data_4U7Y
# 
_entry.id   4U7Y 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4U7Y         
WWPDB D_1000202940 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 4U7E PDB . 
unspecified 4U7I PDB . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4U7Y 
_pdbx_database_status.recvd_initial_deposition_date   2014-07-31 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Guo, E.Z.' 1 
'Xu, Z.'    2 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_id_ASTM           JBCHA3 
_citation.journal_id_CSD            0071 
_citation.journal_id_ISSN           1083-351X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            290 
_citation.language                  ? 
_citation.page_first                8396 
_citation.page_last                 8408 
_citation.title                     
;Distinct Mechanisms of Recognizing Endosomal Sorting Complex Required for Transport III (ESCRT-III) Protein IST1 by Different Microtubule Interacting and Trafficking (MIT) Domains.
;
_citation.year                      2015 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1074/jbc.M114.607903 
_citation.pdbx_database_id_PubMed   25657007 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Guo, E.Z.' 1 ? 
primary 'Xu, Z.'    2 ? 
# 
_cell.entry_id           4U7Y 
_cell.length_a           78.401 
_cell.length_b           78.401 
_cell.length_c           67.642 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4U7Y 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                177 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 6 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Vacuolar protein sorting-associated protein 4B' 10310.705 1 3.6.4.6 ? 'MIT domain (UNP residues 1-89)' ? 
2 polymer man 'IST1 homolog'                                   3009.262  1 ?       ? 'UNP residues 341-364'           ? 
3 water   nat water                                            18.015    6 ?       ? ?                                ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Cell migration-inducing gene 1 protein,Suppressor of K(+) transport growth defect 1,Protein SKD1' 
2 'hIST1,Putative MAPK-activating protein PM28'                                                      
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;SMSSTSPNLQKAIDLASKAAQEDKAGNYEEALQLYQHAVQYFLHVVKYEAQGDKAKQSIRAKCTEYLDRAEKLKEYLKNK
EKKAQKPVKE
;
;SMSSTSPNLQKAIDLASKAAQEDKAGNYEEALQLYQHAVQYFLHVVKYEAQGDKAKQSIRAKCTEYLDRAEKLKEYLKNK
EKKAQKPVKE
;
A ? 
2 'polypeptide(L)' no no STSASEDIDFDDLSRRFEELKKKTW                                                                     
STSASEDIDFDDLSRRFEELKKKTW                                                                     B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  SER n 
1 2  MET n 
1 3  SER n 
1 4  SER n 
1 5  THR n 
1 6  SER n 
1 7  PRO n 
1 8  ASN n 
1 9  LEU n 
1 10 GLN n 
1 11 LYS n 
1 12 ALA n 
1 13 ILE n 
1 14 ASP n 
1 15 LEU n 
1 16 ALA n 
1 17 SER n 
1 18 LYS n 
1 19 ALA n 
1 20 ALA n 
1 21 GLN n 
1 22 GLU n 
1 23 ASP n 
1 24 LYS n 
1 25 ALA n 
1 26 GLY n 
1 27 ASN n 
1 28 TYR n 
1 29 GLU n 
1 30 GLU n 
1 31 ALA n 
1 32 LEU n 
1 33 GLN n 
1 34 LEU n 
1 35 TYR n 
1 36 GLN n 
1 37 HIS n 
1 38 ALA n 
1 39 VAL n 
1 40 GLN n 
1 41 TYR n 
1 42 PHE n 
1 43 LEU n 
1 44 HIS n 
1 45 VAL n 
1 46 VAL n 
1 47 LYS n 
1 48 TYR n 
1 49 GLU n 
1 50 ALA n 
1 51 GLN n 
1 52 GLY n 
1 53 ASP n 
1 54 LYS n 
1 55 ALA n 
1 56 LYS n 
1 57 GLN n 
1 58 SER n 
1 59 ILE n 
1 60 ARG n 
1 61 ALA n 
1 62 LYS n 
1 63 CYS n 
1 64 THR n 
1 65 GLU n 
1 66 TYR n 
1 67 LEU n 
1 68 ASP n 
1 69 ARG n 
1 70 ALA n 
1 71 GLU n 
1 72 LYS n 
1 73 LEU n 
1 74 LYS n 
1 75 GLU n 
1 76 TYR n 
1 77 LEU n 
1 78 LYS n 
1 79 ASN n 
1 80 LYS n 
1 81 GLU n 
1 82 LYS n 
1 83 LYS n 
1 84 ALA n 
1 85 GLN n 
1 86 LYS n 
1 87 PRO n 
1 88 VAL n 
1 89 LYS n 
1 90 GLU n 
2 1  SER n 
2 2  THR n 
2 3  SER n 
2 4  ALA n 
2 5  SER n 
2 6  GLU n 
2 7  ASP n 
2 8  ILE n 
2 9  ASP n 
2 10 PHE n 
2 11 ASP n 
2 12 ASP n 
2 13 LEU n 
2 14 SER n 
2 15 ARG n 
2 16 ARG n 
2 17 PHE n 
2 18 GLU n 
2 19 GLU n 
2 20 LEU n 
2 21 LYS n 
2 22 LYS n 
2 23 LYS n 
2 24 THR n 
2 25 TRP n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 90 Human ? 'VPS4B, SKD1, VPS42, MIG1' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? 'Rosetta (DE3)' ? ? ? ? ? ? ? Plasmid ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 25 Human ? 'IST1, KIAA0174'           ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? 'Rosetta (DE3)' ? ? ? ? ? ? ? plasmid ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP VPS4B_HUMAN O75351 1 
;MSSTSPNLQKAIDLASKAAQEDKAGNYEEALQLYQHAVQYFLHVVKYEAQGDKAKQSIRAKCTEYLDRAEKLKEYLKNKE
KKAQKPVKE
;
1   ? 
2 UNP IST1_HUMAN  P53990 2 STSASEDIDFDDLSRRFEELKKKT                                                                     341 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4U7Y A 2 ? 90 ? O75351 1   ? 89  ? 1   89  
2 2 4U7Y B 1 ? 24 ? P53990 341 ? 364 ? 312 335 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4U7Y SER A 1  ? UNP O75351 ? ? 'expression tag' 0   1 
2 4U7Y TRP B 25 ? UNP P53990 ? ? 'expression tag' 336 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4U7Y 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.25 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         45.40 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.3 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            299 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '2.58 M Na-malonate' 
_exptl_crystal_grow.pdbx_pH_range   5.0 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'MARMOSAIC 225 mm CCD' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-02-19 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.979 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 21-ID-F' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97872 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   21-ID-F 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         4U7Y 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.50 
_reflns.d_resolution_low                 33.82 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       4455 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             96.9 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  12.3 
_reflns.pdbx_Rmerge_I_obs                0.112 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            21.1 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  . 
_reflns_shell.d_res_low                   ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         6.4 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        98.2 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.387 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             12.7 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 4U7Y 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.502 
_refine.ls_d_res_low                             33.82 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     4455 
_refine.ls_number_reflns_R_free                  226 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    96.91 
_refine.ls_percent_reflns_R_free                 5.07 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2276 
_refine.ls_R_factor_R_free                       0.2713 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2252 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.35 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               NONE 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      1WR0 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 28.44 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.39 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.007  ? 725 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.997  ? 978 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 16.239 ? 253 ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.038  ? 111 ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.004  ? 126 ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
'X-RAY DIFFRACTION' 2.502  3.1520  . . 103 2071 98.00 . . . 0.3712 . 0.2485 . . . . . . . . 
'X-RAY DIFFRACTION' 3.1520 33.8241 . . 123 2158 96.00 . . . 0.2355 . 0.2158 . . . . . . . . 
# 
_struct.entry_id                     4U7Y 
_struct.title                        'Structure of the complex of VPS4B MIT and IST1 MIM' 
_struct.pdbx_descriptor              'VPS4B MIT, IST1 MIM' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4U7Y 
_struct_keywords.text            'complex, MIM1, PROTEIN TRANSPORT' 
_struct_keywords.pdbx_keywords   'PROTEIN TRANSPORT' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 SER A 6  ? GLY A 26 ? SER A 5   GLY A 25  1 ? 21 
HELX_P HELX_P2 AA2 ASN A 27 ? GLU A 49 ? ASN A 26  GLU A 48  1 ? 23 
HELX_P HELX_P3 AA3 GLY A 52 ? LYS A 83 ? GLY A 51  LYS A 82  1 ? 32 
HELX_P HELX_P4 AA4 PHE B 10 ? LEU B 20 ? PHE B 321 LEU B 331 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_atom_sites.entry_id                    4U7Y 
_atom_sites.fract_transf_matrix[1][1]   0.012755 
_atom_sites.fract_transf_matrix[1][2]   0.007364 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014728 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.014784 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1   N N   . MET A 1 2  ? 16.501 36.544 40.616  1.00 65.90 ? 1   MET A N   1 
ATOM   2   C CA  . MET A 1 2  ? 16.120 36.265 39.235  1.00 57.75 ? 1   MET A CA  1 
ATOM   3   C C   . MET A 1 2  ? 14.670 36.717 39.014  1.00 61.69 ? 1   MET A C   1 
ATOM   4   O O   . MET A 1 2  ? 13.967 37.019 39.981  1.00 57.77 ? 1   MET A O   1 
ATOM   5   C CB  . MET A 1 2  ? 16.315 34.780 38.910  1.00 52.09 ? 1   MET A CB  1 
ATOM   6   C CG  . MET A 1 2  ? 17.779 34.313 38.991  1.00 49.39 ? 1   MET A CG  1 
ATOM   7   N N   . SER A 1 3  ? 14.226 36.745 37.753  1.00 64.95 ? 2   SER A N   1 
ATOM   8   C CA  . SER A 1 3  ? 13.042 37.523 37.350  1.00 55.18 ? 2   SER A CA  1 
ATOM   9   C C   . SER A 1 3  ? 11.913 36.806 36.570  1.00 48.73 ? 2   SER A C   1 
ATOM   10  O O   . SER A 1 3  ? 11.909 35.585 36.415  1.00 51.26 ? 2   SER A O   1 
ATOM   11  C CB  . SER A 1 3  ? 13.507 38.697 36.500  1.00 51.82 ? 2   SER A CB  1 
ATOM   12  O OG  . SER A 1 3  ? 13.898 38.230 35.221  1.00 52.66 ? 2   SER A OG  1 
ATOM   13  N N   . SER A 1 4  ? 10.979 37.604 36.054  1.00 42.57 ? 3   SER A N   1 
ATOM   14  C CA  . SER A 1 4  ? 9.731  37.098 35.484  1.00 42.45 ? 3   SER A CA  1 
ATOM   15  C C   . SER A 1 4  ? 9.679  37.068 33.950  1.00 38.85 ? 3   SER A C   1 
ATOM   16  O O   . SER A 1 4  ? 9.953  38.064 33.277  1.00 42.66 ? 3   SER A O   1 
ATOM   17  C CB  . SER A 1 4  ? 8.554  37.936 35.994  1.00 38.78 ? 3   SER A CB  1 
ATOM   18  N N   . THR A 1 5  ? 9.299  35.906 33.429  1.00 29.57 ? 4   THR A N   1 
ATOM   19  C CA  . THR A 1 5  ? 8.931  35.699 32.030  1.00 31.38 ? 4   THR A CA  1 
ATOM   20  C C   . THR A 1 5  ? 7.455  36.044 31.764  1.00 29.14 ? 4   THR A C   1 
ATOM   21  O O   . THR A 1 5  ? 6.558  35.422 32.317  1.00 30.16 ? 4   THR A O   1 
ATOM   22  C CB  . THR A 1 5  ? 9.179  34.227 31.610  1.00 34.39 ? 4   THR A CB  1 
ATOM   23  O OG1 . THR A 1 5  ? 10.581 33.999 31.419  1.00 41.47 ? 4   THR A OG1 1 
ATOM   24  C CG2 . THR A 1 5  ? 8.454  33.900 30.327  1.00 33.86 ? 4   THR A CG2 1 
ATOM   25  N N   . SER A 1 6  ? 7.205  37.028 30.913  1.00 26.33 ? 5   SER A N   1 
ATOM   26  C CA  . SER A 1 6  ? 5.843  37.456 30.632  1.00 25.48 ? 5   SER A CA  1 
ATOM   27  C C   . SER A 1 6  ? 5.060  36.357 29.945  1.00 28.33 ? 5   SER A C   1 
ATOM   28  O O   . SER A 1 6  ? 5.647  35.516 29.275  1.00 30.50 ? 5   SER A O   1 
ATOM   29  C CB  . SER A 1 6  ? 5.837  38.707 29.753  1.00 27.07 ? 5   SER A CB  1 
ATOM   30  O OG  . SER A 1 6  ? 5.798  38.356 28.376  1.00 29.59 ? 5   SER A OG  1 
ATOM   31  N N   . PRO A 1 7  ? 3.726  36.370 30.096  1.00 32.08 ? 6   PRO A N   1 
ATOM   32  C CA  . PRO A 1 7  ? 2.893  35.350 29.448  1.00 27.16 ? 6   PRO A CA  1 
ATOM   33  C C   . PRO A 1 7  ? 3.015  35.373 27.919  1.00 30.67 ? 6   PRO A C   1 
ATOM   34  O O   . PRO A 1 7  ? 3.020  34.305 27.290  1.00 31.08 ? 6   PRO A O   1 
ATOM   35  C CB  . PRO A 1 7  ? 1.465  35.718 29.895  1.00 27.56 ? 6   PRO A CB  1 
ATOM   36  C CG  . PRO A 1 7  ? 1.660  36.505 31.158  1.00 27.80 ? 6   PRO A CG  1 
ATOM   37  C CD  . PRO A 1 7  ? 2.928  37.275 30.950  1.00 29.08 ? 6   PRO A CD  1 
ATOM   38  N N   . ASN A 1 8  ? 3.112  36.555 27.322  1.00 24.68 ? 7   ASN A N   1 
ATOM   39  C CA  . ASN A 1 8  ? 3.322  36.611 25.887  1.00 26.70 ? 7   ASN A CA  1 
ATOM   40  C C   . ASN A 1 8  ? 4.670  36.015 25.495  1.00 29.00 ? 7   ASN A C   1 
ATOM   41  O O   . ASN A 1 8  ? 4.774  35.277 24.508  1.00 27.53 ? 7   ASN A O   1 
ATOM   42  C CB  . ASN A 1 8  ? 3.213  38.033 25.391  1.00 22.18 ? 7   ASN A CB  1 
ATOM   43  C CG  . ASN A 1 8  ? 1.790  38.468 25.242  1.00 28.44 ? 7   ASN A CG  1 
ATOM   44  O OD1 . ASN A 1 8  ? 0.941  37.701 24.800  1.00 28.70 ? 7   ASN A OD1 1 
ATOM   45  N ND2 . ASN A 1 8  ? 1.510  39.701 25.618  1.00 26.49 ? 7   ASN A ND2 1 
ATOM   46  N N   . LEU A 1 9  ? 5.694  36.320 26.281  1.00 27.79 ? 8   LEU A N   1 
ATOM   47  C CA  . LEU A 1 9  ? 7.021  35.791 26.010  1.00 29.09 ? 8   LEU A CA  1 
ATOM   48  C C   . LEU A 1 9  ? 7.043  34.291 26.292  1.00 32.57 ? 8   LEU A C   1 
ATOM   49  O O   . LEU A 1 9  ? 7.790  33.546 25.651  1.00 30.85 ? 8   LEU A O   1 
ATOM   50  C CB  . LEU A 1 9  ? 8.087  36.528 26.834  1.00 24.21 ? 8   LEU A CB  1 
ATOM   51  C CG  . LEU A 1 9  ? 9.542  36.037 26.734  1.00 28.17 ? 8   LEU A CG  1 
ATOM   52  C CD1 . LEU A 1 9  ? 10.037 35.854 25.289  1.00 26.45 ? 8   LEU A CD1 1 
ATOM   53  C CD2 . LEU A 1 9  ? 10.476 36.962 27.504  1.00 28.74 ? 8   LEU A CD2 1 
ATOM   54  N N   . GLN A 1 10 ? 6.210  33.830 27.225  1.00 29.10 ? 9   GLN A N   1 
ATOM   55  C CA  . GLN A 1 10 ? 6.163  32.393 27.489  1.00 30.59 ? 9   GLN A CA  1 
ATOM   56  C C   . GLN A 1 10 ? 5.483  31.666 26.330  1.00 28.75 ? 9   GLN A C   1 
ATOM   57  O O   . GLN A 1 10 ? 5.848  30.543 25.981  1.00 30.56 ? 9   GLN A O   1 
ATOM   58  C CB  . GLN A 1 10 ? 5.449  32.090 28.803  1.00 30.25 ? 9   GLN A CB  1 
ATOM   59  C CG  . GLN A 1 10 ? 5.535  30.626 29.228  1.00 30.35 ? 9   GLN A CG  1 
ATOM   60  C CD  . GLN A 1 10 ? 6.976  30.135 29.367  1.00 40.93 ? 9   GLN A CD  1 
ATOM   61  O OE1 . GLN A 1 10 ? 7.770  30.702 30.123  1.00 44.66 ? 9   GLN A OE1 1 
ATOM   62  N NE2 . GLN A 1 10 ? 7.316  29.078 28.630  1.00 34.82 ? 9   GLN A NE2 1 
ATOM   63  N N   . LYS A 1 11 ? 4.507  32.329 25.731  1.00 28.57 ? 10  LYS A N   1 
ATOM   64  C CA  . LYS A 1 11 ? 3.832  31.807 24.565  1.00 27.85 ? 10  LYS A CA  1 
ATOM   65  C C   . LYS A 1 11 ? 4.846  31.635 23.439  1.00 31.28 ? 10  LYS A C   1 
ATOM   66  O O   . LYS A 1 11 ? 4.821  30.640 22.710  1.00 31.78 ? 10  LYS A O   1 
ATOM   67  C CB  . LYS A 1 11 ? 2.690  32.742 24.143  1.00 30.14 ? 10  LYS A CB  1 
ATOM   68  C CG  . LYS A 1 11 ? 1.627  32.090 23.265  1.00 31.34 ? 10  LYS A CG  1 
ATOM   69  N N   . ALA A 1 12 ? 5.757  32.596 23.317  1.00 30.12 ? 11  ALA A N   1 
ATOM   70  C CA  . ALA A 1 12 ? 6.723  32.596 22.223  1.00 31.42 ? 11  ALA A CA  1 
ATOM   71  C C   . ALA A 1 12 ? 7.656  31.392 22.330  1.00 30.42 ? 11  ALA A C   1 
ATOM   72  O O   . ALA A 1 12 ? 7.951  30.715 21.335  1.00 27.47 ? 11  ALA A O   1 
ATOM   73  C CB  . ALA A 1 12 ? 7.529  33.914 22.211  1.00 24.62 ? 11  ALA A CB  1 
ATOM   74  N N   . ILE A 1 13 ? 8.099  31.127 23.554  1.00 29.80 ? 12  ILE A N   1 
ATOM   75  C CA  . ILE A 1 13 ? 9.049  30.055 23.832  1.00 31.99 ? 12  ILE A CA  1 
ATOM   76  C C   . ILE A 1 13 ? 8.414  28.684 23.651  1.00 29.26 ? 12  ILE A C   1 
ATOM   77  O O   . ILE A 1 13 ? 9.021  27.771 23.081  1.00 30.25 ? 12  ILE A O   1 
ATOM   78  C CB  . ILE A 1 13 ? 9.615  30.190 25.266  1.00 33.36 ? 12  ILE A CB  1 
ATOM   79  C CG1 . ILE A 1 13 ? 10.528 31.415 25.342  1.00 21.64 ? 12  ILE A CG1 1 
ATOM   80  C CG2 . ILE A 1 13 ? 10.349 28.929 25.705  1.00 20.58 ? 12  ILE A CG2 1 
ATOM   81  C CD1 . ILE A 1 13 ? 10.452 32.103 26.667  1.00 28.17 ? 12  ILE A CD1 1 
ATOM   82  N N   . ASP A 1 14 ? 7.186  28.550 24.133  1.00 29.54 ? 13  ASP A N   1 
ATOM   83  C CA  . ASP A 1 14 ? 6.460  27.294 24.002  1.00 30.61 ? 13  ASP A CA  1 
ATOM   84  C C   . ASP A 1 14 ? 6.230  26.936 22.548  1.00 30.74 ? 13  ASP A C   1 
ATOM   85  O O   . ASP A 1 14 ? 6.559  25.828 22.117  1.00 31.14 ? 13  ASP A O   1 
ATOM   86  C CB  . ASP A 1 14 ? 5.134  27.366 24.751  1.00 27.97 ? 13  ASP A CB  1 
ATOM   87  C CG  . ASP A 1 14 ? 5.322  27.311 26.255  1.00 36.41 ? 13  ASP A CG  1 
ATOM   88  O OD1 . ASP A 1 14 ? 6.387  26.804 26.688  1.00 37.60 ? 13  ASP A OD1 1 
ATOM   89  O OD2 . ASP A 1 14 ? 4.413  27.759 27.000  1.00 42.99 ? 13  ASP A OD2 1 
ATOM   90  N N   . LEU A 1 15 ? 5.678  27.890 21.803  1.00 30.87 ? 14  LEU A N   1 
ATOM   91  C CA  . LEU A 1 15 ? 5.466  27.741 20.372  1.00 29.99 ? 14  LEU A CA  1 
ATOM   92  C C   . LEU A 1 15 ? 6.754  27.360 19.640  1.00 29.14 ? 14  LEU A C   1 
ATOM   93  O O   . LEU A 1 15 ? 6.749  26.445 18.821  1.00 32.48 ? 14  LEU A O   1 
ATOM   94  C CB  . LEU A 1 15 ? 4.901  29.035 19.781  1.00 29.81 ? 14  LEU A CB  1 
ATOM   95  C CG  . LEU A 1 15 ? 3.467  29.422 20.108  1.00 26.53 ? 14  LEU A CG  1 
ATOM   96  C CD1 . LEU A 1 15 ? 3.200  30.847 19.664  1.00 27.73 ? 14  LEU A CD1 1 
ATOM   97  C CD2 . LEU A 1 15 ? 2.533  28.477 19.423  1.00 27.13 ? 14  LEU A CD2 1 
ATOM   98  N N   . ALA A 1 16 ? 7.840  28.078 19.921  1.00 27.98 ? 15  ALA A N   1 
ATOM   99  C CA  . ALA A 1 16 ? 9.130  27.784 19.302  1.00 28.47 ? 15  ALA A CA  1 
ATOM   100 C C   . ALA A 1 16 ? 9.561  26.373 19.660  1.00 30.70 ? 15  ALA A C   1 
ATOM   101 O O   . ALA A 1 16 ? 10.055 25.639 18.813  1.00 29.28 ? 15  ALA A O   1 
ATOM   102 C CB  . ALA A 1 16 ? 10.200 28.796 19.734  1.00 23.31 ? 15  ALA A CB  1 
ATOM   103 N N   . SER A 1 17 ? 9.360  26.001 20.918  1.00 30.56 ? 16  SER A N   1 
ATOM   104 C CA  . SER A 1 17 ? 9.765  24.694 21.393  1.00 30.82 ? 16  SER A CA  1 
ATOM   105 C C   . SER A 1 17 ? 9.068  23.597 20.598  1.00 32.32 ? 16  SER A C   1 
ATOM   106 O O   . SER A 1 17 ? 9.690  22.620 20.158  1.00 30.48 ? 16  SER A O   1 
ATOM   107 C CB  . SER A 1 17 ? 9.455  24.558 22.879  1.00 30.47 ? 16  SER A CB  1 
ATOM   108 O OG  . SER A 1 17 ? 9.673  23.226 23.302  1.00 43.85 ? 16  SER A OG  1 
ATOM   109 N N   . LYS A 1 18 ? 7.766  23.781 20.413  1.00 32.48 ? 17  LYS A N   1 
ATOM   110 C CA  . LYS A 1 18 ? 6.957  22.845 19.651  1.00 34.86 ? 17  LYS A CA  1 
ATOM   111 C C   . LYS A 1 18 ? 7.333  22.880 18.165  1.00 32.15 ? 17  LYS A C   1 
ATOM   112 O O   . LYS A 1 18 ? 7.321  21.848 17.510  1.00 38.46 ? 17  LYS A O   1 
ATOM   113 C CB  . LYS A 1 18 ? 5.462  23.140 19.847  1.00 30.88 ? 17  LYS A CB  1 
ATOM   114 N N   . ALA A 1 19 ? 7.675  24.052 17.642  1.00 25.64 ? 18  ALA A N   1 
ATOM   115 C CA  . ALA A 1 19 ? 8.137  24.165 16.264  1.00 31.43 ? 18  ALA A CA  1 
ATOM   116 C C   . ALA A 1 19 ? 9.372  23.292 16.030  1.00 35.04 ? 18  ALA A C   1 
ATOM   117 O O   . ALA A 1 19 ? 9.439  22.509 15.069  1.00 32.46 ? 18  ALA A O   1 
ATOM   118 C CB  . ALA A 1 19 ? 8.445  25.626 15.921  1.00 28.79 ? 18  ALA A CB  1 
ATOM   119 N N   . ALA A 1 20 ? 10.349 23.454 16.916  1.00 29.86 ? 19  ALA A N   1 
ATOM   120 C CA  . ALA A 1 20 ? 11.570 22.678 16.886  1.00 33.35 ? 19  ALA A CA  1 
ATOM   121 C C   . ALA A 1 20 ? 11.250 21.188 16.906  1.00 39.80 ? 19  ALA A C   1 
ATOM   122 O O   . ALA A 1 20 ? 11.772 20.430 16.085  1.00 35.80 ? 19  ALA A O   1 
ATOM   123 C CB  . ALA A 1 20 ? 12.468 23.048 18.061  1.00 28.89 ? 19  ALA A CB  1 
ATOM   124 N N   . GLN A 1 21 ? 10.395 20.783 17.849  1.00 36.15 ? 20  GLN A N   1 
ATOM   125 C CA  . GLN A 1 21 ? 9.954  19.394 17.944  1.00 35.36 ? 20  GLN A CA  1 
ATOM   126 C C   . GLN A 1 21 ? 9.372  18.943 16.603  1.00 38.10 ? 20  GLN A C   1 
ATOM   127 O O   . GLN A 1 21 ? 9.875  18.010 15.979  1.00 41.04 ? 20  GLN A O   1 
ATOM   128 C CB  . GLN A 1 21 ? 8.930  19.223 19.074  1.00 31.39 ? 20  GLN A CB  1 
ATOM   129 N N   . GLU A 1 22 ? 8.333  19.635 16.148  1.00 36.48 ? 21  GLU A N   1 
ATOM   130 C CA  . GLU A 1 22 ? 7.688  19.323 14.880  1.00 35.84 ? 21  GLU A CA  1 
ATOM   131 C C   . GLU A 1 22 ? 8.646  19.381 13.678  1.00 39.87 ? 21  GLU A C   1 
ATOM   132 O O   . GLU A 1 22 ? 8.582  18.521 12.792  1.00 36.38 ? 21  GLU A O   1 
ATOM   133 C CB  . GLU A 1 22 ? 6.511  20.265 14.670  1.00 36.19 ? 21  GLU A CB  1 
ATOM   134 C CG  . GLU A 1 22 ? 5.358  19.993 15.623  1.00 37.09 ? 21  GLU A CG  1 
ATOM   135 C CD  . GLU A 1 22 ? 4.584  18.737 15.262  1.00 44.42 ? 21  GLU A CD  1 
ATOM   136 O OE1 . GLU A 1 22 ? 3.810  18.769 14.280  1.00 53.75 ? 21  GLU A OE1 1 
ATOM   137 O OE2 . GLU A 1 22 ? 4.750  17.716 15.952  1.00 41.85 ? 21  GLU A OE2 1 
ATOM   138 N N   . ASP A 1 23 ? 9.529  20.379 13.655  1.00 36.47 ? 22  ASP A N   1 
ATOM   139 C CA  . ASP A 1 23 ? 10.578 20.469 12.631  1.00 34.82 ? 22  ASP A CA  1 
ATOM   140 C C   . ASP A 1 23 ? 11.370 19.155 12.514  1.00 38.67 ? 22  ASP A C   1 
ATOM   141 O O   . ASP A 1 23 ? 11.405 18.531 11.453  1.00 40.41 ? 22  ASP A O   1 
ATOM   142 C CB  . ASP A 1 23 ? 11.530 21.632 12.950  1.00 35.55 ? 22  ASP A CB  1 
ATOM   143 C CG  . ASP A 1 23 ? 12.424 22.019 11.775  1.00 35.81 ? 22  ASP A CG  1 
ATOM   144 O OD1 . ASP A 1 23 ? 12.592 21.222 10.830  1.00 34.00 ? 22  ASP A OD1 1 
ATOM   145 O OD2 . ASP A 1 23 ? 12.979 23.133 11.809  1.00 35.97 ? 22  ASP A OD2 1 
ATOM   146 N N   . LYS A 1 24 ? 11.993 18.740 13.615  1.00 40.01 ? 23  LYS A N   1 
ATOM   147 C CA  . LYS A 1 24 ? 12.824 17.538 13.652  1.00 36.95 ? 23  LYS A CA  1 
ATOM   148 C C   . LYS A 1 24 ? 12.025 16.287 13.309  1.00 39.97 ? 23  LYS A C   1 
ATOM   149 O O   . LYS A 1 24 ? 12.587 15.308 12.822  1.00 46.06 ? 23  LYS A O   1 
ATOM   150 C CB  . LYS A 1 24 ? 13.479 17.375 15.030  1.00 35.58 ? 23  LYS A CB  1 
ATOM   151 C CG  . LYS A 1 24 ? 14.563 18.406 15.338  1.00 41.62 ? 23  LYS A CG  1 
ATOM   152 N N   . ALA A 1 25 ? 10.716 16.331 13.547  1.00 41.62 ? 24  ALA A N   1 
ATOM   153 C CA  . ALA A 1 25 ? 9.832  15.200 13.243  1.00 44.30 ? 24  ALA A CA  1 
ATOM   154 C C   . ALA A 1 25 ? 9.445  15.133 11.763  1.00 47.36 ? 24  ALA A C   1 
ATOM   155 O O   . ALA A 1 25 ? 8.856  14.148 11.309  1.00 49.82 ? 24  ALA A O   1 
ATOM   156 C CB  . ALA A 1 25 ? 8.571  15.259 14.104  1.00 32.80 ? 24  ALA A CB  1 
ATOM   157 N N   . GLY A 1 26 ? 9.755  16.181 11.010  1.00 44.95 ? 25  GLY A N   1 
ATOM   158 C CA  . GLY A 1 26 ? 9.482  16.160 9.586   1.00 48.35 ? 25  GLY A CA  1 
ATOM   159 C C   . GLY A 1 26 ? 8.086  16.607 9.198   1.00 45.40 ? 25  GLY A C   1 
ATOM   160 O O   . GLY A 1 26 ? 7.740  16.581 8.015   1.00 47.79 ? 25  GLY A O   1 
ATOM   161 N N   . ASN A 1 27 ? 7.285  16.997 10.190  1.00 42.44 ? 26  ASN A N   1 
ATOM   162 C CA  . ASN A 1 27 ? 6.030  17.712 9.938   1.00 43.79 ? 26  ASN A CA  1 
ATOM   163 C C   . ASN A 1 27 ? 6.325  19.197 9.658   1.00 44.31 ? 26  ASN A C   1 
ATOM   164 O O   . ASN A 1 27 ? 6.184  20.067 10.536  1.00 42.20 ? 26  ASN A O   1 
ATOM   165 C CB  . ASN A 1 27 ? 5.072  17.560 11.124  1.00 46.67 ? 26  ASN A CB  1 
ATOM   166 C CG  . ASN A 1 27 ? 5.075  16.147 11.707  1.00 51.38 ? 26  ASN A CG  1 
ATOM   167 O OD1 . ASN A 1 27 ? 5.605  15.212 11.102  1.00 51.53 ? 26  ASN A OD1 1 
ATOM   168 N ND2 . ASN A 1 27 ? 4.483  15.992 12.889  1.00 50.44 ? 26  ASN A ND2 1 
ATOM   169 N N   . TYR A 1 28 ? 6.763  19.474 8.435   1.00 38.76 ? 27  TYR A N   1 
ATOM   170 C CA  . TYR A 1 28 ? 7.245  20.799 8.084   1.00 41.33 ? 27  TYR A CA  1 
ATOM   171 C C   . TYR A 1 28 ? 6.132  21.834 8.002   1.00 38.51 ? 27  TYR A C   1 
ATOM   172 O O   . TYR A 1 28 ? 6.356  23.009 8.318   1.00 39.63 ? 27  TYR A O   1 
ATOM   173 C CB  . TYR A 1 28 ? 8.009  20.752 6.766   1.00 35.35 ? 27  TYR A CB  1 
ATOM   174 C CG  . TYR A 1 28 ? 9.341  20.089 6.902   1.00 35.09 ? 27  TYR A CG  1 
ATOM   175 C CD1 . TYR A 1 28 ? 9.938  19.951 8.149   1.00 37.53 ? 27  TYR A CD1 1 
ATOM   176 C CD2 . TYR A 1 28 ? 10.007 19.597 5.794   1.00 37.67 ? 27  TYR A CD2 1 
ATOM   177 C CE1 . TYR A 1 28 ? 11.175 19.342 8.287   1.00 35.90 ? 27  TYR A CE1 1 
ATOM   178 C CE2 . TYR A 1 28 ? 11.239 18.985 5.916   1.00 44.38 ? 27  TYR A CE2 1 
ATOM   179 C CZ  . TYR A 1 28 ? 11.823 18.860 7.168   1.00 39.59 ? 27  TYR A CZ  1 
ATOM   180 O OH  . TYR A 1 28 ? 13.052 18.251 7.292   1.00 37.28 ? 27  TYR A OH  1 
ATOM   181 N N   . GLU A 1 29 ? 4.943  21.413 7.578   1.00 38.18 ? 28  GLU A N   1 
ATOM   182 C CA  . GLU A 1 29 ? 3.819  22.342 7.466   1.00 38.14 ? 28  GLU A CA  1 
ATOM   183 C C   . GLU A 1 29 ? 3.407  22.831 8.854   1.00 36.41 ? 28  GLU A C   1 
ATOM   184 O O   . GLU A 1 29 ? 3.210  24.028 9.062   1.00 35.83 ? 28  GLU A O   1 
ATOM   185 C CB  . GLU A 1 29 ? 2.635  21.695 6.745   1.00 35.79 ? 28  GLU A CB  1 
ATOM   186 N N   . GLU A 1 30 ? 3.313  21.911 9.811   1.00 39.93 ? 29  GLU A N   1 
ATOM   187 C CA  . GLU A 1 30 ? 2.987  22.289 11.183  1.00 40.53 ? 29  GLU A CA  1 
ATOM   188 C C   . GLU A 1 30 ? 4.115  23.123 11.782  1.00 36.12 ? 29  GLU A C   1 
ATOM   189 O O   . GLU A 1 30 ? 3.863  24.146 12.405  1.00 33.84 ? 29  GLU A O   1 
ATOM   190 C CB  . GLU A 1 30 ? 2.718  21.058 12.048  1.00 40.14 ? 29  GLU A CB  1 
ATOM   191 C CG  . GLU A 1 30 ? 1.949  21.366 13.332  1.00 41.86 ? 29  GLU A CG  1 
ATOM   192 N N   . ALA A 1 31 ? 5.355  22.686 11.573  1.00 36.35 ? 30  ALA A N   1 
ATOM   193 C CA  . ALA A 1 31 ? 6.525  23.405 12.071  1.00 33.52 ? 30  ALA A CA  1 
ATOM   194 C C   . ALA A 1 31 ? 6.521  24.860 11.625  1.00 34.54 ? 30  ALA A C   1 
ATOM   195 O O   . ALA A 1 31 ? 6.711  25.771 12.434  1.00 33.28 ? 30  ALA A O   1 
ATOM   196 C CB  . ALA A 1 31 ? 7.805  22.719 11.609  1.00 35.39 ? 30  ALA A CB  1 
ATOM   197 N N   . LEU A 1 32 ? 6.295  25.070 10.334  1.00 30.91 ? 31  LEU A N   1 
ATOM   198 C CA  . LEU A 1 32 ? 6.325  26.401 9.770   1.00 30.18 ? 31  LEU A CA  1 
ATOM   199 C C   . LEU A 1 32 ? 5.336  27.335 10.456  1.00 29.77 ? 31  LEU A C   1 
ATOM   200 O O   . LEU A 1 32 ? 5.663  28.475 10.754  1.00 33.98 ? 31  LEU A O   1 
ATOM   201 C CB  . LEU A 1 32 ? 6.038  26.337 8.275   1.00 34.08 ? 31  LEU A CB  1 
ATOM   202 C CG  . LEU A 1 32 ? 5.696  27.677 7.629   1.00 28.73 ? 31  LEU A CG  1 
ATOM   203 C CD1 . LEU A 1 32 ? 6.885  28.643 7.697   1.00 29.99 ? 31  LEU A CD1 1 
ATOM   204 C CD2 . LEU A 1 32 ? 5.233  27.453 6.206   1.00 26.25 ? 31  LEU A CD2 1 
ATOM   205 N N   . GLN A 1 33 ? 4.129  26.851 10.710  1.00 28.90 ? 32  GLN A N   1 
ATOM   206 C CA  . GLN A 1 33 ? 3.121  27.672 11.368  1.00 34.48 ? 32  GLN A CA  1 
ATOM   207 C C   . GLN A 1 33 ? 3.550  27.994 12.805  1.00 32.49 ? 32  GLN A C   1 
ATOM   208 O O   . GLN A 1 33 ? 3.435  29.129 13.259  1.00 31.49 ? 32  GLN A O   1 
ATOM   209 C CB  . GLN A 1 33 ? 1.751  26.977 11.342  1.00 30.25 ? 32  GLN A CB  1 
ATOM   210 N N   . LEU A 1 34 ? 4.072  26.996 13.505  1.00 32.31 ? 33  LEU A N   1 
ATOM   211 C CA  . LEU A 1 34 ? 4.572  27.191 14.856  1.00 32.74 ? 33  LEU A CA  1 
ATOM   212 C C   . LEU A 1 34 ? 5.728  28.200 14.920  1.00 35.88 ? 33  LEU A C   1 
ATOM   213 O O   . LEU A 1 34 ? 5.761  29.047 15.818  1.00 35.90 ? 33  LEU A O   1 
ATOM   214 C CB  . LEU A 1 34 ? 5.002  25.859 15.441  1.00 30.64 ? 33  LEU A CB  1 
ATOM   215 C CG  . LEU A 1 34 ? 3.842  24.886 15.643  1.00 31.40 ? 33  LEU A CG  1 
ATOM   216 C CD1 . LEU A 1 34 ? 4.341  23.496 15.992  1.00 31.31 ? 33  LEU A CD1 1 
ATOM   217 C CD2 . LEU A 1 34 ? 2.930  25.400 16.723  1.00 24.22 ? 33  LEU A CD2 1 
ATOM   218 N N   . TYR A 1 35 ? 6.659  28.128 13.970  1.00 30.11 ? 34  TYR A N   1 
ATOM   219 C CA  . TYR A 1 35 ? 7.765  29.082 13.942  1.00 29.60 ? 34  TYR A CA  1 
ATOM   220 C C   . TYR A 1 35 ? 7.227  30.478 13.749  1.00 32.39 ? 34  TYR A C   1 
ATOM   221 O O   . TYR A 1 35 ? 7.638  31.404 14.448  1.00 32.63 ? 34  TYR A O   1 
ATOM   222 C CB  . TYR A 1 35 ? 8.768  28.772 12.828  1.00 34.09 ? 34  TYR A CB  1 
ATOM   223 C CG  . TYR A 1 35 ? 9.744  27.656 13.133  1.00 34.25 ? 34  TYR A CG  1 
ATOM   224 C CD1 . TYR A 1 35 ? 10.595 27.729 14.229  1.00 33.81 ? 34  TYR A CD1 1 
ATOM   225 C CD2 . TYR A 1 35 ? 9.827  26.539 12.311  1.00 32.16 ? 34  TYR A CD2 1 
ATOM   226 C CE1 . TYR A 1 35 ? 11.489 26.716 14.508  1.00 32.65 ? 34  TYR A CE1 1 
ATOM   227 C CE2 . TYR A 1 35 ? 10.718 25.517 12.581  1.00 39.07 ? 34  TYR A CE2 1 
ATOM   228 C CZ  . TYR A 1 35 ? 11.551 25.609 13.680  1.00 38.16 ? 34  TYR A CZ  1 
ATOM   229 O OH  . TYR A 1 35 ? 12.449 24.594 13.942  1.00 33.68 ? 34  TYR A OH  1 
ATOM   230 N N   . GLN A 1 36 ? 6.299  30.612 12.804  1.00 31.16 ? 35  GLN A N   1 
ATOM   231 C CA  . GLN A 1 36 ? 5.757  31.912 12.417  1.00 35.16 ? 35  GLN A CA  1 
ATOM   232 C C   . GLN A 1 36 ? 5.066  32.605 13.588  1.00 35.43 ? 35  GLN A C   1 
ATOM   233 O O   . GLN A 1 36 ? 5.224  33.813 13.803  1.00 34.97 ? 35  GLN A O   1 
ATOM   234 C CB  . GLN A 1 36 ? 4.775  31.762 11.252  1.00 31.82 ? 35  GLN A CB  1 
ATOM   235 C CG  . GLN A 1 36 ? 4.019  33.049 10.928  1.00 43.18 ? 35  GLN A CG  1 
ATOM   236 C CD  . GLN A 1 36 ? 2.946  32.861 9.861   1.00 54.06 ? 35  GLN A CD  1 
ATOM   237 O OE1 . GLN A 1 36 ? 3.216  32.347 8.770   1.00 58.36 ? 35  GLN A OE1 1 
ATOM   238 N NE2 . GLN A 1 36 ? 1.717  33.266 10.180  1.00 42.39 ? 35  GLN A NE2 1 
ATOM   239 N N   . HIS A 1 37 ? 4.306  31.827 14.346  1.00 32.32 ? 36  HIS A N   1 
ATOM   240 C CA  . HIS A 1 37 ? 3.550  32.361 15.464  1.00 33.20 ? 36  HIS A CA  1 
ATOM   241 C C   . HIS A 1 37 ? 4.454  32.665 16.641  1.00 32.09 ? 36  HIS A C   1 
ATOM   242 O O   . HIS A 1 37 ? 4.202  33.604 17.399  1.00 31.40 ? 36  HIS A O   1 
ATOM   243 C CB  . HIS A 1 37 ? 2.445  31.388 15.859  1.00 30.49 ? 36  HIS A CB  1 
ATOM   244 C CG  . HIS A 1 37 ? 1.285  31.406 14.915  1.00 32.91 ? 36  HIS A CG  1 
ATOM   245 N ND1 . HIS A 1 37 ? 0.512  30.300 14.656  1.00 37.33 ? 36  HIS A ND1 1 
ATOM   246 C CD2 . HIS A 1 37 ? 0.777  32.410 14.163  1.00 35.05 ? 36  HIS A CD2 1 
ATOM   247 C CE1 . HIS A 1 37 ? -0.428 30.619 13.784  1.00 42.53 ? 36  HIS A CE1 1 
ATOM   248 N NE2 . HIS A 1 37 ? -0.291 31.893 13.470  1.00 38.33 ? 36  HIS A NE2 1 
ATOM   249 N N   . ALA A 1 38 ? 5.515  31.875 16.772  1.00 31.09 ? 37  ALA A N   1 
ATOM   250 C CA  . ALA A 1 38 ? 6.539  32.157 17.757  1.00 31.46 ? 37  ALA A CA  1 
ATOM   251 C C   . ALA A 1 38 ? 7.147  33.518 17.449  1.00 29.64 ? 37  ALA A C   1 
ATOM   252 O O   . ALA A 1 38 ? 7.269  34.364 18.333  1.00 31.06 ? 37  ALA A O   1 
ATOM   253 C CB  . ALA A 1 38 ? 7.615  31.061 17.769  1.00 28.58 ? 37  ALA A CB  1 
ATOM   254 N N   . VAL A 1 39 ? 7.510  33.740 16.190  1.00 28.55 ? 38  VAL A N   1 
ATOM   255 C CA  . VAL A 1 39 ? 8.136  35.000 15.805  1.00 29.57 ? 38  VAL A CA  1 
ATOM   256 C C   . VAL A 1 39 ? 7.183  36.161 16.070  1.00 31.07 ? 38  VAL A C   1 
ATOM   257 O O   . VAL A 1 39 ? 7.601  37.227 16.538  1.00 29.98 ? 38  VAL A O   1 
ATOM   258 C CB  . VAL A 1 39 ? 8.578  34.974 14.332  1.00 31.70 ? 38  VAL A CB  1 
ATOM   259 C CG1 . VAL A 1 39 ? 8.899  36.370 13.827  1.00 26.03 ? 38  VAL A CG1 1 
ATOM   260 C CG2 . VAL A 1 39 ? 9.786  34.036 14.179  1.00 28.79 ? 38  VAL A CG2 1 
ATOM   261 N N   . GLN A 1 40 ? 5.898  35.926 15.822  1.00 28.58 ? 39  GLN A N   1 
ATOM   262 C CA  . GLN A 1 40 ? 4.872  36.931 16.051  1.00 29.59 ? 39  GLN A CA  1 
ATOM   263 C C   . GLN A 1 40 ? 4.837  37.368 17.507  1.00 30.23 ? 39  GLN A C   1 
ATOM   264 O O   . GLN A 1 40 ? 4.621  38.542 17.810  1.00 29.56 ? 39  GLN A O   1 
ATOM   265 C CB  . GLN A 1 40 ? 3.504  36.396 15.646  1.00 33.08 ? 39  GLN A CB  1 
ATOM   266 C CG  . GLN A 1 40 ? 2.377  37.386 15.836  1.00 31.21 ? 39  GLN A CG  1 
ATOM   267 C CD  . GLN A 1 40 ? 1.015  36.722 15.781  1.00 40.24 ? 39  GLN A CD  1 
ATOM   268 O OE1 . GLN A 1 40 ? 0.852  35.571 16.184  1.00 34.15 ? 39  GLN A OE1 1 
ATOM   269 N NE2 . GLN A 1 40 ? 0.029  37.446 15.270  1.00 51.63 ? 39  GLN A NE2 1 
ATOM   270 N N   . TYR A 1 41 ? 5.042  36.418 18.411  1.00 30.13 ? 40  TYR A N   1 
ATOM   271 C CA  . TYR A 1 41 ? 5.024  36.739 19.828  1.00 25.02 ? 40  TYR A CA  1 
ATOM   272 C C   . TYR A 1 41 ? 6.327  37.357 20.299  1.00 28.10 ? 40  TYR A C   1 
ATOM   273 O O   . TYR A 1 41 ? 6.308  38.239 21.154  1.00 25.31 ? 40  TYR A O   1 
ATOM   274 C CB  . TYR A 1 41 ? 4.682  35.502 20.645  1.00 27.80 ? 40  TYR A CB  1 
ATOM   275 C CG  . TYR A 1 41 ? 3.202  35.371 20.737  1.00 30.59 ? 40  TYR A CG  1 
ATOM   276 C CD1 . TYR A 1 41 ? 2.494  36.018 21.743  1.00 31.42 ? 40  TYR A CD1 1 
ATOM   277 C CD2 . TYR A 1 41 ? 2.492  34.680 19.770  1.00 32.47 ? 40  TYR A CD2 1 
ATOM   278 C CE1 . TYR A 1 41 ? 1.114  35.937 21.811  1.00 32.21 ? 40  TYR A CE1 1 
ATOM   279 C CE2 . TYR A 1 41 ? 1.110  34.598 19.824  1.00 37.36 ? 40  TYR A CE2 1 
ATOM   280 C CZ  . TYR A 1 41 ? 0.429  35.226 20.847  1.00 33.66 ? 40  TYR A CZ  1 
ATOM   281 O OH  . TYR A 1 41 ? -0.936 35.141 20.898  1.00 31.91 ? 40  TYR A OH  1 
ATOM   282 N N   . PHE A 1 42 ? 7.445  36.916 19.722  1.00 23.69 ? 41  PHE A N   1 
ATOM   283 C CA  . PHE A 1 42 ? 8.741  37.447 20.089  1.00 23.28 ? 41  PHE A CA  1 
ATOM   284 C C   . PHE A 1 42 ? 8.838  38.911 19.694  1.00 27.88 ? 41  PHE A C   1 
ATOM   285 O O   . PHE A 1 42 ? 9.351  39.729 20.458  1.00 30.06 ? 41  PHE A O   1 
ATOM   286 C CB  . PHE A 1 42 ? 9.865  36.646 19.434  1.00 28.07 ? 41  PHE A CB  1 
ATOM   287 C CG  . PHE A 1 42 ? 10.262 35.402 20.190  1.00 26.67 ? 41  PHE A CG  1 
ATOM   288 C CD1 . PHE A 1 42 ? 10.698 35.478 21.505  1.00 22.42 ? 41  PHE A CD1 1 
ATOM   289 C CD2 . PHE A 1 42 ? 10.246 34.155 19.562  1.00 29.24 ? 41  PHE A CD2 1 
ATOM   290 C CE1 . PHE A 1 42 ? 11.083 34.333 22.197  1.00 24.95 ? 41  PHE A CE1 1 
ATOM   291 C CE2 . PHE A 1 42 ? 10.636 33.005 20.247  1.00 28.62 ? 41  PHE A CE2 1 
ATOM   292 C CZ  . PHE A 1 42 ? 11.049 33.100 21.567  1.00 26.49 ? 41  PHE A CZ  1 
ATOM   293 N N   . LEU A 1 43 ? 8.335  39.237 18.504  1.00 29.00 ? 42  LEU A N   1 
ATOM   294 C CA  . LEU A 1 43 ? 8.313  40.620 18.031  1.00 27.42 ? 42  LEU A CA  1 
ATOM   295 C C   . LEU A 1 43 ? 7.445  41.494 18.919  1.00 27.92 ? 42  LEU A C   1 
ATOM   296 O O   . LEU A 1 43 ? 7.833  42.609 19.284  1.00 25.56 ? 42  LEU A O   1 
ATOM   297 C CB  . LEU A 1 43 ? 7.818  40.703 16.584  1.00 21.32 ? 42  LEU A CB  1 
ATOM   298 C CG  . LEU A 1 43 ? 8.860  40.273 15.545  1.00 32.50 ? 42  LEU A CG  1 
ATOM   299 C CD1 . LEU A 1 43 ? 8.274  40.415 14.161  1.00 38.22 ? 42  LEU A CD1 1 
ATOM   300 C CD2 . LEU A 1 43 ? 10.176 41.056 15.648  1.00 25.45 ? 42  LEU A CD2 1 
ATOM   301 N N   . HIS A 1 44 ? 6.271  40.984 19.270  1.00 27.86 ? 43  HIS A N   1 
ATOM   302 C CA  . HIS A 1 44 ? 5.366  41.751 20.111  1.00 29.82 ? 43  HIS A CA  1 
ATOM   303 C C   . HIS A 1 44 ? 5.998  42.088 21.463  1.00 31.36 ? 43  HIS A C   1 
ATOM   304 O O   . HIS A 1 44 ? 5.953  43.230 21.926  1.00 29.14 ? 43  HIS A O   1 
ATOM   305 C CB  . HIS A 1 44 ? 4.070  41.002 20.344  1.00 27.30 ? 43  HIS A CB  1 
ATOM   306 C CG  . HIS A 1 44 ? 3.079  41.801 21.113  1.00 31.00 ? 43  HIS A CG  1 
ATOM   307 N ND1 . HIS A 1 44 ? 2.291  42.768 20.528  1.00 33.97 ? 43  HIS A ND1 1 
ATOM   308 C CD2 . HIS A 1 44 ? 2.788  41.824 22.436  1.00 31.90 ? 43  HIS A CD2 1 
ATOM   309 C CE1 . HIS A 1 44 ? 1.540  43.336 21.451  1.00 33.70 ? 43  HIS A CE1 1 
ATOM   310 N NE2 . HIS A 1 44 ? 1.818  42.778 22.618  1.00 32.30 ? 43  HIS A NE2 1 
ATOM   311 N N   . VAL A 1 45 ? 6.592  41.075 22.077  1.00 25.67 ? 44  VAL A N   1 
ATOM   312 C CA  . VAL A 1 45 ? 7.237  41.231 23.355  1.00 28.06 ? 44  VAL A CA  1 
ATOM   313 C C   . VAL A 1 45 ? 8.351  42.254 23.262  1.00 34.13 ? 44  VAL A C   1 
ATOM   314 O O   . VAL A 1 45 ? 8.416  43.184 24.077  1.00 30.75 ? 44  VAL A O   1 
ATOM   315 C CB  . VAL A 1 45 ? 7.814  39.891 23.859  1.00 33.06 ? 44  VAL A CB  1 
ATOM   316 C CG1 . VAL A 1 45 ? 8.806  40.111 25.005  1.00 27.95 ? 44  VAL A CG1 1 
ATOM   317 C CG2 . VAL A 1 45 ? 6.693  38.939 24.259  1.00 29.99 ? 44  VAL A CG2 1 
ATOM   318 N N   . VAL A 1 46 ? 9.220  42.102 22.262  1.00 30.81 ? 45  VAL A N   1 
ATOM   319 C CA  . VAL A 1 46 ? 10.416 42.933 22.231  1.00 31.74 ? 45  VAL A CA  1 
ATOM   320 C C   . VAL A 1 46 ? 10.065 44.397 21.962  1.00 29.93 ? 45  VAL A C   1 
ATOM   321 O O   . VAL A 1 46 ? 10.744 45.288 22.461  1.00 30.97 ? 45  VAL A O   1 
ATOM   322 C CB  . VAL A 1 46 ? 11.460 42.430 21.201  1.00 32.39 ? 45  VAL A CB  1 
ATOM   323 C CG1 . VAL A 1 46 ? 11.173 42.948 19.777  1.00 25.96 ? 45  VAL A CG1 1 
ATOM   324 C CG2 . VAL A 1 46 ? 12.866 42.840 21.659  1.00 31.69 ? 45  VAL A CG2 1 
ATOM   325 N N   . LYS A 1 47 ? 8.987  44.640 21.217  1.00 27.03 ? 46  LYS A N   1 
ATOM   326 C CA  . LYS A 1 47 ? 8.588  45.997 20.889  1.00 26.52 ? 46  LYS A CA  1 
ATOM   327 C C   . LYS A 1 47 ? 7.789  46.650 22.007  1.00 32.47 ? 46  LYS A C   1 
ATOM   328 O O   . LYS A 1 47 ? 8.048  47.789 22.371  1.00 29.03 ? 46  LYS A O   1 
ATOM   329 C CB  . LYS A 1 47 ? 7.782  46.019 19.592  1.00 27.81 ? 46  LYS A CB  1 
ATOM   330 C CG  . LYS A 1 47 ? 8.612  45.594 18.399  1.00 28.71 ? 46  LYS A CG  1 
ATOM   331 C CD  . LYS A 1 47 ? 7.980  45.949 17.075  1.00 30.87 ? 46  LYS A CD  1 
ATOM   332 C CE  . LYS A 1 47 ? 6.753  45.129 16.776  1.00 37.53 ? 46  LYS A CE  1 
ATOM   333 N NZ  . LYS A 1 47 ? 6.491  45.180 15.308  1.00 43.35 ? 46  LYS A NZ  1 
ATOM   334 N N   . TYR A 1 48 ? 6.825  45.933 22.573  1.00 34.52 ? 47  TYR A N   1 
ATOM   335 C CA  . TYR A 1 48 ? 5.861  46.602 23.443  1.00 35.58 ? 47  TYR A CA  1 
ATOM   336 C C   . TYR A 1 48 ? 5.927  46.181 24.913  1.00 33.24 ? 47  TYR A C   1 
ATOM   337 O O   . TYR A 1 48 ? 5.243  46.743 25.763  1.00 29.85 ? 47  TYR A O   1 
ATOM   338 C CB  . TYR A 1 48 ? 4.464  46.395 22.869  1.00 28.89 ? 47  TYR A CB  1 
ATOM   339 C CG  . TYR A 1 48 ? 4.369  46.983 21.481  1.00 35.05 ? 47  TYR A CG  1 
ATOM   340 C CD1 . TYR A 1 48 ? 4.800  48.286 21.232  1.00 31.36 ? 47  TYR A CD1 1 
ATOM   341 C CD2 . TYR A 1 48 ? 3.896  46.230 20.405  1.00 36.50 ? 47  TYR A CD2 1 
ATOM   342 C CE1 . TYR A 1 48 ? 4.722  48.840 19.959  1.00 30.33 ? 47  TYR A CE1 1 
ATOM   343 C CE2 . TYR A 1 48 ? 3.818  46.775 19.127  1.00 33.72 ? 47  TYR A CE2 1 
ATOM   344 C CZ  . TYR A 1 48 ? 4.234  48.084 18.911  1.00 36.15 ? 47  TYR A CZ  1 
ATOM   345 O OH  . TYR A 1 48 ? 4.170  48.630 17.646  1.00 35.85 ? 47  TYR A OH  1 
ATOM   346 N N   . GLU A 1 49 ? 6.774  45.219 25.226  1.00 30.93 ? 48  GLU A N   1 
ATOM   347 C CA  . GLU A 1 49 ? 7.010  44.922 26.626  1.00 32.75 ? 48  GLU A CA  1 
ATOM   348 C C   . GLU A 1 49 ? 8.419  45.372 27.006  1.00 33.72 ? 48  GLU A C   1 
ATOM   349 O O   . GLU A 1 49 ? 9.339  45.400 26.180  1.00 38.60 ? 48  GLU A O   1 
ATOM   350 C CB  . GLU A 1 49 ? 6.776  43.434 26.918  1.00 26.57 ? 48  GLU A CB  1 
ATOM   351 C CG  . GLU A 1 49 ? 5.389  42.968 26.492  1.00 27.58 ? 48  GLU A CG  1 
ATOM   352 C CD  . GLU A 1 49 ? 5.018  41.590 27.028  1.00 36.88 ? 48  GLU A CD  1 
ATOM   353 O OE1 . GLU A 1 49 ? 5.901  40.933 27.616  1.00 41.31 ? 48  GLU A OE1 1 
ATOM   354 O OE2 . GLU A 1 49 ? 3.844  41.163 26.873  1.00 33.84 ? 48  GLU A OE2 1 
ATOM   355 N N   . ALA A 1 50 ? 8.563  45.765 28.261  1.00 37.35 ? 49  ALA A N   1 
ATOM   356 C CA  . ALA A 1 50 ? 9.812  46.305 28.775  1.00 43.41 ? 49  ALA A CA  1 
ATOM   357 C C   . ALA A 1 50 ? 10.843 45.227 29.124  1.00 40.20 ? 49  ALA A C   1 
ATOM   358 O O   . ALA A 1 50 ? 10.559 44.305 29.895  1.00 45.82 ? 49  ALA A O   1 
ATOM   359 C CB  . ALA A 1 50 ? 9.521  47.164 30.001  1.00 41.85 ? 49  ALA A CB  1 
ATOM   360 N N   . GLN A 1 51 ? 12.043 45.351 28.569  1.00 41.23 ? 50  GLN A N   1 
ATOM   361 C CA  . GLN A 1 51 ? 13.145 44.478 28.978  1.00 41.32 ? 50  GLN A CA  1 
ATOM   362 C C   . GLN A 1 51 ? 14.505 45.133 28.780  1.00 38.36 ? 50  GLN A C   1 
ATOM   363 O O   . GLN A 1 51 ? 14.652 46.090 28.010  1.00 41.48 ? 50  GLN A O   1 
ATOM   364 C CB  . GLN A 1 51 ? 13.104 43.152 28.217  1.00 41.81 ? 50  GLN A CB  1 
ATOM   365 C CG  . GLN A 1 51 ? 13.325 43.287 26.715  1.00 41.83 ? 50  GLN A CG  1 
ATOM   366 C CD  . GLN A 1 51 ? 12.070 43.707 25.975  1.00 40.43 ? 50  GLN A CD  1 
ATOM   367 O OE1 . GLN A 1 51 ? 11.061 43.002 26.011  1.00 38.04 ? 50  GLN A OE1 1 
ATOM   368 N NE2 . GLN A 1 51 ? 12.117 44.872 25.316  1.00 45.54 ? 50  GLN A NE2 1 
ATOM   369 N N   . GLY A 1 52 ? 15.503 44.600 29.474  1.00 34.99 ? 51  GLY A N   1 
ATOM   370 C CA  . GLY A 1 52 ? 16.855 45.094 29.333  1.00 35.93 ? 51  GLY A CA  1 
ATOM   371 C C   . GLY A 1 52 ? 17.457 44.810 27.965  1.00 44.39 ? 51  GLY A C   1 
ATOM   372 O O   . GLY A 1 52 ? 16.925 44.015 27.173  1.00 37.95 ? 51  GLY A O   1 
ATOM   373 N N   . ASP A 1 53 ? 18.583 45.467 27.700  1.00 47.10 ? 52  ASP A N   1 
ATOM   374 C CA  . ASP A 1 53 ? 19.343 45.267 26.472  1.00 45.90 ? 52  ASP A CA  1 
ATOM   375 C C   . ASP A 1 53 ? 19.620 43.796 26.205  1.00 41.77 ? 52  ASP A C   1 
ATOM   376 O O   . ASP A 1 53 ? 19.409 43.303 25.091  1.00 41.22 ? 52  ASP A O   1 
ATOM   377 C CB  . ASP A 1 53 ? 20.668 46.029 26.536  1.00 50.64 ? 52  ASP A CB  1 
ATOM   378 C CG  . ASP A 1 53 ? 20.497 47.522 26.317  1.00 63.91 ? 52  ASP A CG  1 
ATOM   379 O OD1 . ASP A 1 53 ? 21.138 48.320 27.040  1.00 74.77 ? 52  ASP A OD1 1 
ATOM   380 O OD2 . ASP A 1 53 ? 19.726 47.898 25.411  1.00 68.37 ? 52  ASP A OD2 1 
ATOM   381 N N   . LYS A 1 54 ? 20.099 43.101 27.229  1.00 37.41 ? 53  LYS A N   1 
ATOM   382 C CA  . LYS A 1 54 ? 20.468 41.706 27.072  1.00 40.72 ? 53  LYS A CA  1 
ATOM   383 C C   . LYS A 1 54 ? 19.248 40.881 26.663  1.00 40.99 ? 53  LYS A C   1 
ATOM   384 O O   . LYS A 1 54 ? 19.341 39.996 25.811  1.00 38.49 ? 53  LYS A O   1 
ATOM   385 C CB  . LYS A 1 54 ? 21.086 41.164 28.364  1.00 42.19 ? 53  LYS A CB  1 
ATOM   386 N NZ  . LYS A 1 54 ? 27.804 39.808 29.435  1.00 36.60 ? 53  LYS A NZ  1 
ATOM   387 N N   . ALA A 1 55 ? 18.098 41.189 27.254  1.00 39.65 ? 54  ALA A N   1 
ATOM   388 C CA  . ALA A 1 55 ? 16.871 40.503 26.887  1.00 37.81 ? 54  ALA A CA  1 
ATOM   389 C C   . ALA A 1 55 ? 16.505 40.760 25.414  1.00 35.57 ? 54  ALA A C   1 
ATOM   390 O O   . ALA A 1 55 ? 16.205 39.824 24.674  1.00 35.07 ? 54  ALA A O   1 
ATOM   391 C CB  . ALA A 1 55 ? 15.754 40.927 27.799  1.00 37.83 ? 54  ALA A CB  1 
ATOM   392 N N   . LYS A 1 56 ? 16.536 42.025 24.996  1.00 32.16 ? 55  LYS A N   1 
ATOM   393 C CA  . LYS A 1 56 ? 16.235 42.384 23.617  1.00 33.17 ? 55  LYS A CA  1 
ATOM   394 C C   . LYS A 1 56 ? 17.188 41.682 22.636  1.00 34.98 ? 55  LYS A C   1 
ATOM   395 O O   . LYS A 1 56 ? 16.776 41.213 21.571  1.00 30.42 ? 55  LYS A O   1 
ATOM   396 C CB  . LYS A 1 56 ? 16.318 43.896 23.425  1.00 31.07 ? 55  LYS A CB  1 
ATOM   397 C CG  . LYS A 1 56 ? 15.243 44.705 24.113  1.00 38.16 ? 55  LYS A CG  1 
ATOM   398 C CD  . LYS A 1 56 ? 15.503 46.221 23.945  1.00 46.49 ? 55  LYS A CD  1 
ATOM   399 C CE  . LYS A 1 56 ? 14.389 47.073 24.542  1.00 40.26 ? 55  LYS A CE  1 
ATOM   400 N N   . GLN A 1 57 ? 18.462 41.610 23.007  1.00 31.76 ? 56  GLN A N   1 
ATOM   401 C CA  . GLN A 1 57 ? 19.476 41.006 22.159  1.00 26.54 ? 56  GLN A CA  1 
ATOM   402 C C   . GLN A 1 57 ? 19.248 39.493 21.971  1.00 31.44 ? 56  GLN A C   1 
ATOM   403 O O   . GLN A 1 57 ? 19.408 38.960 20.875  1.00 34.39 ? 56  GLN A O   1 
ATOM   404 C CB  . GLN A 1 57 ? 20.860 41.282 22.741  1.00 27.56 ? 56  GLN A CB  1 
ATOM   405 N N   . SER A 1 58 ? 18.867 38.797 23.031  1.00 32.06 ? 57  SER A N   1 
ATOM   406 C CA  . SER A 1 58 ? 18.530 37.382 22.906  1.00 32.61 ? 57  SER A CA  1 
ATOM   407 C C   . SER A 1 58 ? 17.244 37.168 22.100  1.00 33.96 ? 57  SER A C   1 
ATOM   408 O O   . SER A 1 58 ? 17.139 36.191 21.346  1.00 29.78 ? 57  SER A O   1 
ATOM   409 C CB  . SER A 1 58 ? 18.386 36.726 24.284  1.00 34.15 ? 57  SER A CB  1 
ATOM   410 O OG  . SER A 1 58 ? 19.555 36.908 25.056  1.00 43.82 ? 57  SER A OG  1 
ATOM   411 N N   . ILE A 1 59 ? 16.264 38.063 22.253  1.00 31.36 ? 58  ILE A N   1 
ATOM   412 C CA  . ILE A 1 59 ? 15.015 37.891 21.506  1.00 34.12 ? 58  ILE A CA  1 
ATOM   413 C C   . ILE A 1 59 ? 15.279 38.125 20.008  1.00 31.03 ? 58  ILE A C   1 
ATOM   414 O O   . ILE A 1 59 ? 14.812 37.352 19.158  1.00 26.63 ? 58  ILE A O   1 
ATOM   415 C CB  . ILE A 1 59 ? 13.884 38.812 22.035  1.00 26.47 ? 58  ILE A CB  1 
ATOM   416 C CG1 . ILE A 1 59 ? 13.521 38.414 23.463  1.00 24.95 ? 58  ILE A CG1 1 
ATOM   417 C CG2 . ILE A 1 59 ? 12.635 38.703 21.167  1.00 23.37 ? 58  ILE A CG2 1 
ATOM   418 C CD1 . ILE A 1 59 ? 12.553 39.344 24.148  1.00 28.45 ? 58  ILE A CD1 1 
ATOM   419 N N   . ARG A 1 60 ? 16.060 39.161 19.700  1.00 28.15 ? 59  ARG A N   1 
ATOM   420 C CA  . ARG A 1 60 ? 16.467 39.434 18.324  1.00 33.55 ? 59  ARG A CA  1 
ATOM   421 C C   . ARG A 1 60 ? 17.122 38.191 17.708  1.00 33.71 ? 59  ARG A C   1 
ATOM   422 O O   . ARG A 1 60 ? 16.770 37.778 16.596  1.00 31.19 ? 59  ARG A O   1 
ATOM   423 C CB  . ARG A 1 60 ? 17.420 40.642 18.269  1.00 35.32 ? 59  ARG A CB  1 
ATOM   424 C CG  . ARG A 1 60 ? 17.865 41.046 16.865  1.00 37.03 ? 59  ARG A CG  1 
ATOM   425 C CD  . ARG A 1 60 ? 18.637 42.375 16.846  1.00 40.68 ? 59  ARG A CD  1 
ATOM   426 N NE  . ARG A 1 60 ? 17.744 43.528 16.707  1.00 45.65 ? 59  ARG A NE  1 
ATOM   427 N N   . ALA A 1 61 ? 18.049 37.591 18.457  1.00 32.22 ? 60  ALA A N   1 
ATOM   428 C CA  . ALA A 1 61 ? 18.760 36.388 18.031  1.00 33.89 ? 60  ALA A CA  1 
ATOM   429 C C   . ALA A 1 61 ? 17.803 35.247 17.682  1.00 34.40 ? 60  ALA A C   1 
ATOM   430 O O   . ALA A 1 61 ? 17.900 34.647 16.610  1.00 34.44 ? 60  ALA A O   1 
ATOM   431 C CB  . ALA A 1 61 ? 19.745 35.936 19.117  1.00 29.08 ? 60  ALA A CB  1 
ATOM   432 N N   . LYS A 1 62 ? 16.881 34.954 18.589  1.00 31.37 ? 61  LYS A N   1 
ATOM   433 C CA  . LYS A 1 62 ? 15.940 33.864 18.388  1.00 29.65 ? 61  LYS A CA  1 
ATOM   434 C C   . LYS A 1 62 ? 14.978 34.179 17.242  1.00 31.60 ? 61  LYS A C   1 
ATOM   435 O O   . LYS A 1 62 ? 14.607 33.293 16.460  1.00 29.92 ? 61  LYS A O   1 
ATOM   436 C CB  . LYS A 1 62 ? 15.188 33.576 19.693  1.00 28.70 ? 61  LYS A CB  1 
ATOM   437 C CG  . LYS A 1 62 ? 15.535 32.241 20.257  1.00 34.20 ? 61  LYS A CG  1 
ATOM   438 C CD  . LYS A 1 62 ? 16.012 32.292 21.679  1.00 31.88 ? 61  LYS A CD  1 
ATOM   439 C CE  . LYS A 1 62 ? 16.514 30.902 22.057  1.00 31.60 ? 61  LYS A CE  1 
ATOM   440 N NZ  . LYS A 1 62 ? 16.575 30.706 23.528  1.00 39.49 ? 61  LYS A NZ  1 
ATOM   441 N N   . CYS A 1 63 ? 14.592 35.448 17.131  1.00 32.58 ? 62  CYS A N   1 
ATOM   442 C CA  . CYS A 1 63 ? 13.756 35.896 16.020  1.00 31.31 ? 62  CYS A CA  1 
ATOM   443 C C   . CYS A 1 63 ? 14.406 35.609 14.677  1.00 33.82 ? 62  CYS A C   1 
ATOM   444 O O   . CYS A 1 63 ? 13.763 35.124 13.753  1.00 37.94 ? 62  CYS A O   1 
ATOM   445 C CB  . CYS A 1 63 ? 13.470 37.385 16.130  1.00 29.06 ? 62  CYS A CB  1 
ATOM   446 S SG  . CYS A 1 63 ? 11.895 37.708 16.840  1.00 38.16 ? 62  CYS A SG  1 
ATOM   447 N N   . THR A 1 64 ? 15.689 35.925 14.581  1.00 33.02 ? 63  THR A N   1 
ATOM   448 C CA  . THR A 1 64 ? 16.455 35.684 13.380  1.00 31.19 ? 63  THR A CA  1 
ATOM   449 C C   . THR A 1 64 ? 16.511 34.203 13.023  1.00 31.80 ? 63  THR A C   1 
ATOM   450 O O   . THR A 1 64 ? 16.336 33.834 11.864  1.00 29.89 ? 63  THR A O   1 
ATOM   451 C CB  . THR A 1 64 ? 17.865 36.208 13.546  1.00 33.54 ? 63  THR A CB  1 
ATOM   452 O OG1 . THR A 1 64 ? 17.805 37.573 13.975  1.00 34.35 ? 63  THR A OG1 1 
ATOM   453 C CG2 . THR A 1 64 ? 18.633 36.100 12.238  1.00 30.33 ? 63  THR A CG2 1 
ATOM   454 N N   . GLU A 1 65 ? 16.750 33.358 14.018  1.00 28.01 ? 64  GLU A N   1 
ATOM   455 C CA  . GLU A 1 65 ? 16.899 31.930 13.762  1.00 31.69 ? 64  GLU A CA  1 
ATOM   456 C C   . GLU A 1 65 ? 15.595 31.317 13.259  1.00 33.20 ? 64  GLU A C   1 
ATOM   457 O O   . GLU A 1 65 ? 15.587 30.548 12.286  1.00 29.25 ? 64  GLU A O   1 
ATOM   458 C CB  . GLU A 1 65 ? 17.362 31.189 15.017  1.00 26.77 ? 64  GLU A CB  1 
ATOM   459 C CG  . GLU A 1 65 ? 17.909 29.814 14.710  1.00 32.09 ? 64  GLU A CG  1 
ATOM   460 C CD  . GLU A 1 65 ? 17.954 28.905 15.921  1.00 41.45 ? 64  GLU A CD  1 
ATOM   461 O OE1 . GLU A 1 65 ? 17.821 29.409 17.061  1.00 41.42 ? 64  GLU A OE1 1 
ATOM   462 O OE2 . GLU A 1 65 ? 18.116 27.675 15.731  1.00 46.21 ? 64  GLU A OE2 1 
ATOM   463 N N   . TYR A 1 66 ? 14.495 31.686 13.914  1.00 33.57 ? 65  TYR A N   1 
ATOM   464 C CA  . TYR A 1 66 ? 13.190 31.117 13.607  1.00 27.80 ? 65  TYR A CA  1 
ATOM   465 C C   . TYR A 1 66 ? 12.622 31.618 12.285  1.00 29.97 ? 65  TYR A C   1 
ATOM   466 O O   . TYR A 1 66 ? 11.975 30.863 11.577  1.00 32.65 ? 65  TYR A O   1 
ATOM   467 C CB  . TYR A 1 66 ? 12.223 31.390 14.752  1.00 29.47 ? 65  TYR A CB  1 
ATOM   468 C CG  . TYR A 1 66 ? 12.688 30.760 16.044  1.00 29.06 ? 65  TYR A CG  1 
ATOM   469 C CD1 . TYR A 1 66 ? 13.409 29.564 16.030  1.00 31.30 ? 65  TYR A CD1 1 
ATOM   470 C CD2 . TYR A 1 66 ? 12.438 31.362 17.268  1.00 27.94 ? 65  TYR A CD2 1 
ATOM   471 C CE1 . TYR A 1 66 ? 13.859 28.980 17.198  1.00 27.15 ? 65  TYR A CE1 1 
ATOM   472 C CE2 . TYR A 1 66 ? 12.886 30.784 18.453  1.00 32.08 ? 65  TYR A CE2 1 
ATOM   473 C CZ  . TYR A 1 66 ? 13.591 29.594 18.407  1.00 30.65 ? 65  TYR A CZ  1 
ATOM   474 O OH  . TYR A 1 66 ? 14.031 29.021 19.565  1.00 27.23 ? 65  TYR A OH  1 
ATOM   475 N N   . LEU A 1 67 ? 12.880 32.870 11.929  1.00 30.39 ? 66  LEU A N   1 
ATOM   476 C CA  . LEU A 1 67 ? 12.453 33.345 10.623  1.00 32.41 ? 66  LEU A CA  1 
ATOM   477 C C   . LEU A 1 67 ? 13.306 32.707 9.524   1.00 37.12 ? 66  LEU A C   1 
ATOM   478 O O   . LEU A 1 67 ? 12.786 32.416 8.451   1.00 36.11 ? 66  LEU A O   1 
ATOM   479 C CB  . LEU A 1 67 ? 12.515 34.868 10.536  1.00 31.86 ? 66  LEU A CB  1 
ATOM   480 C CG  . LEU A 1 67 ? 11.287 35.627 11.042  1.00 38.57 ? 66  LEU A CG  1 
ATOM   481 C CD1 . LEU A 1 67 ? 11.548 37.131 11.041  1.00 34.97 ? 66  LEU A CD1 1 
ATOM   482 C CD2 . LEU A 1 67 ? 10.072 35.308 10.202  1.00 32.08 ? 66  LEU A CD2 1 
ATOM   483 N N   . ASP A 1 68 ? 14.601 32.490 9.795   1.00 34.01 ? 67  ASP A N   1 
ATOM   484 C CA  . ASP A 1 68 ? 15.505 31.823 8.847   1.00 30.86 ? 67  ASP A CA  1 
ATOM   485 C C   . ASP A 1 68 ? 14.950 30.467 8.486   1.00 35.71 ? 67  ASP A C   1 
ATOM   486 O O   . ASP A 1 68 ? 14.737 30.133 7.320   1.00 35.62 ? 67  ASP A O   1 
ATOM   487 C CB  . ASP A 1 68 ? 16.905 31.619 9.430   1.00 27.21 ? 67  ASP A CB  1 
ATOM   488 C CG  . ASP A 1 68 ? 17.774 32.841 9.329   1.00 32.34 ? 67  ASP A CG  1 
ATOM   489 O OD1 . ASP A 1 68 ? 17.289 33.899 8.900   1.00 36.36 ? 67  ASP A OD1 1 
ATOM   490 O OD2 . ASP A 1 68 ? 18.956 32.750 9.707   1.00 36.02 ? 67  ASP A OD2 1 
ATOM   491 N N   . ARG A 1 69 ? 14.724 29.682 9.524   1.00 31.84 ? 68  ARG A N   1 
ATOM   492 C CA  . ARG A 1 69 ? 14.301 28.326 9.341   1.00 33.31 ? 68  ARG A CA  1 
ATOM   493 C C   . ARG A 1 69 ? 12.923 28.337 8.700   1.00 36.04 ? 68  ARG A C   1 
ATOM   494 O O   . ARG A 1 69 ? 12.658 27.561 7.790   1.00 35.01 ? 68  ARG A O   1 
ATOM   495 C CB  . ARG A 1 69 ? 14.295 27.588 10.682  1.00 30.30 ? 68  ARG A CB  1 
ATOM   496 C CG  . ARG A 1 69 ? 13.867 26.139 10.594  1.00 33.75 ? 68  ARG A CG  1 
ATOM   497 C CD  . ARG A 1 69 ? 14.888 25.280 9.867   1.00 27.65 ? 68  ARG A CD  1 
ATOM   498 N NE  . ARG A 1 69 ? 14.408 23.907 9.760   1.00 32.45 ? 68  ARG A NE  1 
ATOM   499 C CZ  . ARG A 1 69 ? 14.641 23.099 8.729   1.00 36.35 ? 68  ARG A CZ  1 
ATOM   500 N NH1 . ARG A 1 69 ? 15.360 23.511 7.691   1.00 30.77 ? 68  ARG A NH1 1 
ATOM   501 N NH2 . ARG A 1 69 ? 14.149 21.869 8.737   1.00 35.36 ? 68  ARG A NH2 1 
ATOM   502 N N   . ALA A 1 70 ? 12.055 29.232 9.162   1.00 34.25 ? 69  ALA A N   1 
ATOM   503 C CA  . ALA A 1 70 ? 10.678 29.264 8.669   1.00 39.76 ? 69  ALA A CA  1 
ATOM   504 C C   . ALA A 1 70 ? 10.628 29.553 7.179   1.00 36.12 ? 69  ALA A C   1 
ATOM   505 O O   . ALA A 1 70 ? 9.850  28.945 6.445   1.00 37.09 ? 69  ALA A O   1 
ATOM   506 C CB  . ALA A 1 70 ? 9.850  30.294 9.428   1.00 40.48 ? 69  ALA A CB  1 
ATOM   507 N N   . GLU A 1 71 ? 11.463 30.483 6.741   1.00 32.89 ? 70  GLU A N   1 
ATOM   508 C CA  . GLU A 1 71 ? 11.512 30.846 5.341   1.00 38.66 ? 70  GLU A CA  1 
ATOM   509 C C   . GLU A 1 71 ? 12.025 29.659 4.525   1.00 37.71 ? 70  GLU A C   1 
ATOM   510 O O   . GLU A 1 71 ? 11.467 29.328 3.478   1.00 36.13 ? 70  GLU A O   1 
ATOM   511 C CB  . GLU A 1 71 ? 12.381 32.096 5.141   1.00 37.93 ? 70  GLU A CB  1 
ATOM   512 C CG  . GLU A 1 71 ? 11.673 33.411 5.533   1.00 45.98 ? 70  GLU A CG  1 
ATOM   513 C CD  . GLU A 1 71 ? 12.607 34.629 5.622   1.00 48.58 ? 70  GLU A CD  1 
ATOM   514 O OE1 . GLU A 1 71 ? 13.840 34.434 5.692   1.00 50.50 ? 70  GLU A OE1 1 
ATOM   515 O OE2 . GLU A 1 71 ? 12.105 35.782 5.627   1.00 48.14 ? 70  GLU A OE2 1 
ATOM   516 N N   . LYS A 1 72 ? 13.069 29.004 5.021   1.00 39.10 ? 71  LYS A N   1 
ATOM   517 C CA  . LYS A 1 72 ? 13.562 27.777 4.393   1.00 39.18 ? 71  LYS A CA  1 
ATOM   518 C C   . LYS A 1 72 ? 12.453 26.719 4.285   1.00 40.20 ? 71  LYS A C   1 
ATOM   519 O O   . LYS A 1 72 ? 12.409 25.976 3.304   1.00 42.96 ? 71  LYS A O   1 
ATOM   520 C CB  . LYS A 1 72 ? 14.758 27.195 5.170   1.00 41.08 ? 71  LYS A CB  1 
ATOM   521 C CG  . LYS A 1 72 ? 16.157 27.590 4.676   1.00 41.88 ? 71  LYS A CG  1 
ATOM   522 C CD  . LYS A 1 72 ? 17.230 26.887 5.530   1.00 55.98 ? 71  LYS A CD  1 
ATOM   523 C CE  . LYS A 1 72 ? 18.625 26.885 4.892   1.00 55.03 ? 71  LYS A CE  1 
ATOM   524 N NZ  . LYS A 1 72 ? 19.419 25.698 5.352   1.00 55.24 ? 71  LYS A NZ  1 
ATOM   525 N N   . LEU A 1 73 ? 11.555 26.649 5.273   1.00 37.60 ? 72  LEU A N   1 
ATOM   526 C CA  . LEU A 1 73 ? 10.472 25.672 5.218   1.00 31.44 ? 72  LEU A CA  1 
ATOM   527 C C   . LEU A 1 73 ? 9.403  26.104 4.220   1.00 35.04 ? 72  LEU A C   1 
ATOM   528 O O   . LEU A 1 73 ? 8.780  25.255 3.567   1.00 34.77 ? 72  LEU A O   1 
ATOM   529 C CB  . LEU A 1 73 ? 9.849  25.443 6.594   1.00 32.48 ? 72  LEU A CB  1 
ATOM   530 C CG  . LEU A 1 73 ? 10.616 24.581 7.605   1.00 33.06 ? 72  LEU A CG  1 
ATOM   531 C CD1 . LEU A 1 73 ? 9.672  24.112 8.681   1.00 37.56 ? 72  LEU A CD1 1 
ATOM   532 C CD2 . LEU A 1 73 ? 11.346 23.391 6.980   1.00 31.79 ? 72  LEU A CD2 1 
ATOM   533 N N   . LYS A 1 74 ? 9.197  27.412 4.085   1.00 33.33 ? 73  LYS A N   1 
ATOM   534 C CA  . LYS A 1 74 ? 8.250  27.910 3.088   1.00 36.78 ? 73  LYS A CA  1 
ATOM   535 C C   . LYS A 1 74 ? 8.719  27.479 1.706   1.00 36.66 ? 73  LYS A C   1 
ATOM   536 O O   . LYS A 1 74 ? 7.930  26.948 0.925   1.00 33.87 ? 73  LYS A O   1 
ATOM   537 C CB  . LYS A 1 74 ? 8.091  29.439 3.147   1.00 30.44 ? 73  LYS A CB  1 
ATOM   538 N N   . GLU A 1 75 ? 10.006 27.684 1.419   1.00 36.45 ? 74  GLU A N   1 
ATOM   539 C CA  . GLU A 1 75 ? 10.559 27.364 0.101   1.00 35.94 ? 74  GLU A CA  1 
ATOM   540 C C   . GLU A 1 75 ? 10.458 25.861 -0.169  1.00 36.61 ? 74  GLU A C   1 
ATOM   541 O O   . GLU A 1 75 ? 10.120 25.441 -1.278  1.00 35.87 ? 74  GLU A O   1 
ATOM   542 C CB  . GLU A 1 75 ? 12.009 27.844 -0.018  1.00 28.20 ? 74  GLU A CB  1 
ATOM   543 N N   . TYR A 1 76 ? 10.732 25.061 0.860   1.00 36.73 ? 75  TYR A N   1 
ATOM   544 C CA  . TYR A 1 76 ? 10.599 23.615 0.778   1.00 30.65 ? 75  TYR A CA  1 
ATOM   545 C C   . TYR A 1 76 ? 9.171  23.226 0.417   1.00 38.74 ? 75  TYR A C   1 
ATOM   546 O O   . TYR A 1 76 ? 8.948  22.393 -0.466  1.00 38.30 ? 75  TYR A O   1 
ATOM   547 C CB  . TYR A 1 76 ? 10.994 22.954 2.105   1.00 32.04 ? 75  TYR A CB  1 
ATOM   548 C CG  . TYR A 1 76 ? 10.795 21.459 2.103   1.00 31.02 ? 75  TYR A CG  1 
ATOM   549 C CD1 . TYR A 1 76 ? 11.818 20.609 1.712   1.00 33.94 ? 75  TYR A CD1 1 
ATOM   550 C CD2 . TYR A 1 76 ? 9.580  20.896 2.464   1.00 31.79 ? 75  TYR A CD2 1 
ATOM   551 C CE1 . TYR A 1 76 ? 11.643 19.234 1.685   1.00 35.70 ? 75  TYR A CE1 1 
ATOM   552 C CE2 . TYR A 1 76 ? 9.390  19.523 2.429   1.00 38.18 ? 75  TYR A CE2 1 
ATOM   553 C CZ  . TYR A 1 76 ? 10.428 18.696 2.043   1.00 38.67 ? 75  TYR A CZ  1 
ATOM   554 O OH  . TYR A 1 76 ? 10.254 17.329 2.020   1.00 42.59 ? 75  TYR A OH  1 
ATOM   555 N N   . LEU A 1 77 ? 8.206  23.816 1.121   1.00 36.46 ? 76  LEU A N   1 
ATOM   556 C CA  . LEU A 1 77 ? 6.807  23.457 0.932   1.00 36.56 ? 76  LEU A CA  1 
ATOM   557 C C   . LEU A 1 77 ? 6.298  23.936 -0.426  1.00 37.14 ? 76  LEU A C   1 
ATOM   558 O O   . LEU A 1 77 ? 5.401  23.326 -1.012  1.00 38.18 ? 76  LEU A O   1 
ATOM   559 C CB  . LEU A 1 77 ? 5.944  24.022 2.068   1.00 32.76 ? 76  LEU A CB  1 
ATOM   560 C CG  . LEU A 1 77 ? 6.101  23.298 3.410   1.00 36.92 ? 76  LEU A CG  1 
ATOM   561 C CD1 . LEU A 1 77 ? 5.556  24.112 4.585   1.00 34.09 ? 76  LEU A CD1 1 
ATOM   562 C CD2 . LEU A 1 77 ? 5.451  21.916 3.371   1.00 34.88 ? 76  LEU A CD2 1 
ATOM   563 N N   . LYS A 1 78 ? 6.880  25.019 -0.930  1.00 33.88 ? 77  LYS A N   1 
ATOM   564 C CA  . LYS A 1 78 ? 6.520  25.512 -2.248  1.00 38.19 ? 77  LYS A CA  1 
ATOM   565 C C   . LYS A 1 78 ? 6.945  24.485 -3.299  1.00 43.96 ? 77  LYS A C   1 
ATOM   566 O O   . LYS A 1 78 ? 6.228  24.230 -4.269  1.00 46.13 ? 77  LYS A O   1 
ATOM   567 C CB  . LYS A 1 78 ? 7.167  26.880 -2.520  1.00 44.61 ? 77  LYS A CB  1 
ATOM   568 C CG  . LYS A 1 78 ? 6.925  27.439 -3.933  1.00 46.95 ? 77  LYS A CG  1 
ATOM   569 C CD  . LYS A 1 78 ? 8.176  28.084 -4.537  1.00 47.44 ? 77  LYS A CD  1 
ATOM   570 C CE  . LYS A 1 78 ? 8.520  29.403 -3.857  1.00 43.91 ? 77  LYS A CE  1 
ATOM   571 N N   . ASN A 1 79 ? 8.104  23.876 -3.097  1.00 38.16 ? 78  ASN A N   1 
ATOM   572 C CA  . ASN A 1 79 ? 8.604  22.933 -4.082  1.00 43.25 ? 78  ASN A CA  1 
ATOM   573 C C   . ASN A 1 79 ? 7.993  21.547 -3.953  1.00 43.55 ? 78  ASN A C   1 
ATOM   574 O O   . ASN A 1 79 ? 7.790  20.864 -4.963  1.00 46.05 ? 78  ASN A O   1 
ATOM   575 C CB  . ASN A 1 79 ? 10.123 22.855 -4.005  1.00 40.91 ? 78  ASN A CB  1 
ATOM   576 C CG  . ASN A 1 79 ? 10.783 24.050 -4.653  1.00 48.21 ? 78  ASN A CG  1 
ATOM   577 O OD1 . ASN A 1 79 ? 10.456 24.417 -5.790  1.00 49.41 ? 78  ASN A OD1 1 
ATOM   578 N ND2 . ASN A 1 79 ? 11.692 24.690 -3.924  1.00 47.87 ? 78  ASN A ND2 1 
ATOM   579 N N   . LYS A 1 80 ? 7.694  21.131 -2.726  1.00 39.89 ? 79  LYS A N   1 
ATOM   580 C CA  . LYS A 1 80 ? 6.929  19.910 -2.536  1.00 42.84 ? 79  LYS A CA  1 
ATOM   581 C C   . LYS A 1 80 ? 5.600  20.055 -3.275  1.00 46.59 ? 79  LYS A C   1 
ATOM   582 O O   . LYS A 1 80 ? 5.131  19.113 -3.920  1.00 50.13 ? 79  LYS A O   1 
ATOM   583 C CB  . LYS A 1 80 ? 6.699  19.619 -1.053  1.00 39.60 ? 79  LYS A CB  1 
ATOM   584 C CG  . LYS A 1 80 ? 5.976  18.306 -0.779  1.00 30.18 ? 79  LYS A CG  1 
ATOM   585 N N   . GLU A 1 81 ? 5.017  21.250 -3.214  1.00 41.33 ? 80  GLU A N   1 
ATOM   586 C CA  . GLU A 1 81 ? 3.719  21.483 -3.840  1.00 47.06 ? 80  GLU A CA  1 
ATOM   587 C C   . GLU A 1 81 ? 3.821  21.658 -5.348  1.00 48.91 ? 80  GLU A C   1 
ATOM   588 O O   . GLU A 1 81 ? 2.842  21.469 -6.057  1.00 49.98 ? 80  GLU A O   1 
ATOM   589 C CB  . GLU A 1 81 ? 3.033  22.709 -3.231  1.00 44.29 ? 80  GLU A CB  1 
ATOM   590 N N   . LYS A 1 82 ? 4.995  22.030 -5.844  1.00 48.70 ? 81  LYS A N   1 
ATOM   591 C CA  . LYS A 1 82 ? 5.157  22.201 -7.282  1.00 49.47 ? 81  LYS A CA  1 
ATOM   592 C C   . LYS A 1 82 ? 5.180  20.836 -7.963  1.00 50.32 ? 81  LYS A C   1 
ATOM   593 O O   . LYS A 1 82 ? 4.956  20.717 -9.171  1.00 58.62 ? 81  LYS A O   1 
ATOM   594 C CB  . LYS A 1 82 ? 6.427  22.995 -7.607  1.00 50.79 ? 81  LYS A CB  1 
ATOM   595 C CG  . LYS A 1 82 ? 6.267  24.510 -7.503  1.00 47.17 ? 81  LYS A CG  1 
ATOM   596 N N   . LYS A 1 83 ? 5.440  19.803 -7.178  1.00 49.76 ? 82  LYS A N   1 
ATOM   597 C CA  . LYS A 1 83 ? 5.457  18.451 -7.706  1.00 57.80 ? 82  LYS A CA  1 
ATOM   598 C C   . LYS A 1 83 ? 4.146  18.120 -8.417  1.00 65.00 ? 82  LYS A C   1 
ATOM   599 O O   . LYS A 1 83 ? 4.159  17.737 -9.592  1.00 71.32 ? 82  LYS A O   1 
ATOM   600 C CB  . LYS A 1 83 ? 5.742  17.452 -6.587  1.00 54.01 ? 82  LYS A CB  1 
ATOM   601 C CG  . LYS A 1 83 ? 7.179  17.529 -6.087  1.00 49.83 ? 82  LYS A CG  1 
ATOM   602 C CD  . LYS A 1 83 ? 7.464  16.411 -5.106  1.00 57.54 ? 82  LYS A CD  1 
ATOM   603 C CE  . LYS A 1 83 ? 8.952  16.104 -5.027  1.00 57.18 ? 82  LYS A CE  1 
ATOM   604 N NZ  . LYS A 1 83 ? 9.229  15.051 -4.004  1.00 59.45 ? 82  LYS A NZ  1 
ATOM   605 N N   . ALA A 1 84 ? 3.022  18.294 -7.724  1.00 61.24 ? 83  ALA A N   1 
ATOM   606 C CA  . ALA A 1 84 ? 1.713  18.125 -8.352  1.00 61.29 ? 83  ALA A CA  1 
ATOM   607 C C   . ALA A 1 84 ? 1.214  19.432 -8.973  1.00 57.39 ? 83  ALA A C   1 
ATOM   608 O O   . ALA A 1 84 ? 1.437  19.701 -10.157 1.00 62.93 ? 83  ALA A O   1 
ATOM   609 C CB  . ALA A 1 84 ? 0.711  17.607 -7.347  1.00 69.25 ? 83  ALA A CB  1 
ATOM   610 N N   . ASP B 2 9  ? 15.720 48.862 17.168  1.00 45.63 ? 320 ASP B N   1 
ATOM   611 C CA  . ASP B 2 9  ? 15.317 48.765 15.766  1.00 53.42 ? 320 ASP B CA  1 
ATOM   612 C C   . ASP B 2 9  ? 15.097 47.314 15.283  1.00 53.83 ? 320 ASP B C   1 
ATOM   613 O O   . ASP B 2 9  ? 16.042 46.548 15.096  1.00 58.28 ? 320 ASP B O   1 
ATOM   614 C CB  . ASP B 2 9  ? 16.358 49.456 14.889  1.00 59.46 ? 320 ASP B CB  1 
ATOM   615 C CG  . ASP B 2 9  ? 15.977 49.466 13.418  1.00 60.44 ? 320 ASP B CG  1 
ATOM   616 O OD1 . ASP B 2 9  ? 16.860 49.767 12.579  1.00 65.08 ? 320 ASP B OD1 1 
ATOM   617 O OD2 . ASP B 2 9  ? 14.802 49.172 13.101  1.00 51.32 ? 320 ASP B OD2 1 
ATOM   618 N N   . PHE B 2 10 ? 13.833 46.962 15.058  1.00 56.34 ? 321 PHE B N   1 
ATOM   619 C CA  . PHE B 2 10 ? 13.455 45.612 14.644  1.00 47.78 ? 321 PHE B CA  1 
ATOM   620 C C   . PHE B 2 10 ? 12.660 45.598 13.334  1.00 42.56 ? 321 PHE B C   1 
ATOM   621 O O   . PHE B 2 10 ? 11.842 44.703 13.103  1.00 42.95 ? 321 PHE B O   1 
ATOM   622 C CB  . PHE B 2 10 ? 12.651 44.939 15.763  1.00 42.35 ? 321 PHE B CB  1 
ATOM   623 C CG  . PHE B 2 10 ? 13.511 44.403 16.869  1.00 50.01 ? 321 PHE B CG  1 
ATOM   624 C CD1 . PHE B 2 10 ? 13.706 43.038 17.016  1.00 45.54 ? 321 PHE B CD1 1 
ATOM   625 C CD2 . PHE B 2 10 ? 14.173 45.269 17.736  1.00 53.63 ? 321 PHE B CD2 1 
ATOM   626 C CE1 . PHE B 2 10 ? 14.528 42.542 18.029  1.00 44.83 ? 321 PHE B CE1 1 
ATOM   627 C CE2 . PHE B 2 10 ? 14.998 44.782 18.749  1.00 45.19 ? 321 PHE B CE2 1 
ATOM   628 C CZ  . PHE B 2 10 ? 15.172 43.418 18.896  1.00 41.99 ? 321 PHE B CZ  1 
ATOM   629 N N   . ASP B 2 11 ? 12.921 46.580 12.474  1.00 40.60 ? 322 ASP B N   1 
ATOM   630 C CA  . ASP B 2 11 ? 12.194 46.728 11.212  1.00 40.02 ? 322 ASP B CA  1 
ATOM   631 C C   . ASP B 2 11 ? 12.421 45.568 10.241  1.00 37.99 ? 322 ASP B C   1 
ATOM   632 O O   . ASP B 2 11 ? 11.468 45.084 9.630   1.00 35.58 ? 322 ASP B O   1 
ATOM   633 C CB  . ASP B 2 11 ? 12.577 48.040 10.518  1.00 40.27 ? 322 ASP B CB  1 
ATOM   634 C CG  . ASP B 2 11 ? 12.114 49.265 11.278  1.00 47.12 ? 322 ASP B CG  1 
ATOM   635 O OD1 . ASP B 2 11 ? 11.102 49.159 12.000  1.00 54.20 ? 322 ASP B OD1 1 
ATOM   636 O OD2 . ASP B 2 11 ? 12.753 50.334 11.148  1.00 42.50 ? 322 ASP B OD2 1 
ATOM   637 N N   . ASP B 2 12 ? 13.677 45.137 10.096  1.00 38.09 ? 323 ASP B N   1 
ATOM   638 C CA  . ASP B 2 12 ? 14.032 44.077 9.147   1.00 40.66 ? 323 ASP B CA  1 
ATOM   639 C C   . ASP B 2 12 ? 13.299 42.783 9.493   1.00 39.61 ? 323 ASP B C   1 
ATOM   640 O O   . ASP B 2 12 ? 12.727 42.121 8.616   1.00 33.69 ? 323 ASP B O   1 
ATOM   641 C CB  . ASP B 2 12 ? 15.548 43.850 9.121   1.00 33.24 ? 323 ASP B CB  1 
ATOM   642 N N   . LEU B 2 13 ? 13.290 42.452 10.783  1.00 37.08 ? 324 LEU B N   1 
ATOM   643 C CA  . LEU B 2 13 ? 12.585 41.271 11.261  1.00 34.60 ? 324 LEU B CA  1 
ATOM   644 C C   . LEU B 2 13 ? 11.082 41.456 11.065  1.00 37.07 ? 324 LEU B C   1 
ATOM   645 O O   . LEU B 2 13 ? 10.386 40.517 10.665  1.00 33.10 ? 324 LEU B O   1 
ATOM   646 C CB  . LEU B 2 13 ? 12.926 40.986 12.733  1.00 31.08 ? 324 LEU B CB  1 
ATOM   647 C CG  . LEU B 2 13 ? 14.432 40.769 12.987  1.00 36.06 ? 324 LEU B CG  1 
ATOM   648 C CD1 . LEU B 2 13 ? 14.813 40.773 14.461  1.00 30.98 ? 324 LEU B CD1 1 
ATOM   649 C CD2 . LEU B 2 13 ? 14.904 39.491 12.332  1.00 27.88 ? 324 LEU B CD2 1 
ATOM   650 N N   . SER B 2 14 ? 10.578 42.662 11.321  1.00 34.06 ? 325 SER B N   1 
ATOM   651 C CA  . SER B 2 14 ? 9.146  42.897 11.128  1.00 35.67 ? 325 SER B CA  1 
ATOM   652 C C   . SER B 2 14 ? 8.780  42.789 9.655   1.00 36.57 ? 325 SER B C   1 
ATOM   653 O O   . SER B 2 14 ? 7.736  42.239 9.296   1.00 31.35 ? 325 SER B O   1 
ATOM   654 C CB  . SER B 2 14 ? 8.727  44.255 11.665  1.00 31.74 ? 325 SER B CB  1 
ATOM   655 O OG  . SER B 2 14 ? 8.569  44.208 13.066  1.00 45.74 ? 325 SER B OG  1 
ATOM   656 N N   . ARG B 2 15 ? 9.661  43.312 8.811   1.00 35.73 ? 326 ARG B N   1 
ATOM   657 C CA  . ARG B 2 15 ? 9.464  43.271 7.377   1.00 36.68 ? 326 ARG B CA  1 
ATOM   658 C C   . ARG B 2 15 ? 9.429  41.809 6.930   1.00 38.77 ? 326 ARG B C   1 
ATOM   659 O O   . ARG B 2 15 ? 8.489  41.391 6.260   1.00 36.95 ? 326 ARG B O   1 
ATOM   660 C CB  . ARG B 2 15 ? 10.564 44.076 6.672   1.00 35.87 ? 326 ARG B CB  1 
ATOM   661 C CG  . ARG B 2 15 ? 10.395 44.260 5.178   1.00 38.29 ? 326 ARG B CG  1 
ATOM   662 C CD  . ARG B 2 15 ? 11.531 43.554 4.438   1.00 50.02 ? 326 ARG B CD  1 
ATOM   663 N NE  . ARG B 2 15 ? 12.802 43.680 5.165   1.00 59.58 ? 326 ARG B NE  1 
ATOM   664 C CZ  . ARG B 2 15 ? 13.826 42.827 5.063   1.00 61.64 ? 326 ARG B CZ  1 
ATOM   665 N NH1 . ARG B 2 15 ? 13.732 41.772 4.249   1.00 58.48 ? 326 ARG B NH1 1 
ATOM   666 N NH2 . ARG B 2 15 ? 14.940 43.022 5.779   1.00 50.11 ? 326 ARG B NH2 1 
ATOM   667 N N   . ARG B 2 16 ? 10.415 41.018 7.350   1.00 38.80 ? 327 ARG B N   1 
ATOM   668 C CA  . ARG B 2 16 ? 10.457 39.597 6.988   1.00 36.67 ? 327 ARG B CA  1 
ATOM   669 C C   . ARG B 2 16 ? 9.302  38.770 7.573   1.00 36.32 ? 327 ARG B C   1 
ATOM   670 O O   . ARG B 2 16 ? 8.794  37.851 6.931   1.00 36.41 ? 327 ARG B O   1 
ATOM   671 C CB  . ARG B 2 16 ? 11.789 38.992 7.414   1.00 38.93 ? 327 ARG B CB  1 
ATOM   672 C CG  . ARG B 2 16 ? 12.955 39.515 6.608   1.00 40.67 ? 327 ARG B CG  1 
ATOM   673 C CD  . ARG B 2 16 ? 14.266 39.001 7.143   1.00 42.34 ? 327 ARG B CD  1 
ATOM   674 N NE  . ARG B 2 16 ? 14.289 37.548 7.225   1.00 39.58 ? 327 ARG B NE  1 
ATOM   675 C CZ  . ARG B 2 16 ? 15.190 36.866 7.925   1.00 37.94 ? 327 ARG B CZ  1 
ATOM   676 N NH1 . ARG B 2 16 ? 16.131 37.509 8.595   1.00 38.71 ? 327 ARG B NH1 1 
ATOM   677 N NH2 . ARG B 2 16 ? 15.148 35.548 7.965   1.00 37.90 ? 327 ARG B NH2 1 
ATOM   678 N N   . PHE B 2 17 ? 8.880  39.092 8.788   1.00 36.07 ? 328 PHE B N   1 
ATOM   679 C CA  . PHE B 2 17 ? 7.747  38.386 9.367   1.00 35.20 ? 328 PHE B CA  1 
ATOM   680 C C   . PHE B 2 17 ? 6.449  38.636 8.577   1.00 34.86 ? 328 PHE B C   1 
ATOM   681 O O   . PHE B 2 17 ? 5.687  37.714 8.303   1.00 36.71 ? 328 PHE B O   1 
ATOM   682 C CB  . PHE B 2 17 ? 7.555  38.775 10.838  1.00 33.83 ? 328 PHE B CB  1 
ATOM   683 C CG  . PHE B 2 17 ? 6.250  38.306 11.409  1.00 36.06 ? 328 PHE B CG  1 
ATOM   684 C CD1 . PHE B 2 17 ? 5.988  36.949 11.551  1.00 31.65 ? 328 PHE B CD1 1 
ATOM   685 C CD2 . PHE B 2 17 ? 5.270  39.215 11.764  1.00 34.71 ? 328 PHE B CD2 1 
ATOM   686 C CE1 . PHE B 2 17 ? 4.788  36.512 12.052  1.00 32.60 ? 328 PHE B CE1 1 
ATOM   687 C CE2 . PHE B 2 17 ? 4.066  38.784 12.272  1.00 32.31 ? 328 PHE B CE2 1 
ATOM   688 C CZ  . PHE B 2 17 ? 3.825  37.430 12.414  1.00 36.50 ? 328 PHE B CZ  1 
ATOM   689 N N   . GLU B 2 18 ? 6.198  39.886 8.217   1.00 37.59 ? 329 GLU B N   1 
ATOM   690 C CA  . GLU B 2 18 ? 5.000  40.226 7.460   1.00 40.09 ? 329 GLU B CA  1 
ATOM   691 C C   . GLU B 2 18 ? 4.967  39.518 6.100   1.00 40.67 ? 329 GLU B C   1 
ATOM   692 O O   . GLU B 2 18 ? 3.943  38.953 5.726   1.00 41.39 ? 329 GLU B O   1 
ATOM   693 C CB  . GLU B 2 18 ? 4.896  41.745 7.290   1.00 32.11 ? 329 GLU B CB  1 
ATOM   694 C CG  . GLU B 2 18 ? 4.232  42.445 8.479   1.00 36.98 ? 329 GLU B CG  1 
ATOM   695 N N   . GLU B 2 19 ? 6.088  39.530 5.383   1.00 39.63 ? 330 GLU B N   1 
ATOM   696 C CA  . GLU B 2 19 ? 6.197  38.814 4.112   1.00 41.20 ? 330 GLU B CA  1 
ATOM   697 C C   . GLU B 2 19 ? 5.881  37.324 4.287   1.00 49.57 ? 330 GLU B C   1 
ATOM   698 O O   . GLU B 2 19 ? 5.262  36.700 3.420   1.00 52.61 ? 330 GLU B O   1 
ATOM   699 C CB  . GLU B 2 19 ? 7.597  38.987 3.508   1.00 34.14 ? 330 GLU B CB  1 
ATOM   700 N N   . LEU B 2 20 ? 6.268  36.760 5.426   1.00 46.52 ? 331 LEU B N   1 
ATOM   701 C CA  . LEU B 2 20 ? 6.080  35.333 5.662   1.00 48.25 ? 331 LEU B CA  1 
ATOM   702 C C   . LEU B 2 20 ? 4.592  34.955 5.841   1.00 49.24 ? 331 LEU B C   1 
ATOM   703 O O   . LEU B 2 20 ? 4.277  33.864 6.298   1.00 60.07 ? 331 LEU B O   1 
ATOM   704 C CB  . LEU B 2 20 ? 6.921  34.900 6.879   1.00 50.08 ? 331 LEU B CB  1 
ATOM   705 C CG  . LEU B 2 20 ? 7.061  33.437 7.346   1.00 54.03 ? 331 LEU B CG  1 
ATOM   706 C CD1 . LEU B 2 20 ? 8.430  32.835 7.033   1.00 48.99 ? 331 LEU B CD1 1 
ATOM   707 C CD2 . LEU B 2 20 ? 6.782  33.344 8.839   1.00 48.61 ? 331 LEU B CD2 1 
ATOM   708 N N   . LYS B 2 21 ? 3.674  35.835 5.452   1.00 54.65 ? 332 LYS B N   1 
ATOM   709 C CA  . LYS B 2 21 ? 2.245  35.490 5.449   1.00 58.41 ? 332 LYS B CA  1 
ATOM   710 C C   . LYS B 2 21 ? 1.569  35.749 4.088   1.00 55.08 ? 332 LYS B C   1 
ATOM   711 O O   . LYS B 2 21 ? 1.647  34.929 3.165   1.00 52.08 ? 332 LYS B O   1 
ATOM   712 C CB  . LYS B 2 21 ? 1.521  36.267 6.547   1.00 48.56 ? 332 LYS B CB  1 
ATOM   713 C CG  . LYS B 2 21 ? 2.211  36.200 7.905   1.00 45.26 ? 332 LYS B CG  1 
ATOM   714 C CD  . LYS B 2 21 ? 2.073  37.513 8.671   1.00 42.87 ? 332 LYS B CD  1 
ATOM   715 C CE  . LYS B 2 21 ? 0.643  37.750 9.152   1.00 46.96 ? 332 LYS B CE  1 
ATOM   716 N NZ  . LYS B 2 21 ? 0.506  39.078 9.821   1.00 39.20 ? 332 LYS B NZ  1 
HETATM 717 O O   . HOH C 3 .  ? 2.418  39.229 28.375  1.00 28.86 ? 101 HOH A O   1 
HETATM 718 O O   . HOH C 3 .  ? 21.431 34.793 24.564  1.00 35.02 ? 102 HOH A O   1 
HETATM 719 O O   . HOH C 3 .  ? 18.384 42.074 30.182  1.00 39.98 ? 103 HOH A O   1 
HETATM 720 O O   . HOH C 3 .  ? 16.499 38.504 43.120  1.00 23.53 ? 104 HOH A O   1 
HETATM 721 O O   . HOH D 3 .  ? 15.528 43.960 12.352  1.00 30.35 ? 401 HOH B O   1 
HETATM 722 O O   . HOH D 3 .  ? 17.112 50.534 21.150  1.00 42.67 ? 402 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  SER 1  0   ?   ?   ?   A . n 
A 1 2  MET 2  1   1   MET MET A . n 
A 1 3  SER 3  2   2   SER SER A . n 
A 1 4  SER 4  3   3   SER SER A . n 
A 1 5  THR 5  4   4   THR THR A . n 
A 1 6  SER 6  5   5   SER SER A . n 
A 1 7  PRO 7  6   6   PRO PRO A . n 
A 1 8  ASN 8  7   7   ASN ASN A . n 
A 1 9  LEU 9  8   8   LEU LEU A . n 
A 1 10 GLN 10 9   9   GLN GLN A . n 
A 1 11 LYS 11 10  10  LYS LYS A . n 
A 1 12 ALA 12 11  11  ALA ALA A . n 
A 1 13 ILE 13 12  12  ILE ILE A . n 
A 1 14 ASP 14 13  13  ASP ASP A . n 
A 1 15 LEU 15 14  14  LEU LEU A . n 
A 1 16 ALA 16 15  15  ALA ALA A . n 
A 1 17 SER 17 16  16  SER SER A . n 
A 1 18 LYS 18 17  17  LYS LYS A . n 
A 1 19 ALA 19 18  18  ALA ALA A . n 
A 1 20 ALA 20 19  19  ALA ALA A . n 
A 1 21 GLN 21 20  20  GLN GLN A . n 
A 1 22 GLU 22 21  21  GLU GLU A . n 
A 1 23 ASP 23 22  22  ASP ASP A . n 
A 1 24 LYS 24 23  23  LYS LYS A . n 
A 1 25 ALA 25 24  24  ALA ALA A . n 
A 1 26 GLY 26 25  25  GLY GLY A . n 
A 1 27 ASN 27 26  26  ASN ASN A . n 
A 1 28 TYR 28 27  27  TYR TYR A . n 
A 1 29 GLU 29 28  28  GLU GLU A . n 
A 1 30 GLU 30 29  29  GLU GLU A . n 
A 1 31 ALA 31 30  30  ALA ALA A . n 
A 1 32 LEU 32 31  31  LEU LEU A . n 
A 1 33 GLN 33 32  32  GLN GLN A . n 
A 1 34 LEU 34 33  33  LEU LEU A . n 
A 1 35 TYR 35 34  34  TYR TYR A . n 
A 1 36 GLN 36 35  35  GLN GLN A . n 
A 1 37 HIS 37 36  36  HIS HIS A . n 
A 1 38 ALA 38 37  37  ALA ALA A . n 
A 1 39 VAL 39 38  38  VAL VAL A . n 
A 1 40 GLN 40 39  39  GLN GLN A . n 
A 1 41 TYR 41 40  40  TYR TYR A . n 
A 1 42 PHE 42 41  41  PHE PHE A . n 
A 1 43 LEU 43 42  42  LEU LEU A . n 
A 1 44 HIS 44 43  43  HIS HIS A . n 
A 1 45 VAL 45 44  44  VAL VAL A . n 
A 1 46 VAL 46 45  45  VAL VAL A . n 
A 1 47 LYS 47 46  46  LYS LYS A . n 
A 1 48 TYR 48 47  47  TYR TYR A . n 
A 1 49 GLU 49 48  48  GLU GLU A . n 
A 1 50 ALA 50 49  49  ALA ALA A . n 
A 1 51 GLN 51 50  50  GLN GLN A . n 
A 1 52 GLY 52 51  51  GLY GLY A . n 
A 1 53 ASP 53 52  52  ASP ASP A . n 
A 1 54 LYS 54 53  53  LYS LYS A . n 
A 1 55 ALA 55 54  54  ALA ALA A . n 
A 1 56 LYS 56 55  55  LYS LYS A . n 
A 1 57 GLN 57 56  56  GLN GLN A . n 
A 1 58 SER 58 57  57  SER SER A . n 
A 1 59 ILE 59 58  58  ILE ILE A . n 
A 1 60 ARG 60 59  59  ARG ARG A . n 
A 1 61 ALA 61 60  60  ALA ALA A . n 
A 1 62 LYS 62 61  61  LYS LYS A . n 
A 1 63 CYS 63 62  62  CYS CYS A . n 
A 1 64 THR 64 63  63  THR THR A . n 
A 1 65 GLU 65 64  64  GLU GLU A . n 
A 1 66 TYR 66 65  65  TYR TYR A . n 
A 1 67 LEU 67 66  66  LEU LEU A . n 
A 1 68 ASP 68 67  67  ASP ASP A . n 
A 1 69 ARG 69 68  68  ARG ARG A . n 
A 1 70 ALA 70 69  69  ALA ALA A . n 
A 1 71 GLU 71 70  70  GLU GLU A . n 
A 1 72 LYS 72 71  71  LYS LYS A . n 
A 1 73 LEU 73 72  72  LEU LEU A . n 
A 1 74 LYS 74 73  73  LYS LYS A . n 
A 1 75 GLU 75 74  74  GLU GLU A . n 
A 1 76 TYR 76 75  75  TYR TYR A . n 
A 1 77 LEU 77 76  76  LEU LEU A . n 
A 1 78 LYS 78 77  77  LYS LYS A . n 
A 1 79 ASN 79 78  78  ASN ASN A . n 
A 1 80 LYS 80 79  79  LYS LYS A . n 
A 1 81 GLU 81 80  80  GLU GLU A . n 
A 1 82 LYS 82 81  81  LYS LYS A . n 
A 1 83 LYS 83 82  82  LYS LYS A . n 
A 1 84 ALA 84 83  83  ALA ALA A . n 
A 1 85 GLN 85 84  ?   ?   ?   A . n 
A 1 86 LYS 86 85  ?   ?   ?   A . n 
A 1 87 PRO 87 86  ?   ?   ?   A . n 
A 1 88 VAL 88 87  ?   ?   ?   A . n 
A 1 89 LYS 89 88  ?   ?   ?   A . n 
A 1 90 GLU 90 89  ?   ?   ?   A . n 
B 2 1  SER 1  312 ?   ?   ?   B . n 
B 2 2  THR 2  313 ?   ?   ?   B . n 
B 2 3  SER 3  314 ?   ?   ?   B . n 
B 2 4  ALA 4  315 ?   ?   ?   B . n 
B 2 5  SER 5  316 ?   ?   ?   B . n 
B 2 6  GLU 6  317 ?   ?   ?   B . n 
B 2 7  ASP 7  318 ?   ?   ?   B . n 
B 2 8  ILE 8  319 ?   ?   ?   B . n 
B 2 9  ASP 9  320 320 ASP ASP B . n 
B 2 10 PHE 10 321 321 PHE PHE B . n 
B 2 11 ASP 11 322 322 ASP ASP B . n 
B 2 12 ASP 12 323 323 ASP ASP B . n 
B 2 13 LEU 13 324 324 LEU LEU B . n 
B 2 14 SER 14 325 325 SER SER B . n 
B 2 15 ARG 15 326 326 ARG ARG B . n 
B 2 16 ARG 16 327 327 ARG ARG B . n 
B 2 17 PHE 17 328 328 PHE PHE B . n 
B 2 18 GLU 18 329 329 GLU GLU B . n 
B 2 19 GLU 19 330 330 GLU GLU B . n 
B 2 20 LEU 20 331 331 LEU LEU B . n 
B 2 21 LYS 21 332 332 LYS LYS B . n 
B 2 22 LYS 22 333 ?   ?   ?   B . n 
B 2 23 LYS 23 334 ?   ?   ?   B . n 
B 2 24 THR 24 335 ?   ?   ?   B . n 
B 2 25 TRP 25 336 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 HOH 1 101 2  HOH HOH A . 
C 3 HOH 2 102 5  HOH HOH A . 
C 3 HOH 3 103 3  HOH HOH A . 
C 3 HOH 4 104 11 HOH HOH A . 
D 3 HOH 1 401 1  HOH HOH B . 
D 3 HOH 2 402 15 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1090 ? 
1 MORE         -7   ? 
1 'SSA (A^2)'  6070 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2015-02-11 
2 'Structure model' 1 1 2015-02-18 
3 'Structure model' 1 2 2015-04-08 
4 'Structure model' 1 3 2017-09-27 
5 'Structure model' 1 4 2019-12-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1  2 'Structure model' 'Database references'        
2  3 'Structure model' 'Database references'        
3  4 'Structure model' 'Author supporting evidence' 
4  4 'Structure model' 'Database references'        
5  4 'Structure model' 'Derived calculations'       
6  4 'Structure model' Other                        
7  4 'Structure model' 'Refinement description'     
8  4 'Structure model' 'Source and taxonomy'        
9  4 'Structure model' 'Structure summary'          
10 5 'Structure model' 'Author supporting evidence' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' citation                  
2  4 'Structure model' entity_src_gen            
3  4 'Structure model' pdbx_audit_support        
4  4 'Structure model' pdbx_database_status      
5  4 'Structure model' pdbx_struct_assembly      
6  4 'Structure model' pdbx_struct_assembly_gen  
7  4 'Structure model' pdbx_struct_assembly_prop 
8  4 'Structure model' pdbx_struct_oper_list     
9  4 'Structure model' software                  
10 4 'Structure model' struct_keywords           
11 5 'Structure model' pdbx_audit_support        
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_citation.journal_id_CSD'                    
2  4 'Structure model' '_entity_src_gen.pdbx_alt_source_flag'        
3  4 'Structure model' '_pdbx_audit_support.funding_organization'    
4  4 'Structure model' '_pdbx_database_status.pdb_format_compatible' 
5  4 'Structure model' '_pdbx_struct_assembly.oligomeric_details'    
6  4 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list'      
7  4 'Structure model' '_pdbx_struct_assembly_prop.type'             
8  4 'Structure model' '_pdbx_struct_assembly_prop.value'            
9  4 'Structure model' '_pdbx_struct_oper_list.symmetry_operation'   
10 4 'Structure model' '_struct_keywords.text'                       
11 5 'Structure model' '_pdbx_audit_support.funding_organization'    
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .                           1 
? phasing        ? ? ? ? ? ? ? ? ? ? ? PHASER   ? ? ? .                           2 
? refinement     ? ? ? ? ? ? ? ? ? ? ? PHENIX   ? ? ? '(phenix.refine: dev_1593)' 3 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 SER A 2   ? ? -127.46 -169.75 
2 1 LEU B 331 ? ? -69.69  15.93   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A MET 1   ? SD  ? A MET 2  SD  
2  1 Y 1 A MET 1   ? CE  ? A MET 2  CE  
3  1 Y 1 A SER 3   ? OG  ? A SER 4  OG  
4  1 Y 1 A LYS 10  ? CD  ? A LYS 11 CD  
5  1 Y 1 A LYS 10  ? CE  ? A LYS 11 CE  
6  1 Y 1 A LYS 10  ? NZ  ? A LYS 11 NZ  
7  1 Y 1 A LYS 17  ? CG  ? A LYS 18 CG  
8  1 Y 1 A LYS 17  ? CD  ? A LYS 18 CD  
9  1 Y 1 A LYS 17  ? CE  ? A LYS 18 CE  
10 1 Y 1 A LYS 17  ? NZ  ? A LYS 18 NZ  
11 1 Y 1 A GLN 20  ? CG  ? A GLN 21 CG  
12 1 Y 1 A GLN 20  ? CD  ? A GLN 21 CD  
13 1 Y 1 A GLN 20  ? OE1 ? A GLN 21 OE1 
14 1 Y 1 A GLN 20  ? NE2 ? A GLN 21 NE2 
15 1 Y 1 A LYS 23  ? CD  ? A LYS 24 CD  
16 1 Y 1 A LYS 23  ? CE  ? A LYS 24 CE  
17 1 Y 1 A LYS 23  ? NZ  ? A LYS 24 NZ  
18 1 Y 1 A GLU 28  ? CG  ? A GLU 29 CG  
19 1 Y 1 A GLU 28  ? CD  ? A GLU 29 CD  
20 1 Y 1 A GLU 28  ? OE1 ? A GLU 29 OE1 
21 1 Y 1 A GLU 28  ? OE2 ? A GLU 29 OE2 
22 1 Y 1 A GLU 29  ? CD  ? A GLU 30 CD  
23 1 Y 1 A GLU 29  ? OE1 ? A GLU 30 OE1 
24 1 Y 1 A GLU 29  ? OE2 ? A GLU 30 OE2 
25 1 Y 1 A GLN 32  ? CG  ? A GLN 33 CG  
26 1 Y 1 A GLN 32  ? CD  ? A GLN 33 CD  
27 1 Y 1 A GLN 32  ? OE1 ? A GLN 33 OE1 
28 1 Y 1 A GLN 32  ? NE2 ? A GLN 33 NE2 
29 1 Y 1 A LYS 53  ? CG  ? A LYS 54 CG  
30 1 Y 1 A LYS 53  ? CD  ? A LYS 54 CD  
31 1 Y 1 A LYS 53  ? CE  ? A LYS 54 CE  
32 1 Y 1 A LYS 55  ? NZ  ? A LYS 56 NZ  
33 1 Y 1 A GLN 56  ? CG  ? A GLN 57 CG  
34 1 Y 1 A GLN 56  ? CD  ? A GLN 57 CD  
35 1 Y 1 A GLN 56  ? OE1 ? A GLN 57 OE1 
36 1 Y 1 A GLN 56  ? NE2 ? A GLN 57 NE2 
37 1 Y 1 A ARG 59  ? CZ  ? A ARG 60 CZ  
38 1 Y 1 A ARG 59  ? NH1 ? A ARG 60 NH1 
39 1 Y 1 A ARG 59  ? NH2 ? A ARG 60 NH2 
40 1 Y 1 A LYS 73  ? CG  ? A LYS 74 CG  
41 1 Y 1 A LYS 73  ? CD  ? A LYS 74 CD  
42 1 Y 1 A LYS 73  ? CE  ? A LYS 74 CE  
43 1 Y 1 A LYS 73  ? NZ  ? A LYS 74 NZ  
44 1 Y 1 A GLU 74  ? CG  ? A GLU 75 CG  
45 1 Y 1 A GLU 74  ? CD  ? A GLU 75 CD  
46 1 Y 1 A GLU 74  ? OE1 ? A GLU 75 OE1 
47 1 Y 1 A GLU 74  ? OE2 ? A GLU 75 OE2 
48 1 Y 1 A LYS 77  ? NZ  ? A LYS 78 NZ  
49 1 Y 1 A LYS 79  ? CD  ? A LYS 80 CD  
50 1 Y 1 A LYS 79  ? CE  ? A LYS 80 CE  
51 1 Y 1 A LYS 79  ? NZ  ? A LYS 80 NZ  
52 1 Y 1 A GLU 80  ? CG  ? A GLU 81 CG  
53 1 Y 1 A GLU 80  ? CD  ? A GLU 81 CD  
54 1 Y 1 A GLU 80  ? OE1 ? A GLU 81 OE1 
55 1 Y 1 A GLU 80  ? OE2 ? A GLU 81 OE2 
56 1 Y 1 A LYS 81  ? CD  ? A LYS 82 CD  
57 1 Y 1 A LYS 81  ? CE  ? A LYS 82 CE  
58 1 Y 1 A LYS 81  ? NZ  ? A LYS 82 NZ  
59 1 Y 1 B ASP 323 ? CG  ? B ASP 12 CG  
60 1 Y 1 B ASP 323 ? OD1 ? B ASP 12 OD1 
61 1 Y 1 B ASP 323 ? OD2 ? B ASP 12 OD2 
62 1 Y 1 B GLU 329 ? CD  ? B GLU 18 CD  
63 1 Y 1 B GLU 329 ? OE1 ? B GLU 18 OE1 
64 1 Y 1 B GLU 329 ? OE2 ? B GLU 18 OE2 
65 1 Y 1 B GLU 330 ? CG  ? B GLU 19 CG  
66 1 Y 1 B GLU 330 ? CD  ? B GLU 19 CD  
67 1 Y 1 B GLU 330 ? OE1 ? B GLU 19 OE1 
68 1 Y 1 B GLU 330 ? OE2 ? B GLU 19 OE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 0   ? A SER 1  
2  1 Y 1 A GLN 84  ? A GLN 85 
3  1 Y 1 A LYS 85  ? A LYS 86 
4  1 Y 1 A PRO 86  ? A PRO 87 
5  1 Y 1 A VAL 87  ? A VAL 88 
6  1 Y 1 A LYS 88  ? A LYS 89 
7  1 Y 1 A GLU 89  ? A GLU 90 
8  1 Y 1 B SER 312 ? B SER 1  
9  1 Y 1 B THR 313 ? B THR 2  
10 1 Y 1 B SER 314 ? B SER 3  
11 1 Y 1 B ALA 315 ? B ALA 4  
12 1 Y 1 B SER 316 ? B SER 5  
13 1 Y 1 B GLU 317 ? B GLU 6  
14 1 Y 1 B ASP 318 ? B ASP 7  
15 1 Y 1 B ILE 319 ? B ILE 8  
16 1 Y 1 B LYS 333 ? B LYS 22 
17 1 Y 1 B LYS 334 ? B LYS 23 
18 1 Y 1 B THR 335 ? B THR 24 
19 1 Y 1 B TRP 336 ? B TRP 25 
# 
_pdbx_audit_support.funding_organization   
'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 
_pdbx_audit_support.country                'United States' 
_pdbx_audit_support.grant_number           GM095769 
_pdbx_audit_support.ordinal                1 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#