17.277  26.714 1.00 40.30  ? 12  DA  P N3    1 
ATOM   7386 C  C4    . DA  E 2 8   ? 16.646  16.534  26.751 1.00 40.44  ? 12  DA  P C4    1 
ATOM   7387 P  P     . DG  E 2 9   ? 19.467  19.709  21.933 1.00 62.98  ? 13  DG  P P     1 
ATOM   7388 O  OP1   . DG  E 2 9   ? 19.901  19.892  20.571 1.00 62.54  ? 13  DG  P OP1   1 
ATOM   7389 O  OP2   . DG  E 2 9   ? 20.460  19.374  22.948 1.00 47.90  ? 13  DG  P OP2   1 
ATOM   7390 O  "O5'" . DG  E 2 9   ? 18.659  21.016  22.306 1.00 52.62  ? 13  DG  P "O5'" 1 
ATOM   7391 C  "C5'" . DG  E 2 9   ? 17.397  20.961  22.976 1.00 53.03  ? 13  DG  P "C5'" 1 
ATOM   7392 C  "C4'" . DG  E 2 9   ? 17.397  21.858  24.191 1.00 46.94  ? 13  DG  P "C4'" 1 
ATOM   7393 O  "O4'" . DG  E 2 9   ? 17.343  21.036  25.372 1.00 50.42  ? 13  DG  P "O4'" 1 
ATOM   7394 C  "C3'" . DG  E 2 9   ? 18.627  22.749  24.359 1.00 51.50  ? 13  DG  P "C3'" 1 
ATOM   7395 O  "O3'" . DG  E 2 9   ? 18.310  24.010  24.925 1.00 57.71  ? 13  DG  P "O3'" 1 
ATOM   7396 C  "C2'" . DG  E 2 9   ? 19.419  22.054  25.437 1.00 53.00  ? 13  DG  P "C2'" 1 
ATOM   7397 C  "C1'" . DG  E 2 9   ? 18.311  21.498  26.285 1.00 52.98  ? 13  DG  P "C1'" 1 
ATOM   7398 N  N9    . DG  E 2 9   ? 18.737  20.377  27.101 1.00 45.87  ? 13  DG  P N9    1 
ATOM   7399 C  C8    . DG  E 2 9   ? 19.866  19.620  26.932 1.00 46.88  ? 13  DG  P C8    1 
ATOM   7400 N  N7    . DG  E 2 9   ? 20.009  18.705  27.848 1.00 45.23  ? 13  DG  P N7    1 
ATOM   7401 C  C5    . DG  E 2 9   ? 18.912  18.876  28.675 1.00 47.23  ? 13  DG  P C5    1 
ATOM   7402 C  C6    . DG  E 2 9   ? 18.522  18.173  29.837 1.00 45.04  ? 13  DG  P C6    1 
ATOM   7403 O  O6    . DG  E 2 9   ? 19.083  17.226  30.389 1.00 41.78  ? 13  DG  P O6    1 
ATOM   7404 N  N1    . DG  E 2 9   ? 17.350  18.686  30.371 1.00 43.87  ? 13  DG  P N1    1 
ATOM   7405 C  C2    . DG  E 2 9   ? 16.630  19.721  29.844 1.00 41.34  ? 13  DG  P C2    1 
ATOM   7406 N  N2    . DG  E 2 9   ? 15.528  20.065  30.506 1.00 36.63  ? 13  DG  P N2    1 
ATOM   7407 N  N3    . DG  E 2 9   ? 16.974  20.377  28.756 1.00 44.99  ? 13  DG  P N3    1 
ATOM   7408 C  C4    . DG  E 2 9   ? 18.124  19.912  28.233 1.00 47.04  ? 13  DG  P C4    1 
ATOM   7409 C  "C5'" . DA  F 3 1   ? 32.041  15.974  53.315 1.00 68.77  ? 2   DA  T "C5'" 1 
ATOM   7410 C  "C4'" . DA  F 3 1   ? 30.804  16.694  52.831 1.00 70.93  ? 2   DA  T "C4'" 1 
ATOM   7411 O  "O4'" . DA  F 3 1   ? 31.092  18.097  52.695 1.00 70.14  ? 2   DA  T "O4'" 1 
ATOM   7412 C  "C3'" . DA  F 3 1   ? 30.286  16.226  51.471 1.00 75.55  ? 2   DA  T "C3'" 1 
ATOM   7413 O  "O3'" . DA  F 3 1   ? 28.955  15.683  51.628 1.00 76.80  ? 2   DA  T "O3'" 1 
ATOM   7414 C  "C2'" . DA  F 3 1   ? 30.213  17.478  50.604 1.00 69.48  ? 2   DA  T "C2'" 1 
ATOM   7415 C  "C1'" . DA  F 3 1   ? 30.410  18.623  51.576 1.00 67.72  ? 2   DA  T "C1'" 1 
ATOM   7416 N  N9    . DA  F 3 1   ? 31.251  19.663  51.011 1.00 68.29  ? 2   DA  T N9    1 
ATOM   7417 C  C8    . DA  F 3 1   ? 32.620  19.694  50.960 1.00 69.35  ? 2   DA  T C8    1 
ATOM   7418 N  N7    . DA  F 3 1   ? 33.098  20.777  50.372 1.00 78.24  ? 2   DA  T N7    1 
ATOM   7419 C  C5    . DA  F 3 1   ? 31.958  21.491  49.998 1.00 79.65  ? 2   DA  T C5    1 
ATOM   7420 C  C6    . DA  F 3 1   ? 31.753  22.724  49.331 1.00 81.28  ? 2   DA  T C6    1 
ATOM   7421 N  N6    . DA  F 3 1   ? 32.755  23.494  48.898 1.00 76.80  ? 2   DA  T N6    1 
ATOM   7422 N  N1    . DA  F 3 1   ? 30.481  23.128  49.127 1.00 76.67  ? 2   DA  T N1    1 
ATOM   7423 C  C2    . DA  F 3 1   ? 29.482  22.352  49.561 1.00 74.68  ? 2   DA  T C2    1 
ATOM   7424 N  N3    . DA  F 3 1   ? 29.537  21.182  50.193 1.00 75.51  ? 2   DA  T N3    1 
ATOM   7425 C  C4    . DA  F 3 1   ? 30.817  20.807  50.379 1.00 75.52  ? 2   DA  T C4    1 
ATOM   7426 P  P     . DT  F 3 2   ? 28.167  15.059  50.360 1.00 71.32  ? 3   DT  T P     1 
ATOM   7427 O  OP1   . DT  F 3 2   ? 26.862  14.512  50.798 1.00 61.66  ? 3   DT  T OP1   1 
ATOM   7428 O  OP2   . DT  F 3 2   ? 29.113  14.157  49.663 1.00 64.57  ? 3   DT  T OP2   1 
ATOM   7429 O  "O5'" . DT  F 3 2   ? 27.877  16.318  49.411 1.00 77.78  ? 3   DT  T "O5'" 1 
ATOM   7430 C  "C5'" . DT  F 3 2   ? 26.584  16.874  49.209 1.00 72.62  ? 3   DT  T "C5'" 1 
ATOM   7431 C  "C4'" . DT  F 3 2   ? 26.724  17.937  48.138 1.00 72.21  ? 3   DT  T "C4'" 1 
ATOM   7432 O  "O4'" . DT  F 3 2   ? 27.993  18.601  48.316 1.00 76.02  ? 3   DT  T "O4'" 1 
ATOM   7433 C  "C3'" . DT  F 3 2   ? 26.796  17.444  46.699 1.00 64.87  ? 3   DT  T "C3'" 1 
ATOM   7434 O  "O3'" . DT  F 3 2   ? 25.512  17.469  46.140 1.00 57.97  ? 3   DT  T "O3'" 1 
ATOM   7435 C  "C2'" . DT  F 3 2   ? 27.673  18.451  45.960 1.00 60.73  ? 3   DT  T "C2'" 1 
ATOM   7436 C  "C1'" . DT  F 3 2   ? 28.460  19.112  47.081 1.00 67.97  ? 3   DT  T "C1'" 1 
ATOM   7437 N  N1    . DT  F 3 2   ? 29.909  18.836  47.009 1.00 67.66  ? 3   DT  T N1    1 
ATOM   7438 C  C2    . DT  F 3 2   ? 30.768  19.888  46.797 1.00 70.70  ? 3   DT  T C2    1 
ATOM   7439 O  O2    . DT  F 3 2   ? 30.396  21.044  46.670 1.00 71.99  ? 3   DT  T O2    1 
ATOM   7440 N  N3    . DT  F 3 2   ? 32.091  19.529  46.762 1.00 70.17  ? 3   DT  T N3    1 
ATOM   7441 C  C4    . DT  F 3 2   ? 32.619  18.257  46.902 1.00 67.81  ? 3   DT  T C4    1 
ATOM   7442 O  O4    . DT  F 3 2   ? 33.825  18.045  46.846 1.00 65.27  ? 3   DT  T O4    1 
ATOM   7443 C  C5    . DT  F 3 2   ? 31.657  17.204  47.116 1.00 70.76  ? 3   DT  T C5    1 
ATOM   7444 C  C7    . DT  F 3 2   ? 32.109  15.782  47.282 1.00 67.84  ? 3   DT  T C7    1 
ATOM   7445 C  C6    . DT  F 3 2   ? 30.362  17.540  47.157 1.00 69.52  ? 3   DT  T C6    1 
ATOM   7446 P  P     . DG  F 3 3   ? 24.910  16.155  45.460 1.00 55.11  ? 4   DG  T P     1 
ATOM   7447 O  OP1   . DG  F 3 3   ? 23.460  16.394  45.280 1.00 48.70  ? 4   DG  T OP1   1 
ATOM   7448 O  OP2   . DG  F 3 3   ? 25.385  14.964  46.206 1.00 53.01  ? 4   DG  T OP2   1 
ATOM   7449 O  "O5'" . DG  F 3 3   ? 25.617  16.138  44.033 1.00 50.01  ? 4   DG  T "O5'" 1 
ATOM   7450 C  "C5'" . DG  F 3 3   ? 25.488  17.268  43.195 1.00 52.19  ? 4   DG  T "C5'" 1 
ATOM   7451 C  "C4'" . DG  F 3 3   ? 25.304  16.776  41.782 1.00 44.89  ? 4   DG  T "C4'" 1 
ATOM   7452 O  "O4'" . DG  F 3 3   ? 26.528  16.117  41.395 1.00 50.99  ? 4   DG  T "O4'" 1 
ATOM   7453 C  "C3'" . DG  F 3 3   ? 24.189  15.753  41.635 1.00 36.31  ? 4   DG  T "C3'" 1 
ATOM   7454 O  "O3'" . DG  F 3 3   ? 23.498  16.009  40.444 1.00 34.59  ? 4   DG  T "O3'" 1 
ATOM   7455 C  "C2'" . DG  F 3 3   ? 24.918  14.423  41.542 1.00 42.56  ? 4   DG  T "C2'" 1 
ATOM   7456 C  "C1'" . DG  F 3 3   ? 26.237  14.830  40.905 1.00 48.05  ? 4   DG  T "C1'" 1 
ATOM   7457 N  N9    . DG  F 3 3   ? 27.327  13.974  41.341 1.00 48.17  ? 4   DG  T N9    1 
ATOM   7458 C  C8    . DG  F 3 3   ? 27.574  13.548  42.625 1.00 50.35  ? 4   DG  T C8    1 
ATOM   7459 N  N7    . DG  F 3 3   ? 28.626  12.790  42.732 1.00 48.56  ? 4   DG  T N7    1 
ATOM   7460 C  C5    . DG  F 3 3   ? 29.105  12.719  41.430 1.00 50.26  ? 4   DG  T C5    1 
ATOM   7461 C  C6    . DG  F 3 3   ? 30.228  12.031  40.921 1.00 58.84  ? 4   DG  T C6    1 
ATOM   7462 O  O6    . DG  F 3 3   ? 31.041  11.335  41.550 1.00 63.44  ? 4   DG  T O6    1 
ATOM   7463 N  N1    . DG  F 3 3   ? 30.363  12.207  39.542 1.00 55.80  ? 4   DG  T N1    1 
ATOM   7464 C  C2    . DG  F 3 3   ? 29.516  12.960  38.760 1.00 51.04  ? 4   DG  T C2    1 
ATOM   7465 N  N2    . DG  F 3 3   ? 29.803  13.016  37.451 1.00 51.81  ? 4   DG  T N2    1 
ATOM   7466 N  N3    . DG  F 3 3   ? 28.457  13.613  39.225 1.00 48.99  ? 4   DG  T N3    1 
ATOM   7467 C  C4    . DG  F 3 3   ? 28.320  13.443  40.562 1.00 48.59  ? 4   DG  T C4    1 
HETATM 7468 O  O1    . VKJ F 3 4   ? 21.663  18.580  32.415 1.00 45.92  ? 5   VKJ T O1    1 
HETATM 7469 C  C1    . VKJ F 3 4   ? 20.968  19.182  33.266 1.00 47.35  ? 5   VKJ T C1    1 
HETATM 7470 N  N1    . VKJ F 3 4   ? 20.197  20.243  32.921 1.00 49.41  ? 5   VKJ T N1    1 
HETATM 7471 C  C2    . VKJ F 3 4   ? 19.441  20.902  33.838 1.00 39.66  ? 5   VKJ T C2    1 
HETATM 7472 N  N2    . VKJ F 3 4   ? 18.692  21.956  33.427 1.00 40.85  ? 5   VKJ T N2    1 
HETATM 7473 N  N3    . VKJ F 3 4   ? 19.438  20.510  35.130 1.00 39.00  ? 5   VKJ T N3    1 
HETATM 7474 C  C3    . VKJ F 3 4   ? 20.203  19.451  35.507 1.00 40.25  ? 5   VKJ T C3    1 
HETATM 7475 C  C4    . VKJ F 3 4   ? 20.980  18.765  34.586 1.00 39.71  ? 5   VKJ T C4    1 
HETATM 7476 N  N4    . VKJ F 3 4   ? 21.626  17.773  35.236 1.00 34.12  ? 5   VKJ T N4    1 
HETATM 7477 C  C5    . VKJ F 3 4   ? 21.254  17.847  36.529 1.00 36.90  ? 5   VKJ T C5    1 
HETATM 7478 N  N5    . VKJ F 3 4   ? 20.390  18.861  36.683 1.00 37.32  ? 5   VKJ T N5    1 
HETATM 7479 C  C6    . VKJ F 3 4   ? 19.739  19.297  37.941 1.00 35.84  ? 5   VKJ T C6    1 
HETATM 7480 O  O2    . VKJ F 3 4   ? 20.732  19.633  38.915 1.00 33.13  ? 5   VKJ T O2    1 
HETATM 7481 C  C7    . VKJ F 3 4   ? 18.879  18.198  38.542 1.00 33.97  ? 5   VKJ T C7    1 
HETATM 7482 C  C8    . VKJ F 3 4   ? 18.983  18.497  40.014 1.00 30.01  ? 5   VKJ T C8    1 
HETATM 7483 O  O3    . VKJ F 3 4   ? 17.982  19.457  40.304 1.00 21.86  ? 5   VKJ T O3    1 
HETATM 7484 C  C9    . VKJ F 3 4   ? 20.357  19.118  40.192 1.00 30.10  ? 5   VKJ T C9    1 
HETATM 7485 C  C10   . VKJ F 3 4   ? 21.384  18.091  40.657 1.00 34.86  ? 5   VKJ T C10   1 
HETATM 7486 O  O4    . VKJ F 3 4   ? 21.276  16.918  39.843 1.00 35.22  ? 5   VKJ T O4    1 
HETATM 7487 P  P1    . VKJ F 3 4   ? 21.982  15.560  40.301 1.00 35.89  ? 5   VKJ T P1    1 
HETATM 7488 O  O5    . VKJ F 3 4   ? 21.523  15.223  41.666 1.00 32.35  ? 5   VKJ T O5    1 
HETATM 7489 O  O6    . VKJ F 3 4   ? 21.879  14.575  39.200 1.00 44.93  ? 5   VKJ T O6    1 
HETATM 7490 O  O7    . VKJ F 3 4   ? 15.513  23.454  34.256 1.00 47.46  ? 5   VKJ T O7    1 
HETATM 7491 C  C11   . VKJ F 3 4   ? 16.550  22.834  33.488 1.00 41.96  ? 5   VKJ T C11   1 
HETATM 7492 C  C12   . VKJ F 3 4   ? 17.832  22.735  34.308 1.00 45.68  ? 5   VKJ T C12   1 
HETATM 7493 C  C13   . VKJ F 3 4   ? 18.515  24.094  34.474 1.00 50.55  ? 5   VKJ T C13   1 
HETATM 7494 C  C14   . VKJ F 3 4   ? 16.724  23.583  32.167 1.00 53.80  ? 5   VKJ T C14   1 
HETATM 7495 O  O8    . VKJ F 3 4   ? 15.407  23.880  31.689 1.00 59.67  ? 5   VKJ T O8    1 
HETATM 7496 C  C15   . VKJ F 3 4   ? 17.544  24.876  32.263 1.00 53.16  ? 5   VKJ T C15   1 
HETATM 7497 O  O9    . VKJ F 3 4   ? 18.779  24.721  31.569 1.00 61.33  ? 5   VKJ T O9    1 
HETATM 7498 C  C16   . VKJ F 3 4   ? 17.840  25.168  33.674 1.00 51.47  ? 5   VKJ T C16   1 
HETATM 7499 C  C17   . VKJ F 3 4   ? 17.491  26.434  34.152 1.00 61.62  ? 5   VKJ T C17   1 
HETATM 7500 C  C18   . VKJ F 3 4   ? 17.725  26.798  35.471 1.00 62.80  ? 5   VKJ T C18   1 
HETATM 7501 C  C19   . VKJ F 3 4   ? 18.360  25.809  36.364 1.00 65.18  ? 5   VKJ T C19   1 
HETATM 7502 C  C20   . VKJ F 3 4   ? 18.734  24.460  35.884 1.00 57.70  ? 5   VKJ T C20   1 
HETATM 7503 C  C21   . VKJ F 3 4   ? 19.340  23.595  36.799 1.00 55.67  ? 5   VKJ T C21   1 
HETATM 7504 C  C22   . VKJ F 3 4   ? 19.568  23.973  38.128 1.00 57.68  ? 5   VKJ T C22   1 
HETATM 7505 C  C23   . VKJ F 3 4   ? 18.614  26.170  37.771 1.00 68.05  ? 5   VKJ T C23   1 
HETATM 7506 C  C24   . VKJ F 3 4   ? 18.245  27.436  38.210 1.00 69.03  ? 5   VKJ T C24   1 
HETATM 7507 C  C25   . VKJ F 3 4   ? 17.643  28.349  37.330 1.00 60.86  ? 5   VKJ T C25   1 
HETATM 7508 C  C26   . VKJ F 3 4   ? 17.385  28.048  35.989 1.00 57.34  ? 5   VKJ T C26   1 
HETATM 7509 C  C27   . VKJ F 3 4   ? 18.487  27.774  39.541 1.00 64.44  ? 5   VKJ T C27   1 
HETATM 7510 C  C28   . VKJ F 3 4   ? 19.213  25.237  38.612 1.00 67.82  ? 5   VKJ T C28   1 
HETATM 7511 C  C29   . VKJ F 3 4   ? 19.440  25.584  39.938 1.00 69.50  ? 5   VKJ T C29   1 
HETATM 7512 C  C30   . VKJ F 3 4   ? 19.088  26.852  40.396 1.00 66.89  ? 5   VKJ T C30   1 
ATOM   7513 P  P     . DC  F 3 5   ? 16.656  19.237  41.137 1.00 24.82  ? 6   DC  T P     1 
ATOM   7514 O  OP1   . DC  F 3 5   ? 16.669  20.191  42.261 1.00 31.91  ? 6   DC  T OP1   1 
ATOM   7515 O  OP2   . DC  F 3 5   ? 16.436  17.798  41.341 1.00 35.38  ? 6   DC  T OP2   1 
ATOM   7516 O  "O5'" . DC  F 3 5   ? 15.590  19.713  40.060 1.00 28.35  ? 6   DC  T "O5'" 1 
ATOM   7517 C  "C5'" . DC  F 3 5   ? 15.948  20.848  39.303 1.00 27.74  ? 6   DC  T "C5'" 1 
ATOM   7518 C  "C4'" . DC  F 3 5   ? 15.146  21.003  38.030 1.00 25.99  ? 6   DC  T "C4'" 1 
ATOM   7519 O  "O4'" . DC  F 3 5   ? 15.932  20.555  36.905 1.00 30.60  ? 6   DC  T "O4'" 1 
ATOM   7520 C  "C3'" . DC  F 3 5   ? 13.824  20.260  37.982 1.00 24.40  ? 6   DC  T "C3'" 1 
ATOM   7521 O  "O3'" . DC  F 3 5   ? 12.864  21.261  37.737 1.00 25.26  ? 6   DC  T "O3'" 1 
ATOM   7522 C  "C2'" . DC  F 3 5   ? 13.981  19.260  36.836 1.00 25.16  ? 6   DC  T "C2'" 1 
ATOM   7523 C  "C1'" . DC  F 3 5   ? 15.104  19.856  36.003 1.00 26.21  ? 6   DC  T "C1'" 1 
ATOM   7524 N  N1    . DC  F 3 5   ? 15.992  18.910  35.275 1.00 33.69  ? 6   DC  T N1    1 
ATOM   7525 C  C2    . DC  F 3 5   ? 16.048  18.949  33.883 1.00 37.75  ? 6   DC  T C2    1 
ATOM   7526 O  O2    . DC  F 3 5   ? 15.326  19.760  33.300 1.00 41.56  ? 6   DC  T O2    1 
ATOM   7527 N  N3    . DC  F 3 5   ? 16.875  18.097  33.222 1.00 32.71  ? 6   DC  T N3    1 
ATOM   7528 C  C4    . DC  F 3 5   ? 17.627  17.238  33.912 1.00 36.04  ? 6   DC  T C4    1 
ATOM   7529 N  N4    . DC  F 3 5   ? 18.424  16.419  33.217 1.00 41.48  ? 6   DC  T N4    1 
ATOM   7530 C  C5    . DC  F 3 5   ? 17.587  17.187  35.339 1.00 36.11  ? 6   DC  T C5    1 
ATOM   7531 C  C6    . DC  F 3 5   ? 16.765  18.035  35.969 1.00 34.60  ? 6   DC  T C6    1 
ATOM   7532 P  P     . DT  F 3 6   ? 11.332  20.887  37.444 1.00 19.57  ? 7   DT  T P     1 
ATOM   7533 O  OP1   . DT  F 3 6   ? 10.480  22.042  37.778 1.00 28.07  ? 7   DT  T OP1   1 
ATOM   7534 O  OP2   . DT  F 3 6   ? 11.012  19.594  38.077 1.00 24.79  ? 7   DT  T OP2   1 
ATOM   7535 O  "O5'" . DT  F 3 6   ? 11.296  20.710  35.876 1.00 24.10  ? 7   DT  T "O5'" 1 
ATOM   7536 C  "C5'" . DT  F 3 6   ? 10.512  21.590  35.103 1.00 31.25  ? 7   DT  T "C5'" 1 
ATOM   7537 C  "C4'" . DT  F 3 6   ? 10.424  21.017  33.714 1.00 27.47  ? 7   DT  T "C4'" 1 
ATOM   7538 O  "O4'" . DT  F 3 6   ? 11.586  20.208  33.454 1.00 31.05  ? 7   DT  T "O4'" 1 
ATOM   7539 C  "C3'" . DT  F 3 6   ? 9.225   20.112  33.501 1.00 27.49  ? 7   DT  T "C3'" 1 
ATOM   7540 O  "O3'" . DT  F 3 6   ? 8.392   20.711  32.548 1.00 26.81  ? 7   DT  T "O3'" 1 
ATOM   7541 C  "C2'" . DT  F 3 6   ? 9.810   18.781  33.025 1.00 32.85  ? 7   DT  T "C2'" 1 
ATOM   7542 C  "C1'" . DT  F 3 6   ? 11.193  19.197  32.555 1.00 32.23  ? 7   DT  T "C1'" 1 
ATOM   7543 N  N1    . DT  F 3 6   ? 12.242  18.146  32.565 1.00 29.76  ? 7   DT  T N1    1 
ATOM   7544 C  C2    . DT  F 3 6   ? 12.837  17.851  31.369 1.00 29.67  ? 7   DT  T C2    1 
ATOM   7545 O  O2    . DT  F 3 6   ? 12.509  18.395  30.333 1.00 27.98  ? 7   DT  T O2    1 
ATOM   7546 N  N3    . DT  F 3 6   ? 13.810  16.887  31.440 1.00 32.45  ? 7   DT  T N3    1 
ATOM   7547 C  C4    . DT  F 3 6   ? 14.245  16.211  32.564 1.00 32.55  ? 7   DT  T C4    1 
ATOM   7548 O  O4    . DT  F 3 6   ? 15.133  15.362  32.517 1.00 29.03  ? 7   DT  T O4    1 
ATOM   7549 C  C5    . DT  F 3 6   ? 13.579  16.583  33.786 1.00 29.55  ? 7   DT  T C5    1 
ATOM   7550 C  C7    . DT  F 3 6   ? 13.965  15.923  35.071 1.00 31.16  ? 7   DT  T C7    1 
ATOM   7551 C  C6    . DT  F 3 6   ? 12.624  17.520  33.734 1.00 27.29  ? 7   DT  T C6    1 
ATOM   7552 P  P     . DG  F 3 7   ? 6.855   20.264  32.438 1.00 39.63  ? 8   DG  T P     1 
ATOM   7553 O  OP1   . DG  F 3 7   ? 6.009   21.466  32.353 1.00 45.12  ? 8   DG  T OP1   1 
ATOM   7554 O  OP2   . DG  F 3 7   ? 6.613   19.253  33.489 1.00 38.33  ? 8   DG  T OP2   1 
ATOM   7555 O  "O5'" . DG  F 3 7   ? 6.762   19.537  31.020 1.00 43.23  ? 8   DG  T "O5'" 1 
ATOM   7556 C  "C5'" . DG  F 3 7   ? 7.415   20.088  29.876 1.00 40.59  ? 8   DG  T "C5'" 1 
ATOM   7557 C  "C4'" . DG  F 3 7   ? 7.792   18.991  28.896 1.00 37.62  ? 8   DG  T "C4'" 1 
ATOM   7558 O  "O4'" . DG  F 3 7   ? 8.962   18.269  29.348 1.00 39.13  ? 8   DG  T "O4'" 1 
ATOM   7559 C  "C3'" . DG  F 3 7   ? 6.722   17.943  28.597 1.00 35.96  ? 8   DG  T "C3'" 1 
ATOM   7560 O  "O3'" . DG  F 3 7   ? 6.471   18.002  27.231 1.00 41.52  ? 8   DG  T "O3'" 1 
ATOM   7561 C  "C2'" . DG  F 3 7   ? 7.385   16.617  28.955 1.00 37.52  ? 8   DG  T "C2'" 1 
ATOM   7562 C  "C1'" . DG  F 3 7   ? 8.854   16.972  28.809 1.00 34.96  ? 8   DG  T "C1'" 1 
ATOM   7563 N  N9    . DG  F 3 7   ? 9.755   16.138  29.584 1.00 32.05  ? 8   DG  T N9    1 
ATOM   7564 C  C8    . DG  F 3 7   ? 9.671   15.833  30.919 1.00 29.68  ? 8   DG  T C8    1 
ATOM   7565 N  N7    . DG  F 3 7   ? 10.639  15.064  31.328 1.00 31.04  ? 8   DG  T N7    1 
ATOM   7566 C  C5    . DG  F 3 7   ? 11.404  14.840  30.190 1.00 30.86  ? 8   DG  T C5    1 
ATOM   7567 C  C6    . DG  F 3 7   ? 12.582  14.076  30.016 1.00 32.99  ? 8   DG  T C6    1 
ATOM   7568 O  O6    . DG  F 3 7   ? 13.206  13.418  30.864 1.00 30.93  ? 8   DG  T O6    1 
ATOM   7569 N  N1    . DG  F 3 7   ? 13.027  14.123  28.694 1.00 33.22  ? 8   DG  T N1    1 
ATOM   7570 C  C2    . DG  F 3 7   ? 12.404  14.825  27.685 1.00 30.91  ? 8   DG  T C2    1 
ATOM   7571 N  N2    . DG  F 3 7   ? 12.967  14.764  26.476 1.00 31.81  ? 8   DG  T N2    1 
ATOM   7572 N  N3    . DG  F 3 7   ? 11.302  15.538  27.835 1.00 30.75  ? 8   DG  T N3    1 
ATOM   7573 C  C4    . DG  F 3 7   ? 10.866  15.496  29.110 1.00 29.75  ? 8   DG  T C4    1 
ATOM   7574 P  P     . DA  F 3 8   ? 5.167   17.317  26.601 1.00 45.77  ? 9   DA  T P     1 
ATOM   7575 O  OP1   . DA  F 3 8   ? 4.471   18.354  25.817 1.00 56.06  ? 9   DA  T OP1   1 
ATOM   7576 O  OP2   . DA  F 3 8   ? 4.451   16.547  27.640 1.00 44.42  ? 9   DA  T OP2   1 
ATOM   7577 O  "O5'" . DA  F 3 8   ? 5.778   16.298  25.543 1.00 49.30  ? 9   DA  T "O5'" 1 
ATOM   7578 C  "C5'" . DA  F 3 8   ? 6.962   16.653  24.825 1.00 44.29  ? 9   DA  T "C5'" 1 
ATOM   7579 C  "C4'" . DA  F 3 8   ? 7.706   15.390  24.443 1.00 39.70  ? 9   DA  T "C4'" 1 
ATOM   7580 O  "O4'" . DA  F 3 8   ? 8.535   14.919  25.528 1.00 44.41  ? 9   DA  T "O4'" 1 
ATOM   7581 C  "C3'" . DA  F 3 8   ? 6.765   14.243  24.094 1.00 44.98  ? 9   DA  T "C3'" 1 
ATOM   7582 O  "O3'" . DA  F 3 8   ? 6.880   13.959  22.716 1.00 50.52  ? 9   DA  T "O3'" 1 
ATOM   7583 C  "C2'" . DA  F 3 8   ? 7.246   13.063  24.944 1.00 42.67  ? 9   DA  T "C2'" 1 
ATOM   7584 C  "C1'" . DA  F 3 8   ? 8.625   13.514  25.408 1.00 39.63  ? 9   DA  T "C1'" 1 
ATOM   7585 N  N9    . DA  F 3 8   ? 9.057   12.959  26.687 1.00 31.62  ? 9   DA  T N9    1 
ATOM   7586 C  C8    . DA  F 3 8   ? 8.491   13.103  27.922 1.00 30.55  ? 9   DA  T C8    1 
ATOM   7587 N  N7    . DA  F 3 8   ? 9.155   12.487  28.875 1.00 33.13  ? 9   DA  T N7    1 
ATOM   7588 C  C5    . DA  F 3 8   ? 10.232  11.908  28.224 1.00 32.80  ? 9   DA  T C5    1 
ATOM   7589 C  C6    . DA  F 3 8   ? 11.320  11.115  28.655 1.00 30.62  ? 9   DA  T C6    1 
ATOM   7590 N  N6    . DA  F 3 8   ? 11.541  10.727  29.915 1.00 24.12  ? 9   DA  T N6    1 
ATOM   7591 N  N1    . DA  F 3 8   ? 12.201  10.721  27.717 1.00 33.91  ? 9   DA  T N1    1 
ATOM   7592 C  C2    . DA  F 3 8   ? 12.025  11.081  26.444 1.00 31.49  ? 9   DA  T C2    1 
ATOM   7593 N  N3    . DA  F 3 8   ? 11.047  11.816  25.926 1.00 33.77  ? 9   DA  T N3    1 
ATOM   7594 C  C4    . DA  F 3 8   ? 10.181  12.198  26.875 1.00 32.23  ? 9   DA  T C4    1 
ATOM   7595 P  P     . DT  F 3 9   ? 5.846   12.954  22.012 1.00 55.08  ? 10  DT  T P     1 
ATOM   7596 O  OP1   . DT  F 3 9   ? 5.674   13.452  20.623 1.00 43.09  ? 10  DT  T OP1   1 
ATOM   7597 O  OP2   . DT  F 3 9   ? 4.670   12.744  22.893 1.00 53.68  ? 10  DT  T OP2   1 
ATOM   7598 O  "O5'" . DT  F 3 9   ? 6.649   11.584  21.983 1.00 48.07  ? 10  DT  T "O5'" 1 
ATOM   7599 C  "C5'" . DT  F 3 9   ? 7.970   11.617  21.488 1.00 43.70  ? 10  DT  T "C5'" 1 
ATOM   7600 C  "C4'" . DT  F 3 9   ? 8.655   10.338  21.887 1.00 44.31  ? 10  DT  T "C4'" 1 
ATOM   7601 O  "O4'" . DT  F 3 9   ? 8.922   10.321  23.305 1.00 44.78  ? 10  DT  T "O4'" 1 
ATOM   7602 C  "C3'" . DT  F 3 9   ? 7.798   9.116   21.602 1.00 50.08  ? 10  DT  T "C3'" 1 
ATOM   7603 O  "O3'" . DT  F 3 9   ? 8.553   8.269   20.776 1.00 55.68  ? 10  DT  T "O3'" 1 
ATOM   7604 C  "C2'" . DT  F 3 9   ? 7.559   8.495   22.982 1.00 43.44  ? 10  DT  T "C2'" 1 
ATOM   7605 C  "C1'" . DT  F 3 9   ? 8.768   8.992   23.759 1.00 39.37  ? 10  DT  T "C1'" 1 
ATOM   7606 N  N1    . DT  F 3 9   ? 8.614   9.030   25.237 1.00 34.99  ? 10  DT  T N1    1 
ATOM   7607 C  C2    . DT  F 3 9   ? 9.600   8.450   25.986 1.00 33.09  ? 10  DT  T C2    1 
ATOM   7608 O  O2    . DT  F 3 9   ? 10.582  7.921   25.498 1.00 37.42  ? 10  DT  T O2    1 
ATOM   7609 N  N3    . DT  F 3 9   ? 9.405   8.536   27.335 1.00 30.49  ? 10  DT  T N3    1 
ATOM   7610 C  C4    . DT  F 3 9   ? 8.354   9.108   28.014 1.00 31.72  ? 10  DT  T C4    1 
ATOM   7611 O  O4    . DT  F 3 9   ? 8.303   9.105   29.241 1.00 26.19  ? 10  DT  T O4    1 
ATOM   7612 C  C5    . DT  F 3 9   ? 7.347   9.695   27.168 1.00 31.17  ? 10  DT  T C5    1 
ATOM   7613 C  C7    . DT  F 3 9   ? 6.144   10.357  27.772 1.00 26.58  ? 10  DT  T C7    1 
ATOM   7614 C  C6    . DT  F 3 9   ? 7.523   9.626   25.839 1.00 35.28  ? 10  DT  T C6    1 
ATOM   7615 P  P     . DC  F 3 10  ? 7.836   7.156   19.873 1.00 58.00  ? 11  DC  T P     1 
ATOM   7616 O  OP1   . DC  F 3 10  ? 8.030   7.560   18.458 1.00 48.24  ? 11  DC  T OP1   1 
ATOM   7617 O  OP2   . DC  F 3 10  ? 6.476   6.895   20.393 1.00 53.96  ? 11  DC  T OP2   1 
ATOM   7618 O  "O5'" . DC  F 3 10  ? 8.710   5.866   20.180 1.00 46.37  ? 11  DC  T "O5'" 1 
ATOM   7619 C  "C5'" . DC  F 3 10  ? 9.977   6.099   20.779 1.00 41.83  ? 11  DC  T "C5'" 1 
ATOM   7620 C  "C4'" . DC  F 3 10  ? 10.426  4.841   21.484 1.00 49.14  ? 11  DC  T "C4'" 1 
ATOM   7621 O  "O4'" . DC  F 3 10  ? 10.372  4.966   22.933 1.00 51.56  ? 11  DC  T "O4'" 1 
ATOM   7622 C  "C3'" . DC  F 3 10  ? 9.562   3.641   21.140 1.00 49.13  ? 11  DC  T "C3'" 1 
ATOM   7623 O  "O3'" . DC  F 3 10  ? 10.411  2.539   21.169 1.00 50.27  ? 11  DC  T "O3'" 1 
ATOM   7624 C  "C2'" . DC  F 3 10  ? 8.586   3.591   22.316 1.00 40.32  ? 11  DC  T "C2'" 1 
ATOM   7625 C  "C1'" . DC  F 3 10  ? 9.505   3.983   23.472 1.00 43.83  ? 11  DC  T "C1'" 1 
ATOM   7626 N  N1    . DC  F 3 10  ? 8.804   4.540   24.680 1.00 39.11  ? 11  DC  T N1    1 
ATOM   7627 C  C2    . DC  F 3 10  ? 9.370   4.357   25.945 1.00 33.30  ? 11  DC  T C2    1 
ATOM   7628 O  O2    . DC  F 3 10  ? 10.440  3.747   26.045 1.00 37.16  ? 11  DC  T O2    1 
ATOM   7629 N  N3    . DC  F 3 10  ? 8.733   4.857   27.034 1.00 37.36  ? 11  DC  T N3    1 
ATOM   7630 C  C4    . DC  F 3 10  ? 7.582   5.519   26.899 1.00 38.82  ? 11  DC  T C4    1 
ATOM   7631 N  N4    . DC  F 3 10  ? 6.995   5.995   28.007 1.00 26.96  ? 11  DC  T N4    1 
ATOM   7632 C  C5    . DC  F 3 10  ? 6.989   5.716   25.617 1.00 38.13  ? 11  DC  T C5    1 
ATOM   7633 C  C6    . DC  F 3 10  ? 7.626   5.216   24.550 1.00 41.24  ? 11  DC  T C6    1 
ATOM   7634 P  P     . DC  F 3 11  ? 10.197  1.314   20.158 1.00 57.05  ? 12  DC  T P     1 
ATOM   7635 O  OP1   . DC  F 3 11  ? 11.247  1.436   19.124 1.00 54.82  ? 12  DC  T OP1   1 
ATOM   7636 O  OP2   . DC  F 3 11  ? 8.763   1.250   19.780 1.00 44.40  ? 12  DC  T OP2   1 
ATOM   7637 O  "O5'" . DC  F 3 11  ? 10.532  0.062   21.078 1.00 48.71  ? 12  DC  T "O5'" 1 
ATOM   7638 C  "C5'" . DC  F 3 11  ? 11.684  0.239   21.887 1.00 46.90  ? 12  DC  T "C5'" 1 
ATOM   7639 C  "C4'" . DC  F 3 11  ? 11.660  -0.700  23.072 1.00 53.53  ? 12  DC  T "C4'" 1 
ATOM   7640 O  "O4'" . DC  F 3 11  ? 11.019  -0.064  24.212 1.00 51.41  ? 12  DC  T "O4'" 1 
ATOM   7641 C  "C3'" . DC  F 3 11  ? 10.879  -1.979  22.826 1.00 56.23  ? 12  DC  T "C3'" 1 
ATOM   7642 O  "O3'" . DC  F 3 11  ? 11.593  -3.023  23.460 1.00 57.50  ? 12  DC  T "O3'" 1 
ATOM   7643 C  "C2'" . DC  F 3 11  ? 9.520   -1.705  23.472 1.00 49.53  ? 12  DC  T "C2'" 1 
ATOM   7644 C  "C1'" . DC  F 3 11  ? 9.954   -0.875  24.673 1.00 48.29  ? 12  DC  T "C1'" 1 
ATOM   7645 N  N1    . DC  F 3 11  ? 8.901   0.016   25.213 1.00 38.36  ? 12  DC  T N1    1 
ATOM   7646 C  C2    . DC  F 3 11  ? 8.897   0.251   26.580 1.00 41.38  ? 12  DC  T C2    1 
ATOM   7647 O  O2    . DC  F 3 11  ? 9.771   -0.302  27.265 1.00 45.79  ? 12  DC  T O2    1 
ATOM   7648 N  N3    . DC  F 3 11  ? 7.944   1.063   27.101 1.00 39.02  ? 12  DC  T N3    1 
ATOM   7649 C  C4    . DC  F 3 11  ? 7.034   1.616   26.298 1.00 38.83  ? 12  DC  T C4    1 
ATOM   7650 N  N4    . DC  F 3 11  ? 6.113   2.412   26.852 1.00 37.69  ? 12  DC  T N4    1 
ATOM   7651 C  C5    . DC  F 3 11  ? 7.027   1.382   24.893 1.00 35.56  ? 12  DC  T C5    1 
ATOM   7652 C  C6    . DC  F 3 11  ? 7.972   0.582   24.396 1.00 37.13  ? 12  DC  T C6    1 
ATOM   7653 P  P     . DG  F 3 12  ? 11.449  -4.528  22.928 1.00 56.53  ? 13  DG  T P     1 
ATOM   7654 O  OP1   . DG  F 3 12  ? 12.393  -5.363  23.703 1.00 59.44  ? 13  DG  T OP1   1 
ATOM   7655 O  OP2   . DG  F 3 12  ? 11.544  -4.491  21.452 1.00 59.78  ? 13  DG  T OP2   1 
ATOM   7656 O  "O5'" . DG  F 3 12  ? 9.927   -4.893  23.258 1.00 51.66  ? 13  DG  T "O5'" 1 
ATOM   7657 C  "C5'" . DG  F 3 12  ? 9.593   -6.022  24.047 1.00 54.83  ? 13  DG  T "C5'" 1 
ATOM   7658 C  "C4'" . DG  F 3 12  ? 9.905   -5.833  25.524 1.00 52.18  ? 13  DG  T "C4'" 1 
ATOM   7659 O  "O4'" . DG  F 3 12  ? 9.505   -4.486  25.920 1.00 55.34  ? 13  DG  T "O4'" 1 
ATOM   7660 C  "C3'" . DG  F 3 12  ? 9.089   -6.781  26.378 1.00 57.96  ? 13  DG  T "C3'" 1 
ATOM   7661 O  "O3'" . DG  F 3 12  ? 9.799   -7.237  27.519 1.00 61.21  ? 13  DG  T "O3'" 1 
ATOM   7662 C  "C2'" . DG  F 3 12  ? 7.906   -5.915  26.756 1.00 48.48  ? 13  DG  T "C2'" 1 
ATOM   7663 C  "C1'" . DG  F 3 12  ? 8.518   -4.558  26.941 1.00 42.96  ? 13  DG  T "C1'" 1 
ATOM   7664 N  N9    . DG  F 3 12  ? 7.519   -3.515  26.710 1.00 42.16  ? 13  DG  T N9    1 
ATOM   7665 C  C8    . DG  F 3 12  ? 6.965   -3.182  25.502 1.00 42.26  ? 13  DG  T C8    1 
ATOM   7666 N  N7    . DG  F 3 12  ? 6.041   -2.266  25.590 1.00 43.08  ? 13  DG  T N7    1 
ATOM   7667 C  C5    . DG  F 3 12  ? 5.954   -2.003  26.952 1.00 41.51  ? 13  DG  T C5    1 
ATOM   7668 C  C6    . DG  F 3 12  ? 5.125   -1.096  27.650 1.00 36.62  ? 13  DG  T C6    1 
ATOM   7669 O  O6    . DG  F 3 12  ? 4.280   -0.322  27.184 1.00 33.77  ? 13  DG  T O6    1 
ATOM   7670 N  N1    . DG  F 3 12  ? 5.351   -1.145  29.021 1.00 31.43  ? 13  DG  T N1    1 
ATOM   7671 C  C2    . DG  F 3 12  ? 6.264   -1.970  29.632 1.00 35.25  ? 13  DG  T C2    1 
ATOM   7672 N  N2    . DG  F 3 12  ? 6.342   -1.881  30.965 1.00 38.02  ? 13  DG  T N2    1 
ATOM   7673 N  N3    . DG  F 3 12  ? 7.050   -2.824  28.993 1.00 38.38  ? 13  DG  T N3    1 
ATOM   7674 C  C4    . DG  F 3 12  ? 6.841   -2.787  27.657 1.00 41.48  ? 13  DG  T C4    1 
ATOM   7675 P  P     . DC  F 3 13  ? 9.881   -8.810  27.824 1.00 58.41  ? 14  DC  T P     1 
ATOM   7676 O  OP1   . DC  F 3 13  ? 11.189  -9.063  28.461 1.00 68.46  ? 14  DC  T OP1   1 
ATOM   7677 O  OP2   . DC  F 3 13  ? 9.488   -9.514  26.585 1.00 52.42  ? 14  DC  T OP2   1 
ATOM   7678 O  "O5'" . DC  F 3 13  ? 8.726   -9.081  28.897 1.00 66.55  ? 14  DC  T "O5'" 1 
ATOM   7679 C  "C5'" . DC  F 3 13  ? 7.420   -8.551  28.797 1.00 53.04  ? 14  DC  T "C5'" 1 
ATOM   7680 C  "C4'" . DC  F 3 13  ? 7.215   -7.570  29.930 1.00 47.36  ? 14  DC  T "C4'" 1 
ATOM   7681 O  "O4'" . DC  F 3 13  ? 6.714   -6.303  29.450 1.00 54.84  ? 14  DC  T "O4'" 1 
ATOM   7682 C  "C3'" . DC  F 3 13  ? 6.233   -8.007  30.995 1.00 56.51  ? 14  DC  T "C3'" 1 
ATOM   7683 O  "O3'" . DC  F 3 13  ? 6.673   -7.463  32.240 1.00 63.66  ? 14  DC  T "O3'" 1 
ATOM   7684 C  "C2'" . DC  F 3 13  ? 4.928   -7.389  30.504 1.00 53.85  ? 14  DC  T "C2'" 1 
ATOM   7685 C  "C1'" . DC  F 3 13  ? 5.433   -6.049  29.987 1.00 48.86  ? 14  DC  T "C1'" 1 
ATOM   7686 N  N1    . DC  F 3 13  ? 4.619   -5.333  28.956 1.00 44.72  ? 14  DC  T N1    1 
ATOM   7687 C  C2    . DC  F 3 13  ? 3.793   -4.288  29.373 1.00 40.22  ? 14  DC  T C2    1 
ATOM   7688 O  O2    . DC  F 3 13  ? 3.761   -4.019  30.577 1.00 39.93  ? 14  DC  T O2    1 
ATOM   7689 N  N3    . DC  F 3 13  ? 3.059   -3.615  28.448 1.00 41.73  ? 14  DC  T N3    1 
ATOM   7690 C  C4    . DC  F 3 13  ? 3.146   -3.955  27.156 1.00 43.05  ? 14  DC  T C4    1 
ATOM   7691 N  N4    . DC  F 3 13  ? 2.411   -3.271  26.272 1.00 39.17  ? 14  DC  T N4    1 
ATOM   7692 C  C5    . DC  F 3 13  ? 3.990   -5.013  26.710 1.00 39.97  ? 14  DC  T C5    1 
ATOM   7693 C  C6    . DC  F 3 13  ? 4.700   -5.666  27.636 1.00 44.36  ? 14  DC  T C6    1 
HETATM 7694 MG MG    . MG  G 4 .   ? 16.244  29.736  65.597 1.00 31.14  ? 601 MG  A MG    1 
HETATM 7695 P  PG    . 0KX H 5 .   ? 19.419  30.737  66.545 1.00 35.96  ? 602 0KX A PG    1 
HETATM 7696 O  O1G   . 0KX H 5 .   ? 19.678  32.169  66.947 1.00 45.39  ? 602 0KX A O1G   1 
HETATM 7697 O  O2G   . 0KX H 5 .   ? 17.961  30.409  66.762 1.00 39.88  ? 602 0KX A O2G   1 
HETATM 7698 O  O3G   . 0KX H 5 .   ? 20.273  29.816  67.384 1.00 41.51  ? 602 0KX A O3G   1 
HETATM 7699 P  PB    . 0KX H 5 .   ? 18.899  30.501  63.725 1.00 45.91  ? 602 0KX A PB    1 
HETATM 7700 O  O1B   . 0KX H 5 .   ? 17.803  29.477  63.898 1.00 39.77  ? 602 0KX A O1B   1 
HETATM 7701 O  O2B   . 0KX H 5 .   ? 19.731  30.135  62.583 1.00 33.44  ? 602 0KX A O2B   1 
HETATM 7702 O  O3B   . 0KX H 5 .   ? 19.780  30.545  65.019 1.00 36.44  ? 602 0KX A O3B   1 
HETATM 7703 P  PA    . 0KX H 5 .   ? 16.737  32.515  63.802 1.00 44.04  ? 602 0KX A PA    1 
HETATM 7704 O  O1A   . 0KX H 5 .   ? 16.772  33.967  63.949 1.00 46.35  ? 602 0KX A O1A   1 
HETATM 7705 O  O2A   . 0KX H 5 .   ? 16.250  31.890  65.087 1.00 44.87  ? 602 0KX A O2A   1 
HETATM 7706 N  N3A   . 0KX H 5 .   ? 18.236  31.967  63.466 1.00 43.47  ? 602 0KX A N3A   1 
HETATM 7707 O  "O5'" . 0KX H 5 .   ? 15.739  32.121  62.601 1.00 45.67  ? 602 0KX A "O5'" 1 
HETATM 7708 C  "C5'" . 0KX H 5 .   ? 15.953  32.620  61.297 1.00 42.13  ? 602 0KX A "C5'" 1 
HETATM 7709 C  "C4'" . 0KX H 5 .   ? 15.869  31.494  60.285 1.00 40.59  ? 602 0KX A "C4'" 1 
HETATM 7710 O  "O4'" . 0KX H 5 .   ? 15.399  32.098  59.063 1.00 41.26  ? 602 0KX A "O4'" 1 
HETATM 7711 C  "C3'" . 0KX H 5 .   ? 17.268  30.959  59.965 1.00 38.60  ? 602 0KX A "C3'" 1 
HETATM 7712 O  "O3'" . 0KX H 5 .   ? 17.352  29.559  60.255 1.00 40.76  ? 602 0KX A "O3'" 1 
HETATM 7713 C  "C2'" . 0KX H 5 .   ? 17.501  31.202  58.472 1.00 37.49  ? 602 0KX A "C2'" 1 
HETATM 7714 C  "C1'" . 0KX H 5 .   ? 16.460  32.249  58.103 1.00 42.71  ? 602 0KX A "C1'" 1 
HETATM 7715 N  N1    . 0KX H 5 .   ? 17.061  33.600  58.176 1.00 46.18  ? 602 0KX A N1    1 
HETATM 7716 C  C2    . 0KX H 5 .   ? 17.513  34.201  56.980 1.00 41.60  ? 602 0KX A C2    1 
HETATM 7717 N  N3    . 0KX H 5 .   ? 18.086  35.423  56.993 1.00 45.22  ? 602 0KX A N3    1 
HETATM 7718 C  C4    . 0KX H 5 .   ? 18.243  36.082  58.161 1.00 42.10  ? 602 0KX A C4    1 
HETATM 7719 C  C5    . 0KX H 5 .   ? 17.816  35.502  59.350 1.00 36.66  ? 602 0KX A C5    1 
HETATM 7720 C  C6    . 0KX H 5 .   ? 17.225  34.244  59.341 1.00 44.52  ? 602 0KX A C6    1 
HETATM 7721 O  O2    . 0KX H 5 .   ? 17.370  33.595  55.896 1.00 47.05  ? 602 0KX A O2    1 
HETATM 7722 N  N4    . 0KX H 5 .   ? 18.819  37.308  58.174 1.00 41.79  ? 602 0KX A N4    1 
HETATM 7723 C  C1    . PEG I 6 .   ? 14.397  49.593  51.763 1.00 52.87  ? 603 PEG A C1    1 
HETATM 7724 O  O1    . PEG I 6 .   ? 14.462  51.014  51.561 1.00 57.63  ? 603 PEG A O1    1 
HETATM 7725 C  C2    . PEG I 6 .   ? 15.187  48.866  50.675 1.00 56.91  ? 603 PEG A C2    1 
HETATM 7726 O  O2    . PEG I 6 .   ? 16.080  47.928  51.276 1.00 75.11  ? 603 PEG A O2    1 
HETATM 7727 C  C3    . PEG I 6 .   ? 17.011  47.372  50.347 1.00 63.37  ? 603 PEG A C3    1 
HETATM 7728 C  C4    . PEG I 6 .   ? 18.245  46.866  51.093 1.00 62.53  ? 603 PEG A C4    1 
HETATM 7729 O  O4    . PEG I 6 .   ? 19.406  47.548  50.596 1.00 60.13  ? 603 PEG A O4    1 
HETATM 7730 C  C1    . EDO J 7 .   ? 22.526  26.338  40.476 1.00 63.52  ? 601 EDO B C1    1 
HETATM 7731 O  O1    . EDO J 7 .   ? 22.595  27.685  40.962 1.00 60.98  ? 601 EDO B O1    1 
HETATM 7732 C  C2    . EDO J 7 .   ? 22.516  26.289  38.952 1.00 61.46  ? 601 EDO B C2    1 
HETATM 7733 O  O2    . EDO J 7 .   ? 22.678  24.936  38.503 1.00 60.62  ? 601 EDO B O2    1 
HETATM 7734 MG MG    . MG  K 4 .   ? 23.496  27.044  22.414 1.00 51.33  ? 602 MG  B MG    1 
HETATM 7735 P  PG    . 0KX L 5 .   ? 26.655  26.285  22.921 1.00 56.13  ? 603 0KX B PG    1 
HETATM 7736 O  O1G   . 0KX L 5 .   ? 27.219  24.885  22.980 1.00 65.05  ? 603 0KX B O1G   1 
HETATM 7737 O  O2G   . 0KX L 5 .   ? 25.424  26.295  22.047 1.00 52.35  ? 603 0KX B O2G   1 
HETATM 7738 O  O3G   . 0KX L 5 .   ? 27.690  27.221  22.344 1.00 56.02  ? 603 0KX B O3G   1 
HETATM 7739 P  PB    . 0KX L 5 .   ? 24.896  26.848  25.234 1.00 58.26  ? 603 0KX B PB    1 
HETATM 7740 O  O1B   . 0KX L 5 .   ? 25.170  27.351  26.578 1.00 53.79  ? 603 0KX B O1B   1 
HETATM 7741 O  O2B   . 0KX L 5 .   ? 23.937  27.780  24.534 1.00 54.68  ? 603 0KX B O2B   1 
HETATM 7742 O  O3B   . 0KX L 5 .   ? 26.262  26.768  24.406 1.00 45.73  ? 603 0KX B O3B   1 
HETATM 7743 P  PA    . 0KX L 5 .   ? 22.931  24.742  24.577 1.00 61.14  ? 603 0KX B PA    1 
HETATM 7744 O  O1A   . 0KX L 5 .   ? 23.102  24.886  23.084 1.00 56.25  ? 603 0KX B O1A   1 
HETATM 7745 O  O2A   . 0KX L 5 .   ? 22.797  23.328  24.918 1.00 62.86  ? 603 0KX B O2A   1 
HETATM 7746 N  N3A   . 0KX L 5 .   ? 24.234  25.362  25.335 1.00 61.18  ? 603 0KX B N3A   1 
HETATM 7747 O  "O5'" . 0KX L 5 .   ? 21.610  25.534  25.045 1.00 56.22  ? 603 0KX B "O5'" 1 
HETATM 7748 C  "C5'" . 0KX L 5 .   ? 20.888  25.114  26.183 1.00 54.15  ? 603 0KX B "C5'" 1 
HETATM 7749 C  "C4'" . 0KX L 5 .   ? 20.933  26.172  27.276 1.00 55.20  ? 603 0KX B "C4'" 1 
HETATM 7750 O  "O4'" . 0KX L 5 .   ? 20.195  25.623  28.379 1.00 46.14  ? 603 0KX B "O4'" 1 
HETATM 7751 C  "C3'" . 0KX L 5 .   ? 22.366  26.399  27.810 1.00 54.77  ? 603 0KX B "C3'" 1 
HETATM 7752 O  "O3'" . 0KX L 5 .   ? 22.826  27.747  27.610 1.00 53.47  ? 603 0KX B "O3'" 1 
HETATM 7753 C  "C2'" . 0KX L 5 .   ? 22.312  26.137  29.309 1.00 49.97  ? 603 0KX B "C2'" 1 
HETATM 7754 C  "C1'" . 0KX L 5 .   ? 21.058  25.303  29.481 1.00 50.42  ? 603 0KX B "C1'" 1 
HETATM 7755 N  N1    . 0KX L 5 .   ? 21.433  23.879  29.479 1.00 53.08  ? 603 0KX B N1    1 
HETATM 7756 C  C2    . 0KX L 5 .   ? 21.147  23.133  30.627 1.00 46.87  ? 603 0KX B C2    1 
HETATM 7757 N  N3    . 0KX L 5 .   ? 21.489  21.829  30.711 1.00 51.59  ? 603 0KX B N3    1 
HETATM 7758 C  C4    . 0KX L 5 .   ? 22.124  21.231  29.681 1.00 50.07  ? 603 0KX B C4    1 
HETATM 7759 C  C5    . 0KX L 5 .   ? 22.426  21.956  28.534 1.00 54.12  ? 603 0KX B C5    1 
HETATM 7760 C  C6    . 0KX L 5 .   ? 22.076  23.298  28.443 1.00 52.84  ? 603 0KX B C6    1 
HETATM 7761 O  O2    . 0KX L 5 .   ? 20.560  23.682  31.584 1.00 50.96  ? 603 0KX B O2    1 
HETATM 7762 N  N4    . 0KX L 5 .   ? 22.467  19.923  29.765 1.00 43.94  ? 603 0KX B N4    1 
HETATM 7763 C  C1    . PEG M 6 .   ? 14.232  26.625  35.947 1.00 60.69  ? 604 PEG B C1    1 
HETATM 7764 O  O1    . PEG M 6 .   ? 13.545  27.778  35.440 1.00 52.61  ? 604 PEG B O1    1 
HETATM 7765 C  C2    . PEG M 6 .   ? 13.245  25.589  36.486 1.00 51.32  ? 604 PEG B C2    1 
HETATM 7766 O  O2    . PEG M 6 .   ? 13.803  24.981  37.655 1.00 52.78  ? 604 PEG B O2    1 
HETATM 7767 C  C3    . PEG M 6 .   ? 12.872  24.933  38.738 1.00 47.99  ? 604 PEG B C3    1 
HETATM 7768 C  C4    . PEG M 6 .   ? 13.589  25.216  40.055 1.00 50.57  ? 604 PEG B C4    1 
HETATM 7769 O  O4    . PEG M 6 .   ? 13.008  26.366  40.694 1.00 50.53  ? 604 PEG B O4    1 
HETATM 7770 C  C1    . PEG N 6 .   ? -1.332  13.435  56.283 1.00 57.33  ? 605 PEG B C1    1 
HETATM 7771 O  O1    . PEG N 6 .   ? -1.338  14.659  55.537 1.00 51.52  ? 605 PEG B O1    1 
HETATM 7772 C  C2    . PEG N 6 .   ? -0.661  12.330  55.479 1.00 61.60  ? 605 PEG B C2    1 
HETATM 7773 O  O2    . PEG N 6 .   ? -0.869  11.092  56.150 1.00 70.56  ? 605 PEG B O2    1 
HETATM 7774 C  C3    . PEG N 6 .   ? 0.293   10.703  56.879 1.00 64.66  ? 605 PEG B C3    1 
HETATM 7775 C  C4    . PEG N 6 .   ? 0.098   9.283   57.381 1.00 57.82  ? 605 PEG B C4    1 
HETATM 7776 O  O4    . PEG N 6 .   ? -0.013  8.437   56.235 1.00 62.29  ? 605 PEG B O4    1 
HETATM 7777 O  O     . HOH O 8 .   ? 25.206  56.286  69.736 1.00 46.33  ? 701 HOH A O     1 
HETATM 7778 O  O     . HOH O 8 .   ? -3.748  29.854  77.050 1.00 38.38  ? 702 HOH A O     1 
HETATM 7779 O  O     . HOH O 8 .   ? 12.017  34.267  87.520 1.00 32.64  ? 703 HOH A O     1 
HETATM 7780 O  O     . HOH O 8 .   ? -2.662  26.466  76.795 1.00 36.62  ? 704 HOH A O     1 
HETATM 7781 O  O     . HOH O 8 .   ? 2.349   48.408  46.999 1.00 36.03  ? 705 HOH A O     1 
HETATM 7782 O  O     . HOH O 8 .   ? 10.083  23.057  87.347 1.00 37.91  ? 706 HOH A O     1 
HETATM 7783 O  O     . HOH O 8 .   ? 14.541  10.756  66.503 1.00 43.60  ? 707 HOH A O     1 
HETATM 7784 O  O     . HOH O 8 .   ? 20.525  43.457  45.793 1.00 40.80  ? 708 HOH A O     1 
HETATM 7785 O  O     . HOH O 8 .   ? 9.637   41.614  48.080 1.00 31.78  ? 709 HOH A O     1 
HETATM 7786 O  O     . HOH O 8 .   ? 1.323   16.140  77.491 1.00 42.29  ? 710 HOH A O     1 
HETATM 7787 O  O     . HOH O 8 .   ? 3.984   41.970  82.339 1.00 30.97  ? 711 HOH A O     1 
HETATM 7788 O  O     . HOH O 8 .   ? 24.371  50.714  66.757 1.00 40.13  ? 712 HOH A O     1 
HETATM 7789 O  O     . HOH O 8 .   ? 1.604   10.679  77.389 1.00 45.71  ? 713 HOH A O     1 
HETATM 7790 O  O     . HOH O 8 .   ? 14.766  29.038  84.319 1.00 32.98  ? 714 HOH A O     1 
HETATM 7791 O  O     . HOH O 8 .   ? 6.480   47.445  26.859 1.00 47.79  ? 715 HOH A O     1 
HETATM 7792 O  O     . HOH O 8 .   ? 6.074   32.824  83.899 1.00 34.18  ? 716 HOH A O     1 
HETATM 7793 O  O     . HOH O 8 .   ? 4.751   29.280  86.378 1.00 35.06  ? 717 HOH A O     1 
HETATM 7794 O  O     . HOH O 8 .   ? 18.209  29.059  83.834 1.00 38.09  ? 718 HOH A O     1 
HETATM 7795 O  O     . HOH O 8 .   ? 4.182   24.955  47.996 1.00 39.99  ? 719 HOH A O     1 
HETATM 7796 O  O     . HOH O 8 .   ? 15.527  38.273  87.297 1.00 35.10  ? 720 HOH A O     1 
HETATM 7797 O  O     . HOH O 8 .   ? 6.872   26.875  87.010 1.00 29.68  ? 721 HOH A O     1 
HETATM 7798 O  O     . HOH O 8 .   ? 21.044  31.699  49.314 1.00 47.78  ? 722 HOH A O     1 
HETATM 7799 O  O     . HOH O 8 .   ? 6.032   37.326  31.746 1.00 42.29  ? 723 HOH A O     1 
HETATM 7800 O  O     . HOH O 8 .   ? 13.962  21.584  49.177 1.00 35.83  ? 724 HOH A O     1 
HETATM 7801 O  O     . HOH O 8 .   ? 17.031  44.032  49.304 1.00 33.56  ? 725 HOH A O     1 
HETATM 7802 O  O     . HOH O 8 .   ? 1.255   43.811  80.601 1.00 32.21  ? 726 HOH A O     1 
HETATM 7803 O  O     . HOH O 8 .   ? 1.174   50.350  26.261 1.00 45.16  ? 727 HOH A O     1 
HETATM 7804 O  O     . HOH O 8 .   ? 8.783   39.762  28.725 1.00 48.39  ? 728 HOH A O     1 
HETATM 7805 O  O     . HOH O 8 .   ? 6.066   13.683  69.782 1.00 24.90  ? 729 HOH A O     1 
HETATM 7806 O  O     . HOH O 8 .   ? 10.563  52.493  67.202 1.00 28.11  ? 730 HOH A O     1 
HETATM 7807 O  O     . HOH O 8 .   ? 4.591   48.979  73.045 1.00 49.17  ? 731 HOH A O     1 
HETATM 7808 O  O     . HOH O 8 .   ? 10.600  51.401  88.107 1.00 50.10  ? 732 HOH A O     1 
HETATM 7809 O  O     . HOH O 8 .   ? 4.169   49.194  92.614 1.00 40.23  ? 733 HOH A O     1 
HETATM 7810 O  O     . HOH P 8 .   ? 22.402  13.536  19.119 1.00 40.71  ? 701 HOH B O     1 
HETATM 7811 O  O     . HOH P 8 .   ? 23.477  13.492  21.713 1.00 41.69  ? 702 HOH B O     1 
HETATM 7812 O  O     . HOH P 8 .   ? 1.036   2.432   40.676 1.00 34.45  ? 703 HOH B O     1 
HETATM 7813 O  O     . HOH P 8 .   ? 8.639   5.072   -7.864 1.00 74.82  ? 704 HOH B O     1 
HETATM 7814 O  O     . HOH P 8 .   ? 5.213   34.136  -1.522 1.00 67.52  ? 705 HOH B O     1 
HETATM 7815 O  O     . HOH P 8 .   ? 7.623   0.540   16.280 1.00 38.49  ? 706 HOH B O     1 
HETATM 7816 O  O     . HOH P 8 .   ? 25.816  21.854  -3.658 1.00 44.14  ? 707 HOH B O     1 
HETATM 7817 O  O     . HOH P 8 .   ? 7.883   41.517  12.964 1.00 33.40  ? 708 HOH B O     1 
HETATM 7818 O  O     . HOH P 8 .   ? 29.232  -6.579  12.602 1.00 49.76  ? 709 HOH B O     1 
HETATM 7819 O  O     . HOH P 8 .   ? -2.024  8.216   54.717 1.00 53.87  ? 710 HOH B O     1 
HETATM 7820 O  O     . HOH P 8 .   ? 19.167  11.246  58.775 1.00 31.65  ? 711 HOH B O     1 
HETATM 7821 O  O     . HOH P 8 .   ? 15.961  16.179  38.770 1.00 32.98  ? 712 HOH B O     1 
HETATM 7822 O  O     . HOH P 8 .   ? 9.949   17.101  36.761 1.00 24.46  ? 713 HOH B O     1 
HETATM 7823 O  O     . HOH P 8 .   ? 8.745   30.044  4.445  1.00 52.92  ? 714 HOH B O     1 
HETATM 7824 O  O     . HOH P 8 .   ? 20.407  2.417   38.856 1.00 45.46  ? 715 HOH B O     1 
HETATM 7825 O  O     . HOH P 8 .   ? 9.422   -2.552  3.367  1.00 48.87  ? 716 HOH B O     1 
HETATM 7826 O  O     . HOH P 8 .   ? 14.637  3.693   36.770 1.00 24.73  ? 717 HOH B O     1 
HETATM 7827 O  O     . HOH P 8 .   ? 35.478  8.928   3.920  1.00 65.79  ? 718 HOH B O     1 
HETATM 7828 O  O     . HOH P 8 .   ? 21.710  -4.096  5.345  1.00 38.51  ? 719 HOH B O     1 
HETATM 7829 O  O     . HOH P 8 .   ? 11.329  8.035   10.904 1.00 35.96  ? 720 HOH B O     1 
HETATM 7830 O  O     . HOH P 8 .   ? 16.214  12.455  36.635 1.00 42.90  ? 721 HOH B O     1 
HETATM 7831 O  O     . HOH P 8 .   ? 29.152  4.838   17.259 1.00 41.44  ? 722 HOH B O     1 
HETATM 7832 O  O     . HOH P 8 .   ? 24.255  8.079   38.778 1.00 34.91  ? 723 HOH B O     1 
HETATM 7833 O  O     . HOH P 8 .   ? 14.871  0.465   45.544 1.00 39.37  ? 724 HOH B O     1 
HETATM 7834 O  O     . HOH P 8 .   ? 2.618   15.138  56.189 1.00 35.93  ? 725 HOH B O     1 
HETATM 7835 O  O     . HOH P 8 .   ? 16.324  24.405  39.148 1.00 47.79  ? 726 HOH B O     1 
HETATM 7836 O  O     . HOH P 8 .   ? 24.328  10.468  47.443 1.00 38.33  ? 727 HOH B O     1 
HETATM 7837 O  O     . HOH P 8 .   ? 33.912  32.126  26.004 1.00 50.92  ? 728 HOH B O     1 
HETATM 7838 O  O     . HOH P 8 .   ? 14.996  12.842  57.911 1.00 38.80  ? 729 HOH B O     1 
HETATM 7839 O  O     . HOH P 8 .   ? 29.612  8.872   16.592 1.00 41.89  ? 730 HOH B O     1 
HETATM 7840 O  O     . HOH P 8 .   ? 10.231  6.370   12.806 1.00 33.92  ? 731 HOH B O     1 
HETATM 7841 O  O     . HOH P 8 .   ? 17.771  11.584  62.589 1.00 27.27  ? 732 HOH B O     1 
HETATM 7842 O  O     . HOH P 8 .   ? 7.740   33.588  6.370  1.00 55.23  ? 733 HOH B O     1 
HETATM 7843 O  O     . HOH P 8 .   ? 14.459  4.599   44.992 1.00 38.08  ? 734 HOH B O     1 
HETATM 7844 O  O     . HOH P 8 .   ? 13.522  22.233  41.775 1.00 24.22  ? 735 HOH B O     1 
HETATM 7845 O  O     . HOH P 8 .   ? 8.927   45.373  4.892  1.00 52.80  ? 736 HOH B O     1 
HETATM 7846 O  O     . HOH P 8 .   ? 31.409  30.836  9.979  1.00 55.26  ? 737 HOH B O     1 
HETATM 7847 O  O     . HOH P 8 .   ? 9.614   25.840  47.429 1.00 33.85  ? 738 HOH B O     1 
HETATM 7848 O  O     . HOH P 8 .   ? -3.329  2.224   42.307 1.00 30.12  ? 739 HOH B O     1 
HETATM 7849 O  O     . HOH P 8 .   ? 1.633   22.525  51.153 1.00 42.67  ? 740 HOH B O     1 
HETATM 7850 O  O     . HOH P 8 .   ? 15.428  48.045  7.481  1.00 43.22  ? 741 HOH B O     1 
HETATM 7851 O  O     . HOH P 8 .   ? 14.778  11.971  10.388 1.00 43.92  ? 742 HOH B O     1 
HETATM 7852 O  O     . HOH P 8 .   ? 16.921  36.552  37.666 1.00 33.78  ? 743 HOH B O     1 
HETATM 7853 O  O     . HOH P 8 .   ? 13.299  15.615  3.237  1.00 37.39  ? 744 HOH B O     1 
HETATM 7854 O  O     . HOH P 8 .   ? 13.986  3.895   47.428 1.00 32.40  ? 745 HOH B O     1 
HETATM 7855 O  O     . HOH P 8 .   ? 1.518   12.084  62.258 1.00 58.92  ? 746 HOH B O     1 
HETATM 7856 O  O     . HOH P 8 .   ? 3.050   5.920   57.845 1.00 39.51  ? 747 HOH B O     1 
HETATM 7857 O  O     . HOH P 8 .   ? 0.652   26.220  50.164 1.00 38.65  ? 748 HOH B O     1 
HETATM 7858 O  O     . HOH Q 8 .   ? 16.369  38.883  64.699 1.00 43.02  ? 101 HOH C O     1 
HETATM 7859 O  O     . HOH Q 8 .   ? 17.405  43.648  67.832 1.00 31.93  ? 102 HOH C O     1 
HETATM 7860 O  O     . HOH Q 8 .   ? 16.775  43.772  56.561 1.00 38.25  ? 103 HOH C O     1 
HETATM 7861 O  O     . HOH Q 8 .   ? 9.956   49.582  62.354 1.00 37.38  ? 104 HOH C O     1 
HETATM 7862 O  O     . HOH R 8 .   ? 16.150  41.671  47.885 1.00 37.97  ? 101 HOH D O     1 
HETATM 7863 O  O     . HOH R 8 .   ? 2.649   55.005  62.833 1.00 52.10  ? 102 HOH D O     1 
HETATM 7864 O  O     . HOH R 8 .   ? 12.690  61.957  61.543 1.00 44.37  ? 103 HOH D O     1 
HETATM 7865 O  O     . HOH R 8 .   ? 38.708  32.500  41.890 1.00 74.16  ? 104 HOH D O     1 
HETATM 7866 O  O     . HOH R 8 .   ? 8.509   47.198  52.683 1.00 36.04  ? 105 HOH D O     1 
HETATM 7867 O  O     . HOH R 8 .   ? 7.045   36.434  47.227 1.00 26.83  ? 106 HOH D O     1 
HETATM 7868 O  O     . HOH R 8 .   ? 10.259  45.062  51.435 1.00 38.89  ? 107 HOH D O     1 
HETATM 7869 O  O     . HOH R 8 .   ? 19.474  43.072  51.235 1.00 33.52  ? 108 HOH D O     1 
HETATM 7870 O  O     . HOH R 8 .   ? 19.933  36.759  43.778 1.00 38.50  ? 109 HOH D O     1 
HETATM 7871 O  O     . HOH R 8 .   ? 39.441  37.286  43.586 1.00 63.35  ? 110 HOH D O     1 
HETATM 7872 O  O     . HOH R 8 .   ? 13.616  33.389  48.656 1.00 38.59  ? 111 HOH D O     1 
HETATM 7873 O  O     . HOH R 8 .   ? 4.036   64.727  61.846 1.00 46.14  ? 112 HOH D O     1 
HETATM 7874 O  O     . HOH R 8 .   ? 7.794   51.039  67.529 1.00 51.12  ? 113 HOH D O     1 
HETATM 7875 O  O     . HOH R 8 .   ? 11.266  30.267  49.370 1.00 38.48  ? 114 HOH D O     1 
HETATM 7876 O  O     . HOH S 8 .   ? 16.500  19.148  20.745 1.00 49.60  ? 101 HOH P O     1 
HETATM 7877 O  O     . HOH S 8 .   ? 14.503  16.705  22.865 1.00 46.43  ? 102 HOH P O     1 
HETATM 7878 O  O     . HOH S 8 .   ? 19.445  13.843  29.997 1.00 40.55  ? 103 HOH P O     1 
HETATM 7879 O  O     . HOH S 8 .   ? 7.354   6.126   33.751 1.00 28.65  ? 104 HOH P O     1 
HETATM 7880 O  O     . HOH S 8 .   ? 10.449  7.080   34.397 1.00 36.54  ? 105 HOH P O     1 
HETATM 7881 O  O     . HOH T 8 .   ? 8.248   22.024  37.216 1.00 27.06  ? 101 HOH T O     1 
HETATM 7882 O  O     . HOH T 8 .   ? 7.776   -4.424  22.200 1.00 30.51  ? 102 HOH T O     1 
HETATM 7883 O  O     . HOH T 8 .   ? 10.579  8.233   17.893 1.00 36.29  ? 103 HOH T O     1 
HETATM 7884 O  O     . HOH T 8 .   ? 12.531  12.874  33.702 1.00 37.08  ? 104 HOH T O     1 
HETATM 7885 O  O     . HOH T 8 .   ? 9.760   11.256  32.280 1.00 34.74  ? 105 HOH T O     1 
HETATM 7886 O  O     . HOH T 8 .   ? 9.458   -3.384  19.260 1.00 50.99  ? 106 HOH T O     1 
HETATM 7887 O  O     . HOH T 8 .   ? 18.926  14.606  37.664 1.00 25.88  ? 107 HOH T O     1 
HETATM 7888 O  O     . HOH T 8 .   ? 9.662   -4.074  30.900 1.00 32.18  ? 108 HOH T O     1 
HETATM 7889 O  O     . HOH T 8 .   ? 26.979  21.926  47.182 1.00 50.60  ? 109 HOH T O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   27  ?   ?   ?   A . n 
A 1 2   MET 2   28  ?   ?   ?   A . n 
A 1 3   GLU 3   29  ?   ?   ?   A . n 
A 1 4   GLY 4   30  ?   ?   ?   A . n 
A 1 5   LEU 5   31  ?   ?   ?   A . n 
A 1 6   ASP 6   32  32  ASP ASP A . n 
A 1 7   LYS 7   33  33  LYS LYS A . n 
A 1 8   GLU 8   34  34  GLU GLU A . n 
A 1 9   LYS 9   35  35  LYS LYS A . n 
A 1 10  ILE 10  36  36  ILE ILE A . n 
A 1 11  ASN 11  37  37  ASN ASN A . n 
A 1 12  LYS 12  38  38  LYS LYS A . n 
A 1 13  ILE 13  39  39  ILE ILE A . n 
A 1 14  ILE 14  40  40  ILE ILE A . n 
A 1 15  MET 15  41  41  MET MET A . n 
A 1 16  GLU 16  42  42  GLU GLU A . n 
A 1 17  ALA 17  43  43  ALA ALA A . n 
A 1 18  THR 18  44  44  THR THR A . n 
A 1 19  LYS 19  45  45  LYS LYS A . n 
A 1 20  GLY 20  46  46  GLY GLY A . n 
A 1 21  SER 21  47  47  SER SER A . n 
A 1 22  ARG 22  48  48  ARG ARG A . n 
A 1 23  PHE 23  49  49  PHE PHE A . n 
A 1 24  TYR 24  50  50  TYR TYR A . n 
A 1 25  GLY 25  51  51  GLY GLY A . n 
A 1 26  ASN 26  52  52  ASN ASN A . n 
A 1 27  GLU 27  53  53  GLU GLU A . n 
A 1 28  LEU 28  54  54  LEU LEU A . n 
A 1 29  LYS 29  55  55  LYS LYS A . n 
A 1 30  LYS 30  56  56  LYS LYS A . n 
A 1 31  GLU 31  57  57  GLU GLU A . n 
A 1 32  LYS 32  58  58  LYS LYS A . n 
A 1 33  GLN 33  59  59  GLN GLN A . n 
A 1 34  VAL 34  60  60  VAL VAL A . n 
A 1 35  ASN 35  61  61  ASN ASN A . n 
A 1 36  GLN 36  62  62  GLN GLN A . n 
A 1 37  ARG 37  63  63  ARG ARG A . n 
A 1 38  ILE 38  64  64  ILE ILE A . n 
A 1 39  GLU 39  65  65  GLU GLU A . n 
A 1 40  ASN 40  66  66  ASN ASN A . n 
A 1 41  MET 41  67  67  MET MET A . n 
A 1 42  MET 42  68  68  MET MET A . n 
A 1 43  GLN 43  69  69  GLN GLN A . n 
A 1 44  GLN 44  70  70  GLN GLN A . n 
A 1 45  LYS 45  71  71  LYS LYS A . n 
A 1 46  ALA 46  72  72  ALA ALA A . n 
A 1 47  GLN 47  73  73  GLN GLN A . n 
A 1 48  ILE 48  74  74  ILE ILE A . n 
A 1 49  THR 49  75  75  THR THR A . n 
A 1 50  SER 50  76  76  SER SER A . n 
A 1 51  GLN 51  77  77  GLN GLN A . n 
A 1 52  GLN 52  78  78  GLN GLN A . n 
A 1 53  LEU 53  79  79  LEU LEU A . n 
A 1 54  ARG 54  80  80  ARG ARG A . n 
A 1 55  LYS 55  81  81  LYS LYS A . n 
A 1 56  ALA 56  82  82  ALA ALA A . n 
A 1 57  GLN 57  83  83  GLN GLN A . n 
A 1 58  LEU 58  84  84  LEU LEU A . n 
A 1 59  GLN 59  85  85  GLN GLN A . n 
A 1 60  VAL 60  86  86  VAL VAL A . n 
A 1 61  ASP 61  87  87  ASP ASP A . n 
A 1 62  ARG 62  88  88  ARG ARG A . n 
A 1 63  PHE 63  89  89  PHE PHE A . n 
A 1 64  ALA 64  90  90  ALA ALA A . n 
A 1 65  MET 65  91  91  MET MET A . n 
A 1 66  GLU 66  92  92  GLU GLU A . n 
A 1 67  LEU 67  93  93  LEU LEU A . n 
A 1 68  GLU 68  94  94  GLU GLU A . n 
A 1 69  GLN 69  95  95  GLN GLN A . n 
A 1 70  SER 70  96  96  SER SER A . n 
A 1 71  ARG 71  97  97  ARG ARG A . n 
A 1 72  ASN 72  98  98  ASN ASN A . n 
A 1 73  LEU 73  99  99  LEU LEU A . n 
A 1 74  SER 74  100 100 SER SER A . n 
A 1 75  ASN 75  101 101 ASN ASN A . n 
A 1 76  THR 76  102 102 THR THR A . n 
A 1 77  ILE 77  103 103 ILE ILE A . n 
A 1 78  VAL 78  104 104 VAL VAL A . n 
A 1 79  HIS 79  105 105 HIS HIS A . n 
A 1 80  ILE 80  106 106 ILE ILE A . n 
A 1 81  ASP 81  107 107 ASP ASP A . n 
A 1 82  MET 82  108 108 MET MET A . n 
A 1 83  ASP 83  109 109 ASP ASP A . n 
A 1 84  ALA 84  110 110 ALA ALA A . n 
A 1 85  PHE 85  111 111 PHE PHE A . n 
A 1 86  TYR 86  112 112 TYR TYR A . n 
A 1 87  ALA 87  113 113 ALA ALA A . n 
A 1 88  ALA 88  114 114 ALA ALA A . n 
A 1 89  VAL 89  115 115 VAL VAL A . n 
A 1 90  GLU 90  116 116 GLU GLU A . n 
A 1 91  MET 91  117 117 MET MET A . n 
A 1 92  ARG 92  118 118 ARG ARG A . n 
A 1 93  ASP 93  119 119 ASP ASP A . n 
A 1 94  ASN 94  120 120 ASN ASN A . n 
A 1 95  PRO 95  121 121 PRO PRO A . n 
A 1 96  GLU 96  122 122 GLU GLU A . n 
A 1 97  LEU 97  123 123 LEU LEU A . n 
A 1 98  LYS 98  124 124 LYS LYS A . n 
A 1 99  ASP 99  125 125 ASP ASP A . n 
A 1 100 LYS 100 126 126 LYS LYS A . n 
A 1 101 PRO 101 127 127 PRO PRO A . n 
A 1 102 ILE 102 128 128 ILE ILE A . n 
A 1 103 ALA 103 129 129 ALA ALA A . n 
A 1 104 VAL 104 130 130 VAL VAL A . n 
A 1 105 GLY 105 131 131 GLY GLY A . n 
A 1 106 SER 106 132 132 SER SER A . n 
A 1 107 MET 107 133 133 MET MET A . n 
A 1 108 SER 108 134 134 SER SER A . n 
A 1 109 MET 109 135 135 MET MET A . n 
A 1 110 LEU 110 136 136 LEU LEU A . n 
A 1 111 SER 111 137 137 SER SER A . n 
A 1 112 THR 112 138 138 THR THR A . n 
A 1 113 SER 113 139 139 SER SER A . n 
A 1 114 ASN 114 140 140 ASN ASN A . n 
A 1 115 TYR 115 141 141 TYR TYR A . n 
A 1 116 HIS 116 142 142 HIS HIS A . n 
A 1 117 ALA 117 143 143 ALA ALA A . n 
A 1 118 ARG 118 144 144 ARG ARG A . n 
A 1 119 ARG 119 145 145 ARG ARG A . n 
A 1 120 PHE 120 146 146 PHE PHE A . n 
A 1 121 GLY 121 147 147 GLY GLY A . n 
A 1 122 VAL 122 148 148 VAL VAL A . n 
A 1 123 ARG 123 149 149 ARG ARG A . n 
A 1 124 ALA 124 150 150 ALA ALA A . n 
A 1 125 ALA 125 151 151 ALA ALA A . n 
A 1 126 MET 126 152 152 MET MET A . n 
A 1 127 PRO 127 153 153 PRO PRO A . n 
A 1 128 GLY 128 154 154 GLY GLY A . n 
A 1 129 PHE 129 155 155 PHE PHE A . n 
A 1 130 ILE 130 156 156 ILE ILE A . n 
A 1 131 ALA 131 157 157 ALA ALA A . n 
A 1 132 LYS 132 158 158 LYS LYS A . n 
A 1 133 ARG 133 159 159 ARG ARG A . n 
A 1 134 LEU 134 160 160 LEU LEU A . n 
A 1 135 CYS 135 161 161 CYS CYS A . n 
A 1 136 PRO 136 162 162 PRO PRO A . n 
A 1 137 GLN 137 163 163 GLN GLN A . n 
A 1 138 LEU 138 164 164 LEU LEU A . n 
A 1 139 ILE 139 165 165 ILE ILE A . n 
A 1 140 ILE 140 166 166 ILE ILE A . n 
A 1 141 VAL 141 167 167 VAL VAL A . n 
A 1 142 PRO 142 168 168 PRO PRO A . n 
A 1 143 PRO 143 169 169 PRO PRO A . n 
A 1 144 ASN 144 170 170 ASN ASN A . n 
A 1 145 PHE 145 171 171 PHE PHE A . n 
A 1 146 ASP 146 172 172 ASP ASP A . n 
A 1 147 LYS 147 173 173 LYS LYS A . n 
A 1 148 TYR 148 174 174 TYR TYR A . n 
A 1 149 ARG 149 175 175 ARG ARG A . n 
A 1 150 ALA 150 176 176 ALA ALA A . n 
A 1 151 VAL 151 177 177 VAL VAL A . n 
A 1 152 SER 152 178 178 SER SER A . n 
A 1 153 LYS 153 179 179 LYS LYS A . n 
A 1 154 GLU 154 180 180 GLU GLU A . n 
A 1 155 VAL 155 181 181 VAL VAL A . n 
A 1 156 LYS 156 182 182 LYS LYS A . n 
A 1 157 GLU 157 183 183 GLU GLU A . n 
A 1 158 ILE 158 184 184 ILE ILE A . n 
A 1 159 LEU 159 185 185 LEU LEU A . n 
A 1 160 ALA 160 186 186 ALA ALA A . n 
A 1 161 ASP 161 187 187 ASP ASP A . n 
A 1 162 TYR 162 188 188 TYR TYR A . n 
A 1 163 ASP 163 189 189 ASP ASP A . n 
A 1 164 PRO 164 190 190 PRO PRO A . n 
A 1 165 ASN 165 191 191 ASN ASN A . n 
A 1 166 PHE 166 192 192 PHE PHE A . n 
A 1 167 MET 167 193 193 MET MET A . n 
A 1 168 ALA 168 194 194 ALA ALA A . n 
A 1 169 MET 169 195 195 MET MET A . n 
A 1 170 SER 170 196 196 SER SER A . n 
A 1 171 LEU 171 197 197 LEU LEU A . n 
A 1 172 ASP 172 198 198 ASP ASP A . n 
A 1 173 GLU 173 199 199 GLU GLU A . n 
A 1 174 ALA 174 200 200 ALA ALA A . n 
A 1 175 TYR 175 201 201 TYR TYR A . n 
A 1 176 LEU 176 202 202 LEU LEU A . n 
A 1 177 ASN 177 203 203 ASN ASN A . n 
A 1 178 ILE 178 204 204 ILE ILE A . n 
A 1 179 THR 179 205 205 THR THR A . n 
A 1 180 LYS 180 206 206 LYS LYS A . n 
A 1 181 HIS 181 207 207 HIS HIS A . n 
A 1 182 LEU 182 208 208 LEU LEU A . n 
A 1 183 GLU 183 209 209 GLU GLU A . n 
A 1 184 GLU 184 210 210 GLU GLU A . n 
A 1 185 ARG 185 211 211 ARG ARG A . n 
A 1 186 GLN 186 212 212 GLN GLN A . n 
A 1 187 ASN 187 213 213 ASN ASN A . n 
A 1 188 TRP 188 214 214 TRP TRP A . n 
A 1 189 PRO 189 215 215 PRO PRO A . n 
A 1 190 GLU 190 216 216 GLU GLU A . n 
A 1 191 ASP 191 217 217 ASP ASP A . n 
A 1 192 LYS 192 218 218 LYS LYS A . n 
A 1 193 ARG 193 219 219 ARG ARG A . n 
A 1 194 ARG 194 220 220 ARG ARG A . n 
A 1 195 TYR 195 221 221 TYR TYR A . n 
A 1 196 PHE 196 222 222 PHE PHE A . n 
A 1 197 ILE 197 223 223 ILE ILE A . n 
A 1 198 LYS 198 224 224 LYS LYS A . n 
A 1 199 MET 199 225 ?   ?   ?   A . n 
A 1 200 GLY 200 226 ?   ?   ?   A . n 
A 1 201 SER 201 227 ?   ?   ?   A . n 
A 1 202 SER 202 228 ?   ?   ?   A . n 
A 1 203 VAL 203 229 ?   ?   ?   A . n 
A 1 204 GLU 204 230 ?   ?   ?   A . n 
A 1 205 ASN 205 231 ?   ?   ?   A . n 
A 1 206 ASP 206 232 ?   ?   ?   A . n 
A 1 207 ASN 207 233 ?   ?   ?   A . n 
A 1 208 PRO 208 234 ?   ?   ?   A . n 
A 1 209 GLY 209 235 ?   ?   ?   A . n 
A 1 210 LYS 210 236 ?   ?   ?   A . n 
A 1 211 GLU 211 237 ?   ?   ?   A . n 
A 1 212 VAL 212 238 ?   ?   ?   A . n 
A 1 213 ASN 213 239 ?   ?   ?   A . n 
A 1 214 LYS 214 240 ?   ?   ?   A . n 
A 1 215 LEU 215 241 ?   ?   ?   A . n 
A 1 216 SER 216 242 ?   ?   ?   A . n 
A 1 217 GLU 217 243 ?   ?   ?   A . n 
A 1 218 HIS 218 244 ?   ?   ?   A . n 
A 1 219 GLU 219 245 ?   ?   ?   A . n 
A 1 220 ARG 220 246 ?   ?   ?   A . n 
A 1 221 SER 221 247 ?   ?   ?   A . n 
A 1 222 ILE 222 248 ?   ?   ?   A . n 
A 1 223 SER 223 249 ?   ?   ?   A . n 
A 1 224 PRO 224 250 ?   ?   ?   A . n 
A 1 225 LEU 225 251 ?   ?   ?   A . n 
A 1 226 LEU 226 252 ?   ?   ?   A . n 
A 1 227 PHE 227 253 ?   ?   ?   A . n 
A 1 228 GLU 228 254 ?   ?   ?   A . n 
A 1 229 GLU 229 255 ?   ?   ?   A . n 
A 1 230 SER 230 256 ?   ?   ?   A . n 
A 1 231 PRO 231 257 ?   ?   ?   A . n 
A 1 232 SER 232 258 ?   ?   ?   A . n 
A 1 233 ASP 233 259 ?   ?   ?   A . n 
A 1 234 VAL 234 260 ?   ?   ?   A . n 
A 1 235 GLN 235 261 ?   ?   ?   A . n 
A 1 236 PRO 236 262 ?   ?   ?   A . n 
A 1 237 PRO 237 263 ?   ?   ?   A . n 
A 1 238 GLY 238 264 ?   ?   ?   A . n 
A 1 239 ASP 239 265 ?   ?   ?   A . n 
A 1 240 PRO 240 266 ?   ?   ?   A . n 
A 1 241 PHE 241 267 ?   ?   ?   A . n 
A 1 242 GLN 242 268 ?   ?   ?   A . n 
A 1 243 VAL 243 269 ?   ?   ?   A . n 
A 1 244 ASN 244 270 ?   ?   ?   A . n 
A 1 245 PHE 245 271 ?   ?   ?   A . n 
A 1 246 GLU 246 272 ?   ?   ?   A . n 
A 1 247 GLU 247 273 ?   ?   ?   A . n 
A 1 248 GLN 248 274 ?   ?   ?   A . n 
A 1 249 ASN 249 275 ?   ?   ?   A . n 
A 1 250 ASN 250 276 ?   ?   ?   A . n 
A 1 251 PRO 251 277 ?   ?   ?   A . n 
A 1 252 GLN 252 278 ?   ?   ?   A . n 
A 1 253 ILE 253 279 ?   ?   ?   A . n 
A 1 254 LEU 254 280 ?   ?   ?   A . n 
A 1 255 GLN 255 281 281 GLN GLN A . n 
A 1 256 ASN 256 282 282 ASN ASN A . n 
A 1 257 SER 257 283 283 SER SER A . n 
A 1 258 VAL 258 284 284 VAL VAL A . n 
A 1 259 VAL 259 285 285 VAL VAL A . n 
A 1 260 PHE 260 286 286 PHE PHE A . n 
A 1 261 GLY 261 287 287 GLY GLY A . n 
A 1 262 THR 262 288 288 THR THR A . n 
A 1 263 SER 263 289 289 SER SER A . n 
A 1 264 ALA 264 290 290 ALA ALA A . n 
A 1 265 GLN 265 291 291 GLN GLN A . n 
A 1 266 GLU 266 292 292 GLU GLU A . n 
A 1 267 VAL 267 293 293 VAL VAL A . n 
A 1 268 VAL 268 294 294 VAL VAL A . n 
A 1 269 LYS 269 295 295 LYS LYS A . n 
A 1 270 GLU 270 296 296 GLU GLU A . n 
A 1 271 ILE 271 297 297 ILE ILE A . n 
A 1 272 ARG 272 298 298 ARG ARG A . n 
A 1 273 PHE 273 299 299 PHE PHE A . n 
A 1 274 ARG 274 300 300 ARG ARG A . n 
A 1 275 ILE 275 301 301 ILE ILE A . n 
A 1 276 GLU 276 302 302 GLU GLU A . n 
A 1 277 GLN 277 303 303 GLN GLN A . n 
A 1 278 LYS 278 304 304 LYS LYS A . n 
A 1 279 THR 279 305 305 THR THR A . n 
A 1 280 THR 280 306 306 THR THR A . n 
A 1 281 LEU 281 307 307 LEU LEU A . n 
A 1 282 THR 282 308 308 THR THR A . n 
A 1 283 ALA 283 309 309 ALA ALA A . n 
A 1 284 SER 284 310 310 SER SER A . n 
A 1 285 ALA 285 311 311 ALA ALA A . n 
A 1 286 GLY 286 312 312 GLY GLY A . n 
A 1 287 ILE 287 313 313 ILE ILE A . n 
A 1 288 ALA 288 314 314 ALA ALA A . n 
A 1 289 PRO 289 315 315 PRO PRO A . n 
A 1 290 ASN 290 316 316 ASN ASN A . n 
A 1 291 THR 291 317 317 THR THR A . n 
A 1 292 MET 292 318 318 MET MET A . n 
A 1 293 LEU 293 319 319 LEU LEU A . n 
A 1 294 ALA 294 320 320 ALA ALA A . n 
A 1 295 LYS 295 321 321 LYS LYS A . n 
A 1 296 VAL 296 322 322 VAL VAL A . n 
A 1 297 CYS 297 323 323 CYS CYS A . n 
A 1 298 SER 298 324 324 SER SER A . n 
A 1 299 ASP 299 325 325 ASP ASP A . n 
A 1 300 LYS 300 326 326 LYS LYS A . n 
A 1 301 ASN 301 327 327 ASN ASN A . n 
A 1 302 LYS 302 328 328 LYS LYS A . n 
A 1 303 PRO 303 329 329 PRO PRO A . n 
A 1 304 ASN 304 330 330 ASN ASN A . n 
A 1 305 GLY 305 331 331 GLY GLY A . n 
A 1 306 GLN 306 332 332 GLN GLN A . n 
A 1 307 TYR 307 333 333 TYR TYR A . n 
A 1 308 GLN 308 334 334 GLN GLN A . n 
A 1 309 ILE 309 335 335 ILE ILE A . n 
A 1 310 LEU 310 336 336 LEU LEU A . n 
A 1 311 PRO 311 337 337 PRO PRO A . n 
A 1 312 ASN 312 338 338 ASN ASN A . n 
A 1 313 ARG 313 339 339 ARG ARG A . n 
A 1 314 GLN 314 340 340 GLN GLN A . n 
A 1 315 ALA 315 341 341 ALA ALA A . n 
A 1 316 VAL 316 342 342 VAL VAL A . n 
A 1 317 MET 317 343 343 MET MET A . n 
A 1 318 ASP 318 344 344 ASP ASP A . n 
A 1 319 PHE 319 345 345 PHE PHE A . n 
A 1 320 ILE 320 346 346 ILE ILE A . n 
A 1 321 LYS 321 347 347 LYS LYS A . n 
A 1 322 ASP 322 348 348 ASP ASP A . n 
A 1 323 LEU 323 349 349 LEU LEU A . n 
A 1 324 PRO 324 350 350 PRO PRO A . n 
A 1 325 ILE 325 351 351 ILE ILE A . n 
A 1 326 ARG 326 352 352 ARG ARG A . n 
A 1 327 LYS 327 353 353 LYS LYS A . n 
A 1 328 VAL 328 354 354 VAL VAL A . n 
A 1 329 SER 329 355 355 SER SER A . n 
A 1 330 GLY 330 356 356 GLY GLY A . n 
A 1 331 ILE 331 357 357 ILE ILE A . n 
A 1 332 GLY 332 358 358 GLY GLY A . n 
A 1 333 LYS 333 359 359 LYS LYS A . n 
A 1 334 VAL 334 360 360 VAL VAL A . n 
A 1 335 THR 335 361 361 THR THR A . n 
A 1 336 GLU 336 362 362 GLU GLU A . n 
A 1 337 LYS 337 363 363 LYS LYS A . n 
A 1 338 MET 338 364 364 MET MET A . n 
A 1 339 LEU 339 365 365 LEU LEU A . n 
A 1 340 LYS 340 366 366 LYS LYS A . n 
A 1 341 ALA 341 367 367 ALA ALA A . n 
A 1 342 LEU 342 368 368 LEU LEU A . n 
A 1 343 GLY 343 369 369 GLY GLY A . n 
A 1 344 ILE 344 370 370 ILE ILE A . n 
A 1 345 ILE 345 371 371 ILE ILE A . n 
A 1 346 THR 346 372 372 THR THR A . n 
A 1 347 CYS 347 373 373 CYS CYS A . n 
A 1 348 THR 348 374 374 THR THR A . n 
A 1 349 GLU 349 375 375 GLU GLU A . n 
A 1 350 LEU 350 376 376 LEU LEU A . n 
A 1 351 TYR 351 377 377 TYR TYR A . n 
A 1 352 GLN 352 378 378 GLN GLN A . n 
A 1 353 GLN 353 379 379 GLN GLN A . n 
A 1 354 ARG 354 380 380 ARG ARG A . n 
A 1 355 ALA 355 381 381 ALA ALA A . n 
A 1 356 LEU 356 382 382 LEU LEU A . n 
A 1 357 LEU 357 383 383 LEU LEU A . n 
A 1 358 SER 358 384 384 SER SER A . n 
A 1 359 LEU 359 385 385 LEU LEU A . n 
A 1 360 LEU 360 386 386 LEU LEU A . n 
A 1 361 PHE 361 387 387 PHE PHE A . n 
A 1 362 SER 362 388 388 SER SER A . n 
A 1 363 GLU 363 389 389 GLU GLU A . n 
A 1 364 THR 364 390 390 THR THR A . n 
A 1 365 SER 365 391 391 SER SER A . n 
A 1 366 TRP 366 392 392 TRP TRP A . n 
A 1 367 HIS 367 393 393 HIS HIS A . n 
A 1 368 TYR 368 394 394 TYR TYR A . n 
A 1 369 PHE 369 395 395 PHE PHE A . n 
A 1 370 LEU 370 396 396 LEU LEU A . n 
A 1 371 HIS 371 397 397 HIS HIS A . n 
A 1 372 ILE 372 398 398 ILE ILE A . n 
A 1 373 SER 373 399 399 SER SER A . n 
A 1 374 LEU 374 400 400 LEU LEU A . n 
A 1 375 GLY 375 401 401 GLY GLY A . n 
A 1 376 LEU 376 402 402 LEU LEU A . n 
A 1 377 GLY 377 403 403 GLY GLY A . n 
A 1 378 SER 378 404 404 SER SER A . n 
A 1 379 THR 379 405 405 THR THR A . n 
A 1 380 HIS 380 406 406 HIS HIS A . n 
A 1 381 LEU 381 407 407 LEU LEU A . n 
A 1 382 THR 382 408 408 THR THR A . n 
A 1 383 ARG 383 409 409 ARG ARG A . n 
A 1 384 ASP 384 410 410 ASP ASP A . n 
A 1 385 GLY 385 411 411 GLY GLY A . n 
A 1 386 GLU 386 412 412 GLU GLU A . n 
A 1 387 ARG 387 413 413 ARG ARG A . n 
A 1 388 LYS 388 414 414 LYS LYS A . n 
A 1 389 SER 389 415 415 SER SER A . n 
A 1 390 MET 390 416 416 MET MET A . n 
A 1 391 SER 391 417 417 SER SER A . n 
A 1 392 VAL 392 418 418 VAL VAL A . n 
A 1 393 GLU 393 419 419 GLU GLU A . n 
A 1 394 ARG 394 420 420 ARG ARG A . n 
A 1 395 THR 395 421 421 THR THR A . n 
A 1 396 PHE 396 422 422 PHE PHE A . n 
A 1 397 SER 397 423 423 SER SER A . n 
A 1 398 GLU 398 424 424 GLU GLU A . n 
A 1 399 ILE 399 425 425 ILE ILE A . n 
A 1 400 ASN 400 426 426 ASN ASN A . n 
A 1 401 LYS 401 427 427 LYS LYS A . n 
A 1 402 ALA 402 428 428 ALA ALA A . n 
A 1 403 GLU 403 429 429 GLU GLU A . n 
A 1 404 GLU 404 430 430 GLU GLU A . n 
A 1 405 GLN 405 431 431 GLN GLN A . n 
A 1 406 TYR 406 432 432 TYR TYR A . n 
A 1 407 SER 407 433 433 SER SER A . n 
A 1 408 LEU 408 434 434 LEU LEU A . n 
A 1 409 CYS 409 435 435 CYS CYS A . n 
A 1 410 GLN 410 436 436 GLN GLN A . n 
A 1 411 GLU 411 437 437 GLU GLU A . n 
A 1 412 LEU 412 438 438 LEU LEU A . n 
A 1 413 CYS 413 439 439 CYS CYS A . n 
A 1 414 SER 414 440 440 SER SER A . n 
A 1 415 GLU 415 441 441 GLU GLU A . n 
A 1 416 LEU 416 442 442 LEU LEU A . n 
A 1 417 ALA 417 443 443 ALA ALA A . n 
A 1 418 GLN 418 444 444 GLN GLN A . n 
A 1 419 ASP 419 445 445 ASP ASP A . n 
A 1 420 LEU 420 446 446 LEU LEU A . n 
A 1 421 GLN 421 447 447 GLN GLN A . n 
A 1 422 LYS 422 448 448 LYS LYS A . n 
A 1 423 GLU 423 449 449 GLU GLU A . n 
A 1 424 ARG 424 450 450 ARG ARG A . n 
A 1 425 LEU 425 451 451 LEU LEU A . n 
A 1 426 LYS 426 452 452 LYS LYS A . n 
A 1 427 GLY 427 453 453 GLY GLY A . n 
A 1 428 ARG 428 454 454 ARG ARG A . n 
A 1 429 THR 429 455 455 THR THR A . n 
A 1 430 VAL 430 456 456 VAL VAL A . n 
A 1 431 THR 431 457 457 THR THR A . n 
A 1 432 ILE 432 458 458 ILE ILE A . n 
A 1 433 LYS 433 459 459 LYS LYS A . n 
A 1 434 LEU 434 460 460 LEU LEU A . n 
A 1 435 LYS 435 461 461 LYS LYS A . n 
A 1 436 ASN 436 462 462 ASN ASN A . n 
A 1 437 VAL 437 463 463 VAL VAL A . n 
A 1 438 ASN 438 464 464 ASN ASN A . n 
A 1 439 PHE 439 465 465 PHE PHE A . n 
A 1 440 GLU 440 466 466 GLU GLU A . n 
A 1 441 VAL 441 467 467 VAL VAL A . n 
A 1 442 LYS 442 468 468 LYS LYS A . n 
A 1 443 THR 443 469 469 THR THR A . n 
A 1 444 ARG 444 470 470 ARG ARG A . n 
A 1 445 ALA 445 471 471 ALA ALA A . n 
A 1 446 SER 446 472 472 SER SER A . n 
A 1 447 THR 447 473 473 THR THR A . n 
A 1 448 VAL 448 474 474 VAL VAL A . n 
A 1 449 SER 449 475 475 SER SER A . n 
A 1 450 SER 450 476 476 SER SER A . n 
A 1 451 VAL 451 477 477 VAL VAL A . n 
A 1 452 VAL 452 478 478 VAL VAL A . n 
A 1 453 SER 453 479 479 SER SER A . n 
A 1 454 THR 454 480 480 THR THR A . n 
A 1 455 ALA 455 481 481 ALA ALA A . n 
A 1 456 GLU 456 482 482 GLU GLU A . n 
A 1 457 GLU 457 483 483 GLU GLU A . n 
A 1 458 ILE 458 484 484 ILE ILE A . n 
A 1 459 PHE 459 485 485 PHE PHE A . n 
A 1 460 ALA 460 486 486 ALA ALA A . n 
A 1 461 ILE 461 487 487 ILE ILE A . n 
A 1 462 ALA 462 488 488 ALA ALA A . n 
A 1 463 LYS 463 489 489 LYS LYS A . n 
A 1 464 GLU 464 490 490 GLU GLU A . n 
A 1 465 LEU 465 491 491 LEU LEU A . n 
A 1 466 LEU 466 492 492 LEU LEU A . n 
A 1 467 LYS 467 493 493 LYS LYS A . n 
A 1 468 THR 468 494 494 THR THR A . n 
A 1 469 GLU 469 495 495 GLU GLU A . n 
A 1 470 ILE 470 496 496 ILE ILE A . n 
A 1 471 ASP 471 497 497 ASP ASP A . n 
A 1 472 ALA 472 498 498 ALA ALA A . n 
A 1 473 ASP 473 499 499 ASP ASP A . n 
A 1 474 PHE 474 500 500 PHE PHE A . n 
A 1 475 PRO 475 501 501 PRO PRO A . n 
A 1 476 HIS 476 502 502 HIS HIS A . n 
A 1 477 PRO 477 503 503 PRO PRO A . n 
A 1 478 LEU 478 504 504 LEU LEU A . n 
A 1 479 ARG 479 505 505 ARG ARG A . n 
A 1 480 LEU 480 506 506 LEU LEU A . n 
A 1 481 ARG 481 507 507 ARG ARG A . n 
A 1 482 LEU 482 508 508 LEU LEU A . n 
A 1 483 MET 483 509 509 MET MET A . n 
A 1 484 GLY 484 510 510 GLY GLY A . n 
A 1 485 VAL 485 511 511 VAL VAL A . n 
A 1 486 ARG 486 512 512 ARG ARG A . n 
A 1 487 ILE 487 513 513 ILE ILE A . n 
A 1 488 SER 488 514 514 SER SER A . n 
A 1 489 SER 489 515 515 SER SER A . n 
A 1 490 PHE 490 516 516 PHE PHE A . n 
A 1 491 PRO 491 517 517 PRO PRO A . n 
A 1 492 ASN 492 518 518 ASN ASN A . n 
B 1 1   GLY 1   27  ?   ?   ?   B . n 
B 1 2   MET 2   28  ?   ?   ?   B . n 
B 1 3   GLU 3   29  ?   ?   ?   B . n 
B 1 4   GLY 4   30  ?   ?   ?   B . n 
B 1 5   LEU 5   31  31  LEU LEU B . n 
B 1 6   ASP 6   32  32  ASP ASP B . n 
B 1 7   LYS 7   33  33  LYS LYS B . n 
B 1 8   GLU 8   34  34  GLU GLU B . n 
B 1 9   LYS 9   35  35  LYS LYS B . n 
B 1 10  ILE 10  36  36  ILE ILE B . n 
B 1 11  ASN 11  37  37  ASN ASN B . n 
B 1 12  LYS 12  38  38  LYS LYS B . n 
B 1 13  ILE 13  39  39  ILE ILE B . n 
B 1 14  ILE 14  40  40  ILE ILE B . n 
B 1 15  MET 15  41  41  MET MET B . n 
B 1 16  GLU 16  42  42  GLU GLU B . n 
B 1 17  ALA 17  43  43  ALA ALA B . n 
B 1 18  THR 18  44  44  THR THR B . n 
B 1 19  LYS 19  45  45  LYS LYS B . n 
B 1 20  GLY 20  46  46  GLY GLY B . n 
B 1 21  SER 21  47  47  SER SER B . n 
B 1 22  ARG 22  48  48  ARG ARG B . n 
B 1 23  PHE 23  49  49  PHE PHE B . n 
B 1 24  TYR 24  50  50  TYR TYR B . n 
B 1 25  GLY 25  51  51  GLY GLY B . n 
B 1 26  ASN 26  52  52  ASN ASN B . n 
B 1 27  GLU 27  53  53  GLU GLU B . n 
B 1 28  LEU 28  54  54  LEU LEU B . n 
B 1 29  LYS 29  55  55  LYS LYS B . n 
B 1 30  LYS 30  56  56  LYS LYS B . n 
B 1 31  GLU 31  57  57  GLU GLU B . n 
B 1 32  LYS 32  58  58  LYS LYS B . n 
B 1 33  GLN 33  59  59  GLN GLN B . n 
B 1 34  VAL 34  60  60  VAL VAL B . n 
B 1 35  ASN 35  61  61  ASN ASN B . n 
B 1 36  GLN 36  62  62  GLN GLN B . n 
B 1 37  ARG 37  63  63  ARG ARG B . n 
B 1 38  ILE 38  64  64  ILE ILE B . n 
B 1 39  GLU 39  65  65  GLU GLU B . n 
B 1 40  ASN 40  66  66  ASN ASN B . n 
B 1 41  MET 41  67  67  MET MET B . n 
B 1 42  MET 42  68  68  MET MET B . n 
B 1 43  GLN 43  69  69  GLN GLN B . n 
B 1 44  GLN 44  70  70  GLN GLN B . n 
B 1 45  LYS 45  71  71  LYS LYS B . n 
B 1 46  ALA 46  72  72  ALA ALA B . n 
B 1 47  GLN 47  73  73  GLN GLN B . n 
B 1 48  ILE 48  74  74  ILE ILE B . n 
B 1 49  THR 49  75  75  THR THR B . n 
B 1 50  SER 50  76  76  SER SER B . n 
B 1 51  GLN 51  77  77  GLN GLN B . n 
B 1 52  GLN 52  78  78  GLN GLN B . n 
B 1 53  LEU 53  79  79  LEU LEU B . n 
B 1 54  ARG 54  80  80  ARG ARG B . n 
B 1 55  LYS 55  81  81  LYS LYS B . n 
B 1 56  ALA 56  82  82  ALA ALA B . n 
B 1 57  GLN 57  83  83  GLN GLN B . n 
B 1 58  LEU 58  84  84  LEU LEU B . n 
B 1 59  GLN 59  85  85  GLN GLN B . n 
B 1 60  VAL 60  86  86  VAL VAL B . n 
B 1 61  ASP 61  87  87  ASP ASP B . n 
B 1 62  ARG 62  88  88  ARG ARG B . n 
B 1 63  PHE 63  89  89  PHE PHE B . n 
B 1 64  ALA 64  90  90  ALA ALA B . n 
B 1 65  MET 65  91  91  MET MET B . n 
B 1 66  GLU 66  92  92  GLU GLU B . n 
B 1 67  LEU 67  93  93  LEU LEU B . n 
B 1 68  GLU 68  94  94  GLU GLU B . n 
B 1 69  GLN 69  95  95  GLN GLN B . n 
B 1 70  SER 70  96  96  SER SER B . n 
B 1 71  ARG 71  97  97  ARG ARG B . n 
B 1 72  ASN 72  98  98  ASN ASN B . n 
B 1 73  LEU 73  99  99  LEU LEU B . n 
B 1 74  SER 74  100 100 SER SER B . n 
B 1 75  ASN 75  101 101 ASN ASN B . n 
B 1 76  THR 76  102 102 THR THR B . n 
B 1 77  ILE 77  103 103 ILE ILE B . n 
B 1 78  VAL 78  104 104 VAL VAL B . n 
B 1 79  HIS 79  105 105 HIS HIS B . n 
B 1 80  ILE 80  106 106 ILE ILE B . n 
B 1 81  ASP 81  107 107 ASP ASP B . n 
B 1 82  MET 82  108 108 MET MET B . n 
B 1 83  ASP 83  109 109 ASP ASP B . n 
B 1 84  ALA 84  110 110 ALA ALA B . n 
B 1 85  PHE 85  111 111 PHE PHE B . n 
B 1 86  TYR 86  112 112 TYR TYR B . n 
B 1 87  ALA 87  113 113 ALA ALA B . n 
B 1 88  ALA 88  114 114 ALA ALA B . n 
B 1 89  VAL 89  115 115 VAL VAL B . n 
B 1 90  GLU 90  116 116 GLU GLU B . n 
B 1 91  MET 91  117 117 MET MET B . n 
B 1 92  ARG 92  118 118 ARG ARG B . n 
B 1 93  ASP 93  119 119 ASP ASP B . n 
B 1 94  ASN 94  120 120 ASN ASN B . n 
B 1 95  PRO 95  121 121 PRO PRO B . n 
B 1 96  GLU 96  122 122 GLU GLU B . n 
B 1 97  LEU 97  123 123 LEU LEU B . n 
B 1 98  LYS 98  124 124 LYS LYS B . n 
B 1 99  ASP 99  125 125 ASP ASP B . n 
B 1 100 LYS 100 126 126 LYS LYS B . n 
B 1 101 PRO 101 127 127 PRO PRO B . n 
B 1 102 ILE 102 128 128 ILE ILE B . n 
B 1 103 ALA 103 129 129 ALA ALA B . n 
B 1 104 VAL 104 130 130 VAL VAL B . n 
B 1 105 GLY 105 131 131 GLY GLY B . n 
B 1 106 SER 106 132 132 SER SER B . n 
B 1 107 MET 107 133 133 MET MET B . n 
B 1 108 SER 108 134 134 SER SER B . n 
B 1 109 MET 109 135 135 MET MET B . n 
B 1 110 LEU 110 136 136 LEU LEU B . n 
B 1 111 SER 111 137 137 SER SER B . n 
B 1 112 THR 112 138 138 THR THR B . n 
B 1 113 SER 113 139 139 SER SER B . n 
B 1 114 ASN 114 140 140 ASN ASN B . n 
B 1 115 TYR 115 141 141 TYR TYR B . n 
B 1 116 HIS 116 142 142 HIS HIS B . n 
B 1 117 ALA 117 143 143 ALA ALA B . n 
B 1 118 ARG 118 144 144 ARG ARG B . n 
B 1 119 ARG 119 145 145 ARG ARG B . n 
B 1 120 PHE 120 146 146 PHE PHE B . n 
B 1 121 GLY 121 147 147 GLY GLY B . n 
B 1 122 VAL 122 148 148 VAL VAL B . n 
B 1 123 ARG 123 149 149 ARG ARG B . n 
B 1 124 ALA 124 150 150 ALA ALA B . n 
B 1 125 ALA 125 151 151 ALA ALA B . n 
B 1 126 MET 126 152 152 MET MET B . n 
B 1 127 PRO 127 153 153 PRO PRO B . n 
B 1 128 GLY 128 154 154 GLY GLY B . n 
B 1 129 PHE 129 155 155 PHE PHE B . n 
B 1 130 ILE 130 156 156 ILE ILE B . n 
B 1 131 ALA 131 157 157 ALA ALA B . n 
B 1 132 LYS 132 158 158 LYS LYS B . n 
B 1 133 ARG 133 159 159 ARG ARG B . n 
B 1 134 LEU 134 160 160 LEU LEU B . n 
B 1 135 CYS 135 161 161 CYS CYS B . n 
B 1 136 PRO 136 162 162 PRO PRO B . n 
B 1 137 GLN 137 163 163 GLN GLN B . n 
B 1 138 LEU 138 164 164 LEU LEU B . n 
B 1 139 ILE 139 165 165 ILE ILE B . n 
B 1 140 ILE 140 166 166 ILE ILE B . n 
B 1 141 VAL 141 167 167 VAL VAL B . n 
B 1 142 PRO 142 168 168 PRO PRO B . n 
B 1 143 PRO 143 169 169 PRO PRO B . n 
B 1 144 ASN 144 170 170 ASN ASN B . n 
B 1 145 PHE 145 171 171 PHE PHE B . n 
B 1 146 ASP 146 172 172 ASP ASP B . n 
B 1 147 LYS 147 173 173 LYS LYS B . n 
B 1 148 TYR 148 174 174 TYR TYR B . n 
B 1 149 ARG 149 175 175 ARG ARG B . n 
B 1 150 ALA 150 176 176 ALA ALA B . n 
B 1 151 VAL 151 177 177 VAL VAL B . n 
B 1 152 SER 152 178 178 SER SER B . n 
B 1 153 LYS 153 179 179 LYS LYS B . n 
B 1 154 GLU 154 180 180 GLU GLU B . n 
B 1 155 VAL 155 181 181 VAL VAL B . n 
B 1 156 LYS 156 182 182 LYS LYS B . n 
B 1 157 GLU 157 183 183 GLU GLU B . n 
B 1 158 ILE 158 184 184 ILE ILE B . n 
B 1 159 LEU 159 185 185 LEU LEU B . n 
B 1 160 ALA 160 186 186 ALA ALA B . n 
B 1 161 ASP 161 187 187 ASP ASP B . n 
B 1 162 TYR 162 188 188 TYR TYR B . n 
B 1 163 ASP 163 189 189 ASP ASP B . n 
B 1 164 PRO 164 190 190 PRO PRO B . n 
B 1 165 ASN 165 191 191 ASN ASN B . n 
B 1 166 PHE 166 192 192 PHE PHE B . n 
B 1 167 MET 167 193 193 MET MET B . n 
B 1 168 ALA 168 194 194 ALA ALA B . n 
B 1 169 MET 169 195 195 MET MET B . n 
B 1 170 SER 170 196 196 SER SER B . n 
B 1 171 LEU 171 197 197 LEU LEU B . n 
B 1 172 ASP 172 198 198 ASP ASP B . n 
B 1 173 GLU 173 199 199 GLU GLU B . n 
B 1 174 ALA 174 200 200 ALA ALA B . n 
B 1 175 TYR 175 201 201 TYR TYR B . n 
B 1 176 LEU 176 202 202 LEU LEU B . n 
B 1 177 ASN 177 203 203 ASN ASN B . n 
B 1 178 ILE 178 204 204 ILE ILE B . n 
B 1 179 THR 179 205 205 THR THR B . n 
B 1 180 LYS 180 206 206 LYS LYS B . n 
B 1 181 HIS 181 207 207 HIS HIS B . n 
B 1 182 LEU 182 208 208 LEU LEU B . n 
B 1 183 GLU 183 209 209 GLU GLU B . n 
B 1 184 GLU 184 210 210 GLU GLU B . n 
B 1 185 ARG 185 211 211 ARG ARG B . n 
B 1 186 GLN 186 212 212 GLN GLN B . n 
B 1 187 ASN 187 213 213 ASN ASN B . n 
B 1 188 TRP 188 214 214 TRP TRP B . n 
B 1 189 PRO 189 215 215 PRO PRO B . n 
B 1 190 GLU 190 216 216 GLU GLU B . n 
B 1 191 ASP 191 217 217 ASP ASP B . n 
B 1 192 LYS 192 218 218 LYS LYS B . n 
B 1 193 ARG 193 219 219 ARG ARG B . n 
B 1 194 ARG 194 220 220 ARG ARG B . n 
B 1 195 TYR 195 221 221 TYR TYR B . n 
B 1 196 PHE 196 222 222 PHE PHE B . n 
B 1 197 ILE 197 223 223 ILE ILE B . n 
B 1 198 LYS 198 224 224 LYS LYS B . n 
B 1 199 MET 199 225 ?   ?   ?   B . n 
B 1 200 GLY 200 226 ?   ?   ?   B . n 
B 1 201 SER 201 227 ?   ?   ?   B . n 
B 1 202 SER 202 228 ?   ?   ?   B . n 
B 1 203 VAL 203 229 ?   ?   ?   B . n 
B 1 204 GLU 204 230 ?   ?   ?   B . n 
B 1 205 ASN 205 231 ?   ?   ?   B . n 
B 1 206 ASP 206 232 ?   ?   ?   B . n 
B 1 207 ASN 207 233 ?   ?   ?   B . n 
B 1 208 PRO 208 234 ?   ?   ?   B . n 
B 1 209 GLY 209 235 ?   ?   ?   B . n 
B 1 210 LYS 210 236 ?   ?   ?   B . n 
B 1 211 GLU 211 237 ?   ?   ?   B . n 
B 1 212 VAL 212 238 ?   ?   ?   B . n 
B 1 213 ASN 213 239 ?   ?   ?   B . n 
B 1 214 LYS 214 240 ?   ?   ?   B . n 
B 1 215 LEU 215 241 ?   ?   ?   B . n 
B 1 216 SER 216 242 ?   ?   ?   B . n 
B 1 217 GLU 217 243 ?   ?   ?   B . n 
B 1 218 HIS 218 244 ?   ?   ?   B . n 
B 1 219 GLU 219 245 ?   ?   ?   B . n 
B 1 220 ARG 220 246 ?   ?   ?   B . n 
B 1 221 SER 221 247 ?   ?   ?   B . n 
B 1 222 ILE 222 248 ?   ?   ?   B . n 
B 1 223 SER 223 249 ?   ?   ?   B . n 
B 1 224 PRO 224 250 ?   ?   ?   B . n 
B 1 225 LEU 225 251 ?   ?   ?   B . n 
B 1 226 LEU 226 252 ?   ?   ?   B . n 
B 1 227 PHE 227 253 ?   ?   ?   B . n 
B 1 228 GLU 228 254 ?   ?   ?   B . n 
B 1 229 GLU 229 255 ?   ?   ?   B . n 
B 1 230 SER 230 256 ?   ?   ?   B . n 
B 1 231 PRO 231 257 ?   ?   ?   B . n 
B 1 232 SER 232 258 ?   ?   ?   B . n 
B 1 233 ASP 233 259 ?   ?   ?   B . n 
B 1 234 VAL 234 260 ?   ?   ?   B . n 
B 1 235 GLN 235 261 ?   ?   ?   B . n 
B 1 236 PRO 236 262 ?   ?   ?   B . n 
B 1 237 PRO 237 263 ?   ?   ?   B . n 
B 1 238 GLY 238 264 ?   ?   ?   B . n 
B 1 239 ASP 239 265 ?   ?   ?   B . n 
B 1 240 PRO 240 266 ?   ?   ?   B . n 
B 1 241 PHE 241 267 ?   ?   ?   B . n 
B 1 242 GLN 242 268 ?   ?   ?   B . n 
B 1 243 VAL 243 269 ?   ?   ?   B . n 
B 1 244 ASN 244 270 ?   ?   ?   B . n 
B 1 245 PHE 245 271 ?   ?   ?   B . n 
B 1 246 GLU 246 272 ?   ?   ?   B . n 
B 1 247 GLU 247 273 ?   ?   ?   B . n 
B 1 248 GLN 248 274 ?   ?   ?   B . n 
B 1 249 ASN 249 275 ?   ?   ?   B . n 
B 1 250 ASN 250 276 ?   ?   ?   B . n 
B 1 251 PRO 251 277 ?   ?   ?   B . n 
B 1 252 GLN 252 278 ?   ?   ?   B . n 
B 1 253 ILE 253 279 ?   ?   ?   B . n 
B 1 254 LEU 254 280 ?   ?   ?   B . n 
B 1 255 GLN 255 281 ?   ?   ?   B . n 
B 1 256 ASN 256 282 282 ASN ASN B . n 
B 1 257 SER 257 283 283 SER SER B . n 
B 1 258 VAL 258 284 284 VAL VAL B . n 
B 1 259 VAL 259 285 285 VAL VAL B . n 
B 1 260 PHE 260 286 286 PHE PHE B . n 
B 1 261 GLY 261 287 287 GLY GLY B . n 
B 1 262 THR 262 288 288 THR THR B . n 
B 1 263 SER 263 289 289 SER SER B . n 
B 1 264 ALA 264 290 290 ALA ALA B . n 
B 1 265 GLN 265 291 291 GLN GLN B . n 
B 1 266 GLU 266 292 292 GLU GLU B . n 
B 1 267 VAL 267 293 293 VAL VAL B . n 
B 1 268 VAL 268 294 294 VAL VAL B . n 
B 1 269 LYS 269 295 295 LYS LYS B . n 
B 1 270 GLU 270 296 296 GLU GLU B . n 
B 1 271 ILE 271 297 297 ILE ILE B . n 
B 1 272 ARG 272 298 298 ARG ARG B . n 
B 1 273 PHE 273 299 299 PHE PHE B . n 
B 1 274 ARG 274 300 300 ARG ARG B . n 
B 1 275 ILE 275 301 301 ILE ILE B . n 
B 1 276 GLU 276 302 302 GLU GLU B . n 
B 1 277 GLN 277 303 303 GLN GLN B . n 
B 1 278 LYS 278 304 304 LYS LYS B . n 
B 1 279 THR 279 305 305 THR THR B . n 
B 1 280 THR 280 306 306 THR THR B . n 
B 1 281 LEU 281 307 307 LEU LEU B . n 
B 1 282 THR 282 308 308 THR THR B . n 
B 1 283 ALA 283 309 309 ALA ALA B . n 
B 1 284 SER 284 310 310 SER SER B . n 
B 1 285 ALA 285 311 311 ALA ALA B . n 
B 1 286 GLY 286 312 312 GLY GLY B . n 
B 1 287 ILE 287 313 313 ILE ILE B . n 
B 1 288 ALA 288 314 314 ALA ALA B . n 
B 1 289 PRO 289 315 315 PRO PRO B . n 
B 1 290 ASN 290 316 316 ASN ASN B . n 
B 1 291 THR 291 317 317 THR THR B . n 
B 1 292 MET 292 318 318 MET MET B . n 
B 1 293 LEU 293 319 319 LEU LEU B . n 
B 1 294 ALA 294 320 320 ALA ALA B . n 
B 1 295 LYS 295 321 321 LYS LYS B . n 
B 1 296 VAL 296 322 322 VAL VAL B . n 
B 1 297 CYS 297 323 323 CYS CYS B . n 
B 1 298 SER 298 324 324 SER SER B . n 
B 1 299 ASP 299 325 325 ASP ASP B . n 
B 1 300 LYS 300 326 326 LYS LYS B . n 
B 1 301 ASN 301 327 327 ASN ASN B . n 
B 1 302 LYS 302 328 328 LYS LYS B . n 
B 1 303 PRO 303 329 329 PRO PRO B . n 
B 1 304 ASN 304 330 330 ASN ASN B . n 
B 1 305 GLY 305 331 331 GLY GLY B . n 
B 1 306 GLN 306 332 332 GLN GLN B . n 
B 1 307 TYR 307 333 333 TYR TYR B . n 
B 1 308 GLN 308 334 334 GLN GLN B . n 
B 1 309 ILE 309 335 335 ILE ILE B . n 
B 1 310 LEU 310 336 336 LEU LEU B . n 
B 1 311 PRO 311 337 337 PRO PRO B . n 
B 1 312 ASN 312 338 338 ASN ASN B . n 
B 1 313 ARG 313 339 339 ARG ARG B . n 
B 1 314 GLN 314 340 340 GLN GLN B . n 
B 1 315 ALA 315 341 341 ALA ALA B . n 
B 1 316 VAL 316 342 342 VAL VAL B . n 
B 1 317 MET 317 343 343 MET MET B . n 
B 1 318 ASP 318 344 344 ASP ASP B . n 
B 1 319 PHE 319 345 345 PHE PHE B . n 
B 1 320 ILE 320 346 346 ILE ILE B . n 
B 1 321 LYS 321 347 347 LYS LYS B . n 
B 1 322 ASP 322 348 348 ASP ASP B . n 
B 1 323 LEU 323 349 349 LEU LEU B . n 
B 1 324 PRO 324 350 350 PRO PRO B . n 
B 1 325 ILE 325 351 351 ILE ILE B . n 
B 1 326 ARG 326 352 352 ARG ARG B . n 
B 1 327 LYS 327 353 353 LYS LYS B . n 
B 1 328 VAL 328 354 354 VAL VAL B . n 
B 1 329 SER 329 355 355 SER SER B . n 
B 1 330 GLY 330 356 356 GLY GLY B . n 
B 1 331 ILE 331 357 357 ILE ILE B . n 
B 1 332 GLY 332 358 358 GLY GLY B . n 
B 1 333 LYS 333 359 359 LYS LYS B . n 
B 1 334 VAL 334 360 360 VAL VAL B . n 
B 1 335 THR 335 361 361 THR THR B . n 
B 1 336 GLU 336 362 362 GLU GLU B . n 
B 1 337 LYS 337 363 363 LYS LYS B . n 
B 1 338 MET 338 364 364 MET MET B . n 
B 1 339 LEU 339 365 365 LEU LEU B . n 
B 1 340 LYS 340 366 366 LYS LYS B . n 
B 1 341 ALA 341 367 367 ALA ALA B . n 
B 1 342 LEU 342 368 368 LEU LEU B . n 
B 1 343 GLY 343 369 369 GLY GLY B . n 
B 1 344 ILE 344 370 370 ILE ILE B . n 
B 1 345 ILE 345 371 371 ILE ILE B . n 
B 1 346 THR 346 372 372 THR THR B . n 
B 1 347 CYS 347 373 373 CYS CYS B . n 
B 1 348 THR 348 374 374 THR THR B . n 
B 1 349 GLU 349 375 375 GLU GLU B . n 
B 1 350 LEU 350 376 376 LEU LEU B . n 
B 1 351 TYR 351 377 377 TYR TYR B . n 
B 1 352 GLN 352 378 378 GLN GLN B . n 
B 1 353 GLN 353 379 379 GLN GLN B . n 
B 1 354 ARG 354 380 380 ARG ARG B . n 
B 1 355 ALA 355 381 381 ALA ALA B . n 
B 1 356 LEU 356 382 382 LEU LEU B . n 
B 1 357 LEU 357 383 383 LEU LEU B . n 
B 1 358 SER 358 384 384 SER SER B . n 
B 1 359 LEU 359 385 385 LEU LEU B . n 
B 1 360 LEU 360 386 386 LEU LEU B . n 
B 1 361 PHE 361 387 387 PHE PHE B . n 
B 1 362 SER 362 388 388 SER SER B . n 
B 1 363 GLU 363 389 389 GLU GLU B . n 
B 1 364 THR 364 390 390 THR THR B . n 
B 1 365 SER 365 391 391 SER SER B . n 
B 1 366 TRP 366 392 392 TRP TRP B . n 
B 1 367 HIS 367 393 393 HIS HIS B . n 
B 1 368 TYR 368 394 394 TYR TYR B . n 
B 1 369 PHE 369 395 395 PHE PHE B . n 
B 1 370 LEU 370 396 396 LEU LEU B . n 
B 1 371 HIS 371 397 397 HIS HIS B . n 
B 1 372 ILE 372 398 398 ILE ILE B . n 
B 1 373 SER 373 399 399 SER SER B . n 
B 1 374 LEU 374 400 400 LEU LEU B . n 
B 1 375 GLY 375 401 401 GLY GLY B . n 
B 1 376 LEU 376 402 402 LEU LEU B . n 
B 1 377 GLY 377 403 403 GLY GLY B . n 
B 1 378 SER 378 404 404 SER SER B . n 
B 1 379 THR 379 405 405 THR THR B . n 
B 1 380 HIS 380 406 406 HIS HIS B . n 
B 1 381 LEU 381 407 407 LEU LEU B . n 
B 1 382 THR 382 408 408 THR THR B . n 
B 1 383 ARG 383 409 409 ARG ARG B . n 
B 1 384 ASP 384 410 410 ASP ASP B . n 
B 1 385 GLY 385 411 411 GLY GLY B . n 
B 1 386 GLU 386 412 412 GLU GLU B . n 
B 1 387 ARG 387 413 413 ARG ARG B . n 
B 1 388 LYS 388 414 414 LYS LYS B . n 
B 1 389 SER 389 415 415 SER SER B . n 
B 1 390 MET 390 416 416 MET MET B . n 
B 1 391 SER 391 417 417 SER SER B . n 
B 1 392 VAL 392 418 418 VAL VAL B . n 
B 1 393 GLU 393 419 419 GLU GLU B . n 
B 1 394 ARG 394 420 420 ARG ARG B . n 
B 1 395 THR 395 421 421 THR THR B . n 
B 1 396 PHE 396 422 422 PHE PHE B . n 
B 1 397 SER 397 423 423 SER SER B . n 
B 1 398 GLU 398 424 424 GLU GLU B . n 
B 1 399 ILE 399 425 425 ILE ILE B . n 
B 1 400 ASN 400 426 426 ASN ASN B . n 
B 1 401 LYS 401 427 427 LYS LYS B . n 
B 1 402 ALA 402 428 428 ALA ALA B . n 
B 1 403 GLU 403 429 429 GLU GLU B . n 
B 1 404 GLU 404 430 430 GLU GLU B . n 
B 1 405 GLN 405 431 431 GLN GLN B . n 
B 1 406 TYR 406 432 432 TYR TYR B . n 
B 1 407 SER 407 433 433 SER SER B . n 
B 1 408 LEU 408 434 434 LEU LEU B . n 
B 1 409 CYS 409 435 435 CYS CYS B . n 
B 1 410 GLN 410 436 436 GLN GLN B . n 
B 1 411 GLU 411 437 437 GLU GLU B . n 
B 1 412 LEU 412 438 438 LEU LEU B . n 
B 1 413 CYS 413 439 439 CYS CYS B . n 
B 1 414 SER 414 440 440 SER SER B . n 
B 1 415 GLU 415 441 441 GLU GLU B . n 
B 1 416 LEU 416 442 442 LEU LEU B . n 
B 1 417 ALA 417 443 443 ALA ALA B . n 
B 1 418 GLN 418 444 444 GLN GLN B . n 
B 1 419 ASP 419 445 445 ASP ASP B . n 
B 1 420 LEU 420 446 446 LEU LEU B . n 
B 1 421 GLN 421 447 447 GLN GLN B . n 
B 1 422 LYS 422 448 448 LYS LYS B . n 
B 1 423 GLU 423 449 449 GLU GLU B . n 
B 1 424 ARG 424 450 450 ARG ARG B . n 
B 1 425 LEU 425 451 451 LEU LEU B . n 
B 1 426 LYS 426 452 452 LYS LYS B . n 
B 1 427 GLY 427 453 453 GLY GLY B . n 
B 1 428 ARG 428 454 454 ARG ARG B . n 
B 1 429 THR 429 455 455 THR THR B . n 
B 1 430 VAL 430 456 456 VAL VAL B . n 
B 1 431 THR 431 457 457 THR THR B . n 
B 1 432 ILE 432 458 458 ILE ILE B . n 
B 1 433 LYS 433 459 459 LYS LYS B . n 
B 1 434 LEU 434 460 460 LEU LEU B . n 
B 1 435 LYS 435 461 461 LYS LYS B . n 
B 1 436 ASN 436 462 462 ASN ASN B . n 
B 1 437 VAL 437 463 463 VAL VAL B . n 
B 1 438 ASN 438 464 464 ASN ASN B . n 
B 1 439 PHE 439 465 465 PHE PHE B . n 
B 1 440 GLU 440 466 466 GLU GLU B . n 
B 1 441 VAL 441 467 467 VAL VAL B . n 
B 1 442 LYS 442 468 468 LYS LYS B . n 
B 1 443 THR 443 469 469 THR THR B . n 
B 1 444 ARG 444 470 470 ARG ARG B . n 
B 1 445 ALA 445 471 471 ALA ALA B . n 
B 1 446 SER 446 472 472 SER SER B . n 
B 1 447 THR 447 473 473 THR THR B . n 
B 1 448 VAL 448 474 474 VAL VAL B . n 
B 1 449 SER 449 475 475 SER SER B . n 
B 1 450 SER 450 476 476 SER SER B . n 
B 1 451 VAL 451 477 477 VAL VAL B . n 
B 1 452 VAL 452 478 478 VAL VAL B . n 
B 1 453 SER 453 479 479 SER SER B . n 
B 1 454 THR 454 480 480 THR THR B . n 
B 1 455 ALA 455 481 481 ALA ALA B . n 
B 1 456 GLU 456 482 482 GLU GLU B . n 
B 1 457 GLU 457 483 483 GLU GLU B . n 
B 1 458 ILE 458 484 484 ILE ILE B . n 
B 1 459 PHE 459 485 485 PHE PHE B . n 
B 1 460 ALA 460 486 486 ALA ALA B . n 
B 1 461 ILE 461 487 487 ILE ILE B . n 
B 1 462 ALA 462 488 488 ALA ALA B . n 
B 1 463 LYS 463 489 489 LYS LYS B . n 
B 1 464 GLU 464 490 490 GLU GLU B . n 
B 1 465 LEU 465 491 491 LEU LEU B . n 
B 1 466 LEU 466 492 492 LEU LEU B . n 
B 1 467 LYS 467 493 493 LYS LYS B . n 
B 1 468 THR 468 494 494 THR THR B . n 
B 1 469 GLU 469 495 495 GLU GLU B . n 
B 1 470 ILE 470 496 496 ILE ILE B . n 
B 1 471 ASP 471 497 497 ASP ASP B . n 
B 1 472 ALA 472 498 498 ALA ALA B . n 
B 1 473 ASP 473 499 499 ASP ASP B . n 
B 1 474 PHE 474 500 500 PHE PHE B . n 
B 1 475 PRO 475 501 501 PRO PRO B . n 
B 1 476 HIS 476 502 502 HIS HIS B . n 
B 1 477 PRO 477 503 503 PRO PRO B . n 
B 1 478 LEU 478 504 504 LEU LEU B . n 
B 1 479 ARG 479 505 505 ARG ARG B . n 
B 1 480 LEU 480 506 506 LEU LEU B . n 
B 1 481 ARG 481 507 507 ARG ARG B . n 
B 1 482 LEU 482 508 508 LEU LEU B . n 
B 1 483 MET 483 509 509 MET MET B . n 
B 1 484 GLY 484 510 510 GLY GLY B . n 
B 1 485 VAL 485 511 511 VAL VAL B . n 
B 1 486 ARG 486 512 512 ARG ARG B . n 
B 1 487 ILE 487 513 513 ILE ILE B . n 
B 1 488 SER 488 514 514 SER SER B . n 
B 1 489 SER 489 515 515 SER SER B . n 
B 1 490 PHE 490 516 516 PHE PHE B . n 
B 1 491 PRO 491 517 517 PRO PRO B . n 
B 1 492 ASN 492 518 ?   ?   ?   B . n 
C 2 1   DG  1   5   5   DG  DG  C . n 
C 2 2   DC  2   6   6   DC  DC  C . n 
C 2 3   DG  3   7   7   DG  DG  C . n 
C 2 4   DG  4   8   8   DG  DG  C . n 
C 2 5   DA  5   9   9   DA  DA  C . n 
C 2 6   DT  6   10  10  DT  DT  C . n 
C 2 7   DC  7   11  11  DC  DC  C . n 
C 2 8   DA  8   12  12  DA  DA  C . n 
C 2 9   DG  9   13  13  DG  DG  C . n 
D 3 1   DA  1   2   2   DA  DA  D . n 
D 3 2   DT  2   3   3   DT  DT  D . n 
D 3 3   DG  3   4   4   DG  DG  D . n 
D 3 4   VKJ 4   5   5   VKJ GBA D . n 
D 3 5   DC  5   6   6   DC  DC  D . n 
D 3 6   DT  6   7   7   DT  DT  D . n 
D 3 7   DG  7   8   8   DG  DG  D . n 
D 3 8   DA  8   9   9   DA  DA  D . n 
D 3 9   DT  9   10  10  DT  DT  D . n 
D 3 10  DC  10  11  11  DC  DC  D . n 
D 3 11  DC  11  12  12  DC  DC  D . n 
D 3 12  DG  12  13  13  DG  DG  D . n 
D 3 13  DC  13  14  14  DC  DC  D . n 
E 2 1   DG  1   5   5   DG  DG  P . n 
E 2 2   DC  2   6   6   DC  DC  P . n 
E 2 3   DG  3   7   7   DG  DG  P . n 
E 2 4   DG  4   8   8   DG  DG  P . n 
E 2 5   DA  5   9   9   DA  DA  P . n 
E 2 6   DT  6   10  10  DT  DT  P . n 
E 2 7   DC  7   11  11  DC  DC  P . n 
E 2 8   DA  8   12  12  DA  DA  P . n 
E 2 9   DG  9   13  13  DG  DG  P . n 
F 3 1   DA  1   2   2   DA  DA  T . n 
F 3 2   DT  2   3   3   DT  DT  T . n 
F 3 3   DG  3   4   4   DG  DG  T . n 
F 3 4   VKJ 4   5   5   VKJ GBA T . n 
F 3 5   DC  5   6   6   DC  DC  T . n 
F 3 6   DT  6   7   7   DT  DT  T . n 
F 3 7   DG  7   8   8   DG  DG  T . n 
F 3 8   DA  8   9   9   DA  DA  T . n 
F 3 9   DT  9   10  10  DT  DT  T . n 
F 3 10  DC  10  11  11  DC  DC  T . n 
F 3 11  DC  11  12  12  DC  DC  T . n 
F 3 12  DG  12  13  13  DG  DG  T . n 
F 3 13  DC  13  14  14  DC  DC  T . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
G 4 MG  1  601 1   MG  MG  A . 
H 5 0KX 1  602 10  0KX 0KX A . 
I 6 PEG 1  603 1   PEG PEG A . 
J 7 EDO 1  601 1   EDO EDO B . 
K 4 MG  1  602 2   MG  MG  B . 
L 5 0KX 1  603 10  0KX 0KX B . 
M 6 PEG 1  604 2   PEG PEG B . 
N 6 PEG 1  605 1   PEG PEG B . 
O 8 HOH 1  701 34  HOH HOH A . 
O 8 HOH 2  702 27  HOH HOH A . 
O 8 HOH 3  703 99  HOH HOH A . 
O 8 HOH 4  704 44  HOH HOH A . 
O 8 HOH 5  705 14  HOH HOH A . 
O 8 HOH 6  706 100 HOH HOH A . 
O 8 HOH 7  707 42  HOH HOH A . 
O 8 HOH 8  708 29  HOH HOH A . 
O 8 HOH 9  709 1   HOH HOH A . 
O 8 HOH 10 710 28  HOH HOH A . 
O 8 HOH 11 711 8   HOH HOH A . 
O 8 HOH 12 712 108 HOH HOH A . 
O 8 HOH 13 713 57  HOH HOH A . 
O 8 HOH 14 714 19  HOH HOH A . 
O 8 HOH 15 715 2   HOH HOH A . 
O 8 HOH 16 716 61  HOH HOH A . 
O 8 HOH 17 717 85  HOH HOH A . 
O 8 HOH 18 718 65  HOH HOH A . 
O 8 HOH 19 719 98  HOH HOH A . 
O 8 HOH 20 720 58  HOH HOH A . 
O 8 HOH 21 721 76  HOH HOH A . 
O 8 HOH 22 722 93  HOH HOH A . 
O 8 HOH 23 723 101 HOH HOH A . 
O 8 HOH 24 724 16  HOH HOH A . 
O 8 HOH 25 725 73  HOH HOH A . 
O 8 HOH 26 726 35  HOH HOH A . 
O 8 HOH 27 727 92  HOH HOH A . 
O 8 HOH 28 728 50  HOH HOH A . 
O 8 HOH 29 729 56  HOH HOH A . 
O 8 HOH 30 730 15  HOH HOH A . 
O 8 HOH 31 731 64  HOH HOH A . 
O 8 HOH 32 732 46  HOH HOH A . 
O 8 HOH 33 733 90  HOH HOH A . 
P 8 HOH 1  701 111 HOH HOH B . 
P 8 HOH 2  702 110 HOH HOH B . 
P 8 HOH 3  703 79  HOH HOH B . 
P 8 HOH 4  704 32  HOH HOH B . 
P 8 HOH 5  705 95  HOH HOH B . 
P 8 HOH 6  706 106 HOH HOH B . 
P 8 HOH 7  707 43  HOH HOH B . 
P 8 HOH 8  708 84  HOH HOH B . 
P 8 HOH 9  709 22  HOH HOH B . 
P 8 HOH 10 710 107 HOH HOH B . 
P 8 HOH 11 711 5   HOH HOH B . 
P 8 HOH 12 712 53  HOH HOH B . 
P 8 HOH 13 713 4   HOH HOH B . 
P 8 HOH 14 714 33  HOH HOH B . 
P 8 HOH 15 715 105 HOH HOH B . 
P 8 HOH 16 716 88  HOH HOH B . 
P 8 HOH 17 717 41  HOH HOH B . 
P 8 HOH 18 718 83  HOH HOH B . 
P 8 HOH 19 719 91  HOH HOH B . 
P 8 HOH 20 720 81  HOH HOH B . 
P 8 HOH 21 721 20  HOH HOH B . 
P 8 HOH 22 722 31  HOH HOH B . 
P 8 HOH 23 723 3   HOH HOH B . 
P 8 HOH 24 724 102 HOH HOH B . 
P 8 HOH 25 725 7   HOH HOH B . 
P 8 HOH 26 726 112 HOH HOH B . 
P 8 HOH 27 727 89  HOH HOH B . 
P 8 HOH 28 728 30  HOH HOH B . 
P 8 HOH 29 729 6   HOH HOH B . 
P 8 HOH 30 730 69  HOH HOH B . 
P 8 HOH 31 731 80  HOH HOH B . 
P 8 HOH 32 732 71  HOH HOH B . 
P 8 HOH 33 733 78  HOH HOH B . 
P 8 HOH 34 734 104 HOH HOH B . 
P 8 HOH 35 735 38  HOH HOH B . 
P 8 HOH 36 736 74  HOH HOH B . 
P 8 HOH 37 737 25  HOH HOH B . 
P 8 HOH 38 738 23  HOH HOH B . 
P 8 HOH 39 739 68  HOH HOH B . 
P 8 HOH 40 740 75  HOH HOH B . 
P 8 HOH 41 741 24  HOH HOH B . 
P 8 HOH 42 742 63  HOH HOH B . 
P 8 HOH 43 743 49  HOH HOH B . 
P 8 HOH 44 744 62  HOH HOH B . 
P 8 HOH 45 745 103 HOH HOH B . 
P 8 HOH 46 746 55  HOH HOH B . 
P 8 HOH 47 747 10  HOH HOH B . 
P 8 HOH 48 748 97  HOH HOH B . 
Q 8 HOH 1  101 54  HOH HOH C . 
Q 8 HOH 2  102 113 HOH HOH C . 
Q 8 HOH 3  103 66  HOH HOH C . 
Q 8 HOH 4  104 47  HOH HOH C . 
R 8 HOH 1  101 48  HOH HOH D . 
R 8 HOH 2  102 18  HOH HOH D . 
R 8 HOH 3  103 17  HOH HOH D . 
R 8 HOH 4  104 52  HOH HOH D . 
R 8 HOH 5  105 70  HOH HOH D . 
R 8 HOH 6  106 13  HOH HOH D . 
R 8 HOH 7  107 82  HOH HOH D . 
R 8 HOH 8  108 37  HOH HOH D . 
R 8 HOH 9  109 77  HOH HOH D . 
R 8 HOH 10 110 94  HOH HOH D . 
R 8 HOH 11 111 12  HOH HOH D . 
R 8 HOH 12 112 96  HOH HOH D . 
R 8 HOH 13 113 45  HOH HOH D . 
R 8 HOH 14 114 36  HOH HOH D . 
S 8 HOH 1  101 59  HOH HOH P . 
S 8 HOH 2  102 109 HOH HOH P . 
S 8 HOH 3  103 9   HOH HOH P . 
S 8 HOH 4  104 86  HOH HOH P . 
S 8 HOH 5  105 72  HOH HOH P . 
T 8 HOH 1  101 60  HOH HOH T . 
T 8 HOH 2  102 39  HOH HOH T . 
T 8 HOH 3  103 26  HOH HOH T . 
T 8 HOH 4  104 67  HOH HOH T . 
T 8 HOH 5  105 87  HOH HOH T . 
T 8 HOH 6  106 40  HOH HOH T . 
T 8 HOH 7  107 21  HOH HOH T . 
T 8 HOH 8  108 51  HOH HOH T . 
T 8 HOH 9  109 11  HOH HOH T . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA trimeric 3 
2 author_and_software_defined_assembly PISA trimeric 3 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,D,G,H,I,O,Q,R     
2 1 B,E,F,J,K,L,M,N,P,S,T 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4680  ? 
1 MORE         -33   ? 
1 'SSA (A^2)'  24440 ? 
2 'ABSA (A^2)' 4650  ? 
2 MORE         -34   ? 
2 'SSA (A^2)'  23930 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1 ? A ASP 81  ? A ASP 107 ? 1_555 MG ? G MG . ? A MG 601 ? 1_555 O   ? A MET 82  ? A MET 108 ? 1_555 94.5  ? 
2  OD1 ? A ASP 81  ? A ASP 107 ? 1_555 MG ? G MG . ? A MG 601 ? 1_555 OD1 ? A ASP 172 ? A ASP 198 ? 1_555 98.7  ? 
3  O   ? A MET 82  ? A MET 108 ? 1_555 MG ? G MG . ? A MG 601 ? 1_555 OD1 ? A ASP 172 ? A ASP 198 ? 1_555 95.4  ? 
4  OD1 ? A ASP 81  ? A ASP 107 ? 1_555 MG ? G MG . ? A MG 601 ? 1_555 O1B ? H 0KX .   ? A 0KX 602 ? 1_555 164.5 ? 
5  O   ? A MET 82  ? A MET 108 ? 1_555 MG ? G MG . ? A MG 601 ? 1_555 O1B ? H 0KX .   ? A 0KX 602 ? 1_555 95.5  ? 
6  OD1 ? A ASP 172 ? A ASP 198 ? 1_555 MG ? G MG . ? A MG 601 ? 1_555 O1B ? H 0KX .   ? A 0KX 602 ? 1_555 92.1  ? 
7  OD1 ? A ASP 81  ? A ASP 107 ? 1_555 MG ? G MG . ? A MG 601 ? 1_555 O2A ? H 0KX .   ? A 0KX 602 ? 1_555 81.5  ? 
8  O   ? A MET 82  ? A MET 108 ? 1_555 MG ? G MG . ? A MG 601 ? 1_555 O2A ? H 0KX .   ? A 0KX 602 ? 1_555 168.2 ? 
9  OD1 ? A ASP 172 ? A ASP 198 ? 1_555 MG ? G MG . ? A MG 601 ? 1_555 O2A ? H 0KX .   ? A 0KX 602 ? 1_555 96.2  ? 
10 O1B ? H 0KX .   ? A 0KX 602 ? 1_555 MG ? G MG . ? A MG 601 ? 1_555 O2A ? H 0KX .   ? A 0KX 602 ? 1_555 86.5  ? 
11 OD1 ? A ASP 81  ? A ASP 107 ? 1_555 MG ? G MG . ? A MG 601 ? 1_555 O2G ? H 0KX .   ? A 0KX 602 ? 1_555 84.3  ? 
12 O   ? A MET 82  ? A MET 108 ? 1_555 MG ? G MG . ? A MG 601 ? 1_555 O2G ? H 0KX .   ? A 0KX 602 ? 1_555 88.9  ? 
13 OD1 ? A ASP 172 ? A ASP 198 ? 1_555 MG ? G MG . ? A MG 601 ? 1_555 O2G ? H 0KX .   ? A 0KX 602 ? 1_555 174.5 ? 
14 O1B ? H 0KX .   ? A 0KX 602 ? 1_555 MG ? G MG . ? A MG 601 ? 1_555 O2G ? H 0KX .   ? A 0KX 602 ? 1_555 84.1  ? 
15 O2A ? H 0KX .   ? A 0KX 602 ? 1_555 MG ? G MG . ? A MG 601 ? 1_555 O2G ? H 0KX .   ? A 0KX 602 ? 1_555 79.7  ? 
16 OD1 ? B ASP 81  ? B ASP 107 ? 1_555 MG ? K MG . ? B MG 602 ? 1_555 O   ? B MET 82  ? B MET 108 ? 1_555 90.5  ? 
17 OD1 ? B ASP 81  ? B ASP 107 ? 1_555 MG ? K MG . ? B MG 602 ? 1_555 OD2 ? B ASP 172 ? B ASP 198 ? 1_555 95.4  ? 
18 O   ? B MET 82  ? B MET 108 ? 1_555 MG ? K MG . ? B MG 602 ? 1_555 OD2 ? B ASP 172 ? B ASP 198 ? 1_555 73.5  ? 
19 OD1 ? B ASP 81  ? B ASP 107 ? 1_555 MG ? K MG . ? B MG 602 ? 1_555 O1A ? L 0KX .   ? B 0KX 603 ? 1_555 99.4  ? 
20 O   ? B MET 82  ? B MET 108 ? 1_555 MG ? K MG . ? B MG 602 ? 1_555 O1A ? L 0KX .   ? B 0KX 603 ? 1_555 169.9 ? 
21 OD2 ? B ASP 172 ? B ASP 198 ? 1_555 MG ? K MG . ? B MG 602 ? 1_555 O1A ? L 0KX .   ? B 0KX 603 ? 1_555 103.5 ? 
22 OD1 ? B ASP 81  ? B ASP 107 ? 1_555 MG ? K MG . ? B MG 602 ? 1_555 O2G ? L 0KX .   ? B 0KX 603 ? 1_555 108.1 ? 
23 O   ? B MET 82  ? B MET 108 ? 1_555 MG ? K MG . ? B MG 602 ? 1_555 O2G ? L 0KX .   ? B 0KX 603 ? 1_555 96.0  ? 
24 OD2 ? B ASP 172 ? B ASP 198 ? 1_555 MG ? K MG . ? B MG 602 ? 1_555 O2G ? L 0KX .   ? B 0KX 603 ? 1_555 154.5 ? 
25 O1A ? L 0KX .   ? B 0KX 603 ? 1_555 MG ? K MG . ? B MG 602 ? 1_555 O2G ? L 0KX .   ? B 0KX 603 ? 1_555 82.7  ? 
26 OD1 ? B ASP 81  ? B ASP 107 ? 1_555 MG ? K MG . ? B MG 602 ? 1_555 O2B ? L 0KX .   ? B 0KX 603 ? 1_555 154.0 ? 
27 O   ? B MET 82  ? B MET 108 ? 1_555 MG ? K MG . ? B MG 602 ? 1_555 O2B ? L 0KX .   ? B 0KX 603 ? 1_555 76.4  ? 
28 OD2 ? B ASP 172 ? B ASP 198 ? 1_555 MG ? K MG . ? B MG 602 ? 1_555 O2B ? L 0KX .   ? B 0KX 603 ? 1_555 59.5  ? 
29 O1A ? L 0KX .   ? B 0KX 603 ? 1_555 MG ? K MG . ? B MG 602 ? 1_555 O2B ? L 0KX .   ? B 0KX 603 ? 1_555 93.7  ? 
30 O2G ? L 0KX .   ? B 0KX 603 ? 1_555 MG ? K MG . ? B MG 602 ? 1_555 O2B ? L 0KX .   ? B 0KX 603 ? 1_555 95.7  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2016-01-27 
2 'Structure model' 1 1 2016-03-23 
3 'Structure model' 1 2 2016-04-13 
4 'Structure model' 1 3 2016-06-15 
5 'Structure model' 1 4 2017-09-27 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Derived calculations'       
2 3 'Structure model' 'Database references'        
3 4 'Structure model' 'Database references'        
4 5 'Structure model' 'Author supporting evidence' 
5 5 'Structure model' 'Database references'        
6 5 'Structure model' 'Derived calculations'       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 5 'Structure model' citation              
2 5 'Structure model' pdbx_audit_support    
3 5 'Structure model' pdbx_struct_oper_list 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 5 'Structure model' '_citation.journal_id_CSD'                  
2 5 'Structure model' '_pdbx_audit_support.funding_organization'  
3 5 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.8.2_1309 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? MOSFLM ? ? ? .          2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? SCALA  ? ? ? .          3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? .          4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O9  T VKJ 5   ? ? O2  B 0KX 603 ? ? 2.06 
2 1 OG  B SER 388 ? ? OP1 T DC  12  ? ? 2.10 
3 1 OP2 C DG  13  ? ? O   C HOH 101 ? ? 2.12 
4 1 O   B VAL 354 ? ? O   B HOH 701 ? ? 2.19 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "O4'" C DG 8 ? ? "C1'" C DG 8 ? ? N9 C DG 8 ? ? 110.30 108.30 2.00 0.30 N 
2 1 "O4'" P DG 5 ? ? "C1'" P DG 5 ? ? N9 P DG 5 ? ? 111.11 108.30 2.81 0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ALA A 110 ? ? 37.54   30.08   
2  1 PHE A 111 ? ? -13.66  -86.64  
3  1 SER A 132 ? ? -126.14 -159.90 
4  1 CYS A 161 ? ? -162.80 92.36   
5  1 ASN A 170 ? ? -118.34 76.96   
6  1 ASN A 191 ? ? -92.34  33.07   
7  1 MET A 195 ? ? -76.05  -70.46  
8  1 SER A 196 ? ? -119.75 -146.29 
9  1 ILE A 204 ? ? -95.72  31.93   
10 1 ASN A 213 ? ? -100.94 53.62   
11 1 SER A 324 ? ? -48.56  -18.97  
12 1 ASN A 330 ? ? 49.02   71.20   
13 1 ASP A 410 ? ? -49.43  105.37  
14 1 SER A 479 ? ? -150.34 -39.00  
15 1 LYS B 35  ? ? 64.40   -48.74  
16 1 ALA B 110 ? ? 39.18   26.01   
17 1 PHE B 111 ? ? -13.02  -86.37  
18 1 ASN B 120 ? ? -151.28 86.90   
19 1 GLU B 122 ? ? -67.87  1.92    
20 1 SER B 132 ? ? -127.61 -157.97 
21 1 THR B 138 ? ? -170.01 -178.42 
22 1 CYS B 161 ? ? -162.51 92.94   
23 1 ASN B 191 ? ? -93.59  32.91   
24 1 MET B 195 ? ? -76.50  -71.43  
25 1 SER B 196 ? ? -119.63 -147.10 
26 1 ILE B 204 ? ? -95.02  34.11   
27 1 ASN B 213 ? ? -103.24 54.93   
28 1 SER B 324 ? ? -48.87  -19.63  
29 1 ASN B 330 ? ? 47.87   71.37   
30 1 ASP B 410 ? ? -48.15  106.63  
31 1 SER B 479 ? ? -151.44 -30.81  
32 1 PHE B 500 ? ? -39.79  137.64  
# 
_pdbx_distant_solvent_atoms.id                                1 
_pdbx_distant_solvent_atoms.PDB_model_num                     1 
_pdbx_distant_solvent_atoms.auth_atom_id                      O 
_pdbx_distant_solvent_atoms.label_alt_id                      ? 
_pdbx_distant_solvent_atoms.auth_asym_id                      D 
_pdbx_distant_solvent_atoms.auth_comp_id                      HOH 
_pdbx_distant_solvent_atoms.auth_seq_id                       114 
_pdbx_distant_solvent_atoms.PDB_ins_code                      ? 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance   5.95 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance          . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A ASP 32  ? CG    ? A ASP 6   CG    
2   1 Y 1 A ASP 32  ? OD1   ? A ASP 6   OD1   
3   1 Y 1 A ASP 32  ? OD2   ? A ASP 6   OD2   
4   1 Y 1 A LYS 33  ? CG    ? A LYS 7   CG    
5   1 Y 1 A LYS 33  ? CD    ? A LYS 7   CD    
6   1 Y 1 A LYS 33  ? CE    ? A LYS 7   CE    
7   1 Y 1 A LYS 33  ? NZ    ? A LYS 7   NZ    
8   1 Y 1 A GLU 34  ? CG    ? A GLU 8   CG    
9   1 Y 1 A GLU 34  ? CD    ? A GLU 8   CD    
10  1 Y 1 A GLU 34  ? OE1   ? A GLU 8   OE1   
11  1 Y 1 A GLU 34  ? OE2   ? A GLU 8   OE2   
12  1 Y 1 A LYS 35  ? NZ    ? A LYS 9   NZ    
13  1 Y 1 A LYS 38  ? CG    ? A LYS 12  CG    
14  1 Y 1 A LYS 38  ? CD    ? A LYS 12  CD    
15  1 Y 1 A LYS 38  ? CE    ? A LYS 12  CE    
16  1 Y 1 A LYS 38  ? NZ    ? A LYS 12  NZ    
17  1 Y 1 A GLU 42  ? CG    ? A GLU 16  CG    
18  1 Y 1 A GLU 42  ? CD    ? A GLU 16  CD    
19  1 Y 1 A GLU 42  ? OE1   ? A GLU 16  OE1   
20  1 Y 1 A GLU 42  ? OE2   ? A GLU 16  OE2   
21  1 Y 1 A LYS 45  ? CG    ? A LYS 19  CG    
22  1 Y 1 A LYS 45  ? CD    ? A LYS 19  CD    
23  1 Y 1 A LYS 45  ? CE    ? A LYS 19  CE    
24  1 Y 1 A LYS 45  ? NZ    ? A LYS 19  NZ    
25  1 Y 1 A LYS 55  ? CE    ? A LYS 29  CE    
26  1 Y 1 A LYS 55  ? NZ    ? A LYS 29  NZ    
27  1 Y 1 A ARG 88  ? CG    ? A ARG 62  CG    
28  1 Y 1 A ARG 88  ? CD    ? A ARG 62  CD    
29  1 Y 1 A ARG 88  ? NE    ? A ARG 62  NE    
30  1 Y 1 A ARG 88  ? CZ    ? A ARG 62  CZ    
31  1 Y 1 A ARG 88  ? NH1   ? A ARG 62  NH1   
32  1 Y 1 A ARG 88  ? NH2   ? A ARG 62  NH2   
33  1 Y 1 A GLU 92  ? CG    ? A GLU 66  CG    
34  1 Y 1 A GLU 92  ? CD    ? A GLU 66  CD    
35  1 Y 1 A GLU 92  ? OE1   ? A GLU 66  OE1   
36  1 Y 1 A GLU 92  ? OE2   ? A GLU 66  OE2   
37  1 Y 1 A GLN 95  ? CG    ? A GLN 69  CG    
38  1 Y 1 A GLN 95  ? CD    ? A GLN 69  CD    
39  1 Y 1 A GLN 95  ? OE1   ? A GLN 69  OE1   
40  1 Y 1 A GLN 95  ? NE2   ? A GLN 69  NE2   
41  1 Y 1 A SER 96  ? OG    ? A SER 70  OG    
42  1 Y 1 A ASN 191 ? CG    ? A ASN 165 CG    
43  1 Y 1 A ASN 191 ? OD1   ? A ASN 165 OD1   
44  1 Y 1 A ASN 191 ? ND2   ? A ASN 165 ND2   
45  1 Y 1 A ASP 217 ? CG    ? A ASP 191 CG    
46  1 Y 1 A ASP 217 ? OD1   ? A ASP 191 OD1   
47  1 Y 1 A ASP 217 ? OD2   ? A ASP 191 OD2   
48  1 Y 1 A LYS 224 ? CG    ? A LYS 198 CG    
49  1 Y 1 A LYS 224 ? CD    ? A LYS 198 CD    
50  1 Y 1 A LYS 224 ? CE    ? A LYS 198 CE    
51  1 Y 1 A LYS 224 ? NZ    ? A LYS 198 NZ    
52  1 Y 1 A GLN 281 ? CG    ? A GLN 255 CG    
53  1 Y 1 A GLN 281 ? CD    ? A GLN 255 CD    
54  1 Y 1 A GLN 281 ? OE1   ? A GLN 255 OE1   
55  1 Y 1 A GLN 281 ? NE2   ? A GLN 255 NE2   
56  1 Y 1 A ASP 410 ? CG    ? A ASP 384 CG    
57  1 Y 1 A ASP 410 ? OD1   ? A ASP 384 OD1   
58  1 Y 1 A ASP 410 ? OD2   ? A ASP 384 OD2   
59  1 Y 1 A GLU 412 ? CG    ? A GLU 386 CG    
60  1 Y 1 A GLU 412 ? CD    ? A GLU 386 CD    
61  1 Y 1 A GLU 412 ? OE1   ? A GLU 386 OE1   
62  1 Y 1 A GLU 412 ? OE2   ? A GLU 386 OE2   
63  1 Y 1 A ASP 499 ? CG    ? A ASP 473 CG    
64  1 Y 1 A ASP 499 ? OD1   ? A ASP 473 OD1   
65  1 Y 1 A ASP 499 ? OD2   ? A ASP 473 OD2   
66  1 Y 1 A PHE 500 ? CG    ? A PHE 474 CG    
67  1 Y 1 A PHE 500 ? CD1   ? A PHE 474 CD1   
68  1 Y 1 A PHE 500 ? CD2   ? A PHE 474 CD2   
69  1 Y 1 A PHE 500 ? CE1   ? A PHE 474 CE1   
70  1 Y 1 A PHE 500 ? CE2   ? A PHE 474 CE2   
71  1 Y 1 A PHE 500 ? CZ    ? A PHE 474 CZ    
72  1 Y 1 A ASN 518 ? CG    ? A ASN 492 CG    
73  1 Y 1 A ASN 518 ? OD1   ? A ASN 492 OD1   
74  1 Y 1 A ASN 518 ? ND2   ? A ASN 492 ND2   
75  1 Y 1 B LEU 31  ? CG    ? B LEU 5   CG    
76  1 Y 1 B LEU 31  ? CD1   ? B LEU 5   CD1   
77  1 Y 1 B LEU 31  ? CD2   ? B LEU 5   CD2   
78  1 Y 1 B ASP 32  ? CG    ? B ASP 6   CG    
79  1 Y 1 B ASP 32  ? OD1   ? B ASP 6   OD1   
80  1 Y 1 B ASP 32  ? OD2   ? B ASP 6   OD2   
81  1 Y 1 B GLU 34  ? CG    ? B GLU 8   CG    
82  1 Y 1 B GLU 34  ? CD    ? B GLU 8   CD    
83  1 Y 1 B GLU 34  ? OE1   ? B GLU 8   OE1   
84  1 Y 1 B GLU 34  ? OE2   ? B GLU 8   OE2   
85  1 Y 1 B ASN 37  ? CG    ? B ASN 11  CG    
86  1 Y 1 B ASN 37  ? OD1   ? B ASN 11  OD1   
87  1 Y 1 B ASN 37  ? ND2   ? B ASN 11  ND2   
88  1 Y 1 B LYS 38  ? CG    ? B LYS 12  CG    
89  1 Y 1 B LYS 38  ? CD    ? B LYS 12  CD    
90  1 Y 1 B LYS 38  ? CE    ? B LYS 12  CE    
91  1 Y 1 B LYS 38  ? NZ    ? B LYS 12  NZ    
92  1 Y 1 B ILE 39  ? CG1   ? B ILE 13  CG1   
93  1 Y 1 B ILE 39  ? CG2   ? B ILE 13  CG2   
94  1 Y 1 B ILE 39  ? CD1   ? B ILE 13  CD1   
95  1 Y 1 B GLU 42  ? CG    ? B GLU 16  CG    
96  1 Y 1 B GLU 42  ? CD    ? B GLU 16  CD    
97  1 Y 1 B GLU 42  ? OE1   ? B GLU 16  OE1   
98  1 Y 1 B GLU 42  ? OE2   ? B GLU 16  OE2   
99  1 Y 1 B LYS 58  ? CE    ? B LYS 32  CE    
100 1 Y 1 B LYS 58  ? NZ    ? B LYS 32  NZ    
101 1 Y 1 B GLU 65  ? CD    ? B GLU 39  CD    
102 1 Y 1 B GLU 65  ? OE1   ? B GLU 39  OE1   
103 1 Y 1 B GLU 65  ? OE2   ? B GLU 39  OE2   
104 1 Y 1 B LEU 84  ? CG    ? B LEU 58  CG    
105 1 Y 1 B LEU 84  ? CD1   ? B LEU 58  CD1   
106 1 Y 1 B LEU 84  ? CD2   ? B LEU 58  CD2   
107 1 Y 1 B ARG 88  ? CG    ? B ARG 62  CG    
108 1 Y 1 B ARG 88  ? CD    ? B ARG 62  CD    
109 1 Y 1 B ARG 88  ? NE    ? B ARG 62  NE    
110 1 Y 1 B ARG 88  ? CZ    ? B ARG 62  CZ    
111 1 Y 1 B ARG 88  ? NH1   ? B ARG 62  NH1   
112 1 Y 1 B ARG 88  ? NH2   ? B ARG 62  NH2   
113 1 Y 1 B GLU 122 ? CG    ? B GLU 96  CG    
114 1 Y 1 B GLU 122 ? CD    ? B GLU 96  CD    
115 1 Y 1 B GLU 122 ? OE1   ? B GLU 96  OE1   
116 1 Y 1 B GLU 122 ? OE2   ? B GLU 96  OE2   
117 1 Y 1 B LYS 124 ? CG    ? B LYS 98  CG    
118 1 Y 1 B LYS 124 ? CD    ? B LYS 98  CD    
119 1 Y 1 B LYS 124 ? CE    ? B LYS 98  CE    
120 1 Y 1 B LYS 124 ? NZ    ? B LYS 98  NZ    
121 1 Y 1 B ARG 145 ? CG    ? B ARG 119 CG    
122 1 Y 1 B ARG 145 ? CD    ? B ARG 119 CD    
123 1 Y 1 B ARG 145 ? NE    ? B ARG 119 NE    
124 1 Y 1 B ARG 145 ? CZ    ? B ARG 119 CZ    
125 1 Y 1 B ARG 145 ? NH1   ? B ARG 119 NH1   
126 1 Y 1 B ARG 145 ? NH2   ? B ARG 119 NH2   
127 1 Y 1 B ARG 149 ? CG    ? B ARG 123 CG    
128 1 Y 1 B ARG 149 ? CD    ? B ARG 123 CD    
129 1 Y 1 B ARG 149 ? NE    ? B ARG 123 NE    
130 1 Y 1 B ARG 149 ? CZ    ? B ARG 123 CZ    
131 1 Y 1 B ARG 149 ? NH1   ? B ARG 123 NH1   
132 1 Y 1 B ARG 149 ? NH2   ? B ARG 123 NH2   
133 1 Y 1 B GLN 163 ? CG    ? B GLN 137 CG    
134 1 Y 1 B GLN 163 ? CD    ? B GLN 137 CD    
135 1 Y 1 B GLN 163 ? OE1   ? B GLN 137 OE1   
136 1 Y 1 B GLN 163 ? NE2   ? B GLN 137 NE2   
137 1 Y 1 B LYS 182 ? CE    ? B LYS 156 CE    
138 1 Y 1 B LYS 182 ? NZ    ? B LYS 156 NZ    
139 1 Y 1 B ASN 191 ? CG    ? B ASN 165 CG    
140 1 Y 1 B ASN 191 ? OD1   ? B ASN 165 OD1   
141 1 Y 1 B ASN 191 ? ND2   ? B ASN 165 ND2   
142 1 Y 1 B GLU 216 ? CG    ? B GLU 190 CG    
143 1 Y 1 B GLU 216 ? CD    ? B GLU 190 CD    
144 1 Y 1 B GLU 216 ? OE1   ? B GLU 190 OE1   
145 1 Y 1 B GLU 216 ? OE2   ? B GLU 190 OE2   
146 1 Y 1 B ASP 217 ? CG    ? B ASP 191 CG    
147 1 Y 1 B ASP 217 ? OD1   ? B ASP 191 OD1   
148 1 Y 1 B ASP 217 ? OD2   ? B ASP 191 OD2   
149 1 Y 1 B PHE 222 ? CG    ? B PHE 196 CG    
150 1 Y 1 B PHE 222 ? CD1   ? B PHE 196 CD1   
151 1 Y 1 B PHE 222 ? CD2   ? B PHE 196 CD2   
152 1 Y 1 B PHE 222 ? CE1   ? B PHE 196 CE1   
153 1 Y 1 B PHE 222 ? CE2   ? B PHE 196 CE2   
154 1 Y 1 B PHE 222 ? CZ    ? B PHE 196 CZ    
155 1 Y 1 B LYS 224 ? CG    ? B LYS 198 CG    
156 1 Y 1 B LYS 224 ? CD    ? B LYS 198 CD    
157 1 Y 1 B LYS 224 ? CE    ? B LYS 198 CE    
158 1 Y 1 B LYS 224 ? NZ    ? B LYS 198 NZ    
159 1 Y 1 B SER 283 ? OG    ? B SER 257 OG    
160 1 Y 1 B VAL 285 ? CG1   ? B VAL 259 CG1   
161 1 Y 1 B VAL 285 ? CG2   ? B VAL 259 CG2   
162 1 Y 1 B LYS 347 ? CG    ? B LYS 321 CG    
163 1 Y 1 B LYS 347 ? CD    ? B LYS 321 CD    
164 1 Y 1 B LYS 347 ? CE    ? B LYS 321 CE    
165 1 Y 1 B LYS 347 ? NZ    ? B LYS 321 NZ    
166 1 Y 1 B LYS 359 ? CD    ? B LYS 333 CD    
167 1 Y 1 B LYS 359 ? CE    ? B LYS 333 CE    
168 1 Y 1 B LYS 359 ? NZ    ? B LYS 333 NZ    
169 1 Y 1 B ARG 409 ? CG    ? B ARG 383 CG    
170 1 Y 1 B ARG 409 ? CD    ? B ARG 383 CD    
171 1 Y 1 B ARG 409 ? NE    ? B ARG 383 NE    
172 1 Y 1 B ARG 409 ? CZ    ? B ARG 383 CZ    
173 1 Y 1 B ARG 409 ? NH1   ? B ARG 383 NH1   
174 1 Y 1 B ARG 409 ? NH2   ? B ARG 383 NH2   
175 1 Y 1 B ASP 410 ? CG    ? B ASP 384 CG    
176 1 Y 1 B ASP 410 ? OD1   ? B ASP 384 OD1   
177 1 Y 1 B ASP 410 ? OD2   ? B ASP 384 OD2   
178 1 Y 1 B GLU 412 ? CG    ? B GLU 386 CG    
179 1 Y 1 B GLU 412 ? CD    ? B GLU 386 CD    
180 1 Y 1 B GLU 412 ? OE1   ? B GLU 386 OE1   
181 1 Y 1 B GLU 412 ? OE2   ? B GLU 386 OE2   
182 1 Y 1 B ARG 450 ? CD    ? B ARG 424 CD    
183 1 Y 1 B ARG 450 ? NE    ? B ARG 424 NE    
184 1 Y 1 B ARG 450 ? CZ    ? B ARG 424 CZ    
185 1 Y 1 B ARG 450 ? NH1   ? B ARG 424 NH1   
186 1 Y 1 B ARG 450 ? NH2   ? B ARG 424 NH2   
187 1 Y 1 B GLU 490 ? CD    ? B GLU 464 CD    
188 1 Y 1 B GLU 490 ? OE1   ? B GLU 464 OE1   
189 1 Y 1 B GLU 490 ? OE2   ? B GLU 464 OE2   
190 1 Y 1 D DA  2   ? "O5'" ? D DA  1   "O5'" 
191 1 Y 1 T DA  2   ? "O5'" ? F DA  1   "O5'" 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A GLY 27  ? A GLY 1   
2   1 Y 1 A MET 28  ? A MET 2   
3   1 Y 1 A GLU 29  ? A GLU 3   
4   1 Y 1 A GLY 30  ? A GLY 4   
5   1 Y 1 A LEU 31  ? A LEU 5   
6   1 Y 1 A MET 225 ? A MET 199 
7   1 Y 1 A GLY 226 ? A GLY 200 
8   1 Y 1 A SER 227 ? A SER 201 
9   1 Y 1 A SER 228 ? A SER 202 
10  1 Y 1 A VAL 229 ? A VAL 203 
11  1 Y 1 A GLU 230 ? A GLU 204 
12  1 Y 1 A ASN 231 ? A ASN 205 
13  1 Y 1 A ASP 232 ? A ASP 206 
14  1 Y 1 A ASN 233 ? A ASN 207 
15  1 Y 1 A PRO 234 ? A PRO 208 
16  1 Y 1 A GLY 235 ? A GLY 209 
17  1 Y 1 A LYS 236 ? A LYS 210 
18  1 Y 1 A GLU 237 ? A GLU 211 
19  1 Y 1 A VAL 238 ? A VAL 212 
20  1 Y 1 A ASN 239 ? A ASN 213 
21  1 Y 1 A LYS 240 ? A LYS 214 
22  1 Y 1 A LEU 241 ? A LEU 215 
23  1 Y 1 A SER 242 ? A SER 216 
24  1 Y 1 A GLU 243 ? A GLU 217 
25  1 Y 1 A HIS 244 ? A HIS 218 
26  1 Y 1 A GLU 245 ? A GLU 219 
27  1 Y 1 A ARG 246 ? A ARG 220 
28  1 Y 1 A SER 247 ? A SER 221 
29  1 Y 1 A ILE 248 ? A ILE 222 
30  1 Y 1 A SER 249 ? A SER 223 
31  1 Y 1 A PRO 250 ? A PRO 224 
32  1 Y 1 A LEU 251 ? A LEU 225 
33  1 Y 1 A LEU 252 ? A LEU 226 
34  1 Y 1 A PHE 253 ? A PHE 227 
35  1 Y 1 A GLU 254 ? A GLU 228 
36  1 Y 1 A GLU 255 ? A GLU 229 
37  1 Y 1 A SER 256 ? A SER 230 
38  1 Y 1 A PRO 257 ? A PRO 231 
39  1 Y 1 A SER 258 ? A SER 232 
40  1 Y 1 A ASP 259 ? A ASP 233 
41  1 Y 1 A VAL 260 ? A VAL 234 
42  1 Y 1 A GLN 261 ? A GLN 235 
43  1 Y 1 A PRO 262 ? A PRO 236 
44  1 Y 1 A PRO 263 ? A PRO 237 
45  1 Y 1 A GLY 264 ? A GLY 238 
46  1 Y 1 A ASP 265 ? A ASP 239 
47  1 Y 1 A PRO 266 ? A PRO 240 
48  1 Y 1 A PHE 267 ? A PHE 241 
49  1 Y 1 A GLN 268 ? A GLN 242 
50  1 Y 1 A VAL 269 ? A VAL 243 
51  1 Y 1 A ASN 270 ? A ASN 244 
52  1 Y 1 A PHE 271 ? A PHE 245 
53  1 Y 1 A GLU 272 ? A GLU 246 
54  1 Y 1 A GLU 273 ? A GLU 247 
55  1 Y 1 A GLN 274 ? A GLN 248 
56  1 Y 1 A ASN 275 ? A ASN 249 
57  1 Y 1 A ASN 276 ? A ASN 250 
58  1 Y 1 A PRO 277 ? A PRO 251 
59  1 Y 1 A GLN 278 ? A GLN 252 
60  1 Y 1 A ILE 279 ? A ILE 253 
61  1 Y 1 A LEU 280 ? A LEU 254 
62  1 Y 1 B GLY 27  ? B GLY 1   
63  1 Y 1 B MET 28  ? B MET 2   
64  1 Y 1 B GLU 29  ? B GLU 3   
65  1 Y 1 B GLY 30  ? B GLY 4   
66  1 Y 1 B MET 225 ? B MET 199 
67  1 Y 1 B GLY 226 ? B GLY 200 
68  1 Y 1 B SER 227 ? B SER 201 
69  1 Y 1 B SER 228 ? B SER 202 
70  1 Y 1 B VAL 229 ? B VAL 203 
71  1 Y 1 B GLU 230 ? B GLU 204 
72  1 Y 1 B ASN 231 ? B ASN 205 
73  1 Y 1 B ASP 232 ? B ASP 206 
74  1 Y 1 B ASN 233 ? B ASN 207 
75  1 Y 1 B PRO 234 ? B PRO 208 
76  1 Y 1 B GLY 235 ? B GLY 209 
77  1 Y 1 B LYS 236 ? B LYS 210 
78  1 Y 1 B GLU 237 ? B GLU 211 
79  1 Y 1 B VAL 238 ? B VAL 212 
80  1 Y 1 B ASN 239 ? B ASN 213 
81  1 Y 1 B LYS 240 ? B LYS 214 
82  1 Y 1 B LEU 241 ? B LEU 215 
83  1 Y 1 B SER 242 ? B SER 216 
84  1 Y 1 B GLU 243 ? B GLU 217 
85  1 Y 1 B HIS 244 ? B HIS 218 
86  1 Y 1 B GLU 245 ? B GLU 219 
87  1 Y 1 B ARG 246 ? B ARG 220 
88  1 Y 1 B SER 247 ? B SER 221 
89  1 Y 1 B ILE 248 ? B ILE 222 
90  1 Y 1 B SER 249 ? B SER 223 
91  1 Y 1 B PRO 250 ? B PRO 224 
92  1 Y 1 B LEU 251 ? B LEU 225 
93  1 Y 1 B LEU 252 ? B LEU 226 
94  1 Y 1 B PHE 253 ? B PHE 227 
95  1 Y 1 B GLU 254 ? B GLU 228 
96  1 Y 1 B GLU 255 ? B GLU 229 
97  1 Y 1 B SER 256 ? B SER 230 
98  1 Y 1 B PRO 257 ? B PRO 231 
99  1 Y 1 B SER 258 ? B SER 232 
100 1 Y 1 B ASP 259 ? B ASP 233 
101 1 Y 1 B VAL 260 ? B VAL 234 
102 1 Y 1 B GLN 261 ? B GLN 235 
103 1 Y 1 B PRO 262 ? B PRO 236 
104 1 Y 1 B PRO 263 ? B PRO 237 
105 1 Y 1 B GLY 264 ? B GLY 238 
106 1 Y 1 B ASP 265 ? B ASP 239 
107 1 Y 1 B PRO 266 ? B PRO 240 
108 1 Y 1 B PHE 267 ? B PHE 241 
109 1 Y 1 B GLN 268 ? B GLN 242 
110 1 Y 1 B VAL 269 ? B VAL 243 
111 1 Y 1 B ASN 270 ? B ASN 244 
112 1 Y 1 B PHE 271 ? B PHE 245 
113 1 Y 1 B GLU 272 ? B GLU 246 
114 1 Y 1 B GLU 273 ? B GLU 247 
115 1 Y 1 B GLN 274 ? B GLN 248 
116 1 Y 1 B ASN 275 ? B ASN 249 
117 1 Y 1 B ASN 276 ? B ASN 250 
118 1 Y 1 B PRO 277 ? B PRO 251 
119 1 Y 1 B GLN 278 ? B GLN 252 
120 1 Y 1 B ILE 279 ? B ILE 253 
121 1 Y 1 B LEU 280 ? B LEU 254 
122 1 Y 1 B GLN 281 ? B GLN 255 
123 1 Y 1 B ASN 518 ? B ASN 492 
# 
_ndb_struct_conf_na.entry_id   4U7C 
_ndb_struct_conf_na.feature    'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 C DG 1 1_555 D DC 13 1_555 -0.131 -0.090 -0.068 -6.786  -11.459 0.678  1  C_DG5:DC14_D C 5  ? D 14 ? 19 1 
1 C DC 2 1_555 D DG 12 1_555 0.298  -0.174 0.184  -6.135  -8.830  -2.788 2  C_DC6:DG13_D C 6  ? D 13 ? 19 1 
1 C DG 3 1_555 D DC 11 1_555 0.605  -0.124 0.018  2.036   -6.129  -0.764 3  C_DG7:DC12_D C 7  ? D 12 ? 19 1 
1 C DG 4 1_555 D DC 10 1_555 -0.469 -0.225 -0.680 -8.504  -13.548 2.170  4  C_DG8:DC11_D C 8  ? D 11 ? 19 1 
1 C DA 5 1_555 D DT 9  1_555 0.017  -0.155 -0.451 -6.635  -7.076  3.494  5  C_DA9:DT10_D C 9  ? D 10 ? 20 1 
1 C DT 6 1_555 D DA 8  1_555 0.009  -0.016 -0.168 -2.618  -9.306  2.755  6  C_DT10:DA9_D C 10 ? D 9  ? 20 1 
1 C DC 7 1_555 D DG 7  1_555 0.158  -0.172 -0.590 4.234   -1.379  -3.722 7  C_DC11:DG8_D C 11 ? D 8  ? 19 1 
1 C DA 8 1_555 D DT 6  1_555 0.355  -0.171 0.045  11.194  -1.929  2.426  8  C_DA12:DT7_D C 12 ? D 7  ? 20 1 
1 C DG 9 1_555 D DC 5  1_555 -0.526 -0.185 0.544  29.594  1.208   -1.249 9  C_DG13:DC6_D C 13 ? D 6  ? 19 1 
1 E DG 1 1_555 F DC 13 1_555 -0.240 -0.118 -0.141 -6.715  -10.441 -0.010 10 P_DG5:DC14_T P 5  ? T 14 ? 19 1 
1 E DC 2 1_555 F DG 12 1_555 0.185  -0.128 0.210  -9.117  -6.740  -1.981 11 P_DC6:DG13_T P 6  ? T 13 ? 19 1 
1 E DG 3 1_555 F DC 11 1_555 0.461  -0.092 -0.328 -4.751  -6.885  -0.230 12 P_DG7:DC12_T P 7  ? T 12 ? 19 1 
1 E DG 4 1_555 F DC 10 1_555 -0.576 0.041  -0.317 -10.329 -10.469 5.281  13 P_DG8:DC11_T P 8  ? T 11 ? 19 1 
1 E DA 5 1_555 F DT 9  1_555 -0.337 -0.296 -0.453 0.093   -10.426 0.762  14 P_DA9:DT10_T P 9  ? T 10 ? 20 1 
1 E DT 6 1_555 F DA 8  1_555 0.101  -0.107 -0.092 -1.376  -8.792  0.008  15 P_DT10:DA9_T P 10 ? T 9  ? 20 1 
1 E DC 7 1_555 F DG 7  1_555 0.067  0.067  -0.195 2.394   -5.743  1.672  16 P_DC11:DG8_T P 11 ? T 8  ? 19 1 
1 E DA 8 1_555 F DT 6  1_555 -0.077 -0.094 -0.067 18.722  0.781   -1.858 17 P_DA12:DT7_T P 12 ? T 7  ? 20 1 
1 E DG 9 1_555 F DC 5  1_555 -0.165 0.052  0.313  32.095  -3.112  2.081  18 P_DG13:DC6_T P 13 ? T 6  ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 C DG 1 1_555 D DC 13 1_555 C DC 2 1_555 D DG 12 1_555 -1.138 -0.719 3.248 -5.062 1.392 32.444 -1.513 1.133  3.349 2.472  8.986  
32.854 1  CC_DG5DC6:DG13DC14_DD C 5  ? D 14 ? C 6  ? D 13 ? 
1 C DC 2 1_555 D DG 12 1_555 C DG 3 1_555 D DC 11 1_555 -0.383 0.145  3.097 0.190  5.864 29.039 -0.895 0.787  3.064 11.546 -0.374 
29.614 2  CC_DC6DG7:DC12DG13_DD C 6  ? D 13 ? C 7  ? D 12 ? 
1 C DG 3 1_555 D DC 11 1_555 C DG 4 1_555 D DC 10 1_555 0.150  -0.112 3.655 3.480  6.595 31.339 -1.518 0.424  3.554 11.997 -6.331 
32.193 3  CC_DG7DG8:DC11DC12_DD C 7  ? D 12 ? C 8  ? D 11 ? 
1 C DG 4 1_555 D DC 10 1_555 C DA 5 1_555 D DT 9  1_555 0.495  -0.421 3.278 -1.473 3.243 35.736 -1.144 -1.012 3.206 5.269  2.393  
35.907 4  CC_DG8DA9:DT10DC11_DD C 8  ? D 11 ? C 9  ? D 10 ? 
1 C DA 5 1_555 D DT 9  1_555 C DT 6 1_555 D DA 8  1_555 -0.453 -0.519 3.237 -2.268 3.513 32.782 -1.499 0.417  3.189 6.193  3.997  
33.041 5  CC_DA9DT10:DA9DT10_DD C 9  ? D 10 ? C 10 ? D 9  ? 
1 C DT 6 1_555 D DA 8  1_555 C DC 7 1_555 D DG 7  1_555 -0.199 -0.640 3.152 3.901  6.735 29.093 -2.526 1.132  2.884 13.114 -7.596 
30.094 6  CC_DT10DC11:DG8DA9_DD C 10 ? D 9  ? C 11 ? D 8  ? 
1 C DC 7 1_555 D DG 7  1_555 C DA 8 1_555 D DT 6  1_555 0.090  -0.159 3.211 -4.177 8.560 29.647 -1.894 -0.948 3.009 16.210 7.911  
31.106 7  CC_DC11DA12:DT7DG8_DD C 11 ? D 8  ? C 12 ? D 7  ? 
1 C DA 8 1_555 D DT 6  1_555 C DG 9 1_555 D DC 5  1_555 0.426  -0.361 3.048 -1.453 0.677 24.123 -1.060 -1.446 3.006 1.617  3.472  
24.176 8  CC_DA12DG13:DC6DT7_DD C 12 ? D 7  ? C 13 ? D 6  ? 
1 E DG 1 1_555 F DC 13 1_555 E DC 2 1_555 F DG 12 1_555 -0.827 -0.927 3.340 -3.933 0.181 33.694 -1.620 0.764  3.407 0.311  6.757  
33.917 9  PP_DG5DC6:DG13DC14_TT P 5  ? T 14 ? P 6  ? T 13 ? 
1 E DC 2 1_555 F DG 12 1_555 E DG 3 1_555 F DC 11 1_555 -0.432 0.236  3.260 2.609  5.351 31.726 -0.524 1.239  3.211 9.682  -4.720 
32.265 10 PP_DC6DG7:DC12DG13_TT P 6  ? T 13 ? P 7  ? T 12 ? 
1 E DG 3 1_555 F DC 11 1_555 E DG 4 1_555 F DC 10 1_555 0.023  0.362  3.467 -1.806 2.901 33.514 0.122  -0.353 3.479 5.015  3.121  
33.683 11 PP_DG7DG8:DC11DC12_TT P 7  ? T 12 ? P 8  ? T 11 ? 
1 E DG 4 1_555 F DC 10 1_555 E DA 5 1_555 F DT 9  1_555 0.246  -0.459 3.210 2.672  3.484 30.660 -1.518 0.043  3.149 6.547  -5.020 
30.965 12 PP_DG8DA9:DT10DC11_TT P 8  ? T 11 ? P 9  ? T 10 ? 
1 E DA 5 1_555 F DT 9  1_555 E DT 6 1_555 F DA 8  1_555 -0.408 -0.302 3.356 -4.409 6.403 33.924 -1.508 -0.009 3.272 10.799 7.436  
34.778 13 PP_DA9DT10:DA9DT10_TT P 9  ? T 10 ? P 10 ? T 9  ? 
1 E DT 6 1_555 F DA 8  1_555 E DC 7 1_555 F DG 7  1_555 0.083  -0.700 3.307 2.724  5.154 28.752 -2.488 0.419  3.131 10.246 -5.416 
29.325 14 PP_DT10DC11:DG8DA9_TT P 10 ? T 9  ? P 11 ? T 8  ? 
1 E DC 7 1_555 F DG 7  1_555 E DA 8 1_555 F DT 6  1_555 -0.271 -0.143 2.938 -0.834 9.145 28.977 -1.915 0.367  2.772 17.723 1.616  
30.368 15 PP_DC11DA12:DT7DG8_TT P 11 ? T 8  ? P 12 ? T 7  ? 
1 E DA 8 1_555 F DT 6  1_555 E DG 9 1_555 F DC 5  1_555 0.676  -0.108 3.209 -0.541 4.789 27.904 -1.303 -1.504 3.133 9.838  1.111  
28.309 16 PP_DA12DG13:DC6DT7_TT P 12 ? T 7  ? P 13 ? T 6  ? 
# 
_pdbx_audit_support.funding_organization   'Canadian Institutes of Health Research' 
_pdbx_audit_support.country                Canada 
_pdbx_audit_support.grant_number           MOP-67128 
_pdbx_audit_support.ordinal                1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'MAGNESIUM ION'                                                                             MG  
5 "2'-deoxy-5'-O-[(R)-hydroxy{[(R)-hydroxy(phosphonooxy)phosphoryl]amino}phosphoryl]cytidine" 0KX 
6 'DI(HYDROXYETHYL)ETHER'                                                                     PEG 
7 1,2-ETHANEDIOL                                                                              EDO 
8 water                                                                                       HOH 
#