data_4U7E
# 
_entry.id   4U7E 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4U7E         
WWPDB D_1000202931 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 4U7I PDB . 
unspecified 4U7Y PDB . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4U7E 
_pdbx_database_status.recvd_initial_deposition_date   2014-07-30 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Guo, E.Z.' 1 
'Xu, Z.'    2 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_id_ASTM           JBCHA3 
_citation.journal_id_CSD            0071 
_citation.journal_id_ISSN           1083-351X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            290 
_citation.language                  ? 
_citation.page_first                8396 
_citation.page_last                 8408 
_citation.title                     
;Distinct Mechanisms of Recognizing Endosomal Sorting Complex Required for Transport III (ESCRT-III) Protein IST1 by Different Microtubule Interacting and Trafficking (MIT) Domains.
;
_citation.year                      2015 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1074/jbc.M114.607903 
_citation.pdbx_database_id_PubMed   25657007 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Guo, E.Z.' 1 ? 
primary 'Xu, Z.'    2 ? 
# 
_cell.entry_id           4U7E 
_cell.length_a           32.315 
_cell.length_b           65.578 
_cell.length_c           78.539 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4U7E 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Vacuolar protein sorting-associated protein VTA1 homolog' 18792.727 1   ? ? 
'N-terminal domain (UNP residues 1-162)' ? 
2 polymer man 'IST1 homolog'                                             3009.262  1   ? ? 'UNP residues 341-364' ? 
3 water   nat water                                                      18.015    210 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Dopamine-responsive gene 1 protein,DRG-1,LYST-interacting protein 5,LIP5,SKD1-binding protein 1,SBP1' 
2 'hIST1,Putative MAPK-activating protein PM28'                                                          
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;SMAALAPLPPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEALKKQLGDNEA
ITQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIKSFYTASLLIDVITVFGELTDENVKHRKYARWKATYIHNCLKNG
ETP
;
;SMAALAPLPPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEALKKQLGDNEA
ITQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIKSFYTASLLIDVITVFGELTDENVKHRKYARWKATYIHNCLKNG
ETP
;
B ? 
2 'polypeptide(L)' no no STSASEDIDFDDLSRRFEELKKKTW STSASEDIDFDDLSRRFEELKKKTW A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   MET n 
1 3   ALA n 
1 4   ALA n 
1 5   LEU n 
1 6   ALA n 
1 7   PRO n 
1 8   LEU n 
1 9   PRO n 
1 10  PRO n 
1 11  LEU n 
1 12  PRO n 
1 13  ALA n 
1 14  GLN n 
1 15  PHE n 
1 16  LYS n 
1 17  SER n 
1 18  ILE n 
1 19  GLN n 
1 20  HIS n 
1 21  HIS n 
1 22  LEU n 
1 23  ARG n 
1 24  THR n 
1 25  ALA n 
1 26  GLN n 
1 27  GLU n 
1 28  HIS n 
1 29  ASP n 
1 30  LYS n 
1 31  ARG n 
1 32  ASP n 
1 33  PRO n 
1 34  VAL n 
1 35  VAL n 
1 36  ALA n 
1 37  TYR n 
1 38  TYR n 
1 39  CYS n 
1 40  ARG n 
1 41  LEU n 
1 42  TYR n 
1 43  ALA n 
1 44  MET n 
1 45  GLN n 
1 46  THR n 
1 47  GLY n 
1 48  MET n 
1 49  LYS n 
1 50  ILE n 
1 51  ASP n 
1 52  SER n 
1 53  LYS n 
1 54  THR n 
1 55  PRO n 
1 56  GLU n 
1 57  CYS n 
1 58  ARG n 
1 59  LYS n 
1 60  PHE n 
1 61  LEU n 
1 62  SER n 
1 63  LYS n 
1 64  LEU n 
1 65  MET n 
1 66  ASP n 
1 67  GLN n 
1 68  LEU n 
1 69  GLU n 
1 70  ALA n 
1 71  LEU n 
1 72  LYS n 
1 73  LYS n 
1 74  GLN n 
1 75  LEU n 
1 76  GLY n 
1 77  ASP n 
1 78  ASN n 
1 79  GLU n 
1 80  ALA n 
1 81  ILE n 
1 82  THR n 
1 83  GLN n 
1 84  GLU n 
1 85  ILE n 
1 86  VAL n 
1 87  GLY n 
1 88  CYS n 
1 89  ALA n 
1 90  HIS n 
1 91  LEU n 
1 92  GLU n 
1 93  ASN n 
1 94  TYR n 
1 95  ALA n 
1 96  LEU n 
1 97  LYS n 
1 98  MET n 
1 99  PHE n 
1 100 LEU n 
1 101 TYR n 
1 102 ALA n 
1 103 ASP n 
1 104 ASN n 
1 105 GLU n 
1 106 ASP n 
1 107 ARG n 
1 108 ALA n 
1 109 GLY n 
1 110 ARG n 
1 111 PHE n 
1 112 HIS n 
1 113 LYS n 
1 114 ASN n 
1 115 MET n 
1 116 ILE n 
1 117 LYS n 
1 118 SER n 
1 119 PHE n 
1 120 TYR n 
1 121 THR n 
1 122 ALA n 
1 123 SER n 
1 124 LEU n 
1 125 LEU n 
1 126 ILE n 
1 127 ASP n 
1 128 VAL n 
1 129 ILE n 
1 130 THR n 
1 131 VAL n 
1 132 PHE n 
1 133 GLY n 
1 134 GLU n 
1 135 LEU n 
1 136 THR n 
1 137 ASP n 
1 138 GLU n 
1 139 ASN n 
1 140 VAL n 
1 141 LYS n 
1 142 HIS n 
1 143 ARG n 
1 144 LYS n 
1 145 TYR n 
1 146 ALA n 
1 147 ARG n 
1 148 TRP n 
1 149 LYS n 
1 150 ALA n 
1 151 THR n 
1 152 TYR n 
1 153 ILE n 
1 154 HIS n 
1 155 ASN n 
1 156 CYS n 
1 157 LEU n 
1 158 LYS n 
1 159 ASN n 
1 160 GLY n 
1 161 GLU n 
1 162 THR n 
1 163 PRO n 
2 1   SER n 
2 2   THR n 
2 3   SER n 
2 4   ALA n 
2 5   SER n 
2 6   GLU n 
2 7   ASP n 
2 8   ILE n 
2 9   ASP n 
2 10  PHE n 
2 11  ASP n 
2 12  ASP n 
2 13  LEU n 
2 14  SER n 
2 15  ARG n 
2 16  ARG n 
2 17  PHE n 
2 18  GLU n 
2 19  GLU n 
2 20  LEU n 
2 21  LYS n 
2 22  LYS n 
2 23  LYS n 
2 24  THR n 
2 25  TRP n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 163 Human ? 'VTA1, C6orf55, HSPC228, My012' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? 'Rosetta (DE3)' ? ? ? ? ? ? ? plasmid ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 25  Human ? 'IST1, KIAA0174'                ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? 'Rosetta (DE3)' ? ? ? ? ? ? ? plasmid ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP VTA1_HUMAN Q9NP79 1 
;MAALAPLPPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEALKKQLGDNEAI
TQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIKSFYTASLLIDVITVFGELTDENVKHRKYARWKATYIHNCLKNGE
TP
;
1   ? 
2 UNP IST1_HUMAN P53990 2 STSASEDIDFDDLSRRFEELKKKT 341 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4U7E B 2 ? 163 ? Q9NP79 1   ? 162 ? 1   162 
2 2 4U7E A 1 ? 24  ? P53990 341 ? 364 ? 312 335 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4U7E SER B 1  ? UNP Q9NP79 ? ? 'expression tag' 0   1 
2 4U7E TRP A 25 ? UNP P53990 ? ? 'expression tag' 336 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4U7E 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            1.91 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         35.55 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277.15 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '30% (w/v) PEG5000MME, 0.1 M ammonium sulfate , 0.1 M MES' 
_exptl_crystal_grow.pdbx_pH_range   7.0 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'MARMOSAIC 225 mm CCD' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-02-19 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.979 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 21-ID-F' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97872 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   21-ID-F 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         4U7E 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.6 
_reflns.d_resolution_low                 33.69 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       22717 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.8 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  7.1 
_reflns.pdbx_Rmerge_I_obs                0.060 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            27.5 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  . 
_reflns_shell.d_res_low                   ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         4.1 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        99.4 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.370 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             7.0 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 4U7E 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.600 
_refine.ls_d_res_low                             33.69 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     22717 
_refine.ls_number_reflns_R_free                  1143 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.78 
_refine.ls_percent_reflns_R_free                 5.03 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1787 
_refine.ls_R_factor_R_free                       0.2008 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1775 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.36 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               NONE 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 20.14 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.15 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.009  ? 1401 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.283  ? 1894 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 10.478 ? 502  ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.053  ? 212  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.007  ? 243  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
'X-RAY DIFFRACTION' 1.6    1.6724 . . 132 2608 99.00  . . . 0.2280 . 0.1810 . . . . . . . . 
'X-RAY DIFFRACTION' 1.6724 1.7605 . . 149 2641 100.00 . . . 0.2145 . 0.1833 . . . . . . . . 
'X-RAY DIFFRACTION' 1.7605 1.8708 . . 133 2664 100.00 . . . 0.2381 . 0.1835 . . . . . . . . 
'X-RAY DIFFRACTION' 1.8708 2.0153 . . 132 2702 100.00 . . . 0.2194 . 0.1762 . . . . . . . . 
'X-RAY DIFFRACTION' 2.0153 2.2180 . . 145 2655 100.00 . . . 0.2053 . 0.1689 . . . . . . . . 
'X-RAY DIFFRACTION' 2.2180 2.5389 . . 147 2706 100.00 . . . 0.1988 . 0.1780 . . . . . . . . 
'X-RAY DIFFRACTION' 2.5389 3.1983 . . 152 2731 100.00 . . . 0.1930 . 0.1831 . . . . . . . . 
'X-RAY DIFFRACTION' 3.1983 33.69  . . 153 2867 100.00 . . . 0.1883 . 0.1747 . . . . . . . . 
# 
_struct.entry_id                     4U7E 
_struct.title                        'The crystal structure of the complex of LIP5 NTD and IST1 MIM' 
_struct.pdbx_descriptor              'LIP5 NTD, IST1 MIM' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4U7E 
_struct_keywords.text            'Complex, MIM1, PROTEIN TRANSPORT' 
_struct_keywords.pdbx_keywords   'PROTEIN TRANSPORT' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 MET A 2   ? ALA A 6   ? MET B 1   ALA B 5   5 ? 5  
HELX_P HELX_P2  AA2 PRO A 12  ? SER A 17  ? PRO B 11  SER B 16  5 ? 6  
HELX_P HELX_P3  AA3 ILE A 18  ? HIS A 28  ? ILE B 17  HIS B 27  1 ? 11 
HELX_P HELX_P4  AA4 ASP A 32  ? ASP A 51  ? ASP B 31  ASP B 50  1 ? 20 
HELX_P HELX_P5  AA5 THR A 54  ? GLY A 76  ? THR B 53  GLY B 75  1 ? 23 
HELX_P HELX_P6  AA6 ASN A 78  ? GLN A 83  ? ASN B 77  GLN B 82  1 ? 6  
HELX_P HELX_P7  AA7 GLN A 83  ? ALA A 108 ? GLN B 82  ALA B 107 1 ? 26 
HELX_P HELX_P8  AA8 HIS A 112 ? ILE A 129 ? HIS B 111 ILE B 128 1 ? 18 
HELX_P HELX_P9  AA9 THR A 130 ? GLY A 133 ? THR B 129 GLY B 132 5 ? 4  
HELX_P HELX_P10 AB1 THR A 136 ? ASN A 159 ? THR B 135 ASN B 158 1 ? 24 
HELX_P HELX_P11 AB2 ASP B 11  ? LYS B 21  ? ASP A 322 LYS A 332 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_atom_sites.entry_id                    4U7E 
_atom_sites.fract_transf_matrix[1][1]   0.030945 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015249 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012733 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 1   ? -24.835 -2.693  28.190  1.00 36.51 ? 0   SER B N   1 
ATOM   2    C CA  . SER A 1 1   ? -24.581 -1.929  29.404  1.00 27.32 ? 0   SER B CA  1 
ATOM   3    C C   . SER A 1 1   ? -24.128 -2.824  30.555  1.00 22.13 ? 0   SER B C   1 
ATOM   4    O O   . SER A 1 1   ? -24.166 -2.413  31.716  1.00 24.58 ? 0   SER B O   1 
ATOM   5    C CB  . SER A 1 1   ? -25.830 -1.148  29.814  1.00 25.95 ? 0   SER B CB  1 
ATOM   6    O OG  . SER A 1 1   ? -25.622 -0.471  31.038  1.00 39.59 ? 0   SER B OG  1 
ATOM   7    N N   . MET A 1 2   ? -23.712 -4.052  30.240  1.00 20.55 ? 1   MET B N   1 
ATOM   8    C CA  . MET A 1 2   ? -23.118 -4.940  31.248  1.00 18.51 ? 1   MET B CA  1 
ATOM   9    C C   . MET A 1 2   ? -21.734 -4.419  31.628  1.00 18.32 ? 1   MET B C   1 
ATOM   10   O O   . MET A 1 2   ? -20.894 -4.216  30.758  1.00 18.60 ? 1   MET B O   1 
ATOM   11   C CB  . MET A 1 2   ? -23.001 -6.391  30.744  1.00 20.59 ? 1   MET B CB  1 
ATOM   12   C CG  . MET A 1 2   ? -24.329 -7.124  30.497  1.00 19.40 ? 1   MET B CG  1 
ATOM   13   S SD  . MET A 1 2   ? -24.117 -8.790  29.813  1.00 23.49 ? 1   MET B SD  1 
ATOM   14   C CE  . MET A 1 2   ? -23.580 -9.685  31.264  1.00 27.20 ? 1   MET B CE  1 
ATOM   15   N N   . ALA A 1 3   ? -21.498 -4.210  32.921  1.00 18.73 ? 2   ALA B N   1 
ATOM   16   C CA  . ALA A 1 3   ? -20.244 -3.618  33.383  1.00 16.34 ? 2   ALA B CA  1 
ATOM   17   C C   . ALA A 1 3   ? -19.020 -4.430  32.975  1.00 16.39 ? 2   ALA B C   1 
ATOM   18   O O   . ALA A 1 3   ? -17.957 -3.861  32.721  1.00 14.93 ? 2   ALA B O   1 
ATOM   19   C CB  . ALA A 1 3   ? -20.270 -3.443  34.895  1.00 17.97 ? 2   ALA B CB  1 
ATOM   20   N N   . ALA A 1 4   ? -19.164 -5.750  32.911  1.00 17.12 ? 3   ALA B N   1 
ATOM   21   C CA  . ALA A 1 4   ? -18.038 -6.609  32.547  1.00 15.22 ? 3   ALA B CA  1 
ATOM   22   C C   . ALA A 1 4   ? -17.610 -6.403  31.094  1.00 18.52 ? 3   ALA B C   1 
ATOM   23   O O   . ALA A 1 4   ? -16.524 -6.839  30.704  1.00 20.47 ? 3   ALA B O   1 
ATOM   24   C CB  . ALA A 1 4   ? -18.388 -8.076  32.784  1.00 17.67 ? 3   ALA B CB  1 
ATOM   25   N N   . LEU A 1 5   ? -18.446 -5.749  30.289  1.00 17.56 ? 4   LEU B N   1 
ATOM   26   C CA  . LEU A 1 5   ? -18.100 -5.541  28.883  1.00 15.34 ? 4   LEU B CA  1 
ATOM   27   C C   . LEU A 1 5   ? -17.366 -4.219  28.658  1.00 14.52 ? 4   LEU B C   1 
ATOM   28   O O   . LEU A 1 5   ? -17.003 -3.884  27.528  1.00 18.02 ? 4   LEU B O   1 
ATOM   29   C CB  . LEU A 1 5   ? -19.356 -5.614  28.001  1.00 16.80 ? 4   LEU B CB  1 
ATOM   30   C CG  . LEU A 1 5   ? -20.059 -6.974  28.027  1.00 18.66 ? 4   LEU B CG  1 
ATOM   31   C CD1 . LEU A 1 5   ? -21.294 -6.989  27.128  1.00 20.92 ? 4   LEU B CD1 1 
ATOM   32   C CD2 . LEU A 1 5   ? -19.118 -8.100  27.629  1.00 19.65 ? 4   LEU B CD2 1 
ATOM   33   N N   . ALA A 1 6   ? -17.105 -3.498  29.747  1.00 15.12 ? 5   ALA B N   1 
ATOM   34   C CA  . ALA A 1 6   ? -16.377 -2.237  29.696  1.00 15.92 ? 5   ALA B CA  1 
ATOM   35   C C   . ALA A 1 6   ? -14.876 -2.492  29.532  1.00 16.88 ? 5   ALA B C   1 
ATOM   36   O O   . ALA A 1 6   ? -14.426 -3.629  29.696  1.00 15.35 ? 5   ALA B O   1 
ATOM   37   C CB  . ALA A 1 6   ? -16.664 -1.424  30.955  1.00 19.07 ? 5   ALA B CB  1 
ATOM   38   N N   . PRO A 1 7   ? -14.096 -1.447  29.187  1.00 15.56 ? 6   PRO B N   1 
ATOM   39   C CA  . PRO A 1 7   ? -12.682 -1.688  28.862  1.00 15.45 ? 6   PRO B CA  1 
ATOM   40   C C   . PRO A 1 7   ? -11.846 -2.385  29.930  1.00 15.61 ? 6   PRO B C   1 
ATOM   41   O O   . PRO A 1 7   ? -12.031 -2.226  31.145  1.00 17.49 ? 6   PRO B O   1 
ATOM   42   C CB  . PRO A 1 7   ? -12.152 -0.278  28.598  1.00 17.98 ? 6   PRO B CB  1 
ATOM   43   C CG  . PRO A 1 7   ? -13.323 0.431   28.014  1.00 15.58 ? 6   PRO B CG  1 
ATOM   44   C CD  . PRO A 1 7   ? -14.502 -0.078  28.809  1.00 14.76 ? 6   PRO B CD  1 
ATOM   45   N N   . LEU A 1 8   ? -10.924 -3.199  29.423  1.00 13.79 ? 7   LEU B N   1 
ATOM   46   C CA  . LEU A 1 8   ? -9.993  -3.985  30.228  1.00 16.94 ? 7   LEU B CA  1 
ATOM   47   C C   . LEU A 1 8   ? -8.878  -3.111  30.783  1.00 16.04 ? 7   LEU B C   1 
ATOM   48   O O   . LEU A 1 8   ? -8.668  -1.998  30.286  1.00 17.62 ? 7   LEU B O   1 
ATOM   49   C CB  . LEU A 1 8   ? -9.399  -5.096  29.356  1.00 15.55 ? 7   LEU B CB  1 
ATOM   50   C CG  . LEU A 1 8   ? -10.408 -6.105  28.807  1.00 15.42 ? 7   LEU B CG  1 
ATOM   51   C CD1 . LEU A 1 8   ? -9.748  -6.958  27.712  1.00 16.40 ? 7   LEU B CD1 1 
ATOM   52   C CD2 . LEU A 1 8   ? -10.955 -6.977  29.932  1.00 16.62 ? 7   LEU B CD2 1 
ATOM   53   N N   . PRO A 1 9   ? -8.129  -3.624  31.781  1.00 14.26 ? 8   PRO B N   1 
ATOM   54   C CA  . PRO A 1 9   ? -6.914  -2.923  32.203  1.00 15.12 ? 8   PRO B CA  1 
ATOM   55   C C   . PRO A 1 9   ? -5.959  -2.747  31.039  1.00 16.03 ? 8   PRO B C   1 
ATOM   56   O O   . PRO A 1 9   ? -6.097  -3.414  30.026  1.00 15.82 ? 8   PRO B O   1 
ATOM   57   C CB  . PRO A 1 9   ? -6.305  -3.866  33.252  1.00 13.74 ? 8   PRO B CB  1 
ATOM   58   C CG  . PRO A 1 9   ? -7.436  -4.681  33.741  1.00 16.56 ? 8   PRO B CG  1 
ATOM   59   C CD  . PRO A 1 9   ? -8.323  -4.871  32.544  1.00 14.80 ? 8   PRO B CD  1 
ATOM   60   N N   . PRO A 1 10  ? -4.992  -1.840  31.180  1.00 14.02 ? 9   PRO B N   1 
ATOM   61   C CA  . PRO A 1 10  ? -3.952  -1.729  30.159  1.00 13.88 ? 9   PRO B CA  1 
ATOM   62   C C   . PRO A 1 10  ? -3.283  -3.080  29.943  1.00 14.63 ? 9   PRO B C   1 
ATOM   63   O O   . PRO A 1 10  ? -3.107  -3.826  30.901  1.00 16.32 ? 9   PRO B O   1 
ATOM   64   C CB  . PRO A 1 10  ? -2.974  -0.722  30.759  1.00 14.85 ? 9   PRO B CB  1 
ATOM   65   C CG  . PRO A 1 10  ? -3.806  0.088   31.715  1.00 15.47 ? 9   PRO B CG  1 
ATOM   66   C CD  . PRO A 1 10  ? -4.820  -0.862  32.268  1.00 16.98 ? 9   PRO B CD  1 
ATOM   67   N N   . LEU A 1 11  ? -2.917  -3.386  28.706  1.00 15.13 ? 10  LEU B N   1 
ATOM   68   C CA  . LEU A 1 11  ? -2.329  -4.684  28.395  1.00 14.71 ? 10  LEU B CA  1 
ATOM   69   C C   . LEU A 1 11  ? -0.935  -4.805  29.011  1.00 16.85 ? 10  LEU B C   1 
ATOM   70   O O   . LEU A 1 11  ? -0.088  -3.944  28.765  1.00 16.64 ? 10  LEU B O   1 
ATOM   71   C CB  . LEU A 1 11  ? -2.246  -4.876  26.882  1.00 17.23 ? 10  LEU B CB  1 
ATOM   72   C CG  . LEU A 1 11  ? -1.757  -6.250  26.423  1.00 13.05 ? 10  LEU B CG  1 
ATOM   73   C CD1 . LEU A 1 11  ? -2.767  -7.335  26.773  1.00 12.55 ? 10  LEU B CD1 1 
ATOM   74   C CD2 . LEU A 1 11  ? -1.441  -6.255  24.939  1.00 16.42 ? 10  LEU B CD2 1 
ATOM   75   N N   . PRO A 1 12  ? -0.702  -5.848  29.834  1.00 14.20 ? 11  PRO B N   1 
ATOM   76   C CA  . PRO A 1 12  ? 0.640   -6.053  30.399  1.00 13.07 ? 11  PRO B CA  1 
ATOM   77   C C   . PRO A 1 12  ? 1.696   -6.241  29.314  1.00 14.01 ? 11  PRO B C   1 
ATOM   78   O O   . PRO A 1 12  ? 1.394   -6.824  28.276  1.00 14.33 ? 11  PRO B O   1 
ATOM   79   C CB  . PRO A 1 12  ? 0.480   -7.329  31.233  1.00 13.56 ? 11  PRO B CB  1 
ATOM   80   C CG  . PRO A 1 12  ? -0.981  -7.366  31.594  1.00 16.51 ? 11  PRO B CG  1 
ATOM   81   C CD  . PRO A 1 12  ? -1.666  -6.834  30.354  1.00 13.90 ? 11  PRO B CD  1 
ATOM   82   N N   . ALA A 1 13  ? 2.915   -5.756  29.563  1.00 14.89 ? 12  ALA B N   1 
ATOM   83   C CA  . ALA A 1 13  ? 3.991   -5.857  28.584  1.00 15.27 ? 12  ALA B CA  1 
ATOM   84   C C   . ALA A 1 13  ? 4.277   -7.306  28.227  1.00 14.28 ? 12  ALA B C   1 
ATOM   85   O O   . ALA A 1 13  ? 4.660   -7.605  27.097  1.00 13.56 ? 12  ALA B O   1 
ATOM   86   C CB  . ALA A 1 13  ? 5.244   -5.180  29.112  1.00 18.70 ? 12  ALA B CB  1 
ATOM   87   N N   . GLN A 1 14  ? 4.068   -8.202  29.189  1.00 14.98 ? 13  GLN B N   1 
ATOM   88   C CA  . GLN A 1 14  ? 4.228   -9.632  28.949  1.00 13.60 ? 13  GLN B CA  1 
ATOM   89   C C   . GLN A 1 14  ? 3.344   -10.158 27.830  1.00 12.68 ? 13  GLN B C   1 
ATOM   90   O O   . GLN A 1 14  ? 3.658   -11.179 27.245  1.00 13.37 ? 13  GLN B O   1 
ATOM   91   C CB  . GLN A 1 14  ? 3.912   -10.448 30.202  1.00 15.86 ? 13  GLN B CB  1 
ATOM   92   C CG  . GLN A 1 14  ? 4.898   -10.320 31.352  1.00 17.41 ? 13  GLN B CG  1 
ATOM   93   C CD  . GLN A 1 14  ? 4.634   -9.114  32.231  1.00 17.57 ? 13  GLN B CD  1 
ATOM   94   O OE1 . GLN A 1 14  ? 3.774   -8.288  31.938  1.00 16.78 ? 13  GLN B OE1 1 
ATOM   95   N NE2 . GLN A 1 14  ? 5.358   -9.027  33.344  1.00 25.67 ? 13  GLN B NE2 1 
ATOM   96   N N   . PHE A 1 15  ? 2.239   -9.466  27.562  1.00 12.60 ? 14  PHE B N   1 
ATOM   97   C CA  . PHE A 1 15  ? 1.233   -9.941  26.613  1.00 12.20 ? 14  PHE B CA  1 
ATOM   98   C C   . PHE A 1 15  ? 1.289   -9.181  25.295  1.00 13.94 ? 14  PHE B C   1 
ATOM   99   O O   . PHE A 1 15  ? 0.323   -9.173  24.534  1.00 11.68 ? 14  PHE B O   1 
ATOM   100  C CB  . PHE A 1 15  ? -0.186  -9.807  27.205  1.00 12.29 ? 14  PHE B CB  1 
ATOM   101  C CG  . PHE A 1 15  ? -0.449  -10.670 28.417  1.00 13.29 ? 14  PHE B CG  1 
ATOM   102  C CD1 . PHE A 1 15  ? 0.372   -11.747 28.747  1.00 13.39 ? 14  PHE B CD1 1 
ATOM   103  C CD2 . PHE A 1 15  ? -1.564  -10.430 29.204  1.00 13.37 ? 14  PHE B CD2 1 
ATOM   104  C CE1 . PHE A 1 15  ? 0.106   -12.540 29.874  1.00 12.87 ? 14  PHE B CE1 1 
ATOM   105  C CE2 . PHE A 1 15  ? -1.839  -11.222 30.317  1.00 13.26 ? 14  PHE B CE2 1 
ATOM   106  C CZ  . PHE A 1 15  ? -1.002  -12.284 30.647  1.00 13.40 ? 14  PHE B CZ  1 
ATOM   107  N N   . LYS A 1 16  ? 2.422   -8.548  25.019  1.00 14.76 ? 15  LYS B N   1 
ATOM   108  C CA  . LYS A 1 16  ? 2.610   -7.806  23.781  1.00 13.97 ? 15  LYS B CA  1 
ATOM   109  C C   . LYS A 1 16  ? 2.218   -8.633  22.552  1.00 14.85 ? 15  LYS B C   1 
ATOM   110  O O   . LYS A 1 16  ? 1.665   -8.091  21.589  1.00 16.06 ? 15  LYS B O   1 
ATOM   111  C CB  . LYS A 1 16  ? 4.071   -7.339  23.682  1.00 16.12 ? 15  LYS B CB  1 
ATOM   112  C CG  . LYS A 1 16  ? 4.413   -6.552  22.421  1.00 20.97 ? 15  LYS B CG  1 
ATOM   113  C CD  . LYS A 1 16  ? 5.878   -6.120  22.448  1.00 22.61 ? 15  LYS B CD  1 
ATOM   114  N NZ  . LYS A 1 16  ? 6.607   -3.794  20.478  1.00 41.98 ? 15  LYS B NZ  1 
ATOM   115  N N   . SER A 1 17  ? 2.474   -9.943  22.593  1.00 13.26 ? 16  SER B N   1 
ATOM   116  C CA  . SER A 1 17  ? 2.237   -10.783 21.418  1.00 13.79 ? 16  SER B CA  1 
ATOM   117  C C   . SER A 1 17  ? 0.762   -10.950 21.060  1.00 15.80 ? 16  SER B C   1 
ATOM   118  O O   . SER A 1 17  ? 0.472   -11.388 19.962  1.00 19.78 ? 16  SER B O   1 
ATOM   119  C CB  . SER A 1 17  ? 2.876   -12.173 21.589  1.00 14.35 ? 16  SER B CB  1 
ATOM   120  O OG  . SER A 1 17  ? 2.305   -12.920 22.657  1.00 14.03 ? 16  SER B OG  1 
ATOM   121  N N   . ILE A 1 18  ? -0.156  -10.600 21.965  1.00 14.90 ? 17  ILE B N   1 
ATOM   122  C CA  . ILE A 1 18  ? -1.596  -10.687 21.652  1.00 13.04 ? 17  ILE B CA  1 
ATOM   123  C C   . ILE A 1 18  ? -2.274  -9.318  21.567  1.00 13.37 ? 17  ILE B C   1 
ATOM   124  O O   . ILE A 1 18  ? -3.503  -9.236  21.478  1.00 13.97 ? 17  ILE B O   1 
ATOM   125  C CB  . ILE A 1 18  ? -2.360  -11.556 22.676  1.00 17.46 ? 17  ILE B CB  1 
ATOM   126  C CG1 . ILE A 1 18  ? -2.179  -10.994 24.096  1.00 16.24 ? 17  ILE B CG1 1 
ATOM   127  C CG2 . ILE A 1 18  ? -1.953  -13.034 22.506  1.00 18.07 ? 17  ILE B CG2 1 
ATOM   128  C CD1 . ILE A 1 18  ? -3.106  -11.580 25.177  1.00 18.10 ? 17  ILE B CD1 1 
ATOM   129  N N   . GLN A 1 19  ? -1.480  -8.250  21.552  1.00 12.93 ? 18  GLN B N   1 
ATOM   130  C CA  . GLN A 1 19  ? -2.021  -6.892  21.440  1.00 14.65 ? 18  GLN B CA  1 
ATOM   131  C C   . GLN A 1 19  ? -2.894  -6.714  20.194  1.00 13.18 ? 18  GLN B C   1 
ATOM   132  O O   . GLN A 1 19  ? -3.973  -6.124  20.259  1.00 13.33 ? 18  GLN B O   1 
ATOM   133  C CB  . GLN A 1 19  ? -0.878  -5.865  21.443  1.00 18.13 ? 18  GLN B CB  1 
ATOM   134  C CG  . GLN A 1 19  ? -1.335  -4.419  21.425  1.00 21.40 ? 18  GLN B CG  1 
ATOM   135  C CD  . GLN A 1 19  ? -0.189  -3.418  21.520  1.00 31.09 ? 18  GLN B CD  1 
ATOM   136  O OE1 . GLN A 1 19  ? 0.987   -3.759  21.369  1.00 31.81 ? 18  GLN B OE1 1 
ATOM   137  N N   . HIS A 1 20  ? -2.441  -7.226  19.055  1.00 14.06 ? 19  HIS B N   1 
ATOM   138  C CA  . HIS A 1 20  ? -3.200  -7.010  17.838  1.00 15.34 ? 19  HIS B CA  1 
ATOM   139  C C   . HIS A 1 20  ? -4.452  -7.890  17.772  1.00 13.14 ? 19  HIS B C   1 
ATOM   140  O O   . HIS A 1 20  ? -5.459  -7.477  17.202  1.00 12.89 ? 19  HIS B O   1 
ATOM   141  C CB  . HIS A 1 20  ? -2.296  -7.216  16.625  1.00 14.83 ? 19  HIS B CB  1 
ATOM   142  C CG  . HIS A 1 20  ? -1.212  -6.188  16.523  1.00 19.96 ? 19  HIS B CG  1 
ATOM   143  N ND1 . HIS A 1 20  ? -0.092  -6.353  15.739  1.00 21.13 ? 19  HIS B ND1 1 
ATOM   144  C CD2 . HIS A 1 20  ? -1.081  -4.975  17.114  1.00 25.04 ? 19  HIS B CD2 1 
ATOM   145  C CE1 . HIS A 1 20  ? 0.684   -5.290  15.850  1.00 22.40 ? 19  HIS B CE1 1 
ATOM   146  N NE2 . HIS A 1 20  ? 0.104   -4.435  16.673  1.00 22.37 ? 19  HIS B NE2 1 
ATOM   147  N N   . HIS A 1 21  ? -4.416  -9.065  18.402  1.00 11.84 ? 20  HIS B N   1 
ATOM   148  C CA  . HIS A 1 21  ? -5.583  -9.948  18.427  1.00 13.31 ? 20  HIS B CA  1 
ATOM   149  C C   . HIS A 1 21  ? -6.682  -9.323  19.289  1.00 11.28 ? 20  HIS B C   1 
ATOM   150  O O   . HIS A 1 21  ? -7.878  -9.402  18.962  1.00 11.99 ? 20  HIS B O   1 
ATOM   151  C CB  . HIS A 1 21  ? -5.202  -11.318 18.981  1.00 13.42 ? 20  HIS B CB  1 
ATOM   152  C CG  . HIS A 1 21  ? -4.057  -11.951 18.260  1.00 12.80 ? 20  HIS B CG  1 
ATOM   153  N ND1 . HIS A 1 21  ? -2.743  -11.656 18.563  1.00 12.33 ? 20  HIS B ND1 1 
ATOM   154  C CD2 . HIS A 1 21  ? -4.020  -12.819 17.221  1.00 11.91 ? 20  HIS B CD2 1 
ATOM   155  C CE1 . HIS A 1 21  ? -1.947  -12.346 17.766  1.00 13.01 ? 20  HIS B CE1 1 
ATOM   156  N NE2 . HIS A 1 21  ? -2.697  -13.057 16.939  1.00 12.91 ? 20  HIS B NE2 1 
ATOM   157  N N   . LEU A 1 22  ? -6.269  -8.713  20.403  1.00 12.54 ? 21  LEU B N   1 
ATOM   158  C CA  . LEU A 1 22  ? -7.201  -7.981  21.256  1.00 11.03 ? 21  LEU B CA  1 
ATOM   159  C C   . LEU A 1 22  ? -7.762  -6.753  20.559  1.00 14.71 ? 21  LEU B C   1 
ATOM   160  O O   . LEU A 1 22  ? -8.953  -6.459  20.687  1.00 13.62 ? 21  LEU B O   1 
ATOM   161  C CB  . LEU A 1 22  ? -6.523  -7.604  22.579  1.00 12.67 ? 21  LEU B CB  1 
ATOM   162  C CG  . LEU A 1 22  ? -6.450  -8.788  23.539  1.00 15.16 ? 21  LEU B CG  1 
ATOM   163  C CD1 . LEU A 1 22  ? -5.510  -8.467  24.691  1.00 19.30 ? 21  LEU B CD1 1 
ATOM   164  C CD2 . LEU A 1 22  ? -7.852  -9.092  24.074  1.00 19.64 ? 21  LEU B CD2 1 
ATOM   165  N N   . ARG A 1 23  ? -6.930  -6.050  19.802  1.00 13.03 ? 22  ARG B N   1 
ATOM   166  C CA  . ARG A 1 23  ? -7.422  -4.906  19.041  1.00 15.26 ? 22  ARG B CA  1 
ATOM   167  C C   . ARG A 1 23  ? -8.474  -5.348  18.020  1.00 16.04 ? 22  ARG B C   1 
ATOM   168  O O   . ARG A 1 23  ? -9.513  -4.705  17.864  1.00 16.94 ? 22  ARG B O   1 
ATOM   169  C CB  . ARG A 1 23  ? -6.273  -4.187  18.337  1.00 16.08 ? 22  ARG B CB  1 
ATOM   170  N NE  . ARG A 1 23  ? -4.809  -3.163  15.718  1.00 34.96 ? 22  ARG B NE  1 
ATOM   171  N NH1 . ARG A 1 23  ? -7.177  -4.331  14.480  1.00 31.04 ? 22  ARG B NH1 1 
ATOM   172  N NH2 . ARG A 1 23  ? -4.903  -5.893  14.882  1.00 32.05 ? 22  ARG B NH2 1 
ATOM   173  N N   . THR A 1 24  ? -8.203  -6.454  17.330  1.00 13.19 ? 23  THR B N   1 
ATOM   174  C CA  . THR A 1 24  ? -9.171  -7.032  16.397  1.00 12.18 ? 23  THR B CA  1 
ATOM   175  C C   . THR A 1 24  ? -10.503 -7.353  17.103  1.00 15.58 ? 23  THR B C   1 
ATOM   176  O O   . THR A 1 24  ? -11.586 -7.075  16.575  1.00 15.12 ? 23  THR B O   1 
ATOM   177  C CB  . THR A 1 24  ? -8.602  -8.297  15.746  1.00 11.90 ? 23  THR B CB  1 
ATOM   178  O OG1 . THR A 1 24  ? -7.380  -7.966  15.076  1.00 14.33 ? 23  THR B OG1 1 
ATOM   179  C CG2 . THR A 1 24  ? -9.597  -8.880  14.737  1.00 12.78 ? 23  THR B CG2 1 
ATOM   180  N N   . ALA A 1 25  ? -10.411 -7.919  18.301  1.00 11.71 ? 24  ALA B N   1 
ATOM   181  C CA  . ALA A 1 25  ? -11.600 -8.237  19.090  1.00 10.91 ? 24  ALA B CA  1 
ATOM   182  C C   . ALA A 1 25  ? -12.455 -6.996  19.308  1.00 17.04 ? 24  ALA B C   1 
ATOM   183  O O   . ALA A 1 25  ? -13.671 -7.010  19.102  1.00 17.25 ? 24  ALA B O   1 
ATOM   184  C CB  . ALA A 1 25  ? -11.206 -8.850  20.439  1.00 12.68 ? 24  ALA B CB  1 
ATOM   185  N N   . GLN A 1 26  ? -11.817 -5.913  19.721  1.00 15.65 ? 25  GLN B N   1 
ATOM   186  C CA  . GLN A 1 26  ? -12.578 -4.743  20.117  1.00 19.13 ? 25  GLN B CA  1 
ATOM   187  C C   . GLN A 1 26  ? -13.141 -4.016  18.901  1.00 18.69 ? 25  GLN B C   1 
ATOM   188  O O   . GLN A 1 26  ? -14.222 -3.433  18.962  1.00 21.20 ? 25  GLN B O   1 
ATOM   189  C CB  . GLN A 1 26  ? -11.708 -3.842  20.975  1.00 21.93 ? 25  GLN B CB  1 
ATOM   190  C CG  . GLN A 1 26  ? -11.259 -4.589  22.205  1.00 22.72 ? 25  GLN B CG  1 
ATOM   191  O OE1 . GLN A 1 26  ? -8.981  -2.656  22.735  1.00 41.21 ? 25  GLN B OE1 1 
ATOM   192  N NE2 . GLN A 1 26  ? -10.109 -4.113  24.925  1.00 37.93 ? 25  GLN B NE2 1 
ATOM   193  N N   . GLU A 1 27  ? -12.431 -4.090  17.781  1.00 16.68 ? 26  GLU B N   1 
ATOM   194  C CA  . GLU A 1 27  ? -12.933 -3.486  16.556  1.00 17.73 ? 26  GLU B CA  1 
ATOM   195  C C   . GLU A 1 27  ? -14.145 -4.260  16.033  1.00 21.83 ? 26  GLU B C   1 
ATOM   196  O O   . GLU A 1 27  ? -14.885 -3.752  15.196  1.00 22.35 ? 26  GLU B O   1 
ATOM   197  C CB  . GLU A 1 27  ? -11.826 -3.400  15.502  1.00 19.08 ? 26  GLU B CB  1 
ATOM   198  C CG  . GLU A 1 27  ? -10.744 -2.402  15.879  1.00 24.31 ? 26  GLU B CG  1 
ATOM   199  C CD  . GLU A 1 27  ? -9.606  -2.303  14.869  1.00 28.81 ? 26  GLU B CD  1 
ATOM   200  O OE1 . GLU A 1 27  ? -9.553  -3.114  13.922  1.00 33.06 ? 26  GLU B OE1 1 
ATOM   201  O OE2 . GLU A 1 27  ? -8.751  -1.409  15.044  1.00 31.55 ? 26  GLU B OE2 1 
ATOM   202  N N   . HIS A 1 28  ? -14.382 -5.464  16.552  1.00 19.39 ? 27  HIS B N   1 
ATOM   203  C CA  . HIS A 1 28  ? -15.559 -6.231  16.124  1.00 18.32 ? 27  HIS B CA  1 
ATOM   204  C C   . HIS A 1 28  ? -16.689 -6.323  17.136  1.00 22.71 ? 27  HIS B C   1 
ATOM   205  O O   . HIS A 1 28  ? -17.654 -7.052  16.913  1.00 21.86 ? 27  HIS B O   1 
ATOM   206  C CB  . HIS A 1 28  ? -15.149 -7.644  15.720  1.00 18.45 ? 27  HIS B CB  1 
ATOM   207  C CG  . HIS A 1 28  ? -14.437 -7.698  14.409  1.00 17.54 ? 27  HIS B CG  1 
ATOM   208  N ND1 . HIS A 1 28  ? -13.090 -7.436  14.274  1.00 16.93 ? 27  HIS B ND1 1 
ATOM   209  C CD2 . HIS A 1 28  ? -14.896 -7.954  13.161  1.00 18.56 ? 27  HIS B CD2 1 
ATOM   210  C CE1 . HIS A 1 28  ? -12.751 -7.534  12.999  1.00 20.70 ? 27  HIS B CE1 1 
ATOM   211  N NE2 . HIS A 1 28  ? -13.829 -7.853  12.306  1.00 17.28 ? 27  HIS B NE2 1 
ATOM   212  N N   . ASP A 1 29  ? -16.589 -5.588  18.236  1.00 19.74 ? 28  ASP B N   1 
ATOM   213  C CA  . ASP A 1 29  ? -17.602 -5.671  19.281  1.00 22.87 ? 28  ASP B CA  1 
ATOM   214  C C   . ASP A 1 29  ? -19.005 -5.377  18.781  1.00 21.75 ? 28  ASP B C   1 
ATOM   215  O O   . ASP A 1 29  ? -19.962 -6.013  19.214  1.00 26.02 ? 28  ASP B O   1 
ATOM   216  C CB  . ASP A 1 29  ? -17.252 -4.733  20.427  1.00 20.65 ? 28  ASP B CB  1 
ATOM   217  C CG  . ASP A 1 29  ? -16.189 -5.310  21.324  1.00 23.56 ? 28  ASP B CG  1 
ATOM   218  O OD1 . ASP A 1 29  ? -16.052 -6.548  21.323  1.00 25.13 ? 28  ASP B OD1 1 
ATOM   219  O OD2 . ASP A 1 29  ? -15.492 -4.537  21.997  1.00 25.36 ? 28  ASP B OD2 1 
ATOM   220  N N   . LYS A 1 30  ? -19.122 -4.429  17.863  1.00 24.67 ? 29  LYS B N   1 
ATOM   221  C CA  . LYS A 1 30  ? -20.417 -4.159  17.253  1.00 26.29 ? 29  LYS B CA  1 
ATOM   222  C C   . LYS A 1 30  ? -20.585 -4.934  15.952  1.00 24.82 ? 29  LYS B C   1 
ATOM   223  O O   . LYS A 1 30  ? -21.615 -5.580  15.741  1.00 34.51 ? 29  LYS B O   1 
ATOM   224  C CB  . LYS A 1 30  ? -20.601 -2.658  17.010  1.00 26.87 ? 29  LYS B CB  1 
ATOM   225  C CG  . LYS A 1 30  ? -21.033 -1.883  18.248  1.00 31.14 ? 29  LYS B CG  1 
ATOM   226  N NZ  . LYS A 1 30  ? -22.785 -1.876  21.858  1.00 39.86 ? 29  LYS B NZ  1 
ATOM   227  N N   . ARG A 1 31  ? -19.570 -4.879  15.096  1.00 23.96 ? 30  ARG B N   1 
ATOM   228  C CA  . ARG A 1 31  ? -19.626 -5.468  13.760  1.00 27.60 ? 30  ARG B CA  1 
ATOM   229  C C   . ARG A 1 31  ? -19.906 -6.969  13.734  1.00 27.84 ? 30  ARG B C   1 
ATOM   230  O O   . ARG A 1 31  ? -20.749 -7.437  12.964  1.00 30.39 ? 30  ARG B O   1 
ATOM   231  C CB  . ARG A 1 31  ? -18.315 -5.188  13.019  1.00 27.22 ? 30  ARG B CB  1 
ATOM   232  C CD  . ARG A 1 31  ? -16.273 -3.018  11.263  1.00 43.93 ? 30  ARG B CD  1 
ATOM   233  C CZ  . ARG A 1 31  ? -16.625 -5.492  8.330   1.00 45.49 ? 30  ARG B CZ  1 
ATOM   234  N NH1 . ARG A 1 31  ? -15.573 -4.725  8.586   1.00 48.25 ? 30  ARG B NH1 1 
ATOM   235  N NH2 . ARG A 1 31  ? -16.607 -6.304  7.280   1.00 46.96 ? 30  ARG B NH2 1 
ATOM   236  N N   . ASP A 1 32  ? -19.185 -7.727  14.552  1.00 25.68 ? 31  ASP B N   1 
ATOM   237  C CA  . ASP A 1 32  ? -19.388 -9.172  14.611  1.00 24.75 ? 31  ASP B CA  1 
ATOM   238  C C   . ASP A 1 32  ? -18.949 -9.702  15.962  1.00 19.88 ? 31  ASP B C   1 
ATOM   239  O O   . ASP A 1 32  ? -17.779 -10.050 16.151  1.00 17.62 ? 31  ASP B O   1 
ATOM   240  C CB  . ASP A 1 32  ? -18.642 -9.865  13.465  1.00 19.66 ? 31  ASP B CB  1 
ATOM   241  C CG  . ASP A 1 32  ? -18.902 -11.378 13.402  1.00 16.91 ? 31  ASP B CG  1 
ATOM   242  O OD1 . ASP A 1 32  ? -19.409 -11.970 14.375  1.00 19.92 ? 31  ASP B OD1 1 
ATOM   243  O OD2 . ASP A 1 32  ? -18.687 -11.951 12.322  1.00 19.82 ? 31  ASP B OD2 1 
ATOM   244  N N   . PRO A 1 33  ? -19.891 -9.771  16.913  1.00 18.35 ? 32  PRO B N   1 
ATOM   245  C CA  . PRO A 1 33  ? -19.609 -10.210 18.279  1.00 19.64 ? 32  PRO B CA  1 
ATOM   246  C C   . PRO A 1 33  ? -19.093 -11.637 18.366  1.00 16.14 ? 32  PRO B C   1 
ATOM   247  O O   . PRO A 1 33  ? -18.493 -11.975 19.378  1.00 16.69 ? 32  PRO B O   1 
ATOM   248  C CB  . PRO A 1 33  ? -20.973 -10.094 18.974  1.00 25.80 ? 32  PRO B CB  1 
ATOM   249  C CG  . PRO A 1 33  ? -21.695 -9.063  18.199  1.00 26.39 ? 32  PRO B CG  1 
ATOM   250  C CD  . PRO A 1 33  ? -21.275 -9.276  16.777  1.00 21.45 ? 32  PRO B CD  1 
ATOM   251  N N   . VAL A 1 34  ? -19.333 -12.463 17.348  1.00 14.73 ? 33  VAL B N   1 
ATOM   252  C CA  . VAL A 1 34  ? -18.791 -13.822 17.366  1.00 13.51 ? 33  VAL B CA  1 
ATOM   253  C C   . VAL A 1 34  ? -17.281 -13.744 17.195  1.00 14.76 ? 33  VAL B C   1 
ATOM   254  O O   . VAL A 1 34  ? -16.538 -14.407 17.931  1.00 12.59 ? 33  VAL B O   1 
ATOM   255  C CB  . VAL A 1 34  ? -19.420 -14.715 16.274  1.00 15.89 ? 33  VAL B CB  1 
ATOM   256  C CG1 . VAL A 1 34  ? -18.701 -16.052 16.198  1.00 15.77 ? 33  VAL B CG1 1 
ATOM   257  C CG2 . VAL A 1 34  ? -20.885 -14.953 16.587  1.00 19.36 ? 33  VAL B CG2 1 
ATOM   258  N N   . VAL A 1 35  ? -16.833 -12.927 16.241  1.00 14.66 ? 34  VAL B N   1 
ATOM   259  C CA  . VAL A 1 35  ? -15.401 -12.704 16.046  1.00 13.10 ? 34  VAL B CA  1 
ATOM   260  C C   . VAL A 1 35  ? -14.811 -12.053 17.306  1.00 13.01 ? 34  VAL B C   1 
ATOM   261  O O   . VAL A 1 35  ? -13.738 -12.450 17.772  1.00 13.75 ? 34  VAL B O   1 
ATOM   262  C CB  . VAL A 1 35  ? -15.124 -11.837 14.799  1.00 13.63 ? 34  VAL B CB  1 
ATOM   263  C CG1 . VAL A 1 35  ? -13.617 -11.489 14.682  1.00 13.32 ? 34  VAL B CG1 1 
ATOM   264  C CG2 . VAL A 1 35  ? -15.587 -12.557 13.549  1.00 14.47 ? 34  VAL B CG2 1 
ATOM   265  N N   . ALA A 1 36  ? -15.523 -11.080 17.875  1.00 13.69 ? 35  ALA B N   1 
ATOM   266  C CA  . ALA A 1 36  ? -15.057 -10.401 19.089  1.00 13.11 ? 35  ALA B CA  1 
ATOM   267  C C   . ALA A 1 36  ? -14.834 -11.400 20.218  1.00 14.97 ? 35  ALA B C   1 
ATOM   268  O O   . ALA A 1 36  ? -13.840 -11.328 20.949  1.00 14.60 ? 35  ALA B O   1 
ATOM   269  C CB  . ALA A 1 36  ? -16.056 -9.315  19.522  1.00 16.19 ? 35  ALA B CB  1 
ATOM   270  N N   . TYR A 1 37  ? -15.763 -12.340 20.361  1.00 13.39 ? 36  TYR B N   1 
ATOM   271  C CA  . TYR A 1 37  ? -15.682 -13.340 21.399  1.00 12.17 ? 36  TYR B CA  1 
ATOM   272  C C   . TYR A 1 37  ? -14.483 -14.261 21.183  1.00 11.87 ? 36  TYR B C   1 
ATOM   273  O O   . TYR A 1 37  ? -13.698 -14.477 22.105  1.00 11.09 ? 36  TYR B O   1 
ATOM   274  C CB  . TYR A 1 37  ? -16.985 -14.159 21.474  1.00 12.51 ? 36  TYR B CB  1 
ATOM   275  C CG  . TYR A 1 37  ? -16.919 -15.308 22.458  1.00 9.60  ? 36  TYR B CG  1 
ATOM   276  C CD1 . TYR A 1 37  ? -17.092 -15.093 23.823  1.00 14.02 ? 36  TYR B CD1 1 
ATOM   277  C CD2 . TYR A 1 37  ? -16.644 -16.607 22.028  1.00 11.27 ? 36  TYR B CD2 1 
ATOM   278  C CE1 . TYR A 1 37  ? -17.014 -16.140 24.727  1.00 14.11 ? 36  TYR B CE1 1 
ATOM   279  C CE2 . TYR A 1 37  ? -16.561 -17.656 22.927  1.00 13.03 ? 36  TYR B CE2 1 
ATOM   280  C CZ  . TYR A 1 37  ? -16.760 -17.412 24.283  1.00 13.73 ? 36  TYR B CZ  1 
ATOM   281  O OH  . TYR A 1 37  ? -16.667 -18.467 25.166  1.00 16.83 ? 36  TYR B OH  1 
ATOM   282  N N   . TYR A 1 38  ? -14.343 -14.819 19.985  1.00 10.51 ? 37  TYR B N   1 
ATOM   283  C CA  . TYR A 1 38  ? -13.301 -15.824 19.822  1.00 11.10 ? 37  TYR B CA  1 
ATOM   284  C C   . TYR A 1 38  ? -11.919 -15.205 19.807  1.00 10.11 ? 37  TYR B C   1 
ATOM   285  O O   . TYR A 1 38  ? -10.959 -15.853 20.253  1.00 9.65  ? 37  TYR B O   1 
ATOM   286  C CB  . TYR A 1 38  ? -13.522 -16.693 18.575  1.00 9.11  ? 37  TYR B CB  1 
ATOM   287  C CG  . TYR A 1 38  ? -14.609 -17.713 18.791  1.00 9.36  ? 37  TYR B CG  1 
ATOM   288  C CD1 . TYR A 1 38  ? -14.414 -18.761 19.683  1.00 13.58 ? 37  TYR B CD1 1 
ATOM   289  C CD2 . TYR A 1 38  ? -15.790 -17.683 18.053  1.00 12.39 ? 37  TYR B CD2 1 
ATOM   290  C CE1 . TYR A 1 38  ? -15.388 -19.712 19.897  1.00 13.56 ? 37  TYR B CE1 1 
ATOM   291  C CE2 . TYR A 1 38  ? -16.754 -18.642 18.234  1.00 12.24 ? 37  TYR B CE2 1 
ATOM   292  C CZ  . TYR A 1 38  ? -16.552 -19.653 19.161  1.00 14.47 ? 37  TYR B CZ  1 
ATOM   293  O OH  . TYR A 1 38  ? -17.508 -20.621 19.381  1.00 14.38 ? 37  TYR B OH  1 
ATOM   294  N N   . CYS A 1 39  ? -11.799 -13.957 19.357  1.00 11.91 ? 38  CYS B N   1 
ATOM   295  C CA  . CYS A 1 39  ? -10.501 -13.288 19.472  1.00 10.40 ? 38  CYS B CA  1 
ATOM   296  C C   . CYS A 1 39  ? -10.127 -13.116 20.941  1.00 10.20 ? 38  CYS B C   1 
ATOM   297  O O   . CYS A 1 39  ? -8.970  -13.299 21.310  1.00 10.71 ? 38  CYS B O   1 
ATOM   298  C CB  . CYS A 1 39  ? -10.479 -11.919 18.765  1.00 11.37 ? 38  CYS B CB  1 
ATOM   299  S SG  . CYS A 1 39  ? -10.550 -11.986 16.960  1.00 12.23 ? 38  CYS B SG  1 
ATOM   300  N N   . ARG A 1 40  ? -11.084 -12.757 21.790  1.00 9.41  ? 39  ARG B N   1 
ATOM   301  C CA  . ARG A 1 40  ? -10.794 -12.683 23.217  1.00 9.99  ? 39  ARG B CA  1 
ATOM   302  C C   . ARG A 1 40  ? -10.465 -14.045 23.813  1.00 9.34  ? 39  ARG B C   1 
ATOM   303  O O   . ARG A 1 40  ? -9.656  -14.136 24.745  1.00 12.27 ? 39  ARG B O   1 
ATOM   304  C CB  . ARG A 1 40  ? -11.976 -12.068 23.974  1.00 9.03  ? 39  ARG B CB  1 
ATOM   305  C CG  . ARG A 1 40  ? -12.107 -10.564 23.830  1.00 12.84 ? 39  ARG B CG  1 
ATOM   306  C CD  . ARG A 1 40  ? -13.406 -10.087 24.492  1.00 15.51 ? 39  ARG B CD  1 
ATOM   307  N NE  . ARG A 1 40  ? -13.511 -8.630  24.535  1.00 14.38 ? 39  ARG B NE  1 
ATOM   308  C CZ  . ARG A 1 40  ? -13.952 -7.858  23.543  1.00 14.38 ? 39  ARG B CZ  1 
ATOM   309  N NH1 . ARG A 1 40  ? -14.337 -8.385  22.389  1.00 17.51 ? 39  ARG B NH1 1 
ATOM   310  N NH2 . ARG A 1 40  ? -14.008 -6.545  23.708  1.00 19.70 ? 39  ARG B NH2 1 
ATOM   311  N N   . LEU A 1 41  ? -11.107 -15.092 23.299  1.00 9.47  ? 40  LEU B N   1 
ATOM   312  C CA  . LEU A 1 41  ? -10.915 -16.424 23.840  1.00 9.41  ? 40  LEU B CA  1 
ATOM   313  C C   . LEU A 1 41  ? -9.483  -16.862 23.542  1.00 10.65 ? 40  LEU B C   1 
ATOM   314  O O   . LEU A 1 41  ? -8.802  -17.427 24.399  1.00 10.13 ? 40  LEU B O   1 
ATOM   315  C CB  . LEU A 1 41  ? -11.922 -17.407 23.237  1.00 12.84 ? 40  LEU B CB  1 
ATOM   316  C CG  . LEU A 1 41  ? -11.928 -18.791 23.886  1.00 11.31 ? 40  LEU B CG  1 
ATOM   317  C CD1 . LEU A 1 41  ? -12.529 -18.691 25.281  1.00 15.28 ? 40  LEU B CD1 1 
ATOM   318  C CD2 . LEU A 1 41  ? -12.700 -19.795 23.053  1.00 15.55 ? 40  LEU B CD2 1 
ATOM   319  N N   . TYR A 1 42  ? -9.021  -16.577 22.323  1.00 10.46 ? 41  TYR B N   1 
ATOM   320  C CA  . TYR A 1 42  ? -7.627  -16.821 21.983  1.00 10.49 ? 41  TYR B CA  1 
ATOM   321  C C   . TYR A 1 42  ? -6.663  -16.025 22.851  1.00 12.28 ? 41  TYR B C   1 
ATOM   322  O O   . TYR A 1 42  ? -5.634  -16.554 23.282  1.00 10.82 ? 41  TYR B O   1 
ATOM   323  C CB  . TYR A 1 42  ? -7.383  -16.504 20.503  1.00 11.28 ? 41  TYR B CB  1 
ATOM   324  C CG  . TYR A 1 42  ? -5.910  -16.506 20.135  1.00 10.51 ? 41  TYR B CG  1 
ATOM   325  C CD1 . TYR A 1 42  ? -5.233  -17.688 19.928  1.00 10.86 ? 41  TYR B CD1 1 
ATOM   326  C CD2 . TYR A 1 42  ? -5.217  -15.316 20.009  1.00 10.81 ? 41  TYR B CD2 1 
ATOM   327  C CE1 . TYR A 1 42  ? -3.872  -17.691 19.601  1.00 11.04 ? 41  TYR B CE1 1 
ATOM   328  C CE2 . TYR A 1 42  ? -3.857  -15.303 19.688  1.00 12.89 ? 41  TYR B CE2 1 
ATOM   329  C CZ  . TYR A 1 42  ? -3.203  -16.496 19.482  1.00 11.79 ? 41  TYR B CZ  1 
ATOM   330  O OH  . TYR A 1 42  ? -1.859  -16.486 19.153  1.00 13.18 ? 41  TYR B OH  1 
ATOM   331  N N   . ALA A 1 43  ? -6.964  -14.750 23.061  1.00 10.65 ? 42  ALA B N   1 
ATOM   332  C CA  . ALA A 1 43  ? -6.096  -13.908 23.869  1.00 9.12  ? 42  ALA B CA  1 
ATOM   333  C C   . ALA A 1 43  ? -6.000  -14.476 25.281  1.00 9.75  ? 42  ALA B C   1 
ATOM   334  O O   . ALA A 1 43  ? -4.922  -14.481 25.895  1.00 11.23 ? 42  ALA B O   1 
ATOM   335  C CB  . ALA A 1 43  ? -6.615  -12.464 23.881  1.00 10.63 ? 42  ALA B CB  1 
ATOM   336  N N   . MET A 1 44  ? -7.127  -14.962 25.796  1.00 9.65  ? 43  MET B N   1 
ATOM   337  C CA  . MET A 1 44  ? -7.167  -15.537 27.140  1.00 10.90 ? 43  MET B CA  1 
ATOM   338  C C   . MET A 1 44  ? -6.281  -16.779 27.207  1.00 10.40 ? 43  MET B C   1 
ATOM   339  O O   . MET A 1 44  ? -5.427  -16.893 28.104  1.00 13.86 ? 43  MET B O   1 
ATOM   340  C CB  . MET A 1 44  ? -8.616  -15.883 27.538  1.00 10.85 ? 43  MET B CB  1 
ATOM   341  C CG  . MET A 1 44  ? -8.724  -16.427 28.961  1.00 11.75 ? 43  MET B CG  1 
ATOM   342  S SD  . MET A 1 44  ? -8.534  -15.123 30.206  1.00 12.32 ? 43  MET B SD  1 
ATOM   343  C CE  . MET A 1 44  ? -8.227  -16.136 31.661  1.00 13.42 ? 43  MET B CE  1 
ATOM   344  N N   . GLN A 1 45  ? -6.463  -17.698 26.257  1.00 11.73 ? 44  GLN B N   1 
ATOM   345  C CA  . GLN A 1 45  ? -5.690  -18.935 26.243  1.00 12.77 ? 44  GLN B CA  1 
ATOM   346  C C   . GLN A 1 45  ? -4.191  -18.655 26.131  1.00 15.63 ? 44  GLN B C   1 
ATOM   347  O O   . GLN A 1 45  ? -3.375  -19.274 26.823  1.00 13.76 ? 44  GLN B O   1 
ATOM   348  C CB  . GLN A 1 45  ? -6.145  -19.836 25.094  1.00 17.21 ? 44  GLN B CB  1 
ATOM   349  C CG  . GLN A 1 45  ? -5.508  -21.217 25.134  1.00 20.83 ? 44  GLN B CG  1 
ATOM   350  C CD  . GLN A 1 45  ? -6.171  -22.206 24.193  1.00 30.72 ? 44  GLN B CD  1 
ATOM   351  O OE1 . GLN A 1 45  ? -7.104  -21.863 23.463  1.00 33.88 ? 44  GLN B OE1 1 
ATOM   352  N NE2 . GLN A 1 45  ? -5.725  -23.457 24.245  1.00 35.73 ? 44  GLN B NE2 1 
ATOM   353  N N   . THR A 1 46  ? -3.846  -17.701 25.278  1.00 10.87 ? 45  THR B N   1 
ATOM   354  C CA  . THR A 1 46  ? -2.452  -17.383 24.993  1.00 11.50 ? 45  THR B CA  1 
ATOM   355  C C   . THR A 1 46  ? -1.822  -16.668 26.174  1.00 14.04 ? 45  THR B C   1 
ATOM   356  O O   . THR A 1 46  ? -0.703  -16.974 26.582  1.00 13.36 ? 45  THR B O   1 
ATOM   357  C CB  . THR A 1 46  ? -2.327  -16.511 23.735  1.00 14.36 ? 45  THR B CB  1 
ATOM   358  O OG1 . THR A 1 46  ? -2.947  -17.192 22.640  1.00 15.49 ? 45  THR B OG1 1 
ATOM   359  C CG2 . THR A 1 46  ? -0.856  -16.278 23.397  1.00 15.08 ? 45  THR B CG2 1 
ATOM   360  N N   . GLY A 1 47  ? -2.553  -15.720 26.737  1.00 11.42 ? 46  GLY B N   1 
ATOM   361  C CA  . GLY A 1 47  ? -2.084  -15.032 27.929  1.00 11.97 ? 46  GLY B CA  1 
ATOM   362  C C   . GLY A 1 47  ? -1.828  -15.969 29.095  1.00 15.57 ? 46  GLY B C   1 
ATOM   363  O O   . GLY A 1 47  ? -0.835  -15.814 29.812  1.00 14.12 ? 46  GLY B O   1 
ATOM   364  N N   . MET A 1 48  ? -2.706  -16.950 29.293  1.00 12.88 ? 47  MET B N   1 
ATOM   365  C CA  . MET A 1 48  ? -2.496  -17.919 30.374  1.00 16.00 ? 47  MET B CA  1 
ATOM   366  C C   . MET A 1 48  ? -1.219  -18.726 30.178  1.00 16.19 ? 47  MET B C   1 
ATOM   367  O O   . MET A 1 48  ? -0.547  -19.057 31.161  1.00 24.55 ? 47  MET B O   1 
ATOM   368  C CB  . MET A 1 48  ? -3.675  -18.877 30.497  1.00 17.99 ? 47  MET B CB  1 
ATOM   369  C CG  . MET A 1 48  ? -4.930  -18.216 30.985  1.00 18.33 ? 47  MET B CG  1 
ATOM   370  S SD  . MET A 1 48  ? -6.174  -19.460 31.394  1.00 23.38 ? 47  MET B SD  1 
ATOM   371  C CE  . MET A 1 48  ? -6.535  -20.058 29.776  1.00 17.39 ? 47  MET B CE  1 
ATOM   372  N N   . LYS A 1 49  ? -0.905  -19.052 28.927  1.00 19.03 ? 48  LYS B N   1 
ATOM   373  C CA  . LYS A 1 49  ? 0.336   -19.760 28.584  1.00 17.73 ? 48  LYS B CA  1 
ATOM   374  C C   . LYS A 1 49  ? 1.543   -18.930 28.982  1.00 21.40 ? 48  LYS B C   1 
ATOM   375  O O   . LYS A 1 49  ? 2.554   -19.456 29.452  1.00 23.73 ? 48  LYS B O   1 
ATOM   376  C CB  . LYS A 1 49  ? 0.419   -20.062 27.079  1.00 25.08 ? 48  LYS B CB  1 
ATOM   377  C CG  . LYS A 1 49  ? -0.577  -21.071 26.525  1.00 28.94 ? 48  LYS B CG  1 
ATOM   378  C CD  . LYS A 1 49  ? -0.398  -21.200 25.011  1.00 30.69 ? 48  LYS B CD  1 
ATOM   379  C CE  . LYS A 1 49  ? -1.341  -22.231 24.426  1.00 35.41 ? 48  LYS B CE  1 
ATOM   380  N NZ  . LYS A 1 49  ? -1.200  -22.316 22.945  1.00 39.62 ? 48  LYS B NZ  1 
ATOM   381  N N   . ILE A 1 50  ? 1.438   -17.626 28.776  1.00 16.92 ? 49  ILE B N   1 
ATOM   382  C CA  . ILE A 1 50  ? 2.580   -16.744 28.966  1.00 18.59 ? 49  ILE B CA  1 
ATOM   383  C C   . ILE A 1 50  ? 2.855   -16.483 30.440  1.00 20.77 ? 49  ILE B C   1 
ATOM   384  O O   . ILE A 1 50  ? 3.999   -16.664 30.914  1.00 19.43 ? 49  ILE B O   1 
ATOM   385  C CB  . ILE A 1 50  ? 2.368   -15.405 28.233  1.00 15.17 ? 49  ILE B CB  1 
ATOM   386  C CG1 . ILE A 1 50  ? 2.345   -15.621 26.713  1.00 16.70 ? 49  ILE B CG1 1 
ATOM   387  C CG2 . ILE A 1 50  ? 3.437   -14.399 28.641  1.00 13.63 ? 49  ILE B CG2 1 
ATOM   388  C CD1 . ILE A 1 50  ? 1.894   -14.391 25.928  1.00 18.02 ? 49  ILE B CD1 1 
ATOM   389  N N   . ASP A 1 51  ? 1.814   -16.081 31.167  1.00 15.79 ? 50  ASP B N   1 
ATOM   390  C CA  . ASP A 1 51  ? 1.958   -15.677 32.566  1.00 18.08 ? 50  ASP B CA  1 
ATOM   391  C C   . ASP A 1 51  ? 0.594   -15.430 33.196  1.00 17.58 ? 50  ASP B C   1 
ATOM   392  O O   . ASP A 1 51  ? -0.060  -14.433 32.889  1.00 16.78 ? 50  ASP B O   1 
ATOM   393  C CB  . ASP A 1 51  ? 2.835   -14.420 32.647  1.00 20.12 ? 50  ASP B CB  1 
ATOM   394  C CG  . ASP A 1 51  ? 3.217   -14.037 34.065  1.00 24.91 ? 50  ASP B CG  1 
ATOM   395  O OD1 . ASP A 1 51  ? 2.635   -14.559 35.040  1.00 21.62 ? 50  ASP B OD1 1 
ATOM   396  O OD2 . ASP A 1 51  ? 4.167   -13.234 34.186  1.00 23.41 ? 50  ASP B OD2 1 
ATOM   397  N N   . SER A 1 52  ? 0.168   -16.334 34.075  1.00 17.99 ? 51  SER B N   1 
ATOM   398  C CA  . SER A 1 52  ? -1.086  -16.155 34.777  1.00 15.37 ? 51  SER B CA  1 
ATOM   399  C C   . SER A 1 52  ? -0.876  -15.841 36.253  1.00 19.95 ? 51  SER B C   1 
ATOM   400  O O   . SER A 1 52  ? -1.833  -15.808 37.007  1.00 19.81 ? 51  SER B O   1 
ATOM   401  C CB  . SER A 1 52  ? -1.965  -17.401 34.654  1.00 20.16 ? 51  SER B CB  1 
ATOM   402  O OG  . SER A 1 52  ? -1.392  -18.485 35.363  1.00 24.92 ? 51  SER B OG  1 
ATOM   403  N N   . LYS A 1 53  ? 0.369   -15.611 36.660  1.00 19.97 ? 52  LYS B N   1 
ATOM   404  C CA  . LYS A 1 53  ? 0.662   -15.468 38.088  1.00 20.53 ? 52  LYS B CA  1 
ATOM   405  C C   . LYS A 1 53  ? 1.220   -14.104 38.497  1.00 18.02 ? 52  LYS B C   1 
ATOM   406  O O   . LYS A 1 53  ? 0.932   -13.647 39.599  1.00 21.59 ? 52  LYS B O   1 
ATOM   407  C CB  . LYS A 1 53  ? 1.629   -16.563 38.525  1.00 24.95 ? 52  LYS B CB  1 
ATOM   408  C CG  . LYS A 1 53  ? 0.972   -17.932 38.604  1.00 22.66 ? 52  LYS B CG  1 
ATOM   409  C CD  . LYS A 1 53  ? 1.995   -19.030 38.464  1.00 30.28 ? 52  LYS B CD  1 
ATOM   410  N NZ  . LYS A 1 53  ? -0.948  -20.167 39.553  1.00 38.09 ? 52  LYS B NZ  1 
ATOM   411  N N   . THR A 1 54  ? 2.006   -13.463 37.629  1.00 18.65 ? 53  THR B N   1 
ATOM   412  C CA  . THR A 1 54  ? 2.450   -12.088 37.884  1.00 20.67 ? 53  THR B CA  1 
ATOM   413  C C   . THR A 1 54  ? 1.195   -11.259 38.110  1.00 20.33 ? 53  THR B C   1 
ATOM   414  O O   . THR A 1 54  ? 0.273   -11.344 37.303  1.00 17.56 ? 53  THR B O   1 
ATOM   415  C CB  . THR A 1 54  ? 3.267   -11.516 36.705  1.00 23.46 ? 53  THR B CB  1 
ATOM   416  O OG1 . THR A 1 54  ? 4.433   -12.324 36.486  1.00 24.46 ? 53  THR B OG1 1 
ATOM   417  C CG2 . THR A 1 54  ? 3.706   -10.081 36.993  1.00 26.10 ? 53  THR B CG2 1 
ATOM   418  N N   . PRO A 1 55  ? 1.129   -10.498 39.220  1.00 16.75 ? 54  PRO B N   1 
ATOM   419  C CA  . PRO A 1 55  ? -0.093  -9.788  39.626  1.00 16.38 ? 54  PRO B CA  1 
ATOM   420  C C   . PRO A 1 55  ? -0.793  -9.000  38.501  1.00 15.84 ? 54  PRO B C   1 
ATOM   421  O O   . PRO A 1 55  ? -2.006  -9.134  38.337  1.00 15.84 ? 54  PRO B O   1 
ATOM   422  C CB  . PRO A 1 55  ? 0.410   -8.853  40.730  1.00 20.24 ? 54  PRO B CB  1 
ATOM   423  C CG  . PRO A 1 55  ? 1.519   -9.636  41.351  1.00 16.18 ? 54  PRO B CG  1 
ATOM   424  C CD  . PRO A 1 55  ? 2.214   -10.323 40.206  1.00 16.22 ? 54  PRO B CD  1 
ATOM   425  N N   . GLU A 1 56  ? -0.053  -8.208  37.741  1.00 15.65 ? 55  GLU B N   1 
ATOM   426  C CA  . GLU A 1 56  ? -0.688  -7.422  36.686  1.00 15.90 ? 55  GLU B CA  1 
ATOM   427  C C   . GLU A 1 56  ? -1.292  -8.331  35.632  1.00 16.66 ? 55  GLU B C   1 
ATOM   428  O O   . GLU A 1 56  ? -2.361  -8.030  35.078  1.00 14.86 ? 55  GLU B O   1 
ATOM   429  C CB  . GLU A 1 56  ? 0.314   -6.474  36.041  1.00 19.79 ? 55  GLU B CB  1 
ATOM   430  O OE1 . GLU A 1 56  ? 2.230   -5.146  34.169  1.00 32.05 ? 55  GLU B OE1 1 
ATOM   431  O OE2 . GLU A 1 56  ? 0.144   -3.843  33.380  1.00 22.50 ? 55  GLU B OE2 1 
ATOM   432  N N   . CYS A 1 57  ? -0.604  -9.436  35.353  1.00 15.61 ? 56  CYS B N   1 
ATOM   433  C CA  . CYS A 1 57  ? -1.081  -10.380 34.343  1.00 16.35 ? 56  CYS B CA  1 
ATOM   434  C C   . CYS A 1 57  ? -2.296  -11.143 34.842  1.00 15.04 ? 56  CYS B C   1 
ATOM   435  O O   . CYS A 1 57  ? -3.255  -11.358 34.087  1.00 15.02 ? 56  CYS B O   1 
ATOM   436  C CB  . CYS A 1 57  ? 0.032   -11.354 33.940  1.00 15.54 ? 56  CYS B CB  1 
ATOM   437  S SG  . CYS A 1 57  ? 1.416   -10.580 33.107  1.00 18.97 ? 56  CYS B SG  1 
ATOM   438  N N   . ARG A 1 58  ? -2.254  -11.569 36.103  1.00 15.82 ? 57  ARG B N   1 
ATOM   439  C CA  . ARG A 1 58  ? -3.394  -12.239 36.714  1.00 14.55 ? 57  ARG B CA  1 
ATOM   440  C C   . ARG A 1 58  ? -4.638  -11.350 36.743  1.00 14.86 ? 57  ARG B C   1 
ATOM   441  O O   . ARG A 1 58  ? -5.739  -11.806 36.413  1.00 16.08 ? 57  ARG B O   1 
ATOM   442  C CB  . ARG A 1 58  ? -3.038  -12.704 38.134  1.00 16.61 ? 57  ARG B CB  1 
ATOM   443  C CG  . ARG A 1 58  ? -4.101  -13.576 38.758  1.00 18.16 ? 57  ARG B CG  1 
ATOM   444  N NH2 . ARG A 1 58  ? -3.156  -10.988 42.266  1.00 27.64 ? 57  ARG B NH2 1 
ATOM   445  N N   . LYS A 1 59  ? -4.465  -10.082 37.109  1.00 15.38 ? 58  LYS B N   1 
ATOM   446  C CA  . LYS A 1 59  ? -5.574  -9.140  37.144  1.00 14.83 ? 58  LYS B CA  1 
ATOM   447  C C   . LYS A 1 59  ? -6.149  -8.913  35.744  1.00 15.13 ? 58  LYS B C   1 
ATOM   448  O O   . LYS A 1 59  ? -7.367  -8.867  35.570  1.00 13.75 ? 58  LYS B O   1 
ATOM   449  C CB  . LYS A 1 59  ? -5.133  -7.811  37.763  1.00 15.50 ? 58  LYS B CB  1 
ATOM   450  C CG  . LYS A 1 59  ? -4.774  -7.918  39.247  1.00 21.88 ? 58  LYS B CG  1 
ATOM   451  N NZ  . LYS A 1 59  ? -2.562  -6.228  41.778  1.00 37.49 ? 58  LYS B NZ  1 
ATOM   452  N N   . PHE A 1 60  ? -5.275  -8.768  34.753  1.00 12.70 ? 59  PHE B N   1 
ATOM   453  C CA  . PHE A 1 60  ? -5.743  -8.543  33.393  1.00 11.52 ? 59  PHE B CA  1 
ATOM   454  C C   . PHE A 1 60  ? -6.549  -9.740  32.909  1.00 11.97 ? 59  PHE B C   1 
ATOM   455  O O   . PHE A 1 60  ? -7.629  -9.574  32.330  1.00 12.66 ? 59  PHE B O   1 
ATOM   456  C CB  . PHE A 1 60  ? -4.576  -8.291  32.431  1.00 12.00 ? 59  PHE B CB  1 
ATOM   457  C CG  . PHE A 1 60  ? -5.010  -8.116  31.000  1.00 12.12 ? 59  PHE B CG  1 
ATOM   458  C CD1 . PHE A 1 60  ? -5.411  -6.870  30.530  1.00 10.62 ? 59  PHE B CD1 1 
ATOM   459  C CD2 . PHE A 1 60  ? -5.058  -9.203  30.137  1.00 9.55  ? 59  PHE B CD2 1 
ATOM   460  C CE1 . PHE A 1 60  ? -5.840  -6.720  29.205  1.00 13.25 ? 59  PHE B CE1 1 
ATOM   461  C CE2 . PHE A 1 60  ? -5.502  -9.057  28.828  1.00 12.47 ? 59  PHE B CE2 1 
ATOM   462  C CZ  . PHE A 1 60  ? -5.878  -7.811  28.363  1.00 14.54 ? 59  PHE B CZ  1 
ATOM   463  N N   . LEU A 1 61  ? -6.011  -10.941 33.124  1.00 12.62 ? 60  LEU B N   1 
ATOM   464  C CA  . LEU A 1 61  ? -6.683  -12.158 32.677  1.00 10.58 ? 60  LEU B CA  1 
ATOM   465  C C   . LEU A 1 61  ? -7.985  -12.380 33.429  1.00 12.91 ? 60  LEU B C   1 
ATOM   466  O O   . LEU A 1 61  ? -8.934  -12.934 32.878  1.00 12.36 ? 60  LEU B O   1 
ATOM   467  C CB  . LEU A 1 61  ? -5.774  -13.373 32.834  1.00 10.71 ? 60  LEU B CB  1 
ATOM   468  C CG  . LEU A 1 61  ? -4.560  -13.396 31.907  1.00 12.96 ? 60  LEU B CG  1 
ATOM   469  C CD1 . LEU A 1 61  ? -3.693  -14.587 32.293  1.00 15.22 ? 60  LEU B CD1 1 
ATOM   470  C CD2 . LEU A 1 61  ? -4.997  -13.489 30.444  1.00 13.07 ? 60  LEU B CD2 1 
ATOM   471  N N   . SER A 1 62  ? -8.035  -11.958 34.691  1.00 12.39 ? 61  SER B N   1 
ATOM   472  C CA  . SER A 1 62  ? -9.265  -12.097 35.459  1.00 12.63 ? 61  SER B CA  1 
ATOM   473  C C   . SER A 1 62  ? -10.374 -11.218 34.866  1.00 14.17 ? 61  SER B C   1 
ATOM   474  O O   . SER A 1 62  ? -11.516 -11.656 34.720  1.00 12.90 ? 61  SER B O   1 
ATOM   475  C CB  . SER A 1 62  ? -9.011  -11.759 36.926  1.00 15.22 ? 61  SER B CB  1 
ATOM   476  O OG  . SER A 1 62  ? -10.182 -12.004 37.684  1.00 25.25 ? 61  SER B OG  1 
ATOM   477  N N   . LYS A 1 63  ? -10.030 -9.989  34.494  1.00 12.93 ? 62  LYS B N   1 
ATOM   478  C CA  . LYS A 1 63  ? -10.994 -9.097  33.866  1.00 11.93 ? 62  LYS B CA  1 
ATOM   479  C C   . LYS A 1 63  ? -11.374 -9.589  32.470  1.00 12.56 ? 62  LYS B C   1 
ATOM   480  O O   . LYS A 1 63  ? -12.520 -9.457  32.066  1.00 12.94 ? 62  LYS B O   1 
ATOM   481  C CB  . LYS A 1 63  ? -10.440 -7.670  33.792  1.00 12.27 ? 62  LYS B CB  1 
ATOM   482  C CG  . LYS A 1 63  ? -10.269 -7.003  35.175  1.00 17.26 ? 62  LYS B CG  1 
ATOM   483  C CD  . LYS A 1 63  ? -11.606 -6.737  35.831  1.00 23.48 ? 62  LYS B CD  1 
ATOM   484  C CE  . LYS A 1 63  ? -11.410 -6.032  37.165  1.00 31.21 ? 62  LYS B CE  1 
ATOM   485  N N   . LEU A 1 64  ? -10.416 -10.164 31.751  1.00 11.07 ? 63  LEU B N   1 
ATOM   486  C CA  . LEU A 1 64  ? -10.702 -10.723 30.430  1.00 8.85  ? 63  LEU B CA  1 
ATOM   487  C C   . LEU A 1 64  ? -11.670 -11.894 30.567  1.00 10.00 ? 63  LEU B C   1 
ATOM   488  O O   . LEU A 1 64  ? -12.578 -12.036 29.751  1.00 10.82 ? 63  LEU B O   1 
ATOM   489  C CB  . LEU A 1 64  ? -9.401  -11.144 29.718  1.00 11.56 ? 63  LEU B CB  1 
ATOM   490  C CG  . LEU A 1 64  ? -9.538  -11.777 28.319  1.00 9.51  ? 63  LEU B CG  1 
ATOM   491  C CD1 . LEU A 1 64  ? -10.279 -10.833 27.409  1.00 11.59 ? 63  LEU B CD1 1 
ATOM   492  C CD2 . LEU A 1 64  ? -8.165  -12.067 27.735  1.00 10.98 ? 63  LEU B CD2 1 
ATOM   493  N N   . MET A 1 65  ? -11.489 -12.712 31.600  1.00 11.72 ? 64  MET B N   1 
ATOM   494  C CA  . MET A 1 65  ? -12.385 -13.838 31.806  1.00 12.89 ? 64  MET B CA  1 
ATOM   495  C C   . MET A 1 65  ? -13.776 -13.346 32.195  1.00 12.93 ? 64  MET B C   1 
ATOM   496  O O   . MET A 1 65  ? -14.762 -13.862 31.676  1.00 13.85 ? 64  MET B O   1 
ATOM   497  C CB  . MET A 1 65  ? -11.820 -14.802 32.841  1.00 13.40 ? 64  MET B CB  1 
ATOM   498  C CG  . MET A 1 65  ? -12.714 -16.003 33.122  1.00 13.54 ? 64  MET B CG  1 
ATOM   499  S SD  . MET A 1 65  ? -13.138 -16.977 31.658  1.00 19.81 ? 64  MET B SD  1 
ATOM   500  C CE  . MET A 1 65  ? -11.500 -17.468 31.259  1.00 11.12 ? 64  MET B CE  1 
ATOM   501  N N   . ASP A 1 66  ? -13.861 -12.331 33.059  1.00 13.09 ? 65  ASP B N   1 
ATOM   502  C CA  . ASP A 1 66  ? -15.154 -11.702 33.343  1.00 14.09 ? 65  ASP B CA  1 
ATOM   503  C C   . ASP A 1 66  ? -15.879 -11.295 32.061  1.00 15.60 ? 65  ASP B C   1 
ATOM   504  O O   . ASP A 1 66  ? -17.090 -11.473 31.909  1.00 14.14 ? 65  ASP B O   1 
ATOM   505  C CB  . ASP A 1 66  ? -14.985 -10.447 34.220  1.00 13.35 ? 65  ASP B CB  1 
ATOM   506  C CG  . ASP A 1 66  ? -14.580 -10.760 35.654  1.00 19.99 ? 65  ASP B CG  1 
ATOM   507  O OD1 . ASP A 1 66  ? -14.725 -11.910 36.120  1.00 18.08 ? 65  ASP B OD1 1 
ATOM   508  O OD2 . ASP A 1 66  ? -14.108 -9.820  36.321  1.00 17.79 ? 65  ASP B OD2 1 
ATOM   509  N N   . GLN A 1 67  ? -15.125 -10.696 31.153  1.00 13.17 ? 66  GLN B N   1 
ATOM   510  C CA  . GLN A 1 67  ? -15.685 -10.157 29.932  1.00 14.94 ? 66  GLN B CA  1 
ATOM   511  C C   . GLN A 1 67  ? -16.095 -11.297 28.992  1.00 12.45 ? 66  GLN B C   1 
ATOM   512  O O   . GLN A 1 67  ? -17.193 -11.256 28.404  1.00 13.64 ? 66  GLN B O   1 
ATOM   513  C CB  . GLN A 1 67  ? -14.669 -9.167  29.342  1.00 17.08 ? 66  GLN B CB  1 
ATOM   514  C CG  . GLN A 1 67  ? -14.951 -8.568  28.003  1.00 19.59 ? 66  GLN B CG  1 
ATOM   515  C CD  . GLN A 1 67  ? -14.238 -7.231  27.828  1.00 17.82 ? 66  GLN B CD  1 
ATOM   516  O OE1 . GLN A 1 67  ? -14.326 -6.341  28.684  1.00 22.47 ? 66  GLN B OE1 1 
ATOM   517  N NE2 . GLN A 1 67  ? -13.368 -7.175  26.849  1.00 15.54 ? 66  GLN B NE2 1 
ATOM   518  N N   . LEU A 1 68  ? -15.266 -12.342 28.906  1.00 10.76 ? 67  LEU B N   1 
ATOM   519  C CA  . LEU A 1 68  ? -15.642 -13.533 28.134  1.00 10.60 ? 67  LEU B CA  1 
ATOM   520  C C   . LEU A 1 68  ? -16.928 -14.191 28.644  1.00 11.71 ? 67  LEU B C   1 
ATOM   521  O O   . LEU A 1 68  ? -17.771 -14.579 27.841  1.00 13.49 ? 67  LEU B O   1 
ATOM   522  C CB  . LEU A 1 68  ? -14.514 -14.566 28.127  1.00 13.92 ? 67  LEU B CB  1 
ATOM   523  C CG  . LEU A 1 68  ? -13.349 -14.282 27.181  1.00 10.41 ? 67  LEU B CG  1 
ATOM   524  C CD1 . LEU A 1 68  ? -12.202 -15.181 27.551  1.00 12.94 ? 67  LEU B CD1 1 
ATOM   525  C CD2 . LEU A 1 68  ? -13.801 -14.620 25.768  1.00 12.74 ? 67  LEU B CD2 1 
ATOM   526  N N   . GLU A 1 69  ? -17.054 -14.333 29.961  1.00 13.71 ? 68  GLU B N   1 
ATOM   527  C CA  . GLU A 1 69  ? -18.226 -14.960 30.555  1.00 14.23 ? 68  GLU B CA  1 
ATOM   528  C C   . GLU A 1 69  ? -19.462 -14.117 30.261  1.00 15.24 ? 68  GLU B C   1 
ATOM   529  O O   . GLU A 1 69  ? -20.515 -14.651 29.909  1.00 17.01 ? 68  GLU B O   1 
ATOM   530  C CB  . GLU A 1 69  ? -18.009 -15.164 32.059  1.00 15.60 ? 68  GLU B CB  1 
ATOM   531  C CG  . GLU A 1 69  ? -16.998 -16.270 32.349  1.00 15.79 ? 68  GLU B CG  1 
ATOM   532  C CD  . GLU A 1 69  ? -16.535 -16.342 33.787  1.00 15.82 ? 68  GLU B CD  1 
ATOM   533  O OE1 . GLU A 1 69  ? -16.879 -15.431 34.587  1.00 17.45 ? 68  GLU B OE1 1 
ATOM   534  O OE2 . GLU A 1 69  ? -15.817 -17.310 34.117  1.00 17.39 ? 68  GLU B OE2 1 
ATOM   535  N N   . ALA A 1 70  ? -19.322 -12.795 30.351  1.00 15.22 ? 69  ALA B N   1 
ATOM   536  C CA  . ALA A 1 70  ? -20.431 -11.899 30.065  1.00 13.50 ? 69  ALA B CA  1 
ATOM   537  C C   . ALA A 1 70  ? -20.811 -11.936 28.596  1.00 16.24 ? 69  ALA B C   1 
ATOM   538  O O   . ALA A 1 70  ? -21.981 -11.964 28.248  1.00 16.53 ? 69  ALA B O   1 
ATOM   539  C CB  . ALA A 1 70  ? -20.094 -10.464 30.482  1.00 14.51 ? 69  ALA B CB  1 
ATOM   540  N N   . LEU A 1 71  ? -19.806 -11.942 27.734  1.00 12.74 ? 70  LEU B N   1 
ATOM   541  C CA  . LEU A 1 71  ? -20.056 -11.901 26.313  1.00 13.43 ? 70  LEU B CA  1 
ATOM   542  C C   . LEU A 1 71  ? -20.676 -13.221 25.850  1.00 15.53 ? 70  LEU B C   1 
ATOM   543  O O   . LEU A 1 71  ? -21.588 -13.211 25.025  1.00 17.42 ? 70  LEU B O   1 
ATOM   544  C CB  . LEU A 1 71  ? -18.760 -11.571 25.553  1.00 14.77 ? 70  LEU B CB  1 
ATOM   545  C CG  . LEU A 1 71  ? -18.825 -11.466 24.037  1.00 16.68 ? 70  LEU B CG  1 
ATOM   546  C CD1 . LEU A 1 71  ? -19.902 -10.461 23.629  1.00 18.83 ? 70  LEU B CD1 1 
ATOM   547  C CD2 . LEU A 1 71  ? -17.463 -11.007 23.504  1.00 19.95 ? 70  LEU B CD2 1 
ATOM   548  N N   . LYS A 1 72  ? -20.217 -14.348 26.387  1.00 14.80 ? 71  LYS B N   1 
ATOM   549  C CA  . LYS A 1 72  ? -20.823 -15.630 26.016  1.00 16.70 ? 71  LYS B CA  1 
ATOM   550  C C   . LYS A 1 72  ? -22.299 -15.666 26.413  1.00 20.19 ? 71  LYS B C   1 
ATOM   551  O O   . LYS A 1 72  ? -23.158 -16.075 25.622  1.00 22.48 ? 71  LYS B O   1 
ATOM   552  C CB  . LYS A 1 72  ? -20.080 -16.797 26.652  1.00 20.71 ? 71  LYS B CB  1 
ATOM   553  C CG  . LYS A 1 72  ? -20.532 -18.157 26.118  1.00 18.43 ? 71  LYS B CG  1 
ATOM   554  C CD  . LYS A 1 72  ? -19.893 -19.288 26.905  1.00 24.07 ? 71  LYS B CD  1 
ATOM   555  N NZ  . LYS A 1 72  ? -20.198 -22.286 26.154  1.00 35.08 ? 71  LYS B NZ  1 
ATOM   556  N N   . LYS A 1 73  ? -22.589 -15.219 27.632  1.00 18.07 ? 72  LYS B N   1 
ATOM   557  C CA  . LYS A 1 73  ? -23.972 -15.113 28.081  1.00 16.46 ? 72  LYS B CA  1 
ATOM   558  C C   . LYS A 1 73  ? -24.807 -14.238 27.141  1.00 17.46 ? 72  LYS B C   1 
ATOM   559  O O   . LYS A 1 73  ? -25.913 -14.621 26.751  1.00 20.17 ? 72  LYS B O   1 
ATOM   560  C CB  . LYS A 1 73  ? -24.037 -14.559 29.508  1.00 18.40 ? 72  LYS B CB  1 
ATOM   561  C CG  . LYS A 1 73  ? -25.460 -14.370 29.960  1.00 19.93 ? 72  LYS B CG  1 
ATOM   562  C CD  . LYS A 1 73  ? -25.567 -13.729 31.308  1.00 23.79 ? 72  LYS B CD  1 
ATOM   563  C CE  . LYS A 1 73  ? -25.185 -14.696 32.391  1.00 26.40 ? 72  LYS B CE  1 
ATOM   564  N NZ  . LYS A 1 73  ? -25.413 -14.053 33.710  1.00 26.65 ? 72  LYS B NZ  1 
ATOM   565  N N   . GLN A 1 74  ? -24.274 -13.084 26.754  1.00 17.58 ? 73  GLN B N   1 
ATOM   566  C CA  . GLN A 1 74  ? -25.036 -12.131 25.939  1.00 15.39 ? 73  GLN B CA  1 
ATOM   567  C C   . GLN A 1 74  ? -25.257 -12.604 24.499  1.00 22.57 ? 73  GLN B C   1 
ATOM   568  O O   . GLN A 1 74  ? -26.267 -12.274 23.868  1.00 20.42 ? 73  GLN B O   1 
ATOM   569  C CB  . GLN A 1 74  ? -24.329 -10.788 25.880  1.00 22.23 ? 73  GLN B CB  1 
ATOM   570  C CG  . GLN A 1 74  ? -25.253 -9.643  25.542  1.00 25.39 ? 73  GLN B CG  1 
ATOM   571  C CD  . GLN A 1 74  ? -24.511 -8.339  25.351  1.00 25.95 ? 73  GLN B CD  1 
ATOM   572  O OE1 . GLN A 1 74  ? -23.345 -8.327  24.958  1.00 29.31 ? 73  GLN B OE1 1 
ATOM   573  N NE2 . GLN A 1 74  ? -25.125 -7.249  25.796  1.00 25.32 ? 73  GLN B NE2 1 
ATOM   574  N N   . LEU A 1 75  ? -24.295 -13.344 23.965  1.00 19.51 ? 74  LEU B N   1 
ATOM   575  C CA  . LEU A 1 75  ? -24.442 -13.892 22.614  1.00 19.74 ? 74  LEU B CA  1 
ATOM   576  C C   . LEU A 1 75  ? -25.614 -14.855 22.548  1.00 22.78 ? 74  LEU B C   1 
ATOM   577  O O   . LEU A 1 75  ? -26.180 -15.087 21.469  1.00 21.70 ? 74  LEU B O   1 
ATOM   578  C CB  . LEU A 1 75  ? -23.142 -14.573 22.165  1.00 18.37 ? 74  LEU B CB  1 
ATOM   579  C CG  . LEU A 1 75  ? -22.088 -13.573 21.702  1.00 20.30 ? 74  LEU B CG  1 
ATOM   580  C CD1 . LEU A 1 75  ? -20.735 -14.237 21.636  1.00 15.19 ? 74  LEU B CD1 1 
ATOM   581  C CD2 . LEU A 1 75  ? -22.481 -13.088 20.311  1.00 23.77 ? 74  LEU B CD2 1 
ATOM   582  N N   . GLY A 1 76  ? -25.958 -15.399 23.711  1.00 25.20 ? 75  GLY B N   1 
ATOM   583  C CA  . GLY A 1 76  ? -27.138 -16.221 23.898  1.00 28.39 ? 75  GLY B CA  1 
ATOM   584  C C   . GLY A 1 76  ? -27.209 -17.417 22.976  1.00 33.43 ? 75  GLY B C   1 
ATOM   585  O O   . GLY A 1 76  ? -26.294 -18.247 22.931  1.00 30.61 ? 75  GLY B O   1 
ATOM   586  N N   . ASP A 1 77  ? -28.301 -17.481 22.224  1.00 26.40 ? 76  ASP B N   1 
ATOM   587  C CA  . ASP A 1 77  ? -28.636 -18.659 21.449  1.00 28.93 ? 76  ASP B CA  1 
ATOM   588  C C   . ASP A 1 77  ? -28.006 -18.562 20.067  1.00 28.88 ? 76  ASP B C   1 
ATOM   589  O O   . ASP A 1 77  ? -28.703 -18.536 19.047  1.00 30.37 ? 76  ASP B O   1 
ATOM   590  C CB  . ASP A 1 77  ? -30.153 -18.792 21.330  1.00 29.29 ? 76  ASP B CB  1 
ATOM   591  C CG  . ASP A 1 77  ? -30.579 -20.170 20.912  1.00 36.72 ? 76  ASP B CG  1 
ATOM   592  O OD1 . ASP A 1 77  ? -29.722 -21.082 20.943  1.00 38.12 ? 76  ASP B OD1 1 
ATOM   593  O OD2 . ASP A 1 77  ? -31.761 -20.337 20.540  1.00 31.01 ? 76  ASP B OD2 1 
ATOM   594  N N   . ASN A 1 78  ? -26.679 -18.493 20.035  1.00 20.21 ? 77  ASN B N   1 
ATOM   595  C CA  . ASN A 1 78  ? -25.972 -18.288 18.787  1.00 20.32 ? 77  ASN B CA  1 
ATOM   596  C C   . ASN A 1 78  ? -25.242 -19.559 18.359  1.00 17.67 ? 77  ASN B C   1 
ATOM   597  O O   . ASN A 1 78  ? -24.432 -20.105 19.094  1.00 16.90 ? 77  ASN B O   1 
ATOM   598  C CB  . ASN A 1 78  ? -25.024 -17.089 18.934  1.00 19.67 ? 77  ASN B CB  1 
ATOM   599  C CG  . ASN A 1 78  ? -24.359 -16.683 17.632  1.00 18.58 ? 77  ASN B CG  1 
ATOM   600  O OD1 . ASN A 1 78  ? -23.891 -17.519 16.852  1.00 19.19 ? 77  ASN B OD1 1 
ATOM   601  N ND2 . ASN A 1 78  ? -24.404 -15.391 17.341  1.00 19.95 ? 77  ASN B ND2 1 
ATOM   602  N N   . GLU A 1 79  ? -25.560 -20.022 17.154  1.00 18.80 ? 78  GLU B N   1 
ATOM   603  C CA  . GLU A 1 79  ? -25.055 -21.287 16.629  1.00 16.75 ? 78  GLU B CA  1 
ATOM   604  C C   . GLU A 1 79  ? -23.536 -21.345 16.612  1.00 15.01 ? 78  GLU B C   1 
ATOM   605  O O   . GLU A 1 79  ? -22.934 -22.398 16.821  1.00 14.53 ? 78  GLU B O   1 
ATOM   606  C CB  . GLU A 1 79  ? -25.571 -21.493 15.201  1.00 18.64 ? 78  GLU B CB  1 
ATOM   607  C CG  . GLU A 1 79  ? -25.301 -22.872 14.649  1.00 23.94 ? 78  GLU B CG  1 
ATOM   608  C CD  . GLU A 1 79  ? -25.675 -23.003 13.188  1.00 24.34 ? 78  GLU B CD  1 
ATOM   609  O OE1 . GLU A 1 79  ? -25.769 -21.963 12.487  1.00 21.87 ? 78  GLU B OE1 1 
ATOM   610  O OE2 . GLU A 1 79  ? -25.940 -24.154 12.766  1.00 23.99 ? 78  GLU B OE2 1 
ATOM   611  N N   . ALA A 1 80  ? -22.918 -20.204 16.351  1.00 14.93 ? 79  ALA B N   1 
ATOM   612  C CA  . ALA A 1 80  ? -21.466 -20.149 16.225  1.00 12.38 ? 79  ALA B CA  1 
ATOM   613  C C   . ALA A 1 80  ? -20.791 -20.226 17.595  1.00 14.65 ? 79  ALA B C   1 
ATOM   614  O O   . ALA A 1 80  ? -19.574 -20.378 17.695  1.00 15.12 ? 79  ALA B O   1 
ATOM   615  C CB  . ALA A 1 80  ? -21.046 -18.873 15.491  1.00 13.76 ? 79  ALA B CB  1 
ATOM   616  N N   . ILE A 1 81  ? -21.583 -20.108 18.652  1.00 15.23 ? 80  ILE B N   1 
ATOM   617  C CA  . ILE A 1 81  ? -21.059 -20.177 20.015  1.00 17.93 ? 80  ILE B CA  1 
ATOM   618  C C   . ILE A 1 81  ? -21.399 -21.523 20.650  1.00 18.26 ? 80  ILE B C   1 
ATOM   619  O O   . ILE A 1 81  ? -20.575 -22.121 21.348  1.00 22.45 ? 80  ILE B O   1 
ATOM   620  C CB  . ILE A 1 81  ? -21.618 -19.030 20.885  1.00 16.50 ? 80  ILE B CB  1 
ATOM   621  C CG1 . ILE A 1 81  ? -21.298 -17.676 20.258  1.00 16.24 ? 80  ILE B CG1 1 
ATOM   622  C CG2 . ILE A 1 81  ? -21.068 -19.107 22.314  1.00 21.75 ? 80  ILE B CG2 1 
ATOM   623  C CD1 . ILE A 1 81  ? -19.774 -17.438 20.119  1.00 16.31 ? 80  ILE B CD1 1 
ATOM   624  N N   . THR A 1 82  ? -22.613 -22.007 20.387  1.00 18.73 ? 81  THR B N   1 
ATOM   625  C CA  . THR A 1 82  ? -23.056 -23.285 20.929  1.00 22.37 ? 81  THR B CA  1 
ATOM   626  C C   . THR A 1 82  ? -22.416 -24.464 20.202  1.00 21.68 ? 81  THR B C   1 
ATOM   627  O O   . THR A 1 82  ? -22.251 -25.530 20.780  1.00 24.16 ? 81  THR B O   1 
ATOM   628  C CB  . THR A 1 82  ? -24.594 -23.433 20.862  1.00 19.73 ? 81  THR B CB  1 
ATOM   629  O OG1 . THR A 1 82  ? -25.021 -23.378 19.496  1.00 24.00 ? 81  THR B OG1 1 
ATOM   630  C CG2 . THR A 1 82  ? -25.273 -22.310 21.632  1.00 22.28 ? 81  THR B CG2 1 
ATOM   631  N N   . GLN A 1 83  ? -22.057 -24.271 18.933  1.00 17.46 ? 82  GLN B N   1 
ATOM   632  C CA  . GLN A 1 83  ? -21.432 -25.324 18.149  1.00 17.28 ? 82  GLN B CA  1 
ATOM   633  C C   . GLN A 1 83  ? -20.037 -24.908 17.720  1.00 18.89 ? 82  GLN B C   1 
ATOM   634  O O   . GLN A 1 83  ? -19.891 -24.035 16.867  1.00 15.83 ? 82  GLN B O   1 
ATOM   635  C CB  . GLN A 1 83  ? -22.279 -25.650 16.915  1.00 19.84 ? 82  GLN B CB  1 
ATOM   636  C CG  . GLN A 1 83  ? -23.761 -25.788 17.214  1.00 23.41 ? 82  GLN B CG  1 
ATOM   637  C CD  . GLN A 1 83  ? -24.100 -27.099 17.891  1.00 28.36 ? 82  GLN B CD  1 
ATOM   638  O OE1 . GLN A 1 83  ? -23.299 -28.033 17.894  1.00 35.68 ? 82  GLN B OE1 1 
ATOM   639  N N   . GLU A 1 84  ? -19.031 -25.529 18.327  1.00 18.26 ? 83  GLU B N   1 
ATOM   640  C CA  . GLU A 1 84  ? -17.627 -25.244 18.024  1.00 16.99 ? 83  GLU B CA  1 
ATOM   641  C C   . GLU A 1 84  ? -17.301 -25.363 16.540  1.00 15.49 ? 83  GLU B C   1 
ATOM   642  O O   . GLU A 1 84  ? -16.522 -24.574 16.020  1.00 16.07 ? 83  GLU B O   1 
ATOM   643  C CB  . GLU A 1 84  ? -16.707 -26.178 18.820  1.00 22.21 ? 83  GLU B CB  1 
ATOM   644  O OE1 . GLU A 1 84  ? -14.601 -25.589 21.896  1.00 46.25 ? 83  GLU B OE1 1 
ATOM   645  O OE2 . GLU A 1 84  ? -15.005 -28.040 20.525  1.00 46.06 ? 83  GLU B OE2 1 
ATOM   646  N N   . ILE A 1 85  ? -17.884 -26.350 15.854  1.00 15.27 ? 84  ILE B N   1 
ATOM   647  C CA  . ILE A 1 85  ? -17.602 -26.552 14.435  1.00 14.40 ? 84  ILE B CA  1 
ATOM   648  C C   . ILE A 1 85  ? -18.030 -25.319 13.643  1.00 13.02 ? 84  ILE B C   1 
ATOM   649  O O   . ILE A 1 85  ? -17.301 -24.850 12.767  1.00 12.97 ? 84  ILE B O   1 
ATOM   650  C CB  . ILE A 1 85  ? -18.307 -27.815 13.898  1.00 17.53 ? 84  ILE B CB  1 
ATOM   651  C CG1 . ILE A 1 85  ? -17.737 -29.061 14.589  1.00 20.64 ? 84  ILE B CG1 1 
ATOM   652  C CG2 . ILE A 1 85  ? -18.175 -27.906 12.380  1.00 20.27 ? 84  ILE B CG2 1 
ATOM   653  C CD1 . ILE A 1 85  ? -18.573 -30.304 14.423  1.00 25.33 ? 84  ILE B CD1 1 
ATOM   654  N N   . VAL A 1 86  ? -19.192 -24.774 13.982  1.00 11.18 ? 85  VAL B N   1 
ATOM   655  C CA  . VAL A 1 86  ? -19.681 -23.578 13.321  1.00 11.26 ? 85  VAL B CA  1 
ATOM   656  C C   . VAL A 1 86  ? -18.847 -22.346 13.701  1.00 13.10 ? 85  VAL B C   1 
ATOM   657  O O   . VAL A 1 86  ? -18.556 -21.506 12.847  1.00 12.25 ? 85  VAL B O   1 
ATOM   658  C CB  . VAL A 1 86  ? -21.181 -23.347 13.637  1.00 13.15 ? 85  VAL B CB  1 
ATOM   659  C CG1 . VAL A 1 86  ? -21.675 -22.052 13.005  1.00 13.68 ? 85  VAL B CG1 1 
ATOM   660  C CG2 . VAL A 1 86  ? -22.000 -24.550 13.162  1.00 14.57 ? 85  VAL B CG2 1 
ATOM   661  N N   . GLY A 1 87  ? -18.447 -22.234 14.968  1.00 12.00 ? 86  GLY B N   1 
ATOM   662  C CA  . GLY A 1 87  ? -17.622 -21.107 15.371  1.00 11.32 ? 86  GLY B CA  1 
ATOM   663  C C   . GLY A 1 87  ? -16.303 -21.072 14.621  1.00 11.62 ? 86  GLY B C   1 
ATOM   664  O O   . GLY A 1 87  ? -15.849 -20.001 14.167  1.00 9.98  ? 86  GLY B O   1 
ATOM   665  N N   . CYS A 1 88  ? -15.680 -22.238 14.496  1.00 11.06 ? 87  CYS B N   1 
ATOM   666  C CA  . CYS A 1 88  ? -14.428 -22.327 13.758  1.00 12.70 ? 87  CYS B CA  1 
ATOM   667  C C   . CYS A 1 88  ? -14.631 -21.939 12.289  1.00 11.54 ? 87  CYS B C   1 
ATOM   668  O O   . CYS A 1 88  ? -13.848 -21.168 11.741  1.00 11.76 ? 87  CYS B O   1 
ATOM   669  C CB  . CYS A 1 88  ? -13.847 -23.727 13.865  1.00 13.68 ? 87  CYS B CB  1 
ATOM   670  S SG  . CYS A 1 88  ? -12.194 -23.872 13.172  1.00 16.74 ? 87  CYS B SG  1 
ATOM   671  N N   . ALA A 1 89  ? -15.684 -22.462 11.663  1.00 11.99 ? 88  ALA B N   1 
ATOM   672  C CA  . ALA A 1 89  ? -15.948 -22.130 10.263  1.00 12.10 ? 88  ALA B CA  1 
ATOM   673  C C   . ALA A 1 89  ? -16.243 -20.647 10.098  1.00 9.32  ? 88  ALA B C   1 
ATOM   674  O O   . ALA A 1 89  ? -15.808 -20.028 9.128   1.00 11.02 ? 88  ALA B O   1 
ATOM   675  C CB  . ALA A 1 89  ? -17.098 -22.961 9.724   1.00 11.95 ? 88  ALA B CB  1 
ATOM   676  N N   . HIS A 1 90  ? -16.965 -20.066 11.059  1.00 9.47  ? 89  HIS B N   1 
ATOM   677  C CA  . HIS A 1 90  ? -17.299 -18.654 10.968  1.00 8.87  ? 89  HIS B CA  1 
ATOM   678  C C   . HIS A 1 90  ? -16.028 -17.795 10.911  1.00 11.61 ? 89  HIS B C   1 
ATOM   679  O O   . HIS A 1 90  ? -15.882 -16.922 10.046  1.00 10.80 ? 89  HIS B O   1 
ATOM   680  C CB  . HIS A 1 90  ? -18.169 -18.221 12.157  1.00 11.25 ? 89  HIS B CB  1 
ATOM   681  C CG  . HIS A 1 90  ? -18.657 -16.811 12.047  1.00 11.86 ? 89  HIS B CG  1 
ATOM   682  N ND1 . HIS A 1 90  ? -19.699 -16.448 11.222  1.00 21.14 ? 89  HIS B ND1 1 
ATOM   683  C CD2 . HIS A 1 90  ? -18.184 -15.664 12.584  1.00 13.18 ? 89  HIS B CD2 1 
ATOM   684  C CE1 . HIS A 1 90  ? -19.888 -15.141 11.307  1.00 23.16 ? 89  HIS B CE1 1 
ATOM   685  N NE2 . HIS A 1 90  ? -18.979 -14.640 12.124  1.00 16.26 ? 89  HIS B NE2 1 
ATOM   686  N N   . LEU A 1 91  ? -15.099 -18.057 11.827  1.00 11.77 ? 90  LEU B N   1 
ATOM   687  C CA  . LEU A 1 91  ? -13.849 -17.322 11.839  1.00 11.38 ? 90  LEU B CA  1 
ATOM   688  C C   . LEU A 1 91  ? -12.974 -17.632 10.628  1.00 12.53 ? 90  LEU B C   1 
ATOM   689  O O   . LEU A 1 91  ? -12.396 -16.729 10.043  1.00 12.39 ? 90  LEU B O   1 
ATOM   690  C CB  . LEU A 1 91  ? -13.094 -17.607 13.129  1.00 13.18 ? 90  LEU B CB  1 
ATOM   691  C CG  . LEU A 1 91  ? -13.391 -16.559 14.201  1.00 17.57 ? 90  LEU B CG  1 
ATOM   692  C CD1 . LEU A 1 91  ? -14.859 -16.556 14.648  1.00 14.20 ? 90  LEU B CD1 1 
ATOM   693  C CD2 . LEU A 1 91  ? -12.491 -16.839 15.333  1.00 26.62 ? 90  LEU B CD2 1 
ATOM   694  N N   . GLU A 1 92  ? -12.908 -18.901 10.239  1.00 10.64 ? 91  GLU B N   1 
ATOM   695  C CA  . GLU A 1 92  ? -12.080 -19.315 9.101   1.00 9.96  ? 91  GLU B CA  1 
ATOM   696  C C   . GLU A 1 92  ? -12.600 -18.656 7.831   1.00 12.90 ? 91  GLU B C   1 
ATOM   697  O O   . GLU A 1 92  ? -11.831 -18.159 7.004   1.00 11.32 ? 91  GLU B O   1 
ATOM   698  C CB  . GLU A 1 92  ? -12.134 -20.833 8.963   1.00 13.90 ? 91  GLU B CB  1 
ATOM   699  C CG  . GLU A 1 92  ? -10.978 -21.454 8.234   1.00 20.67 ? 91  GLU B CG  1 
ATOM   700  C CD  . GLU A 1 92  ? -11.049 -22.967 8.287   1.00 26.97 ? 91  GLU B CD  1 
ATOM   701  O OE1 . GLU A 1 92  ? -12.161 -23.533 8.288   1.00 24.42 ? 91  GLU B OE1 1 
ATOM   702  O OE2 . GLU A 1 92  ? -9.993  -23.584 8.508   1.00 24.28 ? 91  GLU B OE2 1 
ATOM   703  N N   . ASN A 1 93  ? -13.921 -18.642 7.691   1.00 11.45 ? 92  ASN B N   1 
ATOM   704  C CA  . ASN A 1 93  ? -14.510 -18.063 6.499   1.00 10.99 ? 92  ASN B CA  1 
ATOM   705  C C   . ASN A 1 93  ? -14.444 -16.545 6.476   1.00 10.56 ? 92  ASN B C   1 
ATOM   706  O O   . ASN A 1 93  ? -14.361 -15.966 5.408   1.00 11.36 ? 92  ASN B O   1 
ATOM   707  C CB  . ASN A 1 93  ? -15.964 -18.521 6.312   1.00 10.09 ? 92  ASN B CB  1 
ATOM   708  C CG  . ASN A 1 93  ? -16.068 -20.000 6.012   1.00 11.51 ? 92  ASN B CG  1 
ATOM   709  O OD1 . ASN A 1 93  ? -17.134 -20.618 6.171   1.00 13.42 ? 92  ASN B OD1 1 
ATOM   710  N ND2 . ASN A 1 93  ? -14.948 -20.599 5.656   1.00 9.15  ? 92  ASN B ND2 1 
ATOM   711  N N   . TYR A 1 94  ? -14.503 -15.902 7.637   1.00 10.80 ? 93  TYR B N   1 
ATOM   712  C CA  . TYR A 1 94  ? -14.357 -14.450 7.691   1.00 10.58 ? 93  TYR B CA  1 
ATOM   713  C C   . TYR A 1 94  ? -12.921 -14.070 7.322   1.00 14.78 ? 93  TYR B C   1 
ATOM   714  O O   . TYR A 1 94  ? -12.693 -13.149 6.524   1.00 13.25 ? 93  TYR B O   1 
ATOM   715  C CB  . TYR A 1 94  ? -14.778 -13.923 9.069   1.00 12.27 ? 93  TYR B CB  1 
ATOM   716  C CG  . TYR A 1 94  ? -14.668 -12.429 9.234   1.00 13.98 ? 93  TYR B CG  1 
ATOM   717  C CD1 . TYR A 1 94  ? -15.345 -11.567 8.384   1.00 20.03 ? 93  TYR B CD1 1 
ATOM   718  C CD2 . TYR A 1 94  ? -13.974 -11.880 10.291  1.00 15.34 ? 93  TYR B CD2 1 
ATOM   719  C CE1 . TYR A 1 94  ? -15.260 -10.197 8.540   1.00 24.94 ? 93  TYR B CE1 1 
ATOM   720  C CE2 . TYR A 1 94  ? -13.905 -10.509 10.469  1.00 16.58 ? 93  TYR B CE2 1 
ATOM   721  C CZ  . TYR A 1 94  ? -14.553 -9.676  9.598   1.00 18.71 ? 93  TYR B CZ  1 
ATOM   722  O OH  . TYR A 1 94  ? -14.467 -8.317  9.766   1.00 18.83 ? 93  TYR B OH  1 
ATOM   723  N N   . ALA A 1 95  ? -11.967 -14.826 7.853   1.00 11.00 ? 94  ALA B N   1 
ATOM   724  C CA  . ALA A 1 95  ? -10.568 -14.692 7.447   1.00 10.62 ? 94  ALA B CA  1 
ATOM   725  C C   . ALA A 1 95  ? -10.403 -14.856 5.947   1.00 12.91 ? 94  ALA B C   1 
ATOM   726  O O   . ALA A 1 95  ? -9.683  -14.094 5.314   1.00 12.17 ? 94  ALA B O   1 
ATOM   727  C CB  . ALA A 1 95  ? -9.698  -15.705 8.179   1.00 10.71 ? 94  ALA B CB  1 
ATOM   728  N N   . LEU A 1 96  ? -11.078 -15.848 5.379   1.00 10.20 ? 95  LEU B N   1 
ATOM   729  C CA  . LEU A 1 96  ? -10.954 -16.112 3.957   1.00 10.52 ? 95  LEU B CA  1 
ATOM   730  C C   . LEU A 1 96  ? -11.539 -14.953 3.146   1.00 12.70 ? 95  LEU B C   1 
ATOM   731  O O   . LEU A 1 96  ? -10.956 -14.529 2.152   1.00 12.71 ? 95  LEU B O   1 
ATOM   732  C CB  . LEU A 1 96  ? -11.646 -17.435 3.601   1.00 10.71 ? 95  LEU B CB  1 
ATOM   733  C CG  . LEU A 1 96  ? -11.601 -17.816 2.116   1.00 10.26 ? 95  LEU B CG  1 
ATOM   734  C CD1 . LEU A 1 96  ? -10.155 -18.075 1.671   1.00 13.44 ? 95  LEU B CD1 1 
ATOM   735  C CD2 . LEU A 1 96  ? -12.464 -19.033 1.839   1.00 13.52 ? 95  LEU B CD2 1 
ATOM   736  N N   . LYS A 1 97  ? -12.672 -14.412 3.591   1.00 11.26 ? 96  LYS B N   1 
ATOM   737  C CA  . LYS A 1 97  ? -13.272 -13.277 2.890   1.00 12.66 ? 96  LYS B CA  1 
ATOM   738  C C   . LYS A 1 97  ? -12.337 -12.071 2.855   1.00 15.46 ? 96  LYS B C   1 
ATOM   739  O O   . LYS A 1 97  ? -12.165 -11.460 1.788   1.00 16.70 ? 96  LYS B O   1 
ATOM   740  C CB  . LYS A 1 97  ? -14.610 -12.893 3.530   1.00 15.76 ? 96  LYS B CB  1 
ATOM   741  C CG  . LYS A 1 97  ? -15.649 -13.951 3.323   1.00 20.30 ? 96  LYS B CG  1 
ATOM   742  C CD  . LYS A 1 97  ? -16.945 -13.610 4.017   1.00 21.86 ? 96  LYS B CD  1 
ATOM   743  C CE  . LYS A 1 97  ? -17.951 -14.725 3.806   1.00 24.47 ? 96  LYS B CE  1 
ATOM   744  N NZ  . LYS A 1 97  ? -19.242 -14.452 4.483   1.00 34.47 ? 96  LYS B NZ  1 
ATOM   745  N N   . MET A 1 98  ? -11.708 -11.722 3.975   1.00 14.58 ? 97  MET B N   1 
ATOM   746  C CA  . MET A 1 98  ? -10.828 -10.555 3.900   1.00 14.38 ? 97  MET B CA  1 
ATOM   747  C C   . MET A 1 98  ? -9.553  -10.894 3.149   1.00 12.50 ? 97  MET B C   1 
ATOM   748  O O   . MET A 1 98  ? -9.027  -10.026 2.458   1.00 12.20 ? 97  MET B O   1 
ATOM   749  C CB  . MET A 1 98  ? -10.509 -9.959  5.260   1.00 21.16 ? 97  MET B CB  1 
ATOM   750  C CG  . MET A 1 98  ? -9.874  -10.848 6.217   1.00 18.26 ? 97  MET B CG  1 
ATOM   751  S SD  . MET A 1 98  ? -9.738  -9.853  7.727   1.00 26.74 ? 97  MET B SD  1 
ATOM   752  C CE  . MET A 1 98  ? -11.407 -9.875  8.323   1.00 22.36 ? 97  MET B CE  1 
ATOM   753  N N   . PHE A 1 99  ? -9.091  -12.141 3.247   1.00 11.25 ? 98  PHE B N   1 
ATOM   754  C CA  . PHE A 1 99  ? -7.939  -12.604 2.450   1.00 12.11 ? 98  PHE B CA  1 
ATOM   755  C C   . PHE A 1 99  ? -8.219  -12.441 0.951   1.00 12.09 ? 98  PHE B C   1 
ATOM   756  O O   . PHE A 1 99  ? -7.386  -11.906 0.202   1.00 10.87 ? 98  PHE B O   1 
ATOM   757  C CB  . PHE A 1 99  ? -7.623  -14.073 2.766   1.00 12.64 ? 98  PHE B CB  1 
ATOM   758  C CG  . PHE A 1 99  ? -6.392  -14.623 2.072   1.00 13.03 ? 98  PHE B CG  1 
ATOM   759  C CD1 . PHE A 1 99  ? -5.147  -14.566 2.686   1.00 16.84 ? 98  PHE B CD1 1 
ATOM   760  C CD2 . PHE A 1 99  ? -6.493  -15.208 0.821   1.00 16.31 ? 98  PHE B CD2 1 
ATOM   761  C CE1 . PHE A 1 99  ? -4.021  -15.089 2.051   1.00 17.20 ? 98  PHE B CE1 1 
ATOM   762  C CE2 . PHE A 1 99  ? -5.372  -15.727 0.180   1.00 19.26 ? 98  PHE B CE2 1 
ATOM   763  C CZ  . PHE A 1 99  ? -4.138  -15.662 0.801   1.00 19.35 ? 98  PHE B CZ  1 
ATOM   764  N N   . LEU A 1 100 ? -9.389  -12.903 0.510   1.00 10.77 ? 99  LEU B N   1 
ATOM   765  C CA  . LEU A 1 100 ? -9.707  -12.861 -0.914  1.00 10.52 ? 99  LEU B CA  1 
ATOM   766  C C   . LEU A 1 100 ? -9.994  -11.433 -1.383  1.00 11.51 ? 99  LEU B C   1 
ATOM   767  O O   . LEU A 1 100 ? -9.723  -11.105 -2.540  1.00 11.74 ? 99  LEU B O   1 
ATOM   768  C CB  . LEU A 1 100 ? -10.885 -13.790 -1.245  1.00 12.02 ? 99  LEU B CB  1 
ATOM   769  C CG  . LEU A 1 100 ? -10.625 -15.288 -1.048  1.00 10.73 ? 99  LEU B CG  1 
ATOM   770  C CD1 . LEU A 1 100 ? -11.904 -16.100 -1.285  1.00 13.53 ? 99  LEU B CD1 1 
ATOM   771  C CD2 . LEU A 1 100 ? -9.480  -15.791 -1.921  1.00 13.32 ? 99  LEU B CD2 1 
ATOM   772  N N   . TYR A 1 101 ? -10.536 -10.594 -0.499  1.00 12.95 ? 100 TYR B N   1 
ATOM   773  C CA  . TYR A 1 101 ? -10.649 -9.159  -0.785  1.00 10.55 ? 100 TYR B CA  1 
ATOM   774  C C   . TYR A 1 101 ? -9.272  -8.552  -1.057  1.00 13.56 ? 100 TYR B C   1 
ATOM   775  O O   . TYR A 1 101 ? -9.058  -7.893  -2.081  1.00 11.85 ? 100 TYR B O   1 
ATOM   776  C CB  . TYR A 1 101 ? -11.335 -8.406  0.371   1.00 14.66 ? 100 TYR B CB  1 
ATOM   777  C CG  . TYR A 1 101 ? -11.090 -6.921  0.291   1.00 15.32 ? 100 TYR B CG  1 
ATOM   778  C CD1 . TYR A 1 101 ? -11.788 -6.117  -0.602  1.00 17.13 ? 100 TYR B CD1 1 
ATOM   779  C CD2 . TYR A 1 101 ? -10.122 -6.326  1.086   1.00 14.42 ? 100 TYR B CD2 1 
ATOM   780  C CE1 . TYR A 1 101 ? -11.533 -4.754  -0.680  1.00 18.13 ? 100 TYR B CE1 1 
ATOM   781  C CE2 . TYR A 1 101 ? -9.860  -4.980  1.018   1.00 15.89 ? 100 TYR B CE2 1 
ATOM   782  C CZ  . TYR A 1 101 ? -10.570 -4.196  0.131   1.00 15.65 ? 100 TYR B CZ  1 
ATOM   783  O OH  . TYR A 1 101 ? -10.295 -2.854  0.080   1.00 20.07 ? 100 TYR B OH  1 
ATOM   784  N N   . ALA A 1 102 ? -8.342  -8.803  -0.143  1.00 12.02 ? 101 ALA B N   1 
ATOM   785  C CA  . ALA A 1 102 ? -6.988  -8.276  -0.258  1.00 11.31 ? 101 ALA B CA  1 
ATOM   786  C C   . ALA A 1 102 ? -6.281  -8.836  -1.484  1.00 11.00 ? 101 ALA B C   1 
ATOM   787  O O   . ALA A 1 102 ? -5.587  -8.101  -2.181  1.00 11.32 ? 101 ALA B O   1 
ATOM   788  C CB  . ALA A 1 102 ? -6.187  -8.571  1.010   1.00 12.13 ? 101 ALA B CB  1 
ATOM   789  N N   . ASP A 1 103 ? -6.483  -10.124 -1.770  1.00 10.43 ? 102 ASP B N   1 
ATOM   790  C CA  . ASP A 1 103 ? -5.912  -10.736 -2.969  1.00 9.94  ? 102 ASP B CA  1 
ATOM   791  C C   . ASP A 1 103 ? -6.421  -10.053 -4.245  1.00 11.67 ? 102 ASP B C   1 
ATOM   792  O O   . ASP A 1 103 ? -5.650  -9.785  -5.151  1.00 11.31 ? 102 ASP B O   1 
ATOM   793  C CB  . ASP A 1 103 ? -6.230  -12.239 -2.990  1.00 11.16 ? 102 ASP B CB  1 
ATOM   794  C CG  . ASP A 1 103 ? -5.657  -12.942 -4.199  1.00 13.55 ? 102 ASP B CG  1 
ATOM   795  O OD1 . ASP A 1 103 ? -4.441  -12.855 -4.394  1.00 12.38 ? 102 ASP B OD1 1 
ATOM   796  O OD2 . ASP A 1 103 ? -6.411  -13.601 -4.937  1.00 14.63 ? 102 ASP B OD2 1 
ATOM   797  N N   . ASN A 1 104 ? -7.721  -9.784  -4.311  1.00 12.11 ? 103 ASN B N   1 
ATOM   798  C CA  . ASN A 1 104 ? -8.304  -9.082  -5.449  1.00 12.90 ? 103 ASN B CA  1 
ATOM   799  C C   . ASN A 1 104 ? -7.702  -7.686  -5.649  1.00 11.58 ? 103 ASN B C   1 
ATOM   800  O O   . ASN A 1 104 ? -7.423  -7.276  -6.779  1.00 11.27 ? 103 ASN B O   1 
ATOM   801  C CB  . ASN A 1 104 ? -9.820  -8.962  -5.255  1.00 15.02 ? 103 ASN B CB  1 
ATOM   802  C CG  . ASN A 1 104 ? -10.544 -8.544  -6.510  1.00 23.72 ? 103 ASN B CG  1 
ATOM   803  O OD1 . ASN A 1 104 ? -10.365 -9.135  -7.570  1.00 27.52 ? 103 ASN B OD1 1 
ATOM   804  N ND2 . ASN A 1 104 ? -11.301 -7.458  -6.415  1.00 26.40 ? 103 ASN B ND2 1 
ATOM   805  N N   . GLU A 1 105 ? -7.517  -6.948  -4.552  1.00 10.39 ? 104 GLU B N   1 
ATOM   806  C CA  . GLU A 1 105 ? -6.843  -5.641  -4.604  1.00 12.07 ? 104 GLU B CA  1 
ATOM   807  C C   . GLU A 1 105 ? -5.406  -5.802  -5.099  1.00 12.22 ? 104 GLU B C   1 
ATOM   808  O O   . GLU A 1 105 ? -4.947  -5.075  -5.987  1.00 11.54 ? 104 GLU B O   1 
ATOM   809  C CB  . GLU A 1 105 ? -6.876  -4.963  -3.220  1.00 11.34 ? 104 GLU B CB  1 
ATOM   810  C CG  . GLU A 1 105 ? -8.308  -4.661  -2.769  1.00 10.84 ? 104 GLU B CG  1 
ATOM   811  C CD  . GLU A 1 105 ? -9.021  -3.708  -3.721  1.00 13.41 ? 104 GLU B CD  1 
ATOM   812  O OE1 . GLU A 1 105 ? -8.508  -2.591  -3.939  1.00 13.37 ? 104 GLU B OE1 1 
ATOM   813  O OE2 . GLU A 1 105 ? -10.068 -4.105  -4.287  1.00 15.19 ? 104 GLU B OE2 1 
ATOM   814  N N   . ASP A 1 106 ? -4.701  -6.783  -4.544  1.00 10.67 ? 105 ASP B N   1 
ATOM   815  C CA  . ASP A 1 106 ? -3.317  -7.045  -4.925  1.00 11.47 ? 105 ASP B CA  1 
ATOM   816  C C   . ASP A 1 106 ? -3.185  -7.357  -6.423  1.00 11.52 ? 105 ASP B C   1 
ATOM   817  O O   . ASP A 1 106 ? -2.312  -6.811  -7.121  1.00 12.22 ? 105 ASP B O   1 
ATOM   818  C CB  . ASP A 1 106 ? -2.784  -8.181  -4.032  1.00 9.17  ? 105 ASP B CB  1 
ATOM   819  C CG  . ASP A 1 106 ? -1.333  -8.519  -4.296  1.00 13.51 ? 105 ASP B CG  1 
ATOM   820  O OD1 . ASP A 1 106 ? -0.512  -7.591  -4.364  1.00 17.15 ? 105 ASP B OD1 1 
ATOM   821  O OD2 . ASP A 1 106 ? -1.020  -9.725  -4.343  1.00 12.81 ? 105 ASP B OD2 1 
ATOM   822  N N   . ARG A 1 107 ? -4.071  -8.202  -6.926  1.00 11.33 ? 106 ARG B N   1 
ATOM   823  C CA  . ARG A 1 107 ? -4.017  -8.585  -8.333  1.00 10.43 ? 106 ARG B CA  1 
ATOM   824  C C   . ARG A 1 107 ? -4.275  -7.392  -9.249  1.00 15.15 ? 106 ARG B C   1 
ATOM   825  O O   . ARG A 1 107 ? -3.709  -7.307  -10.333 1.00 13.84 ? 106 ARG B O   1 
ATOM   826  C CB  . ARG A 1 107 ? -5.017  -9.707  -8.590  1.00 12.08 ? 106 ARG B CB  1 
ATOM   827  C CG  . ARG A 1 107 ? -4.605  -11.016 -7.914  1.00 12.35 ? 106 ARG B CG  1 
ATOM   828  C CD  . ARG A 1 107 ? -5.720  -12.054 -7.965  1.00 11.96 ? 106 ARG B CD  1 
ATOM   829  N NE  . ARG A 1 107 ? -6.029  -12.531 -9.320  1.00 12.82 ? 106 ARG B NE  1 
ATOM   830  C CZ  . ARG A 1 107 ? -5.388  -13.523 -9.928  1.00 10.71 ? 106 ARG B CZ  1 
ATOM   831  N NH1 . ARG A 1 107 ? -4.386  -14.143 -9.322  1.00 11.66 ? 106 ARG B NH1 1 
ATOM   832  N NH2 . ARG A 1 107 ? -5.768  -13.905 -11.154 1.00 12.90 ? 106 ARG B NH2 1 
ATOM   833  N N   . ALA A 1 108 ? -5.093  -6.455  -8.781  1.00 13.71 ? 107 ALA B N   1 
ATOM   834  C CA  . ALA A 1 108 ? -5.406  -5.249  -9.536  1.00 13.04 ? 107 ALA B CA  1 
ATOM   835  C C   . ALA A 1 108 ? -4.328  -4.180  -9.404  1.00 12.19 ? 107 ALA B C   1 
ATOM   836  O O   . ALA A 1 108 ? -4.422  -3.120  -10.019 1.00 14.75 ? 107 ALA B O   1 
ATOM   837  C CB  . ALA A 1 108 ? -6.757  -4.690  -9.075  1.00 12.82 ? 107 ALA B CB  1 
ATOM   838  N N   . GLY A 1 109 ? -3.316  -4.454  -8.588  1.00 11.82 ? 108 GLY B N   1 
ATOM   839  C CA  . GLY A 1 109 ? -2.266  -3.485  -8.331  1.00 14.61 ? 108 GLY B CA  1 
ATOM   840  C C   . GLY A 1 109 ? -2.733  -2.309  -7.488  1.00 14.81 ? 108 GLY B C   1 
ATOM   841  O O   . GLY A 1 109 ? -2.156  -1.235  -7.553  1.00 15.30 ? 108 GLY B O   1 
ATOM   842  N N   . ARG A 1 110 ? -3.774  -2.519  -6.689  1.00 13.40 ? 109 ARG B N   1 
ATOM   843  C CA  . ARG A 1 110 ? -4.303  -1.474  -5.813  1.00 14.46 ? 109 ARG B CA  1 
ATOM   844  C C   . ARG A 1 110 ? -3.785  -1.687  -4.410  1.00 14.83 ? 109 ARG B C   1 
ATOM   845  O O   . ARG A 1 110 ? -4.189  -2.638  -3.727  1.00 13.82 ? 109 ARG B O   1 
ATOM   846  C CB  . ARG A 1 110 ? -5.836  -1.470  -5.816  1.00 13.26 ? 109 ARG B CB  1 
ATOM   847  C CG  . ARG A 1 110 ? -6.419  -1.065  -7.175  1.00 12.70 ? 109 ARG B CG  1 
ATOM   848  C CD  . ARG A 1 110 ? -7.926  -0.785  -7.083  1.00 14.03 ? 109 ARG B CD  1 
ATOM   849  N NE  . ARG A 1 110 ? -8.712  -1.978  -6.772  1.00 13.98 ? 109 ARG B NE  1 
ATOM   850  C CZ  . ARG A 1 110 ? -9.349  -2.734  -7.664  1.00 17.17 ? 109 ARG B CZ  1 
ATOM   851  N NH1 . ARG A 1 110 ? -9.337  -2.412  -8.961  1.00 17.92 ? 109 ARG B NH1 1 
ATOM   852  N NH2 . ARG A 1 110 ? -10.023 -3.806  -7.258  1.00 18.57 ? 109 ARG B NH2 1 
ATOM   853  N N   . PHE A 1 111 ? -2.889  -0.801  -3.981  1.00 15.50 ? 110 PHE B N   1 
ATOM   854  C CA  . PHE A 1 111 ? -2.205  -0.964  -2.714  1.00 15.34 ? 110 PHE B CA  1 
ATOM   855  C C   . PHE A 1 111 ? -2.579  0.180   -1.788  1.00 17.56 ? 110 PHE B C   1 
ATOM   856  O O   . PHE A 1 111 ? -2.483  1.348   -2.163  1.00 17.70 ? 110 PHE B O   1 
ATOM   857  C CB  . PHE A 1 111 ? -0.686  -1.031  -2.927  1.00 16.37 ? 110 PHE B CB  1 
ATOM   858  C CG  . PHE A 1 111 ? -0.269  -2.085  -3.906  1.00 14.50 ? 110 PHE B CG  1 
ATOM   859  C CD1 . PHE A 1 111 ? -0.356  -3.428  -3.578  1.00 15.34 ? 110 PHE B CD1 1 
ATOM   860  C CD2 . PHE A 1 111 ? 0.231   -1.733  -5.147  1.00 15.82 ? 110 PHE B CD2 1 
ATOM   861  C CE1 . PHE A 1 111 ? 0.014   -4.407  -4.495  1.00 16.36 ? 110 PHE B CE1 1 
ATOM   862  C CE2 . PHE A 1 111 ? 0.608   -2.703  -6.058  1.00 20.26 ? 110 PHE B CE2 1 
ATOM   863  C CZ  . PHE A 1 111 ? 0.503   -4.043  -5.723  1.00 20.64 ? 110 PHE B CZ  1 
ATOM   864  N N   . HIS A 1 112 ? -3.010  -0.167  -0.583  1.00 15.57 ? 111 HIS B N   1 
ATOM   865  C CA  . HIS A 1 112 ? -3.595  0.789   0.348   1.00 15.36 ? 111 HIS B CA  1 
ATOM   866  C C   . HIS A 1 112 ? -3.753  0.174   1.727   1.00 18.29 ? 111 HIS B C   1 
ATOM   867  O O   . HIS A 1 112 ? -3.608  -1.044  1.887   1.00 16.11 ? 111 HIS B O   1 
ATOM   868  C CB  . HIS A 1 112 ? -4.941  1.311   -0.180  1.00 15.99 ? 111 HIS B CB  1 
ATOM   869  C CG  . HIS A 1 112 ? -5.880  0.247   -0.676  1.00 14.78 ? 111 HIS B CG  1 
ATOM   870  N ND1 . HIS A 1 112 ? -6.641  -0.540  0.163   1.00 16.50 ? 111 HIS B ND1 1 
ATOM   871  C CD2 . HIS A 1 112 ? -6.206  -0.129  -1.938  1.00 14.74 ? 111 HIS B CD2 1 
ATOM   872  C CE1 . HIS A 1 112 ? -7.390  -1.358  -0.559  1.00 15.30 ? 111 HIS B CE1 1 
ATOM   873  N NE2 . HIS A 1 112 ? -7.140  -1.132  -1.838  1.00 15.35 ? 111 HIS B NE2 1 
ATOM   874  N N   . LYS A 1 113 ? -4.009  1.028   2.719   1.00 15.87 ? 112 LYS B N   1 
ATOM   875  C CA  . LYS A 1 113 ? -4.102  0.595   4.109   1.00 17.87 ? 112 LYS B CA  1 
ATOM   876  C C   . LYS A 1 113 ? -5.129  -0.501  4.309   1.00 15.91 ? 112 LYS B C   1 
ATOM   877  O O   . LYS A 1 113 ? -4.899  -1.419  5.095   1.00 17.22 ? 112 LYS B O   1 
ATOM   878  C CB  . LYS A 1 113 ? -4.447  1.779   5.019   1.00 20.32 ? 112 LYS B CB  1 
ATOM   879  C CD  . LYS A 1 113 ? -1.200  2.853   4.980   1.00 38.97 ? 112 LYS B CD  1 
ATOM   880  N NZ  . LYS A 1 113 ? -0.622  5.456   6.597   1.00 43.59 ? 112 LYS B NZ  1 
ATOM   881  N N   . ASN A 1 114 ? -6.265  -0.403  3.623   1.00 16.63 ? 113 ASN B N   1 
ATOM   882  C CA  . ASN A 1 114 ? -7.366  -1.321  3.874   1.00 17.06 ? 113 ASN B CA  1 
ATOM   883  C C   . ASN A 1 114 ? -7.015  -2.748  3.484   1.00 14.90 ? 113 ASN B C   1 
ATOM   884  O O   . ASN A 1 114 ? -7.317  -3.683  4.216   1.00 16.42 ? 113 ASN B O   1 
ATOM   885  C CB  . ASN A 1 114 ? -8.634  -0.883  3.144   1.00 18.44 ? 113 ASN B CB  1 
ATOM   886  C CG  . ASN A 1 114 ? -9.886  -1.504  3.739   1.00 27.37 ? 113 ASN B CG  1 
ATOM   887  N ND2 . ASN A 1 114 ? -10.600 -2.295  2.945   1.00 26.54 ? 113 ASN B ND2 1 
ATOM   888  N N   . MET A 1 115 ? -6.342  -2.932  2.355   1.00 15.29 ? 114 MET B N   1 
ATOM   889  C CA  . MET A 1 115 ? -6.058  -4.292  1.934   1.00 12.77 ? 114 MET B CA  1 
ATOM   890  C C   . MET A 1 115 ? -4.857  -4.810  2.786   1.00 15.09 ? 114 MET B C   1 
ATOM   891  O O   . MET A 1 115 ? -4.728  -6.022  2.977   1.00 11.84 ? 114 MET B O   1 
ATOM   892  C CB  . MET A 1 115 ? -5.686  -4.339  0.459   1.00 13.02 ? 114 MET B CB  1 
ATOM   893  C CG  . MET A 1 115 ? -4.266  -4.527  0.568   1.00 27.74 ? 114 MET B CG  1 
ATOM   894  S SD  . MET A 1 115 ? -2.915  -4.147  -0.330  1.00 13.40 ? 114 MET B SD  1 
ATOM   895  C CE  . MET A 1 115 ? -3.152  -5.183  -1.781  1.00 13.02 ? 114 MET B CE  1 
ATOM   896  N N   . ILE A 1 116 ? -3.962  -3.903  3.240   1.00 15.03 ? 115 ILE B N   1 
ATOM   897  C CA  . ILE A 1 116 ? -2.826  -4.293  4.079   1.00 14.29 ? 115 ILE B CA  1 
ATOM   898  C C   . ILE A 1 116 ? -3.442  -4.815  5.360   1.00 13.20 ? 115 ILE B C   1 
ATOM   899  O O   . ILE A 1 116 ? -3.109  -5.908  5.827   1.00 12.00 ? 115 ILE B O   1 
ATOM   900  C CB  . ILE A 1 116 ? -1.850  -3.124  4.385   1.00 13.09 ? 115 ILE B CB  1 
ATOM   901  C CG1 . ILE A 1 116 ? -1.127  -2.663  3.118   1.00 16.19 ? 115 ILE B CG1 1 
ATOM   902  C CG2 . ILE A 1 116 ? -0.820  -3.521  5.439   1.00 13.59 ? 115 ILE B CG2 1 
ATOM   903  C CD1 . ILE A 1 116 ? -0.395  -1.335  3.302   1.00 16.18 ? 115 ILE B CD1 1 
ATOM   904  N N   . LYS A 1 117 ? -4.383  -4.047  5.903   1.00 15.84 ? 116 LYS B N   1 
ATOM   905  C CA  . LYS A 1 117 ? -5.030  -4.436  7.157   1.00 15.89 ? 116 LYS B CA  1 
ATOM   906  C C   . LYS A 1 117 ? -5.830  -5.715  6.963   1.00 14.50 ? 116 LYS B C   1 
ATOM   907  O O   . LYS A 1 117 ? -5.910  -6.552  7.860   1.00 13.61 ? 116 LYS B O   1 
ATOM   908  C CB  . LYS A 1 117 ? -5.944  -3.323  7.689   1.00 14.17 ? 116 LYS B CB  1 
ATOM   909  C CG  . LYS A 1 117 ? -6.547  -3.651  9.061   1.00 17.01 ? 116 LYS B CG  1 
ATOM   910  N NZ  . LYS A 1 117 ? -7.972  -1.996  11.517  1.00 31.44 ? 116 LYS B NZ  1 
ATOM   911  N N   . SER A 1 118 ? -6.416  -5.885  5.783   1.00 12.30 ? 117 SER B N   1 
ATOM   912  C CA  . SER A 1 118 ? -7.171  -7.098  5.528   1.00 9.69  ? 117 SER B CA  1 
ATOM   913  C C   . SER A 1 118 ? -6.254  -8.315  5.504   1.00 11.34 ? 117 SER B C   1 
ATOM   914  O O   . SER A 1 118 ? -6.582  -9.333  6.102   1.00 11.68 ? 117 SER B O   1 
ATOM   915  C CB  . SER A 1 118 ? -7.959  -7.000  4.216   1.00 12.87 ? 117 SER B CB  1 
ATOM   916  O OG  . SER A 1 118 ? -9.008  -6.045  4.333   1.00 15.35 ? 117 SER B OG  1 
ATOM   917  N N   . PHE A 1 119 ? -5.119  -8.229  4.808   1.00 10.69 ? 118 PHE B N   1 
ATOM   918  C CA  . PHE A 1 119 ? -4.165  -9.331  4.887   1.00 10.58 ? 118 PHE B CA  1 
ATOM   919  C C   . PHE A 1 119 ? -3.748  -9.590  6.336   1.00 11.38 ? 118 PHE B C   1 
ATOM   920  O O   . PHE A 1 119 ? -3.728  -10.732 6.796   1.00 11.64 ? 118 PHE B O   1 
ATOM   921  C CB  . PHE A 1 119 ? -2.890  -9.092  4.056   1.00 9.21  ? 118 PHE B CB  1 
ATOM   922  C CG  . PHE A 1 119 ? -3.025  -9.361  2.561   1.00 9.34  ? 118 PHE B CG  1 
ATOM   923  C CD1 . PHE A 1 119 ? -3.320  -10.639 2.096   1.00 12.54 ? 118 PHE B CD1 1 
ATOM   924  C CD2 . PHE A 1 119 ? -2.659  -8.389  1.633   1.00 10.96 ? 118 PHE B CD2 1 
ATOM   925  C CE1 . PHE A 1 119 ? -3.377  -10.912 0.716   1.00 11.65 ? 118 PHE B CE1 1 
ATOM   926  C CE2 . PHE A 1 119 ? -2.709  -8.650  0.250   1.00 12.28 ? 118 PHE B CE2 1 
ATOM   927  C CZ  . PHE A 1 119 ? -3.066  -9.924  -0.194  1.00 12.48 ? 118 PHE B CZ  1 
ATOM   928  N N   . TYR A 1 120 ? -3.381  -8.536  7.048   1.00 10.36 ? 119 TYR B N   1 
ATOM   929  C CA  . TYR A 1 120 ? -2.822  -8.762  8.374   1.00 11.09 ? 119 TYR B CA  1 
ATOM   930  C C   . TYR A 1 120 ? -3.881  -9.348  9.287   1.00 11.57 ? 119 TYR B C   1 
ATOM   931  O O   . TYR A 1 120 ? -3.591  -10.286 10.043  1.00 12.06 ? 119 TYR B O   1 
ATOM   932  C CB  . TYR A 1 120 ? -2.251  -7.472  8.953   1.00 9.60  ? 119 TYR B CB  1 
ATOM   933  C CG  . TYR A 1 120 ? -1.522  -7.674  10.261  1.00 11.93 ? 119 TYR B CG  1 
ATOM   934  C CD1 . TYR A 1 120 ? -0.360  -8.433  10.314  1.00 15.09 ? 119 TYR B CD1 1 
ATOM   935  C CD2 . TYR A 1 120 ? -1.960  -7.054  11.422  1.00 16.32 ? 119 TYR B CD2 1 
ATOM   936  C CE1 . TYR A 1 120 ? 0.314   -8.609  11.509  1.00 18.60 ? 119 TYR B CE1 1 
ATOM   937  C CE2 . TYR A 1 120 ? -1.283  -7.219  12.615  1.00 17.18 ? 119 TYR B CE2 1 
ATOM   938  C CZ  . TYR A 1 120 ? -0.149  -7.994  12.647  1.00 18.79 ? 119 TYR B CZ  1 
ATOM   939  O OH  . TYR A 1 120 ? 0.533   -8.158  13.836  1.00 21.80 ? 119 TYR B OH  1 
ATOM   940  N N   . THR A 1 121 ? -5.103  -8.830  9.208   1.00 12.97 ? 120 THR B N   1 
ATOM   941  C CA  . THR A 1 121 ? -6.173  -9.319  10.074  1.00 12.74 ? 120 THR B CA  1 
ATOM   942  C C   . THR A 1 121 ? -6.516  -10.764 9.739   1.00 10.89 ? 120 THR B C   1 
ATOM   943  O O   . THR A 1 121 ? -6.818  -11.551 10.641  1.00 11.54 ? 120 THR B O   1 
ATOM   944  C CB  . THR A 1 121 ? -7.431  -8.420  9.979   1.00 12.35 ? 120 THR B CB  1 
ATOM   945  O OG1 . THR A 1 121 ? -7.056  -7.098  10.368  1.00 15.42 ? 120 THR B OG1 1 
ATOM   946  C CG2 . THR A 1 121 ? -8.551  -8.916  10.907  1.00 14.12 ? 120 THR B CG2 1 
ATOM   947  N N   . ALA A 1 122 ? -6.462  -11.130 8.451   1.00 11.05 ? 121 ALA B N   1 
ATOM   948  C CA  . ALA A 1 122 ? -6.677  -12.526 8.116   1.00 10.78 ? 121 ALA B CA  1 
ATOM   949  C C   . ALA A 1 122 ? -5.644  -13.383 8.853   1.00 10.80 ? 121 ALA B C   1 
ATOM   950  O O   . ALA A 1 122 ? -5.986  -14.431 9.387   1.00 10.77 ? 121 ALA B O   1 
ATOM   951  C CB  . ALA A 1 122 ? -6.612  -12.767 6.592   1.00 12.40 ? 121 ALA B CB  1 
ATOM   952  N N   . SER A 1 123 ? -4.395  -12.923 8.932   1.00 12.17 ? 122 SER B N   1 
ATOM   953  C CA  . SER A 1 123 ? -3.366  -13.745 9.570   1.00 11.23 ? 122 SER B CA  1 
ATOM   954  C C   . SER A 1 123 ? -3.634  -13.840 11.078  1.00 11.16 ? 122 SER B C   1 
ATOM   955  O O   . SER A 1 123 ? -3.432  -14.896 11.687  1.00 9.79  ? 122 SER B O   1 
ATOM   956  C CB  . SER A 1 123 ? -1.939  -13.195 9.296   1.00 11.83 ? 122 SER B CB  1 
ATOM   957  O OG  . SER A 1 123 ? -1.622  -12.042 10.072  1.00 11.38 ? 122 SER B OG  1 
ATOM   958  N N   . LEU A 1 124 ? -4.098  -12.741 11.674  1.00 10.47 ? 123 LEU B N   1 
ATOM   959  C CA  . LEU A 1 124 ? -4.437  -12.744 13.092  1.00 13.61 ? 123 LEU B CA  1 
ATOM   960  C C   . LEU A 1 124 ? -5.589  -13.693 13.385  1.00 10.22 ? 123 LEU B C   1 
ATOM   961  O O   . LEU A 1 124 ? -5.598  -14.393 14.408  1.00 9.11  ? 123 LEU B O   1 
ATOM   962  C CB  . LEU A 1 124 ? -4.811  -11.337 13.555  1.00 10.88 ? 123 LEU B CB  1 
ATOM   963  C CG  . LEU A 1 124 ? -3.701  -10.292 13.473  1.00 12.52 ? 123 LEU B CG  1 
ATOM   964  C CD1 . LEU A 1 124 ? -4.263  -8.926  13.831  1.00 14.82 ? 123 LEU B CD1 1 
ATOM   965  C CD2 . LEU A 1 124 ? -2.536  -10.664 14.371  1.00 13.71 ? 123 LEU B CD2 1 
ATOM   966  N N   . LEU A 1 125 ? -6.586  -13.712 12.503  1.00 10.05 ? 124 LEU B N   1 
ATOM   967  C CA  . LEU A 1 125 ? -7.711  -14.607 12.703  1.00 13.15 ? 124 LEU B CA  1 
ATOM   968  C C   . LEU A 1 125 ? -7.313  -16.077 12.595  1.00 10.92 ? 124 LEU B C   1 
ATOM   969  O O   . LEU A 1 125 ? -7.913  -16.930 13.248  1.00 9.53  ? 124 LEU B O   1 
ATOM   970  C CB  . LEU A 1 125 ? -8.827  -14.291 11.706  1.00 10.19 ? 124 LEU B CB  1 
ATOM   971  C CG  . LEU A 1 125 ? -9.484  -12.934 11.973  1.00 11.16 ? 124 LEU B CG  1 
ATOM   972  C CD1 . LEU A 1 125 ? -10.460 -12.570 10.849  1.00 14.54 ? 124 LEU B CD1 1 
ATOM   973  C CD2 . LEU A 1 125 ? -10.213 -12.940 13.325  1.00 14.63 ? 124 LEU B CD2 1 
ATOM   974  N N   . ILE A 1 126 ? -6.303  -16.391 11.788  1.00 9.96  ? 125 ILE B N   1 
ATOM   975  C CA  . ILE A 1 126 ? -5.857  -17.777 11.751  1.00 10.28 ? 125 ILE B CA  1 
ATOM   976  C C   . ILE A 1 126 ? -5.114  -18.149 13.056  1.00 10.20 ? 125 ILE B C   1 
ATOM   977  O O   . ILE A 1 126 ? -5.241  -19.275 13.527  1.00 12.77 ? 125 ILE B O   1 
ATOM   978  C CB  . ILE A 1 126 ? -4.995  -18.046 10.509  1.00 9.63  ? 125 ILE B CB  1 
ATOM   979  C CG1 . ILE A 1 126 ? -5.892  -17.919 9.266   1.00 11.89 ? 125 ILE B CG1 1 
ATOM   980  C CG2 . ILE A 1 126 ? -4.397  -19.435 10.586  1.00 11.53 ? 125 ILE B CG2 1 
ATOM   981  C CD1 . ILE A 1 126 ? -5.139  -17.846 7.926   1.00 15.70 ? 125 ILE B CD1 1 
ATOM   982  N N   . ASP A 1 127 ? -4.341  -17.226 13.632  1.00 10.35 ? 126 ASP B N   1 
ATOM   983  C CA  . ASP A 1 127 ? -3.865  -17.423 15.014  1.00 9.60  ? 126 ASP B CA  1 
ATOM   984  C C   . ASP A 1 127 ? -5.041  -17.786 15.924  1.00 12.57 ? 126 ASP B C   1 
ATOM   985  O O   . ASP A 1 127 ? -4.974  -18.744 16.686  1.00 12.29 ? 126 ASP B O   1 
ATOM   986  C CB  . ASP A 1 127 ? -3.194  -16.167 15.574  1.00 9.03  ? 126 ASP B CB  1 
ATOM   987  C CG  . ASP A 1 127 ? -1.836  -15.876 14.959  1.00 12.99 ? 126 ASP B CG  1 
ATOM   988  O OD1 . ASP A 1 127 ? -1.178  -16.798 14.436  1.00 14.72 ? 126 ASP B OD1 1 
ATOM   989  O OD2 . ASP A 1 127 ? -1.439  -14.694 15.003  1.00 12.59 ? 126 ASP B OD2 1 
ATOM   990  N N   . VAL A 1 128 ? -6.109  -16.993 15.854  1.00 10.55 ? 127 VAL B N   1 
ATOM   991  C CA  . VAL A 1 128 ? -7.247  -17.168 16.750  1.00 11.47 ? 127 VAL B CA  1 
ATOM   992  C C   . VAL A 1 128 ? -7.866  -18.555 16.620  1.00 10.79 ? 127 VAL B C   1 
ATOM   993  O O   . VAL A 1 128 ? -8.230  -19.154 17.636  1.00 12.72 ? 127 VAL B O   1 
ATOM   994  C CB  . VAL A 1 128 ? -8.324  -16.083 16.494  1.00 9.49  ? 127 VAL B CB  1 
ATOM   995  C CG1 . VAL A 1 128 ? -9.662  -16.442 17.163  1.00 9.89  ? 127 VAL B CG1 1 
ATOM   996  C CG2 . VAL A 1 128 ? -7.835  -14.735 16.995  1.00 11.40 ? 127 VAL B CG2 1 
ATOM   997  N N   . ILE A 1 129 ? -7.986  -19.095 15.405  1.00 10.07 ? 128 ILE B N   1 
ATOM   998  C CA  . ILE A 1 129 ? -8.700  -20.364 15.312  1.00 14.21 ? 128 ILE B CA  1 
ATOM   999  C C   . ILE A 1 129 ? -7.884  -21.535 15.853  1.00 13.26 ? 128 ILE B C   1 
ATOM   1000 O O   . ILE A 1 129 ? -8.396  -22.642 15.920  1.00 13.76 ? 128 ILE B O   1 
ATOM   1001 C CB  . ILE A 1 129 ? -9.192  -20.693 13.880  1.00 18.50 ? 128 ILE B CB  1 
ATOM   1002 C CG1 . ILE A 1 129 ? -8.054  -20.883 12.905  1.00 15.08 ? 128 ILE B CG1 1 
ATOM   1003 C CG2 . ILE A 1 129 ? -10.162 -19.631 13.377  1.00 16.35 ? 128 ILE B CG2 1 
ATOM   1004 C CD1 . ILE A 1 129 ? -8.561  -21.246 11.485  1.00 17.63 ? 128 ILE B CD1 1 
ATOM   1005 N N   . THR A 1 130 ? -6.653  -21.293 16.313  1.00 14.62 ? 129 THR B N   1 
ATOM   1006 C CA  . THR A 1 130 ? -5.958  -22.335 17.069  1.00 14.40 ? 129 THR B CA  1 
ATOM   1007 C C   . THR A 1 130 ? -6.697  -22.675 18.371  1.00 15.46 ? 129 THR B C   1 
ATOM   1008 O O   . THR A 1 130 ? -6.407  -23.694 18.994  1.00 15.62 ? 129 THR B O   1 
ATOM   1009 C CB  . THR A 1 130 ? -4.495  -21.955 17.431  1.00 13.69 ? 129 THR B CB  1 
ATOM   1010 O OG1 . THR A 1 130 ? -4.490  -20.812 18.300  1.00 14.00 ? 129 THR B OG1 1 
ATOM   1011 C CG2 . THR A 1 130 ? -3.672  -21.670 16.182  1.00 16.66 ? 129 THR B CG2 1 
ATOM   1012 N N   . VAL A 1 131 ? -7.651  -21.846 18.795  1.00 14.67 ? 130 VAL B N   1 
ATOM   1013 C CA  . VAL A 1 131 ? -8.410  -22.203 19.995  1.00 14.67 ? 130 VAL B CA  1 
ATOM   1014 C C   . VAL A 1 131 ? -9.269  -23.433 19.749  1.00 18.60 ? 130 VAL B C   1 
ATOM   1015 O O   . VAL A 1 131 ? -9.705  -24.096 20.698  1.00 17.46 ? 130 VAL B O   1 
ATOM   1016 C CB  . VAL A 1 131 ? -9.345  -21.079 20.488  1.00 16.21 ? 130 VAL B CB  1 
ATOM   1017 C CG1 . VAL A 1 131 ? -8.548  -19.879 20.867  1.00 18.20 ? 130 VAL B CG1 1 
ATOM   1018 C CG2 . VAL A 1 131 ? -10.406 -20.748 19.436  1.00 15.53 ? 130 VAL B CG2 1 
ATOM   1019 N N   . PHE A 1 132 ? -9.528  -23.731 18.482  1.00 16.92 ? 131 PHE B N   1 
ATOM   1020 C CA  . PHE A 1 132 ? -10.397 -24.852 18.150  1.00 17.64 ? 131 PHE B CA  1 
ATOM   1021 C C   . PHE A 1 132 ? -9.594  -26.130 17.957  1.00 20.67 ? 131 PHE B C   1 
ATOM   1022 O O   . PHE A 1 132 ? -10.165 -27.208 17.820  1.00 26.36 ? 131 PHE B O   1 
ATOM   1023 C CB  . PHE A 1 132 ? -11.220 -24.557 16.888  1.00 16.08 ? 131 PHE B CB  1 
ATOM   1024 C CG  . PHE A 1 132 ? -12.135 -23.377 17.028  1.00 17.10 ? 131 PHE B CG  1 
ATOM   1025 C CD1 . PHE A 1 132 ? -13.317 -23.486 17.750  1.00 16.67 ? 131 PHE B CD1 1 
ATOM   1026 C CD2 . PHE A 1 132 ? -11.842 -22.172 16.399  1.00 14.64 ? 131 PHE B CD2 1 
ATOM   1027 C CE1 . PHE A 1 132 ? -14.177 -22.399 17.877  1.00 14.67 ? 131 PHE B CE1 1 
ATOM   1028 C CE2 . PHE A 1 132 ? -12.701 -21.078 16.510  1.00 15.59 ? 131 PHE B CE2 1 
ATOM   1029 C CZ  . PHE A 1 132 ? -13.867 -21.190 17.252  1.00 14.08 ? 131 PHE B CZ  1 
ATOM   1030 N N   . GLY A 1 133 ? -8.273  -25.998 17.947  1.00 17.55 ? 132 GLY B N   1 
ATOM   1031 C CA  . GLY A 1 133 ? -7.395  -27.138 17.785  1.00 21.40 ? 132 GLY B CA  1 
ATOM   1032 C C   . GLY A 1 133 ? -6.321  -26.917 16.734  1.00 20.76 ? 132 GLY B C   1 
ATOM   1033 O O   . GLY A 1 133 ? -5.998  -25.780 16.391  1.00 18.74 ? 132 GLY B O   1 
ATOM   1034 N N   . GLU A 1 134 ? -5.762  -28.013 16.229  1.00 19.44 ? 133 GLU B N   1 
ATOM   1035 C CA  . GLU A 1 134 ? -4.641  -27.948 15.291  1.00 21.66 ? 133 GLU B CA  1 
ATOM   1036 C C   . GLU A 1 134 ? -5.035  -27.273 13.988  1.00 15.67 ? 133 GLU B C   1 
ATOM   1037 O O   . GLU A 1 134 ? -6.115  -27.518 13.458  1.00 21.43 ? 133 GLU B O   1 
ATOM   1038 C CB  . GLU A 1 134 ? -4.104  -29.352 14.992  1.00 25.30 ? 133 GLU B CB  1 
ATOM   1039 C CG  . GLU A 1 134 ? -3.569  -30.098 16.208  1.00 31.28 ? 133 GLU B CG  1 
ATOM   1040 O OE1 . GLU A 1 134 ? -1.049  -28.441 15.161  1.00 41.52 ? 133 GLU B OE1 1 
ATOM   1041 O OE2 . GLU A 1 134 ? -1.758  -27.649 17.773  1.00 47.74 ? 133 GLU B OE2 1 
ATOM   1042 N N   . LEU A 1 135 ? -4.155  -26.423 13.471  1.00 18.23 ? 134 LEU B N   1 
ATOM   1043 C CA  . LEU A 1 135 ? -4.413  -25.777 12.189  1.00 15.91 ? 134 LEU B CA  1 
ATOM   1044 C C   . LEU A 1 135 ? -4.302  -26.743 11.023  1.00 16.90 ? 134 LEU B C   1 
ATOM   1045 O O   . LEU A 1 135 ? -3.475  -27.663 11.039  1.00 20.24 ? 134 LEU B O   1 
ATOM   1046 C CB  . LEU A 1 135 ? -3.449  -24.608 11.969  1.00 15.50 ? 134 LEU B CB  1 
ATOM   1047 C CG  . LEU A 1 135 ? -3.570  -23.424 12.937  1.00 15.61 ? 134 LEU B CG  1 
ATOM   1048 C CD1 . LEU A 1 135 ? -2.557  -22.354 12.577  1.00 15.73 ? 134 LEU B CD1 1 
ATOM   1049 C CD2 . LEU A 1 135 ? -5.001  -22.848 12.978  1.00 14.52 ? 134 LEU B CD2 1 
ATOM   1050 N N   . THR A 1 136 ? -5.125  -26.516 10.002  1.00 15.44 ? 135 THR B N   1 
ATOM   1051 C CA  . THR A 1 136 ? -4.976  -27.241 8.734   1.00 16.02 ? 135 THR B CA  1 
ATOM   1052 C C   . THR A 1 136 ? -3.771  -26.724 7.969   1.00 16.35 ? 135 THR B C   1 
ATOM   1053 O O   . THR A 1 136 ? -3.242  -25.647 8.264   1.00 15.15 ? 135 THR B O   1 
ATOM   1054 C CB  . THR A 1 136 ? -6.203  -27.112 7.807   1.00 15.90 ? 135 THR B CB  1 
ATOM   1055 O OG1 . THR A 1 136 ? -6.369  -25.748 7.412   1.00 16.65 ? 135 THR B OG1 1 
ATOM   1056 C CG2 . THR A 1 136 ? -7.481  -27.599 8.481   1.00 17.85 ? 135 THR B CG2 1 
ATOM   1057 N N   . ASP A 1 137 ? -3.342  -27.496 6.973   1.00 17.51 ? 136 ASP B N   1 
ATOM   1058 C CA  . ASP A 1 137 ? -2.241  -27.062 6.127   1.00 16.32 ? 136 ASP B CA  1 
ATOM   1059 C C   . ASP A 1 137 ? -2.588  -25.772 5.414   1.00 15.74 ? 136 ASP B C   1 
ATOM   1060 O O   . ASP A 1 137 ? -1.738  -24.886 5.268   1.00 15.64 ? 136 ASP B O   1 
ATOM   1061 C CB  . ASP A 1 137 ? -1.868  -28.137 5.110   1.00 19.13 ? 136 ASP B CB  1 
ATOM   1062 C CG  . ASP A 1 137 ? -1.197  -29.328 5.749   1.00 27.26 ? 136 ASP B CG  1 
ATOM   1063 O OD1 . ASP A 1 137 ? -0.829  -29.232 6.937   1.00 25.46 ? 136 ASP B OD1 1 
ATOM   1064 O OD2 . ASP A 1 137 ? -1.014  -30.352 5.060   1.00 28.43 ? 136 ASP B OD2 1 
ATOM   1065 N N   . GLU A 1 138 ? -3.838  -25.639 4.981   1.00 13.44 ? 137 GLU B N   1 
ATOM   1066 C CA  . GLU A 1 138 ? -4.213  -24.444 4.247   1.00 15.64 ? 137 GLU B CA  1 
ATOM   1067 C C   . GLU A 1 138 ? -4.240  -23.233 5.195   1.00 14.14 ? 137 GLU B C   1 
ATOM   1068 O O   . GLU A 1 138 ? -3.874  -22.127 4.801   1.00 13.43 ? 137 GLU B O   1 
ATOM   1069 C CB  . GLU A 1 138 ? -5.569  -24.644 3.556   1.00 15.94 ? 137 GLU B CB  1 
ATOM   1070 C CG  . GLU A 1 138 ? -5.928  -23.568 2.545   1.00 18.72 ? 137 GLU B CG  1 
ATOM   1071 C CD  . GLU A 1 138 ? -5.097  -23.646 1.278   1.00 18.90 ? 137 GLU B CD  1 
ATOM   1072 O OE1 . GLU A 1 138 ? -4.417  -24.676 1.067   1.00 20.47 ? 137 GLU B OE1 1 
ATOM   1073 O OE2 . GLU A 1 138 ? -5.141  -22.692 0.469   1.00 24.72 ? 137 GLU B OE2 1 
ATOM   1074 N N   . ASN A 1 139 ? -4.683  -23.440 6.437   1.00 14.70 ? 138 ASN B N   1 
ATOM   1075 C CA  . ASN A 1 139 ? -4.584  -22.390 7.458   1.00 14.24 ? 138 ASN B CA  1 
ATOM   1076 C C   . ASN A 1 139 ? -3.164  -21.857 7.584   1.00 12.77 ? 138 ASN B C   1 
ATOM   1077 O O   . ASN A 1 139 ? -2.937  -20.654 7.634   1.00 11.86 ? 138 ASN B O   1 
ATOM   1078 C CB  . ASN A 1 139 ? -4.989  -22.893 8.851   1.00 12.78 ? 138 ASN B CB  1 
ATOM   1079 C CG  . ASN A 1 139 ? -6.469  -23.154 9.004   1.00 19.41 ? 138 ASN B CG  1 
ATOM   1080 O OD1 . ASN A 1 139 ? -7.319  -22.589 8.299   1.00 22.42 ? 138 ASN B OD1 1 
ATOM   1081 N ND2 . ASN A 1 139 ? -6.788  -24.011 9.966   1.00 15.84 ? 138 ASN B ND2 1 
ATOM   1082 N N   . VAL A 1 140 ? -2.213  -22.778 7.706   1.00 13.12 ? 139 VAL B N   1 
ATOM   1083 C CA  . VAL A 1 140 ? -0.822  -22.403 7.888   1.00 13.08 ? 139 VAL B CA  1 
ATOM   1084 C C   . VAL A 1 140 ? -0.327  -21.634 6.676   1.00 12.24 ? 139 VAL B C   1 
ATOM   1085 O O   . VAL A 1 140 ? 0.323   -20.585 6.801   1.00 13.40 ? 139 VAL B O   1 
ATOM   1086 C CB  . VAL A 1 140 ? 0.036   -23.655 8.147   1.00 13.15 ? 139 VAL B CB  1 
ATOM   1087 C CG1 . VAL A 1 140 ? 1.534   -23.323 8.094   1.00 15.56 ? 139 VAL B CG1 1 
ATOM   1088 C CG2 . VAL A 1 140 ? -0.332  -24.250 9.513   1.00 13.65 ? 139 VAL B CG2 1 
ATOM   1089 N N   . LYS A 1 141 ? -0.662  -22.153 5.501   1.00 11.36 ? 140 LYS B N   1 
ATOM   1090 C CA  . LYS A 1 141 ? -0.291  -21.521 4.248   1.00 11.61 ? 140 LYS B CA  1 
ATOM   1091 C C   . LYS A 1 141 ? -0.889  -20.122 4.127   1.00 13.08 ? 140 LYS B C   1 
ATOM   1092 O O   . LYS A 1 141 ? -0.186  -19.175 3.766   1.00 12.17 ? 140 LYS B O   1 
ATOM   1093 C CB  . LYS A 1 141 ? -0.727  -22.404 3.074   1.00 15.00 ? 140 LYS B CB  1 
ATOM   1094 C CG  . LYS A 1 141 ? -0.702  -21.730 1.739   1.00 22.26 ? 140 LYS B CG  1 
ATOM   1095 C CE  . LYS A 1 141 ? -1.372  -22.502 -1.984  1.00 29.77 ? 140 LYS B CE  1 
ATOM   1096 N N   . HIS A 1 142 ? -2.184  -19.974 4.419   1.00 13.93 ? 141 HIS B N   1 
ATOM   1097 C CA  . HIS A 1 142 ? -2.783  -18.650 4.305   1.00 13.00 ? 141 HIS B CA  1 
ATOM   1098 C C   . HIS A 1 142 ? -2.235  -17.642 5.303   1.00 10.59 ? 141 HIS B C   1 
ATOM   1099 O O   . HIS A 1 142 ? -2.038  -16.487 4.941   1.00 12.88 ? 141 HIS B O   1 
ATOM   1100 C CB  . HIS A 1 142 ? -4.314  -18.679 4.450   1.00 11.14 ? 141 HIS B CB  1 
ATOM   1101 C CG  . HIS A 1 142 ? -5.033  -19.099 3.205   1.00 16.73 ? 141 HIS B CG  1 
ATOM   1102 N ND1 . HIS A 1 142 ? -6.402  -19.226 3.153   1.00 21.50 ? 141 HIS B ND1 1 
ATOM   1103 C CD2 . HIS A 1 142 ? -4.578  -19.419 1.969   1.00 16.07 ? 141 HIS B CD2 1 
ATOM   1104 C CE1 . HIS A 1 142 ? -6.763  -19.600 1.937   1.00 22.05 ? 141 HIS B CE1 1 
ATOM   1105 N NE2 . HIS A 1 142 ? -5.674  -19.727 1.200   1.00 19.30 ? 141 HIS B NE2 1 
ATOM   1106 N N   . ARG A 1 143 ? -1.989  -18.062 6.546   1.00 10.15 ? 142 ARG B N   1 
ATOM   1107 C CA  . ARG A 1 143 ? -1.481  -17.135 7.541   1.00 11.00 ? 142 ARG B CA  1 
ATOM   1108 C C   . ARG A 1 143 ? -0.115  -16.607 7.130   1.00 11.31 ? 142 ARG B C   1 
ATOM   1109 O O   . ARG A 1 143 ? 0.165   -15.414 7.256   1.00 10.10 ? 142 ARG B O   1 
ATOM   1110 C CB  . ARG A 1 143 ? -1.417  -17.789 8.934   1.00 11.01 ? 142 ARG B CB  1 
ATOM   1111 C CG  . ARG A 1 143 ? -0.782  -16.896 9.981   1.00 11.40 ? 142 ARG B CG  1 
ATOM   1112 C CD  . ARG A 1 143 ? -0.741  -17.557 11.365  1.00 12.87 ? 142 ARG B CD  1 
ATOM   1113 N NE  . ARG A 1 143 ? -0.000  -18.811 11.339  1.00 13.47 ? 142 ARG B NE  1 
ATOM   1114 C CZ  . ARG A 1 143 ? 0.051   -19.688 12.337  1.00 14.28 ? 142 ARG B CZ  1 
ATOM   1115 N NH1 . ARG A 1 143 ? -0.569  -19.448 13.491  1.00 13.58 ? 142 ARG B NH1 1 
ATOM   1116 N NH2 . ARG A 1 143 ? 0.748   -20.803 12.179  1.00 16.11 ? 142 ARG B NH2 1 
ATOM   1117 N N   . LYS A 1 144 ? 0.716   -17.505 6.617   1.00 11.94 ? 143 LYS B N   1 
ATOM   1118 C CA  . LYS A 1 144 ? 2.074   -17.151 6.229   1.00 10.82 ? 143 LYS B CA  1 
ATOM   1119 C C   . LYS A 1 144 ? 2.047   -16.189 5.051   1.00 12.18 ? 143 LYS B C   1 
ATOM   1120 O O   . LYS A 1 144 ? 2.742   -15.173 5.057   1.00 11.74 ? 143 LYS B O   1 
ATOM   1121 C CB  . LYS A 1 144 ? 2.863   -18.416 5.884   1.00 13.28 ? 143 LYS B CB  1 
ATOM   1122 C CG  . LYS A 1 144 ? 4.351   -18.210 5.626   1.00 15.21 ? 143 LYS B CG  1 
ATOM   1123 C CD  . LYS A 1 144 ? 4.985   -19.560 5.323   1.00 18.93 ? 143 LYS B CD  1 
ATOM   1124 C CE  . LYS A 1 144 ? 6.474   -19.462 4.990   1.00 13.95 ? 143 LYS B CE  1 
ATOM   1125 N NZ  . LYS A 1 144 ? 7.273   -19.001 6.173   1.00 17.25 ? 143 LYS B NZ  1 
ATOM   1126 N N   . TYR A 1 145 ? 1.234   -16.512 4.048   1.00 9.66  ? 144 TYR B N   1 
ATOM   1127 C CA  . TYR A 1 145 ? 1.115   -15.687 2.851   1.00 10.11 ? 144 TYR B CA  1 
ATOM   1128 C C   . TYR A 1 145 ? 0.547   -14.308 3.203   1.00 11.76 ? 144 TYR B C   1 
ATOM   1129 O O   . TYR A 1 145 ? 1.068   -13.274 2.786   1.00 11.41 ? 144 TYR B O   1 
ATOM   1130 C CB  . TYR A 1 145 ? 0.211   -16.402 1.843   1.00 9.33  ? 144 TYR B CB  1 
ATOM   1131 C CG  . TYR A 1 145 ? -0.012  -15.732 0.499   1.00 11.72 ? 144 TYR B CG  1 
ATOM   1132 C CD1 . TYR A 1 145 ? 0.704   -16.122 -0.619  1.00 11.69 ? 144 TYR B CD1 1 
ATOM   1133 C CD2 . TYR A 1 145 ? -0.903  -14.683 0.367   1.00 10.90 ? 144 TYR B CD2 1 
ATOM   1134 C CE1 . TYR A 1 145 ? 0.489   -15.522 -1.844  1.00 12.30 ? 144 TYR B CE1 1 
ATOM   1135 C CE2 . TYR A 1 145 ? -1.124  -14.069 -0.857  1.00 12.40 ? 144 TYR B CE2 1 
ATOM   1136 C CZ  . TYR A 1 145 ? -0.416  -14.493 -1.955  1.00 11.44 ? 144 TYR B CZ  1 
ATOM   1137 O OH  . TYR A 1 145 ? -0.636  -13.887 -3.181  1.00 10.96 ? 144 TYR B OH  1 
ATOM   1138 N N   . ALA A 1 146 ? -0.520  -14.304 3.994   1.00 10.15 ? 145 ALA B N   1 
ATOM   1139 C CA  . ALA A 1 146 ? -1.178  -13.050 4.356   1.00 11.81 ? 145 ALA B CA  1 
ATOM   1140 C C   . ALA A 1 146 ? -0.265  -12.147 5.170   1.00 10.71 ? 145 ALA B C   1 
ATOM   1141 O O   . ALA A 1 146 ? -0.201  -10.946 4.916   1.00 12.10 ? 145 ALA B O   1 
ATOM   1142 C CB  . ALA A 1 146 ? -2.482  -13.315 5.139   1.00 9.75  ? 145 ALA B CB  1 
ATOM   1143 N N   . ARG A 1 147 ? 0.447   -12.705 6.146   1.00 10.63 ? 146 ARG B N   1 
ATOM   1144 C CA  . ARG A 1 147 ? 1.274   -11.850 6.970   1.00 11.48 ? 146 ARG B CA  1 
ATOM   1145 C C   . ARG A 1 147 ? 2.490   -11.374 6.162   1.00 10.76 ? 146 ARG B C   1 
ATOM   1146 O O   . ARG A 1 147 ? 2.932   -10.240 6.321   1.00 12.12 ? 146 ARG B O   1 
ATOM   1147 C CB  . ARG A 1 147 ? 1.685   -12.570 8.255   1.00 13.80 ? 146 ARG B CB  1 
ATOM   1148 C CG  . ARG A 1 147 ? 2.303   -11.643 9.278   1.00 13.70 ? 146 ARG B CG  1 
ATOM   1149 C CD  . ARG A 1 147 ? 2.416   -12.350 10.606  1.00 14.56 ? 146 ARG B CD  1 
ATOM   1150 N NE  . ARG A 1 147 ? 1.077   -12.648 11.107  1.00 17.16 ? 146 ARG B NE  1 
ATOM   1151 C CZ  . ARG A 1 147 ? 0.825   -13.407 12.163  1.00 16.34 ? 146 ARG B CZ  1 
ATOM   1152 N NH1 . ARG A 1 147 ? 1.830   -13.950 12.840  1.00 18.79 ? 146 ARG B NH1 1 
ATOM   1153 N NH2 . ARG A 1 147 ? -0.430  -13.632 12.537  1.00 13.72 ? 146 ARG B NH2 1 
ATOM   1154 N N   . TRP A 1 148 ? 2.992   -12.214 5.260   1.00 12.47 ? 147 TRP B N   1 
ATOM   1155 C CA  . TRP A 1 148 ? 4.088   -11.791 4.386   1.00 12.05 ? 147 TRP B CA  1 
ATOM   1156 C C   . TRP A 1 148 ? 3.643   -10.614 3.506   1.00 14.09 ? 147 TRP B C   1 
ATOM   1157 O O   . TRP A 1 148 ? 4.351   -9.604  3.395   1.00 12.36 ? 147 TRP B O   1 
ATOM   1158 C CB  . TRP A 1 148 ? 4.563   -12.953 3.507   1.00 11.31 ? 147 TRP B CB  1 
ATOM   1159 C CG  . TRP A 1 148 ? 5.807   -12.612 2.716   1.00 13.68 ? 147 TRP B CG  1 
ATOM   1160 C CD1 . TRP A 1 148 ? 7.097   -12.860 3.086   1.00 19.09 ? 147 TRP B CD1 1 
ATOM   1161 C CD2 . TRP A 1 148 ? 5.871   -11.900 1.478   1.00 13.45 ? 147 TRP B CD2 1 
ATOM   1162 N NE1 . TRP A 1 148 ? 7.965   -12.372 2.133   1.00 18.29 ? 147 TRP B NE1 1 
ATOM   1163 C CE2 . TRP A 1 148 ? 7.237   -11.774 1.139   1.00 15.12 ? 147 TRP B CE2 1 
ATOM   1164 C CE3 . TRP A 1 148 ? 4.912   -11.369 0.611   1.00 13.38 ? 147 TRP B CE3 1 
ATOM   1165 C CZ2 . TRP A 1 148 ? 7.662   -11.133 -0.024  1.00 16.81 ? 147 TRP B CZ2 1 
ATOM   1166 C CZ3 . TRP A 1 148 ? 5.333   -10.736 -0.539  1.00 15.11 ? 147 TRP B CZ3 1 
ATOM   1167 C CH2 . TRP A 1 148 ? 6.697   -10.626 -0.850  1.00 17.08 ? 147 TRP B CH2 1 
ATOM   1168 N N   . LYS A 1 149 ? 2.469   -10.739 2.885   1.00 11.31 ? 148 LYS B N   1 
ATOM   1169 C CA  . LYS A 1 149 ? 1.969   -9.663  2.023   1.00 13.28 ? 148 LYS B CA  1 
ATOM   1170 C C   . LYS A 1 149 ? 1.756   -8.373  2.797   1.00 12.68 ? 148 LYS B C   1 
ATOM   1171 O O   . LYS A 1 149 ? 2.124   -7.299  2.316   1.00 12.86 ? 148 LYS B O   1 
ATOM   1172 C CB  . LYS A 1 149 ? 0.662   -10.074 1.310   1.00 11.46 ? 148 LYS B CB  1 
ATOM   1173 C CG  . LYS A 1 149 ? 0.855   -11.241 0.323   1.00 15.81 ? 148 LYS B CG  1 
ATOM   1174 C CD  . LYS A 1 149 ? 1.718   -10.919 -0.898  1.00 30.78 ? 148 LYS B CD  1 
ATOM   1175 C CE  . LYS A 1 149 ? 0.888   -10.652 -2.105  1.00 22.42 ? 148 LYS B CE  1 
ATOM   1176 N NZ  . LYS A 1 149 ? 1.613   -10.398 -3.394  1.00 14.40 ? 148 LYS B NZ  1 
ATOM   1177 N N   . ALA A 1 150 ? 1.166   -8.466  3.992   1.00 12.73 ? 149 ALA B N   1 
ATOM   1178 C CA  . ALA A 1 150 ? 0.903   -7.262  4.763   1.00 10.84 ? 149 ALA B CA  1 
ATOM   1179 C C   . ALA A 1 150 ? 2.209   -6.535  5.059   1.00 14.33 ? 149 ALA B C   1 
ATOM   1180 O O   . ALA A 1 150 ? 2.304   -5.316  4.880   1.00 14.48 ? 149 ALA B O   1 
ATOM   1181 C CB  . ALA A 1 150 ? 0.162   -7.601  6.067   1.00 11.30 ? 149 ALA B CB  1 
ATOM   1182 N N   . THR A 1 151 ? 3.216   -7.297  5.471   1.00 11.84 ? 150 THR B N   1 
ATOM   1183 C CA  . THR A 1 151 ? 4.501   -6.732  5.840   1.00 13.67 ? 150 THR B CA  1 
ATOM   1184 C C   . THR A 1 151 ? 5.203   -6.173  4.610   1.00 16.74 ? 150 THR B C   1 
ATOM   1185 O O   . THR A 1 151 ? 5.704   -5.043  4.626   1.00 17.48 ? 150 THR B O   1 
ATOM   1186 C CB  . THR A 1 151 ? 5.395   -7.777  6.530   1.00 15.59 ? 150 THR B CB  1 
ATOM   1187 O OG1 . THR A 1 151 ? 4.742   -8.229  7.726   1.00 18.04 ? 150 THR B OG1 1 
ATOM   1188 C CG2 . THR A 1 151 ? 6.738   -7.164  6.913   1.00 20.06 ? 150 THR B CG2 1 
ATOM   1189 N N   . TYR A 1 152 ? 5.232   -6.971  3.549   1.00 13.16 ? 151 TYR B N   1 
ATOM   1190 C CA  . TYR A 1 152 ? 5.909   -6.571  2.323   1.00 13.51 ? 151 TYR B CA  1 
ATOM   1191 C C   . TYR A 1 152 ? 5.291   -5.325  1.685   1.00 15.56 ? 151 TYR B C   1 
ATOM   1192 O O   . TYR A 1 152 ? 6.014   -4.371  1.355   1.00 16.12 ? 151 TYR B O   1 
ATOM   1193 C CB  . TYR A 1 152 ? 5.911   -7.719  1.315   1.00 14.67 ? 151 TYR B CB  1 
ATOM   1194 C CG  . TYR A 1 152 ? 6.434   -7.307  -0.036  1.00 14.01 ? 151 TYR B CG  1 
ATOM   1195 C CD1 . TYR A 1 152 ? 7.779   -7.020  -0.222  1.00 17.81 ? 151 TYR B CD1 1 
ATOM   1196 C CD2 . TYR A 1 152 ? 5.590   -7.219  -1.128  1.00 14.89 ? 151 TYR B CD2 1 
ATOM   1197 C CE1 . TYR A 1 152 ? 8.262   -6.643  -1.459  1.00 18.88 ? 151 TYR B CE1 1 
ATOM   1198 C CE2 . TYR A 1 152 ? 6.068   -6.856  -2.377  1.00 15.18 ? 151 TYR B CE2 1 
ATOM   1199 C CZ  . TYR A 1 152 ? 7.401   -6.564  -2.532  1.00 16.64 ? 151 TYR B CZ  1 
ATOM   1200 O OH  . TYR A 1 152 ? 7.871   -6.188  -3.773  1.00 17.00 ? 151 TYR B OH  1 
ATOM   1201 N N   . ILE A 1 153 ? 3.969   -5.328  1.493   1.00 12.19 ? 152 ILE B N   1 
ATOM   1202 C CA  . ILE A 1 153 ? 3.314   -4.179  0.876   1.00 13.28 ? 152 ILE B CA  1 
ATOM   1203 C C   . ILE A 1 153 ? 3.468   -2.910  1.717   1.00 14.56 ? 152 ILE B C   1 
ATOM   1204 O O   . ILE A 1 153 ? 3.732   -1.835  1.181   1.00 16.18 ? 152 ILE B O   1 
ATOM   1205 C CB  . ILE A 1 153 ? 1.829   -4.469  0.634   1.00 12.99 ? 152 ILE B CB  1 
ATOM   1206 C CG1 . ILE A 1 153 ? 1.695   -5.575  -0.413  1.00 12.87 ? 152 ILE B CG1 1 
ATOM   1207 C CG2 . ILE A 1 153 ? 1.078   -3.207  0.197   1.00 15.85 ? 152 ILE B CG2 1 
ATOM   1208 C CD1 . ILE A 1 153 ? 0.271   -6.112  -0.545  1.00 11.35 ? 152 ILE B CD1 1 
ATOM   1209 N N   . HIS A 1 154 ? 3.314   -3.041  3.027   1.00 13.79 ? 153 HIS B N   1 
ATOM   1210 C CA  . HIS A 1 154 ? 3.511   -1.924  3.949   1.00 16.29 ? 153 HIS B CA  1 
ATOM   1211 C C   . HIS A 1 154 ? 4.912   -1.328  3.792   1.00 18.80 ? 153 HIS B C   1 
ATOM   1212 O O   . HIS A 1 154 ? 5.071   -0.113  3.658   1.00 16.96 ? 153 HIS B O   1 
ATOM   1213 C CB  . HIS A 1 154 ? 3.300   -2.384  5.390   1.00 15.87 ? 153 HIS B CB  1 
ATOM   1214 C CG  . HIS A 1 154 ? 3.544   -1.319  6.412   1.00 20.79 ? 153 HIS B CG  1 
ATOM   1215 N ND1 . HIS A 1 154 ? 2.643   -0.311  6.680   1.00 28.09 ? 153 HIS B ND1 1 
ATOM   1216 C CD2 . HIS A 1 154 ? 4.627   -1.073  7.186   1.00 21.81 ? 153 HIS B CD2 1 
ATOM   1217 C CE1 . HIS A 1 154 ? 3.142   0.485   7.608   1.00 29.89 ? 153 HIS B CE1 1 
ATOM   1218 N NE2 . HIS A 1 154 ? 4.348   0.051   7.927   1.00 28.23 ? 153 HIS B NE2 1 
ATOM   1219 N N   . ASN A 1 155 ? 5.928   -2.186  3.803   1.00 16.23 ? 154 ASN B N   1 
ATOM   1220 C CA  . ASN A 1 155 ? 7.303   -1.714  3.662   1.00 18.29 ? 154 ASN B CA  1 
ATOM   1221 C C   . ASN A 1 155 ? 7.562   -1.058  2.316   1.00 17.17 ? 154 ASN B C   1 
ATOM   1222 O O   . ASN A 1 155 ? 8.236   -0.037  2.245   1.00 20.09 ? 154 ASN B O   1 
ATOM   1223 C CB  . ASN A 1 155 ? 8.286   -2.857  3.872   1.00 16.49 ? 154 ASN B CB  1 
ATOM   1224 C CG  . ASN A 1 155 ? 8.375   -3.286  5.323   1.00 24.51 ? 154 ASN B CG  1 
ATOM   1225 O OD1 . ASN A 1 155 ? 8.019   -2.533  6.229   1.00 31.20 ? 154 ASN B OD1 1 
ATOM   1226 N ND2 . ASN A 1 155 ? 8.881   -4.495  5.550   1.00 32.82 ? 154 ASN B ND2 1 
ATOM   1227 N N   . CYS A 1 156 ? 7.026   -1.633  1.244   1.00 14.79 ? 155 CYS B N   1 
ATOM   1228 C CA  . CYS A 1 156 ? 7.182   -1.010  -0.067  1.00 16.06 ? 155 CYS B CA  1 
ATOM   1229 C C   . CYS A 1 156 ? 6.576   0.388   -0.103  1.00 16.83 ? 155 CYS B C   1 
ATOM   1230 O O   . CYS A 1 156 ? 7.221   1.332   -0.566  1.00 17.02 ? 155 CYS B O   1 
ATOM   1231 C CB  . CYS A 1 156 ? 6.547   -1.867  -1.167  1.00 18.78 ? 155 CYS B CB  1 
ATOM   1232 S SG  . CYS A 1 156 ? 7.418   -3.396  -1.500  1.00 19.50 ? 155 CYS B SG  1 
ATOM   1233 N N   . LEU A 1 157 ? 5.341   0.523   0.375   1.00 16.08 ? 156 LEU B N   1 
ATOM   1234 C CA  . LEU A 1 157 ? 4.670   1.813   0.338   1.00 18.40 ? 156 LEU B CA  1 
ATOM   1235 C C   . LEU A 1 157 ? 5.385   2.824   1.225   1.00 21.03 ? 156 LEU B C   1 
ATOM   1236 O O   . LEU A 1 157 ? 5.499   3.998   0.868   1.00 20.63 ? 156 LEU B O   1 
ATOM   1237 C CB  . LEU A 1 157 ? 3.210   1.682   0.755   1.00 17.43 ? 156 LEU B CB  1 
ATOM   1238 C CG  . LEU A 1 157 ? 2.384   0.815   -0.192  1.00 17.61 ? 156 LEU B CG  1 
ATOM   1239 C CD1 . LEU A 1 157 ? 0.933   0.749   0.266   1.00 19.48 ? 156 LEU B CD1 1 
ATOM   1240 C CD2 . LEU A 1 157 ? 2.517   1.326   -1.629  1.00 20.05 ? 156 LEU B CD2 1 
ATOM   1241 N N   . LYS A 1 158 ? 5.861   2.371   2.380   1.00 19.22 ? 157 LYS B N   1 
ATOM   1242 C CA  . LYS A 1 158 ? 6.667   3.232   3.232   1.00 19.69 ? 157 LYS B CA  1 
ATOM   1243 C C   . LYS A 1 158 ? 7.885   3.781   2.468   1.00 19.72 ? 157 LYS B C   1 
ATOM   1244 O O   . LYS A 1 158 ? 8.272   4.927   2.657   1.00 24.97 ? 157 LYS B O   1 
ATOM   1245 C CB  . LYS A 1 158 ? 7.112   2.476   4.491   1.00 21.24 ? 157 LYS B CB  1 
ATOM   1246 C CE  . LYS A 1 158 ? 7.587   2.258   7.964   1.00 44.63 ? 157 LYS B CE  1 
ATOM   1247 N N   . ASN A 1 159 ? 8.473   2.968   1.595   1.00 19.61 ? 158 ASN B N   1 
ATOM   1248 C CA  . ASN A 1 159 ? 9.640   3.390   0.807   1.00 22.62 ? 158 ASN B CA  1 
ATOM   1249 C C   . ASN A 1 159 ? 9.311   3.958   -0.579  1.00 21.15 ? 158 ASN B C   1 
ATOM   1250 O O   . ASN A 1 159 ? 10.210  4.242   -1.379  1.00 23.44 ? 158 ASN B O   1 
ATOM   1251 C CB  . ASN A 1 159 ? 10.619  2.224   0.655   1.00 21.32 ? 158 ASN B CB  1 
ATOM   1252 C CG  . ASN A 1 159 ? 11.292  1.867   1.960   1.00 28.92 ? 158 ASN B CG  1 
ATOM   1253 O OD1 . ASN A 1 159 ? 11.307  0.708   2.369   1.00 36.82 ? 158 ASN B OD1 1 
ATOM   1254 N ND2 . ASN A 1 159 ? 11.861  2.869   2.622   1.00 34.16 ? 158 ASN B ND2 1 
ATOM   1255 N N   . GLY A 1 160 ? 8.023   4.121   -0.858  1.00 21.50 ? 159 GLY B N   1 
ATOM   1256 C CA  . GLY A 1 160 ? 7.581   4.775   -2.082  1.00 19.81 ? 159 GLY B CA  1 
ATOM   1257 C C   . GLY A 1 160 ? 7.663   3.935   -3.343  1.00 20.76 ? 159 GLY B C   1 
ATOM   1258 O O   . GLY A 1 160 ? 7.597   4.450   -4.463  1.00 21.90 ? 159 GLY B O   1 
ATOM   1259 N N   . GLU A 1 161 ? 7.815   2.632   -3.166  1.00 19.61 ? 160 GLU B N   1 
ATOM   1260 C CA  . GLU A 1 161 ? 7.993   1.752   -4.301  1.00 21.90 ? 160 GLU B CA  1 
ATOM   1261 C C   . GLU A 1 161 ? 6.778   0.878   -4.490  1.00 18.48 ? 160 GLU B C   1 
ATOM   1262 O O   . GLU A 1 161 ? 6.122   0.500   -3.522  1.00 20.02 ? 160 GLU B O   1 
ATOM   1263 C CB  . GLU A 1 161 ? 9.247   0.899   -4.117  1.00 27.47 ? 160 GLU B CB  1 
ATOM   1264 C CG  . GLU A 1 161 ? 10.487  1.733   -3.872  1.00 29.53 ? 160 GLU B CG  1 
ATOM   1265 O OE1 . GLU A 1 161 ? 11.606  -0.828  -2.730  1.00 42.18 ? 160 GLU B OE1 1 
ATOM   1266 O OE2 . GLU A 1 161 ? 13.509  1.634   -3.175  1.00 44.96 ? 160 GLU B OE2 1 
ATOM   1267 N N   . THR A 1 162 ? 6.481   0.562   -5.745  1.00 20.01 ? 161 THR B N   1 
ATOM   1268 C CA  . THR A 1 162 ? 5.379   -0.335  -6.051  1.00 18.04 ? 161 THR B CA  1 
ATOM   1269 C C   . THR A 1 162 ? 5.742   -1.747  -5.606  1.00 18.17 ? 161 THR B C   1 
ATOM   1270 O O   . THR A 1 162 ? 6.797   -2.249  -5.958  1.00 18.71 ? 161 THR B O   1 
ATOM   1271 C CB  . THR A 1 162 ? 5.058   -0.345  -7.547  1.00 19.07 ? 161 THR B CB  1 
ATOM   1272 O OG1 . THR A 1 162 ? 4.865   1.001   -8.000  1.00 22.26 ? 161 THR B OG1 1 
ATOM   1273 C CG2 . THR A 1 162 ? 3.771   -1.135  -7.791  1.00 19.13 ? 161 THR B CG2 1 
ATOM   1274 N N   . PRO A 1 163 ? 4.871   -2.396  -4.821  1.00 18.13 ? 162 PRO B N   1 
ATOM   1275 C CA  . PRO A 1 163 ? 5.151   -3.798  -4.468  1.00 17.08 ? 162 PRO B CA  1 
ATOM   1276 C C   . PRO A 1 163 ? 5.371   -4.705  -5.689  1.00 17.89 ? 162 PRO B C   1 
ATOM   1277 O O   . PRO A 1 163 ? 4.784   -4.440  -6.756  1.00 20.66 ? 162 PRO B O   1 
ATOM   1278 C CB  . PRO A 1 163 ? 3.896   -4.220  -3.709  1.00 18.92 ? 162 PRO B CB  1 
ATOM   1279 C CG  . PRO A 1 163 ? 3.370   -2.952  -3.115  1.00 16.97 ? 162 PRO B CG  1 
ATOM   1280 C CD  . PRO A 1 163 ? 3.713   -1.856  -4.090  1.00 16.77 ? 162 PRO B CD  1 
ATOM   1281 N N   . ASP B 2 9   ? -0.240  -23.175 33.576  1.00 35.01 ? 320 ASP A N   1 
ATOM   1282 C CA  . ASP B 2 9   ? -0.485  -23.601 34.947  1.00 33.45 ? 320 ASP A CA  1 
ATOM   1283 C C   . ASP B 2 9   ? -1.940  -24.001 35.129  1.00 34.75 ? 320 ASP A C   1 
ATOM   1284 O O   . ASP B 2 9   ? -2.828  -23.453 34.477  1.00 37.88 ? 320 ASP A O   1 
ATOM   1285 N N   . PHE B 2 10  ? -2.182  -24.978 35.994  1.00 28.36 ? 321 PHE A N   1 
ATOM   1286 C CA  . PHE B 2 10  ? -3.549  -25.355 36.344  1.00 29.37 ? 321 PHE A CA  1 
ATOM   1287 C C   . PHE B 2 10  ? -4.024  -24.539 37.530  1.00 30.19 ? 321 PHE A C   1 
ATOM   1288 O O   . PHE B 2 10  ? -3.867  -24.943 38.681  1.00 36.49 ? 321 PHE A O   1 
ATOM   1289 C CB  . PHE B 2 10  ? -3.639  -26.843 36.655  1.00 32.11 ? 321 PHE A CB  1 
ATOM   1290 C CG  . PHE B 2 10  ? -3.607  -27.717 35.439  1.00 30.75 ? 321 PHE A CG  1 
ATOM   1291 C CD1 . PHE B 2 10  ? -4.070  -27.248 34.218  1.00 35.06 ? 321 PHE A CD1 1 
ATOM   1292 C CD2 . PHE B 2 10  ? -3.099  -29.001 35.515  1.00 31.80 ? 321 PHE A CD2 1 
ATOM   1293 C CE1 . PHE B 2 10  ? -4.044  -28.057 33.096  1.00 37.09 ? 321 PHE A CE1 1 
ATOM   1294 C CE2 . PHE B 2 10  ? -3.061  -29.813 34.400  1.00 34.36 ? 321 PHE A CE2 1 
ATOM   1295 C CZ  . PHE B 2 10  ? -3.538  -29.341 33.188  1.00 36.69 ? 321 PHE A CZ  1 
ATOM   1296 N N   . ASP B 2 11  ? -4.613  -23.389 37.239  1.00 22.57 ? 322 ASP A N   1 
ATOM   1297 C CA  . ASP B 2 11  ? -5.101  -22.508 38.280  1.00 21.57 ? 322 ASP A CA  1 
ATOM   1298 C C   . ASP B 2 11  ? -6.570  -22.184 38.060  1.00 21.25 ? 322 ASP A C   1 
ATOM   1299 O O   . ASP B 2 11  ? -7.230  -22.796 37.218  1.00 17.90 ? 322 ASP A O   1 
ATOM   1300 C CB  . ASP B 2 11  ? -4.238  -21.242 38.360  1.00 23.98 ? 322 ASP A CB  1 
ATOM   1301 C CG  . ASP B 2 11  ? -4.180  -20.467 37.055  1.00 25.96 ? 322 ASP A CG  1 
ATOM   1302 O OD1 . ASP B 2 11  ? -5.012  -20.689 36.148  1.00 21.77 ? 322 ASP A OD1 1 
ATOM   1303 O OD2 . ASP B 2 11  ? -3.251  -19.642 36.930  1.00 26.77 ? 322 ASP A OD2 1 
ATOM   1304 N N   . ASP B 2 12  ? -7.096  -21.254 38.847  1.00 21.55 ? 323 ASP A N   1 
ATOM   1305 C CA  . ASP B 2 12  ? -8.520  -20.960 38.800  1.00 21.05 ? 323 ASP A CA  1 
ATOM   1306 C C   . ASP B 2 12  ? -8.906  -20.306 37.479  1.00 19.63 ? 323 ASP A C   1 
ATOM   1307 O O   . ASP B 2 12  ? -10.010 -20.519 36.976  1.00 14.57 ? 323 ASP A O   1 
ATOM   1308 C CB  . ASP B 2 12  ? -8.905  -20.077 39.983  1.00 20.24 ? 323 ASP A CB  1 
ATOM   1309 C CG  . ASP B 2 12  ? -8.808  -20.817 41.311  1.00 28.49 ? 323 ASP A CG  1 
ATOM   1310 O OD1 . ASP B 2 12  ? -8.832  -22.070 41.310  1.00 29.82 ? 323 ASP A OD1 1 
ATOM   1311 O OD2 . ASP B 2 12  ? -8.690  -20.143 42.349  1.00 28.47 ? 323 ASP A OD2 1 
ATOM   1312 N N   . LEU B 2 13  ? -8.001  -19.523 36.906  1.00 14.96 ? 324 LEU A N   1 
ATOM   1313 C CA  . LEU B 2 13  ? -8.257  -18.960 35.580  1.00 16.00 ? 324 LEU A CA  1 
ATOM   1314 C C   . LEU B 2 13  ? -8.365  -20.034 34.495  1.00 14.53 ? 324 LEU A C   1 
ATOM   1315 O O   . LEU B 2 13  ? -9.235  -19.939 33.635  1.00 14.89 ? 324 LEU A O   1 
ATOM   1316 C CB  . LEU B 2 13  ? -7.177  -17.936 35.205  1.00 17.23 ? 324 LEU A CB  1 
ATOM   1317 C CG  . LEU B 2 13  ? -7.276  -16.641 36.017  1.00 14.12 ? 324 LEU A CG  1 
ATOM   1318 C CD1 . LEU B 2 13  ? -6.080  -15.745 35.780  1.00 17.07 ? 324 LEU A CD1 1 
ATOM   1319 C CD2 . LEU B 2 13  ? -8.561  -15.888 35.680  1.00 16.16 ? 324 LEU A CD2 1 
ATOM   1320 N N   . SER B 2 14  ? -7.492  -21.041 34.509  1.00 16.61 ? 325 SER A N   1 
ATOM   1321 C CA  . SER B 2 14  ? -7.601  -22.087 33.495  1.00 16.58 ? 325 SER A CA  1 
ATOM   1322 C C   . SER B 2 14  ? -8.873  -22.906 33.704  1.00 14.91 ? 325 SER A C   1 
ATOM   1323 O O   . SER B 2 14  ? -9.477  -23.363 32.739  1.00 16.78 ? 325 SER A O   1 
ATOM   1324 C CB  . SER B 2 14  ? -6.360  -22.988 33.479  1.00 18.59 ? 325 SER A CB  1 
ATOM   1325 O OG  . SER B 2 14  ? -6.214  -23.712 34.683  1.00 23.44 ? 325 SER A OG  1 
ATOM   1326 N N   . ARG B 2 15  ? -9.314  -23.043 34.958  1.00 15.53 ? 326 ARG A N   1 
ATOM   1327 C CA  . ARG B 2 15  ? -10.560 -23.755 35.238  1.00 16.71 ? 326 ARG A CA  1 
ATOM   1328 C C   . ARG B 2 15  ? -11.789 -22.999 34.742  1.00 16.33 ? 326 ARG A C   1 
ATOM   1329 O O   . ARG B 2 15  ? -12.706 -23.604 34.183  1.00 14.76 ? 326 ARG A O   1 
ATOM   1330 C CB  . ARG B 2 15  ? -10.664 -24.050 36.737  1.00 16.43 ? 326 ARG A CB  1 
ATOM   1331 C CG  . ARG B 2 15  ? -9.794  -25.229 37.113  1.00 21.93 ? 326 ARG A CG  1 
ATOM   1332 C CD  . ARG B 2 15  ? -9.907  -25.653 38.567  1.00 24.03 ? 326 ARG A CD  1 
ATOM   1333 N NE  . ARG B 2 15  ? -9.103  -24.811 39.437  1.00 25.09 ? 326 ARG A NE  1 
ATOM   1334 C CZ  . ARG B 2 15  ? -7.799  -25.007 39.612  1.00 23.46 ? 326 ARG A CZ  1 
ATOM   1335 N NH1 . ARG B 2 15  ? -7.191  -25.981 38.943  1.00 26.98 ? 326 ARG A NH1 1 
ATOM   1336 N NH2 . ARG B 2 15  ? -7.096  -24.224 40.421  1.00 23.85 ? 326 ARG A NH2 1 
ATOM   1337 N N   . ARG B 2 16  ? -11.797 -21.680 34.919  1.00 13.34 ? 327 ARG A N   1 
ATOM   1338 C CA  . ARG B 2 16  ? -12.854 -20.861 34.343  1.00 14.31 ? 327 ARG A CA  1 
ATOM   1339 C C   . ARG B 2 16  ? -12.835 -20.911 32.817  1.00 13.45 ? 327 ARG A C   1 
ATOM   1340 O O   . ARG B 2 16  ? -13.894 -20.910 32.180  1.00 15.87 ? 327 ARG A O   1 
ATOM   1341 C CB  . ARG B 2 16  ? -12.738 -19.415 34.820  1.00 15.10 ? 327 ARG A CB  1 
ATOM   1342 C CG  . ARG B 2 16  ? -13.046 -19.260 36.308  1.00 16.46 ? 327 ARG A CG  1 
ATOM   1343 C CD  . ARG B 2 16  ? -12.737 -17.859 36.809  1.00 15.86 ? 327 ARG A CD  1 
ATOM   1344 N NE  . ARG B 2 16  ? -13.623 -16.850 36.250  1.00 14.41 ? 327 ARG A NE  1 
ATOM   1345 C CZ  . ARG B 2 16  ? -13.440 -15.543 36.417  1.00 16.28 ? 327 ARG A CZ  1 
ATOM   1346 N NH1 . ARG B 2 16  ? -12.396 -15.107 37.111  1.00 16.14 ? 327 ARG A NH1 1 
ATOM   1347 N NH2 . ARG B 2 16  ? -14.291 -14.672 35.881  1.00 15.06 ? 327 ARG A NH2 1 
ATOM   1348 N N   . PHE B 2 17  ? -11.635 -20.956 32.237  1.00 13.83 ? 328 PHE A N   1 
ATOM   1349 C CA  . PHE B 2 17  ? -11.477 -21.029 30.783  1.00 16.06 ? 328 PHE A CA  1 
ATOM   1350 C C   . PHE B 2 17  ? -12.088 -22.318 30.249  1.00 17.10 ? 328 PHE A C   1 
ATOM   1351 O O   . PHE B 2 17  ? -12.806 -22.306 29.255  1.00 17.26 ? 328 PHE A O   1 
ATOM   1352 C CB  . PHE B 2 17  ? -9.987  -20.928 30.400  1.00 12.11 ? 328 PHE A CB  1 
ATOM   1353 C CG  . PHE B 2 17  ? -9.718  -21.031 28.912  1.00 16.98 ? 328 PHE A CG  1 
ATOM   1354 C CD1 . PHE B 2 17  ? -9.910  -19.936 28.089  1.00 12.98 ? 328 PHE A CD1 1 
ATOM   1355 C CD2 . PHE B 2 17  ? -9.245  -22.209 28.361  1.00 17.55 ? 328 PHE A CD2 1 
ATOM   1356 C CE1 . PHE B 2 17  ? -9.656  -20.010 26.726  1.00 13.90 ? 328 PHE A CE1 1 
ATOM   1357 C CE2 . PHE B 2 17  ? -8.993  -22.297 26.991  1.00 21.96 ? 328 PHE A CE2 1 
ATOM   1358 C CZ  . PHE B 2 17  ? -9.199  -21.193 26.181  1.00 18.01 ? 328 PHE A CZ  1 
ATOM   1359 N N   . GLU B 2 18  ? -11.803 -23.433 30.912  1.00 15.64 ? 329 GLU A N   1 
ATOM   1360 C CA  . GLU B 2 18  ? -12.370 -24.713 30.505  1.00 19.14 ? 329 GLU A CA  1 
ATOM   1361 C C   . GLU B 2 18  ? -13.895 -24.733 30.605  1.00 18.89 ? 329 GLU A C   1 
ATOM   1362 O O   . GLU B 2 18  ? -14.565 -25.353 29.776  1.00 20.20 ? 329 GLU A O   1 
ATOM   1363 C CB  . GLU B 2 18  ? -11.766 -25.847 31.334  1.00 19.79 ? 329 GLU A CB  1 
ATOM   1364 C CG  . GLU B 2 18  ? -10.290 -26.075 31.042  1.00 22.73 ? 329 GLU A CG  1 
ATOM   1365 C CD  . GLU B 2 18  ? -10.026 -26.394 29.574  1.00 30.97 ? 329 GLU A CD  1 
ATOM   1366 O OE1 . GLU B 2 18  ? -10.812 -27.157 28.970  1.00 34.99 ? 329 GLU A OE1 1 
ATOM   1367 O OE2 . GLU B 2 18  ? -9.040  -25.869 29.014  1.00 34.30 ? 329 GLU A OE2 1 
ATOM   1368 N N   . GLU B 2 19  ? -14.452 -24.045 31.602  1.00 18.74 ? 330 GLU A N   1 
ATOM   1369 C CA  . GLU B 2 19  ? -15.912 -23.940 31.728  1.00 21.79 ? 330 GLU A CA  1 
ATOM   1370 C C   . GLU B 2 19  ? -16.591 -23.226 30.566  1.00 22.47 ? 330 GLU A C   1 
ATOM   1371 O O   . GLU B 2 19  ? -17.697 -23.596 30.195  1.00 23.22 ? 330 GLU A O   1 
ATOM   1372 C CB  . GLU B 2 19  ? -16.290 -23.238 33.028  1.00 26.17 ? 330 GLU A CB  1 
ATOM   1373 C CG  . GLU B 2 19  ? -16.022 -24.067 34.238  1.00 27.97 ? 330 GLU A CG  1 
ATOM   1374 C CD  . GLU B 2 19  ? -16.848 -25.341 34.286  1.00 27.40 ? 330 GLU A CD  1 
ATOM   1375 O OE1 . GLU B 2 19  ? -18.068 -25.284 34.029  1.00 31.97 ? 330 GLU A OE1 1 
ATOM   1376 O OE2 . GLU B 2 19  ? -16.257 -26.407 34.560  1.00 37.56 ? 330 GLU A OE2 1 
ATOM   1377 N N   . LEU B 2 20  ? -15.948 -22.201 30.005  1.00 23.08 ? 331 LEU A N   1 
ATOM   1378 C CA  . LEU B 2 20  ? -16.443 -21.555 28.784  1.00 24.26 ? 331 LEU A CA  1 
ATOM   1379 C C   . LEU B 2 20  ? -16.599 -22.513 27.628  1.00 27.83 ? 331 LEU A C   1 
ATOM   1380 O O   . LEU B 2 20  ? -17.465 -22.331 26.778  1.00 30.89 ? 331 LEU A O   1 
ATOM   1381 C CB  . LEU B 2 20  ? -15.510 -20.437 28.318  1.00 24.19 ? 331 LEU A CB  1 
ATOM   1382 C CG  . LEU B 2 20  ? -15.391 -19.120 29.068  1.00 22.64 ? 331 LEU A CG  1 
ATOM   1383 C CD1 . LEU B 2 20  ? -14.265 -18.303 28.450  1.00 22.62 ? 331 LEU A CD1 1 
ATOM   1384 C CD2 . LEU B 2 20  ? -16.700 -18.362 28.969  1.00 23.09 ? 331 LEU A CD2 1 
ATOM   1385 N N   . LYS B 2 21  ? -15.722 -23.506 27.575  1.00 28.67 ? 332 LYS A N   1 
ATOM   1386 C CA  . LYS B 2 21  ? -15.655 -24.399 26.430  1.00 30.55 ? 332 LYS A CA  1 
ATOM   1387 C C   . LYS B 2 21  ? -16.624 -25.567 26.575  1.00 33.38 ? 332 LYS A C   1 
ATOM   1388 O O   . LYS B 2 21  ? -16.797 -26.360 25.646  1.00 40.72 ? 332 LYS A O   1 
ATOM   1389 C CB  . LYS B 2 21  ? -14.214 -24.891 26.243  1.00 27.18 ? 332 LYS A CB  1 
ATOM   1390 C CG  . LYS B 2 21  ? -13.265 -23.777 25.805  1.00 28.21 ? 332 LYS A CG  1 
ATOM   1391 C CD  . LYS B 2 21  ? -11.804 -24.198 25.913  1.00 28.89 ? 332 LYS A CD  1 
ATOM   1392 C CE  . LYS B 2 21  ? -11.555 -25.539 25.247  1.00 38.93 ? 332 LYS A CE  1 
ATOM   1393 N N   . LYS B 2 22  ? -17.275 -25.653 27.729  1.00 32.36 ? 333 LYS A N   1 
ATOM   1394 C CA  . LYS B 2 22  ? -18.233 -26.723 27.982  1.00 31.06 ? 333 LYS A CA  1 
ATOM   1395 C C   . LYS B 2 22  ? -19.641 -26.333 27.537  1.00 36.36 ? 333 LYS A C   1 
ATOM   1396 O O   . LYS B 2 22  ? -19.880 -25.206 27.097  1.00 41.78 ? 333 LYS A O   1 
ATOM   1397 C CB  . LYS B 2 22  ? -18.235 -27.099 29.468  1.00 29.88 ? 333 LYS A CB  1 
HETATM 1398 O O   . HOH C 3 .   ? -24.879 1.452   31.599  1.00 24.14 ? 201 HOH B O   1 
HETATM 1399 O O   . HOH C 3 .   ? -9.349  -11.180 -7.463  1.00 22.36 ? 202 HOH B O   1 
HETATM 1400 O O   . HOH C 3 .   ? -24.032 -4.637  27.224  1.00 24.73 ? 203 HOH B O   1 
HETATM 1401 O O   . HOH C 3 .   ? -12.477 -12.378 37.895  1.00 22.21 ? 204 HOH B O   1 
HETATM 1402 O O   . HOH C 3 .   ? 3.338   -4.577  32.136  1.00 25.08 ? 205 HOH B O   1 
HETATM 1403 O O   . HOH C 3 .   ? 13.760  -1.917  -2.753  1.00 36.42 ? 206 HOH B O   1 
HETATM 1404 O O   . HOH C 3 .   ? 0.751   7.462   6.723   1.00 41.49 ? 207 HOH B O   1 
HETATM 1405 O O   . HOH C 3 .   ? -26.044 -3.027  25.977  1.00 43.77 ? 208 HOH B O   1 
HETATM 1406 O O   . HOH C 3 .   ? -0.752  -18.779 18.920  1.00 25.77 ? 209 HOH B O   1 
HETATM 1407 O O   . HOH C 3 .   ? -28.634 -11.627 24.642  1.00 14.34 ? 210 HOH B O   1 
HETATM 1408 O O   . HOH C 3 .   ? 9.427   -6.222  3.703   1.00 37.97 ? 211 HOH B O   1 
HETATM 1409 O O   . HOH C 3 .   ? -17.880 -13.462 35.934  1.00 33.91 ? 212 HOH B O   1 
HETATM 1410 O O   . HOH C 3 .   ? -16.140 -19.746 33.300  1.00 19.08 ? 213 HOH B O   1 
HETATM 1411 O O   . HOH C 3 .   ? -0.997  -14.367 41.219  1.00 28.31 ? 214 HOH B O   1 
HETATM 1412 O O   . HOH C 3 .   ? -13.893 -10.953 -0.123  1.00 21.68 ? 215 HOH B O   1 
HETATM 1413 O O   . HOH C 3 .   ? -8.833  -25.036 6.651   1.00 23.34 ? 216 HOH B O   1 
HETATM 1414 O O   . HOH C 3 .   ? -25.087 -26.167 11.306  1.00 22.88 ? 217 HOH B O   1 
HETATM 1415 O O   . HOH C 3 .   ? -2.319  -19.745 22.230  1.00 26.46 ? 218 HOH B O   1 
HETATM 1416 O O   . HOH C 3 .   ? 2.077   -7.674  -3.704  1.00 23.01 ? 219 HOH B O   1 
HETATM 1417 O O   . HOH C 3 .   ? -20.566 -16.212 2.968   1.00 43.63 ? 220 HOH B O   1 
HETATM 1418 O O   . HOH C 3 .   ? -6.182  -2.212  -11.847 1.00 21.19 ? 221 HOH B O   1 
HETATM 1419 O O   . HOH C 3 .   ? 7.869   7.060   -5.101  1.00 28.34 ? 222 HOH B O   1 
HETATM 1420 O O   . HOH C 3 .   ? -3.304  -13.907 -6.619  1.00 12.63 ? 223 HOH B O   1 
HETATM 1421 O O   . HOH C 3 .   ? -2.054  1.108   -6.192  1.00 18.13 ? 224 HOH B O   1 
HETATM 1422 O O   . HOH C 3 .   ? 1.890   -15.461 21.796  1.00 22.30 ? 225 HOH B O   1 
HETATM 1423 O O   . HOH C 3 .   ? -2.317  -11.741 -3.064  1.00 12.05 ? 226 HOH B O   1 
HETATM 1424 O O   . HOH C 3 .   ? -15.174 -25.937 11.452  1.00 20.52 ? 227 HOH B O   1 
HETATM 1425 O O   . HOH C 3 .   ? -26.614 -17.235 27.133  1.00 27.29 ? 228 HOH B O   1 
HETATM 1426 O O   . HOH C 3 .   ? -14.634 -23.055 7.212   1.00 16.63 ? 229 HOH B O   1 
HETATM 1427 O O   . HOH C 3 .   ? -0.669  -12.029 42.765  1.00 24.52 ? 230 HOH B O   1 
HETATM 1428 O O   . HOH C 3 .   ? 1.529   -16.345 14.402  1.00 23.31 ? 231 HOH B O   1 
HETATM 1429 O O   . HOH C 3 .   ? -24.279 -17.309 14.121  1.00 24.21 ? 232 HOH B O   1 
HETATM 1430 O O   . HOH C 3 .   ? 2.253   -19.717 2.568   1.00 20.32 ? 233 HOH B O   1 
HETATM 1431 O O   . HOH C 3 .   ? -12.477 -2.777  -4.649  1.00 32.54 ? 234 HOH B O   1 
HETATM 1432 O O   . HOH C 3 .   ? 0.207   -14.639 19.454  1.00 21.10 ? 235 HOH B O   1 
HETATM 1433 O O   . HOH C 3 .   ? -17.840 -16.335 37.047  1.00 30.78 ? 236 HOH B O   1 
HETATM 1434 O O   . HOH C 3 .   ? 4.390   5.130   -1.432  1.00 27.53 ? 237 HOH B O   1 
HETATM 1435 O O   . HOH C 3 .   ? -13.321 -25.210 10.200  1.00 28.15 ? 238 HOH B O   1 
HETATM 1436 O O   . HOH C 3 .   ? 7.086   -16.204 6.116   1.00 27.82 ? 239 HOH B O   1 
HETATM 1437 O O   . HOH C 3 .   ? -27.805 -1.982  31.953  1.00 33.69 ? 240 HOH B O   1 
HETATM 1438 O O   . HOH C 3 .   ? -3.794  3.196   -3.829  1.00 34.03 ? 241 HOH B O   1 
HETATM 1439 O O   . HOH C 3 .   ? -24.543 -19.450 12.164  1.00 24.61 ? 242 HOH B O   1 
HETATM 1440 O O   . HOH C 3 .   ? -8.241  -8.081  -9.352  1.00 19.30 ? 243 HOH B O   1 
HETATM 1441 O O   . HOH C 3 .   ? -9.667  -0.027  -4.100  1.00 24.28 ? 244 HOH B O   1 
HETATM 1442 O O   . HOH C 3 .   ? -16.428 -2.174  34.395  1.00 26.67 ? 245 HOH B O   1 
HETATM 1443 O O   . HOH C 3 .   ? -18.912 -11.503 34.070  1.00 21.64 ? 246 HOH B O   1 
HETATM 1444 O O   . HOH C 3 .   ? 11.345  6.605   -2.445  1.00 30.52 ? 247 HOH B O   1 
HETATM 1445 O O   . HOH C 3 .   ? -19.208 -16.032 6.839   1.00 30.18 ? 248 HOH B O   1 
HETATM 1446 O O   . HOH C 3 .   ? -24.412 -22.052 9.997   1.00 16.73 ? 249 HOH B O   1 
HETATM 1447 O O   . HOH C 3 .   ? -3.959  -21.564 20.990  1.00 28.23 ? 250 HOH B O   1 
HETATM 1448 O O   . HOH C 3 .   ? -4.441  -30.137 6.823   1.00 27.03 ? 251 HOH B O   1 
HETATM 1449 O O   . HOH C 3 .   ? 6.832   -8.327  35.705  1.00 30.24 ? 252 HOH B O   1 
HETATM 1450 O O   . HOH C 3 .   ? -4.069  -27.397 1.919   1.00 30.96 ? 253 HOH B O   1 
HETATM 1451 O O   . HOH C 3 .   ? 5.560   -4.163  -9.509  1.00 25.84 ? 254 HOH B O   1 
HETATM 1452 O O   . HOH C 3 .   ? -12.058 -5.675  -8.538  1.00 38.70 ? 255 HOH B O   1 
HETATM 1453 O O   . HOH C 3 .   ? 0.144   -21.756 15.060  1.00 29.54 ? 256 HOH B O   1 
HETATM 1454 O O   . HOH C 3 .   ? -8.255  0.404   28.746  1.00 23.07 ? 257 HOH B O   1 
HETATM 1455 O O   . HOH C 3 .   ? 0.519   -7.363  -7.243  1.00 23.13 ? 258 HOH B O   1 
HETATM 1456 O O   . HOH C 3 .   ? -11.493 -8.847  -10.225 1.00 33.05 ? 259 HOH B O   1 
HETATM 1457 O O   . HOH C 3 .   ? -21.454 -7.198  33.966  1.00 26.49 ? 260 HOH B O   1 
HETATM 1458 O O   . HOH C 3 .   ? 1.060   -25.696 5.329   1.00 25.07 ? 261 HOH B O   1 
HETATM 1459 O O   . HOH C 3 .   ? -12.361 -25.116 5.849   1.00 25.75 ? 262 HOH B O   1 
HETATM 1460 O O   . HOH C 3 .   ? -10.704 -4.448  -10.557 1.00 33.02 ? 263 HOH B O   1 
HETATM 1461 O O   . HOH C 3 .   ? 2.621   -7.282  38.544  1.00 24.84 ? 264 HOH B O   1 
HETATM 1462 O O   . HOH C 3 .   ? -11.497 -3.932  33.484  1.00 32.10 ? 265 HOH B O   1 
HETATM 1463 O O   . HOH C 3 .   ? -10.366 -25.904 10.290  1.00 31.15 ? 266 HOH B O   1 
HETATM 1464 O O   . HOH C 3 .   ? -0.615  -6.171  -9.467  1.00 23.19 ? 267 HOH B O   1 
HETATM 1465 O O   . HOH C 3 .   ? 10.880  -12.767 1.740   1.00 27.96 ? 268 HOH B O   1 
HETATM 1466 O O   . HOH C 3 .   ? -27.808 -18.814 15.629  1.00 26.69 ? 269 HOH B O   1 
HETATM 1467 O O   . HOH C 3 .   ? 4.546   -10.189 -3.836  1.00 28.26 ? 270 HOH B O   1 
HETATM 1468 O O   . HOH C 3 .   ? 6.041   -18.297 29.473  1.00 36.43 ? 271 HOH B O   1 
HETATM 1469 O O   . HOH C 3 .   ? 1.320   -27.242 7.564   1.00 32.29 ? 272 HOH B O   1 
HETATM 1470 O O   . HOH C 3 .   ? -0.838  -23.162 39.661  1.00 37.98 ? 273 HOH B O   1 
HETATM 1471 O O   . HOH C 3 .   ? -26.167 -13.434 18.965  1.00 28.51 ? 274 HOH B O   1 
HETATM 1472 O O   . HOH C 3 .   ? 3.983   1.807   -10.756 1.00 30.64 ? 275 HOH B O   1 
HETATM 1473 O O   . HOH C 3 .   ? 10.463  -4.728  -4.225  1.00 24.39 ? 276 HOH B O   1 
HETATM 1474 O O   . HOH C 3 .   ? 12.862  5.540   1.605   1.00 27.98 ? 277 HOH B O   1 
HETATM 1475 O O   . HOH C 3 .   ? -18.215 -15.809 8.390   1.00 25.82 ? 278 HOH B O   1 
HETATM 1476 O O   . HOH C 3 .   ? 5.176   -15.254 37.089  1.00 28.78 ? 279 HOH B O   1 
HETATM 1477 O O   . HOH C 3 .   ? -10.475 -2.233  33.843  1.00 29.16 ? 280 HOH B O   1 
HETATM 1478 O O   . HOH C 3 .   ? -7.097  -30.793 16.725  1.00 33.22 ? 281 HOH B O   1 
HETATM 1479 O O   . HOH C 3 .   ? 9.293   -2.997  -2.392  1.00 38.72 ? 282 HOH B O   1 
HETATM 1480 O O   . HOH C 3 .   ? -12.797 -10.731 -3.403  1.00 21.56 ? 283 HOH B O   1 
HETATM 1481 O O   . HOH C 3 .   ? -6.446  -16.562 -12.903 1.00 28.41 ? 284 HOH B O   1 
HETATM 1482 O O   . HOH C 3 .   ? -19.486 -13.354 1.402   1.00 35.06 ? 285 HOH B O   1 
HETATM 1483 O O   . HOH C 3 .   ? -22.261 -15.666 3.927   1.00 42.13 ? 286 HOH B O   1 
HETATM 1484 O O   . HOH C 3 .   ? 1.014   -19.558 0.668   1.00 26.76 ? 287 HOH B O   1 
HETATM 1485 O O   . HOH C 3 .   ? -31.498 -18.845 17.189  1.00 38.80 ? 288 HOH B O   1 
HETATM 1486 O O   . HOH C 3 .   ? 3.481   -22.378 10.976  1.00 31.27 ? 289 HOH B O   1 
HETATM 1487 O O   . HOH C 3 .   ? 4.719   -17.281 35.673  1.00 39.85 ? 290 HOH B O   1 
HETATM 1488 O O   . HOH C 3 .   ? -4.850  -17.313 -7.835  1.00 34.09 ? 291 HOH B O   1 
HETATM 1489 O O   . HOH C 3 .   ? -1.966  -1.228  34.835  1.00 31.10 ? 292 HOH B O   1 
HETATM 1490 O O   . HOH C 3 .   ? -26.410 -9.760  21.090  1.00 35.13 ? 293 HOH B O   1 
HETATM 1491 O O   . HOH C 3 .   ? -27.023 -20.875 25.527  1.00 41.82 ? 294 HOH B O   1 
HETATM 1492 O O   . HOH C 3 .   ? -8.726  -1.825  35.066  1.00 27.24 ? 295 HOH B O   1 
HETATM 1493 O O   . HOH C 3 .   ? -19.995 -1.688  26.714  1.00 38.71 ? 296 HOH B O   1 
HETATM 1494 O O   . HOH C 3 .   ? -11.892 -12.211 -9.210  1.00 21.23 ? 297 HOH B O   1 
HETATM 1495 O O   . HOH C 3 .   ? 3.637   -19.447 25.796  1.00 39.34 ? 298 HOH B O   1 
HETATM 1496 O O   . HOH C 3 .   ? -23.427 -6.989  20.514  1.00 38.87 ? 299 HOH B O   1 
HETATM 1497 O O   . HOH C 3 .   ? 3.422   -18.328 13.697  1.00 33.37 ? 300 HOH B O   1 
HETATM 1498 O O   . HOH C 3 .   ? -1.672  -19.236 0.008   1.00 26.11 ? 301 HOH B O   1 
HETATM 1499 O O   . HOH C 3 .   ? -23.411 2.319   28.965  1.00 29.01 ? 302 HOH B O   1 
HETATM 1500 O O   . HOH C 3 .   ? -2.574  -12.899 45.896  1.00 32.00 ? 303 HOH B O   1 
HETATM 1501 O O   . HOH C 3 .   ? 1.997   -27.924 3.555   1.00 35.57 ? 304 HOH B O   1 
HETATM 1502 O O   . HOH C 3 .   ? 3.558   -3.973  25.321  1.00 38.02 ? 305 HOH B O   1 
HETATM 1503 O O   . HOH C 3 .   ? -24.445 -9.922  20.893  1.00 41.10 ? 306 HOH B O   1 
HETATM 1504 O O   . HOH C 3 .   ? -12.613 -6.489  -10.309 1.00 41.15 ? 307 HOH B O   1 
HETATM 1505 O O   . HOH C 3 .   ? 0.738   -28.545 1.634   1.00 37.51 ? 308 HOH B O   1 
HETATM 1506 O O   . HOH C 3 .   ? -9.367  -21.931 4.599   1.00 31.51 ? 309 HOH B O   1 
HETATM 1507 O O   . HOH C 3 .   ? -10.379 0.541   25.268  1.00 38.50 ? 310 HOH B O   1 
HETATM 1508 O O   . HOH C 3 .   ? -7.588  -4.387  -12.698 1.00 30.02 ? 311 HOH B O   1 
HETATM 1509 O O   . HOH C 3 .   ? -7.058  3.578   -2.250  1.00 36.25 ? 312 HOH B O   1 
HETATM 1510 O O   . HOH C 3 .   ? 1.563   -19.893 9.190   1.00 14.15 ? 313 HOH B O   1 
HETATM 1511 O O   . HOH C 3 .   ? -2.466  -3.647  33.497  1.00 18.33 ? 314 HOH B O   1 
HETATM 1512 O O   . HOH C 3 .   ? -3.718  -5.579  34.864  1.00 19.16 ? 315 HOH B O   1 
HETATM 1513 O O   . HOH C 3 .   ? -11.126 -6.564  -3.734  1.00 18.03 ? 316 HOH B O   1 
HETATM 1514 O O   . HOH C 3 .   ? -16.491 -20.881 24.114  1.00 21.00 ? 317 HOH B O   1 
HETATM 1515 O O   . HOH C 3 .   ? -19.667 -28.450 17.063  1.00 23.34 ? 318 HOH B O   1 
HETATM 1516 O O   . HOH C 3 .   ? -0.134  -8.918  18.554  1.00 22.43 ? 319 HOH B O   1 
HETATM 1517 O O   . HOH C 3 .   ? -12.553 -4.874  25.804  1.00 24.88 ? 320 HOH B O   1 
HETATM 1518 O O   . HOH C 3 .   ? 4.861   -14.821 6.918   1.00 16.34 ? 321 HOH B O   1 
HETATM 1519 O O   . HOH C 3 .   ? -7.416  -20.502 6.079   1.00 19.92 ? 322 HOH B O   1 
HETATM 1520 O O   . HOH C 3 .   ? -7.484  -6.329  12.904  1.00 23.09 ? 323 HOH B O   1 
HETATM 1521 O O   . HOH C 3 .   ? -9.142  -23.869 23.429  1.00 23.25 ? 324 HOH B O   1 
HETATM 1522 O O   . HOH C 3 .   ? -6.516  -2.939  27.438  1.00 24.47 ? 325 HOH B O   1 
HETATM 1523 O O   . HOH C 3 .   ? -8.107  -24.954 14.379  1.00 23.87 ? 326 HOH B O   1 
HETATM 1524 O O   . HOH C 3 .   ? -23.764 -14.062 14.808  1.00 29.52 ? 327 HOH B O   1 
HETATM 1525 O O   . HOH C 3 .   ? -14.184 -7.265  32.724  1.00 20.94 ? 328 HOH B O   1 
HETATM 1526 O O   . HOH C 3 .   ? -4.882  -4.017  36.713  1.00 29.60 ? 329 HOH B O   1 
HETATM 1527 O O   . HOH C 3 .   ? -17.393 -3.064  15.707  1.00 28.51 ? 330 HOH B O   1 
HETATM 1528 O O   . HOH C 3 .   ? -10.207 -2.925  26.736  1.00 25.90 ? 331 HOH B O   1 
HETATM 1529 O O   . HOH C 3 .   ? -21.341 -17.178 30.512  1.00 26.87 ? 332 HOH B O   1 
HETATM 1530 O O   . HOH C 3 .   ? -23.600 -27.710 15.063  1.00 34.23 ? 333 HOH B O   1 
HETATM 1531 O O   . HOH C 3 .   ? -8.650  -25.069 11.612  1.00 27.72 ? 334 HOH B O   1 
HETATM 1532 O O   . HOH C 3 .   ? -7.707  -17.085 4.584   1.00 22.88 ? 335 HOH B O   1 
HETATM 1533 O O   . HOH C 3 .   ? -21.802 -13.160 13.789  1.00 25.50 ? 336 HOH B O   1 
HETATM 1534 O O   . HOH C 3 .   ? -10.071 -5.351  13.016  1.00 25.68 ? 337 HOH B O   1 
HETATM 1535 O O   . HOH C 3 .   ? -9.021  -18.812 6.239   1.00 22.77 ? 338 HOH B O   1 
HETATM 1536 O O   . HOH C 3 .   ? -11.674 -1.375  -1.507  1.00 30.15 ? 339 HOH B O   1 
HETATM 1537 O O   . HOH C 3 .   ? -7.260  2.333   2.454   1.00 25.24 ? 340 HOH B O   1 
HETATM 1538 O O   . HOH C 3 .   ? -14.908 -7.370  35.360  1.00 25.99 ? 341 HOH B O   1 
HETATM 1539 O O   . HOH C 3 .   ? 1.682   -5.044  25.730  1.00 25.73 ? 342 HOH B O   1 
HETATM 1540 O O   . HOH C 3 .   ? -18.235 -13.538 7.221   1.00 32.72 ? 343 HOH B O   1 
HETATM 1541 O O   . HOH C 3 .   ? -21.895 -29.354 15.969  1.00 32.70 ? 344 HOH B O   1 
HETATM 1542 O O   . HOH C 3 .   ? 4.656   -13.179 13.026  1.00 32.73 ? 345 HOH B O   1 
HETATM 1543 O O   . HOH C 3 .   ? -22.496 -12.243 11.382  1.00 34.65 ? 346 HOH B O   1 
HETATM 1544 O O   . HOH C 3 .   ? -8.991  -14.596 39.486  1.00 31.56 ? 347 HOH B O   1 
HETATM 1545 O O   . HOH C 3 .   ? -11.981 -6.435  4.310   1.00 29.01 ? 348 HOH B O   1 
HETATM 1546 O O   . HOH C 3 .   ? -0.071  0.378   6.687   1.00 32.57 ? 349 HOH B O   1 
HETATM 1547 O O   . HOH C 3 .   ? -13.117 -27.496 18.333  1.00 33.44 ? 350 HOH B O   1 
HETATM 1548 O O   . HOH C 3 .   ? -2.926  -25.160 -1.267  1.00 33.80 ? 351 HOH B O   1 
HETATM 1549 O O   . HOH C 3 .   ? -12.700 -3.726  3.161   1.00 34.79 ? 352 HOH B O   1 
HETATM 1550 O O   . HOH C 3 .   ? -19.363 -7.856  21.112  1.00 28.94 ? 353 HOH B O   1 
HETATM 1551 O O   . HOH C 3 .   ? -13.507 -4.931  32.294  1.00 32.56 ? 354 HOH B O   1 
HETATM 1552 O O   . HOH C 3 .   ? -6.466  -25.102 21.554  1.00 30.12 ? 355 HOH B O   1 
HETATM 1553 O O   . HOH C 3 .   ? 0.035   -1.171  27.892  1.00 33.32 ? 356 HOH B O   1 
HETATM 1554 O O   . HOH C 3 .   ? 7.384   -9.693  4.109   1.00 25.13 ? 357 HOH B O   1 
HETATM 1555 O O   . HOH C 3 .   ? -2.780  -0.812  7.297   1.00 27.89 ? 358 HOH B O   1 
HETATM 1556 O O   . HOH C 3 .   ? -13.560 -7.964  3.517   1.00 32.82 ? 359 HOH B O   1 
HETATM 1557 O O   . HOH C 3 .   ? 2.360   -5.027  19.611  1.00 32.45 ? 360 HOH B O   1 
HETATM 1558 O O   . HOH C 3 .   ? -3.896  -25.347 18.868  1.00 34.79 ? 361 HOH B O   1 
HETATM 1559 O O   . HOH C 3 .   ? 1.789   -11.753 17.540  1.00 34.57 ? 362 HOH B O   1 
HETATM 1560 O O   . HOH C 3 .   ? -0.805  -27.608 11.764  1.00 35.66 ? 363 HOH B O   1 
HETATM 1561 O O   . HOH C 3 .   ? -0.695  -28.154 9.511   1.00 43.02 ? 364 HOH B O   1 
HETATM 1562 O O   . HOH C 3 .   ? -4.781  -4.179  22.509  1.00 30.82 ? 365 HOH B O   1 
HETATM 1563 O O   . HOH C 3 .   ? -2.955  -2.388  23.887  1.00 36.30 ? 366 HOH B O   1 
HETATM 1564 O O   . HOH C 3 .   ? -27.612 -22.598 19.571  1.00 31.33 ? 367 HOH B O   1 
HETATM 1565 O O   . HOH C 3 .   ? -15.073 -2.829  25.960  1.00 38.57 ? 368 HOH B O   1 
HETATM 1566 O O   . HOH C 3 .   ? -9.713  -27.005 13.861  1.00 38.14 ? 369 HOH B O   1 
HETATM 1567 O O   . HOH C 3 .   ? -3.340  -1.407  26.453  1.00 34.51 ? 370 HOH B O   1 
HETATM 1568 O O   . HOH C 3 .   ? -17.801 -0.578  14.817  1.00 36.71 ? 371 HOH B O   1 
HETATM 1569 O O   . HOH C 3 .   ? 5.817   -12.158 7.636   1.00 30.29 ? 372 HOH B O   1 
HETATM 1570 O O   . HOH C 3 .   ? -14.670 -22.828 22.288  1.00 33.40 ? 373 HOH B O   1 
HETATM 1571 O O   . HOH C 3 .   ? 2.578   -7.434  18.753  1.00 34.36 ? 374 HOH B O   1 
HETATM 1572 O O   . HOH C 3 .   ? -13.716 -27.140 15.627  1.00 33.04 ? 375 HOH B O   1 
HETATM 1573 O O   . HOH C 3 .   ? 1.929   -18.714 34.609  1.00 24.79 ? 376 HOH B O   1 
HETATM 1574 O O   . HOH C 3 .   ? -0.641  -20.076 33.313  1.00 25.66 ? 377 HOH B O   1 
HETATM 1575 O O   . HOH C 3 .   ? -1.715  -26.042 14.763  1.00 29.59 ? 378 HOH B O   1 
HETATM 1576 O O   . HOH C 3 .   ? -18.375 -10.681 10.126  1.00 32.04 ? 379 HOH B O   1 
HETATM 1577 O O   . HOH C 3 .   ? -3.677  -21.844 28.077  1.00 32.45 ? 380 HOH B O   1 
HETATM 1578 O O   . HOH C 3 .   ? -22.485 -8.453  22.164  1.00 38.13 ? 381 HOH B O   1 
HETATM 1579 O O   . HOH C 3 .   ? -18.540 -11.401 7.332   1.00 36.27 ? 382 HOH B O   1 
HETATM 1580 O O   . HOH C 3 .   ? -14.832 -8.442  1.017   1.00 29.74 ? 383 HOH B O   1 
HETATM 1581 O O   . HOH C 3 .   ? -14.395 -4.027  1.310   1.00 42.33 ? 384 HOH B O   1 
HETATM 1582 O O   . HOH C 3 .   ? -19.478 -23.769 24.290  1.00 41.15 ? 385 HOH B O   1 
HETATM 1583 O O   . HOH C 3 .   ? 1.345   -1.592  17.418  1.00 38.22 ? 386 HOH B O   1 
HETATM 1584 O O   . HOH C 3 .   ? -23.744 -20.341 25.415  1.00 39.39 ? 387 HOH B O   1 
HETATM 1585 O O   . HOH C 3 .   ? -23.896 -18.142 24.241  1.00 40.67 ? 388 HOH B O   1 
HETATM 1586 O O   . HOH C 3 .   ? -19.666 -27.486 20.271  1.00 38.88 ? 389 HOH B O   1 
HETATM 1587 O O   . HOH C 3 .   ? -19.115 -24.962 22.216  1.00 47.43 ? 390 HOH B O   1 
HETATM 1588 O O   . HOH C 3 .   ? -6.574  -2.973  22.501  1.00 44.52 ? 391 HOH B O   1 
HETATM 1589 O O   . HOH C 3 .   ? -15.345 -2.268  21.884  1.00 36.77 ? 392 HOH B O   1 
HETATM 1590 O O   . HOH C 3 .   ? 4.136   -9.731  18.720  1.00 44.88 ? 393 HOH B O   1 
HETATM 1591 O O   . HOH D 3 .   ? -8.760  -21.611 44.387  1.00 31.50 ? 401 HOH A O   1 
HETATM 1592 O O   . HOH D 3 .   ? -8.437  -17.474 42.425  1.00 32.31 ? 402 HOH A O   1 
HETATM 1593 O O   . HOH D 3 .   ? -13.326 -26.143 34.933  1.00 27.59 ? 403 HOH A O   1 
HETATM 1594 O O   . HOH D 3 .   ? -7.760  -26.184 34.231  1.00 26.11 ? 404 HOH A O   1 
HETATM 1595 O O   . HOH D 3 .   ? -10.467 -16.507 38.941  1.00 24.37 ? 405 HOH A O   1 
HETATM 1596 O O   . HOH D 3 .   ? -5.547  -20.477 41.389  1.00 28.46 ? 406 HOH A O   1 
HETATM 1597 O O   . HOH D 3 .   ? -4.718  -25.552 41.855  1.00 34.49 ? 407 HOH A O   1 
HETATM 1598 O O   . HOH D 3 .   ? -6.803  -26.495 31.585  1.00 37.79 ? 408 HOH A O   1 
HETATM 1599 O O   . HOH D 3 .   ? 1.371   -23.696 30.193  1.00 44.60 ? 409 HOH A O   1 
HETATM 1600 O O   . HOH D 3 .   ? -1.503  -27.494 40.356  1.00 37.80 ? 410 HOH A O   1 
HETATM 1601 O O   . HOH D 3 .   ? -5.037  -22.652 44.473  1.00 31.01 ? 411 HOH A O   1 
HETATM 1602 O O   . HOH D 3 .   ? -5.973  -18.065 38.870  1.00 26.90 ? 412 HOH A O   1 
HETATM 1603 O O   . HOH D 3 .   ? -7.201  -16.589 39.832  1.00 43.00 ? 413 HOH A O   1 
HETATM 1604 O O   . HOH D 3 .   ? -4.053  -19.936 33.773  1.00 26.73 ? 414 HOH A O   1 
HETATM 1605 O O   . HOH D 3 .   ? -3.360  -17.508 38.262  1.00 28.98 ? 415 HOH A O   1 
HETATM 1606 O O   . HOH D 3 .   ? 1.216   -21.017 36.111  1.00 34.38 ? 416 HOH A O   1 
HETATM 1607 O O   . HOH D 3 .   ? -13.698 -27.488 28.377  1.00 34.93 ? 417 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   0   0   SER SER B . n 
A 1 2   MET 2   1   1   MET MET B . n 
A 1 3   ALA 3   2   2   ALA ALA B . n 
A 1 4   ALA 4   3   3   ALA ALA B . n 
A 1 5   LEU 5   4   4   LEU LEU B . n 
A 1 6   ALA 6   5   5   ALA ALA B . n 
A 1 7   PRO 7   6   6   PRO PRO B . n 
A 1 8   LEU 8   7   7   LEU LEU B . n 
A 1 9   PRO 9   8   8   PRO PRO B . n 
A 1 10  PRO 10  9   9   PRO PRO B . n 
A 1 11  LEU 11  10  10  LEU LEU B . n 
A 1 12  PRO 12  11  11  PRO PRO B . n 
A 1 13  ALA 13  12  12  ALA ALA B . n 
A 1 14  GLN 14  13  13  GLN GLN B . n 
A 1 15  PHE 15  14  14  PHE PHE B . n 
A 1 16  LYS 16  15  15  LYS LYS B . n 
A 1 17  SER 17  16  16  SER SER B . n 
A 1 18  ILE 18  17  17  ILE ILE B . n 
A 1 19  GLN 19  18  18  GLN GLN B . n 
A 1 20  HIS 20  19  19  HIS HIS B . n 
A 1 21  HIS 21  20  20  HIS HIS B . n 
A 1 22  LEU 22  21  21  LEU LEU B . n 
A 1 23  ARG 23  22  22  ARG ARG B . n 
A 1 24  THR 24  23  23  THR THR B . n 
A 1 25  ALA 25  24  24  ALA ALA B . n 
A 1 26  GLN 26  25  25  GLN GLN B . n 
A 1 27  GLU 27  26  26  GLU GLU B . n 
A 1 28  HIS 28  27  27  HIS HIS B . n 
A 1 29  ASP 29  28  28  ASP ASP B . n 
A 1 30  LYS 30  29  29  LYS LYS B . n 
A 1 31  ARG 31  30  30  ARG ARG B . n 
A 1 32  ASP 32  31  31  ASP ASP B . n 
A 1 33  PRO 33  32  32  PRO PRO B . n 
A 1 34  VAL 34  33  33  VAL VAL B . n 
A 1 35  VAL 35  34  34  VAL VAL B . n 
A 1 36  ALA 36  35  35  ALA ALA B . n 
A 1 37  TYR 37  36  36  TYR TYR B . n 
A 1 38  TYR 38  37  37  TYR TYR B . n 
A 1 39  CYS 39  38  38  CYS CYS B . n 
A 1 40  ARG 40  39  39  ARG ARG B . n 
A 1 41  LEU 41  40  40  LEU LEU B . n 
A 1 42  TYR 42  41  41  TYR TYR B . n 
A 1 43  ALA 43  42  42  ALA ALA B . n 
A 1 44  MET 44  43  43  MET MET B . n 
A 1 45  GLN 45  44  44  GLN GLN B . n 
A 1 46  THR 46  45  45  THR THR B . n 
A 1 47  GLY 47  46  46  GLY GLY B . n 
A 1 48  MET 48  47  47  MET MET B . n 
A 1 49  LYS 49  48  48  LYS LYS B . n 
A 1 50  ILE 50  49  49  ILE ILE B . n 
A 1 51  ASP 51  50  50  ASP ASP B . n 
A 1 52  SER 52  51  51  SER SER B . n 
A 1 53  LYS 53  52  52  LYS LYS B . n 
A 1 54  THR 54  53  53  THR THR B . n 
A 1 55  PRO 55  54  54  PRO PRO B . n 
A 1 56  GLU 56  55  55  GLU GLU B . n 
A 1 57  CYS 57  56  56  CYS CYS B . n 
A 1 58  ARG 58  57  57  ARG ARG B . n 
A 1 59  LYS 59  58  58  LYS LYS B . n 
A 1 60  PHE 60  59  59  PHE PHE B . n 
A 1 61  LEU 61  60  60  LEU LEU B . n 
A 1 62  SER 62  61  61  SER SER B . n 
A 1 63  LYS 63  62  62  LYS LYS B . n 
A 1 64  LEU 64  63  63  LEU LEU B . n 
A 1 65  MET 65  64  64  MET MET B . n 
A 1 66  ASP 66  65  65  ASP ASP B . n 
A 1 67  GLN 67  66  66  GLN GLN B . n 
A 1 68  LEU 68  67  67  LEU LEU B . n 
A 1 69  GLU 69  68  68  GLU GLU B . n 
A 1 70  ALA 70  69  69  ALA ALA B . n 
A 1 71  LEU 71  70  70  LEU LEU B . n 
A 1 72  LYS 72  71  71  LYS LYS B . n 
A 1 73  LYS 73  72  72  LYS LYS B . n 
A 1 74  GLN 74  73  73  GLN GLN B . n 
A 1 75  LEU 75  74  74  LEU LEU B . n 
A 1 76  GLY 76  75  75  GLY GLY B . n 
A 1 77  ASP 77  76  76  ASP ASP B . n 
A 1 78  ASN 78  77  77  ASN ASN B . n 
A 1 79  GLU 79  78  78  GLU GLU B . n 
A 1 80  ALA 80  79  79  ALA ALA B . n 
A 1 81  ILE 81  80  80  ILE ILE B . n 
A 1 82  THR 82  81  81  THR THR B . n 
A 1 83  GLN 83  82  82  GLN GLN B . n 
A 1 84  GLU 84  83  83  GLU GLU B . n 
A 1 85  ILE 85  84  84  ILE ILE B . n 
A 1 86  VAL 86  85  85  VAL VAL B . n 
A 1 87  GLY 87  86  86  GLY GLY B . n 
A 1 88  CYS 88  87  87  CYS CYS B . n 
A 1 89  ALA 89  88  88  ALA ALA B . n 
A 1 90  HIS 90  89  89  HIS HIS B . n 
A 1 91  LEU 91  90  90  LEU LEU B . n 
A 1 92  GLU 92  91  91  GLU GLU B . n 
A 1 93  ASN 93  92  92  ASN ASN B . n 
A 1 94  TYR 94  93  93  TYR TYR B . n 
A 1 95  ALA 95  94  94  ALA ALA B . n 
A 1 96  LEU 96  95  95  LEU LEU B . n 
A 1 97  LYS 97  96  96  LYS LYS B . n 
A 1 98  MET 98  97  97  MET MET B . n 
A 1 99  PHE 99  98  98  PHE PHE B . n 
A 1 100 LEU 100 99  99  LEU LEU B . n 
A 1 101 TYR 101 100 100 TYR TYR B . n 
A 1 102 ALA 102 101 101 ALA ALA B . n 
A 1 103 ASP 103 102 102 ASP ASP B . n 
A 1 104 ASN 104 103 103 ASN ASN B . n 
A 1 105 GLU 105 104 104 GLU GLU B . n 
A 1 106 ASP 106 105 105 ASP ASP B . n 
A 1 107 ARG 107 106 106 ARG ARG B . n 
A 1 108 ALA 108 107 107 ALA ALA B . n 
A 1 109 GLY 109 108 108 GLY GLY B . n 
A 1 110 ARG 110 109 109 ARG ARG B . n 
A 1 111 PHE 111 110 110 PHE PHE B . n 
A 1 112 HIS 112 111 111 HIS HIS B . n 
A 1 113 LYS 113 112 112 LYS LYS B . n 
A 1 114 ASN 114 113 113 ASN ASN B . n 
A 1 115 MET 115 114 114 MET MET B . n 
A 1 116 ILE 116 115 115 ILE ILE B . n 
A 1 117 LYS 117 116 116 LYS LYS B . n 
A 1 118 SER 118 117 117 SER SER B . n 
A 1 119 PHE 119 118 118 PHE PHE B . n 
A 1 120 TYR 120 119 119 TYR TYR B . n 
A 1 121 THR 121 120 120 THR THR B . n 
A 1 122 ALA 122 121 121 ALA ALA B . n 
A 1 123 SER 123 122 122 SER SER B . n 
A 1 124 LEU 124 123 123 LEU LEU B . n 
A 1 125 LEU 125 124 124 LEU LEU B . n 
A 1 126 ILE 126 125 125 ILE ILE B . n 
A 1 127 ASP 127 126 126 ASP ASP B . n 
A 1 128 VAL 128 127 127 VAL VAL B . n 
A 1 129 ILE 129 128 128 ILE ILE B . n 
A 1 130 THR 130 129 129 THR THR B . n 
A 1 131 VAL 131 130 130 VAL VAL B . n 
A 1 132 PHE 132 131 131 PHE PHE B . n 
A 1 133 GLY 133 132 132 GLY GLY B . n 
A 1 134 GLU 134 133 133 GLU GLU B . n 
A 1 135 LEU 135 134 134 LEU LEU B . n 
A 1 136 THR 136 135 135 THR THR B . n 
A 1 137 ASP 137 136 136 ASP ASP B . n 
A 1 138 GLU 138 137 137 GLU GLU B . n 
A 1 139 ASN 139 138 138 ASN ASN B . n 
A 1 140 VAL 140 139 139 VAL VAL B . n 
A 1 141 LYS 141 140 140 LYS LYS B . n 
A 1 142 HIS 142 141 141 HIS HIS B . n 
A 1 143 ARG 143 142 142 ARG ARG B . n 
A 1 144 LYS 144 143 143 LYS LYS B . n 
A 1 145 TYR 145 144 144 TYR TYR B . n 
A 1 146 ALA 146 145 145 ALA ALA B . n 
A 1 147 ARG 147 146 146 ARG ARG B . n 
A 1 148 TRP 148 147 147 TRP TRP B . n 
A 1 149 LYS 149 148 148 LYS LYS B . n 
A 1 150 ALA 150 149 149 ALA ALA B . n 
A 1 151 THR 151 150 150 THR THR B . n 
A 1 152 TYR 152 151 151 TYR TYR B . n 
A 1 153 ILE 153 152 152 ILE ILE B . n 
A 1 154 HIS 154 153 153 HIS HIS B . n 
A 1 155 ASN 155 154 154 ASN ASN B . n 
A 1 156 CYS 156 155 155 CYS CYS B . n 
A 1 157 LEU 157 156 156 LEU LEU B . n 
A 1 158 LYS 158 157 157 LYS LYS B . n 
A 1 159 ASN 159 158 158 ASN ASN B . n 
A 1 160 GLY 160 159 159 GLY GLY B . n 
A 1 161 GLU 161 160 160 GLU GLU B . n 
A 1 162 THR 162 161 161 THR THR B . n 
A 1 163 PRO 163 162 162 PRO PRO B . n 
B 2 1   SER 1   312 ?   ?   ?   A . n 
B 2 2   THR 2   313 ?   ?   ?   A . n 
B 2 3   SER 3   314 ?   ?   ?   A . n 
B 2 4   ALA 4   315 ?   ?   ?   A . n 
B 2 5   SER 5   316 ?   ?   ?   A . n 
B 2 6   GLU 6   317 ?   ?   ?   A . n 
B 2 7   ASP 7   318 ?   ?   ?   A . n 
B 2 8   ILE 8   319 ?   ?   ?   A . n 
B 2 9   ASP 9   320 320 ASP ASP A . n 
B 2 10  PHE 10  321 321 PHE PHE A . n 
B 2 11  ASP 11  322 322 ASP ASP A . n 
B 2 12  ASP 12  323 323 ASP ASP A . n 
B 2 13  LEU 13  324 324 LEU LEU A . n 
B 2 14  SER 14  325 325 SER SER A . n 
B 2 15  ARG 15  326 326 ARG ARG A . n 
B 2 16  ARG 16  327 327 ARG ARG A . n 
B 2 17  PHE 17  328 328 PHE PHE A . n 
B 2 18  GLU 18  329 329 GLU GLU A . n 
B 2 19  GLU 19  330 330 GLU GLU A . n 
B 2 20  LEU 20  331 331 LEU LEU A . n 
B 2 21  LYS 21  332 332 LYS LYS A . n 
B 2 22  LYS 22  333 333 LYS LYS A . n 
B 2 23  LYS 23  334 ?   ?   ?   A . n 
B 2 24  THR 24  335 ?   ?   ?   A . n 
B 2 25  TRP 25  336 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 HOH 1   201 25  HOH HOH B . 
C 3 HOH 2   202 18  HOH HOH B . 
C 3 HOH 3   203 161 HOH HOH B . 
C 3 HOH 4   204 41  HOH HOH B . 
C 3 HOH 5   205 35  HOH HOH B . 
C 3 HOH 6   206 163 HOH HOH B . 
C 3 HOH 7   207 201 HOH HOH B . 
C 3 HOH 8   208 132 HOH HOH B . 
C 3 HOH 9   209 48  HOH HOH B . 
C 3 HOH 10  210 1   HOH HOH B . 
C 3 HOH 11  211 139 HOH HOH B . 
C 3 HOH 12  212 205 HOH HOH B . 
C 3 HOH 13  213 8   HOH HOH B . 
C 3 HOH 14  214 96  HOH HOH B . 
C 3 HOH 15  215 46  HOH HOH B . 
C 3 HOH 16  216 30  HOH HOH B . 
C 3 HOH 17  217 51  HOH HOH B . 
C 3 HOH 18  218 81  HOH HOH B . 
C 3 HOH 19  219 23  HOH HOH B . 
C 3 HOH 20  220 106 HOH HOH B . 
C 3 HOH 21  221 45  HOH HOH B . 
C 3 HOH 22  222 63  HOH HOH B . 
C 3 HOH 23  223 3   HOH HOH B . 
C 3 HOH 24  224 9   HOH HOH B . 
C 3 HOH 25  225 12  HOH HOH B . 
C 3 HOH 26  226 2   HOH HOH B . 
C 3 HOH 27  227 34  HOH HOH B . 
C 3 HOH 28  228 69  HOH HOH B . 
C 3 HOH 29  229 6   HOH HOH B . 
C 3 HOH 30  230 31  HOH HOH B . 
C 3 HOH 31  231 39  HOH HOH B . 
C 3 HOH 32  232 56  HOH HOH B . 
C 3 HOH 33  233 33  HOH HOH B . 
C 3 HOH 34  234 77  HOH HOH B . 
C 3 HOH 35  235 53  HOH HOH B . 
C 3 HOH 36  236 133 HOH HOH B . 
C 3 HOH 37  237 99  HOH HOH B . 
C 3 HOH 38  238 125 HOH HOH B . 
C 3 HOH 39  239 50  HOH HOH B . 
C 3 HOH 40  240 116 HOH HOH B . 
C 3 HOH 41  241 102 HOH HOH B . 
C 3 HOH 42  242 26  HOH HOH B . 
C 3 HOH 43  243 13  HOH HOH B . 
C 3 HOH 44  244 61  HOH HOH B . 
C 3 HOH 45  245 94  HOH HOH B . 
C 3 HOH 46  246 22  HOH HOH B . 
C 3 HOH 47  247 124 HOH HOH B . 
C 3 HOH 48  248 172 HOH HOH B . 
C 3 HOH 49  249 4   HOH HOH B . 
C 3 HOH 50  250 83  HOH HOH B . 
C 3 HOH 51  251 84  HOH HOH B . 
C 3 HOH 52  252 164 HOH HOH B . 
C 3 HOH 53  253 86  HOH HOH B . 
C 3 HOH 54  254 72  HOH HOH B . 
C 3 HOH 55  255 182 HOH HOH B . 
C 3 HOH 56  256 73  HOH HOH B . 
C 3 HOH 57  257 64  HOH HOH B . 
C 3 HOH 58  258 17  HOH HOH B . 
C 3 HOH 59  259 189 HOH HOH B . 
C 3 HOH 60  260 54  HOH HOH B . 
C 3 HOH 61  261 62  HOH HOH B . 
C 3 HOH 62  262 115 HOH HOH B . 
C 3 HOH 63  263 131 HOH HOH B . 
C 3 HOH 64  264 44  HOH HOH B . 
C 3 HOH 65  265 114 HOH HOH B . 
C 3 HOH 66  266 101 HOH HOH B . 
C 3 HOH 67  267 59  HOH HOH B . 
C 3 HOH 68  268 162 HOH HOH B . 
C 3 HOH 69  269 38  HOH HOH B . 
C 3 HOH 70  270 82  HOH HOH B . 
C 3 HOH 71  271 145 HOH HOH B . 
C 3 HOH 72  272 119 HOH HOH B . 
C 3 HOH 73  273 196 HOH HOH B . 
C 3 HOH 74  274 120 HOH HOH B . 
C 3 HOH 75  275 112 HOH HOH B . 
C 3 HOH 76  276 10  HOH HOH B . 
C 3 HOH 77  277 91  HOH HOH B . 
C 3 HOH 78  278 174 HOH HOH B . 
C 3 HOH 79  279 180 HOH HOH B . 
C 3 HOH 80  280 158 HOH HOH B . 
C 3 HOH 81  281 199 HOH HOH B . 
C 3 HOH 82  282 147 HOH HOH B . 
C 3 HOH 83  283 141 HOH HOH B . 
C 3 HOH 84  284 79  HOH HOH B . 
C 3 HOH 85  285 176 HOH HOH B . 
C 3 HOH 86  286 137 HOH HOH B . 
C 3 HOH 87  287 87  HOH HOH B . 
C 3 HOH 88  288 169 HOH HOH B . 
C 3 HOH 89  289 184 HOH HOH B . 
C 3 HOH 90  290 203 HOH HOH B . 
C 3 HOH 91  291 202 HOH HOH B . 
C 3 HOH 92  292 98  HOH HOH B . 
C 3 HOH 93  293 155 HOH HOH B . 
C 3 HOH 94  294 168 HOH HOH B . 
C 3 HOH 95  295 144 HOH HOH B . 
C 3 HOH 96  296 187 HOH HOH B . 
C 3 HOH 97  297 111 HOH HOH B . 
C 3 HOH 98  298 135 HOH HOH B . 
C 3 HOH 99  299 191 HOH HOH B . 
C 3 HOH 100 300 109 HOH HOH B . 
C 3 HOH 101 301 150 HOH HOH B . 
C 3 HOH 102 302 117 HOH HOH B . 
C 3 HOH 103 303 89  HOH HOH B . 
C 3 HOH 104 304 127 HOH HOH B . 
C 3 HOH 105 305 105 HOH HOH B . 
C 3 HOH 106 306 126 HOH HOH B . 
C 3 HOH 107 307 194 HOH HOH B . 
C 3 HOH 108 308 129 HOH HOH B . 
C 3 HOH 109 309 151 HOH HOH B . 
C 3 HOH 110 310 188 HOH HOH B . 
C 3 HOH 111 311 122 HOH HOH B . 
C 3 HOH 112 312 167 HOH HOH B . 
C 3 HOH 113 313 5   HOH HOH B . 
C 3 HOH 114 314 7   HOH HOH B . 
C 3 HOH 115 315 11  HOH HOH B . 
C 3 HOH 116 316 14  HOH HOH B . 
C 3 HOH 117 317 15  HOH HOH B . 
C 3 HOH 118 318 16  HOH HOH B . 
C 3 HOH 119 319 19  HOH HOH B . 
C 3 HOH 120 320 20  HOH HOH B . 
C 3 HOH 121 321 21  HOH HOH B . 
C 3 HOH 122 322 27  HOH HOH B . 
C 3 HOH 123 323 28  HOH HOH B . 
C 3 HOH 124 324 32  HOH HOH B . 
C 3 HOH 125 325 36  HOH HOH B . 
C 3 HOH 126 326 37  HOH HOH B . 
C 3 HOH 127 327 40  HOH HOH B . 
C 3 HOH 128 328 42  HOH HOH B . 
C 3 HOH 129 329 43  HOH HOH B . 
C 3 HOH 130 330 49  HOH HOH B . 
C 3 HOH 131 331 52  HOH HOH B . 
C 3 HOH 132 332 55  HOH HOH B . 
C 3 HOH 133 333 57  HOH HOH B . 
C 3 HOH 134 334 58  HOH HOH B . 
C 3 HOH 135 335 60  HOH HOH B . 
C 3 HOH 136 336 65  HOH HOH B . 
C 3 HOH 137 337 66  HOH HOH B . 
C 3 HOH 138 338 68  HOH HOH B . 
C 3 HOH 139 339 70  HOH HOH B . 
C 3 HOH 140 340 71  HOH HOH B . 
C 3 HOH 141 341 74  HOH HOH B . 
C 3 HOH 142 342 76  HOH HOH B . 
C 3 HOH 143 343 78  HOH HOH B . 
C 3 HOH 144 344 85  HOH HOH B . 
C 3 HOH 145 345 88  HOH HOH B . 
C 3 HOH 146 346 90  HOH HOH B . 
C 3 HOH 147 347 92  HOH HOH B . 
C 3 HOH 148 348 93  HOH HOH B . 
C 3 HOH 149 349 95  HOH HOH B . 
C 3 HOH 150 350 97  HOH HOH B . 
C 3 HOH 151 351 100 HOH HOH B . 
C 3 HOH 152 352 103 HOH HOH B . 
C 3 HOH 153 353 104 HOH HOH B . 
C 3 HOH 154 354 107 HOH HOH B . 
C 3 HOH 155 355 108 HOH HOH B . 
C 3 HOH 156 356 110 HOH HOH B . 
C 3 HOH 157 357 113 HOH HOH B . 
C 3 HOH 158 358 121 HOH HOH B . 
C 3 HOH 159 359 123 HOH HOH B . 
C 3 HOH 160 360 128 HOH HOH B . 
C 3 HOH 161 361 130 HOH HOH B . 
C 3 HOH 162 362 134 HOH HOH B . 
C 3 HOH 163 363 142 HOH HOH B . 
C 3 HOH 164 364 143 HOH HOH B . 
C 3 HOH 165 365 146 HOH HOH B . 
C 3 HOH 166 366 148 HOH HOH B . 
C 3 HOH 167 367 149 HOH HOH B . 
C 3 HOH 168 368 152 HOH HOH B . 
C 3 HOH 169 369 153 HOH HOH B . 
C 3 HOH 170 370 154 HOH HOH B . 
C 3 HOH 171 371 156 HOH HOH B . 
C 3 HOH 172 372 159 HOH HOH B . 
C 3 HOH 173 373 160 HOH HOH B . 
C 3 HOH 174 374 166 HOH HOH B . 
C 3 HOH 175 375 170 HOH HOH B . 
C 3 HOH 176 376 171 HOH HOH B . 
C 3 HOH 177 377 173 HOH HOH B . 
C 3 HOH 178 378 175 HOH HOH B . 
C 3 HOH 179 379 181 HOH HOH B . 
C 3 HOH 180 380 183 HOH HOH B . 
C 3 HOH 181 381 185 HOH HOH B . 
C 3 HOH 182 382 190 HOH HOH B . 
C 3 HOH 183 383 192 HOH HOH B . 
C 3 HOH 184 384 193 HOH HOH B . 
C 3 HOH 185 385 195 HOH HOH B . 
C 3 HOH 186 386 197 HOH HOH B . 
C 3 HOH 187 387 198 HOH HOH B . 
C 3 HOH 188 388 200 HOH HOH B . 
C 3 HOH 189 389 204 HOH HOH B . 
C 3 HOH 190 390 206 HOH HOH B . 
C 3 HOH 191 391 207 HOH HOH B . 
C 3 HOH 192 392 208 HOH HOH B . 
C 3 HOH 193 393 210 HOH HOH B . 
D 3 HOH 1   401 118 HOH HOH A . 
D 3 HOH 2   402 47  HOH HOH A . 
D 3 HOH 3   403 67  HOH HOH A . 
D 3 HOH 4   404 24  HOH HOH A . 
D 3 HOH 5   405 29  HOH HOH A . 
D 3 HOH 6   406 157 HOH HOH A . 
D 3 HOH 7   407 138 HOH HOH A . 
D 3 HOH 8   408 136 HOH HOH A . 
D 3 HOH 9   409 209 HOH HOH A . 
D 3 HOH 10  410 140 HOH HOH A . 
D 3 HOH 11  411 80  HOH HOH A . 
D 3 HOH 12  412 75  HOH HOH A . 
D 3 HOH 13  413 165 HOH HOH A . 
D 3 HOH 14  414 177 HOH HOH A . 
D 3 HOH 15  415 178 HOH HOH A . 
D 3 HOH 16  416 179 HOH HOH A . 
D 3 HOH 17  417 186 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1090  ? 
1 MORE         -5    ? 
1 'SSA (A^2)'  10090 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2015-02-11 
2 'Structure model' 1 1 2015-02-18 
3 'Structure model' 1 2 2015-04-08 
4 'Structure model' 1 3 2017-09-27 
5 'Structure model' 1 4 2019-12-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1  2 'Structure model' 'Database references'        
2  3 'Structure model' 'Database references'        
3  4 'Structure model' Advisory                     
4  4 'Structure model' 'Author supporting evidence' 
5  4 'Structure model' 'Database references'        
6  4 'Structure model' 'Derived calculations'       
7  4 'Structure model' Other                        
8  4 'Structure model' 'Refinement description'     
9  4 'Structure model' 'Source and taxonomy'        
10 4 'Structure model' 'Structure summary'          
11 5 'Structure model' 'Author supporting evidence' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' citation                   
2  4 'Structure model' entity_src_gen             
3  4 'Structure model' pdbx_audit_support         
4  4 'Structure model' pdbx_database_status       
5  4 'Structure model' pdbx_struct_assembly       
6  4 'Structure model' pdbx_struct_assembly_gen   
7  4 'Structure model' pdbx_struct_assembly_prop  
8  4 'Structure model' pdbx_struct_oper_list      
9  4 'Structure model' pdbx_validate_symm_contact 
10 4 'Structure model' software                   
11 4 'Structure model' struct_keywords            
12 5 'Structure model' pdbx_audit_support         
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_citation.journal_id_CSD'                    
2  4 'Structure model' '_entity_src_gen.pdbx_alt_source_flag'        
3  4 'Structure model' '_pdbx_audit_support.funding_organization'    
4  4 'Structure model' '_pdbx_database_status.pdb_format_compatible' 
5  4 'Structure model' '_pdbx_struct_assembly.oligomeric_details'    
6  4 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list'      
7  4 'Structure model' '_pdbx_struct_assembly_prop.type'             
8  4 'Structure model' '_pdbx_struct_assembly_prop.value'            
9  4 'Structure model' '_pdbx_struct_oper_list.symmetry_operation'   
10 4 'Structure model' '_pdbx_validate_symm_contact.auth_seq_id_1'   
11 4 'Structure model' '_pdbx_validate_symm_contact.auth_seq_id_2'   
12 4 'Structure model' '_pdbx_validate_symm_contact.dist'            
13 4 'Structure model' '_pdbx_validate_symm_contact.site_symmetry_2' 
14 4 'Structure model' '_struct_keywords.text'                       
15 5 'Structure model' '_pdbx_audit_support.funding_organization'    
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .                           1 
? phasing        ? ? ? ? ? ? ? ? ? ? ? PHASER   ? ? ? .                           2 
? refinement     ? ? ? ? ? ? ? ? ? ? ? PHENIX   ? ? ? '(phenix.refine: dev_1593)' 3 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1 O   B HOH 248 ? ? O B HOH 278 ? ? 1.86 
2  1 O   B HOH 293 ? ? O B HOH 306 ? ? 1.98 
3  1 O   B HOH 265 ? ? O B HOH 280 ? ? 2.01 
4  1 O   B HOH 220 ? ? O B HOH 286 ? ? 2.02 
5  1 O   B HOH 255 ? ? O B HOH 307 ? ? 2.03 
6  1 SG  B CYS 155 ? ? O B HOH 282 ? ? 2.11 
7  1 OG  B SER 0   ? ? O B HOH 201 ? ? 2.14 
8  1 O   A HOH 412 ? ? O A HOH 413 ? ? 2.15 
9  1 O   B HOH 365 ? ? O B HOH 391 ? ? 2.16 
10 1 O   B HOH 343 ? ? O B HOH 382 ? ? 2.16 
11 1 NE2 B GLN 25  ? ? O B HOH 331 ? ? 2.17 
12 1 O   B HOH 280 ? ? O B HOH 295 ? ? 2.17 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 O B HOH 275 ? ? 1_555 O B HOH 296 ? ? 2_454 1.81 
2 1 O B HOH 268 ? ? 1_555 O B HOH 285 ? ? 1_655 2.06 
3 1 O B HOH 259 ? ? 1_555 O B HOH 289 ? ? 4_445 2.10 
4 1 O B HOH 248 ? ? 1_555 O B HOH 291 ? ? 4_445 2.13 
5 1 O B HOH 285 ? ? 1_555 O B HOH 301 ? ? 4_445 2.18 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CA B MET 114 ? ? CB B MET 114 ? ? CG B MET 114 ? ? 99.91  113.30 -13.39 1.70 N 
2 1 CB B MET 114 ? ? CG B MET 114 ? ? SD B MET 114 ? ? 136.95 112.40 24.55  3.00 N 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    ASP 
_pdbx_validate_torsion.auth_asym_id    B 
_pdbx_validate_torsion.auth_seq_id     50 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             -173.12 
_pdbx_validate_torsion.psi             107.69 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 B LYS 15  ? CE  ? A LYS 16  CE  
2  1 Y 1 B GLN 18  ? NE2 ? A GLN 19  NE2 
3  1 Y 1 B ARG 22  ? CG  ? A ARG 23  CG  
4  1 Y 1 B ARG 22  ? CD  ? A ARG 23  CD  
5  1 Y 1 B ARG 22  ? CZ  ? A ARG 23  CZ  
6  1 Y 1 B GLN 25  ? CD  ? A GLN 26  CD  
7  1 Y 1 B LYS 29  ? CD  ? A LYS 30  CD  
8  1 Y 1 B LYS 29  ? CE  ? A LYS 30  CE  
9  1 Y 1 B ARG 30  ? CG  ? A ARG 31  CG  
10 1 Y 1 B ARG 30  ? NE  ? A ARG 31  NE  
11 1 Y 1 B LYS 52  ? CE  ? A LYS 53  CE  
12 1 Y 1 B GLU 55  ? CG  ? A GLU 56  CG  
13 1 Y 1 B GLU 55  ? CD  ? A GLU 56  CD  
14 1 Y 1 B ARG 57  ? CD  ? A ARG 58  CD  
15 1 Y 1 B ARG 57  ? NE  ? A ARG 58  NE  
16 1 Y 1 B ARG 57  ? CZ  ? A ARG 58  CZ  
17 1 Y 1 B ARG 57  ? NH1 ? A ARG 58  NH1 
18 1 Y 1 B LYS 58  ? CD  ? A LYS 59  CD  
19 1 Y 1 B LYS 58  ? CE  ? A LYS 59  CE  
20 1 Y 1 B LYS 62  ? NZ  ? A LYS 63  NZ  
21 1 Y 1 B LYS 71  ? CE  ? A LYS 72  CE  
22 1 Y 1 B GLN 82  ? NE2 ? A GLN 83  NE2 
23 1 Y 1 B GLU 83  ? CG  ? A GLU 84  CG  
24 1 Y 1 B GLU 83  ? CD  ? A GLU 84  CD  
25 1 Y 1 B LYS 112 ? CG  ? A LYS 113 CG  
26 1 Y 1 B LYS 112 ? CE  ? A LYS 113 CE  
27 1 Y 1 B ASN 113 ? OD1 ? A ASN 114 OD1 
28 1 Y 1 B LYS 116 ? CD  ? A LYS 117 CD  
29 1 Y 1 B LYS 116 ? CE  ? A LYS 117 CE  
30 1 Y 1 B GLU 133 ? CD  ? A GLU 134 CD  
31 1 Y 1 B LYS 140 ? CD  ? A LYS 141 CD  
32 1 Y 1 B LYS 140 ? NZ  ? A LYS 141 NZ  
33 1 Y 1 B LYS 157 ? CG  ? A LYS 158 CG  
34 1 Y 1 B LYS 157 ? CD  ? A LYS 158 CD  
35 1 Y 1 B LYS 157 ? NZ  ? A LYS 158 NZ  
36 1 Y 1 B GLU 160 ? CD  ? A GLU 161 CD  
37 1 Y 1 A ASP 320 ? CB  ? B ASP 9   CB  
38 1 Y 1 A ASP 320 ? CG  ? B ASP 9   CG  
39 1 Y 1 A ASP 320 ? OD1 ? B ASP 9   OD1 
40 1 Y 1 A ASP 320 ? OD2 ? B ASP 9   OD2 
41 1 Y 1 A LYS 332 ? NZ  ? B LYS 21  NZ  
42 1 Y 1 A LYS 333 ? CG  ? B LYS 22  CG  
43 1 Y 1 A LYS 333 ? CD  ? B LYS 22  CD  
44 1 Y 1 A LYS 333 ? CE  ? B LYS 22  CE  
45 1 Y 1 A LYS 333 ? NZ  ? B LYS 22  NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 312 ? B SER 1  
2  1 Y 1 A THR 313 ? B THR 2  
3  1 Y 1 A SER 314 ? B SER 3  
4  1 Y 1 A ALA 315 ? B ALA 4  
5  1 Y 1 A SER 316 ? B SER 5  
6  1 Y 1 A GLU 317 ? B GLU 6  
7  1 Y 1 A ASP 318 ? B ASP 7  
8  1 Y 1 A ILE 319 ? B ILE 8  
9  1 Y 1 A LYS 334 ? B LYS 23 
10 1 Y 1 A THR 335 ? B THR 24 
11 1 Y 1 A TRP 336 ? B TRP 25 
# 
_pdbx_audit_support.funding_organization   
'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 
_pdbx_audit_support.country                'United States' 
_pdbx_audit_support.grant_number           GM095769 
_pdbx_audit_support.ordinal                1 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#