data_4U7I
# 
_entry.id   4U7I 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4U7I         
WWPDB D_1000202938 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 4U7E PDB . 
unspecified 4U7Y PDB . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4U7I 
_pdbx_database_status.recvd_initial_deposition_date   2014-07-30 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Guo, E.Z.' 1 
'Xu, Z.'    2 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_id_ASTM           JBCHA3 
_citation.journal_id_CSD            0071 
_citation.journal_id_ISSN           1083-351X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            290 
_citation.language                  ? 
_citation.page_first                8396 
_citation.page_last                 8408 
_citation.title                     
;Distinct Mechanisms of Recognizing Endosomal Sorting Complex Required for Transport III (ESCRT-III) Protein IST1 by Different Microtubule Interacting and Trafficking (MIT) Domains.
;
_citation.year                      2015 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1074/jbc.M114.607903 
_citation.pdbx_database_id_PubMed   25657007 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Guo, E.Z.' 1 ? 
primary 'Xu, Z.'    2 ? 
# 
_cell.entry_id           4U7I 
_cell.length_a           46.257 
_cell.length_b           46.257 
_cell.length_c           115.620 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4U7I 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                96 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 43 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man Spartin        10794.293 1   ? ? 'MIT domain (UNP residues 8-101)' ? 
2 polymer man 'IST1 homolog' 3009.262  1   ? ? 'UNP residues 341-364'            ? 
3 water   nat water          18.015    100 ? ? ?                                 ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Spastic paraplegia 20 protein,Trans-activated by hepatitis C virus core protein 1' 
2 'hIST1,Putative MAPK-activating protein PM28'                                       
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;SGEPAEIKIIREAYKKAFLFVNKGLNTDELGQKEEAKNYYKQGIGHLLRGISISSKESEHTGPGWESARQMQQKMKETLQ
NVRTRLEILEKGLAT
;
;SGEPAEIKIIREAYKKAFLFVNKGLNTDELGQKEEAKNYYKQGIGHLLRGISISSKESEHTGPGWESARQMQQKMKETLQ
NVRTRLEILEKGLAT
;
A ? 
2 'polypeptide(L)' no no STSASEDIDFDDLSRRFEELKKKTW                                                                          
STSASEDIDFDDLSRRFEELKKKTW                                                                          B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  SER n 
1 2  GLY n 
1 3  GLU n 
1 4  PRO n 
1 5  ALA n 
1 6  GLU n 
1 7  ILE n 
1 8  LYS n 
1 9  ILE n 
1 10 ILE n 
1 11 ARG n 
1 12 GLU n 
1 13 ALA n 
1 14 TYR n 
1 15 LYS n 
1 16 LYS n 
1 17 ALA n 
1 18 PHE n 
1 19 LEU n 
1 20 PHE n 
1 21 VAL n 
1 22 ASN n 
1 23 LYS n 
1 24 GLY n 
1 25 LEU n 
1 26 ASN n 
1 27 THR n 
1 28 ASP n 
1 29 GLU n 
1 30 LEU n 
1 31 GLY n 
1 32 GLN n 
1 33 LYS n 
1 34 GLU n 
1 35 GLU n 
1 36 ALA n 
1 37 LYS n 
1 38 ASN n 
1 39 TYR n 
1 40 TYR n 
1 41 LYS n 
1 42 GLN n 
1 43 GLY n 
1 44 ILE n 
1 45 GLY n 
1 46 HIS n 
1 47 LEU n 
1 48 LEU n 
1 49 ARG n 
1 50 GLY n 
1 51 ILE n 
1 52 SER n 
1 53 ILE n 
1 54 SER n 
1 55 SER n 
1 56 LYS n 
1 57 GLU n 
1 58 SER n 
1 59 GLU n 
1 60 HIS n 
1 61 THR n 
1 62 GLY n 
1 63 PRO n 
1 64 GLY n 
1 65 TRP n 
1 66 GLU n 
1 67 SER n 
1 68 ALA n 
1 69 ARG n 
1 70 GLN n 
1 71 MET n 
1 72 GLN n 
1 73 GLN n 
1 74 LYS n 
1 75 MET n 
1 76 LYS n 
1 77 GLU n 
1 78 THR n 
1 79 LEU n 
1 80 GLN n 
1 81 ASN n 
1 82 VAL n 
1 83 ARG n 
1 84 THR n 
1 85 ARG n 
1 86 LEU n 
1 87 GLU n 
1 88 ILE n 
1 89 LEU n 
1 90 GLU n 
1 91 LYS n 
1 92 GLY n 
1 93 LEU n 
1 94 ALA n 
1 95 THR n 
2 1  SER n 
2 2  THR n 
2 3  SER n 
2 4  ALA n 
2 5  SER n 
2 6  GLU n 
2 7  ASP n 
2 8  ILE n 
2 9  ASP n 
2 10 PHE n 
2 11 ASP n 
2 12 ASP n 
2 13 LEU n 
2 14 SER n 
2 15 ARG n 
2 16 ARG n 
2 17 PHE n 
2 18 GLU n 
2 19 GLU n 
2 20 LEU n 
2 21 LYS n 
2 22 LYS n 
2 23 LYS n 
2 24 THR n 
2 25 TRP n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 95 Human ? 'SPG20, KIAA0610, TAHCCP1' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? 'Rosetta (DE3)' ? ? ? ? ? ? ? plasmid ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 25 Human ? 'IST1, KIAA0174'           ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? 'Rosetta (DE3)' ? ? ? ? ? ? ? plasmid ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP SPG20_HUMAN Q8N0X7 1 
;GEPAEIKIIREAYKKAFLFVNKGLNTDELGQKEEAKNYYKQGIGHLLRGISISSKESEHTGPGWESARQMQQKMKETLQN
VRTRLEILEKGLAT
;
8   ? 
2 UNP IST1_HUMAN  P53990 2 STSASEDIDFDDLSRRFEELKKKT                                                                          341 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4U7I A 2 ? 95 ? Q8N0X7 8   ? 101 ? 8   101 
2 2 4U7I B 1 ? 24 ? P53990 341 ? 364 ? 312 335 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4U7I SER A 1  ? UNP Q8N0X7 ? ? 'expression tag' 7   1 
2 4U7I TRP B 25 ? UNP P53990 ? ? 'expression tag' 336 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4U7I 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.24 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         45.10 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.3 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '2.9 M Na-malonate' 
_exptl_crystal_grow.pdbx_pH_range   6.0 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'MARMOSAIC 225 mm CCD' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2013-08-09 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 0.979   1.0 
2 0.97828 1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 21-ID-F' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97828 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   21-ID-F 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         4U7I 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.79 
_reflns.d_resolution_low                 29.61 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       12400 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.6 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  8.1 
_reflns.pdbx_Rmerge_I_obs                0.081 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            43.0 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  . 
_reflns_shell.d_res_low                   ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         4.0 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        100.0 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.584 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             8.4 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 4U7I 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.794 
_refine.ls_d_res_low                             29.610 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     12400 
_refine.ls_number_reflns_R_free                  598 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.63 
_refine.ls_percent_reflns_R_free                 4.82 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1916 
_refine.ls_R_factor_R_free                       0.2204 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1902 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.35 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               NONE 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      2DL1 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 23.94 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.19 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.006  ? 875  ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.942  ? 1170 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 13.703 ? 337  ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.037  ? 127  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.005  ? 152  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
'X-RAY DIFFRACTION' 1.794  1.9742  . . 158 2867 100.00 . . . 0.2728 . 0.1950 . . . . . . . . 
'X-RAY DIFFRACTION' 1.9742 2.2598  . . 147 2893 100.00 . . . 0.2235 . 0.1919 . . . . . . . . 
'X-RAY DIFFRACTION' 2.2598 2.8467  . . 157 2936 100.00 . . . 0.2286 . 0.2124 . . . . . . . . 
'X-RAY DIFFRACTION' 2.8467 29.6136 . . 136 3106 99.00  . . . 0.2095 . 0.1806 . . . . . . . . 
# 
_struct.entry_id                     4U7I 
_struct.title                        'Structure of the complex of Spartin MIT and IST1 MIM' 
_struct.pdbx_descriptor              'Spartin MIT, IST1 MIM' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4U7I 
_struct_keywords.text            'Complex, MIM3, PROTEIN TRANSPORT' 
_struct_keywords.pdbx_keywords   'PROTEIN TRANSPORT' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 PRO A 4  ? LEU A 30 ? PRO A 10  LEU A 36  1 ? 27 
HELX_P HELX_P2 AA2 GLN A 32 ? SER A 52 ? GLN A 38  SER A 58  1 ? 21 
HELX_P HELX_P3 AA3 GLY A 62 ? LYS A 91 ? GLY A 68  LYS A 97  1 ? 30 
HELX_P HELX_P4 AA4 ASP B 9  ? LYS B 22 ? ASP B 320 LYS B 333 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_atom_sites.entry_id                    4U7I 
_atom_sites.fract_transf_matrix[1][1]   0.021618 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.021618 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008649 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1   N N   . GLU A 1 3  ? -9.062  15.018 13.309  1.00 82.51  ? 9   GLU A N   1 
ATOM   2   C CA  . GLU A 1 3  ? -7.993  15.483 14.188  1.00 94.63  ? 9   GLU A CA  1 
ATOM   3   C C   . GLU A 1 3  ? -6.651  14.818 13.850  1.00 101.65 ? 9   GLU A C   1 
ATOM   4   O O   . GLU A 1 3  ? -5.624  15.494 13.824  1.00 118.55 ? 9   GLU A O   1 
ATOM   5   C CB  . GLU A 1 3  ? -8.358  15.249 15.661  1.00 93.66  ? 9   GLU A CB  1 
ATOM   6   N N   . PRO A 1 4  ? -6.642  13.494 13.601  1.00 75.95  ? 10  PRO A N   1 
ATOM   7   C CA  . PRO A 1 4  ? -5.377  12.972 13.072  1.00 59.67  ? 10  PRO A CA  1 
ATOM   8   C C   . PRO A 1 4  ? -5.148  13.416 11.629  1.00 64.41  ? 10  PRO A C   1 
ATOM   9   O O   . PRO A 1 4  ? -6.102  13.517 10.855  1.00 69.62  ? 10  PRO A O   1 
ATOM   10  C CB  . PRO A 1 4  ? -5.557  11.453 13.158  1.00 59.39  ? 10  PRO A CB  1 
ATOM   11  C CG  . PRO A 1 4  ? -6.605  11.252 14.207  1.00 62.64  ? 10  PRO A CG  1 
ATOM   12  C CD  . PRO A 1 4  ? -7.541  12.406 14.028  1.00 68.68  ? 10  PRO A CD  1 
ATOM   13  N N   . ALA A 1 5  ? -3.895  13.680 11.275  1.00 56.29  ? 11  ALA A N   1 
ATOM   14  C CA  . ALA A 1 5  ? -3.565  14.169 9.942   1.00 49.64  ? 11  ALA A CA  1 
ATOM   15  C C   . ALA A 1 5  ? -3.698  13.078 8.879   1.00 49.42  ? 11  ALA A C   1 
ATOM   16  O O   . ALA A 1 5  ? -3.901  13.366 7.699   1.00 44.26  ? 11  ALA A O   1 
ATOM   17  C CB  . ALA A 1 5  ? -2.164  14.743 9.926   1.00 52.36  ? 11  ALA A CB  1 
ATOM   18  N N   . GLU A 1 6  ? -3.567  11.824 9.292   1.00 45.65  ? 12  GLU A N   1 
ATOM   19  C CA  . GLU A 1 6  ? -3.700  10.730 8.346   1.00 42.72  ? 12  GLU A CA  1 
ATOM   20  C C   . GLU A 1 6  ? -5.148  10.621 7.889   1.00 40.32  ? 12  GLU A C   1 
ATOM   21  O O   . GLU A 1 6  ? -5.415  10.237 6.753   1.00 38.93  ? 12  GLU A O   1 
ATOM   22  C CB  . GLU A 1 6  ? -3.216  9.415  8.962   1.00 50.10  ? 12  GLU A CB  1 
ATOM   23  C CG  . GLU A 1 6  ? -1.693  9.317  9.097   1.00 54.95  ? 12  GLU A CG  1 
ATOM   24  N N   . ILE A 1 7  ? -6.085  10.977 8.766   1.00 33.84  ? 13  ILE A N   1 
ATOM   25  C CA  . ILE A 1 7  ? -7.495  10.907 8.403   1.00 40.99  ? 13  ILE A CA  1 
ATOM   26  C C   . ILE A 1 7  ? -7.852  12.003 7.399   1.00 45.04  ? 13  ILE A C   1 
ATOM   27  O O   . ILE A 1 7  ? -8.610  11.758 6.460   1.00 39.11  ? 13  ILE A O   1 
ATOM   28  C CB  . ILE A 1 7  ? -8.414  10.996 9.642   1.00 38.19  ? 13  ILE A CB  1 
ATOM   29  C CG1 . ILE A 1 7  ? -8.197  9.779  10.543  1.00 32.04  ? 13  ILE A CG1 1 
ATOM   30  C CG2 . ILE A 1 7  ? -9.878  11.056 9.233   1.00 41.38  ? 13  ILE A CG2 1 
ATOM   31  C CD1 . ILE A 1 7  ? -9.030  9.788  11.811  1.00 44.20  ? 13  ILE A CD1 1 
ATOM   32  N N   . LYS A 1 8  ? -7.301  13.206 7.556   1.00 40.44  ? 14  LYS A N   1 
ATOM   33  C CA  . LYS A 1 8  ? -7.660  14.250 6.596   1.00 41.37  ? 14  LYS A CA  1 
ATOM   34  C C   . LYS A 1 8  ? -7.101  13.915 5.209   1.00 38.25  ? 14  LYS A C   1 
ATOM   35  O O   . LYS A 1 8  ? -7.753  14.181 4.197   1.00 41.06  ? 14  LYS A O   1 
ATOM   36  C CB  . LYS A 1 8  ? -7.198  15.635 7.067   1.00 50.89  ? 14  LYS A CB  1 
ATOM   37  C CG  . LYS A 1 8  ? -5.801  15.700 7.622   1.00 55.03  ? 14  LYS A CG  1 
ATOM   38  C CD  . LYS A 1 8  ? -5.540  17.039 8.303   1.00 54.07  ? 14  LYS A CD  1 
ATOM   39  N N   . ILE A 1 9  ? -5.927  13.291 5.153   1.00 38.22  ? 15  ILE A N   1 
ATOM   40  C CA  . ILE A 1 9  ? -5.389  12.819 3.875   1.00 36.18  ? 15  ILE A CA  1 
ATOM   41  C C   . ILE A 1 9  ? -6.359  11.839 3.209   1.00 33.13  ? 15  ILE A C   1 
ATOM   42  O O   . ILE A 1 9  ? -6.648  11.929 2.007   1.00 32.60  ? 15  ILE A O   1 
ATOM   43  C CB  . ILE A 1 9  ? -4.018  12.133 4.048   1.00 36.56  ? 15  ILE A CB  1 
ATOM   44  C CG1 . ILE A 1 9  ? -2.936  13.174 4.313   1.00 36.80  ? 15  ILE A CG1 1 
ATOM   45  C CG2 . ILE A 1 9  ? -3.666  11.320 2.803   1.00 36.30  ? 15  ILE A CG2 1 
ATOM   46  C CD1 . ILE A 1 9  ? -1.630  12.573 4.773   1.00 48.66  ? 15  ILE A CD1 1 
ATOM   47  N N   . ILE A 1 10 ? -6.873  10.905 3.993   1.00 31.42  ? 16  ILE A N   1 
ATOM   48  C CA  . ILE A 1 10 ? -7.837  9.947  3.448   1.00 33.30  ? 16  ILE A CA  1 
ATOM   49  C C   . ILE A 1 10 ? -9.094  10.684 2.987   1.00 36.06  ? 16  ILE A C   1 
ATOM   50  O O   . ILE A 1 10 ? -9.607  10.451 1.887   1.00 31.63  ? 16  ILE A O   1 
ATOM   51  C CB  . ILE A 1 10 ? -8.193  8.864  4.487   1.00 28.22  ? 16  ILE A CB  1 
ATOM   52  C CG1 . ILE A 1 10 ? -7.002  7.933  4.688   1.00 26.42  ? 16  ILE A CG1 1 
ATOM   53  C CG2 . ILE A 1 10 ? -9.414  8.049  4.046   1.00 29.22  ? 16  ILE A CG2 1 
ATOM   54  C CD1 . ILE A 1 10 ? -7.095  7.069  5.975   1.00 24.93  ? 16  ILE A CD1 1 
ATOM   55  N N   . ARG A 1 11 ? -9.575  11.602 3.813   1.00 29.24  ? 17  ARG A N   1 
ATOM   56  C CA  . ARG A 1 11 ? -10.799 12.317 3.479   1.00 32.37  ? 17  ARG A CA  1 
ATOM   57  C C   . ARG A 1 11 ? -10.623 13.164 2.217   1.00 36.94  ? 17  ARG A C   1 
ATOM   58  O O   . ARG A 1 11 ? -11.513 13.201 1.363   1.00 32.98  ? 17  ARG A O   1 
ATOM   59  C CB  . ARG A 1 11 ? -11.243 13.193 4.649   1.00 37.44  ? 17  ARG A CB  1 
ATOM   60  C CG  . ARG A 1 11 ? -12.667 13.722 4.536   1.00 44.08  ? 17  ARG A CG  1 
ATOM   61  C CD  . ARG A 1 11 ? -12.988 14.645 5.708   1.00 48.24  ? 17  ARG A CD  1 
ATOM   62  N NE  . ARG A 1 11 ? -12.656 14.028 6.990   1.00 59.42  ? 17  ARG A NE  1 
ATOM   63  N N   . GLU A 1 12 ? -9.476  13.831 2.092   1.00 35.25  ? 18  GLU A N   1 
ATOM   64  C CA  . GLU A 1 12 ? -9.217  14.670 0.917   1.00 31.66  ? 18  GLU A CA  1 
ATOM   65  C C   . GLU A 1 12 ? -9.163  13.813 -0.335  1.00 31.35  ? 18  GLU A C   1 
ATOM   66  O O   . GLU A 1 12 ? -9.691  14.193 -1.376  1.00 33.86  ? 18  GLU A O   1 
ATOM   67  C CB  . GLU A 1 12 ? -7.908  15.461 1.051   1.00 41.80  ? 18  GLU A CB  1 
ATOM   68  C CG  . GLU A 1 12 ? -7.811  16.430 2.231   1.00 66.13  ? 18  GLU A CG  1 
ATOM   69  C CD  . GLU A 1 12 ? -9.125  17.094 2.597   1.00 75.20  ? 18  GLU A CD  1 
ATOM   70  O OE1 . GLU A 1 12 ? -9.684  17.825 1.753   1.00 75.42  ? 18  GLU A OE1 1 
ATOM   71  O OE2 . GLU A 1 12 ? -9.594  16.891 3.740   1.00 78.92  ? 18  GLU A OE2 1 
ATOM   72  N N   . ALA A 1 13 ? -8.520  12.653 -0.227  1.00 31.59  ? 19  ALA A N   1 
ATOM   73  C CA  . ALA A 1 13 ? -8.386  11.745 -1.357  1.00 28.33  ? 19  ALA A CA  1 
ATOM   74  C C   . ALA A 1 13 ? -9.742  11.224 -1.800  1.00 30.17  ? 19  ALA A C   1 
ATOM   75  O O   . ALA A 1 13 ? -10.013 11.098 -2.988  1.00 25.59  ? 19  ALA A O   1 
ATOM   76  C CB  . ALA A 1 13 ? -7.464  10.576 -1.001  1.00 28.22  ? 19  ALA A CB  1 
ATOM   77  N N   . TYR A 1 14 ? -10.583 10.911 -0.822  1.00 25.38  ? 20  TYR A N   1 
ATOM   78  C CA  . TYR A 1 14 ? -11.941 10.426 -1.055  1.00 26.96  ? 20  TYR A CA  1 
ATOM   79  C C   . TYR A 1 14 ? -12.764 11.433 -1.856  1.00 26.17  ? 20  TYR A C   1 
ATOM   80  O O   . TYR A 1 14 ? -13.394 11.089 -2.867  1.00 26.17  ? 20  TYR A O   1 
ATOM   81  C CB  . TYR A 1 14 ? -12.571 10.141 0.307   1.00 25.21  ? 20  TYR A CB  1 
ATOM   82  C CG  . TYR A 1 14 ? -13.970 9.579  0.348   1.00 26.76  ? 20  TYR A CG  1 
ATOM   83  C CD1 . TYR A 1 14 ? -14.208 8.221  0.185   1.00 28.83  ? 20  TYR A CD1 1 
ATOM   84  C CD2 . TYR A 1 14 ? -15.047 10.400 0.665   1.00 28.00  ? 20  TYR A CD2 1 
ATOM   85  C CE1 . TYR A 1 14 ? -15.501 7.706  0.282   1.00 28.62  ? 20  TYR A CE1 1 
ATOM   86  C CE2 . TYR A 1 14 ? -16.331 9.894  0.759   1.00 35.35  ? 20  TYR A CE2 1 
ATOM   87  C CZ  . TYR A 1 14 ? -16.555 8.557  0.571   1.00 34.77  ? 20  TYR A CZ  1 
ATOM   88  O OH  . TYR A 1 14 ? -17.849 8.082  0.678   1.00 34.73  ? 20  TYR A OH  1 
ATOM   89  N N   . LYS A 1 15 ? -12.720 12.689 -1.423  1.00 26.70  ? 21  LYS A N   1 
ATOM   90  C CA  . LYS A 1 15 ? -13.481 13.749 -2.079  1.00 26.52  ? 21  LYS A CA  1 
ATOM   91  C C   . LYS A 1 15 ? -12.972 14.036 -3.489  1.00 30.89  ? 21  LYS A C   1 
ATOM   92  O O   . LYS A 1 15 ? -13.761 14.172 -4.442  1.00 27.60  ? 21  LYS A O   1 
ATOM   93  C CB  . LYS A 1 15 ? -13.432 15.025 -1.239  1.00 33.40  ? 21  LYS A CB  1 
ATOM   94  C CG  . LYS A 1 15 ? -14.108 14.903 0.110   1.00 29.92  ? 21  LYS A CG  1 
ATOM   95  C CD  . LYS A 1 15 ? -13.989 16.200 0.905   1.00 34.26  ? 21  LYS A CD  1 
ATOM   96  C CE  . LYS A 1 15 ? -14.764 16.124 2.209   1.00 51.00  ? 21  LYS A CE  1 
ATOM   97  N N   . LYS A 1 16 ? -11.653 14.153 -3.626  1.00 24.05  ? 22  LYS A N   1 
ATOM   98  C CA  . LYS A 1 16 ? -11.064 14.421 -4.940  1.00 26.71  ? 22  LYS A CA  1 
ATOM   99  C C   . LYS A 1 16 ? -11.253 13.243 -5.878  1.00 28.54  ? 22  LYS A C   1 
ATOM   100 O O   . LYS A 1 16 ? -11.528 13.439 -7.066  1.00 27.41  ? 22  LYS A O   1 
ATOM   101 C CB  . LYS A 1 16 ? -9.572  14.752 -4.831  1.00 34.76  ? 22  LYS A CB  1 
ATOM   102 C CG  . LYS A 1 16 ? -9.254  16.192 -4.424  1.00 41.29  ? 22  LYS A CG  1 
ATOM   103 C CD  . LYS A 1 16 ? -7.745  16.402 -4.260  1.00 36.79  ? 22  LYS A CD  1 
ATOM   104 C CE  . LYS A 1 16 ? -7.294  17.804 -4.671  1.00 46.82  ? 22  LYS A CE  1 
ATOM   105 N N   . ALA A 1 17 ? -11.090 12.017 -5.373  1.00 24.15  ? 23  ALA A N   1 
ATOM   106 C CA  . ALA A 1 17 ? -11.278 10.869 -6.238  1.00 23.22  ? 23  ALA A CA  1 
ATOM   107 C C   . ALA A 1 17 ? -12.695 10.859 -6.766  1.00 29.09  ? 23  ALA A C   1 
ATOM   108 O O   . ALA A 1 17 ? -12.916 10.587 -7.943  1.00 25.95  ? 23  ALA A O   1 
ATOM   109 C CB  . ALA A 1 17 ? -10.973 9.560  -5.507  1.00 23.53  ? 23  ALA A CB  1 
ATOM   110 N N   . PHE A 1 18 ? -13.667 11.145 -5.901  1.00 24.71  ? 24  PHE A N   1 
ATOM   111 C CA  . PHE A 1 18 ? -15.060 11.132 -6.358  1.00 25.23  ? 24  PHE A CA  1 
ATOM   112 C C   . PHE A 1 18 ? -15.276 12.189 -7.420  1.00 25.93  ? 24  PHE A C   1 
ATOM   113 O O   . PHE A 1 18 ? -15.945 11.952 -8.430  1.00 28.82  ? 24  PHE A O   1 
ATOM   114 C CB  . PHE A 1 18 ? -16.034 11.376 -5.213  1.00 23.22  ? 24  PHE A CB  1 
ATOM   115 C CG  . PHE A 1 18 ? -17.462 11.317 -5.642  1.00 29.04  ? 24  PHE A CG  1 
ATOM   116 C CD1 . PHE A 1 18 ? -18.138 10.117 -5.667  1.00 30.43  ? 24  PHE A CD1 1 
ATOM   117 C CD2 . PHE A 1 18 ? -18.124 12.470 -6.037  1.00 38.04  ? 24  PHE A CD2 1 
ATOM   118 C CE1 . PHE A 1 18 ? -19.463 10.059 -6.074  1.00 34.39  ? 24  PHE A CE1 1 
ATOM   119 C CE2 . PHE A 1 18 ? -19.436 12.423 -6.449  1.00 35.05  ? 24  PHE A CE2 1 
ATOM   120 C CZ  . PHE A 1 18 ? -20.104 11.218 -6.470  1.00 31.90  ? 24  PHE A CZ  1 
ATOM   121 N N   . LEU A 1 19 ? -14.721 13.369 -7.178  1.00 22.92  ? 25  LEU A N   1 
ATOM   122 C CA  . LEU A 1 19 ? -14.838 14.466 -8.132  1.00 24.63  ? 25  LEU A CA  1 
ATOM   123 C C   . LEU A 1 19 ? -14.370 14.024 -9.529  1.00 26.88  ? 25  LEU A C   1 
ATOM   124 O O   . LEU A 1 19 ? -15.077 14.188 -10.524 1.00 28.16  ? 25  LEU A O   1 
ATOM   125 C CB  . LEU A 1 19 ? -14.028 15.670 -7.635  1.00 24.22  ? 25  LEU A CB  1 
ATOM   126 C CG  . LEU A 1 19 ? -14.108 16.967 -8.441  1.00 28.43  ? 25  LEU A CG  1 
ATOM   127 C CD1 . LEU A 1 19 ? -13.795 18.144 -7.526  1.00 28.91  ? 25  LEU A CD1 1 
ATOM   128 C CD2 . LEU A 1 19 ? -13.132 16.958 -9.617  1.00 29.73  ? 25  LEU A CD2 1 
ATOM   129 N N   . PHE A 1 20 ? -13.184 13.434 -9.599  1.00 24.20  ? 26  PHE A N   1 
ATOM   130 C CA  . PHE A 1 20 ? -12.619 13.068 -10.904 1.00 24.70  ? 26  PHE A CA  1 
ATOM   131 C C   . PHE A 1 20 ? -13.255 11.830 -11.515 1.00 21.28  ? 26  PHE A C   1 
ATOM   132 O O   . PHE A 1 20 ? -13.477 11.782 -12.731 1.00 25.57  ? 26  PHE A O   1 
ATOM   133 C CB  . PHE A 1 20 ? -11.100 12.891 -10.791 1.00 25.21  ? 26  PHE A CB  1 
ATOM   134 C CG  . PHE A 1 20 ? -10.375 14.184 -10.767 1.00 24.84  ? 26  PHE A CG  1 
ATOM   135 C CD1 . PHE A 1 20 ? -10.242 14.922 -11.929 1.00 22.17  ? 26  PHE A CD1 1 
ATOM   136 C CD2 . PHE A 1 20 ? -9.879  14.712 -9.584  1.00 26.13  ? 26  PHE A CD2 1 
ATOM   137 C CE1 . PHE A 1 20 ? -9.601  16.130 -11.934 1.00 27.78  ? 26  PHE A CE1 1 
ATOM   138 C CE2 . PHE A 1 20 ? -9.230  15.933 -9.579  1.00 30.72  ? 26  PHE A CE2 1 
ATOM   139 C CZ  . PHE A 1 20 ? -9.092  16.646 -10.754 1.00 34.07  ? 26  PHE A CZ  1 
ATOM   140 N N   . VAL A 1 21 ? -13.601 10.843 -10.699 1.00 22.90  ? 27  VAL A N   1 
ATOM   141 C CA  . VAL A 1 21 ? -14.228 9.648  -11.253 1.00 23.55  ? 27  VAL A CA  1 
ATOM   142 C C   . VAL A 1 21 ? -15.630 9.998  -11.760 1.00 24.11  ? 27  VAL A C   1 
ATOM   143 O O   . VAL A 1 21 ? -16.055 9.521  -12.812 1.00 22.33  ? 27  VAL A O   1 
ATOM   144 C CB  . VAL A 1 21 ? -14.274 8.513  -10.234 1.00 23.43  ? 27  VAL A CB  1 
ATOM   145 C CG1 . VAL A 1 21 ? -15.055 7.346  -10.799 1.00 23.16  ? 27  VAL A CG1 1 
ATOM   146 C CG2 . VAL A 1 21 ? -12.852 8.090  -9.895  1.00 22.08  ? 27  VAL A CG2 1 
ATOM   147 N N   . ASN A 1 22 ? -16.316 10.896 -11.061 1.00 21.29  ? 28  ASN A N   1 
ATOM   148 C CA  . ASN A 1 22 ? -17.620 11.364 -11.521 1.00 26.15  ? 28  ASN A CA  1 
ATOM   149 C C   . ASN A 1 22 ? -17.501 12.117 -12.846 1.00 30.02  ? 28  ASN A C   1 
ATOM   150 O O   . ASN A 1 22 ? -18.316 11.914 -13.755 1.00 25.97  ? 28  ASN A O   1 
ATOM   151 C CB  . ASN A 1 22 ? -18.277 12.253 -10.460 1.00 27.64  ? 28  ASN A CB  1 
ATOM   152 C CG  . ASN A 1 22 ? -19.635 12.771 -10.890 1.00 30.51  ? 28  ASN A CG  1 
ATOM   153 O OD1 . ASN A 1 22 ? -20.583 11.999 -11.040 1.00 31.79  ? 28  ASN A OD1 1 
ATOM   154 N ND2 . ASN A 1 22 ? -19.739 14.081 -11.085 1.00 33.40  ? 28  ASN A ND2 1 
ATOM   155 N N   . LYS A 1 23 ? -16.499 12.994 -12.960 1.00 27.55  ? 29  LYS A N   1 
ATOM   156 C CA  . LYS A 1 23 ? -16.266 13.685 -14.232 1.00 26.39  ? 29  LYS A CA  1 
ATOM   157 C C   . LYS A 1 23 ? -15.973 12.660 -15.327 1.00 23.98  ? 29  LYS A C   1 
ATOM   158 O O   . LYS A 1 23 ? -16.479 12.755 -16.454 1.00 23.88  ? 29  LYS A O   1 
ATOM   159 C CB  . LYS A 1 23 ? -15.113 14.679 -14.123 1.00 28.18  ? 29  LYS A CB  1 
ATOM   160 C CG  . LYS A 1 23 ? -15.435 15.902 -13.299 1.00 28.15  ? 29  LYS A CG  1 
ATOM   161 C CD  . LYS A 1 23 ? -14.213 16.808 -13.172 1.00 30.13  ? 29  LYS A CD  1 
ATOM   162 C CE  . LYS A 1 23 ? -13.686 17.250 -14.522 1.00 39.90  ? 29  LYS A CE  1 
ATOM   163 N NZ  . LYS A 1 23 ? -14.661 18.138 -15.212 1.00 40.83  ? 29  LYS A NZ  1 
ATOM   164 N N   . GLY A 1 24 ? -15.160 11.674 -14.988 1.00 22.42  ? 30  GLY A N   1 
ATOM   165 C CA  . GLY A 1 24 ? -14.826 10.629 -15.940 1.00 21.05  ? 30  GLY A CA  1 
ATOM   166 C C   . GLY A 1 24 ? -16.078 9.909  -16.411 1.00 25.69  ? 30  GLY A C   1 
ATOM   167 O O   . GLY A 1 24 ? -16.264 9.700  -17.609 1.00 23.73  ? 30  GLY A O   1 
ATOM   168 N N   . LEU A 1 25 ? -16.931 9.515  -15.472 1.00 20.22  ? 31  LEU A N   1 
ATOM   169 C CA  . LEU A 1 25 ? -18.176 8.814  -15.845 1.00 21.69  ? 31  LEU A CA  1 
ATOM   170 C C   . LEU A 1 25 ? -19.109 9.709  -16.661 1.00 26.52  ? 31  LEU A C   1 
ATOM   171 O O   . LEU A 1 25 ? -19.716 9.254  -17.629 1.00 24.67  ? 31  LEU A O   1 
ATOM   172 C CB  . LEU A 1 25 ? -18.912 8.310  -14.608 1.00 24.21  ? 31  LEU A CB  1 
ATOM   173 C CG  . LEU A 1 25 ? -18.293 7.076  -13.969 1.00 22.87  ? 31  LEU A CG  1 
ATOM   174 C CD1 . LEU A 1 25 ? -18.800 6.962  -12.548 1.00 25.01  ? 31  LEU A CD1 1 
ATOM   175 C CD2 . LEU A 1 25 ? -18.668 5.842  -14.797 1.00 24.08  ? 31  LEU A CD2 1 
ATOM   176 N N   . ASN A 1 26 ? -19.234 10.983 -16.282 1.00 25.19  ? 32  ASN A N   1 
ATOM   177 C CA  . ASN A 1 26 ? -20.049 11.897 -17.084 1.00 24.45  ? 32  ASN A CA  1 
ATOM   178 C C   . ASN A 1 26 ? -19.578 11.954 -18.531 1.00 25.58  ? 32  ASN A C   1 
ATOM   179 O O   . ASN A 1 26 ? -20.393 11.897 -19.462 1.00 28.13  ? 32  ASN A O   1 
ATOM   180 C CB  . ASN A 1 26 ? -20.034 13.333 -16.523 1.00 26.91  ? 32  ASN A CB  1 
ATOM   181 C CG  . ASN A 1 26 ? -20.923 13.506 -15.313 1.00 31.12  ? 32  ASN A CG  1 
ATOM   182 O OD1 . ASN A 1 26 ? -21.681 12.608 -14.946 1.00 28.86  ? 32  ASN A OD1 1 
ATOM   183 N ND2 . ASN A 1 26 ? -20.843 14.683 -14.686 1.00 30.72  ? 32  ASN A ND2 1 
ATOM   184 N N   . THR A 1 27 ? -18.268 12.101 -18.730 1.00 26.19  ? 33  THR A N   1 
ATOM   185 C CA  . THR A 1 27 ? -17.750 12.257 -20.089 1.00 24.17  ? 33  THR A CA  1 
ATOM   186 C C   . THR A 1 27 ? -17.793 10.939 -20.841 1.00 23.08  ? 33  THR A C   1 
ATOM   187 O O   . THR A 1 27 ? -18.016 10.899 -22.050 1.00 28.05  ? 33  THR A O   1 
ATOM   188 C CB  . THR A 1 27 ? -16.310 12.827 -20.095 1.00 25.12  ? 33  THR A CB  1 
ATOM   189 O OG1 . THR A 1 27 ? -15.469 12.069 -19.225 1.00 30.47  ? 33  THR A OG1 1 
ATOM   190 C CG2 . THR A 1 27 ? -16.353 14.254 -19.571 1.00 33.85  ? 33  THR A CG2 1 
ATOM   191 N N   . ASP A 1 28 ? -17.594 9.859  -20.111 1.00 18.41  ? 34  ASP A N   1 
ATOM   192 C CA  . ASP A 1 28 ? -17.689 8.523  -20.690 1.00 21.17  ? 34  ASP A CA  1 
ATOM   193 C C   . ASP A 1 28 ? -19.106 8.257  -21.211 1.00 25.90  ? 34  ASP A C   1 
ATOM   194 O O   . ASP A 1 28 ? -19.297 7.756  -22.329 1.00 28.39  ? 34  ASP A O   1 
ATOM   195 C CB  . ASP A 1 28 ? -17.287 7.491  -19.632 1.00 24.01  ? 34  ASP A CB  1 
ATOM   196 C CG  . ASP A 1 28 ? -16.812 6.184  -20.233 1.00 28.63  ? 34  ASP A CG  1 
ATOM   197 O OD1 . ASP A 1 28 ? -17.124 5.935  -21.411 1.00 33.79  ? 34  ASP A OD1 1 
ATOM   198 O OD2 . ASP A 1 28 ? -16.133 5.406  -19.516 1.00 26.19  ? 34  ASP A OD2 1 
ATOM   199 N N   . GLU A 1 29 ? -20.110 8.601  -20.408 1.00 22.49  ? 35  GLU A N   1 
ATOM   200 C CA  . GLU A 1 29 ? -21.493 8.409  -20.820 1.00 25.09  ? 35  GLU A CA  1 
ATOM   201 C C   . GLU A 1 29 ? -21.821 9.254  -22.045 1.00 31.39  ? 35  GLU A C   1 
ATOM   202 O O   . GLU A 1 29 ? -22.645 8.866  -22.864 1.00 29.64  ? 35  GLU A O   1 
ATOM   203 C CB  . GLU A 1 29 ? -22.456 8.729  -19.664 1.00 27.27  ? 35  GLU A CB  1 
ATOM   204 C CG  . GLU A 1 29 ? -22.370 7.706  -18.547 1.00 23.61  ? 35  GLU A CG  1 
ATOM   205 C CD  . GLU A 1 29 ? -22.877 8.204  -17.216 1.00 27.66  ? 35  GLU A CD  1 
ATOM   206 O OE1 . GLU A 1 29 ? -23.180 9.417  -17.109 1.00 29.37  ? 35  GLU A OE1 1 
ATOM   207 O OE2 . GLU A 1 29 ? -22.963 7.378  -16.280 1.00 27.43  ? 35  GLU A OE2 1 
ATOM   208 N N   . LEU A 1 30 ? -21.157 10.403 -22.177 1.00 28.04  ? 36  LEU A N   1 
ATOM   209 C CA  . LEU A 1 30 ? -21.410 11.305 -23.290 1.00 28.56  ? 36  LEU A CA  1 
ATOM   210 C C   . LEU A 1 30 ? -20.565 10.931 -24.511 1.00 28.07  ? 36  LEU A C   1 
ATOM   211 O O   . LEU A 1 30 ? -20.652 11.566 -25.560 1.00 31.90  ? 36  LEU A O   1 
ATOM   212 C CB  . LEU A 1 30 ? -21.131 12.745 -22.849 1.00 30.26  ? 36  LEU A CB  1 
ATOM   213 C CG  . LEU A 1 30 ? -21.844 13.890 -23.556 1.00 43.67  ? 36  LEU A CG  1 
ATOM   214 C CD1 . LEU A 1 30 ? -23.308 13.558 -23.753 1.00 38.44  ? 36  LEU A CD1 1 
ATOM   215 C CD2 . LEU A 1 30 ? -21.680 15.162 -22.731 1.00 46.74  ? 36  LEU A CD2 1 
ATOM   216 N N   . GLY A 1 31 ? -19.749 9.896  -24.361 1.00 33.52  ? 37  GLY A N   1 
ATOM   217 C CA  . GLY A 1 31 ? -18.934 9.381  -25.451 1.00 31.50  ? 37  GLY A CA  1 
ATOM   218 C C   . GLY A 1 31 ? -17.618 10.110 -25.669 1.00 35.35  ? 37  GLY A C   1 
ATOM   219 O O   . GLY A 1 31 ? -16.970 9.950  -26.703 1.00 34.65  ? 37  GLY A O   1 
ATOM   220 N N   . GLN A 1 32 ? -17.230 10.936 -24.707 1.00 28.53  ? 38  GLN A N   1 
ATOM   221 C CA  . GLN A 1 32 ? -15.990 11.695 -24.814 1.00 24.59  ? 38  GLN A CA  1 
ATOM   222 C C   . GLN A 1 32 ? -14.853 10.880 -24.193 1.00 26.18  ? 38  GLN A C   1 
ATOM   223 O O   . GLN A 1 32 ? -14.443 11.113 -23.059 1.00 29.46  ? 38  GLN A O   1 
ATOM   224 C CB  . GLN A 1 32 ? -16.173 13.064 -24.153 1.00 27.14  ? 38  GLN A CB  1 
ATOM   225 C CG  . GLN A 1 32 ? -17.294 13.860 -24.832 1.00 30.44  ? 38  GLN A CG  1 
ATOM   226 C CD  . GLN A 1 32 ? -17.806 15.038 -24.027 1.00 31.11  ? 38  GLN A CD  1 
ATOM   227 O OE1 . GLN A 1 32 ? -17.648 15.094 -22.810 1.00 36.91  ? 38  GLN A OE1 1 
ATOM   228 N NE2 . GLN A 1 32 ? -18.448 15.984 -24.713 1.00 39.41  ? 38  GLN A NE2 1 
ATOM   229 N N   . LYS A 1 33 ? -14.367 9.893  -24.940 1.00 27.94  ? 39  LYS A N   1 
ATOM   230 C CA  . LYS A 1 33 ? -13.506 8.866  -24.357 1.00 28.85  ? 39  LYS A CA  1 
ATOM   231 C C   . LYS A 1 33 ? -12.103 9.365  -24.007 1.00 27.45  ? 39  LYS A C   1 
ATOM   232 O O   . LYS A 1 33 ? -11.500 8.915  -23.026 1.00 27.62  ? 39  LYS A O   1 
ATOM   233 C CB  . LYS A 1 33 ? -13.433 7.655  -25.299 1.00 32.07  ? 39  LYS A CB  1 
ATOM   234 C CG  . LYS A 1 33 ? -14.718 6.825  -25.280 1.00 34.04  ? 39  LYS A CG  1 
ATOM   235 C CD  . LYS A 1 33 ? -14.865 5.896  -26.481 1.00 45.23  ? 39  LYS A CD  1 
ATOM   236 C CE  . LYS A 1 33 ? -16.114 5.021  -26.335 1.00 39.98  ? 39  LYS A CE  1 
ATOM   237 N N   . GLU A 1 34 ? -11.582 10.314 -24.775 1.00 30.21  ? 40  GLU A N   1 
ATOM   238 C CA  . GLU A 1 34 ? -10.276 10.857 -24.430 1.00 30.39  ? 40  GLU A CA  1 
ATOM   239 C C   . GLU A 1 34 ? -10.352 11.650 -23.125 1.00 30.14  ? 40  GLU A C   1 
ATOM   240 O O   . GLU A 1 34 ? -9.467  11.537 -22.278 1.00 30.24  ? 40  GLU A O   1 
ATOM   241 C CB  . GLU A 1 34 ? -9.738  11.718 -25.567 1.00 42.96  ? 40  GLU A CB  1 
ATOM   242 C CG  . GLU A 1 34 ? -9.269  10.888 -26.748 1.00 49.79  ? 40  GLU A CG  1 
ATOM   243 C CD  . GLU A 1 34 ? -8.252  9.827  -26.346 1.00 51.94  ? 40  GLU A CD  1 
ATOM   244 O OE1 . GLU A 1 34 ? -7.265  10.168 -25.654 1.00 55.65  ? 40  GLU A OE1 1 
ATOM   245 O OE2 . GLU A 1 34 ? -8.446  8.647  -26.713 1.00 47.65  ? 40  GLU A OE2 1 
ATOM   246 N N   . GLU A 1 35 ? -11.411 12.447 -22.967 1.00 27.39  ? 41  GLU A N   1 
ATOM   247 C CA  . GLU A 1 35 ? -11.626 13.204 -21.740 1.00 32.57  ? 41  GLU A CA  1 
ATOM   248 C C   . GLU A 1 35 ? -11.810 12.262 -20.572 1.00 34.40  ? 41  GLU A C   1 
ATOM   249 O O   . GLU A 1 35 ? -11.268 12.482 -19.486 1.00 30.07  ? 41  GLU A O   1 
ATOM   250 C CB  . GLU A 1 35 ? -12.850 14.108 -21.860 1.00 34.93  ? 41  GLU A CB  1 
ATOM   251 C CG  . GLU A 1 35 ? -12.552 15.581 -21.885 1.00 39.54  ? 41  GLU A CG  1 
ATOM   252 C CD  . GLU A 1 35 ? -13.813 16.411 -21.786 1.00 44.18  ? 41  GLU A CD  1 
ATOM   253 O OE1 . GLU A 1 35 ? -14.605 16.391 -22.751 1.00 42.71  ? 41  GLU A OE1 1 
ATOM   254 O OE2 . GLU A 1 35 ? -14.023 17.064 -20.739 1.00 38.67  ? 41  GLU A OE2 1 
ATOM   255 N N   . ALA A 1 36 ? -12.587 11.209 -20.794 1.00 27.57  ? 42  ALA A N   1 
ATOM   256 C CA  . ALA A 1 36 ? -12.853 10.259 -19.735 1.00 24.37  ? 42  ALA A CA  1 
ATOM   257 C C   . ALA A 1 36 ? -11.557 9.643  -19.224 1.00 24.09  ? 42  ALA A C   1 
ATOM   258 O O   . ALA A 1 36 ? -11.333 9.587  -18.011 1.00 25.54  ? 42  ALA A O   1 
ATOM   259 C CB  . ALA A 1 36 ? -13.801 9.182  -20.218 1.00 25.38  ? 42  ALA A CB  1 
ATOM   260 N N   . LYS A 1 37 ? -10.687 9.216  -20.134 1.00 22.65  ? 43  LYS A N   1 
ATOM   261 C CA  . LYS A 1 37 ? -9.452  8.551  -19.722 1.00 23.37  ? 43  LYS A CA  1 
ATOM   262 C C   . LYS A 1 37 ? -8.627  9.486  -18.858 1.00 25.76  ? 43  LYS A C   1 
ATOM   263 O O   . LYS A 1 37 ? -8.012  9.060  -17.879 1.00 28.61  ? 43  LYS A O   1 
ATOM   264 C CB  . LYS A 1 37 ? -8.638  8.096  -20.946 1.00 25.76  ? 43  LYS A CB  1 
ATOM   265 C CG  . LYS A 1 37 ? -9.280  6.946  -21.711 1.00 30.71  ? 43  LYS A CG  1 
ATOM   266 C CD  . LYS A 1 37 ? -8.344  6.346  -22.754 1.00 40.76  ? 43  LYS A CD  1 
ATOM   267 C CE  . LYS A 1 37 ? -8.283  7.182  -24.010 1.00 46.26  ? 43  LYS A CE  1 
ATOM   268 N NZ  . LYS A 1 37 ? -7.723  6.414  -25.168 1.00 43.81  ? 43  LYS A NZ  1 
ATOM   269 N N   . ASN A 1 38 ? -8.638  10.766 -19.221 1.00 24.93  ? 44  ASN A N   1 
ATOM   270 C CA  . ASN A 1 38 ? -7.920  11.798 -18.472 1.00 30.65  ? 44  ASN A CA  1 
ATOM   271 C C   . ASN A 1 38 ? -8.386  11.880 -17.021 1.00 29.67  ? 44  ASN A C   1 
ATOM   272 O O   . ASN A 1 38 ? -7.581  11.846 -16.092 1.00 26.17  ? 44  ASN A O   1 
ATOM   273 C CB  . ASN A 1 38 ? -8.100  13.158 -19.130 1.00 33.17  ? 44  ASN A CB  1 
ATOM   274 C CG  . ASN A 1 38 ? -7.407  14.267 -18.364 1.00 47.41  ? 44  ASN A CG  1 
ATOM   275 O OD1 . ASN A 1 38 ? -6.348  14.059 -17.775 1.00 54.12  ? 44  ASN A OD1 1 
ATOM   276 N ND2 . ASN A 1 38 ? -8.008  15.451 -18.361 1.00 56.12  ? 44  ASN A ND2 1 
ATOM   277 N N   . TYR A 1 39 ? -9.691  12.002 -16.832 1.00 25.75  ? 45  TYR A N   1 
ATOM   278 C CA  . TYR A 1 39 ? -10.239 12.116 -15.485 1.00 23.42  ? 45  TYR A CA  1 
ATOM   279 C C   . TYR A 1 39 ? -10.054 10.835 -14.713 1.00 22.62  ? 45  TYR A C   1 
ATOM   280 O O   . TYR A 1 39 ? -9.744  10.867 -13.524 1.00 26.58  ? 45  TYR A O   1 
ATOM   281 C CB  . TYR A 1 39 ? -11.707 12.505 -15.539 1.00 25.83  ? 45  TYR A CB  1 
ATOM   282 C CG  . TYR A 1 39 ? -11.924 13.801 -16.277 1.00 25.18  ? 45  TYR A CG  1 
ATOM   283 C CD1 . TYR A 1 39 ? -11.075 14.879 -16.093 1.00 25.83  ? 45  TYR A CD1 1 
ATOM   284 C CD2 . TYR A 1 39 ? -12.964 13.935 -17.175 1.00 20.88  ? 45  TYR A CD2 1 
ATOM   285 C CE1 . TYR A 1 39 ? -11.272 16.062 -16.787 1.00 33.60  ? 45  TYR A CE1 1 
ATOM   286 C CE2 . TYR A 1 39 ? -13.175 15.107 -17.861 1.00 25.42  ? 45  TYR A CE2 1 
ATOM   287 C CZ  . TYR A 1 39 ? -12.329 16.165 -17.672 1.00 33.92  ? 45  TYR A CZ  1 
ATOM   288 O OH  . TYR A 1 39 ? -12.556 17.322 -18.386 1.00 37.26  ? 45  TYR A OH  1 
ATOM   289 N N   . TYR A 1 40 ? -10.235 9.697  -15.381 1.00 20.60  ? 46  TYR A N   1 
ATOM   290 C CA  . TYR A 1 40 ? -10.073 8.425  -14.702 1.00 22.57  ? 46  TYR A CA  1 
ATOM   291 C C   . TYR A 1 40 ? -8.656  8.292  -14.152 1.00 24.17  ? 46  TYR A C   1 
ATOM   292 O O   . TYR A 1 40 ? -8.467  7.839  -13.018 1.00 24.82  ? 46  TYR A O   1 
ATOM   293 C CB  . TYR A 1 40 ? -10.388 7.247  -15.635 1.00 22.05  ? 46  TYR A CB  1 
ATOM   294 C CG  . TYR A 1 40 ? -11.856 7.021  -15.968 1.00 23.10  ? 46  TYR A CG  1 
ATOM   295 C CD1 . TYR A 1 40 ? -12.873 7.367  -15.080 1.00 21.93  ? 46  TYR A CD1 1 
ATOM   296 C CD2 . TYR A 1 40 ? -12.218 6.440  -17.180 1.00 23.80  ? 46  TYR A CD2 1 
ATOM   297 C CE1 . TYR A 1 40 ? -14.216 7.129  -15.398 1.00 24.71  ? 46  TYR A CE1 1 
ATOM   298 C CE2 . TYR A 1 40 ? -13.553 6.225  -17.508 1.00 28.56  ? 46  TYR A CE2 1 
ATOM   299 C CZ  . TYR A 1 40 ? -14.541 6.571  -16.623 1.00 27.47  ? 46  TYR A CZ  1 
ATOM   300 O OH  . TYR A 1 40 ? -15.863 6.341  -16.964 1.00 24.60  ? 46  TYR A OH  1 
ATOM   301 N N   . LYS A 1 41 ? -7.657  8.667  -14.951 1.00 21.71  ? 47  LYS A N   1 
ATOM   302 C CA  . LYS A 1 41 ? -6.279  8.555  -14.490 1.00 25.59  ? 47  LYS A CA  1 
ATOM   303 C C   . LYS A 1 41 ? -6.040  9.477  -13.302 1.00 28.82  ? 47  LYS A C   1 
ATOM   304 O O   . LYS A 1 41 ? -5.318  9.118  -12.373 1.00 28.72  ? 47  LYS A O   1 
ATOM   305 C CB  . LYS A 1 41 ? -5.294  8.861  -15.619 1.00 28.68  ? 47  LYS A CB  1 
ATOM   306 C CG  . LYS A 1 41 ? -5.194  7.732  -16.636 1.00 33.92  ? 47  LYS A CG  1 
ATOM   307 C CD  . LYS A 1 41 ? -4.150  8.003  -17.701 1.00 41.99  ? 47  LYS A CD  1 
ATOM   308 C CE  . LYS A 1 41 ? -4.612  9.062  -18.658 1.00 39.62  ? 47  LYS A CE  1 
ATOM   309 N N   . GLN A 1 42 ? -6.646  10.660 -13.316 1.00 26.79  ? 48  GLN A N   1 
ATOM   310 C CA  . GLN A 1 42 ? -6.485  11.550 -12.173 1.00 27.98  ? 48  GLN A CA  1 
ATOM   311 C C   . GLN A 1 42 ? -7.162  10.938 -10.961 1.00 24.31  ? 48  GLN A C   1 
ATOM   312 O O   . GLN A 1 42 ? -6.625  10.988 -9.856  1.00 29.08  ? 48  GLN A O   1 
ATOM   313 C CB  . GLN A 1 42 ? -7.043  12.945 -12.461 1.00 26.59  ? 48  GLN A CB  1 
ATOM   314 C CG  . GLN A 1 42 ? -6.282  13.657 -13.554 1.00 29.60  ? 48  GLN A CG  1 
ATOM   315 C CD  . GLN A 1 42 ? -6.765  15.064 -13.764 1.00 38.04  ? 48  GLN A CD  1 
ATOM   316 O OE1 . GLN A 1 42 ? -6.595  15.924 -12.895 1.00 29.65  ? 48  GLN A OE1 1 
ATOM   317 N NE2 . GLN A 1 42 ? -7.385  15.313 -14.918 1.00 31.32  ? 48  GLN A NE2 1 
ATOM   318 N N   . GLY A 1 43 ? -8.326  10.328 -11.171 1.00 24.49  ? 49  GLY A N   1 
ATOM   319 C CA  . GLY A 1 43 ? -9.038  9.704  -10.072 1.00 25.27  ? 49  GLY A CA  1 
ATOM   320 C C   . GLY A 1 43 ? -8.221  8.575  -9.458  1.00 27.56  ? 49  GLY A C   1 
ATOM   321 O O   . GLY A 1 43 ? -8.144  8.448  -8.237  1.00 24.86  ? 49  GLY A O   1 
ATOM   322 N N   . ILE A 1 44 ? -7.597  7.763  -10.308 1.00 24.57  ? 50  ILE A N   1 
ATOM   323 C CA  . ILE A 1 44 ? -6.748  6.663  -9.840  1.00 22.70  ? 50  ILE A CA  1 
ATOM   324 C C   . ILE A 1 44 ? -5.652  7.173  -8.902  1.00 26.92  ? 50  ILE A C   1 
ATOM   325 O O   . ILE A 1 44 ? -5.391  6.559  -7.869  1.00 29.36  ? 50  ILE A O   1 
ATOM   326 C CB  . ILE A 1 44 ? -6.131  5.894  -11.036 1.00 25.84  ? 50  ILE A CB  1 
ATOM   327 C CG1 . ILE A 1 44 ? -7.216  5.047  -11.701 1.00 29.10  ? 50  ILE A CG1 1 
ATOM   328 C CG2 . ILE A 1 44 ? -4.989  5.007  -10.577 1.00 27.40  ? 50  ILE A CG2 1 
ATOM   329 C CD1 . ILE A 1 44 ? -6.797  4.372  -12.998 1.00 29.15  ? 50  ILE A CD1 1 
ATOM   330 N N   . GLY A 1 45 ? -5.041  8.308  -9.237  1.00 26.38  ? 51  GLY A N   1 
ATOM   331 C CA  . GLY A 1 45 ? -3.985  8.870  -8.409  1.00 28.64  ? 51  GLY A CA  1 
ATOM   332 C C   . GLY A 1 45 ? -4.487  9.169  -7.007  1.00 32.65  ? 51  GLY A C   1 
ATOM   333 O O   . GLY A 1 45 ? -3.846  8.824  -6.009  1.00 32.46  ? 51  GLY A O   1 
ATOM   334 N N   . HIS A 1 46 ? -5.646  9.813  -6.929  1.00 28.59  ? 52  HIS A N   1 
ATOM   335 C CA  . HIS A 1 46 ? -6.225  10.140 -5.631  1.00 25.64  ? 52  HIS A CA  1 
ATOM   336 C C   . HIS A 1 46 ? -6.661  8.887  -4.886  1.00 27.70  ? 52  HIS A C   1 
ATOM   337 O O   . HIS A 1 46 ? -6.476  8.801  -3.667  1.00 29.53  ? 52  HIS A O   1 
ATOM   338 C CB  . HIS A 1 46 ? -7.400  11.097 -5.801  1.00 25.14  ? 52  HIS A CB  1 
ATOM   339 C CG  . HIS A 1 46 ? -7.010  12.391 -6.441  1.00 28.70  ? 52  HIS A CG  1 
ATOM   340 N ND1 . HIS A 1 46 ? -6.175  13.295 -5.824  1.00 36.32  ? 52  HIS A ND1 1 
ATOM   341 C CD2 . HIS A 1 46 ? -7.309  12.917 -7.649  1.00 26.28  ? 52  HIS A CD2 1 
ATOM   342 C CE1 . HIS A 1 46 ? -5.983  14.329 -6.623  1.00 36.84  ? 52  HIS A CE1 1 
ATOM   343 N NE2 . HIS A 1 46 ? -6.658  14.125 -7.738  1.00 31.18  ? 52  HIS A NE2 1 
ATOM   344 N N   . LEU A 1 47 ? -7.240  7.919  -5.597  1.00 26.47  ? 53  LEU A N   1 
ATOM   345 C CA  . LEU A 1 47 ? -7.700  6.693  -4.932  1.00 22.73  ? 53  LEU A CA  1 
ATOM   346 C C   . LEU A 1 47 ? -6.509  5.974  -4.308  1.00 30.24  ? 53  LEU A C   1 
ATOM   347 O O   . LEU A 1 47 ? -6.552  5.545  -3.147  1.00 28.46  ? 53  LEU A O   1 
ATOM   348 C CB  . LEU A 1 47 ? -8.422  5.745  -5.906  1.00 20.42  ? 53  LEU A CB  1 
ATOM   349 C CG  . LEU A 1 47 ? -9.760  6.266  -6.438  1.00 22.80  ? 53  LEU A CG  1 
ATOM   350 C CD1 . LEU A 1 47 ? -10.147 5.508  -7.681  1.00 23.66  ? 53  LEU A CD1 1 
ATOM   351 C CD2 . LEU A 1 47 ? -10.827 6.110  -5.370  1.00 25.50  ? 53  LEU A CD2 1 
ATOM   352 N N   . LEU A 1 48 ? -5.443  5.841  -5.086  1.00 32.52  ? 54  LEU A N   1 
ATOM   353 C CA  . LEU A 1 48 ? -4.255  5.137  -4.615  1.00 34.55  ? 54  LEU A CA  1 
ATOM   354 C C   . LEU A 1 48 ? -3.703  5.765  -3.347  1.00 41.28  ? 54  LEU A C   1 
ATOM   355 O O   . LEU A 1 48 ? -3.318  5.061  -2.415  1.00 44.91  ? 54  LEU A O   1 
ATOM   356 C CB  . LEU A 1 48 ? -3.170  5.121  -5.691  1.00 27.36  ? 54  LEU A CB  1 
ATOM   357 C CG  . LEU A 1 48 ? -3.366  4.178  -6.878  1.00 30.20  ? 54  LEU A CG  1 
ATOM   358 C CD1 . LEU A 1 48 ? -2.322  4.499  -7.936  1.00 30.51  ? 54  LEU A CD1 1 
ATOM   359 C CD2 . LEU A 1 48 ? -3.285  2.708  -6.453  1.00 38.17  ? 54  LEU A CD2 1 
ATOM   360 N N   . ARG A 1 49 ? -3.672  7.091  -3.306  1.00 28.77  ? 55  ARG A N   1 
ATOM   361 C CA  . ARG A 1 49 ? -3.110  7.767  -2.146  1.00 32.70  ? 55  ARG A CA  1 
ATOM   362 C C   . ARG A 1 49 ? -3.944  7.519  -0.896  1.00 32.82  ? 55  ARG A C   1 
ATOM   363 O O   . ARG A 1 49 ? -3.401  7.238  0.172   1.00 33.75  ? 55  ARG A O   1 
ATOM   364 C CB  . ARG A 1 49 ? -3.001  9.267  -2.394  1.00 32.44  ? 55  ARG A CB  1 
ATOM   365 C CG  . ARG A 1 49 ? -2.374  10.011 -1.223  1.00 40.05  ? 55  ARG A CG  1 
ATOM   366 C CD  . ARG A 1 49 ? -2.127  11.464 -1.564  1.00 41.53  ? 55  ARG A CD  1 
ATOM   367 N NE  . ARG A 1 49 ? -3.377  12.192 -1.764  1.00 46.18  ? 55  ARG A NE  1 
ATOM   368 C CZ  . ARG A 1 49 ? -3.908  12.456 -2.954  1.00 46.36  ? 55  ARG A CZ  1 
ATOM   369 N NH1 . ARG A 1 49 ? -3.299  12.052 -4.061  1.00 39.39  ? 55  ARG A NH1 1 
ATOM   370 N NH2 . ARG A 1 49 ? -5.047  13.131 -3.036  1.00 40.44  ? 55  ARG A NH2 1 
ATOM   371 N N   . GLY A 1 50 ? -5.257  7.655  -1.028  1.00 28.41  ? 56  GLY A N   1 
ATOM   372 C CA  . GLY A 1 50 ? -6.164  7.460  0.095   1.00 25.61  ? 56  GLY A CA  1 
ATOM   373 C C   . GLY A 1 50 ? -6.083  6.042  0.634   1.00 31.04  ? 56  GLY A C   1 
ATOM   374 O O   . GLY A 1 50 ? -6.108  5.821  1.842   1.00 31.74  ? 56  GLY A O   1 
ATOM   375 N N   . ILE A 1 51 ? -5.968  5.078  -0.272  1.00 27.59  ? 57  ILE A N   1 
ATOM   376 C CA  . ILE A 1 51 ? -5.930  3.664  0.099   1.00 28.66  ? 57  ILE A CA  1 
ATOM   377 C C   . ILE A 1 51 ? -4.612  3.327  0.794   1.00 31.91  ? 57  ILE A C   1 
ATOM   378 O O   . ILE A 1 51 ? -4.549  2.439  1.651   1.00 29.36  ? 57  ILE A O   1 
ATOM   379 C CB  . ILE A 1 51 ? -6.141  2.775  -1.149  1.00 26.04  ? 57  ILE A CB  1 
ATOM   380 C CG1 . ILE A 1 51 ? -7.586  2.903  -1.628  1.00 22.31  ? 57  ILE A CG1 1 
ATOM   381 C CG2 . ILE A 1 51 ? -5.823  1.318  -0.855  1.00 34.02  ? 57  ILE A CG2 1 
ATOM   382 C CD1 . ILE A 1 51 ? -7.803  2.453  -3.084  1.00 28.86  ? 57  ILE A CD1 1 
ATOM   383 N N   . SER A 1 52 ? -3.560  4.065  0.455   1.00 28.54  ? 58  SER A N   1 
ATOM   384 C CA  . SER A 1 52 ? -2.215  3.748  0.948   1.00 28.32  ? 58  SER A CA  1 
ATOM   385 C C   . SER A 1 52 ? -2.000  4.054  2.432   1.00 34.90  ? 58  SER A C   1 
ATOM   386 O O   . SER A 1 52 ? -1.022  3.596  3.021   1.00 38.43  ? 58  SER A O   1 
ATOM   387 C CB  . SER A 1 52 ? -1.179  4.514  0.138   1.00 41.02  ? 58  SER A CB  1 
ATOM   388 O OG  . SER A 1 52 ? -1.185  5.880  0.517   1.00 38.35  ? 58  SER A OG  1 
ATOM   389 N N   . ILE A 1 53 ? -2.897  4.832  3.034   1.00 35.12  ? 59  ILE A N   1 
ATOM   390 C CA  . ILE A 1 53 ? -2.707  5.265  4.416   1.00 34.17  ? 59  ILE A CA  1 
ATOM   391 C C   . ILE A 1 53 ? -3.019  4.137  5.404   1.00 30.31  ? 59  ILE A C   1 
ATOM   392 O O   . ILE A 1 53 ? -4.116  3.595  5.397   1.00 31.99  ? 59  ILE A O   1 
ATOM   393 C CB  . ILE A 1 53 ? -3.590  6.489  4.742   1.00 33.67  ? 59  ILE A CB  1 
ATOM   394 C CG1 . ILE A 1 53 ? -3.334  7.614  3.731   1.00 35.36  ? 59  ILE A CG1 1 
ATOM   395 C CG2 . ILE A 1 53 ? -3.370  6.930  6.185   1.00 35.38  ? 59  ILE A CG2 1 
ATOM   396 C CD1 . ILE A 1 53 ? -1.889  8.051  3.667   1.00 37.98  ? 59  ILE A CD1 1 
ATOM   397 N N   . SER A 1 54 ? -2.040  3.773  6.229   1.00 33.02  ? 60  SER A N   1 
ATOM   398 C CA  . SER A 1 54 ? -2.226  2.737  7.247   1.00 32.82  ? 60  SER A CA  1 
ATOM   399 C C   . SER A 1 54 ? -3.375  3.137  8.167   1.00 40.19  ? 60  SER A C   1 
ATOM   400 O O   . SER A 1 54 ? -3.406  4.265  8.652   1.00 36.22  ? 60  SER A O   1 
ATOM   401 C CB  . SER A 1 54 ? -0.930  2.528  8.045   1.00 35.14  ? 60  SER A CB  1 
ATOM   402 O OG  . SER A 1 54 ? -1.100  1.575  9.088   1.00 37.83  ? 60  SER A OG  1 
ATOM   403 N N   . SER A 1 55 ? -4.332  2.234  8.384   1.00 34.83  ? 61  SER A N   1 
ATOM   404 C CA  . SER A 1 55 ? -5.530  2.598  9.141   1.00 30.32  ? 61  SER A CA  1 
ATOM   405 C C   . SER A 1 55 ? -6.049  1.497  10.071  1.00 31.75  ? 61  SER A C   1 
ATOM   406 O O   . SER A 1 55 ? -7.179  1.575  10.549  1.00 36.17  ? 61  SER A O   1 
ATOM   407 C CB  . SER A 1 55 ? -6.647  3.023  8.180   1.00 26.61  ? 61  SER A CB  1 
ATOM   408 O OG  . SER A 1 55 ? -6.923  2.009  7.222   1.00 29.12  ? 61  SER A OG  1 
ATOM   409 N N   . LYS A 1 56 ? -5.226  0.485  10.333  1.00 30.93  ? 62  LYS A N   1 
ATOM   410 C CA  . LYS A 1 56 ? -5.605  -0.596 11.253  1.00 36.12  ? 62  LYS A CA  1 
ATOM   411 C C   . LYS A 1 56 ? -4.693  -0.743 12.474  1.00 48.94  ? 62  LYS A C   1 
ATOM   412 O O   . LYS A 1 56 ? -4.702  -1.784 13.132  1.00 52.30  ? 62  LYS A O   1 
ATOM   413 C CB  . LYS A 1 56 ? -5.627  -1.926 10.508  1.00 42.89  ? 62  LYS A CB  1 
ATOM   414 C CG  . LYS A 1 56 ? -6.814  -2.116 9.611   1.00 41.85  ? 62  LYS A CG  1 
ATOM   415 C CD  . LYS A 1 56 ? -6.824  -3.524 9.038   1.00 51.00  ? 62  LYS A CD  1 
ATOM   416 C CE  . LYS A 1 56 ? -5.477  -3.892 8.446   1.00 50.73  ? 62  LYS A CE  1 
ATOM   417 N NZ  . LYS A 1 56 ? -5.575  -5.063 7.539   1.00 49.75  ? 62  LYS A NZ  1 
ATOM   418 N N   . GLU A 1 57 ? -3.909  0.281  12.785  1.00 42.17  ? 63  GLU A N   1 
ATOM   419 C CA  . GLU A 1 57 ? -2.971  0.178  13.899  1.00 48.16  ? 63  GLU A CA  1 
ATOM   420 C C   . GLU A 1 57 ? -3.647  0.454  15.249  1.00 50.27  ? 63  GLU A C   1 
ATOM   421 O O   . GLU A 1 57 ? -4.821  0.827  15.306  1.00 49.06  ? 63  GLU A O   1 
ATOM   422 C CB  . GLU A 1 57 ? -1.793  1.121  13.680  1.00 52.57  ? 63  GLU A CB  1 
ATOM   423 C CG  . GLU A 1 57 ? -1.043  0.849  12.379  1.00 55.53  ? 63  GLU A CG  1 
ATOM   424 C CD  . GLU A 1 57 ? 0.018   1.891  12.087  1.00 61.75  ? 63  GLU A CD  1 
ATOM   425 O OE1 . GLU A 1 57 ? 0.408   2.613  13.029  1.00 66.45  ? 63  GLU A OE1 1 
ATOM   426 O OE2 . GLU A 1 57 ? 0.453   1.993  10.917  1.00 52.92  ? 63  GLU A OE2 1 
ATOM   427 N N   . SER A 1 58 ? -2.892  0.264  16.327  1.00 52.03  ? 64  SER A N   1 
ATOM   428 C CA  . SER A 1 58 ? -3.432  0.317  17.682  1.00 47.88  ? 64  SER A CA  1 
ATOM   429 C C   . SER A 1 58 ? -4.070  1.661  18.021  1.00 51.49  ? 64  SER A C   1 
ATOM   430 O O   . SER A 1 58 ? -5.108  1.710  18.679  1.00 59.31  ? 64  SER A O   1 
ATOM   431 C CB  . SER A 1 58 ? -2.332  -0.005 18.703  1.00 42.90  ? 64  SER A CB  1 
ATOM   432 N N   . GLU A 1 59 ? -3.451  2.749  17.577  1.00 54.12  ? 65  GLU A N   1 
ATOM   433 C CA  . GLU A 1 59 ? -3.970  4.080  17.869  1.00 56.16  ? 65  GLU A CA  1 
ATOM   434 C C   . GLU A 1 59 ? -5.151  4.440  16.969  1.00 54.02  ? 65  GLU A C   1 
ATOM   435 O O   . GLU A 1 59 ? -5.844  5.427  17.215  1.00 53.93  ? 65  GLU A O   1 
ATOM   436 C CB  . GLU A 1 59 ? -2.867  5.131  17.722  1.00 58.69  ? 65  GLU A CB  1 
ATOM   437 N N   . HIS A 1 60 ? -5.383  3.640  15.931  1.00 52.38  ? 66  HIS A N   1 
ATOM   438 C CA  . HIS A 1 60 ? -6.426  3.955  14.953  1.00 43.30  ? 66  HIS A CA  1 
ATOM   439 C C   . HIS A 1 60 ? -7.801  3.506  15.427  1.00 44.42  ? 66  HIS A C   1 
ATOM   440 O O   . HIS A 1 60 ? -8.449  2.665  14.808  1.00 36.50  ? 66  HIS A O   1 
ATOM   441 C CB  . HIS A 1 60 ? -6.094  3.327  13.600  1.00 38.15  ? 66  HIS A CB  1 
ATOM   442 C CG  . HIS A 1 60 ? -4.765  3.750  13.059  1.00 43.64  ? 66  HIS A CG  1 
ATOM   443 N ND1 . HIS A 1 60 ? -4.089  3.039  12.091  1.00 44.49  ? 66  HIS A ND1 1 
ATOM   444 C CD2 . HIS A 1 60 ? -3.982  4.816  13.356  1.00 48.77  ? 66  HIS A CD2 1 
ATOM   445 C CE1 . HIS A 1 60 ? -2.949  3.647  11.814  1.00 42.28  ? 66  HIS A CE1 1 
ATOM   446 N NE2 . HIS A 1 60 ? -2.863  4.731  12.564  1.00 44.22  ? 66  HIS A NE2 1 
ATOM   447 N N   . THR A 1 61 ? -8.249  4.097  16.524  1.00 42.97  ? 67  THR A N   1 
ATOM   448 C CA  . THR A 1 61 ? -9.543  3.764  17.086  1.00 44.75  ? 67  THR A CA  1 
ATOM   449 C C   . THR A 1 61 ? -10.460 4.979  17.064  1.00 46.42  ? 67  THR A C   1 
ATOM   450 O O   . THR A 1 61 ? -10.004 6.112  16.905  1.00 44.26  ? 67  THR A O   1 
ATOM   451 C CB  . THR A 1 61 ? -9.408  3.259  18.516  1.00 49.61  ? 67  THR A CB  1 
ATOM   452 O OG1 . THR A 1 61 ? -8.868  4.305  19.331  1.00 54.06  ? 67  THR A OG1 1 
ATOM   453 C CG2 . THR A 1 61 ? -8.475  2.055  18.564  1.00 50.56  ? 67  THR A CG2 1 
ATOM   454 N N   . GLY A 1 62 ? -11.756 4.735  17.221  1.00 43.20  ? 68  GLY A N   1 
ATOM   455 C CA  . GLY A 1 62 ? -12.730 5.809  17.273  1.00 46.42  ? 68  GLY A CA  1 
ATOM   456 C C   . GLY A 1 62 ? -13.477 6.015  15.973  1.00 39.90  ? 68  GLY A C   1 
ATOM   457 O O   . GLY A 1 62 ? -13.020 5.591  14.907  1.00 38.59  ? 68  GLY A O   1 
ATOM   458 N N   . PRO A 1 63 ? -14.631 6.693  16.049  1.00 40.03  ? 69  PRO A N   1 
ATOM   459 C CA  . PRO A 1 63 ? -15.513 6.923  14.899  1.00 38.42  ? 69  PRO A CA  1 
ATOM   460 C C   . PRO A 1 63 ? -14.815 7.572  13.701  1.00 34.70  ? 69  PRO A C   1 
ATOM   461 O O   . PRO A 1 63 ? -15.168 7.266  12.566  1.00 36.21  ? 69  PRO A O   1 
ATOM   462 C CB  . PRO A 1 63 ? -16.609 7.841  15.466  1.00 38.20  ? 69  PRO A CB  1 
ATOM   463 C CG  . PRO A 1 63 ? -16.177 8.211  16.847  1.00 45.56  ? 69  PRO A CG  1 
ATOM   464 C CD  . PRO A 1 63 ? -15.224 7.172  17.308  1.00 44.74  ? 69  PRO A CD  1 
ATOM   465 N N   . GLY A 1 64 ? -13.830 8.432  13.940  1.00 40.60  ? 70  GLY A N   1 
ATOM   466 C CA  . GLY A 1 64 ? -13.080 9.026  12.844  1.00 36.20  ? 70  GLY A CA  1 
ATOM   467 C C   . GLY A 1 64 ? -12.280 8.016  12.037  1.00 36.12  ? 70  GLY A C   1 
ATOM   468 O O   . GLY A 1 64 ? -12.326 8.005  10.802  1.00 33.91  ? 70  GLY A O   1 
ATOM   469 N N   . TRP A 1 65 ? -11.535 7.160  12.727  1.00 36.12  ? 71  TRP A N   1 
ATOM   470 C CA  . TRP A 1 65 ? -10.783 6.118  12.036  1.00 33.70  ? 71  TRP A CA  1 
ATOM   471 C C   . TRP A 1 65 ? -11.703 5.087  11.403  1.00 33.96  ? 71  TRP A C   1 
ATOM   472 O O   . TRP A 1 65 ? -11.404 4.556  10.337  1.00 28.85  ? 71  TRP A O   1 
ATOM   473 C CB  . TRP A 1 65 ? -9.807  5.432  12.983  1.00 31.48  ? 71  TRP A CB  1 
ATOM   474 C CG  . TRP A 1 65 ? -8.507  6.180  13.104  1.00 35.16  ? 71  TRP A CG  1 
ATOM   475 C CD1 . TRP A 1 65 ? -8.039  6.844  14.201  1.00 42.41  ? 71  TRP A CD1 1 
ATOM   476 C CD2 . TRP A 1 65 ? -7.525  6.359  12.078  1.00 41.83  ? 71  TRP A CD2 1 
ATOM   477 N NE1 . TRP A 1 65 ? -6.817  7.410  13.926  1.00 41.89  ? 71  TRP A NE1 1 
ATOM   478 C CE2 . TRP A 1 65 ? -6.482  7.130  12.627  1.00 43.57  ? 71  TRP A CE2 1 
ATOM   479 C CE3 . TRP A 1 65 ? -7.426  5.939  10.747  1.00 37.93  ? 71  TRP A CE3 1 
ATOM   480 C CZ2 . TRP A 1 65 ? -5.354  7.491  11.892  1.00 42.23  ? 71  TRP A CZ2 1 
ATOM   481 C CZ3 . TRP A 1 65 ? -6.304  6.294  10.020  1.00 39.27  ? 71  TRP A CZ3 1 
ATOM   482 C CH2 . TRP A 1 65 ? -5.284  7.064  10.593  1.00 39.80  ? 71  TRP A CH2 1 
ATOM   483 N N   . GLU A 1 66 ? -12.812 4.791  12.068  1.00 30.49  ? 72  GLU A N   1 
ATOM   484 C CA  . GLU A 1 66 ? -13.772 3.855  11.499  1.00 26.11  ? 72  GLU A CA  1 
ATOM   485 C C   . GLU A 1 66 ? -14.312 4.424  10.198  1.00 30.53  ? 72  GLU A C   1 
ATOM   486 O O   . GLU A 1 66 ? -14.428 3.727  9.193   1.00 31.24  ? 72  GLU A O   1 
ATOM   487 C CB  . GLU A 1 66 ? -14.899 3.587  12.482  1.00 28.58  ? 72  GLU A CB  1 
ATOM   488 C CG  . GLU A 1 66 ? -14.404 3.061  13.812  1.00 29.81  ? 72  GLU A CG  1 
ATOM   489 C CD  . GLU A 1 66 ? -15.414 3.252  14.917  1.00 35.33  ? 72  GLU A CD  1 
ATOM   490 O OE1 . GLU A 1 66 ? -16.558 3.657  14.613  1.00 35.64  ? 72  GLU A OE1 1 
ATOM   491 O OE2 . GLU A 1 66 ? -15.063 2.996  16.086  1.00 34.52  ? 72  GLU A OE2 1 
ATOM   492 N N   . SER A 1 67 ? -14.626 5.713  10.222  1.00 29.74  ? 73  SER A N   1 
ATOM   493 C CA  . SER A 1 67 ? -15.124 6.389  9.040   1.00 27.54  ? 73  SER A CA  1 
ATOM   494 C C   . SER A 1 67 ? -14.063 6.389  7.940   1.00 30.67  ? 73  SER A C   1 
ATOM   495 O O   . SER A 1 67 ? -14.375 6.223  6.756   1.00 28.65  ? 73  SER A O   1 
ATOM   496 C CB  . SER A 1 67 ? -15.542 7.819  9.387   1.00 33.35  ? 73  SER A CB  1 
ATOM   497 O OG  . SER A 1 67 ? -16.049 8.485  8.247   1.00 51.10  ? 73  SER A OG  1 
ATOM   498 N N   . ALA A 1 68 ? -12.806 6.556  8.333   1.00 29.69  ? 74  ALA A N   1 
ATOM   499 C CA  . ALA A 1 68 ? -11.708 6.582  7.369   1.00 27.02  ? 74  ALA A CA  1 
ATOM   500 C C   . ALA A 1 68 ? -11.536 5.215  6.718   1.00 31.13  ? 74  ALA A C   1 
ATOM   501 O O   . ALA A 1 68 ? -11.340 5.105  5.506   1.00 27.44  ? 74  ALA A O   1 
ATOM   502 C CB  . ALA A 1 68 ? -10.415 7.014  8.047   1.00 30.80  ? 74  ALA A CB  1 
ATOM   503 N N   . ARG A 1 69 ? -11.615 4.165  7.525   1.00 27.73  ? 75  ARG A N   1 
ATOM   504 C CA  . ARG A 1 69 ? -11.512 2.823  6.963   1.00 24.65  ? 75  ARG A CA  1 
ATOM   505 C C   . ARG A 1 69 ? -12.625 2.605  5.950   1.00 27.54  ? 75  ARG A C   1 
ATOM   506 O O   . ARG A 1 69 ? -12.394 2.044  4.877   1.00 30.66  ? 75  ARG A O   1 
ATOM   507 C CB  . ARG A 1 69 ? -11.563 1.756  8.068   1.00 26.02  ? 75  ARG A CB  1 
ATOM   508 C CG  . ARG A 1 69 ? -10.268 1.677  8.872   1.00 28.94  ? 75  ARG A CG  1 
ATOM   509 C CD  . ARG A 1 69 ? -10.271 0.521  9.879   1.00 25.01  ? 75  ARG A CD  1 
ATOM   510 N NE  . ARG A 1 69 ? -11.124 0.747  11.044  1.00 27.43  ? 75  ARG A NE  1 
ATOM   511 C CZ  . ARG A 1 69 ? -10.709 1.323  12.168  1.00 30.85  ? 75  ARG A CZ  1 
ATOM   512 N NH1 . ARG A 1 69 ? -9.448  1.724  12.283  1.00 31.92  ? 75  ARG A NH1 1 
ATOM   513 N NH2 . ARG A 1 69 ? -11.547 1.490  13.187  1.00 30.51  ? 75  ARG A NH2 1 
ATOM   514 N N   . GLN A 1 70 ? -13.832 3.056  6.269   1.00 25.87  ? 76  GLN A N   1 
ATOM   515 C CA  . GLN A 1 70 ? -14.960 2.814  5.357   1.00 22.17  ? 76  GLN A CA  1 
ATOM   516 C C   . GLN A 1 70 ? -14.772 3.605  4.066   1.00 30.42  ? 76  GLN A C   1 
ATOM   517 O O   . GLN A 1 70 ? -15.145 3.153  2.973   1.00 25.80  ? 76  GLN A O   1 
ATOM   518 C CB  . GLN A 1 70 ? -16.289 3.160  6.036   1.00 31.69  ? 76  GLN A CB  1 
ATOM   519 C CG  . GLN A 1 70 ? -16.582 2.246  7.234   1.00 37.96  ? 76  GLN A CG  1 
ATOM   520 C CD  . GLN A 1 70 ? -18.039 2.227  7.639   1.00 61.31  ? 76  GLN A CD  1 
ATOM   521 O OE1 . GLN A 1 70 ? -18.858 2.962  7.089   1.00 77.53  ? 76  GLN A OE1 1 
ATOM   522 N NE2 . GLN A 1 70 ? -18.374 1.373  8.605   1.00 66.06  ? 76  GLN A NE2 1 
ATOM   523 N N   . MET A 1 71 ? -14.177 4.782  4.182   1.00 25.03  ? 77  MET A N   1 
ATOM   524 C CA  . MET A 1 71 ? -13.831 5.540  2.988   1.00 23.78  ? 77  MET A CA  1 
ATOM   525 C C   . MET A 1 71 ? -12.857 4.759  2.123   1.00 24.93  ? 77  MET A C   1 
ATOM   526 O O   . MET A 1 71 ? -12.976 4.739  0.896   1.00 29.40  ? 77  MET A O   1 
ATOM   527 C CB  . MET A 1 71 ? -13.228 6.890  3.360   1.00 27.03  ? 77  MET A CB  1 
ATOM   528 C CG  . MET A 1 71 ? -14.253 7.881  3.849   1.00 24.24  ? 77  MET A CG  1 
ATOM   529 S SD  . MET A 1 71 ? -13.499 9.504  4.079   1.00 32.08  ? 77  MET A SD  1 
ATOM   530 C CE  . MET A 1 71 ? -14.933 10.465 4.544   1.00 52.60  ? 77  MET A CE  1 
ATOM   531 N N   . GLN A 1 72 ? -11.883 4.116  2.762   1.00 25.53  ? 78  GLN A N   1 
ATOM   532 C CA  . GLN A 1 72 ? -10.895 3.367  2.005   1.00 25.52  ? 78  GLN A CA  1 
ATOM   533 C C   . GLN A 1 72 ? -11.519 2.134  1.370   1.00 28.35  ? 78  GLN A C   1 
ATOM   534 O O   . GLN A 1 72 ? -11.120 1.737  0.272   1.00 28.04  ? 78  GLN A O   1 
ATOM   535 C CB  . GLN A 1 72 ? -9.726  2.971  2.893   1.00 24.72  ? 78  GLN A CB  1 
ATOM   536 C CG  . GLN A 1 72 ? -8.873  4.157  3.328   1.00 26.05  ? 78  GLN A CG  1 
ATOM   537 C CD  . GLN A 1 72 ? -7.823  3.742  4.334   1.00 27.23  ? 78  GLN A CD  1 
ATOM   538 O OE1 . GLN A 1 72 ? -8.131  3.052  5.302   1.00 32.20  ? 78  GLN A OE1 1 
ATOM   539 N NE2 . GLN A 1 72 ? -6.578  4.145  4.106   1.00 26.57  ? 78  GLN A NE2 1 
ATOM   540 N N   . GLN A 1 73 ? -12.491 1.531  2.056   1.00 25.08  ? 79  GLN A N   1 
ATOM   541 C CA  . GLN A 1 73 ? -13.243 0.414  1.483   1.00 24.65  ? 79  GLN A CA  1 
ATOM   542 C C   . GLN A 1 73 ? -13.863 0.843  0.165   1.00 29.15  ? 79  GLN A C   1 
ATOM   543 O O   . GLN A 1 73 ? -13.722 0.160  -0.855  1.00 27.58  ? 79  GLN A O   1 
ATOM   544 C CB  . GLN A 1 73 ? -14.347 -0.075 2.423   1.00 27.87  ? 79  GLN A CB  1 
ATOM   545 C CG  . GLN A 1 73 ? -15.161 -1.209 1.818   1.00 29.75  ? 79  GLN A CG  1 
ATOM   546 C CD  . GLN A 1 73 ? -16.096 -1.887 2.794   1.00 39.34  ? 79  GLN A CD  1 
ATOM   547 O OE1 . GLN A 1 73 ? -16.073 -1.623 4.002   1.00 44.92  ? 79  GLN A OE1 1 
ATOM   548 N NE2 . GLN A 1 73 ? -16.923 -2.788 2.274   1.00 33.95  ? 79  GLN A NE2 1 
ATOM   549 N N   . LYS A 1 74 ? -14.542 1.984  0.199   1.00 26.95  ? 80  LYS A N   1 
ATOM   550 C CA  . LYS A 1 74 ? -15.224 2.506  -0.981  1.00 29.03  ? 80  LYS A CA  1 
ATOM   551 C C   . LYS A 1 74 ? -14.224 2.802  -2.083  1.00 28.46  ? 80  LYS A C   1 
ATOM   552 O O   . LYS A 1 74 ? -14.469 2.527  -3.262  1.00 29.26  ? 80  LYS A O   1 
ATOM   553 C CB  . LYS A 1 74 ? -16.004 3.779  -0.645  1.00 29.69  ? 80  LYS A CB  1 
ATOM   554 C CG  . LYS A 1 74 ? -17.179 3.582  0.298   1.00 36.40  ? 80  LYS A CG  1 
ATOM   555 C CD  . LYS A 1 74 ? -18.229 2.677  -0.311  1.00 46.34  ? 80  LYS A CD  1 
ATOM   556 C CE  . LYS A 1 74 ? -19.487 2.666  0.540   1.00 53.67  ? 80  LYS A CE  1 
ATOM   557 N NZ  . LYS A 1 74 ? -20.433 1.608  0.101   1.00 59.85  ? 80  LYS A NZ  1 
ATOM   558 N N   . MET A 1 75 ? -13.092 3.377  -1.698  1.00 24.77  ? 81  MET A N   1 
ATOM   559 C CA  . MET A 1 75 ? -12.080 3.747  -2.669  1.00 22.38  ? 81  MET A CA  1 
ATOM   560 C C   . MET A 1 75 ? -11.462 2.525  -3.334  1.00 26.71  ? 81  MET A C   1 
ATOM   561 O O   . MET A 1 75 ? -11.177 2.554  -4.533  1.00 28.32  ? 81  MET A O   1 
ATOM   562 C CB  . MET A 1 75 ? -11.012 4.621  -2.004  1.00 24.52  ? 81  MET A CB  1 
ATOM   563 C CG  . MET A 1 75 ? -11.523 6.028  -1.726  1.00 24.83  ? 81  MET A CG  1 
ATOM   564 S SD  . MET A 1 75 ? -10.227 7.211  -1.326  1.00 30.35  ? 81  MET A SD  1 
ATOM   565 C CE  . MET A 1 75 ? -9.968  6.819  0.392   1.00 26.88  ? 81  MET A CE  1 
ATOM   566 N N   . LYS A 1 76 ? -11.267 1.435  -2.588  1.00 24.77  ? 82  LYS A N   1 
ATOM   567 C CA  . LYS A 1 76 ? -10.683 0.242  -3.196  1.00 24.38  ? 82  LYS A CA  1 
ATOM   568 C C   . LYS A 1 76 ? -11.623 -0.355 -4.235  1.00 27.44  ? 82  LYS A C   1 
ATOM   569 O O   . LYS A 1 76 ? -11.185 -0.813 -5.285  1.00 30.13  ? 82  LYS A O   1 
ATOM   570 C CB  . LYS A 1 76 ? -10.337 -0.810 -2.136  1.00 28.67  ? 82  LYS A CB  1 
ATOM   571 C CG  . LYS A 1 76 ? -9.101  -0.467 -1.360  1.00 33.73  ? 82  LYS A CG  1 
ATOM   572 C CD  . LYS A 1 76 ? -8.752  -1.550 -0.370  1.00 42.27  ? 82  LYS A CD  1 
ATOM   573 C CE  . LYS A 1 76 ? -9.734  -1.573 0.776   1.00 36.88  ? 82  LYS A CE  1 
ATOM   574 N NZ  . LYS A 1 76 ? -9.359  -2.643 1.745   1.00 33.21  ? 82  LYS A NZ  1 
ATOM   575 N N   . GLU A 1 77 ? -12.916 -0.329 -3.943  1.00 27.50  ? 83  GLU A N   1 
ATOM   576 C CA  . GLU A 1 77 ? -13.906 -0.873 -4.862  1.00 27.17  ? 83  GLU A CA  1 
ATOM   577 C C   . GLU A 1 77 ? -13.936 -0.051 -6.147  1.00 28.90  ? 83  GLU A C   1 
ATOM   578 O O   . GLU A 1 77 ? -13.967 -0.583 -7.256  1.00 30.75  ? 83  GLU A O   1 
ATOM   579 C CB  . GLU A 1 77 ? -15.279 -0.887 -4.205  1.00 35.38  ? 83  GLU A CB  1 
ATOM   580 C CG  . GLU A 1 77 ? -16.399 -1.356 -5.098  1.00 44.70  ? 83  GLU A CG  1 
ATOM   581 C CD  . GLU A 1 77 ? -17.651 -1.677 -4.309  1.00 64.00  ? 83  GLU A CD  1 
ATOM   582 O OE1 . GLU A 1 77 ? -17.543 -1.827 -3.072  1.00 73.06  ? 83  GLU A OE1 1 
ATOM   583 O OE2 . GLU A 1 77 ? -18.736 -1.774 -4.920  1.00 67.91  ? 83  GLU A OE2 1 
ATOM   584 N N   . THR A 1 78 ? -13.926 1.263  -5.989  1.00 33.39  ? 84  THR A N   1 
ATOM   585 C CA  . THR A 1 78 ? -13.975 2.143  -7.137  1.00 26.01  ? 84  THR A CA  1 
ATOM   586 C C   . THR A 1 78 ? -12.685 2.076  -7.930  1.00 27.89  ? 84  THR A C   1 
ATOM   587 O O   . THR A 1 78 ? -12.708 2.114  -9.163  1.00 31.74  ? 84  THR A O   1 
ATOM   588 C CB  . THR A 1 78 ? -14.271 3.576  -6.686  1.00 24.40  ? 84  THR A CB  1 
ATOM   589 O OG1 . THR A 1 78 ? -15.645 3.635  -6.304  1.00 30.10  ? 84  THR A OG1 1 
ATOM   590 C CG2 . THR A 1 78 ? -14.017 4.576  -7.801  1.00 27.49  ? 84  THR A CG2 1 
ATOM   591 N N   . LEU A 1 79 ? -11.560 1.943  -7.237  1.00 26.03  ? 85  LEU A N   1 
ATOM   592 C CA  . LEU A 1 79 ? -10.279 1.839  -7.933  1.00 28.87  ? 85  LEU A CA  1 
ATOM   593 C C   . LEU A 1 79 ? -10.293 0.636  -8.880  1.00 26.22  ? 85  LEU A C   1 
ATOM   594 O O   . LEU A 1 79 ? -9.819  0.725  -10.016 1.00 27.69  ? 85  LEU A O   1 
ATOM   595 C CB  . LEU A 1 79 ? -9.125  1.725  -6.937  1.00 31.71  ? 85  LEU A CB  1 
ATOM   596 C CG  . LEU A 1 79 ? -7.743  1.415  -7.518  1.00 29.52  ? 85  LEU A CG  1 
ATOM   597 C CD1 . LEU A 1 79 ? -7.264  2.515  -8.454  1.00 33.14  ? 85  LEU A CD1 1 
ATOM   598 C CD2 . LEU A 1 79 ? -6.728  1.197  -6.411  1.00 30.19  ? 85  LEU A CD2 1 
ATOM   599 N N   . GLN A 1 80 ? -10.852 -0.479 -8.421  1.00 30.76  ? 86  GLN A N   1 
ATOM   600 C CA  . GLN A 1 80 ? -10.995 -1.654 -9.279  1.00 30.39  ? 86  GLN A CA  1 
ATOM   601 C C   . GLN A 1 80 ? -11.830 -1.329 -10.515 1.00 30.61  ? 86  GLN A C   1 
ATOM   602 O O   . GLN A 1 80 ? -11.431 -1.627 -11.638 1.00 31.90  ? 86  GLN A O   1 
ATOM   603 C CB  . GLN A 1 80 ? -11.640 -2.815 -8.524  1.00 38.79  ? 86  GLN A CB  1 
ATOM   604 C CG  . GLN A 1 80 ? -10.861 -3.290 -7.324  1.00 43.74  ? 86  GLN A CG  1 
ATOM   605 C CD  . GLN A 1 80 ? -11.650 -4.299 -6.510  1.00 48.05  ? 86  GLN A CD  1 
ATOM   606 O OE1 . GLN A 1 80 ? -12.615 -4.892 -7.001  1.00 53.42  ? 86  GLN A OE1 1 
ATOM   607 N NE2 . GLN A 1 80 ? -11.253 -4.489 -5.258  1.00 47.98  ? 86  GLN A NE2 1 
ATOM   608 N N   . ASN A 1 81 ? -12.982 -0.705 -10.307 1.00 29.86  ? 87  ASN A N   1 
ATOM   609 C CA  . ASN A 1 81 ? -13.868 -0.371 -11.430 1.00 28.68  ? 87  ASN A CA  1 
ATOM   610 C C   . ASN A 1 81 ? -13.249 0.617  -12.420 1.00 26.37  ? 87  ASN A C   1 
ATOM   611 O O   . ASN A 1 81 ? -13.383 0.440  -13.637 1.00 25.04  ? 87  ASN A O   1 
ATOM   612 C CB  . ASN A 1 81 ? -15.192 0.188  -10.917 1.00 31.08  ? 87  ASN A CB  1 
ATOM   613 C CG  . ASN A 1 81 ? -15.977 -0.833 -10.116 1.00 38.14  ? 87  ASN A CG  1 
ATOM   614 O OD1 . ASN A 1 81 ? -15.825 -2.038 -10.316 1.00 35.36  ? 87  ASN A OD1 1 
ATOM   615 N ND2 . ASN A 1 81 ? -16.809 -0.360 -9.199  1.00 33.85  ? 87  ASN A ND2 1 
ATOM   616 N N   . VAL A 1 82 ? -12.585 1.652  -11.905 1.00 22.79  ? 88  VAL A N   1 
ATOM   617 C CA  . VAL A 1 82 ? -11.950 2.653  -12.776 1.00 24.03  ? 88  VAL A CA  1 
ATOM   618 C C   . VAL A 1 82 ? -10.816 2.022  -13.575 1.00 23.24  ? 88  VAL A C   1 
ATOM   619 O O   . VAL A 1 82 ? -10.655 2.276  -14.780 1.00 25.73  ? 88  VAL A O   1 
ATOM   620 C CB  . VAL A 1 82 ? -11.401 3.859  -11.973 1.00 25.95  ? 88  VAL A CB  1 
ATOM   621 C CG1 . VAL A 1 82 ? -10.676 4.840  -12.890 1.00 26.69  ? 88  VAL A CG1 1 
ATOM   622 C CG2 . VAL A 1 82 ? -12.535 4.576  -11.250 1.00 26.66  ? 88  VAL A CG2 1 
ATOM   623 N N   . ARG A 1 83 ? -10.026 1.181  -12.919 1.00 25.50  ? 89  ARG A N   1 
ATOM   624 C CA  . ARG A 1 83 ? -8.906  0.562  -13.614 1.00 27.61  ? 89  ARG A CA  1 
ATOM   625 C C   . ARG A 1 83 ? -9.395  -0.347 -14.743 1.00 27.67  ? 89  ARG A C   1 
ATOM   626 O O   . ARG A 1 83 ? -8.789  -0.397 -15.822 1.00 25.91  ? 89  ARG A O   1 
ATOM   627 C CB  . ARG A 1 83 ? -8.025  -0.199 -12.623 1.00 31.73  ? 89  ARG A CB  1 
ATOM   628 C CG  . ARG A 1 83 ? -7.039  0.726  -11.912 1.00 29.63  ? 89  ARG A CG  1 
ATOM   629 C CD  . ARG A 1 83 ? -6.062  -0.017 -11.013 1.00 42.10  ? 89  ARG A CD  1 
ATOM   630 N NE  . ARG A 1 83 ? -4.805  0.720  -10.877 1.00 53.72  ? 89  ARG A NE  1 
ATOM   631 C CZ  . ARG A 1 83 ? -3.920  0.528  -9.903  1.00 51.73  ? 89  ARG A CZ  1 
ATOM   632 N NH1 . ARG A 1 83 ? -4.152  -0.374 -8.956  1.00 53.87  ? 89  ARG A NH1 1 
ATOM   633 N NH2 . ARG A 1 83 ? -2.801  1.241  -9.876  1.00 45.73  ? 89  ARG A NH2 1 
ATOM   634 N N   . THR A 1 84 ? -10.504 -1.041 -14.504 1.00 26.57  ? 90  THR A N   1 
ATOM   635 C CA  . THR A 1 84 ? -11.093 -1.892 -15.537 1.00 25.96  ? 90  THR A CA  1 
ATOM   636 C C   . THR A 1 84 ? -11.563 -1.049 -16.722 1.00 28.26  ? 90  THR A C   1 
ATOM   637 O O   . THR A 1 84 ? -11.233 -1.336 -17.879 1.00 30.73  ? 90  THR A O   1 
ATOM   638 C CB  . THR A 1 84 ? -12.266 -2.697 -14.988 1.00 32.26  ? 90  THR A CB  1 
ATOM   639 O OG1 . THR A 1 84 ? -11.770 -3.644 -14.031 1.00 33.96  ? 90  THR A OG1 1 
ATOM   640 C CG2 . THR A 1 84 ? -12.989 -3.430 -16.112 1.00 34.59  ? 90  THR A CG2 1 
ATOM   641 N N   . ARG A 1 85 ? -12.330 -0.004 -16.438 1.00 24.85  ? 91  ARG A N   1 
ATOM   642 C CA  . ARG A 1 85 ? -12.869 0.836  -17.511 1.00 24.15  ? 91  ARG A CA  1 
ATOM   643 C C   . ARG A 1 85 ? -11.745 1.518  -18.283 1.00 25.84  ? 91  ARG A C   1 
ATOM   644 O O   . ARG A 1 85 ? -11.796 1.651  -19.511 1.00 25.65  ? 91  ARG A O   1 
ATOM   645 C CB  . ARG A 1 85 ? -13.833 1.882  -16.944 1.00 23.36  ? 91  ARG A CB  1 
ATOM   646 C CG  . ARG A 1 85 ? -14.483 2.758  -18.007 1.00 27.74  ? 91  ARG A CG  1 
ATOM   647 C CD  . ARG A 1 85 ? -15.289 1.908  -19.000 1.00 27.92  ? 91  ARG A CD  1 
ATOM   648 N NE  . ARG A 1 85 ? -15.957 2.742  -20.003 1.00 29.72  ? 91  ARG A NE  1 
ATOM   649 C CZ  . ARG A 1 85 ? -16.679 2.262  -21.011 1.00 36.04  ? 91  ARG A CZ  1 
ATOM   650 N NH1 . ARG A 1 85 ? -16.817 0.951  -21.153 1.00 42.07  ? 91  ARG A NH1 1 
ATOM   651 N NH2 . ARG A 1 85 ? -17.255 3.086  -21.881 1.00 29.90  ? 91  ARG A NH2 1 
ATOM   652 N N   . LEU A 1 86 ? -10.721 1.948  -17.560 1.00 25.57  ? 92  LEU A N   1 
ATOM   653 C CA  . LEU A 1 86 ? -9.594  2.606  -18.208 1.00 24.14  ? 92  LEU A CA  1 
ATOM   654 C C   . LEU A 1 86 ? -8.890  1.679  -19.190 1.00 24.23  ? 92  LEU A C   1 
ATOM   655 O O   . LEU A 1 86 ? -8.554  2.078  -20.305 1.00 32.46  ? 92  LEU A O   1 
ATOM   656 C CB  . LEU A 1 86 ? -8.609  3.116  -17.159 1.00 25.76  ? 92  LEU A CB  1 
ATOM   657 C CG  . LEU A 1 86 ? -7.430  3.894  -17.758 1.00 25.77  ? 92  LEU A CG  1 
ATOM   658 C CD1 . LEU A 1 86 ? -7.907  5.065  -18.607 1.00 24.88  ? 92  LEU A CD1 1 
ATOM   659 C CD2 . LEU A 1 86 ? -6.500  4.377  -16.651 1.00 26.69  ? 92  LEU A CD2 1 
ATOM   660 N N   . GLU A 1 87 ? -8.677  0.431  -18.787 1.00 28.72  ? 93  GLU A N   1 
ATOM   661 C CA  . GLU A 1 87 ? -7.970  -0.502 -19.648 1.00 28.90  ? 93  GLU A CA  1 
ATOM   662 C C   . GLU A 1 87 ? -8.831  -0.801 -20.868 1.00 31.96  ? 93  GLU A C   1 
ATOM   663 O O   . GLU A 1 87 ? -8.331  -0.926 -21.985 1.00 32.04  ? 93  GLU A O   1 
ATOM   664 C CB  . GLU A 1 87 ? -7.614  -1.782 -18.897 1.00 29.29  ? 93  GLU A CB  1 
ATOM   665 C CG  . GLU A 1 87 ? -6.823  -2.748 -19.755 1.00 31.43  ? 93  GLU A CG  1 
ATOM   666 C CD  . GLU A 1 87 ? -6.332  -3.962 -19.005 1.00 49.72  ? 93  GLU A CD  1 
ATOM   667 O OE1 . GLU A 1 87 ? -6.498  -4.014 -17.769 1.00 49.01  ? 93  GLU A OE1 1 
ATOM   668 O OE2 . GLU A 1 87 ? -5.777  -4.870 -19.664 1.00 62.42  ? 93  GLU A OE2 1 
ATOM   669 N N   . ILE A 1 88 ? -10.140 -0.870 -20.648 1.00 28.45  ? 94  ILE A N   1 
ATOM   670 C CA  . ILE A 1 88 ? -11.077 -1.120 -21.732 1.00 27.98  ? 94  ILE A CA  1 
ATOM   671 C C   . ILE A 1 88 ? -11.039 0.014  -22.755 1.00 33.46  ? 94  ILE A C   1 
ATOM   672 O O   . ILE A 1 88 ? -10.989 -0.227 -23.966 1.00 31.65  ? 94  ILE A O   1 
ATOM   673 C CB  . ILE A 1 88 ? -12.504 -1.309 -21.182 1.00 31.03  ? 94  ILE A CB  1 
ATOM   674 C CG1 . ILE A 1 88 ? -12.649 -2.722 -20.591 1.00 25.21  ? 94  ILE A CG1 1 
ATOM   675 C CG2 . ILE A 1 88 ? -13.544 -1.085 -22.271 1.00 32.38  ? 94  ILE A CG2 1 
ATOM   676 C CD1 . ILE A 1 88 ? -12.887 -3.833 -21.621 1.00 31.79  ? 94  ILE A CD1 1 
ATOM   677 N N   . LEU A 1 89 ? -11.037 1.252  -22.270 1.00 33.23  ? 95  LEU A N   1 
ATOM   678 C CA  . LEU A 1 89 ? -10.974 2.404  -23.165 1.00 27.56  ? 95  LEU A CA  1 
ATOM   679 C C   . LEU A 1 89 ? -9.634  2.518  -23.876 1.00 28.90  ? 95  LEU A C   1 
ATOM   680 O O   . LEU A 1 89 ? -9.570  2.929  -25.035 1.00 34.36  ? 95  LEU A O   1 
ATOM   681 C CB  . LEU A 1 89 ? -11.233 3.696  -22.398 1.00 28.51  ? 95  LEU A CB  1 
ATOM   682 C CG  . LEU A 1 89 ? -12.664 3.867  -21.900 1.00 26.69  ? 95  LEU A CG  1 
ATOM   683 C CD1 . LEU A 1 89 ? -12.735 5.136  -21.081 1.00 27.66  ? 95  LEU A CD1 1 
ATOM   684 C CD2 . LEU A 1 89 ? -13.641 3.924  -23.071 1.00 28.13  ? 95  LEU A CD2 1 
ATOM   685 N N   . GLU A 1 90 ? -8.563  2.189  -23.169 1.00 28.86  ? 96  GLU A N   1 
ATOM   686 C CA  . GLU A 1 90 ? -7.231  2.327  -23.742 1.00 32.82  ? 96  GLU A CA  1 
ATOM   687 C C   . GLU A 1 90 ? -7.059  1.333  -24.879 1.00 38.17  ? 96  GLU A C   1 
ATOM   688 O O   . GLU A 1 90 ? -6.417  1.630  -25.890 1.00 39.20  ? 96  GLU A O   1 
ATOM   689 C CB  . GLU A 1 90 ? -6.168  2.130  -22.663 1.00 34.62  ? 96  GLU A CB  1 
ATOM   690 C CG  . GLU A 1 90 ? -5.972  3.370  -21.805 1.00 40.01  ? 96  GLU A CG  1 
ATOM   691 C CD  . GLU A 1 90 ? -5.005  3.159  -20.658 1.00 49.54  ? 96  GLU A CD  1 
ATOM   692 O OE1 . GLU A 1 90 ? -4.668  1.992  -20.370 1.00 53.51  ? 96  GLU A OE1 1 
ATOM   693 O OE2 . GLU A 1 90 ? -4.589  4.166  -20.040 1.00 51.15  ? 96  GLU A OE2 1 
ATOM   694 N N   . LYS A 1 91 ? -7.666  0.161  -24.721 1.00 29.43  ? 97  LYS A N   1 
ATOM   695 C CA  . LYS A 1 91 ? -7.551  -0.890 -25.723 1.00 30.60  ? 97  LYS A CA  1 
ATOM   696 C C   . LYS A 1 91 ? -8.668  -0.833 -26.768 1.00 35.54  ? 97  LYS A C   1 
ATOM   697 O O   . LYS A 1 91 ? -8.757  -1.701 -27.653 1.00 38.44  ? 97  LYS A O   1 
ATOM   698 C CB  . LYS A 1 91 ? -7.511  -2.251 -25.030 1.00 37.58  ? 97  LYS A CB  1 
ATOM   699 C CG  . LYS A 1 91 ? -6.281  -2.387 -24.145 1.00 43.98  ? 97  LYS A CG  1 
ATOM   700 C CD  . LYS A 1 91 ? -6.072  -3.788 -23.620 1.00 49.92  ? 97  LYS A CD  1 
ATOM   701 C CE  . LYS A 1 91 ? -4.621  -3.991 -23.201 1.00 57.13  ? 97  LYS A CE  1 
ATOM   702 N N   . GLY A 1 92 ? -9.501  0.199  -26.669 1.00 34.24  ? 98  GLY A N   1 
ATOM   703 C CA  . GLY A 1 92 ? -10.524 0.481  -27.663 1.00 35.33  ? 98  GLY A CA  1 
ATOM   704 C C   . GLY A 1 92 ? -11.587 -0.590 -27.742 1.00 40.52  ? 98  GLY A C   1 
ATOM   705 O O   . GLY A 1 92 ? -12.053 -0.949 -28.832 1.00 45.02  ? 98  GLY A O   1 
ATOM   706 N N   . LEU A 1 93 ? -11.970 -1.111 -26.581 1.00 32.96  ? 99  LEU A N   1 
ATOM   707 C CA  . LEU A 1 93 ? -12.888 -2.241 -26.521 1.00 30.95  ? 99  LEU A CA  1 
ATOM   708 C C   . LEU A 1 93 ? -14.235 -1.839 -25.922 1.00 40.09  ? 99  LEU A C   1 
ATOM   709 O O   . LEU A 1 93 ? -15.022 -2.692 -25.520 1.00 40.57  ? 99  LEU A O   1 
ATOM   710 C CB  . LEU A 1 93 ? -12.263 -3.385 -25.715 1.00 31.74  ? 99  LEU A CB  1 
ATOM   711 C CG  . LEU A 1 93 ? -10.935 -3.971 -26.207 1.00 38.60  ? 99  LEU A CG  1 
ATOM   712 C CD1 . LEU A 1 93 ? -10.405 -5.014 -25.236 1.00 38.80  ? 99  LEU A CD1 1 
ATOM   713 C CD2 . LEU A 1 93 ? -11.101 -4.580 -27.579 1.00 42.73  ? 99  LEU A CD2 1 
ATOM   714 N N   . ALA A 1 94 ? -14.504 -0.534 -25.869 1.00 40.46  ? 100 ALA A N   1 
ATOM   715 C CA  . ALA A 1 94 ? -15.754 -0.048 -25.290 1.00 41.18  ? 100 ALA A CA  1 
ATOM   716 C C   . ALA A 1 94 ? -16.970 -0.396 -26.154 1.00 52.13  ? 100 ALA A C   1 
ATOM   717 O O   . ALA A 1 94 ? -17.016 -0.060 -27.338 1.00 58.64  ? 100 ALA A O   1 
ATOM   718 C CB  . ALA A 1 94 ? -15.682 1.452  -25.073 1.00 39.69  ? 100 ALA A CB  1 
ATOM   719 N N   . THR A 1 95 ? -17.957 -1.054 -25.553 1.00 54.79  ? 101 THR A N   1 
ATOM   720 C CA  . THR A 1 95 ? -19.165 -1.442 -26.279 1.00 70.93  ? 101 THR A CA  1 
ATOM   721 C C   . THR A 1 95 ? -20.003 -0.211 -26.618 1.00 72.40  ? 101 THR A C   1 
ATOM   722 O O   . THR A 1 95 ? -20.892 -0.257 -27.468 1.00 74.20  ? 101 THR A O   1 
ATOM   723 C CB  . THR A 1 95 ? -20.034 -2.447 -25.475 1.00 69.92  ? 101 THR A CB  1 
ATOM   724 O OG1 . THR A 1 95 ? -20.884 -1.740 -24.562 1.00 71.50  ? 101 THR A OG1 1 
ATOM   725 C CG2 . THR A 1 95 ? -19.160 -3.435 -24.704 1.00 71.14  ? 101 THR A CG2 1 
ATOM   726 O OXT . THR A 1 95 ? -19.807 0.865  -26.050 1.00 70.78  ? 101 THR A OXT 1 
ATOM   727 N N   . ASP B 2 7  ? -23.051 14.796 0.035   1.00 104.41 ? 318 ASP B N   1 
ATOM   728 C CA  . ASP B 2 7  ? -23.785 13.613 -0.401  1.00 101.96 ? 318 ASP B CA  1 
ATOM   729 C C   . ASP B 2 7  ? -22.999 12.807 -1.434  1.00 91.28  ? 318 ASP B C   1 
ATOM   730 O O   . ASP B 2 7  ? -23.528 12.437 -2.483  1.00 99.45  ? 318 ASP B O   1 
ATOM   731 C CB  . ASP B 2 7  ? -25.153 14.011 -0.964  1.00 108.70 ? 318 ASP B CB  1 
ATOM   732 C CG  . ASP B 2 7  ? -25.071 15.161 -1.955  1.00 113.18 ? 318 ASP B CG  1 
ATOM   733 O OD1 . ASP B 2 7  ? -25.913 16.081 -1.865  1.00 117.42 ? 318 ASP B OD1 1 
ATOM   734 O OD2 . ASP B 2 7  ? -24.177 15.144 -2.828  1.00 111.17 ? 318 ASP B OD2 1 
ATOM   735 N N   . ILE B 2 8  ? -21.732 12.545 -1.131  1.00 71.03  ? 319 ILE B N   1 
ATOM   736 C CA  . ILE B 2 8  ? -20.890 11.710 -1.983  1.00 52.30  ? 319 ILE B CA  1 
ATOM   737 C C   . ILE B 2 8  ? -21.273 10.243 -1.820  1.00 45.65  ? 319 ILE B C   1 
ATOM   738 O O   . ILE B 2 8  ? -21.344 9.727  -0.708  1.00 44.43  ? 319 ILE B O   1 
ATOM   739 C CB  . ILE B 2 8  ? -19.394 11.899 -1.654  1.00 43.55  ? 319 ILE B CB  1 
ATOM   740 C CG1 . ILE B 2 8  ? -18.858 13.163 -2.323  1.00 47.28  ? 319 ILE B CG1 1 
ATOM   741 C CG2 . ILE B 2 8  ? -18.587 10.693 -2.087  1.00 49.51  ? 319 ILE B CG2 1 
ATOM   742 C CD1 . ILE B 2 8  ? -17.418 13.457 -1.970  1.00 43.39  ? 319 ILE B CD1 1 
ATOM   743 N N   . ASP B 2 9  ? -21.516 9.572  -2.936  1.00 36.85  ? 320 ASP B N   1 
ATOM   744 C CA  . ASP B 2 9  ? -21.972 8.195  -2.889  1.00 35.70  ? 320 ASP B CA  1 
ATOM   745 C C   . ASP B 2 9  ? -21.173 7.357  -3.861  1.00 34.49  ? 320 ASP B C   1 
ATOM   746 O O   . ASP B 2 9  ? -21.499 7.292  -5.040  1.00 33.66  ? 320 ASP B O   1 
ATOM   747 C CB  . ASP B 2 9  ? -23.465 8.108  -3.222  1.00 44.09  ? 320 ASP B CB  1 
ATOM   748 C CG  . ASP B 2 9  ? -24.044 6.729  -2.957  1.00 55.12  ? 320 ASP B CG  1 
ATOM   749 O OD1 . ASP B 2 9  ? -23.266 5.801  -2.648  1.00 48.94  ? 320 ASP B OD1 1 
ATOM   750 O OD2 . ASP B 2 9  ? -25.281 6.574  -3.067  1.00 64.91  ? 320 ASP B OD2 1 
ATOM   751 N N   . PHE B 2 10 ? -20.130 6.709  -3.367  1.00 33.20  ? 321 PHE B N   1 
ATOM   752 C CA  . PHE B 2 10 ? -19.305 5.886  -4.235  1.00 28.59  ? 321 PHE B CA  1 
ATOM   753 C C   . PHE B 2 10 ? -20.061 4.693  -4.799  1.00 31.66  ? 321 PHE B C   1 
ATOM   754 O O   . PHE B 2 10 ? -19.746 4.226  -5.888  1.00 30.72  ? 321 PHE B O   1 
ATOM   755 C CB  . PHE B 2 10 ? -18.067 5.414  -3.496  1.00 25.73  ? 321 PHE B CB  1 
ATOM   756 C CG  . PHE B 2 10 ? -16.921 6.368  -3.598  1.00 26.98  ? 321 PHE B CG  1 
ATOM   757 C CD1 . PHE B 2 10 ? -15.849 6.087  -4.420  1.00 31.88  ? 321 PHE B CD1 1 
ATOM   758 C CD2 . PHE B 2 10 ? -16.921 7.549  -2.884  1.00 30.66  ? 321 PHE B CD2 1 
ATOM   759 C CE1 . PHE B 2 10 ? -14.787 6.961  -4.520  1.00 30.97  ? 321 PHE B CE1 1 
ATOM   760 C CE2 . PHE B 2 10 ? -15.854 8.422  -2.978  1.00 28.32  ? 321 PHE B CE2 1 
ATOM   761 C CZ  . PHE B 2 10 ? -14.790 8.123  -3.801  1.00 26.99  ? 321 PHE B CZ  1 
ATOM   762 N N   . ASP B 2 11 ? -21.067 4.213  -4.073  1.00 36.04  ? 322 ASP B N   1 
ATOM   763 C CA  . ASP B 2 11 ? -21.866 3.095  -4.562  1.00 39.49  ? 322 ASP B CA  1 
ATOM   764 C C   . ASP B 2 11 ? -22.512 3.423  -5.899  1.00 42.00  ? 322 ASP B C   1 
ATOM   765 O O   . ASP B 2 11 ? -22.656 2.559  -6.768  1.00 40.12  ? 322 ASP B O   1 
ATOM   766 C CB  . ASP B 2 11 ? -22.939 2.713  -3.543  1.00 47.45  ? 322 ASP B CB  1 
ATOM   767 C CG  . ASP B 2 11 ? -22.359 2.036  -2.327  1.00 55.83  ? 322 ASP B CG  1 
ATOM   768 O OD1 . ASP B 2 11 ? -21.266 1.439  -2.457  1.00 47.19  ? 322 ASP B OD1 1 
ATOM   769 O OD2 . ASP B 2 11 ? -22.985 2.103  -1.248  1.00 60.23  ? 322 ASP B OD2 1 
ATOM   770 N N   . ASP B 2 12 ? -22.885 4.684  -6.067  1.00 35.76  ? 323 ASP B N   1 
ATOM   771 C CA  . ASP B 2 12 ? -23.527 5.115  -7.296  1.00 44.95  ? 323 ASP B CA  1 
ATOM   772 C C   . ASP B 2 12 ? -22.555 5.030  -8.467  1.00 43.43  ? 323 ASP B C   1 
ATOM   773 O O   . ASP B 2 12 ? -22.955 4.751  -9.595  1.00 39.19  ? 323 ASP B O   1 
ATOM   774 C CB  . ASP B 2 12 ? -24.066 6.537  -7.149  1.00 53.68  ? 323 ASP B CB  1 
ATOM   775 C CG  . ASP B 2 12 ? -25.431 6.704  -7.782  1.00 66.07  ? 323 ASP B CG  1 
ATOM   776 O OD1 . ASP B 2 12 ? -26.200 5.717  -7.804  1.00 63.37  ? 323 ASP B OD1 1 
ATOM   777 O OD2 . ASP B 2 12 ? -25.734 7.817  -8.258  1.00 76.56  ? 323 ASP B OD2 1 
ATOM   778 N N   . LEU B 2 13 ? -21.276 5.275  -8.197  1.00 33.67  ? 324 LEU B N   1 
ATOM   779 C CA  . LEU B 2 13 ? -20.256 5.176  -9.232  1.00 34.33  ? 324 LEU B CA  1 
ATOM   780 C C   . LEU B 2 13 ? -20.205 3.754  -9.773  1.00 37.32  ? 324 LEU B C   1 
ATOM   781 O O   . LEU B 2 13 ? -20.216 3.539  -10.988 1.00 38.26  ? 324 LEU B O   1 
ATOM   782 C CB  . LEU B 2 13 ? -18.890 5.583  -8.695  1.00 29.46  ? 324 LEU B CB  1 
ATOM   783 C CG  . LEU B 2 13 ? -18.793 6.982  -8.089  1.00 35.65  ? 324 LEU B CG  1 
ATOM   784 C CD1 . LEU B 2 13 ? -17.382 7.236  -7.601  1.00 38.16  ? 324 LEU B CD1 1 
ATOM   785 C CD2 . LEU B 2 13 ? -19.226 8.046  -9.093  1.00 36.99  ? 324 LEU B CD2 1 
ATOM   786 N N   . SER B 2 14 ? -20.155 2.787  -8.859  1.00 36.77  ? 325 SER B N   1 
ATOM   787 C CA  . SER B 2 14 ? -20.094 1.383  -9.239  1.00 29.70  ? 325 SER B CA  1 
ATOM   788 C C   . SER B 2 14 ? -21.238 1.011  -10.165 1.00 30.96  ? 325 SER B C   1 
ATOM   789 O O   . SER B 2 14 ? -21.060 0.254  -11.129 1.00 36.27  ? 325 SER B O   1 
ATOM   790 C CB  . SER B 2 14 ? -20.120 0.485  -7.996  1.00 36.84  ? 325 SER B CB  1 
ATOM   791 O OG  . SER B 2 14 ? -19.135 0.871  -7.060  1.00 37.10  ? 325 SER B OG  1 
ATOM   792 N N   . ARG B 2 15 ? -22.417 1.545  -9.866  1.00 34.03  ? 326 ARG B N   1 
ATOM   793 C CA  . ARG B 2 15 ? -23.606 1.253  -10.649 1.00 35.05  ? 326 ARG B CA  1 
ATOM   794 C C   . ARG B 2 15 ? -23.425 1.751  -12.076 1.00 31.40  ? 326 ARG B C   1 
ATOM   795 O O   . ARG B 2 15 ? -23.807 1.084  -13.038 1.00 31.18  ? 326 ARG B O   1 
ATOM   796 C CB  . ARG B 2 15 ? -24.851 1.895  -10.018 1.00 32.00  ? 326 ARG B CB  1 
ATOM   797 C CG  . ARG B 2 15 ? -26.088 1.790  -10.888 1.00 37.41  ? 326 ARG B CG  1 
ATOM   798 C CD  . ARG B 2 15 ? -27.275 2.572  -10.319 1.00 47.17  ? 326 ARG B CD  1 
ATOM   799 N NE  . ARG B 2 15 ? -26.983 3.989  -10.082 1.00 45.63  ? 326 ARG B NE  1 
ATOM   800 C CZ  . ARG B 2 15 ? -26.957 4.921  -11.034 1.00 43.49  ? 326 ARG B CZ  1 
ATOM   801 N NH1 . ARG B 2 15 ? -27.182 4.587  -12.296 1.00 39.71  ? 326 ARG B NH1 1 
ATOM   802 N NH2 . ARG B 2 15 ? -26.696 6.185  -10.726 1.00 38.32  ? 326 ARG B NH2 1 
ATOM   803 N N   . ARG B 2 16 ? -22.832 2.930  -12.203 1.00 28.05  ? 327 ARG B N   1 
ATOM   804 C CA  . ARG B 2 16 ? -22.652 3.542  -13.511 1.00 30.88  ? 327 ARG B CA  1 
ATOM   805 C C   . ARG B 2 16 ? -21.595 2.821  -14.341 1.00 30.32  ? 327 ARG B C   1 
ATOM   806 O O   . ARG B 2 16 ? -21.726 2.733  -15.560 1.00 29.20  ? 327 ARG B O   1 
ATOM   807 C CB  . ARG B 2 16 ? -22.309 5.027  -13.348 1.00 29.00  ? 327 ARG B CB  1 
ATOM   808 C CG  . ARG B 2 16 ? -23.451 5.790  -12.695 1.00 32.55  ? 327 ARG B CG  1 
ATOM   809 C CD  . ARG B 2 16 ? -23.036 7.190  -12.314 1.00 32.43  ? 327 ARG B CD  1 
ATOM   810 N NE  . ARG B 2 16 ? -22.714 7.997  -13.481 1.00 30.14  ? 327 ARG B NE  1 
ATOM   811 C CZ  . ARG B 2 16 ? -22.068 9.154  -13.419 1.00 29.85  ? 327 ARG B CZ  1 
ATOM   812 N NH1 . ARG B 2 16 ? -21.669 9.622  -12.240 1.00 30.28  ? 327 ARG B NH1 1 
ATOM   813 N NH2 . ARG B 2 16 ? -21.811 9.834  -14.531 1.00 27.67  ? 327 ARG B NH2 1 
ATOM   814 N N   . PHE B 2 17 ? -20.563 2.289  -13.690 1.00 26.85  ? 328 PHE B N   1 
ATOM   815 C CA  . PHE B 2 17 ? -19.582 1.472  -14.400 1.00 29.11  ? 328 PHE B CA  1 
ATOM   816 C C   . PHE B 2 17 ? -20.183 0.193  -14.936 1.00 32.60  ? 328 PHE B C   1 
ATOM   817 O O   . PHE B 2 17 ? -19.891 -0.219 -16.055 1.00 31.89  ? 328 PHE B O   1 
ATOM   818 C CB  . PHE B 2 17 ? -18.407 1.146  -13.492 1.00 26.52  ? 328 PHE B CB  1 
ATOM   819 C CG  . PHE B 2 17 ? -17.432 2.271  -13.360 1.00 23.46  ? 328 PHE B CG  1 
ATOM   820 C CD1 . PHE B 2 17 ? -16.665 2.666  -14.443 1.00 28.51  ? 328 PHE B CD1 1 
ATOM   821 C CD2 . PHE B 2 17 ? -17.290 2.949  -12.163 1.00 29.24  ? 328 PHE B CD2 1 
ATOM   822 C CE1 . PHE B 2 17 ? -15.759 3.719  -14.330 1.00 27.31  ? 328 PHE B CE1 1 
ATOM   823 C CE2 . PHE B 2 17 ? -16.383 3.982  -12.038 1.00 29.27  ? 328 PHE B CE2 1 
ATOM   824 C CZ  . PHE B 2 17 ? -15.612 4.367  -13.123 1.00 26.45  ? 328 PHE B CZ  1 
ATOM   825 N N   . GLU B 2 18 ? -21.015 -0.443 -14.124 1.00 28.44  ? 329 GLU B N   1 
ATOM   826 C CA  . GLU B 2 18 ? -21.696 -1.650 -14.558 1.00 28.91  ? 329 GLU B CA  1 
ATOM   827 C C   . GLU B 2 18 ? -22.528 -1.362 -15.795 1.00 36.48  ? 329 GLU B C   1 
ATOM   828 O O   . GLU B 2 18 ? -22.534 -2.143 -16.740 1.00 37.40  ? 329 GLU B O   1 
ATOM   829 C CB  . GLU B 2 18 ? -22.564 -2.203 -13.437 1.00 36.90  ? 329 GLU B CB  1 
ATOM   830 C CG  . GLU B 2 18 ? -21.783 -3.090 -12.490 1.00 59.73  ? 329 GLU B CG  1 
ATOM   831 C CD  . GLU B 2 18 ? -20.929 -4.099 -13.240 1.00 68.61  ? 329 GLU B CD  1 
ATOM   832 O OE1 . GLU B 2 18 ? -19.684 -4.014 -13.144 1.00 68.14  ? 329 GLU B OE1 1 
ATOM   833 O OE2 . GLU B 2 18 ? -21.505 -4.965 -13.934 1.00 65.52  ? 329 GLU B OE2 1 
ATOM   834 N N   . GLU B 2 19 ? -23.208 -0.223 -15.799 1.00 35.17  ? 330 GLU B N   1 
ATOM   835 C CA  . GLU B 2 19 ? -24.078 0.124  -16.919 1.00 34.88  ? 330 GLU B CA  1 
ATOM   836 C C   . GLU B 2 19 ? -23.303 0.360  -18.206 1.00 36.53  ? 330 GLU B C   1 
ATOM   837 O O   . GLU B 2 19 ? -23.831 0.153  -19.300 1.00 38.58  ? 330 GLU B O   1 
ATOM   838 C CB  . GLU B 2 19 ? -24.905 1.370  -16.592 1.00 43.00  ? 330 GLU B CB  1 
ATOM   839 C CG  . GLU B 2 19 ? -26.051 1.113  -15.640 1.00 47.56  ? 330 GLU B CG  1 
ATOM   840 C CD  . GLU B 2 19 ? -27.057 0.132  -16.205 1.00 60.82  ? 330 GLU B CD  1 
ATOM   841 O OE1 . GLU B 2 19 ? -27.377 0.234  -17.409 1.00 59.70  ? 330 GLU B OE1 1 
ATOM   842 O OE2 . GLU B 2 19 ? -27.516 -0.747 -15.448 1.00 69.51  ? 330 GLU B OE2 1 
ATOM   843 N N   . LEU B 2 20 ? -22.057 0.808  -18.079 1.00 29.39  ? 331 LEU B N   1 
ATOM   844 C CA  . LEU B 2 20 ? -21.258 1.129  -19.254 1.00 34.95  ? 331 LEU B CA  1 
ATOM   845 C C   . LEU B 2 20 ? -20.845 -0.143 -19.987 1.00 32.66  ? 331 LEU B C   1 
ATOM   846 O O   . LEU B 2 20 ? -20.476 -0.099 -21.157 1.00 38.77  ? 331 LEU B O   1 
ATOM   847 C CB  . LEU B 2 20 ? -20.029 1.946  -18.862 1.00 30.85  ? 331 LEU B CB  1 
ATOM   848 C CG  . LEU B 2 20 ? -20.309 3.405  -18.513 1.00 30.49  ? 331 LEU B CG  1 
ATOM   849 C CD1 . LEU B 2 20 ? -19.042 4.059  -17.969 1.00 32.62  ? 331 LEU B CD1 1 
ATOM   850 C CD2 . LEU B 2 20 ? -20.814 4.147  -19.739 1.00 35.83  ? 331 LEU B CD2 1 
ATOM   851 N N   . LYS B 2 21 ? -20.902 -1.269 -19.288 1.00 34.58  ? 332 LYS B N   1 
ATOM   852 C CA  . LYS B 2 21 ? -20.550 -2.553 -19.884 1.00 32.92  ? 332 LYS B CA  1 
ATOM   853 C C   . LYS B 2 21 ? -21.619 -3.078 -20.828 1.00 50.70  ? 332 LYS B C   1 
ATOM   854 O O   . LYS B 2 21 ? -21.295 -3.698 -21.845 1.00 61.81  ? 332 LYS B O   1 
ATOM   855 C CB  . LYS B 2 21 ? -20.290 -3.580 -18.796 1.00 32.03  ? 332 LYS B CB  1 
ATOM   856 C CG  . LYS B 2 21 ? -19.044 -3.306 -17.989 1.00 31.58  ? 332 LYS B CG  1 
ATOM   857 C CD  . LYS B 2 21 ? -18.877 -4.362 -16.912 1.00 37.43  ? 332 LYS B CD  1 
ATOM   858 C CE  . LYS B 2 21 ? -17.727 -3.998 -15.989 1.00 37.29  ? 332 LYS B CE  1 
ATOM   859 N NZ  . LYS B 2 21 ? -17.593 -4.982 -14.888 1.00 41.26  ? 332 LYS B NZ  1 
ATOM   860 N N   . LYS B 2 22 ? -22.879 -2.822 -20.475 1.00 45.75  ? 333 LYS B N   1 
ATOM   861 C CA  . LYS B 2 22 ? -24.054 -3.388 -21.147 1.00 58.41  ? 333 LYS B CA  1 
ATOM   862 C C   . LYS B 2 22 ? -23.908 -3.549 -22.661 1.00 66.89  ? 333 LYS B C   1 
ATOM   863 O O   . LYS B 2 22 ? -23.659 -4.655 -23.151 1.00 68.78  ? 333 LYS B O   1 
ATOM   864 C CB  . LYS B 2 22 ? -25.284 -2.526 -20.848 1.00 56.15  ? 333 LYS B CB  1 
HETATM 865 O O   . HOH C 3 .  ? -7.594  -3.239 -15.615 1.00 39.05  ? 201 HOH A O   1 
HETATM 866 O O   . HOH C 3 .  ? -17.778 6.109  -23.904 1.00 40.73  ? 202 HOH A O   1 
HETATM 867 O O   . HOH C 3 .  ? -14.238 16.113 -25.298 1.00 42.82  ? 203 HOH A O   1 
HETATM 868 O O   . HOH C 3 .  ? -18.447 2.967  12.953  1.00 41.62  ? 204 HOH A O   1 
HETATM 869 O O   . HOH C 3 .  ? -17.685 6.627  12.204  1.00 41.90  ? 205 HOH A O   1 
HETATM 870 O O   . HOH C 3 .  ? -23.430 4.803  -16.685 1.00 30.60  ? 206 HOH A O   1 
HETATM 871 O O   . HOH C 3 .  ? -16.139 17.446 -19.156 1.00 48.76  ? 207 HOH A O   1 
HETATM 872 O O   . HOH C 3 .  ? -4.676  -5.520 -16.517 1.00 48.52  ? 208 HOH A O   1 
HETATM 873 O O   . HOH C 3 .  ? -12.635 2.170  16.893  1.00 38.66  ? 209 HOH A O   1 
HETATM 874 O O   . HOH C 3 .  ? -22.860 12.433 -9.648  1.00 52.08  ? 210 HOH A O   1 
HETATM 875 O O   . HOH C 3 .  ? -5.853  15.795 -10.287 1.00 40.64  ? 211 HOH A O   1 
HETATM 876 O O   . HOH C 3 .  ? -23.491 12.542 -12.874 1.00 37.29  ? 212 HOH A O   1 
HETATM 877 O O   . HOH C 3 .  ? -9.605  -3.690 -11.652 1.00 37.10  ? 213 HOH A O   1 
HETATM 878 O O   . HOH C 3 .  ? -15.901 15.934 -4.338  1.00 35.36  ? 214 HOH A O   1 
HETATM 879 O O   . HOH C 3 .  ? -17.390 15.713 -10.379 1.00 29.77  ? 215 HOH A O   1 
HETATM 880 O O   . HOH C 3 .  ? -22.716 15.546 -12.807 1.00 58.12  ? 216 HOH A O   1 
HETATM 881 O O   . HOH C 3 .  ? -16.806 7.765  -28.473 1.00 45.47  ? 217 HOH A O   1 
HETATM 882 O O   . HOH C 3 .  ? -2.863  -0.657 9.115   1.00 40.85  ? 218 HOH A O   1 
HETATM 883 O O   . HOH C 3 .  ? -6.560  0.754  2.800   1.00 36.37  ? 219 HOH A O   1 
HETATM 884 O O   . HOH C 3 .  ? -13.253 -2.746 -0.835  1.00 40.46  ? 220 HOH A O   1 
HETATM 885 O O   . HOH C 3 .  ? -16.592 16.547 -16.794 1.00 34.94  ? 221 HOH A O   1 
HETATM 886 O O   . HOH C 3 .  ? -18.735 16.731 -15.296 1.00 34.40  ? 222 HOH A O   1 
HETATM 887 O O   . HOH C 3 .  ? -16.706 -2.607 -13.151 1.00 44.45  ? 223 HOH A O   1 
HETATM 888 O O   . HOH C 3 .  ? -16.308 -3.721 -0.538  1.00 57.02  ? 224 HOH A O   1 
HETATM 889 O O   . HOH C 3 .  ? -20.255 4.925  -22.882 1.00 44.58  ? 225 HOH A O   1 
HETATM 890 O O   . HOH C 3 .  ? -13.766 -3.881 -11.591 1.00 42.75  ? 226 HOH A O   1 
HETATM 891 O O   . HOH C 3 .  ? -0.584  0.888  -7.732  1.00 50.82  ? 227 HOH A O   1 
HETATM 892 O O   . HOH C 3 .  ? -5.578  17.086 -8.276  1.00 51.73  ? 228 HOH A O   1 
HETATM 893 O O   . HOH C 3 .  ? -12.933 13.313 -25.648 1.00 27.29  ? 229 HOH A O   1 
HETATM 894 O O   . HOH C 3 .  ? -9.507  -2.931 -30.531 1.00 79.37  ? 230 HOH A O   1 
HETATM 895 O O   . HOH C 3 .  ? -6.354  -1.708 2.467   1.00 43.62  ? 231 HOH A O   1 
HETATM 896 O O   . HOH C 3 .  ? -1.365  3.714  -11.531 1.00 46.98  ? 232 HOH A O   1 
HETATM 897 O O   . HOH C 3 .  ? -14.712 -4.902 -13.153 1.00 32.22  ? 233 HOH A O   1 
HETATM 898 O O   . HOH C 3 .  ? -3.617  16.068 -14.480 1.00 53.91  ? 234 HOH A O   1 
HETATM 899 O O   . HOH C 3 .  ? -7.588  -5.312 0.653   1.00 53.54  ? 235 HOH A O   1 
HETATM 900 O O   . HOH C 3 .  ? -13.159 10.478 -28.103 1.00 55.37  ? 236 HOH A O   1 
HETATM 901 O O   . HOH C 3 .  ? -1.799  -2.306 11.159  1.00 49.78  ? 237 HOH A O   1 
HETATM 902 O O   . HOH C 3 .  ? -3.745  15.125 -10.407 1.00 57.88  ? 238 HOH A O   1 
HETATM 903 O O   . HOH C 3 .  ? -14.703 8.581  -29.730 1.00 53.13  ? 239 HOH A O   1 
HETATM 904 O O   . HOH C 3 .  ? -3.461  -1.526 6.931   1.00 52.83  ? 240 HOH A O   1 
HETATM 905 O O   . HOH C 3 .  ? -4.723  -3.221 -12.178 1.00 45.28  ? 241 HOH A O   1 
HETATM 906 O O   . HOH C 3 .  ? -3.285  -1.778 -16.380 1.00 84.81  ? 242 HOH A O   1 
HETATM 907 O O   . HOH C 3 .  ? -17.865 15.939 -5.867  1.00 45.38  ? 243 HOH A O   1 
HETATM 908 O O   . HOH C 3 .  ? -4.605  -1.903 -14.415 1.00 61.47  ? 244 HOH A O   1 
HETATM 909 O O   . HOH C 3 .  ? -6.978  -3.201 -10.897 1.00 43.36  ? 245 HOH A O   1 
HETATM 910 O O   . HOH C 3 .  ? 0.623   0.623  0.000   0.50 44.69  ? 246 HOH A O   1 
HETATM 911 O O   . HOH C 3 .  ? -16.687 17.188 -1.879  1.00 36.88  ? 247 HOH A O   1 
HETATM 912 O O   . HOH C 3 .  ? -16.136 -1.340 -19.340 1.00 35.88  ? 248 HOH A O   1 
HETATM 913 O O   . HOH C 3 .  ? -4.217  12.384 -9.391  1.00 33.43  ? 249 HOH A O   1 
HETATM 914 O O   . HOH C 3 .  ? -15.701 -0.879 -14.850 1.00 29.69  ? 250 HOH A O   1 
HETATM 915 O O   . HOH C 3 .  ? -3.162  7.558  -12.767 1.00 35.97  ? 251 HOH A O   1 
HETATM 916 O O   . HOH C 3 .  ? -1.217  8.271  -5.849  1.00 36.15  ? 252 HOH A O   1 
HETATM 917 O O   . HOH C 3 .  ? -3.067  11.631 -14.302 1.00 38.06  ? 253 HOH A O   1 
HETATM 918 O O   . HOH C 3 .  ? -6.930  11.208 -22.762 1.00 33.92  ? 254 HOH A O   1 
HETATM 919 O O   . HOH C 3 .  ? -2.937  12.670 -7.072  1.00 37.20  ? 255 HOH A O   1 
HETATM 920 O O   . HOH C 3 .  ? -19.604 6.524  -0.496  1.00 37.36  ? 256 HOH A O   1 
HETATM 921 O O   . HOH C 3 .  ? -11.182 8.278  15.488  1.00 43.64  ? 257 HOH A O   1 
HETATM 922 O O   . HOH C 3 .  ? -2.527  2.531  -2.555  1.00 37.00  ? 258 HOH A O   1 
HETATM 923 O O   . HOH C 3 .  ? 0.513   5.282  6.220   1.00 44.24  ? 259 HOH A O   1 
HETATM 924 O O   . HOH C 3 .  ? -1.528  6.022  9.049   1.00 43.42  ? 260 HOH A O   1 
HETATM 925 O O   . HOH C 3 .  ? -4.721  12.425 -16.677 1.00 38.60  ? 261 HOH A O   1 
HETATM 926 O O   . HOH C 3 .  ? -4.900  0.767  5.772   1.00 49.78  ? 262 HOH A O   1 
HETATM 927 O O   . HOH C 3 .  ? -16.975 2.330  -4.436  1.00 35.04  ? 263 HOH A O   1 
HETATM 928 O O   . HOH C 3 .  ? -5.187  13.312 -0.028  1.00 38.52  ? 264 HOH A O   1 
HETATM 929 O O   . HOH C 3 .  ? -3.353  5.284  -14.510 1.00 48.87  ? 265 HOH A O   1 
HETATM 930 O O   . HOH C 3 .  ? -4.815  0.896  -17.941 1.00 52.29  ? 266 HOH A O   1 
HETATM 931 O O   . HOH C 3 .  ? -6.049  0.630  -16.045 1.00 40.75  ? 267 HOH A O   1 
HETATM 932 O O   . HOH C 3 .  ? -1.878  0.775  -0.539  1.00 43.76  ? 268 HOH A O   1 
HETATM 933 O O   . HOH C 3 .  ? -7.742  4.539  -26.694 1.00 59.68  ? 269 HOH A O   1 
HETATM 934 O O   . HOH C 3 .  ? -11.271 4.570  -26.231 1.00 50.18  ? 270 HOH A O   1 
HETATM 935 O O   . HOH C 3 .  ? -5.037  5.938  -24.382 1.00 54.43  ? 271 HOH A O   1 
HETATM 936 O O   . HOH C 3 .  ? -0.505  10.947 -4.706  1.00 48.51  ? 272 HOH A O   1 
HETATM 937 O O   . HOH C 3 .  ? -7.154  -3.656 -28.552 1.00 44.18  ? 273 HOH A O   1 
HETATM 938 O O   . HOH C 3 .  ? -4.585  6.494  -21.723 1.00 58.63  ? 274 HOH A O   1 
HETATM 939 O O   . HOH C 3 .  ? -18.222 -2.594 -7.947  1.00 42.00  ? 275 HOH A O   1 
HETATM 940 O O   . HOH C 3 .  ? -19.685 10.012 1.802   1.00 50.86  ? 276 HOH A O   1 
HETATM 941 O O   . HOH C 3 .  ? -17.199 6.921  5.795   1.00 38.93  ? 277 HOH A O   1 
HETATM 942 O O   . HOH C 3 .  ? -2.949  0.547  3.742   1.00 64.03  ? 278 HOH A O   1 
HETATM 943 O O   . HOH C 3 .  ? -2.136  11.326 11.377  1.00 65.85  ? 279 HOH A O   1 
HETATM 944 O O   . HOH C 3 .  ? -0.084  6.689  -3.843  1.00 41.25  ? 280 HOH A O   1 
HETATM 945 O O   . HOH C 3 .  ? -1.409  7.366  12.303  1.00 50.67  ? 281 HOH A O   1 
HETATM 946 O O   . HOH C 3 .  ? -17.732 6.116  3.309   1.00 44.64  ? 282 HOH A O   1 
HETATM 947 O O   . HOH C 3 .  ? -4.884  11.502 -20.512 1.00 68.39  ? 283 HOH A O   1 
HETATM 948 O O   . HOH C 3 .  ? -0.253  7.708  -8.289  1.00 48.54  ? 284 HOH A O   1 
HETATM 949 O O   . HOH C 3 .  ? -1.572  6.687  -10.799 1.00 49.01  ? 285 HOH A O   1 
HETATM 950 O O   . HOH C 3 .  ? -3.281  -1.199 0.532   1.00 56.73  ? 286 HOH A O   1 
HETATM 951 O O   . HOH C 3 .  ? -0.716  0.788  4.517   1.00 52.22  ? 287 HOH A O   1 
HETATM 952 O O   . HOH D 3 .  ? -25.229 10.057 -9.452  1.00 57.87  ? 401 HOH B O   1 
HETATM 953 O O   . HOH D 3 .  ? -19.646 1.805  -23.060 1.00 55.18  ? 402 HOH B O   1 
HETATM 954 O O   . HOH D 3 .  ? -22.787 9.135  -9.241  1.00 46.11  ? 403 HOH B O   1 
HETATM 955 O O   . HOH D 3 .  ? -20.361 16.194 -4.757  1.00 59.31  ? 404 HOH B O   1 
HETATM 956 O O   . HOH D 3 .  ? -16.808 -3.799 -21.147 1.00 43.12  ? 405 HOH B O   1 
HETATM 957 O O   . HOH D 3 .  ? -17.175 -0.327 -16.820 1.00 29.86  ? 406 HOH B O   1 
HETATM 958 O O   . HOH D 3 .  ? -17.168 2.374  -8.336  1.00 34.71  ? 407 HOH B O   1 
HETATM 959 O O   . HOH D 3 .  ? -18.261 -0.947 -22.662 1.00 42.76  ? 408 HOH B O   1 
HETATM 960 O O   . HOH D 3 .  ? -23.453 0.049  -6.697  1.00 46.18  ? 409 HOH B O   1 
HETATM 961 O O   . HOH D 3 .  ? -25.022 -2.623 -10.708 1.00 46.60  ? 410 HOH B O   1 
HETATM 962 O O   . HOH D 3 .  ? -23.105 9.557  -6.263  1.00 65.69  ? 411 HOH B O   1 
HETATM 963 O O   . HOH D 3 .  ? -25.806 10.841 -3.271  1.00 64.08  ? 412 HOH B O   1 
HETATM 964 O O   . HOH D 3 .  ? -18.734 0.834  -2.891  1.00 79.61  ? 413 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1   N N   . GLU A 3  ? 1.3219 1.0272 0.7858 -0.1600 -0.0539 -0.0616 9   GLU A N   
2   C CA  . GLU A 3  ? 1.4814 1.1886 0.9255 -0.1901 -0.0690 -0.0603 9   GLU A CA  
3   C C   . GLU A 3  ? 1.5331 1.3058 1.0232 -0.2160 -0.0883 -0.0415 9   GLU A C   
4   O O   . GLU A 3  ? 1.7497 1.5201 1.2346 -0.2443 -0.1005 -0.0384 9   GLU A O   
5   C CB  . GLU A 3  ? 1.4793 1.1871 0.8923 -0.1832 -0.0648 -0.0638 9   GLU A CB  
6   N N   . PRO A 4  ? 1.1724 1.0056 0.7077 -0.2053 -0.0900 -0.0263 10  PRO A N   
7   C CA  . PRO A 4  ? 0.9299 0.8242 0.5132 -0.2237 -0.1054 -0.0074 10  PRO A CA  
8   C C   . PRO A 4  ? 0.9859 0.8709 0.5906 -0.2281 -0.1058 -0.0080 10  PRO A C   
9   O O   . PRO A 4  ? 1.0618 0.9155 0.6681 -0.2071 -0.0930 -0.0168 10  PRO A O   
10  C CB  . PRO A 4  ? 0.8922 0.8457 0.5185 -0.2036 -0.1035 0.0100  10  PRO A CB  
11  C CG  . PRO A 4  ? 0.9510 0.8818 0.5473 -0.1853 -0.0910 0.0026  10  PRO A CG  
12  C CD  . PRO A 4  ? 1.0673 0.9249 0.6172 -0.1779 -0.0782 -0.0203 10  PRO A CD  
13  N N   . ALA A 5  ? 0.8656 0.7814 0.4918 -0.2524 -0.1177 0.0035  11  ALA A N   
14  C CA  . ALA A 5  ? 0.7771 0.6869 0.4221 -0.2589 -0.1177 0.0051  11  ALA A CA  
15  C C   . ALA A 5  ? 0.7412 0.6973 0.4392 -0.2399 -0.1156 0.0157  11  ALA A C   
16  O O   . ALA A 5  ? 0.6761 0.6166 0.3890 -0.2339 -0.1098 0.0129  11  ALA A O   
17  C CB  . ALA A 5  ? 0.8016 0.7364 0.4517 -0.2904 -0.1291 0.0173  11  ALA A CB  
18  N N   . GLU A 6  ? 0.6633 0.6743 0.3968 -0.2243 -0.1157 0.0303  12  GLU A N   
19  C CA  . GLU A 6  ? 0.5943 0.6421 0.3868 -0.1959 -0.1055 0.0424  12  GLU A CA  
20  C C   . GLU A 6  ? 0.5780 0.5822 0.3719 -0.1665 -0.0869 0.0298  12  GLU A C   
21  O O   . GLU A 6  ? 0.5472 0.5567 0.3754 -0.1498 -0.0786 0.0323  12  GLU A O   
22  C CB  . GLU A 6  ? 0.6570 0.7650 0.4817 -0.1842 -0.1088 0.0620  12  GLU A CB  
23  C CG  . GLU A 6  ? 0.6917 0.8631 0.5329 -0.2065 -0.1261 0.0811  12  GLU A CG  
24  N N   . ILE A 7  ? 0.5222 0.4859 0.2777 -0.1605 -0.0803 0.0169  13  ILE A N   
25  C CA  . ILE A 7  ? 0.6226 0.5540 0.3808 -0.1328 -0.0626 0.0076  13  ILE A CA  
26  C C   . ILE A 7  ? 0.6943 0.5797 0.4372 -0.1336 -0.0581 -0.0049 13  ILE A C   
27  O O   . ILE A 7  ? 0.6117 0.4932 0.3809 -0.1130 -0.0474 -0.0053 13  ILE A O   
28  C CB  . ILE A 7  ? 0.6075 0.5144 0.3291 -0.1231 -0.0546 -0.0008 13  ILE A CB  
29  C CG1 . ILE A 7  ? 0.5078 0.4609 0.2486 -0.1188 -0.0573 0.0141  13  ILE A CG1 
30  C CG2 . ILE A 7  ? 0.6557 0.5359 0.3807 -0.0951 -0.0361 -0.0085 13  ILE A CG2 
31  C CD1 . ILE A 7  ? 0.6792 0.6155 0.3846 -0.1104 -0.0492 0.0084  13  ILE A CD1 
32  N N   . LYS A 8  ? 0.6628 0.5121 0.3617 -0.1588 -0.0672 -0.0140 14  LYS A N   
33  C CA  . LYS A 8  ? 0.6969 0.4969 0.3781 -0.1581 -0.0624 -0.0244 14  LYS A CA  
34  C C   . LYS A 8  ? 0.6303 0.4637 0.3592 -0.1597 -0.0649 -0.0134 14  LYS A C   
35  O O   . LYS A 8  ? 0.6699 0.4818 0.4083 -0.1443 -0.0559 -0.0171 14  LYS A O   
36  C CB  . LYS A 8  ? 0.8584 0.6012 0.4741 -0.1871 -0.0716 -0.0368 14  LYS A CB  
37  C CG  . LYS A 8  ? 0.9012 0.6765 0.5133 -0.2226 -0.0898 -0.0274 14  LYS A CG  
38  C CD  . LYS A 8  ? 0.9242 0.6456 0.4845 -0.2398 -0.0908 -0.0349 14  LYS A CD  
39  N N   . ILE A 9  ? 0.6012 0.4905 0.3604 -0.1755 -0.0763 0.0012  15  ILE A N   
40  C CA  . ILE A 9  ? 0.5474 0.4744 0.3529 -0.1721 -0.0762 0.0127  15  ILE A CA  
41  C C   . ILE A 9  ? 0.4934 0.4296 0.3357 -0.1380 -0.0620 0.0142  15  ILE A C   
42  O O   . ILE A 9  ? 0.4837 0.4122 0.3426 -0.1286 -0.0561 0.0133  15  ILE A O   
43  C CB  . ILE A 9  ? 0.5197 0.5145 0.3549 -0.1869 -0.0880 0.0309  15  ILE A CB  
44  C CG1 . ILE A 9  ? 0.5327 0.5272 0.3384 -0.2272 -0.1041 0.0327  15  ILE A CG1 
45  C CG2 . ILE A 9  ? 0.4860 0.5219 0.3715 -0.1709 -0.0824 0.0429  15  ILE A CG2 
46  C CD1 . ILE A 9  ? 0.6500 0.7181 0.4807 -0.2433 -0.1174 0.0523  15  ILE A CD1 
47  N N   . ILE A 10 ? 0.4632 0.4150 0.3156 -0.1218 -0.0573 0.0170  16  ILE A N   
48  C CA  . ILE A 10 ? 0.4748 0.4327 0.3576 -0.0945 -0.0454 0.0189  16  ILE A CA  
49  C C   . ILE A 10 ? 0.5301 0.4438 0.3962 -0.0822 -0.0354 0.0064  16  ILE A C   
50  O O   . ILE A 10 ? 0.4668 0.3800 0.3551 -0.0694 -0.0294 0.0069  16  ILE A O   
51  C CB  . ILE A 10 ? 0.4008 0.3795 0.2919 -0.0831 -0.0427 0.0254  16  ILE A CB  
52  C CG1 . ILE A 10 ? 0.3539 0.3803 0.2696 -0.0874 -0.0508 0.0414  16  ILE A CG1 
53  C CG2 . ILE A 10 ? 0.4077 0.3825 0.3201 -0.0602 -0.0308 0.0257  16  ILE A CG2 
54  C CD1 . ILE A 10 ? 0.3296 0.3744 0.2431 -0.0821 -0.0516 0.0497  16  ILE A CD1 
55  N N   . ARG A 11 ? 0.4701 0.3463 0.2944 -0.0850 -0.0334 -0.0043 17  ARG A N   
56  C CA  . ARG A 11 ? 0.5288 0.3653 0.3356 -0.0679 -0.0222 -0.0142 17  ARG A CA  
57  C C   . ARG A 11 ? 0.5957 0.4081 0.3998 -0.0723 -0.0235 -0.0171 17  ARG A C   
58  O O   . ARG A 11 ? 0.5434 0.3486 0.3609 -0.0542 -0.0153 -0.0177 17  ARG A O   
59  C CB  . ARG A 11 ? 0.6241 0.4196 0.3789 -0.0675 -0.0184 -0.0256 17  ARG A CB  
60  C CG  . ARG A 11 ? 0.7237 0.4879 0.4633 -0.0408 -0.0031 -0.0327 17  ARG A CG  
61  C CD  . ARG A 11 ? 0.8118 0.5293 0.4918 -0.0384 0.0021  -0.0451 17  ARG A CD  
62  N NE  . ARG A 11 ? 0.9486 0.6885 0.6206 -0.0472 -0.0015 -0.0431 17  ARG A NE  
63  N N   . GLU A 12 ? 0.5830 0.3863 0.3700 -0.0981 -0.0345 -0.0172 18  GLU A N   
64  C CA  . GLU A 12 ? 0.5472 0.3270 0.3287 -0.1059 -0.0363 -0.0182 18  GLU A CA  
65  C C   . GLU A 12 ? 0.5138 0.3330 0.3443 -0.0957 -0.0340 -0.0087 18  GLU A C   
66  O O   . GLU A 12 ? 0.5503 0.3522 0.3842 -0.0857 -0.0291 -0.0100 18  GLU A O   
67  C CB  . GLU A 12 ? 0.6874 0.4577 0.4433 -0.1410 -0.0499 -0.0171 18  GLU A CB  
68  C CG  . GLU A 12 ? 1.0319 0.7529 0.7280 -0.1584 -0.0549 -0.0281 18  GLU A CG  
69  C CD  . GLU A 12 ? 1.1797 0.8408 0.8369 -0.1340 -0.0418 -0.0417 18  GLU A CD  
70  O OE1 . GLU A 12 ? 1.1996 0.8213 0.8446 -0.1225 -0.0352 -0.0453 18  GLU A OE1 
71  O OE2 . GLU A 12 ? 1.2351 0.8904 0.8732 -0.1248 -0.0375 -0.0475 18  GLU A OE2 
72  N N   . ALA A 13 ? 0.4885 0.3584 0.3534 -0.0969 -0.0375 0.0011  19  ALA A N   
73  C CA  . ALA A 13 ? 0.4228 0.3257 0.3279 -0.0864 -0.0347 0.0092  19  ALA A CA  
74  C C   . ALA A 13 ? 0.4440 0.3394 0.3629 -0.0623 -0.0248 0.0062  19  ALA A C   
75  O O   . ALA A 13 ? 0.3805 0.2772 0.3147 -0.0548 -0.0219 0.0074  19  ALA A O   
76  C CB  . ALA A 13 ? 0.3957 0.3480 0.3284 -0.0880 -0.0387 0.0205  19  ALA A CB  
77  N N   . TYR A 14 ? 0.3868 0.2779 0.2995 -0.0518 -0.0203 0.0034  20  TYR A N   
78  C CA  . TYR A 14 ? 0.4026 0.2935 0.3282 -0.0320 -0.0117 0.0028  20  TYR A CA  
79  C C   . TYR A 14 ? 0.4066 0.2685 0.3194 -0.0232 -0.0071 -0.0025 20  TYR A C   
80  O O   . TYR A 14 ? 0.3969 0.2677 0.3296 -0.0134 -0.0044 0.0003  20  TYR A O   
81  C CB  . TYR A 14 ? 0.3832 0.2761 0.2985 -0.0258 -0.0075 0.0020  20  TYR A CB  
82  C CG  . TYR A 14 ? 0.3950 0.2974 0.3243 -0.0085 0.0012  0.0043  20  TYR A CG  
83  C CD1 . TYR A 14 ? 0.4023 0.3323 0.3608 -0.0060 0.0013  0.0126  20  TYR A CD1 
84  C CD2 . TYR A 14 ? 0.4234 0.3072 0.3334 0.0050  0.0097  -0.0005 20  TYR A CD2 
85  C CE1 . TYR A 14 ? 0.3915 0.3339 0.3620 0.0044  0.0080  0.0167  20  TYR A CE1 
86  C CE2 . TYR A 14 ? 0.5047 0.4079 0.4304 0.0196  0.0177  0.0047  20  TYR A CE2 
87  C CZ  . TYR A 14 ? 0.4766 0.4110 0.4334 0.0167  0.0160  0.0136  20  TYR A CZ  
88  O OH  . TYR A 14 ? 0.4636 0.4206 0.4356 0.0264  0.0227  0.0205  20  TYR A OH  
89  N N   . LYS A 15 ? 0.4381 0.2625 0.3140 -0.0271 -0.0067 -0.0097 21  LYS A N   
90  C CA  . LYS A 15 ? 0.4536 0.2434 0.3107 -0.0154 -0.0015 -0.0136 21  LYS A CA  
91  C C   . LYS A 15 ? 0.5064 0.2941 0.3733 -0.0229 -0.0060 -0.0103 21  LYS A C   
92  O O   . LYS A 15 ? 0.4621 0.2481 0.3384 -0.0089 -0.0021 -0.0079 21  LYS A O   
93  C CB  . LYS A 15 ? 0.5748 0.3135 0.3809 -0.0184 0.0001  -0.0228 21  LYS A CB  
94  C CG  . LYS A 15 ? 0.5375 0.2728 0.3265 -0.0063 0.0074  -0.0272 21  LYS A CG  
95  C CD  . LYS A 15 ? 0.6328 0.3074 0.3616 -0.0098 0.0092  -0.0385 21  LYS A CD  
96  C CE  . LYS A 15 ? 0.8535 0.5233 0.5611 0.0067  0.0193  -0.0433 21  LYS A CE  
97  N N   . LYS A 16 ? 0.4193 0.2110 0.2835 -0.0455 -0.0143 -0.0086 22  LYS A N   
98  C CA  . LYS A 16 ? 0.4494 0.2433 0.3221 -0.0542 -0.0178 -0.0040 22  LYS A CA  
99  C C   . LYS A 16 ? 0.4465 0.2795 0.3585 -0.0440 -0.0159 0.0019  22  LYS A C   
100 O O   . LYS A 16 ? 0.4315 0.2611 0.3489 -0.0390 -0.0147 0.0041  22  LYS A O   
101 C CB  . LYS A 16 ? 0.5520 0.3522 0.4164 -0.0821 -0.0267 -0.0006 22  LYS A CB  
102 C CG  . LYS A 16 ? 0.6679 0.4164 0.4846 -0.1002 -0.0310 -0.0059 22  LYS A CG  
103 C CD  . LYS A 16 ? 0.6062 0.3728 0.4189 -0.1333 -0.0420 0.0001  22  LYS A CD  
104 C CE  . LYS A 16 ? 0.7613 0.4822 0.5354 -0.1554 -0.0469 -0.0003 22  LYS A CE  
105 N N   . ALA A 17 ? 0.3720 0.2382 0.3073 -0.0415 -0.0160 0.0046  23  ALA A N   
106 C CA  . ALA A 17 ? 0.3420 0.2344 0.3060 -0.0326 -0.0142 0.0087  23  ALA A CA  
107 C C   . ALA A 17 ? 0.4179 0.3021 0.3855 -0.0175 -0.0100 0.0072  23  ALA A C   
108 O O   . ALA A 17 ? 0.3726 0.2626 0.3506 -0.0141 -0.0101 0.0090  23  ALA A O   
109 C CB  . ALA A 17 ? 0.3309 0.2502 0.3128 -0.0305 -0.0143 0.0124  23  ALA A CB  
110 N N   . PHE A 18 ? 0.3686 0.2431 0.3271 -0.0083 -0.0062 0.0048  24  PHE A N   
111 C CA  . PHE A 18 ? 0.3717 0.2493 0.3375 0.0068  -0.0022 0.0065  24  PHE A CA  
112 C C   . PHE A 18 ? 0.3914 0.2486 0.3451 0.0111  -0.0023 0.0068  24  PHE A C   
113 O O   . PHE A 18 ? 0.4196 0.2890 0.3863 0.0174  -0.0030 0.0108  24  PHE A O   
114 C CB  . PHE A 18 ? 0.3499 0.2251 0.3071 0.0188  0.0041  0.0057  24  PHE A CB  
115 C CG  . PHE A 18 ? 0.4143 0.3053 0.3840 0.0345  0.0083  0.0110  24  PHE A CG  
116 C CD1 . PHE A 18 ? 0.4120 0.3366 0.4075 0.0336  0.0075  0.0169  24  PHE A CD1 
117 C CD2 . PHE A 18 ? 0.5394 0.4120 0.4937 0.0495  0.0125  0.0117  24  PHE A CD2 
118 C CE1 . PHE A 18 ? 0.4499 0.3977 0.4592 0.0444  0.0097  0.0242  24  PHE A CE1 
119 C CE2 . PHE A 18 ? 0.4887 0.3854 0.4578 0.0652  0.0158  0.0196  24  PHE A CE2 
120 C CZ  . PHE A 18 ? 0.4252 0.3634 0.4235 0.0611  0.0138  0.0262  24  PHE A CZ  
121 N N   . LEU A 19 ? 0.3739 0.1976 0.2992 0.0062  -0.0024 0.0033  25  LEU A N   
122 C CA  . LEU A 19 ? 0.4105 0.2067 0.3184 0.0094  -0.0024 0.0048  25  LEU A CA  
123 C C   . LEU A 19 ? 0.4270 0.2418 0.3526 0.0018  -0.0069 0.0094  25  LEU A C   
124 O O   . LEU A 19 ? 0.4411 0.2581 0.3709 0.0115  -0.0067 0.0136  25  LEU A O   
125 C CB  . LEU A 19 ? 0.4326 0.1847 0.3030 -0.0029 -0.0038 0.0003  25  LEU A CB  
126 C CG  . LEU A 19 ? 0.5095 0.2192 0.3516 -0.0007 -0.0034 0.0022  25  LEU A CG  
127 C CD1 . LEU A 19 ? 0.5500 0.2036 0.3448 -0.0074 -0.0025 -0.0044 25  LEU A CD1 
128 C CD2 . LEU A 19 ? 0.5199 0.2394 0.3704 -0.0189 -0.0094 0.0076  25  LEU A CD2 
129 N N   . PHE A 20 ? 0.3844 0.2155 0.3197 -0.0141 -0.0104 0.0094  26  PHE A N   
130 C CA  . PHE A 20 ? 0.3817 0.2284 0.3285 -0.0198 -0.0125 0.0133  26  PHE A CA  
131 C C   . PHE A 20 ? 0.3222 0.1948 0.2915 -0.0112 -0.0122 0.0140  26  PHE A C   
132 O O   . PHE A 20 ? 0.3749 0.2508 0.3459 -0.0091 -0.0133 0.0163  26  PHE A O   
133 C CB  . PHE A 20 ? 0.3827 0.2431 0.3320 -0.0369 -0.0148 0.0152  26  PHE A CB  
134 C CG  . PHE A 20 ? 0.3946 0.2299 0.3194 -0.0527 -0.0175 0.0170  26  PHE A CG  
135 C CD1 . PHE A 20 ? 0.3688 0.1907 0.2829 -0.0568 -0.0178 0.0215  26  PHE A CD1 
136 C CD2 . PHE A 20 ? 0.4214 0.2423 0.3290 -0.0653 -0.0204 0.0145  26  PHE A CD2 
137 C CE1 . PHE A 20 ? 0.4582 0.2515 0.3459 -0.0744 -0.0208 0.0244  26  PHE A CE1 
138 C CE2 . PHE A 20 ? 0.4992 0.2900 0.3780 -0.0846 -0.0244 0.0161  26  PHE A CE2 
139 C CZ  . PHE A 20 ? 0.5500 0.3257 0.4188 -0.0896 -0.0245 0.0214  26  PHE A CZ  
140 N N   . VAL A 21 ? 0.3333 0.2210 0.3160 -0.0076 -0.0114 0.0123  27  VAL A N   
141 C CA  . VAL A 21 ? 0.3306 0.2355 0.3288 -0.0036 -0.0123 0.0129  27  VAL A CA  
142 C C   . VAL A 21 ? 0.3368 0.2432 0.3359 0.0050  -0.0134 0.0157  27  VAL A C   
143 O O   . VAL A 21 ? 0.3099 0.2249 0.3135 0.0043  -0.0166 0.0171  27  VAL A O   
144 C CB  . VAL A 21 ? 0.3213 0.2381 0.3307 -0.0039 -0.0114 0.0123  27  VAL A CB  
145 C CG1 . VAL A 21 ? 0.3118 0.2375 0.3305 -0.0033 -0.0134 0.0131  27  VAL A CG1 
146 C CG2 . VAL A 21 ? 0.3022 0.2240 0.3128 -0.0095 -0.0107 0.0125  27  VAL A CG2 
147 N N   . ASN A 22 ? 0.3063 0.2042 0.2984 0.0139  -0.0106 0.0170  28  ASN A N   
148 C CA  . ASN A 22 ? 0.3649 0.2699 0.3589 0.0264  -0.0106 0.0227  28  ASN A CA  
149 C C   . ASN A 22 ? 0.4211 0.3147 0.4048 0.0274  -0.0134 0.0258  28  ASN A C   
150 O O   . ASN A 22 ? 0.3614 0.2725 0.3529 0.0310  -0.0173 0.0312  28  ASN A O   
151 C CB  . ASN A 22 ? 0.3906 0.2851 0.3744 0.0410  -0.0041 0.0237  28  ASN A CB  
152 C CG  . ASN A 22 ? 0.4211 0.3293 0.4088 0.0591  -0.0024 0.0325  28  ASN A CG  
153 O OD1 . ASN A 22 ? 0.4178 0.3628 0.4272 0.0604  -0.0047 0.0388  28  ASN A OD1 
154 N ND2 . ASN A 22 ? 0.4749 0.3539 0.4405 0.0728  0.0013  0.0344  28  ASN A ND2 
155 N N   . LYS A 23 ? 0.4054 0.2713 0.3703 0.0221  -0.0123 0.0236  29  LYS A N   
156 C CA  . LYS A 23 ? 0.3986 0.2525 0.3518 0.0207  -0.0146 0.0279  29  LYS A CA  
157 C C   . LYS A 23 ? 0.3566 0.2327 0.3216 0.0120  -0.0187 0.0276  29  LYS A C   
158 O O   . LYS A 23 ? 0.3539 0.2364 0.3171 0.0149  -0.0222 0.0324  29  LYS A O   
159 C CB  . LYS A 23 ? 0.4393 0.2614 0.3701 0.0104  -0.0134 0.0268  29  LYS A CB  
160 C CG  . LYS A 23 ? 0.4597 0.2444 0.3656 0.0188  -0.0097 0.0264  29  LYS A CG  
161 C CD  . LYS A 23 ? 0.5048 0.2552 0.3847 0.0009  -0.0108 0.0252  29  LYS A CD  
162 C CE  . LYS A 23 ? 0.6327 0.3779 0.5054 -0.0081 -0.0135 0.0321  29  LYS A CE  
163 N NZ  . LYS A 23 ? 0.6579 0.3791 0.5144 0.0094  -0.0124 0.0391  29  LYS A NZ  
164 N N   . GLY A 24 ? 0.3308 0.2168 0.3045 0.0028  -0.0179 0.0223  30  GLY A N   
165 C CA  . GLY A 24 ? 0.3075 0.2066 0.2857 -0.0026 -0.0197 0.0204  30  GLY A CA  
166 C C   . GLY A 24 ? 0.3592 0.2724 0.3445 0.0001  -0.0248 0.0214  30  GLY A C   
167 O O   . GLY A 24 ? 0.3355 0.2521 0.3141 -0.0025 -0.0285 0.0223  30  GLY A O   
168 N N   . LEU A 25 ? 0.2824 0.2061 0.2798 0.0031  -0.0253 0.0220  31  LEU A N   
169 C CA  . LEU A 25 ? 0.2914 0.2351 0.2974 0.0011  -0.0316 0.0254  31  LEU A CA  
170 C C   . LEU A 25 ? 0.3496 0.3042 0.3539 0.0085  -0.0358 0.0341  31  LEU A C   
171 O O   . LEU A 25 ? 0.3216 0.2906 0.3252 0.0023  -0.0434 0.0369  31  LEU A O   
172 C CB  . LEU A 25 ? 0.3136 0.2720 0.3344 0.0021  -0.0304 0.0273  31  LEU A CB  
173 C CG  . LEU A 25 ? 0.2982 0.2498 0.3209 -0.0068 -0.0289 0.0214  31  LEU A CG  
174 C CD1 . LEU A 25 ? 0.3177 0.2805 0.3522 -0.0035 -0.0254 0.0244  31  LEU A CD1 
175 C CD2 . LEU A 25 ? 0.3146 0.2672 0.3331 -0.0195 -0.0358 0.0197  31  LEU A CD2 
176 N N   . ASN A 26 ? 0.3372 0.2826 0.3372 0.0220  -0.0313 0.0388  32  ASN A N   
177 C CA  . ASN A 26 ? 0.3269 0.2794 0.3228 0.0333  -0.0342 0.0491  32  ASN A CA  
178 C C   . ASN A 26 ? 0.3478 0.2937 0.3303 0.0256  -0.0394 0.0495  32  ASN A C   
179 O O   . ASN A 26 ? 0.3728 0.3394 0.3567 0.0261  -0.0469 0.0570  32  ASN A O   
180 C CB  . ASN A 26 ? 0.3708 0.2979 0.3536 0.0506  -0.0269 0.0528  32  ASN A CB  
181 C CG  . ASN A 26 ? 0.4171 0.3559 0.4094 0.0659  -0.0212 0.0560  32  ASN A CG  
182 O OD1 . ASN A 26 ? 0.3700 0.3438 0.3830 0.0632  -0.0233 0.0584  32  ASN A OD1 
183 N ND2 . ASN A 26 ? 0.4290 0.3359 0.4024 0.0816  -0.0133 0.0565  32  ASN A ND2 
184 N N   . THR A 27 ? 0.3682 0.2896 0.3375 0.0183  -0.0354 0.0430  33  THR A N   
185 C CA  . THR A 27 ? 0.3494 0.2651 0.3037 0.0123  -0.0380 0.0445  33  THR A CA  
186 C C   . THR A 27 ? 0.3309 0.2608 0.2851 0.0010  -0.0432 0.0387  33  THR A C   
187 O O   . THR A 27 ? 0.3960 0.3313 0.3385 -0.0024 -0.0487 0.0415  33  THR A O   
188 C CB  . THR A 27 ? 0.3737 0.2658 0.3150 0.0066  -0.0315 0.0418  33  THR A CB  
189 O OG1 . THR A 27 ? 0.4385 0.3311 0.3882 0.0000  -0.0270 0.0333  33  THR A OG1 
190 C CG2 . THR A 27 ? 0.4960 0.3633 0.4268 0.0146  -0.0284 0.0479  33  THR A CG2 
191 N N   . ASP A 28 ? 0.2684 0.2001 0.2312 -0.0048 -0.0416 0.0305  34  ASP A N   
192 C CA  . ASP A 28 ? 0.3047 0.2389 0.2609 -0.0155 -0.0461 0.0238  34  ASP A CA  
193 C C   . ASP A 28 ? 0.3563 0.3123 0.3153 -0.0211 -0.0577 0.0298  34  ASP A C   
194 O O   . ASP A 28 ? 0.3934 0.3495 0.3357 -0.0306 -0.0647 0.0278  34  ASP A O   
195 C CB  . ASP A 28 ? 0.3403 0.2677 0.3043 -0.0186 -0.0418 0.0163  34  ASP A CB  
196 C CG  . ASP A 28 ? 0.4098 0.3218 0.3564 -0.0263 -0.0418 0.0070  34  ASP A CG  
197 O OD1 . ASP A 28 ? 0.4820 0.3912 0.4106 -0.0326 -0.0476 0.0054  34  ASP A OD1 
198 O OD2 . ASP A 28 ? 0.3823 0.2826 0.3302 -0.0249 -0.0359 0.0015  34  ASP A OD2 
199 N N   . GLU A 29 ? 0.2993 0.2770 0.2782 -0.0154 -0.0598 0.0381  35  GLU A N   
200 C CA  . GLU A 29 ? 0.3185 0.3291 0.3056 -0.0207 -0.0711 0.0477  35  GLU A CA  
201 C C   . GLU A 29 ? 0.3984 0.4188 0.3754 -0.0156 -0.0770 0.0568  35  GLU A C   
202 O O   . GLU A 29 ? 0.3695 0.4134 0.3434 -0.0263 -0.0890 0.0623  35  GLU A O   
203 C CB  . GLU A 29 ? 0.3283 0.3669 0.3409 -0.0107 -0.0691 0.0574  35  GLU A CB  
204 C CG  . GLU A 29 ? 0.2798 0.3155 0.3019 -0.0199 -0.0660 0.0509  35  GLU A CG  
205 C CD  . GLU A 29 ? 0.3187 0.3714 0.3607 -0.0056 -0.0585 0.0576  35  GLU A CD  
206 O OE1 . GLU A 29 ? 0.3375 0.3962 0.3824 0.0144  -0.0537 0.0654  35  GLU A OE1 
207 O OE2 . GLU A 29 ? 0.3117 0.3679 0.3626 -0.0135 -0.0566 0.0551  35  GLU A OE2 
208 N N   . LEU A 30 ? 0.3650 0.3662 0.3342 -0.0014 -0.0695 0.0591  36  LEU A N   
209 C CA  . LEU A 30 ? 0.3739 0.3798 0.3313 0.0054  -0.0741 0.0697  36  LEU A CA  
210 C C   . LEU A 30 ? 0.3820 0.3705 0.3139 -0.0069 -0.0759 0.0623  36  LEU A C   
211 O O   . LEU A 30 ? 0.4346 0.4252 0.3522 -0.0042 -0.0799 0.0704  36  LEU A O   
212 C CB  . LEU A 30 ? 0.4029 0.3889 0.3581 0.0252  -0.0650 0.0768  36  LEU A CB  
213 C CG  . LEU A 30 ? 0.5719 0.5662 0.5212 0.0413  -0.0686 0.0937  36  LEU A CG  
214 C CD1 . LEU A 30 ? 0.4830 0.5271 0.4505 0.0446  -0.0791 0.1061  36  LEU A CD1 
215 C CD2 . LEU A 30 ? 0.6223 0.5870 0.5667 0.0617  -0.0580 0.0985  36  LEU A CD2 
216 N N   . GLY A 31 ? 0.4594 0.4306 0.3838 -0.0183 -0.0719 0.0478  37  GLY A N   
217 C CA  . GLY A 31 ? 0.4482 0.4027 0.3460 -0.0271 -0.0710 0.0394  37  GLY A CA  
218 C C   . GLY A 31 ? 0.5068 0.4418 0.3945 -0.0206 -0.0595 0.0387  37  GLY A C   
219 O O   . GLY A 31 ? 0.5082 0.4350 0.3733 -0.0244 -0.0572 0.0355  37  GLY A O   
220 N N   . GLN A 32 ? 0.4180 0.3462 0.3200 -0.0121 -0.0523 0.0425  38  GLN A N   
221 C CA  . GLN A 32 ? 0.3761 0.2886 0.2697 -0.0107 -0.0428 0.0441  38  GLN A CA  
222 C C   . GLN A 32 ? 0.3965 0.3038 0.2946 -0.0143 -0.0339 0.0335  38  GLN A C   
223 O O   . GLN A 32 ? 0.4347 0.3380 0.3465 -0.0127 -0.0293 0.0327  38  GLN A O   
224 C CB  . GLN A 32 ? 0.4100 0.3118 0.3092 -0.0025 -0.0412 0.0539  38  GLN A CB  
225 C CG  . GLN A 32 ? 0.4518 0.3595 0.3453 0.0063  -0.0489 0.0668  38  GLN A CG  
226 C CD  . GLN A 32 ? 0.4638 0.3573 0.3610 0.0206  -0.0469 0.0758  38  GLN A CD  
227 O OE1 . GLN A 32 ? 0.5374 0.4209 0.4442 0.0233  -0.0417 0.0706  38  GLN A OE1 
228 N NE2 . GLN A 32 ? 0.5736 0.4639 0.4597 0.0315  -0.0506 0.0897  38  GLN A NE2 
229 N N   . LYS A 33 ? 0.4237 0.3305 0.3073 -0.0177 -0.0313 0.0257  39  LYS A N   
230 C CA  . LYS A 33 ? 0.4353 0.3383 0.3225 -0.0165 -0.0233 0.0163  39  LYS A CA  
231 C C   . LYS A 33 ? 0.4138 0.3219 0.3072 -0.0146 -0.0124 0.0200  39  LYS A C   
232 O O   . LYS A 33 ? 0.4104 0.3216 0.3175 -0.0122 -0.0073 0.0170  39  LYS A O   
233 C CB  . LYS A 33 ? 0.4873 0.3811 0.3502 -0.0175 -0.0225 0.0065  39  LYS A CB  
234 C CG  . LYS A 33 ? 0.5157 0.4035 0.3740 -0.0250 -0.0342 0.0011  39  LYS A CG  
235 C CD  . LYS A 33 ? 0.6747 0.5462 0.4977 -0.0307 -0.0372 -0.0079 39  LYS A CD  
236 C CE  . LYS A 33 ? 0.6118 0.4772 0.4300 -0.0443 -0.0507 -0.0123 39  LYS A CE  
237 N N   . GLU A 34 ? 0.4507 0.3624 0.3346 -0.0174 -0.0097 0.0284  40  GLU A N   
238 C CA  . GLU A 34 ? 0.4473 0.3692 0.3381 -0.0207 -0.0011 0.0346  40  GLU A CA  
239 C C   . GLU A 34 ? 0.4408 0.3567 0.3478 -0.0253 -0.0043 0.0383  40  GLU A C   
240 O O   . GLU A 34 ? 0.4346 0.3606 0.3538 -0.0282 0.0002  0.0386  40  GLU A O   
241 C CB  . GLU A 34 ? 0.6103 0.5369 0.4851 -0.0261 0.0021  0.0446  40  GLU A CB  
242 C CG  . GLU A 34 ? 0.6997 0.6359 0.5563 -0.0205 0.0096  0.0407  40  GLU A CG  
243 C CD  . GLU A 34 ? 0.7195 0.6703 0.5836 -0.0119 0.0209  0.0349  40  GLU A CD  
244 O OE1 . GLU A 34 ? 0.7541 0.7245 0.6357 -0.0152 0.0265  0.0421  40  GLU A OE1 
245 O OE2 . GLU A 34 ? 0.6731 0.6144 0.5231 -0.0019 0.0237  0.0238  40  GLU A OE2 
246 N N   . GLU A 35 ? 0.4121 0.3119 0.3166 -0.0246 -0.0119 0.0415  41  GLU A N   
247 C CA  . GLU A 35 ? 0.4797 0.3659 0.3918 -0.0260 -0.0141 0.0432  41  GLU A CA  
248 C C   . GLU A 35 ? 0.4948 0.3880 0.4243 -0.0220 -0.0138 0.0347  41  GLU A C   
249 O O   . GLU A 35 ? 0.4382 0.3297 0.3747 -0.0262 -0.0120 0.0342  41  GLU A O   
250 C CB  . GLU A 35 ? 0.5183 0.3864 0.4224 -0.0191 -0.0202 0.0486  41  GLU A CB  
251 C CG  . GLU A 35 ? 0.5911 0.4330 0.4781 -0.0240 -0.0198 0.0580  41  GLU A CG  
252 C CD  . GLU A 35 ? 0.6595 0.4807 0.5383 -0.0103 -0.0239 0.0634  41  GLU A CD  
253 O OE1 . GLU A 35 ? 0.6393 0.4691 0.5145 -0.0022 -0.0281 0.0689  41  GLU A OE1 
254 O OE2 . GLU A 35 ? 0.5992 0.3966 0.4734 -0.0063 -0.0227 0.0627  41  GLU A OE2 
255 N N   . ALA A 36 ? 0.4048 0.3045 0.3384 -0.0160 -0.0166 0.0286  42  ALA A N   
256 C CA  . ALA A 36 ? 0.3581 0.2619 0.3058 -0.0133 -0.0167 0.0220  42  ALA A CA  
257 C C   . ALA A 36 ? 0.3495 0.2621 0.3035 -0.0146 -0.0097 0.0195  42  ALA A C   
258 O O   . ALA A 36 ? 0.3635 0.2781 0.3288 -0.0152 -0.0089 0.0189  42  ALA A O   
259 C CB  . ALA A 36 ? 0.3707 0.2771 0.3166 -0.0117 -0.0215 0.0169  42  ALA A CB  
260 N N   . LYS A 37 ? 0.3313 0.2518 0.2773 -0.0136 -0.0040 0.0195  43  LYS A N   
261 C CA  . LYS A 37 ? 0.3329 0.2687 0.2863 -0.0103 0.0040  0.0197  43  LYS A CA  
262 C C   . LYS A 37 ? 0.3556 0.3035 0.3198 -0.0192 0.0044  0.0272  43  LYS A C   
263 O O   . LYS A 37 ? 0.3831 0.3440 0.3598 -0.0182 0.0064  0.0281  43  LYS A O   
264 C CB  . LYS A 37 ? 0.3644 0.3097 0.3049 -0.0045 0.0123  0.0202  43  LYS A CB  
265 C CG  . LYS A 37 ? 0.4391 0.3661 0.3615 0.0035  0.0124  0.0103  43  LYS A CG  
266 C CD  . LYS A 37 ? 0.5703 0.5030 0.4752 0.0138  0.0238  0.0092  43  LYS A CD  
267 C CE  . LYS A 37 ? 0.6432 0.5813 0.5332 0.0084  0.0243  0.0139  43  LYS A CE  
268 N NZ  . LYS A 37 ? 0.6215 0.5574 0.4856 0.0201  0.0351  0.0094  43  LYS A NZ  
269 N N   . ASN A 38 ? 0.3502 0.2910 0.3061 -0.0293 0.0015  0.0333  44  ASN A N   
270 C CA  . ASN A 38 ? 0.4214 0.3643 0.3790 -0.0434 -0.0001 0.0402  44  ASN A CA  
271 C C   . ASN A 38 ? 0.4110 0.3417 0.3745 -0.0442 -0.0047 0.0358  44  ASN A C   
272 O O   . ASN A 38 ? 0.3593 0.3042 0.3308 -0.0515 -0.0048 0.0382  44  ASN A O   
273 C CB  . ASN A 38 ? 0.4660 0.3886 0.4057 -0.0536 -0.0032 0.0467  44  ASN A CB  
274 C CG  . ASN A 38 ? 0.6515 0.5653 0.5846 -0.0724 -0.0062 0.0530  44  ASN A CG  
275 O OD1 . ASN A 38 ? 0.7242 0.6638 0.6683 -0.0822 -0.0050 0.0568  44  ASN A OD1 
276 N ND2 . ASN A 38 ? 0.7813 0.6572 0.6939 -0.0776 -0.0106 0.0549  44  ASN A ND2 
277 N N   . TYR A 39 ? 0.3703 0.2787 0.3294 -0.0366 -0.0085 0.0307  45  TYR A N   
278 C CA  . TYR A 39 ? 0.3437 0.2406 0.3056 -0.0351 -0.0111 0.0267  45  TYR A CA  
279 C C   . TYR A 39 ? 0.3218 0.2374 0.3002 -0.0297 -0.0094 0.0229  45  TYR A C   
280 O O   . TYR A 39 ? 0.3700 0.2880 0.3520 -0.0337 -0.0103 0.0226  45  TYR A O   
281 C CB  . TYR A 39 ? 0.3828 0.2601 0.3387 -0.0249 -0.0136 0.0248  45  TYR A CB  
282 C CG  . TYR A 39 ? 0.3886 0.2429 0.3253 -0.0266 -0.0150 0.0302  45  TYR A CG  
283 C CD1 . TYR A 39 ? 0.4086 0.2442 0.3286 -0.0402 -0.0152 0.0342  45  TYR A CD1 
284 C CD2 . TYR A 39 ? 0.3363 0.1874 0.2697 -0.0162 -0.0169 0.0329  45  TYR A CD2 
285 C CE1 . TYR A 39 ? 0.5239 0.3310 0.4218 -0.0420 -0.0163 0.0404  45  TYR A CE1 
286 C CE2 . TYR A 39 ? 0.4077 0.2362 0.3220 -0.0152 -0.0179 0.0398  45  TYR A CE2 
287 C CZ  . TYR A 39 ? 0.5300 0.3333 0.4255 -0.0274 -0.0171 0.0434  45  TYR A CZ  
288 O OH  . TYR A 39 ? 0.5897 0.3639 0.4622 -0.0264 -0.0180 0.0515  45  TYR A OH  
289 N N   . TYR A 40 ? 0.2911 0.2161 0.2753 -0.0212 -0.0071 0.0203  46  TYR A N   
290 C CA  . TYR A 40 ? 0.3092 0.2440 0.3043 -0.0149 -0.0050 0.0176  46  TYR A CA  
291 C C   . TYR A 40 ? 0.3195 0.2764 0.3226 -0.0177 -0.0016 0.0230  46  TYR A C   
292 O O   . TYR A 40 ? 0.3226 0.2866 0.3340 -0.0166 -0.0022 0.0236  46  TYR A O   
293 C CB  . TYR A 40 ? 0.3052 0.2364 0.2961 -0.0067 -0.0028 0.0133  46  TYR A CB  
294 C CG  . TYR A 40 ? 0.3246 0.2420 0.3110 -0.0066 -0.0083 0.0092  46  TYR A CG  
295 C CD1 . TYR A 40 ? 0.3082 0.2234 0.3017 -0.0079 -0.0126 0.0098  46  TYR A CD1 
296 C CD2 . TYR A 40 ? 0.3402 0.2499 0.3140 -0.0056 -0.0093 0.0056  46  TYR A CD2 
297 C CE1 . TYR A 40 ? 0.3439 0.2577 0.3374 -0.0083 -0.0178 0.0092  46  TYR A CE1 
298 C CE2 . TYR A 40 ? 0.4035 0.3076 0.3741 -0.0092 -0.0165 0.0039  46  TYR A CE2 
299 C CZ  . TYR A 40 ? 0.3837 0.2935 0.3666 -0.0106 -0.0208 0.0068  46  TYR A CZ  
300 O OH  . TYR A 40 ? 0.3456 0.2602 0.3290 -0.0148 -0.0282 0.0081  46  TYR A OH  
301 N N   . LYS A 41 ? 0.2835 0.2563 0.2849 -0.0216 0.0019  0.0287  47  LYS A N   
302 C CA  . LYS A 41 ? 0.3183 0.3234 0.3307 -0.0248 0.0048  0.0372  47  LYS A CA  
303 C C   . LYS A 41 ? 0.3586 0.3648 0.3715 -0.0413 -0.0021 0.0403  47  LYS A C   
304 O O   . LYS A 41 ? 0.3459 0.3756 0.3696 -0.0430 -0.0031 0.0453  47  LYS A O   
305 C CB  . LYS A 41 ? 0.3500 0.3783 0.3613 -0.0273 0.0105  0.0450  47  LYS A CB  
306 C CG  . LYS A 41 ? 0.4165 0.4481 0.4243 -0.0079 0.0198  0.0422  47  LYS A CG  
307 C CD  . LYS A 41 ? 0.5093 0.5700 0.5160 -0.0079 0.0278  0.0512  47  LYS A CD  
308 C CE  . LYS A 41 ? 0.4901 0.5337 0.4818 -0.0205 0.0246  0.0510  47  LYS A CE  
309 N N   . GLN A 42 ? 0.3474 0.3256 0.3450 -0.0526 -0.0071 0.0376  48  GLN A N   
310 C CA  . GLN A 42 ? 0.3690 0.3367 0.3575 -0.0683 -0.0135 0.0382  48  GLN A CA  
311 C C   . GLN A 42 ? 0.3236 0.2841 0.3160 -0.0596 -0.0148 0.0320  48  GLN A C   
312 O O   . GLN A 42 ? 0.3803 0.3514 0.3733 -0.0684 -0.0185 0.0342  48  GLN A O   
313 C CB  . GLN A 42 ? 0.3726 0.3011 0.3367 -0.0784 -0.0168 0.0361  48  GLN A CB  
314 C CG  . GLN A 42 ? 0.4110 0.3454 0.3682 -0.0917 -0.0164 0.0445  48  GLN A CG  
315 C CD  . GLN A 42 ? 0.5428 0.4313 0.4711 -0.1020 -0.0199 0.0441  48  GLN A CD  
316 O OE1 . GLN A 42 ? 0.4518 0.3147 0.3599 -0.1176 -0.0251 0.0431  48  GLN A OE1 
317 N NE2 . GLN A 42 ? 0.4649 0.3387 0.3866 -0.0928 -0.0173 0.0450  48  GLN A NE2 
318 N N   . GLY A 43 ? 0.3298 0.2759 0.3248 -0.0440 -0.0123 0.0257  49  GLY A N   
319 C CA  . GLY A 43 ? 0.3396 0.2816 0.3389 -0.0366 -0.0127 0.0216  49  GLY A CA  
320 C C   . GLY A 43 ? 0.3545 0.3240 0.3688 -0.0329 -0.0115 0.0261  49  GLY A C   
321 O O   . GLY A 43 ? 0.3187 0.2925 0.3335 -0.0354 -0.0139 0.0269  49  GLY A O   
322 N N   . ILE A 44 ? 0.3076 0.2944 0.3315 -0.0249 -0.0070 0.0298  50  ILE A N   
323 C CA  . ILE A 44 ? 0.2713 0.2833 0.3078 -0.0160 -0.0041 0.0362  50  ILE A CA  
324 C C   . ILE A 44 ? 0.3135 0.3543 0.3552 -0.0282 -0.0086 0.0448  50  ILE A C   
325 O O   . ILE A 44 ? 0.3375 0.3919 0.3859 -0.0245 -0.0100 0.0491  50  ILE A O   
326 C CB  . ILE A 44 ? 0.3060 0.3297 0.3461 -0.0027 0.0036  0.0390  50  ILE A CB  
327 C CG1 . ILE A 44 ? 0.3608 0.3533 0.3917 0.0081  0.0062  0.0301  50  ILE A CG1 
328 C CG2 . ILE A 44 ? 0.3111 0.3665 0.3635 0.0091  0.0080  0.0492  50  ILE A CG2 
329 C CD1 . ILE A 44 ? 0.3642 0.3553 0.3879 0.0208  0.0141  0.0293  50  ILE A CD1 
330 N N   . GLY A 45 ? 0.3055 0.3547 0.3421 -0.0452 -0.0119 0.0483  51  GLY A N   
331 C CA  . GLY A 45 ? 0.3239 0.4017 0.3625 -0.0633 -0.0185 0.0573  51  GLY A CA  
332 C C   . GLY A 45 ? 0.3850 0.4442 0.4113 -0.0717 -0.0253 0.0521  51  GLY A C   
333 O O   . GLY A 45 ? 0.3715 0.4576 0.4043 -0.0756 -0.0296 0.0591  51  GLY A O   
334 N N   . HIS A 46 ? 0.3546 0.3697 0.3619 -0.0728 -0.0258 0.0407  52  HIS A N   
335 C CA  . HIS A 46 ? 0.3297 0.3236 0.3208 -0.0775 -0.0298 0.0347  52  HIS A CA  
336 C C   . HIS A 46 ? 0.3479 0.3523 0.3521 -0.0611 -0.0268 0.0354  52  HIS A C   
337 O O   . HIS A 46 ? 0.3705 0.3822 0.3692 -0.0664 -0.0309 0.0371  52  HIS A O   
338 C CB  . HIS A 46 ? 0.3469 0.2934 0.3147 -0.0764 -0.0282 0.0241  52  HIS A CB  
339 C CG  . HIS A 46 ? 0.4054 0.3315 0.3537 -0.0933 -0.0314 0.0240  52  HIS A CG  
340 N ND1 . HIS A 46 ? 0.5110 0.4310 0.4382 -0.1182 -0.0393 0.0259  52  HIS A ND1 
341 C CD2 . HIS A 46 ? 0.3818 0.2908 0.3258 -0.0910 -0.0286 0.0235  52  HIS A CD2 
342 C CE1 . HIS A 46 ? 0.5310 0.4277 0.4410 -0.1313 -0.0409 0.0267  52  HIS A CE1 
343 N NE2 . HIS A 46 ? 0.4579 0.3484 0.3785 -0.1138 -0.0340 0.0257  52  HIS A NE2 
344 N N   . LEU A 47 ? 0.3285 0.3311 0.3462 -0.0433 -0.0203 0.0344  53  LEU A N   
345 C CA  . LEU A 47 ? 0.2770 0.2831 0.3036 -0.0300 -0.0177 0.0360  53  LEU A CA  
346 C C   . LEU A 47 ? 0.3567 0.3972 0.3949 -0.0282 -0.0195 0.0475  53  LEU A C   
347 O O   . LEU A 47 ? 0.3325 0.3792 0.3697 -0.0273 -0.0218 0.0510  53  LEU A O   
348 C CB  . LEU A 47 ? 0.2493 0.2432 0.2832 -0.0156 -0.0119 0.0334  53  LEU A CB  
349 C CG  . LEU A 47 ? 0.2907 0.2587 0.3168 -0.0156 -0.0110 0.0250  53  LEU A CG  
350 C CD1 . LEU A 47 ? 0.3027 0.2633 0.3330 -0.0076 -0.0079 0.0232  53  LEU A CD1 
351 C CD2 . LEU A 47 ? 0.3289 0.2883 0.3516 -0.0140 -0.0109 0.0231  53  LEU A CD2 
352 N N   . LEU A 48 ? 0.3732 0.4399 0.4227 -0.0260 -0.0180 0.0550  54  LEU A N   
353 C CA  . LEU A 48 ? 0.3803 0.4881 0.4443 -0.0198 -0.0185 0.0690  54  LEU A CA  
354 C C   . LEU A 48 ? 0.4600 0.5892 0.5192 -0.0382 -0.0284 0.0745  54  LEU A C   
355 O O   . LEU A 48 ? 0.4967 0.6476 0.5622 -0.0320 -0.0306 0.0838  54  LEU A O   
356 C CB  . LEU A 48 ? 0.2743 0.4141 0.3511 -0.0152 -0.0142 0.0776  54  LEU A CB  
357 C CG  . LEU A 48 ? 0.3140 0.4400 0.3934 0.0079  -0.0031 0.0751  54  LEU A CG  
358 C CD1 . LEU A 48 ? 0.3039 0.4632 0.3922 0.0090  0.0017  0.0828  54  LEU A CD1 
359 C CD2 . LEU A 48 ? 0.4141 0.5387 0.4974 0.0320  0.0025  0.0811  54  LEU A CD2 
360 N N   . ARG A 49 ? 0.3100 0.4291 0.3540 -0.0614 -0.0349 0.0690  55  ARG A N   
361 C CA  . ARG A 49 ? 0.3589 0.4927 0.3907 -0.0836 -0.0459 0.0728  55  ARG A CA  
362 C C   . ARG A 49 ? 0.3731 0.4839 0.3899 -0.0804 -0.0473 0.0666  55  ARG A C   
363 O O   . ARG A 49 ? 0.3764 0.5131 0.3929 -0.0856 -0.0538 0.0750  55  ARG A O   
364 C CB  . ARG A 49 ? 0.3704 0.4829 0.3793 -0.1106 -0.0523 0.0663  55  ARG A CB  
365 C CG  . ARG A 49 ? 0.4706 0.5920 0.4591 -0.1385 -0.0653 0.0690  55  ARG A CG  
366 C CD  . ARG A 49 ? 0.5072 0.6023 0.4686 -0.1680 -0.0721 0.0640  55  ARG A CD  
367 N NE  . ARG A 49 ? 0.5981 0.6258 0.5307 -0.1629 -0.0666 0.0467  55  ARG A NE  
368 C CZ  . ARG A 49 ? 0.6073 0.6115 0.5427 -0.1528 -0.0590 0.0422  55  ARG A CZ  
369 N NH1 . ARG A 49 ? 0.4983 0.5373 0.4612 -0.1480 -0.0554 0.0520  55  ARG A NH1 
370 N NH2 . ARG A 49 ? 0.5598 0.5074 0.4692 -0.1459 -0.0544 0.0289  55  ARG A NH2 
371 N N   . GLY A 50 ? 0.3360 0.4030 0.3405 -0.0722 -0.0413 0.0535  56  GLY A N   
372 C CA  . GLY A 50 ? 0.3118 0.3589 0.3021 -0.0679 -0.0404 0.0481  56  GLY A CA  
373 C C   . GLY A 50 ? 0.3672 0.4369 0.3751 -0.0520 -0.0380 0.0585  56  GLY A C   
374 O O   . GLY A 50 ? 0.3770 0.4531 0.3759 -0.0546 -0.0414 0.0619  56  GLY A O   
375 N N   . ILE A 51 ? 0.3140 0.3917 0.3428 -0.0354 -0.0319 0.0638  57  ILE A N   
376 C CA  . ILE A 51 ? 0.3203 0.4078 0.3609 -0.0180 -0.0284 0.0738  57  ILE A CA  
377 C C   . ILE A 51 ? 0.3436 0.4753 0.3933 -0.0180 -0.0343 0.0898  57  ILE A C   
378 O O   . ILE A 51 ? 0.3078 0.4483 0.3592 -0.0084 -0.0346 0.0996  57  ILE A O   
379 C CB  . ILE A 51 ? 0.2877 0.3619 0.3396 -0.0004 -0.0199 0.0733  57  ILE A CB  
380 C CG1 . ILE A 51 ? 0.2559 0.2922 0.2996 -0.0013 -0.0160 0.0605  57  ILE A CG1 
381 C CG2 . ILE A 51 ? 0.3848 0.4641 0.4436 0.0186  -0.0161 0.0853  57  ILE A CG2 
382 C CD1 . ILE A 51 ? 0.3426 0.3629 0.3908 0.0081  -0.0103 0.0563  57  ILE A CD1 
383 N N   . SER A 52 ? 0.2889 0.4513 0.3441 -0.0302 -0.0397 0.0945  58  SER A N   
384 C CA  . SER A 52 ? 0.2632 0.4803 0.3326 -0.0300 -0.0458 0.1132  58  SER A CA  
385 C C   . SER A 52 ? 0.3456 0.5789 0.4015 -0.0465 -0.0571 0.1180  58  SER A C   
386 O O   . SER A 52 ? 0.3704 0.6514 0.4383 -0.0437 -0.0629 0.1358  58  SER A O   
387 C CB  . SER A 52 ? 0.4089 0.6607 0.4890 -0.0428 -0.0490 0.1185  58  SER A CB  
388 O OG  . SER A 52 ? 0.3850 0.6275 0.4446 -0.0750 -0.0594 0.1103  58  SER A OG  
389 N N   . ILE A 53 ? 0.3699 0.5653 0.3992 -0.0621 -0.0600 0.1030  59  ILE A N   
390 C CA  . ILE A 53 ? 0.3619 0.5666 0.3700 -0.0804 -0.0707 0.1048  59  ILE A CA  
391 C C   . ILE A 53 ? 0.3105 0.5208 0.3204 -0.0638 -0.0686 0.1140  59  ILE A C   
392 O O   . ILE A 53 ? 0.3444 0.5202 0.3511 -0.0494 -0.0592 0.1072  59  ILE A O   
393 C CB  . ILE A 53 ? 0.3838 0.5395 0.3559 -0.0987 -0.0720 0.0847  59  ILE A CB  
394 C CG1 . ILE A 53 ? 0.4119 0.5536 0.3782 -0.1149 -0.0738 0.0765  59  ILE A CG1 
395 C CG2 . ILE A 53 ? 0.4138 0.5740 0.3564 -0.1179 -0.0829 0.0849  59  ILE A CG2 
396 C CD1 . ILE A 53 ? 0.4270 0.6156 0.4004 -0.1374 -0.0861 0.0893  59  ILE A CD1 
397 N N   . SER A 54 ? 0.3275 0.5843 0.3430 -0.0668 -0.0780 0.1315  60  SER A N   
398 C CA  . SER A 54 ? 0.3228 0.5869 0.3373 -0.0522 -0.0773 0.1432  60  SER A CA  
399 C C   . SER A 54 ? 0.4404 0.6637 0.4229 -0.0618 -0.0761 0.1288  60  SER A C   
400 O O   . SER A 54 ? 0.4028 0.6156 0.3580 -0.0854 -0.0834 0.1175  60  SER A O   
401 C CB  . SER A 54 ? 0.3289 0.6552 0.3513 -0.0580 -0.0903 0.1651  60  SER A CB  
402 O OG  . SER A 54 ? 0.3623 0.6946 0.3805 -0.0444 -0.0904 0.1778  60  SER A OG  
403 N N   . SER A 55 ? 0.3808 0.5789 0.3638 -0.0438 -0.0661 0.1292  61  SER A N   
404 C CA  . SER A 55 ? 0.3442 0.5077 0.3001 -0.0498 -0.0617 0.1164  61  SER A CA  
405 C C   . SER A 55 ? 0.3635 0.5264 0.3165 -0.0375 -0.0575 0.1282  61  SER A C   
406 O O   . SER A 55 ? 0.4336 0.5707 0.3701 -0.0378 -0.0503 0.1201  61  SER A O   
407 C CB  . SER A 55 ? 0.3107 0.4336 0.2667 -0.0460 -0.0510 0.0989  61  SER A CB  
408 O OG  . SER A 55 ? 0.3365 0.4522 0.3178 -0.0278 -0.0429 0.1040  61  SER A OG  
409 N N   . LYS A 56 ? 0.3381 0.5308 0.3065 -0.0257 -0.0614 0.1490  62  LYS A N   
410 C CA  . LYS A 56 ? 0.4061 0.5970 0.3692 -0.0147 -0.0584 0.1634  62  LYS A CA  
411 C C   . LYS A 56 ? 0.5582 0.7896 0.5117 -0.0195 -0.0704 0.1808  62  LYS A C   
412 O O   . LYS A 56 ? 0.5990 0.8357 0.5524 -0.0067 -0.0692 0.1986  62  LYS A O   
413 C CB  . LYS A 56 ? 0.4891 0.6670 0.4734 0.0088  -0.0503 0.1753  62  LYS A CB  
414 C CG  . LYS A 56 ? 0.4896 0.6238 0.4768 0.0120  -0.0390 0.1618  62  LYS A CG  
415 C CD  . LYS A 56 ? 0.6091 0.7219 0.6068 0.0323  -0.0323 0.1741  62  LYS A CD  
416 C CE  . LYS A 56 ? 0.5923 0.7290 0.6062 0.0495  -0.0347 0.1856  62  LYS A CE  
417 N NZ  . LYS A 56 ? 0.5904 0.6918 0.6082 0.0705  -0.0256 0.1904  62  LYS A NZ  
418 N N   . GLU A 57 ? 0.4668 0.7257 0.4099 -0.0395 -0.0828 0.1770  63  GLU A N   
419 C CA  . GLU A 57 ? 0.5307 0.8326 0.4664 -0.0471 -0.0956 0.1930  63  GLU A CA  
420 C C   . GLU A 57 ? 0.5749 0.8618 0.4733 -0.0597 -0.0970 0.1872  63  GLU A C   
421 O O   . GLU A 57 ? 0.5797 0.8274 0.4569 -0.0625 -0.0881 0.1718  63  GLU A O   
422 C CB  . GLU A 57 ? 0.5733 0.9083 0.5157 -0.0672 -0.1066 0.1891  63  GLU A CB  
423 C CG  . GLU A 57 ? 0.5913 0.9477 0.5708 -0.0538 -0.1030 0.1960  63  GLU A CG  
424 C CD  . GLU A 57 ? 0.6580 1.0454 0.6427 -0.0780 -0.1121 0.1924  63  GLU A CD  
425 O OE1 . GLU A 57 ? 0.7212 1.1191 0.6845 -0.1035 -0.1221 0.1888  63  GLU A OE1 
426 O OE2 . GLU A 57 ? 0.5346 0.9335 0.5427 -0.0726 -0.1085 0.1934  63  GLU A OE2 
427 N N   . SER A 58 ? 0.5888 0.9046 0.4835 -0.0651 -0.1045 0.1963  64  SER A N   
428 C CA  . SER A 58 ? 0.5509 0.8562 0.4120 -0.0729 -0.1051 0.1939  64  SER A CA  
429 C C   . SER A 58 ? 0.6213 0.8962 0.4388 -0.0955 -0.1067 0.1704  64  SER A C   
430 O O   . SER A 58 ? 0.7392 0.9873 0.5269 -0.0942 -0.0987 0.1636  64  SER A O   
431 C CB  . SER A 58 ? 0.4728 0.8188 0.3382 -0.0773 -0.1152 0.2080  64  SER A CB  
432 N N   . GLU A 59 ? 0.6561 0.9324 0.4677 -0.1155 -0.1154 0.1580  65  GLU A N   
433 C CA  . GLU A 59 ? 0.7109 0.9476 0.4755 -0.1362 -0.1162 0.1336  65  GLU A CA  
434 C C   . GLU A 59 ? 0.7012 0.8956 0.4558 -0.1281 -0.1037 0.1192  65  GLU A C   
435 O O   . GLU A 59 ? 0.7277 0.8791 0.4423 -0.1363 -0.0982 0.0976  65  GLU A O   
436 C CB  . GLU A 59 ? 0.7413 0.9876 0.5010 -0.1632 -0.1295 0.1261  65  GLU A CB  
437 N N   . HIS A 60 ? 0.6642 0.8619 0.4639 -0.1068 -0.0940 0.1264  66  HIS A N   
438 C CA  . HIS A 60 ? 0.5601 0.7168 0.3681 -0.0959 -0.0787 0.1096  66  HIS A CA  
439 C C   . HIS A 60 ? 0.5851 0.7188 0.3840 -0.0807 -0.0627 0.1069  66  HIS A C   
440 O O   . HIS A 60 ? 0.4764 0.6056 0.3047 -0.0638 -0.0521 0.1128  66  HIS A O   
441 C CB  . HIS A 60 ? 0.4754 0.6437 0.3305 -0.0823 -0.0759 0.1173  66  HIS A CB  
442 C CG  . HIS A 60 ? 0.5305 0.7290 0.3988 -0.0954 -0.0894 0.1222  66  HIS A CG  
443 N ND1 . HIS A 60 ? 0.5188 0.7437 0.4277 -0.0821 -0.0891 0.1356  66  HIS A ND1 
444 C CD2 . HIS A 60 ? 0.6004 0.8079 0.4448 -0.1222 -0.1033 0.1165  66  HIS A CD2 
445 C CE1 . HIS A 60 ? 0.4786 0.7351 0.3926 -0.0987 -0.1015 0.1394  66  HIS A CE1 
446 N NE2 . HIS A 60 ? 0.5194 0.7657 0.3949 -0.1257 -0.1114 0.1283  66  HIS A NE2 
447 N N   . THR A 61 ? 0.5863 0.7052 0.3413 -0.0884 -0.0610 0.0979  67  THR A N   
448 C CA  . THR A 61 ? 0.6174 0.7218 0.3611 -0.0751 -0.0450 0.0968  67  THR A CA  
449 C C   . THR A 61 ? 0.6634 0.7276 0.3730 -0.0741 -0.0337 0.0732  67  THR A C   
450 O O   . THR A 61 ? 0.6528 0.6939 0.3350 -0.0873 -0.0404 0.0574  67  THR A O   
451 C CB  . THR A 61 ? 0.6805 0.8050 0.3995 -0.0786 -0.0487 0.1098  67  THR A CB  
452 O OG1 . THR A 61 ? 0.7560 0.8720 0.4258 -0.0977 -0.0590 0.0978  67  THR A OG1 
453 C CG2 . THR A 61 ? 0.6691 0.8322 0.4198 -0.0757 -0.0595 0.1356  67  THR A CG2 
454 N N   . GLY A 62 ? 0.6250 0.6810 0.3353 -0.0581 -0.0162 0.0723  68  GLY A N   
455 C CA  . GLY A 62 ? 0.6878 0.7100 0.3659 -0.0501 -0.0022 0.0529  68  GLY A CA  
456 C C   . GLY A 62 ? 0.5993 0.6088 0.3079 -0.0372 0.0076  0.0466  68  GLY A C   
457 O O   . GLY A 62 ? 0.5666 0.5852 0.3144 -0.0394 0.0007  0.0520  68  GLY A O   
458 N N   . PRO A 63 ? 0.6141 0.6038 0.3031 -0.0220 0.0244  0.0356  69  PRO A N   
459 C CA  . PRO A 63 ? 0.5869 0.5698 0.3032 -0.0074 0.0349  0.0316  69  PRO A CA  
460 C C   . PRO A 63 ? 0.5439 0.5045 0.2699 -0.0147 0.0249  0.0217  69  PRO A C   
461 O O   . PRO A 63 ? 0.5476 0.5161 0.3122 -0.0084 0.0269  0.0253  69  PRO A O   
462 C CB  . PRO A 63 ? 0.6039 0.5661 0.2813 0.0109  0.0533  0.0200  69  PRO A CB  
463 C CG  . PRO A 63 ? 0.7201 0.6681 0.3429 0.0035  0.0514  0.0139  69  PRO A CG  
464 C CD  . PRO A 63 ? 0.6938 0.6724 0.3336 -0.0151 0.0357  0.0293  69  PRO A CD  
465 N N   . GLY A 64 ? 0.6391 0.5738 0.3297 -0.0304 0.0134  0.0104  70  GLY A N   
466 C CA  . GLY A 64 ? 0.5863 0.5036 0.2857 -0.0410 0.0032  0.0035  70  GLY A CA  
467 C C   . GLY A 64 ? 0.5564 0.5091 0.3070 -0.0485 -0.0079 0.0182  70  GLY A C   
468 O O   . GLY A 64 ? 0.5189 0.4704 0.2991 -0.0445 -0.0075 0.0180  70  GLY A O   
469 N N   . TRP A 65 ? 0.5434 0.5271 0.3020 -0.0575 -0.0173 0.0317  71  TRP A N   
470 C CA  . TRP A 65 ? 0.4870 0.5028 0.2906 -0.0589 -0.0254 0.0471  71  TRP A CA  
471 C C   . TRP A 65 ? 0.4747 0.5000 0.3156 -0.0421 -0.0148 0.0559  71  TRP A C   
472 O O   . TRP A 65 ? 0.3966 0.4292 0.2703 -0.0392 -0.0171 0.0610  71  TRP A O   
473 C CB  . TRP A 65 ? 0.4491 0.4965 0.2507 -0.0684 -0.0371 0.0619  71  TRP A CB  
474 C CG  . TRP A 65 ? 0.4994 0.5530 0.2834 -0.0902 -0.0534 0.0592  71  TRP A CG  
475 C CD1 . TRP A 65 ? 0.6073 0.6566 0.3476 -0.1082 -0.0628 0.0545  71  TRP A CD1 
476 C CD2 . TRP A 65 ? 0.5714 0.6385 0.3794 -0.0987 -0.0628 0.0619  71  TRP A CD2 
477 N NE1 . TRP A 65 ? 0.5978 0.6591 0.3349 -0.1305 -0.0789 0.0551  71  TRP A NE1 
478 C CE2 . TRP A 65 ? 0.6002 0.6751 0.3802 -0.1242 -0.0784 0.0604  71  TRP A CE2 
479 C CE3 . TRP A 65 ? 0.5062 0.5805 0.3544 -0.0884 -0.0593 0.0659  71  TRP A CE3 
480 C CZ2 . TRP A 65 ? 0.5712 0.6666 0.3666 -0.1401 -0.0903 0.0648  71  TRP A CZ2 
481 C CZ3 . TRP A 65 ? 0.5127 0.6050 0.3742 -0.1008 -0.0695 0.0691  71  TRP A CZ3 
482 C CH2 . TRP A 65 ? 0.5231 0.6286 0.3604 -0.1267 -0.0847 0.0695  71  TRP A CH2 
483 N N   . GLU A 66 ? 0.4331 0.4588 0.2665 -0.0326 -0.0032 0.0582  72  GLU A N   
484 C CA  . GLU A 66 ? 0.3638 0.3989 0.2294 -0.0220 0.0058  0.0672  72  GLU A CA  
485 C C   . GLU A 66 ? 0.4199 0.4398 0.3004 -0.0161 0.0103  0.0570  72  GLU A C   
486 O O   . GLU A 66 ? 0.4170 0.4416 0.3284 -0.0141 0.0095  0.0625  72  GLU A O   
487 C CB  . GLU A 66 ? 0.3961 0.4401 0.2496 -0.0153 0.0179  0.0726  72  GLU A CB  
488 C CG  . GLU A 66 ? 0.4132 0.4715 0.2479 -0.0211 0.0137  0.0833  72  GLU A CG  
489 C CD  . GLU A 66 ? 0.4900 0.5534 0.2990 -0.0150 0.0268  0.0837  72  GLU A CD  
490 O OE1 . GLU A 66 ? 0.4936 0.5549 0.3054 -0.0043 0.0401  0.0784  72  GLU A OE1 
491 O OE2 . GLU A 66 ? 0.4843 0.5573 0.2701 -0.0199 0.0241  0.0907  72  GLU A OE2 
492 N N   . SER A 67 ? 0.4260 0.4239 0.2799 -0.0131 0.0149  0.0420  73  SER A N   
493 C CA  . SER A 67 ? 0.4003 0.3823 0.2639 -0.0061 0.0190  0.0331  73  SER A CA  
494 C C   . SER A 67 ? 0.4354 0.4134 0.3167 -0.0154 0.0075  0.0319  73  SER A C   
495 O O   . SER A 67 ? 0.4016 0.3795 0.3076 -0.0110 0.0087  0.0321  73  SER A O   
496 C CB  . SER A 67 ? 0.4976 0.4487 0.3209 0.0010  0.0263  0.0178  73  SER A CB  
497 O OG  . SER A 67 ? 0.7248 0.6602 0.5565 0.0102  0.0305  0.0113  73  SER A OG  
498 N N   . ALA A 68 ? 0.4268 0.4059 0.2954 -0.0288 -0.0037 0.0319  74  ALA A N   
499 C CA  . ALA A 68 ? 0.3859 0.3694 0.2714 -0.0377 -0.0137 0.0330  74  ALA A CA  
500 C C   . ALA A 68 ? 0.4178 0.4238 0.3414 -0.0316 -0.0144 0.0462  74  ALA A C   
501 O O   . ALA A 68 ? 0.3648 0.3693 0.3086 -0.0294 -0.0152 0.0455  74  ALA A O   
502 C CB  . ALA A 68 ? 0.4385 0.4284 0.3035 -0.0553 -0.0261 0.0336  74  ALA A CB  
503 N N   . ARG A 69 ? 0.3672 0.3898 0.2964 -0.0284 -0.0137 0.0581  75  ARG A N   
504 C CA  . ARG A 69 ? 0.3157 0.3482 0.2728 -0.0215 -0.0135 0.0704  75  ARG A CA  
505 C C   . ARG A 69 ? 0.3517 0.3710 0.3239 -0.0154 -0.0060 0.0665  75  ARG A C   
506 O O   . ARG A 69 ? 0.3866 0.4018 0.3766 -0.0123 -0.0071 0.0683  75  ARG A O   
507 C CB  . ARG A 69 ? 0.3294 0.3746 0.2846 -0.0192 -0.0131 0.0850  75  ARG A CB  
508 C CG  . ARG A 69 ? 0.3621 0.4282 0.3094 -0.0239 -0.0229 0.0938  75  ARG A CG  
509 C CD  . ARG A 69 ? 0.3088 0.3866 0.2548 -0.0193 -0.0229 0.1111  75  ARG A CD  
510 N NE  . ARG A 69 ? 0.3472 0.4240 0.2708 -0.0232 -0.0179 0.1101  75  ARG A NE  
511 C CZ  . ARG A 69 ? 0.3957 0.4834 0.2932 -0.0310 -0.0230 0.1093  75  ARG A CZ  
512 N NH1 . ARG A 69 ? 0.4055 0.5090 0.2983 -0.0389 -0.0352 0.1105  75  ARG A NH1 
513 N NH2 . ARG A 69 ? 0.3999 0.4850 0.2744 -0.0320 -0.0162 0.1080  75  ARG A NH2 
514 N N   . GLN A 70 ? 0.3348 0.3495 0.2986 -0.0132 0.0018  0.0616  76  GLN A N   
515 C CA  . GLN A 70 ? 0.2835 0.2950 0.2639 -0.0091 0.0075  0.0609  76  GLN A CA  
516 C C   . GLN A 70 ? 0.3904 0.3895 0.3758 -0.0080 0.0055  0.0505  76  GLN A C   
517 O O   . GLN A 70 ? 0.3272 0.3235 0.3295 -0.0072 0.0054  0.0513  76  GLN A O   
518 C CB  . GLN A 70 ? 0.4038 0.4236 0.3766 -0.0046 0.0173  0.0612  76  GLN A CB  
519 C CG  . GLN A 70 ? 0.4794 0.5140 0.4488 -0.0071 0.0203  0.0741  76  GLN A CG  
520 C CD  . GLN A 70 ? 0.7683 0.8207 0.7403 -0.0034 0.0311  0.0794  76  GLN A CD  
521 O OE1 . GLN A 70 ? 0.9712 1.0273 0.9474 0.0039  0.0370  0.0736  76  GLN A OE1 
522 N NE2 . GLN A 70 ? 0.8243 0.8913 0.7946 -0.0076 0.0343  0.0927  76  GLN A NE2 
523 N N   . MET A 71 ? 0.3314 0.3206 0.2989 -0.0099 0.0031  0.0411  77  MET A N   
524 C CA  . MET A 71 ? 0.3191 0.2954 0.2891 -0.0109 0.0004  0.0331  77  MET A CA  
525 C C   . MET A 71 ? 0.3251 0.3083 0.3139 -0.0137 -0.0056 0.0382  77  MET A C   
526 O O   . MET A 71 ? 0.3798 0.3572 0.3801 -0.0116 -0.0054 0.0357  77  MET A O   
527 C CB  . MET A 71 ? 0.3752 0.3346 0.3172 -0.0170 -0.0025 0.0236  77  MET A CB  
528 C CG  . MET A 71 ? 0.3544 0.2948 0.2720 -0.0087 0.0059  0.0155  77  MET A CG  
529 S SD  . MET A 71 ? 0.4801 0.3835 0.3553 -0.0185 0.0015  0.0025  77  MET A SD  
530 C CE  . MET A 71 ? 0.7587 0.6352 0.6046 0.0012  0.0158  -0.0059 77  MET A CE  
531 N N   . GLN A 72 ? 0.3277 0.3245 0.3179 -0.0165 -0.0102 0.0463  78  GLN A N   
532 C CA  . GLN A 72 ? 0.3194 0.3248 0.3255 -0.0141 -0.0137 0.0526  78  GLN A CA  
533 C C   . GLN A 72 ? 0.3537 0.3503 0.3730 -0.0064 -0.0096 0.0572  78  GLN A C   
534 O O   . GLN A 72 ? 0.3488 0.3400 0.3767 -0.0020 -0.0095 0.0569  78  GLN A O   
535 C CB  . GLN A 72 ? 0.3023 0.3295 0.3074 -0.0158 -0.0193 0.0629  78  GLN A CB  
536 C CG  . GLN A 72 ? 0.3205 0.3578 0.3114 -0.0290 -0.0264 0.0592  78  GLN A CG  
537 C CD  . GLN A 72 ? 0.3261 0.3924 0.3160 -0.0325 -0.0336 0.0716  78  GLN A CD  
538 O OE1 . GLN A 72 ? 0.3892 0.4594 0.3749 -0.0282 -0.0326 0.0787  78  GLN A OE1 
539 N NE2 . GLN A 72 ? 0.3079 0.3989 0.3026 -0.0410 -0.0412 0.0764  78  GLN A NE2 
540 N N   . GLN A 73 ? 0.3139 0.3076 0.3314 -0.0064 -0.0062 0.0616  79  GLN A N   
541 C CA  . GLN A 73 ? 0.3104 0.2910 0.3353 -0.0052 -0.0038 0.0659  79  GLN A CA  
542 C C   . GLN A 73 ? 0.3686 0.3399 0.3990 -0.0067 -0.0031 0.0569  79  GLN A C   
543 O O   . GLN A 73 ? 0.3525 0.3095 0.3859 -0.0053 -0.0039 0.0564  79  GLN A O   
544 C CB  . GLN A 73 ? 0.3507 0.3350 0.3731 -0.0096 -0.0004 0.0728  79  GLN A CB  
545 C CG  . GLN A 73 ? 0.3781 0.3472 0.4051 -0.0147 0.0002  0.0780  79  GLN A CG  
546 C CD  . GLN A 73 ? 0.4981 0.4735 0.5231 -0.0222 0.0030  0.0892  79  GLN A CD  
547 O OE1 . GLN A 73 ? 0.5654 0.5567 0.5847 -0.0208 0.0054  0.0938  79  GLN A OE1 
548 N NE2 . GLN A 73 ? 0.4334 0.3960 0.4604 -0.0324 0.0022  0.0942  79  GLN A NE2 
549 N N   . LYS A 74 ? 0.3394 0.3168 0.3676 -0.0081 -0.0013 0.0501  80  LYS A N   
550 C CA  . LYS A 74 ? 0.3657 0.3384 0.3990 -0.0082 -0.0010 0.0436  80  LYS A CA  
551 C C   . LYS A 74 ? 0.3613 0.3253 0.3949 -0.0066 -0.0040 0.0382  80  LYS A C   
552 O O   . LYS A 74 ? 0.3728 0.3285 0.4104 -0.0071 -0.0051 0.0357  80  LYS A O   
553 C CB  . LYS A 74 ? 0.3740 0.3529 0.4013 -0.0047 0.0029  0.0388  80  LYS A CB  
554 C CG  . LYS A 74 ? 0.4535 0.4477 0.4819 -0.0035 0.0084  0.0450  80  LYS A CG  
555 C CD  . LYS A 74 ? 0.5709 0.5752 0.6147 -0.0094 0.0077  0.0521  80  LYS A CD  
556 C CE  . LYS A 74 ? 0.6537 0.6834 0.7020 -0.0084 0.0142  0.0603  80  LYS A CE  
557 N NZ  . LYS A 74 ? 0.7226 0.7658 0.7855 -0.0210 0.0115  0.0704  80  LYS A NZ  
558 N N   . MET A 75 ? 0.3149 0.2833 0.3429 -0.0064 -0.0058 0.0371  81  MET A N   
559 C CA  . MET A 75 ? 0.2844 0.2521 0.3139 -0.0063 -0.0080 0.0342  81  MET A CA  
560 C C   . MET A 75 ? 0.3378 0.3032 0.3740 -0.0002 -0.0073 0.0389  81  MET A C   
561 O O   . MET A 75 ? 0.3596 0.3195 0.3970 0.0022  -0.0066 0.0356  81  MET A O   
562 C CB  . MET A 75 ? 0.3105 0.2887 0.3323 -0.0120 -0.0113 0.0344  81  MET A CB  
563 C CG  . MET A 75 ? 0.3240 0.2898 0.3297 -0.0174 -0.0114 0.0265  81  MET A CG  
564 S SD  . MET A 75 ? 0.3988 0.3665 0.3879 -0.0316 -0.0178 0.0249  81  MET A SD  
565 C CE  . MET A 75 ? 0.3536 0.3341 0.3336 -0.0351 -0.0205 0.0297  81  MET A CE  
566 N N   . LYS A 76 ? 0.3128 0.2788 0.3497 0.0041  -0.0066 0.0469  82  LYS A N   
567 C CA  . LYS A 76 ? 0.3114 0.2665 0.3482 0.0140  -0.0042 0.0514  82  LYS A CA  
568 C C   . LYS A 76 ? 0.3611 0.2894 0.3922 0.0119  -0.0031 0.0459  82  LYS A C   
569 O O   . LYS A 76 ? 0.4017 0.3157 0.4272 0.0188  -0.0009 0.0433  82  LYS A O   
570 C CB  . LYS A 76 ? 0.3665 0.3218 0.4012 0.0204  -0.0036 0.0627  82  LYS A CB  
571 C CG  . LYS A 76 ? 0.4185 0.4042 0.4587 0.0246  -0.0058 0.0706  82  LYS A CG  
572 C CD  . LYS A 76 ? 0.5272 0.5140 0.5648 0.0335  -0.0053 0.0840  82  LYS A CD  
573 C CE  . LYS A 76 ? 0.4621 0.4453 0.4940 0.0233  -0.0070 0.0857  82  LYS A CE  
574 N NZ  . LYS A 76 ? 0.4170 0.4003 0.4445 0.0318  -0.0068 0.1007  82  LYS A NZ  
575 N N   . GLU A 77 ? 0.3632 0.2873 0.3943 0.0019  -0.0047 0.0448  83  GLU A N   
576 C CA  . GLU A 77 ? 0.3673 0.2718 0.3932 -0.0053 -0.0062 0.0413  83  GLU A CA  
577 C C   . GLU A 77 ? 0.3886 0.2945 0.4151 -0.0057 -0.0073 0.0327  83  GLU A C   
578 O O   . GLU A 77 ? 0.4219 0.3079 0.4384 -0.0062 -0.0080 0.0284  83  GLU A O   
579 C CB  . GLU A 77 ? 0.4666 0.3804 0.4973 -0.0169 -0.0078 0.0452  83  GLU A CB  
580 C CG  . GLU A 77 ? 0.5891 0.4925 0.6168 -0.0294 -0.0117 0.0439  83  GLU A CG  
581 C CD  . GLU A 77 ? 0.8265 0.7448 0.8605 -0.0420 -0.0128 0.0526  83  GLU A CD  
582 O OE1 . GLU A 77 ? 0.9375 0.8647 0.9737 -0.0397 -0.0095 0.0596  83  GLU A OE1 
583 O OE2 . GLU A 77 ? 0.8726 0.7979 0.9097 -0.0550 -0.0171 0.0539  83  GLU A OE2 
584 N N   . THR A 78 ? 0.4366 0.3619 0.4703 -0.0056 -0.0075 0.0301  84  THR A N   
585 C CA  . THR A 78 ? 0.3432 0.2691 0.3761 -0.0059 -0.0086 0.0239  84  THR A CA  
586 C C   . THR A 78 ? 0.3697 0.2917 0.3983 0.0008  -0.0064 0.0220  84  THR A C   
587 O O   . THR A 78 ? 0.4234 0.3367 0.4460 0.0010  -0.0066 0.0175  84  THR A O   
588 C CB  . THR A 78 ? 0.3174 0.2564 0.3532 -0.0063 -0.0085 0.0224  84  THR A CB  
589 O OG1 . THR A 78 ? 0.3857 0.3320 0.4259 -0.0088 -0.0087 0.0247  84  THR A OG1 
590 C CG2 . THR A 78 ? 0.3587 0.2950 0.3909 -0.0056 -0.0093 0.0179  84  THR A CG2 
591 N N   . LEU A 79 ? 0.3418 0.2741 0.3733 0.0066  -0.0042 0.0267  85  LEU A N   
592 C CA  . LEU A 79 ? 0.3759 0.3145 0.4067 0.0150  -0.0008 0.0281  85  LEU A CA  
593 C C   . LEU A 79 ? 0.3546 0.2685 0.3732 0.0236  0.0030  0.0257  85  LEU A C   
594 O O   . LEU A 79 ? 0.3762 0.2875 0.3885 0.0287  0.0062  0.0224  85  LEU A O   
595 C CB  . LEU A 79 ? 0.4018 0.3631 0.4400 0.0204  0.0001  0.0370  85  LEU A CB  
596 C CG  . LEU A 79 ? 0.3673 0.3456 0.4087 0.0327  0.0052  0.0428  85  LEU A CG  
597 C CD1 . LEU A 79 ? 0.4074 0.4008 0.4511 0.0264  0.0053  0.0404  85  LEU A CD1 
598 C CD2 . LEU A 79 ? 0.3628 0.3704 0.4140 0.0379  0.0045  0.0548  85  LEU A CD2 
599 N N   . GLN A 80 ? 0.4220 0.3139 0.4330 0.0241  0.0027  0.0274  86  GLN A N   
600 C CA  . GLN A 80 ? 0.4363 0.2918 0.4265 0.0292  0.0054  0.0235  86  GLN A CA  
601 C C   . GLN A 80 ? 0.4464 0.2896 0.4271 0.0185  0.0016  0.0143  86  GLN A C   
602 O O   . GLN A 80 ? 0.4740 0.3001 0.4381 0.0252  0.0052  0.0089  86  GLN A O   
603 C CB  . GLN A 80 ? 0.5550 0.3836 0.5351 0.0251  0.0037  0.0275  86  GLN A CB  
604 C CG  . GLN A 80 ? 0.6130 0.4501 0.5987 0.0369  0.0071  0.0383  86  GLN A CG  
605 C CD  . GLN A 80 ? 0.6795 0.4908 0.6553 0.0291  0.0046  0.0437  86  GLN A CD  
606 O OE1 . GLN A 80 ? 0.7634 0.5432 0.7232 0.0157  0.0013  0.0394  86  GLN A OE1 
607 N NE2 . GLN A 80 ? 0.6710 0.4970 0.6549 0.0347  0.0054  0.0544  86  GLN A NE2 
608 N N   . ASN A 81 ? 0.4299 0.2845 0.4202 0.0035  -0.0051 0.0137  87  ASN A N   
609 C CA  . ASN A 81 ? 0.4188 0.2686 0.4023 -0.0070 -0.0103 0.0077  87  ASN A CA  
610 C C   . ASN A 81 ? 0.3853 0.2472 0.3693 -0.0014 -0.0082 0.0041  87  ASN A C   
611 O O   . ASN A 81 ? 0.3788 0.2261 0.3466 -0.0032 -0.0092 -0.0016 87  ASN A O   
612 C CB  . ASN A 81 ? 0.4378 0.3074 0.4357 -0.0198 -0.0166 0.0112  87  ASN A CB  
613 C CG  . ASN A 81 ? 0.5309 0.3911 0.5271 -0.0301 -0.0194 0.0163  87  ASN A CG  
614 O OD1 . ASN A 81 ? 0.5131 0.3404 0.4899 -0.0327 -0.0195 0.0150  87  ASN A OD1 
615 N ND2 . ASN A 81 ? 0.4622 0.3485 0.4755 -0.0354 -0.0209 0.0226  87  ASN A ND2 
616 N N   . VAL A 82 ? 0.3267 0.2134 0.3259 0.0032  -0.0058 0.0076  88  VAL A N   
617 C CA  . VAL A 82 ? 0.3386 0.2369 0.3376 0.0055  -0.0039 0.0064  88  VAL A CA  
618 C C   . VAL A 82 ? 0.3345 0.2266 0.3220 0.0169  0.0034  0.0053  88  VAL A C   
619 O O   . VAL A 82 ? 0.3707 0.2596 0.3472 0.0179  0.0050  0.0019  88  VAL A O   
620 C CB  . VAL A 82 ? 0.3510 0.2716 0.3634 0.0039  -0.0038 0.0110  88  VAL A CB  
621 C CG1 . VAL A 82 ? 0.3583 0.2879 0.3678 0.0029  -0.0021 0.0116  88  VAL A CG1 
622 C CG2 . VAL A 82 ? 0.3574 0.2799 0.3755 -0.0026 -0.0084 0.0112  88  VAL A CG2 
623 N N   . ARG A 83 ? 0.3629 0.2544 0.3514 0.0279  0.0087  0.0092  89  ARG A N   
624 C CA  . ARG A 83 ? 0.3941 0.2833 0.3718 0.0445  0.0182  0.0100  89  ARG A CA  
625 C C   . ARG A 83 ? 0.4180 0.2675 0.3660 0.0474  0.0200  0.0007  89  ARG A C   
626 O O   . ARG A 83 ? 0.4015 0.2481 0.3350 0.0571  0.0270  -0.0022 89  ARG A O   
627 C CB  . ARG A 83 ? 0.4412 0.3386 0.4256 0.0591  0.0236  0.0184  89  ARG A CB  
628 C CG  . ARG A 83 ? 0.3909 0.3352 0.3996 0.0580  0.0235  0.0286  89  ARG A CG  
629 C CD  . ARG A 83 ? 0.5403 0.5021 0.5572 0.0740  0.0283  0.0397  89  ARG A CD  
630 N NE  . ARG A 83 ? 0.6642 0.6769 0.7000 0.0754  0.0302  0.0507  89  ARG A NE  
631 C CZ  . ARG A 83 ? 0.6227 0.6692 0.6737 0.0822  0.0303  0.0638  89  ARG A CZ  
632 N NH1 . ARG A 83 ? 0.6556 0.6870 0.7040 0.0907  0.0295  0.0672  89  ARG A NH1 
633 N NH2 . ARG A 83 ? 0.5237 0.6216 0.5920 0.0788  0.0305  0.0749  89  ARG A NH2 
634 N N   . THR A 84 ? 0.4177 0.2372 0.3545 0.0368  0.0133  -0.0037 90  THR A N   
635 C CA  . THR A 84 ? 0.4352 0.2124 0.3386 0.0328  0.0119  -0.0132 90  THR A CA  
636 C C   . THR A 84 ? 0.4630 0.2492 0.3616 0.0225  0.0071  -0.0184 90  THR A C   
637 O O   . THR A 84 ? 0.5093 0.2767 0.3817 0.0286  0.0116  -0.0250 90  THR A O   
638 C CB  . THR A 84 ? 0.5271 0.2767 0.4218 0.0165  0.0031  -0.0143 90  THR A CB  
639 O OG1 . THR A 84 ? 0.5559 0.2875 0.4468 0.0279  0.0085  -0.0093 90  THR A OG1 
640 C CG2 . THR A 84 ? 0.5833 0.2903 0.4408 0.0044  -0.0020 -0.0244 90  THR A CG2 
641 N N   . ARG A 85 ? 0.4031 0.2168 0.3243 0.0088  -0.0014 -0.0147 91  ARG A N   
642 C CA  . ARG A 85 ? 0.3924 0.2155 0.3096 0.0000  -0.0069 -0.0170 91  ARG A CA  
643 C C   . ARG A 85 ? 0.4096 0.2473 0.3250 0.0113  0.0015  -0.0161 91  ARG A C   
644 O O   . ARG A 85 ? 0.4160 0.2465 0.3121 0.0100  0.0014  -0.0203 91  ARG A O   
645 C CB  . ARG A 85 ? 0.3652 0.2152 0.3072 -0.0108 -0.0152 -0.0110 91  ARG A CB  
646 C CG  . ARG A 85 ? 0.4185 0.2789 0.3567 -0.0176 -0.0215 -0.0107 91  ARG A CG  
647 C CD  . ARG A 85 ? 0.4361 0.2757 0.3489 -0.0292 -0.0292 -0.0166 91  ARG A CD  
648 N NE  . ARG A 85 ? 0.4549 0.3096 0.3649 -0.0356 -0.0366 -0.0141 91  ARG A NE  
649 C CZ  . ARG A 85 ? 0.5460 0.3900 0.4333 -0.0482 -0.0456 -0.0179 91  ARG A CZ  
650 N NH1 . ARG A 85 ? 0.6418 0.4533 0.5035 -0.0574 -0.0480 -0.0258 91  ARG A NH1 
651 N NH2 . ARG A 85 ? 0.4622 0.3251 0.3489 -0.0524 -0.0527 -0.0132 91  ARG A NH2 
652 N N   . LEU A 86 ? 0.3921 0.2531 0.3266 0.0206  0.0083  -0.0094 92  LEU A N   
653 C CA  . LEU A 86 ? 0.3663 0.2487 0.3023 0.0283  0.0162  -0.0054 92  LEU A CA  
654 C C   . LEU A 86 ? 0.3817 0.2473 0.2914 0.0436  0.0267  -0.0102 92  LEU A C   
655 O O   . LEU A 86 ? 0.4882 0.3595 0.3855 0.0455  0.0309  -0.0110 92  LEU A O   
656 C CB  . LEU A 86 ? 0.3680 0.2817 0.3289 0.0318  0.0199  0.0042  92  LEU A CB  
657 C CG  . LEU A 86 ? 0.3565 0.3005 0.3223 0.0345  0.0269  0.0115  92  LEU A CG  
658 C CD1 . LEU A 86 ? 0.3466 0.2912 0.3074 0.0214  0.0217  0.0115  92  LEU A CD1 
659 C CD2 . LEU A 86 ? 0.3490 0.3266 0.3385 0.0324  0.0275  0.0220  92  LEU A CD2 
660 N N   . GLU A 87 ? 0.4507 0.2922 0.3482 0.0559  0.0319  -0.0132 93  GLU A N   
661 C CA  . GLU A 87 ? 0.4708 0.2894 0.3377 0.0755  0.0444  -0.0183 93  GLU A CA  
662 C C   . GLU A 87 ? 0.5343 0.3154 0.3647 0.0659  0.0395  -0.0306 93  GLU A C   
663 O O   . GLU A 87 ? 0.5464 0.3197 0.3511 0.0765  0.0483  -0.0350 93  GLU A O   
664 C CB  . GLU A 87 ? 0.4880 0.2801 0.3449 0.0926  0.0510  -0.0181 93  GLU A CB  
665 C CG  . GLU A 87 ? 0.5369 0.3002 0.3572 0.1190  0.0666  -0.0230 93  GLU A CG  
666 C CD  . GLU A 87 ? 0.7813 0.5176 0.5904 0.1416  0.0752  -0.0202 93  GLU A CD  
667 O OE1 . GLU A 87 ? 0.7603 0.5077 0.5942 0.1360  0.0689  -0.0126 93  GLU A OE1 
668 O OE2 . GLU A 87 ? 0.9662 0.6674 0.7381 0.1667  0.0891  -0.0252 93  GLU A OE2 
669 N N   . ILE A 88 ? 0.4964 0.2596 0.3250 0.0446  0.0250  -0.0348 94  ILE A N   
670 C CA  . ILE A 88 ? 0.5111 0.2449 0.3072 0.0299  0.0165  -0.0447 94  ILE A CA  
671 C C   . ILE A 88 ? 0.5703 0.3320 0.3692 0.0255  0.0151  -0.0425 94  ILE A C   
672 O O   . ILE A 88 ? 0.5655 0.3075 0.3296 0.0270  0.0176  -0.0500 94  ILE A O   
673 C CB  . ILE A 88 ? 0.5506 0.2753 0.3531 0.0058  0.0002  -0.0451 94  ILE A CB  
674 C CG1 . ILE A 88 ? 0.4998 0.1784 0.2799 0.0060  0.0009  -0.0499 94  ILE A CG1 
675 C CG2 . ILE A 88 ? 0.5762 0.2952 0.3590 -0.0140 -0.0124 -0.0499 94  ILE A CG2 
676 C CD1 . ILE A 88 ? 0.6221 0.2406 0.3452 0.0014  0.0002  -0.0634 94  ILE A CD1 
677 N N   . LEU A 89 ? 0.5414 0.3444 0.3770 0.0205  0.0117  -0.0321 95  LEU A N   
678 C CA  . LEU A 89 ? 0.4609 0.2873 0.2988 0.0162  0.0104  -0.0276 95  LEU A CA  
679 C C   . LEU A 89 ? 0.4773 0.3156 0.3052 0.0323  0.0256  -0.0255 95  LEU A C   
680 O O   . LEU A 89 ? 0.5517 0.3927 0.3611 0.0308  0.0270  -0.0260 95  LEU A O   
681 C CB  . LEU A 89 ? 0.4506 0.3085 0.3241 0.0083  0.0043  -0.0170 95  LEU A CB  
682 C CG  . LEU A 89 ? 0.4244 0.2809 0.3088 -0.0054 -0.0096 -0.0163 95  LEU A CG  
683 C CD1 . LEU A 89 ? 0.4190 0.2996 0.3323 -0.0071 -0.0117 -0.0068 95  LEU A CD1 
684 C CD2 . LEU A 89 ? 0.4519 0.3014 0.3155 -0.0160 -0.0195 -0.0188 95  LEU A CD2 
685 N N   . GLU A 90 ? 0.4678 0.3192 0.3095 0.0476  0.0370  -0.0210 96  GLU A N   
686 C CA  . GLU A 90 ? 0.5110 0.3865 0.3497 0.0639  0.0526  -0.0153 96  GLU A CA  
687 C C   . GLU A 90 ? 0.6047 0.4470 0.3985 0.0787  0.0624  -0.0262 96  GLU A C   
688 O O   . GLU A 90 ? 0.6177 0.4746 0.3971 0.0865  0.0724  -0.0240 96  GLU A O   
689 C CB  . GLU A 90 ? 0.5154 0.4189 0.3811 0.0775  0.0613  -0.0058 96  GLU A CB  
690 C CG  . GLU A 90 ? 0.5580 0.5006 0.4615 0.0622  0.0543  0.0064  96  GLU A CG  
691 C CD  . GLU A 90 ? 0.6601 0.6327 0.5895 0.0715  0.0596  0.0162  96  GLU A CD  
692 O OE1 . GLU A 90 ? 0.7174 0.6772 0.6387 0.0913  0.0675  0.0140  96  GLU A OE1 
693 O OE2 . GLU A 90 ? 0.6606 0.6672 0.6157 0.0584  0.0552  0.0268  96  GLU A OE2 
694 N N   . LYS A 91 ? 0.5189 0.3130 0.2864 0.0808  0.0595  -0.0380 97  LYS A N   
695 C CA  . LYS A 91 ? 0.5665 0.3147 0.2813 0.0944  0.0685  -0.0510 97  LYS A CA  
696 C C   . LYS A 91 ? 0.6501 0.3691 0.3311 0.0732  0.0554  -0.0617 97  LYS A C   
697 O O   . LYS A 91 ? 0.7199 0.3920 0.3485 0.0785  0.0596  -0.0750 97  LYS A O   
698 C CB  . LYS A 91 ? 0.6765 0.3790 0.3722 0.1080  0.0731  -0.0577 97  LYS A CB  
699 C CG  . LYS A 91 ? 0.7371 0.4722 0.4619 0.1339  0.0877  -0.0455 97  LYS A CG  
700 C CD  . LYS A 91 ? 0.8373 0.5233 0.5360 0.1547  0.0958  -0.0505 97  LYS A CD  
701 C CE  . LYS A 91 ? 0.9105 0.6329 0.6274 0.1898  0.1153  -0.0374 97  LYS A CE  
702 N N   . GLY A 92 ? 0.6155 0.3617 0.3236 0.0501  0.0397  -0.0553 98  GLY A N   
703 C CA  . GLY A 92 ? 0.6410 0.3759 0.3255 0.0302  0.0260  -0.0604 98  GLY A CA  
704 C C   . GLY A 92 ? 0.7344 0.4202 0.3850 0.0146  0.0136  -0.0731 98  GLY A C   
705 O O   . GLY A 92 ? 0.8157 0.4731 0.4219 0.0048  0.0080  -0.0829 98  GLY A O   
706 N N   . LEU A 93 ? 0.6360 0.3115 0.3049 0.0097  0.0086  -0.0723 99  LEU A N   
707 C CA  . LEU A 93 ? 0.6380 0.2641 0.2740 -0.0073 -0.0025 -0.0827 99  LEU A CA  
708 C C   . LEU A 93 ? 0.7352 0.3859 0.4021 -0.0347 -0.0226 -0.0752 99  LEU A C   
709 O O   . LEU A 93 ? 0.7552 0.3773 0.4089 -0.0522 -0.0327 -0.0791 99  LEU A O   
710 C CB  . LEU A 93 ? 0.6653 0.2519 0.2887 0.0096  0.0091  -0.0872 99  LEU A CB  
711 C CG  . LEU A 93 ? 0.7719 0.3322 0.3625 0.0426  0.0314  -0.0935 99  LEU A CG  
712 C CD1 . LEU A 93 ? 0.7822 0.3175 0.3745 0.0602  0.0408  -0.0912 99  LEU A CD1 
713 C CD2 . LEU A 93 ? 0.8549 0.3771 0.3916 0.0385  0.0312  -0.1049 99  LEU A CD2 
714 N N   . ALA A 94 ? 0.7092 0.4126 0.4155 -0.0379 -0.0278 -0.0633 100 ALA A N   
715 C CA  . ALA A 94 ? 0.6977 0.4313 0.4358 -0.0575 -0.0441 -0.0540 100 ALA A CA  
716 C C   . ALA A 94 ? 0.8485 0.5731 0.5591 -0.0838 -0.0622 -0.0572 100 ALA A C   
717 O O   . ALA A 94 ? 0.9383 0.6644 0.6252 -0.0869 -0.0656 -0.0594 100 ALA A O   
718 C CB  . ALA A 94 ? 0.6485 0.4318 0.4277 -0.0501 -0.0432 -0.0408 100 ALA A CB  
719 N N   . THR A 95 ? 0.8829 0.6020 0.5970 -0.1045 -0.0745 -0.0558 101 THR A N   
720 C CA  . THR A 95 ? 1.0960 0.8128 0.7861 -0.1349 -0.0943 -0.0565 101 THR A CA  
721 C C   . THR A 95 ? 1.0833 0.8616 0.8060 -0.1400 -0.1056 -0.0415 101 THR A C   
722 O O   . THR A 95 ? 1.1083 0.8978 0.8132 -0.1617 -0.1221 -0.0393 101 THR A O   
723 C CB  . THR A 95 ? 1.0887 0.7904 0.7776 -0.1595 -0.1051 -0.0555 101 THR A CB  
724 O OG1 . THR A 95 ? 1.0708 0.8318 0.8140 -0.1640 -0.1117 -0.0385 101 THR A OG1 
725 C CG2 . THR A 95 ? 1.1240 0.7782 0.8010 -0.1442 -0.0895 -0.0631 101 THR A CG2 
726 O OXT . THR A 95 ? 1.0362 0.8524 0.8008 -0.1221 -0.0988 -0.0307 101 THR A OXT 
727 N N   . ASP B 7  ? 1.4085 1.2841 1.2746 0.1722  0.0849  0.0159  318 ASP B N   
728 C CA  . ASP B 7  ? 1.3364 1.2822 1.2554 0.1659  0.0811  0.0309  318 ASP B CA  
729 C C   . ASP B 7  ? 1.1899 1.1430 1.1355 0.1361  0.0638  0.0308  318 ASP B C   
730 O O   . ASP B 7  ? 1.2728 1.2579 1.2481 0.1344  0.0583  0.0404  318 ASP B O   
731 C CB  . ASP B 7  ? 1.4037 1.3861 1.3402 0.1950  0.0901  0.0453  318 ASP B CB  
732 C CG  . ASP B 7  ? 1.4806 1.4227 1.3971 0.2103  0.0894  0.0430  318 ASP B CG  
733 O OD1 . ASP B 7  ? 1.5417 1.4782 1.4414 0.2451  0.1029  0.0484  318 ASP B OD1 
734 O OD2 . ASP B 7  ? 1.4635 1.3802 1.3802 0.1887  0.0760  0.0372  318 ASP B OD2 
735 N N   . ILE B 8  ? 0.9471 0.8718 0.8798 0.1134  0.0556  0.0206  319 ILE B N   
736 C CA  . ILE B 8  ? 0.7003 0.6318 0.6551 0.0884  0.0417  0.0204  319 ILE B CA  
737 C C   . ILE B 8  ? 0.5896 0.5668 0.5781 0.0763  0.0385  0.0295  319 ILE B C   
738 O O   . ILE B 8  ? 0.5707 0.5597 0.5579 0.0740  0.0426  0.0312  319 ILE B O   
739 C CB  . ILE B 8  ? 0.6094 0.5038 0.5414 0.0702  0.0349  0.0095  319 ILE B CB  
740 C CG1 . ILE B 8  ? 0.6809 0.5303 0.5852 0.0717  0.0330  0.0026  319 ILE B CG1 
741 C CG2 . ILE B 8  ? 0.6700 0.5837 0.6275 0.0487  0.0244  0.0119  319 ILE B CG2 
742 C CD1 . ILE B 8  ? 0.6498 0.4681 0.5309 0.0506  0.0255  -0.0060 319 ILE B CD1 
743 N N   . ASP B 9  ? 0.4622 0.4610 0.4768 0.0671  0.0307  0.0356  320 ASP B N   
744 C CA  . ASP B 9  ? 0.4271 0.4614 0.4681 0.0533  0.0267  0.0446  320 ASP B CA  
745 C C   . ASP B 9  ? 0.4124 0.4363 0.4618 0.0342  0.0153  0.0417  320 ASP B C   
746 O O   . ASP B 9  ? 0.3961 0.4272 0.4554 0.0312  0.0096  0.0441  320 ASP B O   
747 C CB  . ASP B 9  ? 0.5111 0.5902 0.5739 0.0616  0.0297  0.0580  320 ASP B CB  
748 C CG  . ASP B 9  ? 0.6313 0.7463 0.7167 0.0437  0.0261  0.0688  320 ASP B CG  
749 O OD1 . ASP B 9  ? 0.5595 0.6579 0.6422 0.0267  0.0211  0.0653  320 ASP B OD1 
750 O OD2 . ASP B 9  ? 0.7334 0.8940 0.8387 0.0463  0.0280  0.0824  320 ASP B OD2 
751 N N   . PHE B 10 ? 0.4032 0.4112 0.4469 0.0230  0.0124  0.0374  321 PHE B N   
752 C CA  . PHE B 10 ? 0.3473 0.3435 0.3956 0.0098  0.0042  0.0349  321 PHE B CA  
753 C C   . PHE B 10 ? 0.3754 0.3884 0.4392 -0.0018 -0.0008 0.0421  321 PHE B C   
754 O O   . PHE B 10 ? 0.3671 0.3691 0.4311 -0.0096 -0.0071 0.0394  321 PHE B O   
755 C CB  . PHE B 10 ? 0.3186 0.3002 0.3587 0.0042  0.0032  0.0317  321 PHE B CB  
756 C CG  . PHE B 10 ? 0.3461 0.3076 0.3713 0.0060  0.0023  0.0240  321 PHE B CG  
757 C CD1 . PHE B 10 ? 0.4109 0.3633 0.4371 0.0003  -0.0023 0.0216  321 PHE B CD1 
758 C CD2 . PHE B 10 ? 0.4023 0.3530 0.4096 0.0126  0.0065  0.0197  321 PHE B CD2 
759 C CE1 . PHE B 10 ? 0.4072 0.3478 0.4217 -0.0019 -0.0038 0.0171  321 PHE B CE1 
760 C CE2 . PHE B 10 ? 0.3854 0.3151 0.3757 0.0085  0.0039  0.0135  321 PHE B CE2 
761 C CZ  . PHE B 10 ? 0.3669 0.2953 0.3633 -0.0002 -0.0017 0.0132  321 PHE B CZ  
762 N N   . ASP B 11 ? 0.4189 0.4577 0.4928 -0.0045 0.0020  0.0514  322 ASP B N   
763 C CA  . ASP B 11 ? 0.4533 0.5078 0.5392 -0.0211 -0.0042 0.0598  322 ASP B CA  
764 C C   . ASP B 11 ? 0.4788 0.5454 0.5715 -0.0231 -0.0103 0.0609  322 ASP B C   
765 O O   . ASP B 11 ? 0.4571 0.5179 0.5494 -0.0399 -0.0191 0.0616  322 ASP B O   
766 C CB  . ASP B 11 ? 0.5387 0.6278 0.6362 -0.0246 0.0005  0.0725  322 ASP B CB  
767 C CG  . ASP B 11 ? 0.6518 0.7283 0.7412 -0.0281 0.0040  0.0738  322 ASP B CG  
768 O OD1 . ASP B 11 ? 0.5571 0.6003 0.6355 -0.0330 0.0001  0.0677  322 ASP B OD1 
769 O OD2 . ASP B 11 ? 0.6976 0.7995 0.7912 -0.0244 0.0114  0.0821  322 ASP B OD2 
770 N N   . ASP B 12 ? 0.3949 0.4743 0.4896 -0.0057 -0.0058 0.0610  323 ASP B N   
771 C CA  . ASP B 12 ? 0.5038 0.5988 0.6052 -0.0045 -0.0115 0.0643  323 ASP B CA  
772 C C   . ASP B 12 ? 0.5004 0.5613 0.5885 -0.0109 -0.0184 0.0540  323 ASP B C   
773 O O   . ASP B 12 ? 0.4437 0.5117 0.5337 -0.0207 -0.0269 0.0560  323 ASP B O   
774 C CB  . ASP B 12 ? 0.6094 0.7189 0.7114 0.0206  -0.0034 0.0677  323 ASP B CB  
775 C CG  . ASP B 12 ? 0.7440 0.9012 0.8651 0.0237  -0.0065 0.0820  323 ASP B CG  
776 O OD1 . ASP B 12 ? 0.6930 0.8843 0.8306 0.0051  -0.0126 0.0922  323 ASP B OD1 
777 O OD2 . ASP B 12 ? 0.8763 1.0375 0.9950 0.0438  -0.0034 0.0845  323 ASP B OD2 
778 N N   . LEU B 13 ? 0.3926 0.4201 0.4667 -0.0061 -0.0149 0.0438  324 LEU B N   
779 C CA  . LEU B 13 ? 0.4141 0.4141 0.4763 -0.0105 -0.0191 0.0354  324 LEU B CA  
780 C C   . LEU B 13 ? 0.4560 0.4467 0.5151 -0.0275 -0.0258 0.0346  324 LEU B C   
781 O O   . LEU B 13 ? 0.4730 0.4559 0.5248 -0.0341 -0.0318 0.0318  324 LEU B O   
782 C CB  . LEU B 13 ? 0.3641 0.3400 0.4153 -0.0046 -0.0143 0.0280  324 LEU B CB  
783 C CG  . LEU B 13 ? 0.4463 0.4180 0.4904 0.0085  -0.0084 0.0267  324 LEU B CG  
784 C CD1 . LEU B 13 ? 0.4889 0.4399 0.5212 0.0068  -0.0067 0.0205  324 LEU B CD1 
785 C CD2 . LEU B 13 ? 0.4651 0.4354 0.5051 0.0166  -0.0094 0.0278  324 LEU B CD2 
786 N N   . SER B 14 ? 0.4501 0.4370 0.5102 -0.0345 -0.0244 0.0370  325 SER B N   
787 C CA  . SER B 14 ? 0.3706 0.3373 0.4206 -0.0502 -0.0298 0.0362  325 SER B CA  
788 C C   . SER B 14 ? 0.3817 0.3619 0.4326 -0.0667 -0.0393 0.0405  325 SER B C   
789 O O   . SER B 14 ? 0.4636 0.4179 0.4965 -0.0783 -0.0455 0.0352  325 SER B O   
790 C CB  . SER B 14 ? 0.4618 0.4251 0.5130 -0.0556 -0.0271 0.0419  325 SER B CB  
791 O OG  . SER B 14 ? 0.4670 0.4247 0.5179 -0.0417 -0.0198 0.0396  325 SER B OG  
792 N N   . ARG B 15 ? 0.4003 0.4226 0.4702 -0.0672 -0.0402 0.0509  326 ARG B N   
793 C CA  . ARG B 15 ? 0.4024 0.4513 0.4780 -0.0847 -0.0506 0.0589  326 ARG B CA  
794 C C   . ARG B 15 ? 0.3623 0.4031 0.4277 -0.0826 -0.0566 0.0528  326 ARG B C   
795 O O   . ARG B 15 ? 0.3654 0.4004 0.4187 -0.1022 -0.0674 0.0523  326 ARG B O   
796 C CB  . ARG B 15 ? 0.3358 0.4420 0.4379 -0.0791 -0.0481 0.0740  326 ARG B CB  
797 C CG  . ARG B 15 ? 0.3870 0.5344 0.5000 -0.0951 -0.0596 0.0855  326 ARG B CG  
798 C CD  . ARG B 15 ? 0.4793 0.6916 0.6213 -0.0820 -0.0547 0.1026  326 ARG B CD  
799 N NE  . ARG B 15 ? 0.4587 0.6716 0.6035 -0.0474 -0.0429 0.0998  326 ARG B NE  
800 C CZ  . ARG B 15 ? 0.4326 0.6456 0.5743 -0.0333 -0.0450 0.0985  326 ARG B CZ  
801 N NH1 . ARG B 15 ? 0.3851 0.6017 0.5222 -0.0501 -0.0583 0.0993  326 ARG B NH1 
802 N NH2 . ARG B 15 ? 0.3708 0.5756 0.5095 -0.0033 -0.0339 0.0962  326 ARG B NH2 
803 N N   . ARG B 16 ? 0.3204 0.3582 0.3870 -0.0607 -0.0498 0.0484  327 ARG B N   
804 C CA  . ARG B 16 ? 0.3612 0.3935 0.4184 -0.0569 -0.0542 0.0447  327 ARG B CA  
805 C C   . ARG B 16 ? 0.3773 0.3660 0.4088 -0.0643 -0.0561 0.0321  327 ARG B C   
806 O O   . ARG B 16 ? 0.3694 0.3528 0.3872 -0.0722 -0.0636 0.0296  327 ARG B O   
807 C CB  . ARG B 16 ? 0.3348 0.3706 0.3967 -0.0329 -0.0460 0.0449  327 ARG B CB  
808 C CG  . ARG B 16 ? 0.3596 0.4359 0.4414 -0.0205 -0.0428 0.0575  327 ARG B CG  
809 C CD  . ARG B 16 ? 0.3635 0.4279 0.4409 0.0038  -0.0330 0.0558  327 ARG B CD  
810 N NE  . ARG B 16 ? 0.3429 0.3937 0.4087 0.0099  -0.0359 0.0542  327 ARG B NE  
811 C CZ  . ARG B 16 ? 0.3518 0.3773 0.4049 0.0251  -0.0293 0.0508  327 ARG B CZ  
812 N NH1 . ARG B 16 ? 0.3641 0.3738 0.4125 0.0348  -0.0202 0.0470  327 ARG B NH1 
813 N NH2 . ARG B 16 ? 0.3321 0.3455 0.3737 0.0285  -0.0324 0.0513  327 ARG B NH2 
814 N N   . PHE B 17 ? 0.3458 0.3051 0.3693 -0.0603 -0.0490 0.0252  328 PHE B N   
815 C CA  . PHE B 17 ? 0.3962 0.3155 0.3944 -0.0632 -0.0485 0.0148  328 PHE B CA  
816 C C   . PHE B 17 ? 0.4533 0.3533 0.4319 -0.0850 -0.0576 0.0131  328 PHE B C   
817 O O   . PHE B 17 ? 0.4618 0.3352 0.4145 -0.0902 -0.0610 0.0051  328 PHE B O   
818 C CB  . PHE B 17 ? 0.3706 0.2699 0.3673 -0.0518 -0.0388 0.0112  328 PHE B CB  
819 C CG  . PHE B 17 ? 0.3272 0.2332 0.3309 -0.0352 -0.0314 0.0096  328 PHE B CG  
820 C CD1 . PHE B 17 ? 0.3984 0.2946 0.3901 -0.0297 -0.0297 0.0044  328 PHE B CD1 
821 C CD2 . PHE B 17 ? 0.3901 0.3114 0.4093 -0.0273 -0.0266 0.0137  328 PHE B CD2 
822 C CE1 . PHE B 17 ? 0.3790 0.2824 0.3762 -0.0190 -0.0239 0.0047  328 PHE B CE1 
823 C CE2 . PHE B 17 ? 0.3895 0.3126 0.4102 -0.0172 -0.0216 0.0122  328 PHE B CE2 
824 C CZ  . PHE B 17 ? 0.3597 0.2747 0.3705 -0.0143 -0.0206 0.0084  328 PHE B CZ  
825 N N   . GLU B 18 ? 0.3941 0.3050 0.3816 -0.0991 -0.0615 0.0208  329 GLU B N   
826 C CA  . GLU B 18 ? 0.4136 0.3046 0.3801 -0.1259 -0.0721 0.0208  329 GLU B CA  
827 C C   . GLU B 18 ? 0.5049 0.4152 0.4658 -0.1405 -0.0844 0.0222  329 GLU B C   
828 O O   . GLU B 18 ? 0.5391 0.4150 0.4669 -0.1573 -0.0923 0.0146  329 GLU B O   
829 C CB  . GLU B 18 ? 0.5032 0.4139 0.4851 -0.1411 -0.0746 0.0327  329 GLU B CB  
830 C CG  . GLU B 18 ? 0.8094 0.6809 0.7793 -0.1367 -0.0667 0.0302  329 GLU B CG  
831 C CD  . GLU B 18 ? 0.9577 0.7633 0.8858 -0.1382 -0.0665 0.0176  329 GLU B CD  
832 O OE1 . GLU B 18 ? 0.9617 0.7443 0.8830 -0.1142 -0.0557 0.0105  329 GLU B OE1 
833 O OE2 . GLU B 18 ? 0.9366 0.7158 0.8372 -0.1622 -0.0764 0.0152  329 GLU B OE2 
834 N N   . GLU B 19 ? 0.4611 0.4243 0.4511 -0.1325 -0.0858 0.0322  330 GLU B N   
835 C CA  . GLU B 19 ? 0.4483 0.4398 0.4373 -0.1446 -0.0984 0.0373  330 GLU B CA  
836 C C   . GLU B 19 ? 0.4885 0.4493 0.4500 -0.1382 -0.0989 0.0254  330 GLU B C   
837 O O   . GLU B 19 ? 0.5195 0.4830 0.4634 -0.1556 -0.1113 0.0252  330 GLU B O   
838 C CB  . GLU B 19 ? 0.5181 0.5719 0.5437 -0.1298 -0.0971 0.0524  330 GLU B CB  
839 C CG  . GLU B 19 ? 0.5513 0.6519 0.6038 -0.1408 -0.0997 0.0682  330 GLU B CG  
840 C CD  . GLU B 19 ? 0.7167 0.8333 0.7609 -0.1778 -0.1170 0.0755  330 GLU B CD  
841 O OE1 . GLU B 19 ? 0.7042 0.8282 0.7360 -0.1889 -0.1290 0.0755  330 GLU B OE1 
842 O OE2 . GLU B 19 ? 0.8241 0.9451 0.8720 -0.1981 -0.1195 0.0818  330 GLU B OE2 
843 N N   . LEU B 20 ? 0.4079 0.3433 0.3654 -0.1147 -0.0857 0.0166  331 LEU B N   
844 C CA  . LEU B 20 ? 0.4937 0.4064 0.4278 -0.1064 -0.0837 0.0073  331 LEU B CA  
845 C C   . LEU B 20 ? 0.4961 0.3573 0.3875 -0.1202 -0.0866 -0.0056 331 LEU B C   
846 O O   . LEU B 20 ? 0.5885 0.4316 0.4531 -0.1198 -0.0879 -0.0131 331 LEU B O   
847 C CB  . LEU B 20 ? 0.4411 0.3468 0.3843 -0.0806 -0.0691 0.0040  331 LEU B CB  
848 C CG  . LEU B 20 ? 0.4152 0.3573 0.3861 -0.0657 -0.0663 0.0140  331 LEU B CG  
849 C CD1 . LEU B 20 ? 0.4449 0.3742 0.4202 -0.0473 -0.0534 0.0103  331 LEU B CD1 
850 C CD2 . LEU B 20 ? 0.4790 0.4383 0.4442 -0.0666 -0.0739 0.0186  331 LEU B CD2 
851 N N   . LYS B 21 ? 0.5329 0.3668 0.4143 -0.1315 -0.0867 -0.0080 332 LYS B N   
852 C CA  . LYS B 21 ? 0.5479 0.3213 0.3816 -0.1435 -0.0885 -0.0206 332 LYS B CA  
853 C C   . LYS B 21 ? 0.7835 0.5521 0.5906 -0.1759 -0.1066 -0.0212 332 LYS B C   
854 O O   . LYS B 21 ? 0.9519 0.6800 0.7168 -0.1781 -0.1061 -0.0323 332 LYS B O   
855 C CB  . LYS B 21 ? 0.5495 0.2898 0.3777 -0.1450 -0.0831 -0.0211 332 LYS B CB  
856 C CG  . LYS B 21 ? 0.5401 0.2760 0.3836 -0.1142 -0.0660 -0.0221 332 LYS B CG  
857 C CD  . LYS B 21 ? 0.6269 0.3315 0.4637 -0.1161 -0.0621 -0.0202 332 LYS B CD  
858 C CE  . LYS B 21 ? 0.6149 0.3285 0.4732 -0.0871 -0.0473 -0.0179 332 LYS B CE  
859 N NZ  . LYS B 21 ? 0.6758 0.3630 0.5290 -0.0876 -0.0439 -0.0135 332 LYS B NZ  
860 N N   . LYS B 22 ? 0.6941 0.5139 0.5303 -0.1952 -0.1189 -0.0067 333 LYS B N   
861 C CA  . LYS B 22 ? 0.8535 0.6887 0.6771 -0.2211 -0.1319 -0.0005 333 LYS B CA  
862 C C   . LYS B 22 ? 0.9831 0.7922 0.7661 -0.2264 -0.1369 -0.0105 333 LYS B C   
863 O O   . LYS B 22 ? 1.0392 0.7949 0.7792 -0.2333 -0.1348 -0.0206 333 LYS B O   
864 C CB  . LYS B 22 ? 0.7834 0.6978 0.6524 -0.2297 -0.1421 0.0192  333 LYS B CB  
865 O O   . HOH C .  ? 0.6046 0.3865 0.4927 0.1018  0.0471  -0.0022 201 HOH A O   
866 O O   . HOH C .  ? 0.5817 0.4932 0.4728 -0.0433 -0.0605 0.0067  202 HOH A O   
867 O O   . HOH C .  ? 0.6402 0.4913 0.4953 -0.0102 -0.0310 0.0776  203 HOH A O   
868 O O   . HOH C .  ? 0.5420 0.6247 0.4147 0.0065  0.0541  0.0882  204 HOH A O   
869 O O   . HOH C .  ? 0.5958 0.5976 0.3985 0.0220  0.0544  0.0375  205 HOH A O   
870 O O   . HOH C .  ? 0.3549 0.4106 0.3972 -0.0582 -0.0724 0.0497  206 HOH A O   
871 O O   . HOH C .  ? 0.7288 0.5139 0.6101 0.0269  -0.0221 0.0615  207 HOH A O   
872 O O   . HOH C .  ? 0.7523 0.5033 0.5880 0.1918  0.0911  0.0066  208 HOH A O   
873 O O   . HOH C .  ? 0.5311 0.6264 0.3116 -0.0392 -0.0055 0.1088  209 HOH A O   
874 O O   . HOH C .  ? 0.6542 0.6458 0.6786 0.0956  0.0085  0.0540  210 HOH A O   
875 O O   . HOH C .  ? 0.5904 0.4612 0.4927 -0.1376 -0.0343 0.0380  211 HOH A O   
876 O O   . HOH C .  ? 0.4526 0.4737 0.4906 0.0888  -0.0114 0.0692  212 HOH A O   
877 O O   . HOH C .  ? 0.5644 0.3481 0.4972 0.0641  0.0223  0.0139  213 HOH A O   
878 O O   . HOH C .  ? 0.5944 0.3220 0.4270 0.0326  0.0140  -0.0116 214 HOH A O   
879 O O   . HOH C .  ? 0.4782 0.2673 0.3856 0.0526  0.0029  0.0198  215 HOH A O   
880 O O   . HOH C .  ? 0.7702 0.6925 0.7457 0.1266  0.0033  0.0664  216 HOH A O   
881 O O   . HOH C .  ? 0.6697 0.5776 0.4804 -0.0424 -0.0624 0.0144  217 HOH A O   
882 O O   . HOH C .  ? 0.4235 0.6850 0.4435 0.0021  -0.0666 0.1813  218 HOH A O   
883 O O   . HOH C .  ? 0.4186 0.5070 0.4562 0.0080  -0.0258 0.0994  219 HOH A O   
884 O O   . HOH C .  ? 0.5339 0.4485 0.5550 0.0009  -0.0030 0.0728  220 HOH A O   
885 O O   . HOH C .  ? 0.5418 0.3399 0.4458 0.0338  -0.0171 0.0475  221 HOH A O   
886 O O   . HOH C .  ? 0.5275 0.3377 0.4420 0.0708  -0.0104 0.0507  222 HOH A O   
887 O O   . HOH C .  ? 0.6565 0.4422 0.5900 -0.0534 -0.0308 0.0001  223 HOH A O   
888 O O   . HOH C .  ? 0.7473 0.6523 0.7666 -0.0328 -0.0048 0.0809  224 HOH A O   
889 O O   . HOH C .  ? 0.6114 0.5555 0.5268 -0.0678 -0.0817 0.0139  225 HOH A O   
890 O O   . HOH C .  ? 0.6507 0.3995 0.5740 -0.0059 -0.0071 0.0048  226 HOH A O   
891 O O   . HOH C .  ? 0.5403 0.7430 0.6478 0.0903  0.0263  0.1121  227 HOH A O   
892 O O   . HOH C .  ? 0.7651 0.5839 0.6164 -0.1688 -0.0461 0.0304  228 HOH A O   
893 O O   . HOH C .  ? 0.4253 0.3181 0.2936 -0.0207 -0.0230 0.0540  229 HOH A O   
894 O O   . HOH C .  ? 1.3170 0.8889 0.8097 0.0694  0.0580  -0.1074 230 HOH A O   
895 O O   . HOH C .  ? 0.5145 0.5832 0.5598 0.0420  -0.0163 0.1182  231 HOH A O   
896 O O   . HOH C .  ? 0.5097 0.6810 0.5942 0.0477  0.0303  0.0842  232 HOH A O   
897 O O   . HOH C .  ? 0.5519 0.2434 0.4289 -0.0257 -0.0148 -0.0071 233 HOH A O   
898 O O   . HOH C .  ? 0.7212 0.6750 0.6521 -0.1584 -0.0242 0.0729  234 HOH A O   
899 O O   . HOH C .  ? 0.6913 0.6348 0.7080 0.0798  0.0037  0.1217  235 HOH A O   
900 O O   . HOH C .  ? 0.7894 0.6973 0.6172 -0.0214 -0.0244 0.0330  236 HOH A O   
901 O O   . HOH C .  ? 0.5198 0.8319 0.5397 0.0218  -0.0736 0.2204  237 HOH A O   
902 O O   . HOH C .  ? 0.7689 0.7255 0.7046 -0.1606 -0.0378 0.0564  238 HOH A O   
903 O O   . HOH C .  ? 0.7793 0.6775 0.5619 -0.0312 -0.0413 0.0166  239 HOH A O   
904 O O   . HOH C .  ? 0.5847 0.7955 0.6270 0.0308  -0.0469 0.1712  240 HOH A O   
905 O O   . HOH C .  ? 0.6174 0.5182 0.5847 0.1410  0.0570  0.0431  241 HOH A O   
906 O O   . HOH C .  ? 1.1130 1.0542 1.0552 0.1570  0.0818  0.0320  242 HOH A O   
907 O O   . HOH C .  ? 0.7011 0.4582 0.5650 0.0693  0.0217  0.0017  243 HOH A O   
908 O O   . HOH C .  ? 0.8196 0.7372 0.7786 0.1310  0.0614  0.0311  244 HOH A O   
909 O O   . HOH C .  ? 0.6076 0.4657 0.5742 0.1007  0.0363  0.0339  245 HOH A O   
910 O O   . HOH C .  ? 0.5770 0.5770 0.5441 0.0491  -0.0978 0.0978  246 HOH A O   
911 O O   . HOH C .  ? 0.6607 0.3226 0.4178 0.0552  0.0300  -0.0263 247 HOH A O   
912 O O   . HOH C .  ? 0.5876 0.3401 0.4355 -0.0531 -0.0377 -0.0322 248 HOH A O   
913 O O   . HOH C .  ? 0.4248 0.4353 0.4101 -0.1140 -0.0293 0.0514  249 HOH A O   
914 O O   . HOH C .  ? 0.4608 0.2705 0.3968 -0.0349 -0.0259 -0.0082 250 HOH A O   
915 O O   . HOH C .  ? 0.4026 0.5095 0.4547 -0.0226 0.0097  0.0634  251 HOH A O   
916 O O   . HOH C .  ? 0.3704 0.5644 0.4387 -0.0831 -0.0333 0.0899  252 HOH A O   
917 O O   . HOH C .  ? 0.4537 0.5259 0.4664 -0.0882 -0.0036 0.0699  253 HOH A O   
918 O O   . HOH C .  ? 0.4632 0.4373 0.3882 -0.0323 0.0172  0.0488  254 HOH A O   
919 O O   . HOH C .  ? 0.4643 0.5068 0.4425 -0.1466 -0.0450 0.0591  255 HOH A O   
920 O O   . HOH C .  ? 0.4642 0.4700 0.4853 0.0253  0.0225  0.0371  256 HOH A O   
921 O O   . HOH C .  ? 0.6831 0.6406 0.3343 -0.0778 -0.0231 0.0185  257 HOH A O   
922 O O   . HOH C .  ? 0.3779 0.5586 0.4693 0.0156  -0.0181 0.1046  258 HOH A O   
923 O O   . HOH C .  ? 0.4343 0.7887 0.4581 -0.1155 -0.1050 0.1511  259 HOH A O   
924 O O   . HOH C .  ? 0.4855 0.7460 0.4181 -0.1382 -0.1109 0.1210  260 HOH A O   
925 O O   . HOH C .  ? 0.4920 0.5016 0.4729 -0.0781 0.0007  0.0606  261 HOH A O   
926 O O   . HOH C .  ? 0.5679 0.7296 0.5937 -0.0044 -0.0446 0.1275  262 HOH A O   
927 O O   . HOH C .  ? 0.4407 0.4023 0.4884 -0.0153 -0.0065 0.0367  263 HOH A O   
928 O O   . HOH C .  ? 0.5583 0.4860 0.4193 -0.1619 -0.0653 0.0197  264 HOH A O   
929 O O   . HOH C .  ? 0.5750 0.6647 0.6170 0.0254  0.0303  0.0558  265 HOH A O   
930 O O   . HOH C .  ? 0.6966 0.6472 0.6430 0.0981  0.0611  0.0182  266 HOH A O   
931 O O   . HOH C .  ? 0.5527 0.4805 0.5152 0.0812  0.0447  0.0163  267 HOH A O   
932 O O   . HOH C .  ? 0.4502 0.6635 0.5491 0.0399  -0.0209 0.1306  268 HOH A O   
933 O O   . HOH C .  ? 0.8549 0.7515 0.6613 0.0398  0.0461  -0.0093 269 HOH A O   
934 O O   . HOH C .  ? 0.7492 0.6023 0.5552 0.0032  0.0046  -0.0198 270 HOH A O   
935 O O   . HOH C .  ? 0.7263 0.7230 0.6188 0.0422  0.0608  0.0243  271 HOH A O   
936 O O   . HOH C .  ? 0.5461 0.7260 0.5708 -0.1557 -0.0587 0.0896  272 HOH A O   
937 O O   . HOH C .  ? 0.8420 0.4457 0.3908 0.1326  0.0954  -0.0898 273 HOH A O   
938 O O   . HOH C .  ? 0.7509 0.7783 0.6985 0.0288  0.0506  0.0360  274 HOH A O   
939 O O   . HOH C .  ? 0.5758 0.4407 0.5792 -0.0627 -0.0264 0.0363  275 HOH A O   
940 O O   . HOH C .  ? 0.6858 0.6291 0.6176 0.0632  0.0452  0.0158  276 HOH A O   
941 O O   . HOH C .  ? 0.5273 0.5051 0.4466 0.0174  0.0311  0.0286  277 HOH A O   
942 O O   . HOH C .  ? 0.7194 0.9291 0.7842 0.0141  -0.0420 0.1403  278 HOH A O   
943 O O   . HOH C .  ? 0.8990 0.9759 0.6270 -0.2482 -0.1332 0.0501  279 HOH A O   
944 O O   . HOH C .  ? 0.4021 0.6690 0.4963 -0.0675 -0.0393 0.1127  280 HOH A O   
945 O O   . HOH C .  ? 0.6171 0.8550 0.4530 -0.1900 -0.1332 0.1083  281 HOH A O   
946 O O   . HOH C .  ? 0.5773 0.5688 0.5502 0.0159  0.0255  0.0348  282 HOH A O   
947 O O   . HOH C .  ? 0.8715 0.8936 0.8333 -0.0495 0.0195  0.0616  283 HOH A O   
948 O O   . HOH C .  ? 0.5047 0.7412 0.5983 -0.0594 -0.0152 0.1017  284 HOH A O   
949 O O   . HOH C .  ? 0.5348 0.7111 0.6163 -0.0183 0.0066  0.0831  285 HOH A O   
950 O O   . HOH C .  ? 0.6420 0.7914 0.7221 0.0641  -0.0143 0.1325  286 HOH A O   
951 O O   . HOH C .  ? 0.5297 0.8398 0.6145 0.0077  -0.0573 0.1700  287 HOH A O   
952 O O   . HOH D .  ? 0.6639 0.7801 0.7548 0.0778  0.0004  0.0786  401 HOH B O   
953 O O   . HOH D .  ? 0.7921 0.6561 0.6482 -0.0959 -0.0830 -0.0132 402 HOH B O   
954 O O   . HOH D .  ? 0.5468 0.5917 0.6136 0.0470  -0.0048 0.0534  403 HOH B O   
955 O O   . HOH D .  ? 0.8687 0.6514 0.7333 0.1223  0.0431  0.0097  404 HOH B O   
956 O O   . HOH D .  ? 0.7503 0.3935 0.4945 -0.0831 -0.0493 -0.0547 405 HOH B O   
957 O O   . HOH D .  ? 0.4650 0.2841 0.3854 -0.0571 -0.0415 -0.0120 406 HOH B O   
958 O O   . HOH D .  ? 0.4469 0.3851 0.4870 -0.0221 -0.0167 0.0247  407 HOH B O   
959 O O   . HOH D .  ? 0.6913 0.4487 0.4848 -0.0979 -0.0696 -0.0390 408 HOH B O   
960 O O   . HOH D .  ? 0.5366 0.5921 0.6259 -0.0829 -0.0309 0.0734  409 HOH B O   
961 O O   . HOH D .  ? 0.5730 0.5836 0.6142 -0.1693 -0.0759 0.0713  410 HOH B O   
962 O O   . HOH D .  ? 0.7975 0.8442 0.8541 0.0686  0.0164  0.0528  411 HOH B O   
963 O O   . HOH D .  ? 0.7571 0.8685 0.8092 0.1323  0.0552  0.0729  412 HOH B O   
964 O O   . HOH D .  ? 0.9948 0.9785 1.0515 -0.0294 -0.0046 0.0542  413 HOH B O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  SER 1  7   ?   ?   ?   A . n 
A 1 2  GLY 2  8   ?   ?   ?   A . n 
A 1 3  GLU 3  9   9   GLU GLU A . n 
A 1 4  PRO 4  10  10  PRO PRO A . n 
A 1 5  ALA 5  11  11  ALA ALA A . n 
A 1 6  GLU 6  12  12  GLU GLU A . n 
A 1 7  ILE 7  13  13  ILE ILE A . n 
A 1 8  LYS 8  14  14  LYS LYS A . n 
A 1 9  ILE 9  15  15  ILE ILE A . n 
A 1 10 ILE 10 16  16  ILE ILE A . n 
A 1 11 ARG 11 17  17  ARG ARG A . n 
A 1 12 GLU 12 18  18  GLU GLU A . n 
A 1 13 ALA 13 19  19  ALA ALA A . n 
A 1 14 TYR 14 20  20  TYR TYR A . n 
A 1 15 LYS 15 21  21  LYS LYS A . n 
A 1 16 LYS 16 22  22  LYS LYS A . n 
A 1 17 ALA 17 23  23  ALA ALA A . n 
A 1 18 PHE 18 24  24  PHE PHE A . n 
A 1 19 LEU 19 25  25  LEU LEU A . n 
A 1 20 PHE 20 26  26  PHE PHE A . n 
A 1 21 VAL 21 27  27  VAL VAL A . n 
A 1 22 ASN 22 28  28  ASN ASN A . n 
A 1 23 LYS 23 29  29  LYS LYS A . n 
A 1 24 GLY 24 30  30  GLY GLY A . n 
A 1 25 LEU 25 31  31  LEU LEU A . n 
A 1 26 ASN 26 32  32  ASN ASN A . n 
A 1 27 THR 27 33  33  THR THR A . n 
A 1 28 ASP 28 34  34  ASP ASP A . n 
A 1 29 GLU 29 35  35  GLU GLU A . n 
A 1 30 LEU 30 36  36  LEU LEU A . n 
A 1 31 GLY 31 37  37  GLY GLY A . n 
A 1 32 GLN 32 38  38  GLN GLN A . n 
A 1 33 LYS 33 39  39  LYS LYS A . n 
A 1 34 GLU 34 40  40  GLU GLU A . n 
A 1 35 GLU 35 41  41  GLU GLU A . n 
A 1 36 ALA 36 42  42  ALA ALA A . n 
A 1 37 LYS 37 43  43  LYS LYS A . n 
A 1 38 ASN 38 44  44  ASN ASN A . n 
A 1 39 TYR 39 45  45  TYR TYR A . n 
A 1 40 TYR 40 46  46  TYR TYR A . n 
A 1 41 LYS 41 47  47  LYS LYS A . n 
A 1 42 GLN 42 48  48  GLN GLN A . n 
A 1 43 GLY 43 49  49  GLY GLY A . n 
A 1 44 ILE 44 50  50  ILE ILE A . n 
A 1 45 GLY 45 51  51  GLY GLY A . n 
A 1 46 HIS 46 52  52  HIS HIS A . n 
A 1 47 LEU 47 53  53  LEU LEU A . n 
A 1 48 LEU 48 54  54  LEU LEU A . n 
A 1 49 ARG 49 55  55  ARG ARG A . n 
A 1 50 GLY 50 56  56  GLY GLY A . n 
A 1 51 ILE 51 57  57  ILE ILE A . n 
A 1 52 SER 52 58  58  SER SER A . n 
A 1 53 ILE 53 59  59  ILE ILE A . n 
A 1 54 SER 54 60  60  SER SER A . n 
A 1 55 SER 55 61  61  SER SER A . n 
A 1 56 LYS 56 62  62  LYS LYS A . n 
A 1 57 GLU 57 63  63  GLU GLU A . n 
A 1 58 SER 58 64  64  SER SER A . n 
A 1 59 GLU 59 65  65  GLU GLU A . n 
A 1 60 HIS 60 66  66  HIS HIS A . n 
A 1 61 THR 61 67  67  THR THR A . n 
A 1 62 GLY 62 68  68  GLY GLY A . n 
A 1 63 PRO 63 69  69  PRO PRO A . n 
A 1 64 GLY 64 70  70  GLY GLY A . n 
A 1 65 TRP 65 71  71  TRP TRP A . n 
A 1 66 GLU 66 72  72  GLU GLU A . n 
A 1 67 SER 67 73  73  SER SER A . n 
A 1 68 ALA 68 74  74  ALA ALA A . n 
A 1 69 ARG 69 75  75  ARG ARG A . n 
A 1 70 GLN 70 76  76  GLN GLN A . n 
A 1 71 MET 71 77  77  MET MET A . n 
A 1 72 GLN 72 78  78  GLN GLN A . n 
A 1 73 GLN 73 79  79  GLN GLN A . n 
A 1 74 LYS 74 80  80  LYS LYS A . n 
A 1 75 MET 75 81  81  MET MET A . n 
A 1 76 LYS 76 82  82  LYS LYS A . n 
A 1 77 GLU 77 83  83  GLU GLU A . n 
A 1 78 THR 78 84  84  THR THR A . n 
A 1 79 LEU 79 85  85  LEU LEU A . n 
A 1 80 GLN 80 86  86  GLN GLN A . n 
A 1 81 ASN 81 87  87  ASN ASN A . n 
A 1 82 VAL 82 88  88  VAL VAL A . n 
A 1 83 ARG 83 89  89  ARG ARG A . n 
A 1 84 THR 84 90  90  THR THR A . n 
A 1 85 ARG 85 91  91  ARG ARG A . n 
A 1 86 LEU 86 92  92  LEU LEU A . n 
A 1 87 GLU 87 93  93  GLU GLU A . n 
A 1 88 ILE 88 94  94  ILE ILE A . n 
A 1 89 LEU 89 95  95  LEU LEU A . n 
A 1 90 GLU 90 96  96  GLU GLU A . n 
A 1 91 LYS 91 97  97  LYS LYS A . n 
A 1 92 GLY 92 98  98  GLY GLY A . n 
A 1 93 LEU 93 99  99  LEU LEU A . n 
A 1 94 ALA 94 100 100 ALA ALA A . n 
A 1 95 THR 95 101 101 THR THR A . n 
B 2 1  SER 1  312 ?   ?   ?   B . n 
B 2 2  THR 2  313 ?   ?   ?   B . n 
B 2 3  SER 3  314 ?   ?   ?   B . n 
B 2 4  ALA 4  315 ?   ?   ?   B . n 
B 2 5  SER 5  316 ?   ?   ?   B . n 
B 2 6  GLU 6  317 ?   ?   ?   B . n 
B 2 7  ASP 7  318 318 ASP ASP B . n 
B 2 8  ILE 8  319 319 ILE ILE B . n 
B 2 9  ASP 9  320 320 ASP ASP B . n 
B 2 10 PHE 10 321 321 PHE PHE B . n 
B 2 11 ASP 11 322 322 ASP ASP B . n 
B 2 12 ASP 12 323 323 ASP ASP B . n 
B 2 13 LEU 13 324 324 LEU LEU B . n 
B 2 14 SER 14 325 325 SER SER B . n 
B 2 15 ARG 15 326 326 ARG ARG B . n 
B 2 16 ARG 16 327 327 ARG ARG B . n 
B 2 17 PHE 17 328 328 PHE PHE B . n 
B 2 18 GLU 18 329 329 GLU GLU B . n 
B 2 19 GLU 19 330 330 GLU GLU B . n 
B 2 20 LEU 20 331 331 LEU LEU B . n 
B 2 21 LYS 21 332 332 LYS LYS B . n 
B 2 22 LYS 22 333 333 LYS LYS B . n 
B 2 23 LYS 23 334 ?   ?   ?   B . n 
B 2 24 THR 24 335 ?   ?   ?   B . n 
B 2 25 TRP 25 336 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 HOH 1  201 18  HOH HOH A . 
C 3 HOH 2  202 28  HOH HOH A . 
C 3 HOH 3  203 17  HOH HOH A . 
C 3 HOH 4  204 27  HOH HOH A . 
C 3 HOH 5  205 44  HOH HOH A . 
C 3 HOH 6  206 4   HOH HOH A . 
C 3 HOH 7  207 67  HOH HOH A . 
C 3 HOH 8  208 39  HOH HOH A . 
C 3 HOH 9  209 5   HOH HOH A . 
C 3 HOH 10 210 42  HOH HOH A . 
C 3 HOH 11 211 26  HOH HOH A . 
C 3 HOH 12 212 25  HOH HOH A . 
C 3 HOH 13 213 12  HOH HOH A . 
C 3 HOH 14 214 14  HOH HOH A . 
C 3 HOH 15 215 6   HOH HOH A . 
C 3 HOH 16 216 43  HOH HOH A . 
C 3 HOH 17 217 53  HOH HOH A . 
C 3 HOH 18 218 31  HOH HOH A . 
C 3 HOH 19 219 37  HOH HOH A . 
C 3 HOH 20 220 52  HOH HOH A . 
C 3 HOH 21 221 11  HOH HOH A . 
C 3 HOH 22 222 19  HOH HOH A . 
C 3 HOH 23 223 40  HOH HOH A . 
C 3 HOH 24 224 85  HOH HOH A . 
C 3 HOH 25 225 81  HOH HOH A . 
C 3 HOH 26 226 98  HOH HOH A . 
C 3 HOH 27 227 91  HOH HOH A . 
C 3 HOH 28 228 73  HOH HOH A . 
C 3 HOH 29 229 3   HOH HOH A . 
C 3 HOH 30 230 104 HOH HOH A . 
C 3 HOH 31 231 49  HOH HOH A . 
C 3 HOH 32 232 96  HOH HOH A . 
C 3 HOH 33 233 62  HOH HOH A . 
C 3 HOH 34 234 100 HOH HOH A . 
C 3 HOH 35 235 97  HOH HOH A . 
C 3 HOH 36 236 66  HOH HOH A . 
C 3 HOH 37 237 84  HOH HOH A . 
C 3 HOH 38 238 75  HOH HOH A . 
C 3 HOH 39 239 93  HOH HOH A . 
C 3 HOH 40 240 89  HOH HOH A . 
C 3 HOH 41 241 64  HOH HOH A . 
C 3 HOH 42 242 108 HOH HOH A . 
C 3 HOH 43 243 90  HOH HOH A . 
C 3 HOH 44 244 72  HOH HOH A . 
C 3 HOH 45 245 47  HOH HOH A . 
C 3 HOH 46 246 101 HOH HOH A . 
C 3 HOH 47 247 1   HOH HOH A . 
C 3 HOH 48 248 7   HOH HOH A . 
C 3 HOH 49 249 8   HOH HOH A . 
C 3 HOH 50 250 9   HOH HOH A . 
C 3 HOH 51 251 10  HOH HOH A . 
C 3 HOH 52 252 13  HOH HOH A . 
C 3 HOH 53 253 15  HOH HOH A . 
C 3 HOH 54 254 16  HOH HOH A . 
C 3 HOH 55 255 20  HOH HOH A . 
C 3 HOH 56 256 22  HOH HOH A . 
C 3 HOH 57 257 23  HOH HOH A . 
C 3 HOH 58 258 24  HOH HOH A . 
C 3 HOH 59 259 29  HOH HOH A . 
C 3 HOH 60 260 30  HOH HOH A . 
C 3 HOH 61 261 33  HOH HOH A . 
C 3 HOH 62 262 34  HOH HOH A . 
C 3 HOH 63 263 35  HOH HOH A . 
C 3 HOH 64 264 36  HOH HOH A . 
C 3 HOH 65 265 38  HOH HOH A . 
C 3 HOH 66 266 41  HOH HOH A . 
C 3 HOH 67 267 45  HOH HOH A . 
C 3 HOH 68 268 46  HOH HOH A . 
C 3 HOH 69 269 48  HOH HOH A . 
C 3 HOH 70 270 50  HOH HOH A . 
C 3 HOH 71 271 54  HOH HOH A . 
C 3 HOH 72 272 56  HOH HOH A . 
C 3 HOH 73 273 57  HOH HOH A . 
C 3 HOH 74 274 58  HOH HOH A . 
C 3 HOH 75 275 59  HOH HOH A . 
C 3 HOH 76 276 60  HOH HOH A . 
C 3 HOH 77 277 65  HOH HOH A . 
C 3 HOH 78 278 68  HOH HOH A . 
C 3 HOH 79 279 69  HOH HOH A . 
C 3 HOH 80 280 70  HOH HOH A . 
C 3 HOH 81 281 74  HOH HOH A . 
C 3 HOH 82 282 76  HOH HOH A . 
C 3 HOH 83 283 77  HOH HOH A . 
C 3 HOH 84 284 92  HOH HOH A . 
C 3 HOH 85 285 94  HOH HOH A . 
C 3 HOH 86 286 102 HOH HOH A . 
C 3 HOH 87 287 110 HOH HOH A . 
D 3 HOH 1  401 51  HOH HOH B . 
D 3 HOH 2  402 86  HOH HOH B . 
D 3 HOH 3  403 79  HOH HOH B . 
D 3 HOH 4  404 107 HOH HOH B . 
D 3 HOH 5  405 63  HOH HOH B . 
D 3 HOH 6  406 2   HOH HOH B . 
D 3 HOH 7  407 21  HOH HOH B . 
D 3 HOH 8  408 32  HOH HOH B . 
D 3 HOH 9  409 61  HOH HOH B . 
D 3 HOH 10 410 71  HOH HOH B . 
D 3 HOH 11 411 99  HOH HOH B . 
D 3 HOH 12 412 103 HOH HOH B . 
D 3 HOH 13 413 106 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1480 ? 
1 MORE         -9   ? 
1 'SSA (A^2)'  6390 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     246 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   C 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2015-02-11 
2 'Structure model' 1 1 2015-02-18 
3 'Structure model' 1 2 2015-04-08 
4 'Structure model' 1 3 2017-09-27 
5 'Structure model' 1 4 2019-12-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'        
2 3 'Structure model' 'Database references'        
3 4 'Structure model' 'Author supporting evidence' 
4 4 'Structure model' 'Database references'        
5 4 'Structure model' 'Derived calculations'       
6 4 'Structure model' Other                        
7 4 'Structure model' 'Refinement description'     
8 4 'Structure model' 'Source and taxonomy'        
9 5 'Structure model' 'Author supporting evidence' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' citation              
2 4 'Structure model' entity_src_gen        
3 4 'Structure model' pdbx_audit_support    
4 4 'Structure model' pdbx_database_status  
5 4 'Structure model' pdbx_struct_oper_list 
6 4 'Structure model' software              
7 5 'Structure model' pdbx_audit_support    
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_citation.journal_id_CSD'                    
2 4 'Structure model' '_entity_src_gen.pdbx_alt_source_flag'        
3 4 'Structure model' '_pdbx_audit_support.funding_organization'    
4 4 'Structure model' '_pdbx_database_status.pdb_format_compatible' 
5 4 'Structure model' '_pdbx_struct_oper_list.symmetry_operation'   
6 5 'Structure model' '_pdbx_audit_support.funding_organization'    
# 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         -12.3844 
_pdbx_refine_tls.origin_y         6.1248 
_pdbx_refine_tls.origin_z         -7.1335 
_pdbx_refine_tls.T[1][1]          0.1889 
_pdbx_refine_tls.T[1][1]_esd      ? 
_pdbx_refine_tls.T[1][2]          -0.0083 
_pdbx_refine_tls.T[1][2]_esd      ? 
_pdbx_refine_tls.T[1][3]          -0.0090 
_pdbx_refine_tls.T[1][3]_esd      ? 
_pdbx_refine_tls.T[2][2]          0.1303 
_pdbx_refine_tls.T[2][2]_esd      ? 
_pdbx_refine_tls.T[2][3]          0.0173 
_pdbx_refine_tls.T[2][3]_esd      ? 
_pdbx_refine_tls.T[3][3]          0.2132 
_pdbx_refine_tls.T[3][3]_esd      ? 
_pdbx_refine_tls.L[1][1]          1.8436 
_pdbx_refine_tls.L[1][1]_esd      ? 
_pdbx_refine_tls.L[1][2]          0.1574 
_pdbx_refine_tls.L[1][2]_esd      ? 
_pdbx_refine_tls.L[1][3]          -0.1277 
_pdbx_refine_tls.L[1][3]_esd      ? 
_pdbx_refine_tls.L[2][2]          1.8780 
_pdbx_refine_tls.L[2][2]_esd      ? 
_pdbx_refine_tls.L[2][3]          -1.6184 
_pdbx_refine_tls.L[2][3]_esd      ? 
_pdbx_refine_tls.L[3][3]          5.5086 
_pdbx_refine_tls.L[3][3]_esd      ? 
_pdbx_refine_tls.S[1][1]          0.0032 
_pdbx_refine_tls.S[1][1]_esd      ? 
_pdbx_refine_tls.S[1][2]          -0.1122 
_pdbx_refine_tls.S[1][2]_esd      ? 
_pdbx_refine_tls.S[1][3]          -0.0740 
_pdbx_refine_tls.S[1][3]_esd      ? 
_pdbx_refine_tls.S[2][1]          0.0177 
_pdbx_refine_tls.S[2][1]_esd      ? 
_pdbx_refine_tls.S[2][2]          -0.0414 
_pdbx_refine_tls.S[2][2]_esd      ? 
_pdbx_refine_tls.S[2][3]          0.0048 
_pdbx_refine_tls.S[2][3]_esd      ? 
_pdbx_refine_tls.S[3][1]          -0.1073 
_pdbx_refine_tls.S[3][1]_esd      ? 
_pdbx_refine_tls.S[3][2]          0.1448 
_pdbx_refine_tls.S[3][2]_esd      ? 
_pdbx_refine_tls.S[3][3]          0.0114 
_pdbx_refine_tls.S[3][3]_esd      ? 
# 
_pdbx_refine_tls_group.id                  1 
_pdbx_refine_tls_group.pdbx_refine_id      'X-RAY DIFFRACTION' 
_pdbx_refine_tls_group.refine_tls_id       1 
_pdbx_refine_tls_group.beg_label_asym_id   ? 
_pdbx_refine_tls_group.beg_label_seq_id    ? 
_pdbx_refine_tls_group.beg_auth_asym_id    ? 
_pdbx_refine_tls_group.beg_auth_seq_id     ? 
_pdbx_refine_tls_group.end_label_asym_id   ? 
_pdbx_refine_tls_group.end_label_seq_id    ? 
_pdbx_refine_tls_group.end_auth_asym_id    ? 
_pdbx_refine_tls_group.end_auth_seq_id     ? 
_pdbx_refine_tls_group.selection           ? 
_pdbx_refine_tls_group.selection_details   all 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .                           1 
? phasing        ? ? ? ? ? ? ? ? ? ? ? PHASER   ? ? ? .                           2 
? refinement     ? ? ? ? ? ? ? ? ? ? ? PHENIX   ? ? ? '(phenix.refine: dev_1593)' 3 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   HOH 
_pdbx_validate_close_contact.auth_seq_id_1    226 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    233 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.09 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    SER 
_pdbx_validate_torsion.auth_asym_id    A 
_pdbx_validate_torsion.auth_seq_id     61 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             -142.08 
_pdbx_validate_torsion.psi             15.11 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLU 9   ? CG  ? A GLU 3  CG  
2  1 Y 1 A GLU 9   ? CD  ? A GLU 3  CD  
3  1 Y 1 A GLU 9   ? OE1 ? A GLU 3  OE1 
4  1 Y 1 A GLU 9   ? OE2 ? A GLU 3  OE2 
5  1 Y 1 A GLU 12  ? CD  ? A GLU 6  CD  
6  1 Y 1 A GLU 12  ? OE1 ? A GLU 6  OE1 
7  1 Y 1 A GLU 12  ? OE2 ? A GLU 6  OE2 
8  1 Y 1 A LYS 14  ? CE  ? A LYS 8  CE  
9  1 Y 1 A LYS 14  ? NZ  ? A LYS 8  NZ  
10 1 Y 1 A ARG 17  ? CZ  ? A ARG 11 CZ  
11 1 Y 1 A ARG 17  ? NH1 ? A ARG 11 NH1 
12 1 Y 1 A ARG 17  ? NH2 ? A ARG 11 NH2 
13 1 Y 1 A LYS 21  ? NZ  ? A LYS 15 NZ  
14 1 Y 1 A LYS 22  ? NZ  ? A LYS 16 NZ  
15 1 Y 1 A LYS 39  ? NZ  ? A LYS 33 NZ  
16 1 Y 1 A LYS 47  ? NZ  ? A LYS 41 NZ  
17 1 Y 1 A SER 64  ? OG  ? A SER 58 OG  
18 1 Y 1 A GLU 65  ? CG  ? A GLU 59 CG  
19 1 Y 1 A GLU 65  ? CD  ? A GLU 59 CD  
20 1 Y 1 A GLU 65  ? OE1 ? A GLU 59 OE1 
21 1 Y 1 A GLU 65  ? OE2 ? A GLU 59 OE2 
22 1 Y 1 A LYS 97  ? NZ  ? A LYS 91 NZ  
23 1 Y 1 B LYS 333 ? CG  ? B LYS 22 CG  
24 1 Y 1 B LYS 333 ? CD  ? B LYS 22 CD  
25 1 Y 1 B LYS 333 ? CE  ? B LYS 22 CE  
26 1 Y 1 B LYS 333 ? NZ  ? B LYS 22 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 7   ? A SER 1  
2  1 Y 1 A GLY 8   ? A GLY 2  
3  1 Y 1 B SER 312 ? B SER 1  
4  1 Y 1 B THR 313 ? B THR 2  
5  1 Y 1 B SER 314 ? B SER 3  
6  1 Y 1 B ALA 315 ? B ALA 4  
7  1 Y 1 B SER 316 ? B SER 5  
8  1 Y 1 B GLU 317 ? B GLU 6  
9  1 Y 1 B LYS 334 ? B LYS 23 
10 1 Y 1 B THR 335 ? B THR 24 
11 1 Y 1 B TRP 336 ? B TRP 25 
# 
_pdbx_audit_support.funding_organization   
'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 
_pdbx_audit_support.country                'United States' 
_pdbx_audit_support.grant_number           GM095769 
_pdbx_audit_support.ordinal                1 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#