data_4U86
# 
_entry.id   4U86 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4U86         
WWPDB D_1000202969 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 4U84 unspecified . 
PDB 4U85 unspecified . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4U86 
_pdbx_database_status.recvd_initial_deposition_date   2014-08-01 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Li, W.'    1 
'Zhang, Y.' 2 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Neurobiol.Dis. 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1095-953X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            76 
_citation.language                  ? 
_citation.page_first                13 
_citation.page_last                 23 
_citation.title                     
;Pin1 cysteine-113 oxidation inhibits its catalytic activity and cellular function in Alzheimer's disease.
;
_citation.year                      2015 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.nbd.2014.12.027 
_citation.pdbx_database_id_PubMed   25576397 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Chen, C.H.'            1  
primary 'Li, W.'                2  
primary 'Sultana, R.'           3  
primary 'You, M.H.'             4  
primary 'Kondo, A.'             5  
primary 'Shahpasand, K.'        6  
primary 'Kim, B.M.'             7  
primary 'Luo, M.L.'             8  
primary 'Nechama, M.'           9  
primary 'Lin, Y.M.'             10 
primary 'Yao, Y.'               11 
primary 'Lee, T.H.'             12 
primary 'Zhou, X.Z.'            13 
primary 'Swomley, A.M.'         14 
primary 'Allan Butterfield, D.' 15 
primary 'Zhang, Y.'             16 
primary 'Lu, K.P.'              17 
# 
_cell.entry_id           4U86 
_cell.length_a           69.073 
_cell.length_b           69.073 
_cell.length_c           79.727 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4U86 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1'        20258.406 1  5.2.1.8 ? ? ? 
2 non-polymer man '2-(2-{2-[2-(2-METHOXY-ETHOXY)-ETHOXY]-ETHOXY}-ETHOXY)-ETHANOL' 252.305   1  ?       ? ? ? 
3 water       nat water                                                           18.015    98 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Peptidyl-prolyl cis-trans isomerase Pin1,PPIase Pin1,Rotamase Pin1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;HHHHHHHHGGLVPRGSHGMADEEKLPPGWEKAMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLV
KHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSD(OCS)SSAKARGDLGAFSRGQMQKPFEDAS
FALRTGEMSGPVFTDSGIHIILRTE
;
_entity_poly.pdbx_seq_one_letter_code_can   
;HHHHHHHHGGLVPRGSHGMADEEKLPPGWEKAMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLV
KHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALR
TGEMSGPVFTDSGIHIILRTE
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   HIS n 
1 2   HIS n 
1 3   HIS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   GLY n 
1 10  GLY n 
1 11  LEU n 
1 12  VAL n 
1 13  PRO n 
1 14  ARG n 
1 15  GLY n 
1 16  SER n 
1 17  HIS n 
1 18  GLY n 
1 19  MET n 
1 20  ALA n 
1 21  ASP n 
1 22  GLU n 
1 23  GLU n 
1 24  LYS n 
1 25  LEU n 
1 26  PRO n 
1 27  PRO n 
1 28  GLY n 
1 29  TRP n 
1 30  GLU n 
1 31  LYS n 
1 32  ALA n 
1 33  MET n 
1 34  SER n 
1 35  ARG n 
1 36  SER n 
1 37  SER n 
1 38  GLY n 
1 39  ARG n 
1 40  VAL n 
1 41  TYR n 
1 42  TYR n 
1 43  PHE n 
1 44  ASN n 
1 45  HIS n 
1 46  ILE n 
1 47  THR n 
1 48  ASN n 
1 49  ALA n 
1 50  SER n 
1 51  GLN n 
1 52  TRP n 
1 53  GLU n 
1 54  ARG n 
1 55  PRO n 
1 56  SER n 
1 57  GLY n 
1 58  ASN n 
1 59  SER n 
1 60  SER n 
1 61  SER n 
1 62  GLY n 
1 63  GLY n 
1 64  LYS n 
1 65  ASN n 
1 66  GLY n 
1 67  GLN n 
1 68  GLY n 
1 69  GLU n 
1 70  PRO n 
1 71  ALA n 
1 72  ARG n 
1 73  VAL n 
1 74  ARG n 
1 75  CYS n 
1 76  SER n 
1 77  HIS n 
1 78  LEU n 
1 79  LEU n 
1 80  VAL n 
1 81  LYS n 
1 82  HIS n 
1 83  SER n 
1 84  GLN n 
1 85  SER n 
1 86  ARG n 
1 87  ARG n 
1 88  PRO n 
1 89  SER n 
1 90  SER n 
1 91  TRP n 
1 92  ARG n 
1 93  GLN n 
1 94  GLU n 
1 95  LYS n 
1 96  ILE n 
1 97  THR n 
1 98  ARG n 
1 99  THR n 
1 100 LYS n 
1 101 GLU n 
1 102 GLU n 
1 103 ALA n 
1 104 LEU n 
1 105 GLU n 
1 106 LEU n 
1 107 ILE n 
1 108 ASN n 
1 109 GLY n 
1 110 TYR n 
1 111 ILE n 
1 112 GLN n 
1 113 LYS n 
1 114 ILE n 
1 115 LYS n 
1 116 SER n 
1 117 GLY n 
1 118 GLU n 
1 119 GLU n 
1 120 ASP n 
1 121 PHE n 
1 122 GLU n 
1 123 SER n 
1 124 LEU n 
1 125 ALA n 
1 126 SER n 
1 127 GLN n 
1 128 PHE n 
1 129 SER n 
1 130 ASP n 
1 131 OCS n 
1 132 SER n 
1 133 SER n 
1 134 ALA n 
1 135 LYS n 
1 136 ALA n 
1 137 ARG n 
1 138 GLY n 
1 139 ASP n 
1 140 LEU n 
1 141 GLY n 
1 142 ALA n 
1 143 PHE n 
1 144 SER n 
1 145 ARG n 
1 146 GLY n 
1 147 GLN n 
1 148 MET n 
1 149 GLN n 
1 150 LYS n 
1 151 PRO n 
1 152 PHE n 
1 153 GLU n 
1 154 ASP n 
1 155 ALA n 
1 156 SER n 
1 157 PHE n 
1 158 ALA n 
1 159 LEU n 
1 160 ARG n 
1 161 THR n 
1 162 GLY n 
1 163 GLU n 
1 164 MET n 
1 165 SER n 
1 166 GLY n 
1 167 PRO n 
1 168 VAL n 
1 169 PHE n 
1 170 THR n 
1 171 ASP n 
1 172 SER n 
1 173 GLY n 
1 174 ILE n 
1 175 HIS n 
1 176 ILE n 
1 177 ILE n 
1 178 LEU n 
1 179 ARG n 
1 180 THR n 
1 181 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   181 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 PIN1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PIN1_HUMAN 
_struct_ref.pdbx_db_accession          Q13526 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITR
TKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIIL
RTE
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              4U86 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 19 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 181 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q13526 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  163 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       163 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4U86 HIS A 1  ? UNP Q13526 ?   ?  'expression tag' -17 1  
1 4U86 HIS A 2  ? UNP Q13526 ?   ?  'expression tag' -16 2  
1 4U86 HIS A 3  ? UNP Q13526 ?   ?  'expression tag' -15 3  
1 4U86 HIS A 4  ? UNP Q13526 ?   ?  'expression tag' -14 4  
1 4U86 HIS A 5  ? UNP Q13526 ?   ?  'expression tag' -13 5  
1 4U86 HIS A 6  ? UNP Q13526 ?   ?  'expression tag' -12 6  
1 4U86 HIS A 7  ? UNP Q13526 ?   ?  'expression tag' -11 7  
1 4U86 HIS A 8  ? UNP Q13526 ?   ?  'expression tag' -10 8  
1 4U86 GLY A 9  ? UNP Q13526 ?   ?  'expression tag' -9  9  
1 4U86 GLY A 10 ? UNP Q13526 ?   ?  'expression tag' -8  10 
1 4U86 LEU A 11 ? UNP Q13526 ?   ?  'expression tag' -7  11 
1 4U86 VAL A 12 ? UNP Q13526 ?   ?  'expression tag' -6  12 
1 4U86 PRO A 13 ? UNP Q13526 ?   ?  'expression tag' -5  13 
1 4U86 ARG A 14 ? UNP Q13526 ?   ?  'expression tag' -4  14 
1 4U86 GLY A 15 ? UNP Q13526 ?   ?  'expression tag' -3  15 
1 4U86 SER A 16 ? UNP Q13526 ?   ?  'expression tag' -2  16 
1 4U86 HIS A 17 ? UNP Q13526 ?   ?  'expression tag' -1  17 
1 4U86 GLY A 18 ? UNP Q13526 ?   ?  'expression tag' 0   18 
1 4U86 ALA A 32 ? UNP Q13526 ARG 14 conflict         14  19 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
1PG non-polymer         . '2-(2-{2-[2-(2-METHOXY-ETHOXY)-ETHOXY]-ETHOXY}-ETHOXY)-ETHANOL' ? 'C11 H24 O6'     252.305 
ALA 'L-peptide linking' y ALANINE                                                         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                                        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                 ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                                                        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                 ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                                         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                                                       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                                           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                                         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                                          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                                      ? 'C5 H11 N O2 S'  149.211 
OCS 'L-peptide linking' n 'CYSTEINESULFONIC ACID'                                         ? 'C3 H7 N O5 S'   169.156 
PHE 'L-peptide linking' y PHENYLALANINE                                                   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                                         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                                          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                                                       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                                        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                                          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4U86 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.71 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         54.62 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
;50mM HEPES7.5
1% PEG400
1.2-1.5M Ammonium Sulfate
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315r' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2010-02-13 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ALS BEAMLINE 5.0.2' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.0 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   5.0.2 
_diffrn_source.pdbx_synchrotron_site       ALS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         4U86 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.6 
_reflns.d_resolution_low                 50 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       29744 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.7 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  5.2 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            31.9 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  1.6 
_reflns_shell.d_res_low                   1.63 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         1.9 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        99.4 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.609 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             3.7 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            0.47 
_refine.aniso_B[1][2]                            0.23 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][2]                            0.47 
_refine.aniso_B[2][3]                            -0.00 
_refine.aniso_B[3][3]                            -1.52 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               26.896 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               0.960 
_refine.correlation_coeff_Fo_to_Fc_free          0.943 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 4U86 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.60 
_refine.ls_d_res_low                             34.55 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     28112 
_refine.ls_number_reflns_R_free                  1499 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.65 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.19800 
_refine.ls_R_factor_R_free                       0.23073 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.19627 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       0.075 
_refine.pdbx_overall_ESU_R_Free                  0.080 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             1.642 
_refine.overall_SU_ML                            0.057 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         1 
_refine_hist.pdbx_number_atoms_protein        1162 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         17 
_refine_hist.number_atoms_solvent             98 
_refine_hist.number_atoms_total               1277 
_refine_hist.d_res_high                       1.60 
_refine_hist.d_res_low                        34.55 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.025  0.019  1209 ? r_bond_refined_d             ? ? 
'X-RAY DIFFRACTION' ? 0.002  0.020  1140 ? r_bond_other_d               ? ? 
'X-RAY DIFFRACTION' ? 2.433  1.963  1619 ? r_angle_refined_deg          ? ? 
'X-RAY DIFFRACTION' ? 1.032  3.000  2633 ? r_angle_other_deg            ? ? 
'X-RAY DIFFRACTION' ? 6.784  5.000  145  ? r_dihedral_angle_1_deg       ? ? 
'X-RAY DIFFRACTION' ? 31.690 22.586 58   ? r_dihedral_angle_2_deg       ? ? 
'X-RAY DIFFRACTION' ? 15.249 15.000 216  ? r_dihedral_angle_3_deg       ? ? 
'X-RAY DIFFRACTION' ? 18.614 15.000 13   ? r_dihedral_angle_4_deg       ? ? 
'X-RAY DIFFRACTION' ? 0.148  0.200  164  ? r_chiral_restr               ? ? 
'X-RAY DIFFRACTION' ? 0.011  0.021  1343 ? r_gen_planes_refined         ? ? 
'X-RAY DIFFRACTION' ? 0.001  0.020  290  ? r_gen_planes_other           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbd_refined                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbd_other                  ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbtor_refined              ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbtor_other                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_xyhbond_nbd_refined        ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_xyhbond_nbd_other          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_metal_ion_refined          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_metal_ion_other            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_vdw_refined       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_vdw_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_hbond_refined     ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_hbond_other       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_metal_ion_refined ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_metal_ion_other   ? ? 
'X-RAY DIFFRACTION' ? 2.658  2.282  580  ? r_mcbond_it                  ? ? 
'X-RAY DIFFRACTION' ? 2.641  2.280  579  ? r_mcbond_other               ? ? 
'X-RAY DIFFRACTION' ? 3.430  3.416  722  ? r_mcangle_it                 ? ? 
'X-RAY DIFFRACTION' ? 3.431  3.418  723  ? r_mcangle_other              ? ? 
'X-RAY DIFFRACTION' ? 4.258  2.854  629  ? r_scbond_it                  ? ? 
'X-RAY DIFFRACTION' ? 4.257  2.852  630  ? r_scbond_other               ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_scangle_it                 ? ? 
'X-RAY DIFFRACTION' ? 6.178  4.070  897  ? r_scangle_other              ? ? 
'X-RAY DIFFRACTION' ? 7.384  19.140 1365 ? r_long_range_B_refined       ? ? 
'X-RAY DIFFRACTION' ? 7.402  18.893 1341 ? r_long_range_B_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_rigid_bond_restr           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_sphericity_free            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_sphericity_bonded          ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       1.6 
_refine_ls_shell.d_res_low                        1.638 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             93 
_refine_ls_shell.number_reflns_R_work             2028 
_refine_ls_shell.percent_reflns_obs               99.20 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.347 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.285 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
# 
_struct.entry_id                     4U86 
_struct.title                        'Human Pin1 with cysteine sulfonic acid 113' 
_struct.pdbx_descriptor              'Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 (E.C.5.2.1.8)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4U86 
_struct_keywords.text            'Pin1 oxidation isomerase, ISOMERASE' 
_struct_keywords.pdbx_keywords   ISOMERASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 THR A 99  ? SER A 116 ? THR A 81  SER A 98  1 ? 18 
HELX_P HELX_P2 AA2 ASP A 120 ? SER A 129 ? ASP A 102 SER A 111 1 ? 10 
HELX_P HELX_P3 AA3 OCS A 131 ? ARG A 137 ? OCS A 113 ARG A 119 5 ? 7  
HELX_P HELX_P4 AA4 GLN A 149 ? LEU A 159 ? GLN A 131 LEU A 141 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale both ? A ASP 130 C ? ? ? 1_555 A OCS 131 N ? ? A ASP 112 A OCS 113 1_555 ? ? ? ? ? ? ? 1.350 ? 
covale2 covale both ? A OCS 131 C ? ? ? 1_555 A SER 132 N ? ? A OCS 113 A SER 114 1_555 ? ? ? ? ? ? ? 1.330 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3 ? 
AA2 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 TRP A 29  ? MET A 33  ? TRP A 11  MET A 15  
AA1 2 VAL A 40  ? ASN A 44  ? VAL A 22  ASN A 26  
AA1 3 SER A 50  ? GLN A 51  ? SER A 32  GLN A 33  
AA2 1 ASP A 139 ? SER A 144 ? ASP A 121 SER A 126 
AA2 2 ARG A 72  ? VAL A 80  ? ARG A 54  VAL A 62  
AA2 3 GLY A 173 ? GLU A 181 ? GLY A 155 GLU A 163 
AA2 4 VAL A 168 ? THR A 170 ? VAL A 150 THR A 152 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N GLU A 30  ? N GLU A 12  O PHE A 43  ? O PHE A 25  
AA1 2 3 N TYR A 42  ? N TYR A 24  O GLN A 51  ? O GLN A 33  
AA2 1 2 O LEU A 140 ? O LEU A 122 N CYS A 75  ? N CYS A 57  
AA2 2 3 N VAL A 80  ? N VAL A 62  O ILE A 174 ? O ILE A 156 
AA2 3 4 O HIS A 175 ? O HIS A 157 N VAL A 168 ? N VAL A 150 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    A 
_struct_site.pdbx_auth_comp_id    1PG 
_struct_site.pdbx_auth_seq_id     300 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    10 
_struct_site.details              'binding site for residue 1PG A 300' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 10 TYR A 41  ? TYR A 23  . ? 1_555 ? 
2  AC1 10 ALA A 49  ? ALA A 31  . ? 1_555 ? 
3  AC1 10 SER A 50  ? SER A 32  . ? 1_555 ? 
4  AC1 10 TRP A 52  ? TRP A 34  . ? 1_555 ? 
5  AC1 10 ILE A 111 ? ILE A 93  . ? 1_555 ? 
6  AC1 10 LYS A 115 ? LYS A 97  . ? 6_555 ? 
7  AC1 10 LYS A 115 ? LYS A 97  . ? 1_555 ? 
8  AC1 10 SER A 116 ? SER A 98  . ? 6_555 ? 
9  AC1 10 HOH C .   ? HOH A 457 . ? 1_555 ? 
10 AC1 10 HOH C .   ? HOH A 487 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4U86 
_atom_sites.fract_transf_matrix[1][1]   0.014477 
_atom_sites.fract_transf_matrix[1][2]   0.008359 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016717 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012543 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . LYS A 1 24  ? -9.028  10.294 -0.001 1.00 65.81 ? 6   LYS A N   1 
ATOM   2    C CA  . LYS A 1 24  ? -8.320  10.988 1.114  1.00 65.05 ? 6   LYS A CA  1 
ATOM   3    C C   . LYS A 1 24  ? -9.340  11.724 2.003  1.00 57.90 ? 6   LYS A C   1 
ATOM   4    O O   . LYS A 1 24  ? -9.231  11.675 3.240  1.00 53.02 ? 6   LYS A O   1 
ATOM   5    C CB  . LYS A 1 24  ? -7.245  11.929 0.543  1.00 68.31 ? 6   LYS A CB  1 
ATOM   6    C CG  . LYS A 1 24  ? -6.010  12.183 1.418  1.00 71.54 ? 6   LYS A CG  1 
ATOM   7    C CD  . LYS A 1 24  ? -4.752  12.289 0.534  1.00 73.02 ? 6   LYS A CD  1 
ATOM   8    C CE  . LYS A 1 24  ? -3.926  13.544 0.795  1.00 75.39 ? 6   LYS A CE  1 
ATOM   9    N NZ  . LYS A 1 24  ? -3.511  13.614 2.215  1.00 74.79 ? 6   LYS A NZ  1 
ATOM   10   N N   . LEU A 1 25  ? -10.332 12.394 1.409  1.00 45.47 ? 7   LEU A N   1 
ATOM   11   C CA  . LEU A 1 25  ? -11.397 12.972 2.239  1.00 44.49 ? 7   LEU A CA  1 
ATOM   12   C C   . LEU A 1 25  ? -12.287 11.890 2.823  1.00 38.06 ? 7   LEU A C   1 
ATOM   13   O O   . LEU A 1 25  ? -12.638 10.967 2.116  1.00 48.71 ? 7   LEU A O   1 
ATOM   14   C CB  . LEU A 1 25  ? -12.292 13.942 1.417  1.00 36.81 ? 7   LEU A CB  1 
ATOM   15   C CG  . LEU A 1 25  ? -11.662 15.295 1.106  1.00 37.33 ? 7   LEU A CG  1 
ATOM   16   C CD1 . LEU A 1 25  ? -12.497 16.192 0.235  1.00 35.68 ? 7   LEU A CD1 1 
ATOM   17   C CD2 . LEU A 1 25  ? -11.370 15.941 2.443  1.00 36.39 ? 7   LEU A CD2 1 
ATOM   18   N N   . PRO A 1 26  ? -12.760 12.055 4.050  1.00 37.09 ? 8   PRO A N   1 
ATOM   19   C CA  . PRO A 1 26  ? -13.738 11.062 4.481  1.00 32.54 ? 8   PRO A CA  1 
ATOM   20   C C   . PRO A 1 26  ? -15.074 11.175 3.743  1.00 38.34 ? 8   PRO A C   1 
ATOM   21   O O   . PRO A 1 26  ? -15.387 12.223 3.124  1.00 36.35 ? 8   PRO A O   1 
ATOM   22   C CB  . PRO A 1 26  ? -13.942 11.345 5.975  1.00 36.90 ? 8   PRO A CB  1 
ATOM   23   C CG  . PRO A 1 26  ? -13.197 12.565 6.283  1.00 38.88 ? 8   PRO A CG  1 
ATOM   24   C CD  . PRO A 1 26  ? -12.474 13.060 5.083  1.00 37.67 ? 8   PRO A CD  1 
ATOM   25   N N   . PRO A 1 27  ? -15.905 10.107 3.808  1.00 37.76 ? 9   PRO A N   1 
ATOM   26   C CA  . PRO A 1 27  ? -17.140 10.115 3.028  1.00 39.96 ? 9   PRO A CA  1 
ATOM   27   C C   . PRO A 1 27  ? -18.024 11.313 3.453  1.00 30.01 ? 9   PRO A C   1 
ATOM   28   O O   . PRO A 1 27  ? -18.070 11.667 4.661  1.00 33.05 ? 9   PRO A O   1 
ATOM   29   C CB  . PRO A 1 27  ? -17.775 8.762  3.343  1.00 41.26 ? 9   PRO A CB  1 
ATOM   30   C CG  . PRO A 1 27  ? -16.601 7.891  3.678  1.00 42.93 ? 9   PRO A CG  1 
ATOM   31   C CD  . PRO A 1 27  ? -15.652 8.784  4.418  1.00 46.15 ? 9   PRO A CD  1 
ATOM   32   N N   . GLY A 1 28  ? -18.675 11.893 2.432  1.00 27.96 ? 10  GLY A N   1 
ATOM   33   C CA  . GLY A 1 28  ? -19.609 13.007 2.595  1.00 25.15 ? 10  GLY A CA  1 
ATOM   34   C C   . GLY A 1 28  ? -18.974 14.359 2.369  1.00 23.96 ? 10  GLY A C   1 
ATOM   35   O O   . GLY A 1 28  ? -19.642 15.346 2.206  1.00 20.57 ? 10  GLY A O   1 
ATOM   36   N N   . TRP A 1 29  ? -17.659 14.373 2.438  1.00 24.08 ? 11  TRP A N   1 
ATOM   37   C CA  . TRP A 1 29  ? -16.909 15.653 2.308  1.00 21.65 ? 11  TRP A CA  1 
ATOM   38   C C   . TRP A 1 29  ? -16.348 15.876 0.934  1.00 27.28 ? 11  TRP A C   1 
ATOM   39   O O   . TRP A 1 29  ? -15.916 14.921 0.214  1.00 26.32 ? 11  TRP A O   1 
ATOM   40   C CB  . TRP A 1 29  ? -15.797 15.720 3.368  1.00 21.66 ? 11  TRP A CB  1 
ATOM   41   C CG  . TRP A 1 29  ? -16.191 15.862 4.738  1.00 22.93 ? 11  TRP A CG  1 
ATOM   42   C CD1 . TRP A 1 29  ? -16.387 14.895 5.651  1.00 23.73 ? 11  TRP A CD1 1 
ATOM   43   C CD2 . TRP A 1 29  ? -16.568 17.064 5.383  1.00 20.62 ? 11  TRP A CD2 1 
ATOM   44   N NE1 . TRP A 1 29  ? -16.777 15.388 6.788  1.00 23.61 ? 11  TRP A NE1 1 
ATOM   45   C CE2 . TRP A 1 29  ? -16.915 16.749 6.689  1.00 21.43 ? 11  TRP A CE2 1 
ATOM   46   C CE3 . TRP A 1 29  ? -16.636 18.431 4.969  1.00 20.80 ? 11  TRP A CE3 1 
ATOM   47   C CZ2 . TRP A 1 29  ? -17.278 17.709 7.591  1.00 23.55 ? 11  TRP A CZ2 1 
ATOM   48   C CZ3 . TRP A 1 29  ? -17.012 19.373 5.860  1.00 21.53 ? 11  TRP A CZ3 1 
ATOM   49   C CH2 . TRP A 1 29  ? -17.336 19.048 7.158  1.00 24.15 ? 11  TRP A CH2 1 
ATOM   50   N N   . GLU A 1 30  ? -16.332 17.140 0.496  1.00 24.99 ? 12  GLU A N   1 
ATOM   51   C CA  . GLU A 1 30  ? -15.731 17.527 -0.773 1.00 25.11 ? 12  GLU A CA  1 
ATOM   52   C C   . GLU A 1 30  ? -15.007 18.834 -0.585 1.00 25.26 ? 12  GLU A C   1 
ATOM   53   O O   . GLU A 1 30  ? -15.349 19.611 0.305  1.00 21.56 ? 12  GLU A O   1 
ATOM   54   C CB  . GLU A 1 30  ? -16.710 17.684 -1.926 1.00 29.18 ? 12  GLU A CB  1 
ATOM   55   C CG  . GLU A 1 30  ? -17.623 18.904 -1.863 1.00 34.63 ? 12  GLU A CG  1 
ATOM   56   C CD  . GLU A 1 30  ? -18.805 18.869 -2.858 1.00 41.66 ? 12  GLU A CD  1 
ATOM   57   O OE1 . GLU A 1 30  ? -19.880 18.308 -2.538 1.00 39.40 ? 12  GLU A OE1 1 
ATOM   58   O OE2 . GLU A 1 30  ? -18.654 19.456 -3.970 1.00 47.73 ? 12  GLU A OE2 1 
ATOM   59   N N   . LYS A 1 31  ? -14.007 19.043 -1.429 1.00 24.64 ? 13  LYS A N   1 
ATOM   60   C CA  . LYS A 1 31  ? -13.278 20.360 -1.513 1.00 24.99 ? 13  LYS A CA  1 
ATOM   61   C C   . LYS A 1 31  ? -13.981 21.334 -2.328 1.00 28.00 ? 13  LYS A C   1 
ATOM   62   O O   . LYS A 1 31  ? -14.598 20.968 -3.334 1.00 32.42 ? 13  LYS A O   1 
ATOM   63   C CB  . LYS A 1 31  ? -11.877 20.153 -2.141 1.00 32.50 ? 13  LYS A CB  1 
ATOM   64   C CG  . LYS A 1 31  ? -10.860 19.593 -1.205 1.00 49.18 ? 13  LYS A CG  1 
ATOM   65   C CD  . LYS A 1 31  ? -9.461  20.183 -1.447 1.00 52.70 ? 13  LYS A CD  1 
ATOM   66   C CE  . LYS A 1 31  ? -9.001  20.094 -2.900 1.00 57.09 ? 13  LYS A CE  1 
ATOM   67   N NZ  . LYS A 1 31  ? -8.123  21.268 -3.203 1.00 64.85 ? 13  LYS A NZ  1 
ATOM   68   N N   . ALA A 1 32  ? -13.898 22.620 -1.957 1.00 22.76 ? 14  ALA A N   1 
ATOM   69   C CA  . ALA A 1 32  ? -14.557 23.740 -2.613 1.00 23.63 ? 14  ALA A CA  1 
ATOM   70   C C   . ALA A 1 32  ? -13.578 24.961 -2.462 1.00 23.98 ? 14  ALA A C   1 
ATOM   71   O O   . ALA A 1 32  ? -12.569 24.805 -1.740 1.00 22.41 ? 14  ALA A O   1 
ATOM   72   C CB  . ALA A 1 32  ? -15.862 24.063 -1.980 1.00 25.89 ? 14  ALA A CB  1 
ATOM   73   N N   . MET A 1 33  ? -13.828 26.036 -3.197 1.00 29.86 ? 15  MET A N   1 
ATOM   74   C CA  . MET A 1 33  ? -13.130 27.336 -2.998 1.00 25.53 ? 15  MET A CA  1 
ATOM   75   C C   . MET A 1 33  ? -14.126 28.346 -2.825 1.00 27.80 ? 15  MET A C   1 
ATOM   76   O O   . MET A 1 33  ? -15.150 28.386 -3.576 1.00 25.24 ? 15  MET A O   1 
ATOM   77   C CB  . MET A 1 33  ? -12.254 27.748 -4.215 1.00 36.32 ? 15  MET A CB  1 
ATOM   78   C CG  . MET A 1 33  ? -11.576 26.558 -4.833 1.00 45.70 ? 15  MET A CG  1 
ATOM   79   S SD  . MET A 1 33  ? -10.626 27.044 -6.299 1.00 55.81 ? 15  MET A SD  1 
ATOM   80   C CE  . MET A 1 33  ? -9.018  26.698 -5.581 1.00 49.05 ? 15  MET A CE  1 
ATOM   81   N N   . SER A 1 34  ? -13.858 29.295 -1.908 1.00 22.85 ? 16  SER A N   1 
ATOM   82   C CA  . SER A 1 34  ? -14.727 30.371 -1.669 1.00 24.59 ? 16  SER A CA  1 
ATOM   83   C C   . SER A 1 34  ? -14.859 31.234 -2.927 1.00 24.85 ? 16  SER A C   1 
ATOM   84   O O   . SER A 1 34  ? -13.822 31.548 -3.545 1.00 27.80 ? 16  SER A O   1 
ATOM   85   C CB  . SER A 1 34  ? -14.190 31.245 -0.518 1.00 26.58 ? 16  SER A CB  1 
ATOM   86   O OG  . SER A 1 34  ? -14.820 32.507 -0.438 1.00 30.32 ? 16  SER A OG  1 
ATOM   87   N N   . ARG A 1 35  ? -16.089 31.615 -3.239 1.00 29.03 ? 17  ARG A N   1 
ATOM   88   C CA  . ARG A 1 35  ? -16.358 32.542 -4.355 1.00 29.13 ? 17  ARG A CA  1 
ATOM   89   C C   . ARG A 1 35  ? -15.914 33.920 -4.057 1.00 34.17 ? 17  ARG A C   1 
ATOM   90   O O   . ARG A 1 35  ? -15.701 34.719 -4.980 1.00 33.29 ? 17  ARG A O   1 
ATOM   91   C CB  . ARG A 1 35  ? -17.812 32.616 -4.678 1.00 31.66 ? 17  ARG A CB  1 
ATOM   92   C CG  . ARG A 1 35  ? -18.280 31.296 -5.213 1.00 35.40 ? 17  ARG A CG  1 
ATOM   93   C CD  . ARG A 1 35  ? -17.970 31.223 -6.707 1.00 33.04 ? 17  ARG A CD  1 
ATOM   94   N NE  . ARG A 1 35  ? -18.102 29.837 -7.080 1.00 33.49 ? 17  ARG A NE  1 
ATOM   95   C CZ  . ARG A 1 35  ? -19.220 29.248 -7.519 1.00 33.10 ? 17  ARG A CZ  1 
ATOM   96   N NH1 . ARG A 1 35  ? -20.319 29.909 -7.779 1.00 36.40 ? 17  ARG A NH1 1 
ATOM   97   N NH2 . ARG A 1 35  ? -19.170 27.959 -7.726 1.00 34.42 ? 17  ARG A NH2 1 
ATOM   98   N N   . SER A 1 36  ? -15.816 34.275 -2.788 1.00 35.89 ? 18  SER A N   1 
ATOM   99   C CA  . SER A 1 36  ? -15.479 35.674 -2.508 1.00 37.17 ? 18  SER A CA  1 
ATOM   100  C C   . SER A 1 36  ? -13.993 35.844 -2.274 1.00 37.17 ? 18  SER A C   1 
ATOM   101  O O   . SER A 1 36  ? -13.464 36.930 -2.559 1.00 40.35 ? 18  SER A O   1 
ATOM   102  C CB  . SER A 1 36  ? -16.291 36.254 -1.373 1.00 39.10 ? 18  SER A CB  1 
ATOM   103  O OG  . SER A 1 36  ? -16.112 35.458 -0.228 1.00 38.40 ? 18  SER A OG  1 
ATOM   104  N N   . SER A 1 37  ? -13.303 34.821 -1.782 1.00 35.32 ? 19  SER A N   1 
ATOM   105  C CA  . SER A 1 37  ? -11.884 34.861 -1.513 1.00 32.32 ? 19  SER A CA  1 
ATOM   106  C C   . SER A 1 37  ? -10.923 33.913 -2.208 1.00 32.26 ? 19  SER A C   1 
ATOM   107  O O   . SER A 1 37  ? -9.729  34.143 -2.172 1.00 31.08 ? 19  SER A O   1 
ATOM   108  C CB  . SER A 1 37  ? -11.672 34.701 0.018  1.00 38.46 ? 19  SER A CB  1 
ATOM   109  O OG  . SER A 1 37  ? -11.627 33.317 0.375  1.00 33.74 ? 19  SER A OG  1 
ATOM   110  N N   . GLY A 1 38  ? -11.389 32.799 -2.822 1.00 26.54 ? 20  GLY A N   1 
ATOM   111  C CA  . GLY A 1 38  ? -10.566 31.818 -3.413 1.00 29.00 ? 20  GLY A CA  1 
ATOM   112  C C   . GLY A 1 38  ? -10.006 30.710 -2.551 1.00 26.17 ? 20  GLY A C   1 
ATOM   113  O O   . GLY A 1 38  ? -9.425  29.720 -2.992 1.00 30.85 ? 20  GLY A O   1 
ATOM   114  N N   . ARG A 1 39  ? -10.215 30.914 -1.256 1.00 32.80 ? 21  ARG A N   1 
ATOM   115  C CA  . ARG A 1 39  ? -9.593  30.059 -0.246 1.00 28.30 ? 21  ARG A CA  1 
ATOM   116  C C   . ARG A 1 39  ? -10.344 28.678 -0.257 1.00 24.07 ? 21  ARG A C   1 
ATOM   117  O O   . ARG A 1 39  ? -11.566 28.699 -0.316 1.00 26.26 ? 21  ARG A O   1 
ATOM   118  C CB  . ARG A 1 39  ? -9.753  30.756 1.121  1.00 30.24 ? 21  ARG A CB  1 
ATOM   119  C CG  . ARG A 1 39  ? -9.151  30.087 2.361  1.00 31.37 ? 21  ARG A CG  1 
ATOM   120  C CD  . ARG A 1 39  ? -8.591  31.045 3.463  1.00 32.57 ? 21  ARG A CD  1 
ATOM   121  N NE  . ARG A 1 39  ? -9.519  31.770 4.378  1.00 37.31 ? 21  ARG A NE  1 
ATOM   122  C CZ  . ARG A 1 39  ? -9.893  31.431 5.649  1.00 33.01 ? 21  ARG A CZ  1 
ATOM   123  N NH1 . ARG A 1 39  ? -9.491  30.358 6.228  1.00 38.52 ? 21  ARG A NH1 1 
ATOM   124  N NH2 . ARG A 1 39  ? -10.684 32.262 6.395  1.00 43.83 ? 21  ARG A NH2 1 
ATOM   125  N N   . VAL A 1 40  ? -9.562  27.635 -0.202 1.00 25.35 ? 22  VAL A N   1 
ATOM   126  C CA  . VAL A 1 40  ? -10.042 26.250 -0.104 1.00 25.34 ? 22  VAL A CA  1 
ATOM   127  C C   . VAL A 1 40  ? -10.884 26.104 1.182  1.00 22.67 ? 22  VAL A C   1 
ATOM   128  O O   . VAL A 1 40  ? -10.581 26.629 2.262  1.00 20.95 ? 22  VAL A O   1 
ATOM   129  C CB  . VAL A 1 40  ? -8.890  25.301 -0.160 1.00 28.60 ? 22  VAL A CB  1 
ATOM   130  C CG1 . VAL A 1 40  ? -9.321  23.925 0.152  1.00 31.86 ? 22  VAL A CG1 1 
ATOM   131  C CG2 . VAL A 1 40  ? -8.344  25.259 -1.603 1.00 30.78 ? 22  VAL A CG2 1 
ATOM   132  N N   . TYR A 1 41  ? -12.036 25.427 1.058  1.00 20.58 ? 23  TYR A N   1 
ATOM   133  C CA  . TYR A 1 41  ? -12.761 24.975 2.284  1.00 17.41 ? 23  TYR A CA  1 
ATOM   134  C C   . TYR A 1 41  ? -13.361 23.610 1.945  1.00 18.42 ? 23  TYR A C   1 
ATOM   135  O O   . TYR A 1 41  ? -13.202 23.092 0.833  1.00 20.05 ? 23  TYR A O   1 
ATOM   136  C CB  . TYR A 1 41  ? -13.840 25.954 2.638  1.00 17.10 ? 23  TYR A CB  1 
ATOM   137  C CG  . TYR A 1 41  ? -15.004 26.076 1.713  1.00 20.87 ? 23  TYR A CG  1 
ATOM   138  C CD1 . TYR A 1 41  ? -14.961 26.900 0.584  1.00 23.08 ? 23  TYR A CD1 1 
ATOM   139  C CD2 . TYR A 1 41  ? -16.231 25.451 1.978  1.00 19.15 ? 23  TYR A CD2 1 
ATOM   140  C CE1 . TYR A 1 41  ? -16.029 27.019 -0.274 1.00 25.15 ? 23  TYR A CE1 1 
ATOM   141  C CE2 . TYR A 1 41  ? -17.288 25.564 1.145  1.00 20.80 ? 23  TYR A CE2 1 
ATOM   142  C CZ  . TYR A 1 41  ? -17.208 26.322 0.013  1.00 24.20 ? 23  TYR A CZ  1 
ATOM   143  O OH  . TYR A 1 41  ? -18.303 26.442 -0.827 1.00 28.06 ? 23  TYR A OH  1 
ATOM   144  N N   . TYR A 1 42  ? -14.028 22.996 2.934  1.00 18.11 ? 24  TYR A N   1 
ATOM   145  C CA  . TYR A 1 42  ? -14.566 21.699 2.764  1.00 19.32 ? 24  TYR A CA  1 
ATOM   146  C C   . TYR A 1 42  ? -16.075 21.763 3.164  1.00 18.69 ? 24  TYR A C   1 
ATOM   147  O O   . TYR A 1 42  ? -16.483 22.494 4.063  1.00 16.81 ? 24  TYR A O   1 
ATOM   148  C CB  . TYR A 1 42  ? -13.862 20.700 3.631  1.00 20.88 ? 24  TYR A CB  1 
ATOM   149  C CG  . TYR A 1 42  ? -12.389 20.654 3.270  1.00 23.10 ? 24  TYR A CG  1 
ATOM   150  C CD1 . TYR A 1 42  ? -11.551 21.669 3.700  1.00 24.82 ? 24  TYR A CD1 1 
ATOM   151  C CD2 . TYR A 1 42  ? -11.959 19.790 2.308  1.00 29.72 ? 24  TYR A CD2 1 
ATOM   152  C CE1 . TYR A 1 42  ? -10.193 21.681 3.295  1.00 30.87 ? 24  TYR A CE1 1 
ATOM   153  C CE2 . TYR A 1 42  ? -10.631 19.782 1.914  1.00 32.62 ? 24  TYR A CE2 1 
ATOM   154  C CZ  . TYR A 1 42  ? -9.755  20.719 2.421  1.00 34.33 ? 24  TYR A CZ  1 
ATOM   155  O OH  . TYR A 1 42  ? -8.433  20.672 1.935  1.00 37.12 ? 24  TYR A OH  1 
ATOM   156  N N   . PHE A 1 43  ? -16.857 20.991 2.399  1.00 17.30 ? 25  PHE A N   1 
ATOM   157  C CA  . PHE A 1 43  ? -18.364 21.044 2.522  1.00 19.84 ? 25  PHE A CA  1 
ATOM   158  C C   . PHE A 1 43  ? -18.787 19.568 2.649  1.00 19.81 ? 25  PHE A C   1 
ATOM   159  O O   . PHE A 1 43  ? -18.296 18.711 1.917  1.00 20.23 ? 25  PHE A O   1 
ATOM   160  C CB  . PHE A 1 43  ? -18.932 21.660 1.219  1.00 23.54 ? 25  PHE A CB  1 
ATOM   161  C CG  . PHE A 1 43  ? -20.380 21.469 1.043  1.00 23.91 ? 25  PHE A CG  1 
ATOM   162  C CD1 . PHE A 1 43  ? -21.284 22.157 1.908  1.00 26.13 ? 25  PHE A CD1 1 
ATOM   163  C CD2 . PHE A 1 43  ? -20.886 20.581 0.112  1.00 22.78 ? 25  PHE A CD2 1 
ATOM   164  C CE1 . PHE A 1 43  ? -22.682 21.980 1.845  1.00 26.60 ? 25  PHE A CE1 1 
ATOM   165  C CE2 . PHE A 1 43  ? -22.317 20.454 0.016  1.00 27.34 ? 25  PHE A CE2 1 
ATOM   166  C CZ  . PHE A 1 43  ? -23.181 21.149 0.918  1.00 24.24 ? 25  PHE A CZ  1 
ATOM   167  N N   . ASN A 1 44  ? -19.779 19.305 3.507  1.00 16.91 ? 26  ASN A N   1 
ATOM   168  C CA  . ASN A 1 44  ? -20.379 17.976 3.681  1.00 17.72 ? 26  ASN A CA  1 
ATOM   169  C C   . ASN A 1 44  ? -21.804 17.965 3.145  1.00 15.77 ? 26  ASN A C   1 
ATOM   170  O O   . ASN A 1 44  ? -22.670 18.729 3.524  1.00 16.38 ? 26  ASN A O   1 
ATOM   171  C CB  . ASN A 1 44  ? -20.347 17.606 5.150  1.00 16.69 ? 26  ASN A CB  1 
ATOM   172  C CG  . ASN A 1 44  ? -20.777 16.200 5.386  1.00 19.06 ? 26  ASN A CG  1 
ATOM   173  O OD1 . ASN A 1 44  ? -21.890 15.828 5.036  1.00 17.47 ? 26  ASN A OD1 1 
ATOM   174  N ND2 . ASN A 1 44  ? -19.915 15.415 5.961  1.00 21.23 ? 26  ASN A ND2 1 
ATOM   175  N N   . HIS A 1 45  ? -22.068 17.114 2.146  1.00 16.18 ? 27  HIS A N   1 
ATOM   176  C CA  . HIS A 1 45  ? -23.347 17.162 1.483  1.00 17.46 ? 27  HIS A CA  1 
ATOM   177  C C   . HIS A 1 45  ? -24.437 16.374 2.189  1.00 18.80 ? 27  HIS A C   1 
ATOM   178  O O   . HIS A 1 45  ? -25.565 16.429 1.808  1.00 21.00 ? 27  HIS A O   1 
ATOM   179  C CB  . HIS A 1 45  ? -23.281 16.689 0.033  1.00 22.06 ? 27  HIS A CB  1 
ATOM   180  C CG  . HIS A 1 45  ? -23.020 15.245 -0.092 1.00 23.79 ? 27  HIS A CG  1 
ATOM   181  N ND1 . HIS A 1 45  ? -21.760 14.748 -0.310 1.00 30.75 ? 27  HIS A ND1 1 
ATOM   182  C CD2 . HIS A 1 45  ? -23.851 14.173 -0.036 1.00 31.12 ? 27  HIS A CD2 1 
ATOM   183  C CE1 . HIS A 1 45  ? -21.818 13.424 -0.352 1.00 28.60 ? 27  HIS A CE1 1 
ATOM   184  N NE2 . HIS A 1 45  ? -23.066 13.054 -0.179 1.00 31.65 ? 27  HIS A NE2 1 
ATOM   185  N N   . ILE A 1 46  ? -24.080 15.731 3.275  1.00 17.00 ? 28  ILE A N   1 
ATOM   186  C CA  . ILE A 1 46  ? -25.080 15.064 4.147  1.00 18.64 ? 28  ILE A CA  1 
ATOM   187  C C   . ILE A 1 46  ? -25.573 15.982 5.267  1.00 19.02 ? 28  ILE A C   1 
ATOM   188  O O   . ILE A 1 46  ? -26.777 16.029 5.554  1.00 21.83 ? 28  ILE A O   1 
ATOM   189  C CB  . ILE A 1 46  ? -24.514 13.813 4.750  1.00 21.73 ? 28  ILE A CB  1 
ATOM   190  C CG1 . ILE A 1 46  ? -23.994 12.824 3.662  1.00 25.17 ? 28  ILE A CG1 1 
ATOM   191  C CG2 . ILE A 1 46  ? -25.511 13.155 5.698  1.00 23.24 ? 28  ILE A CG2 1 
ATOM   192  C CD1 . ILE A 1 46  ? -23.020 11.808 4.185  1.00 30.73 ? 28  ILE A CD1 1 
ATOM   193  N N   . THR A 1 47  ? -24.649 16.753 5.856  1.00 17.02 ? 29  THR A N   1 
ATOM   194  C CA  . THR A 1 47  ? -25.017 17.640 6.932  1.00 16.17 ? 29  THR A CA  1 
ATOM   195  C C   . THR A 1 47  ? -25.124 19.120 6.548  1.00 16.57 ? 29  THR A C   1 
ATOM   196  O O   . THR A 1 47  ? -25.585 19.945 7.338  1.00 16.47 ? 29  THR A O   1 
ATOM   197  C CB  . THR A 1 47  ? -23.946 17.617 8.020  1.00 16.86 ? 29  THR A CB  1 
ATOM   198  O OG1 . THR A 1 47  ? -22.720 18.168 7.446  1.00 17.45 ? 29  THR A OG1 1 
ATOM   199  C CG2 . THR A 1 47  ? -23.605 16.183 8.546  1.00 19.29 ? 29  THR A CG2 1 
ATOM   200  N N   . ASN A 1 48  ? -24.656 19.463 5.326  1.00 15.24 ? 30  ASN A N   1 
ATOM   201  C CA  . ASN A 1 48  ? -24.610 20.803 4.858  1.00 15.81 ? 30  ASN A CA  1 
ATOM   202  C C   . ASN A 1 48  ? -23.636 21.659 5.629  1.00 15.43 ? 30  ASN A C   1 
ATOM   203  O O   . ASN A 1 48  ? -23.706 22.910 5.491  1.00 15.90 ? 30  ASN A O   1 
ATOM   204  C CB  . ASN A 1 48  ? -25.947 21.427 4.688  1.00 16.64 ? 30  ASN A CB  1 
ATOM   205  C CG  . ASN A 1 48  ? -26.657 20.877 3.452  1.00 18.89 ? 30  ASN A CG  1 
ATOM   206  O OD1 . ASN A 1 48  ? -25.999 20.566 2.467  1.00 19.66 ? 30  ASN A OD1 1 
ATOM   207  N ND2 . ASN A 1 48  ? -27.975 20.725 3.529  1.00 18.97 ? 30  ASN A ND2 1 
ATOM   208  N N   . ALA A 1 49  ? -22.772 21.046 6.431  1.00 15.94 ? 31  ALA A N   1 
ATOM   209  C CA  . ALA A 1 49  ? -21.756 21.818 7.160  1.00 16.22 ? 31  ALA A CA  1 
ATOM   210  C C   . ALA A 1 49  ? -20.659 22.253 6.170  1.00 16.21 ? 31  ALA A C   1 
ATOM   211  O O   . ALA A 1 49  ? -20.362 21.592 5.198  1.00 16.49 ? 31  ALA A O   1 
ATOM   212  C CB  . ALA A 1 49  ? -21.114 20.964 8.218  1.00 17.92 ? 31  ALA A CB  1 
ATOM   213  N N   . SER A 1 50  ? -20.038 23.402 6.488  1.00 18.45 ? 32  SER A N   1 
ATOM   214  C CA  . SER A 1 50  ? -18.813 23.827 5.769  1.00 18.07 ? 32  SER A CA  1 
ATOM   215  C C   . SER A 1 50  ? -17.800 24.290 6.822  1.00 19.49 ? 32  SER A C   1 
ATOM   216  O O   . SER A 1 50  ? -18.172 24.819 7.900  1.00 20.73 ? 32  SER A O   1 
ATOM   217  C CB  . SER A 1 50  ? -19.084 24.886 4.783  1.00 20.77 ? 32  SER A CB  1 
ATOM   218  O OG  . SER A 1 50  ? -19.898 25.812 5.344  1.00 26.67 ? 32  SER A OG  1 
ATOM   219  N N   . GLN A 1 51  ? -16.527 24.053 6.501  1.00 18.43 ? 33  GLN A N   1 
ATOM   220  C CA  . GLN A 1 51  ? -15.436 24.435 7.413  1.00 20.53 ? 33  GLN A CA  1 
ATOM   221  C C   . GLN A 1 51  ? -14.172 24.721 6.602  1.00 18.04 ? 33  GLN A C   1 
ATOM   222  O O   . GLN A 1 51  ? -13.992 24.203 5.552  1.00 18.60 ? 33  GLN A O   1 
ATOM   223  C CB  . GLN A 1 51  ? -15.172 23.300 8.396  1.00 22.41 ? 33  GLN A CB  1 
ATOM   224  C CG  . GLN A 1 51  ? -14.744 21.970 7.825  1.00 25.38 ? 33  GLN A CG  1 
ATOM   225  C CD  . GLN A 1 51  ? -14.553 20.936 8.911  1.00 28.05 ? 33  GLN A CD  1 
ATOM   226  O OE1 . GLN A 1 51  ? -15.486 20.641 9.655  1.00 27.37 ? 33  GLN A OE1 1 
ATOM   227  N NE2 . GLN A 1 51  ? -13.323 20.386 9.030  1.00 25.93 ? 33  GLN A NE2 1 
ATOM   228  N N   . TRP A 1 52  ? -13.240 25.514 7.203  1.00 18.57 ? 34  TRP A N   1 
ATOM   229  C CA  . TRP A 1 52  ? -12.012 25.796 6.495  1.00 19.45 ? 34  TRP A CA  1 
ATOM   230  C C   . TRP A 1 52  ? -10.987 24.652 6.583  1.00 21.84 ? 34  TRP A C   1 
ATOM   231  O O   . TRP A 1 52  ? -10.306 24.349 5.570  1.00 27.27 ? 34  TRP A O   1 
ATOM   232  C CB  . TRP A 1 52  ? -11.425 27.116 7.117  1.00 19.24 ? 34  TRP A CB  1 
ATOM   233  C CG  . TRP A 1 52  ? -12.155 28.326 6.862  1.00 21.36 ? 34  TRP A CG  1 
ATOM   234  C CD1 . TRP A 1 52  ? -12.749 29.136 7.763  1.00 23.97 ? 34  TRP A CD1 1 
ATOM   235  C CD2 . TRP A 1 52  ? -12.365 28.960 5.573  1.00 22.41 ? 34  TRP A CD2 1 
ATOM   236  N NE1 . TRP A 1 52  ? -13.319 30.158 7.151  1.00 25.22 ? 34  TRP A NE1 1 
ATOM   237  C CE2 . TRP A 1 52  ? -13.102 30.096 5.795  1.00 24.53 ? 34  TRP A CE2 1 
ATOM   238  C CE3 . TRP A 1 52  ? -12.021 28.634 4.265  1.00 20.75 ? 34  TRP A CE3 1 
ATOM   239  C CZ2 . TRP A 1 52  ? -13.521 30.941 4.753  1.00 25.25 ? 34  TRP A CZ2 1 
ATOM   240  C CZ3 . TRP A 1 52  ? -12.412 29.492 3.209  1.00 21.35 ? 34  TRP A CZ3 1 
ATOM   241  C CH2 . TRP A 1 52  ? -13.153 30.613 3.464  1.00 25.69 ? 34  TRP A CH2 1 
ATOM   242  N N   . GLU A 1 53  ? -10.858 23.982 7.743  1.00 23.06 ? 35  GLU A N   1 
ATOM   243  C CA  . GLU A 1 53  ? -9.930  22.870 7.873  1.00 25.67 ? 35  GLU A CA  1 
ATOM   244  C C   . GLU A 1 53  ? -10.323 21.573 7.168  1.00 27.51 ? 35  GLU A C   1 
ATOM   245  O O   . GLU A 1 53  ? -11.518 21.232 7.072  1.00 26.62 ? 35  GLU A O   1 
ATOM   246  C CB  . GLU A 1 53  ? -9.559  22.621 9.282  1.00 28.16 ? 35  GLU A CB  1 
ATOM   247  C CG  . GLU A 1 53  ? -8.945  23.845 9.914  1.00 31.25 ? 35  GLU A CG  1 
ATOM   248  C CD  . GLU A 1 53  ? -8.379  23.524 11.272 1.00 33.56 ? 35  GLU A CD  1 
ATOM   249  O OE1 . GLU A 1 53  ? -7.716  22.434 11.409 1.00 34.77 ? 35  GLU A OE1 1 
ATOM   250  O OE2 . GLU A 1 53  ? -8.645  24.380 12.139 1.00 33.40 ? 35  GLU A OE2 1 
ATOM   251  N N   . ARG A 1 54  ? -9.312  20.854 6.662  1.00 28.99 ? 36  ARG A N   1 
ATOM   252  C CA  . ARG A 1 54  ? -9.523  19.552 6.046  1.00 30.00 ? 36  ARG A CA  1 
ATOM   253  C C   . ARG A 1 54  ? -9.979  18.576 7.111  1.00 32.94 ? 36  ARG A C   1 
ATOM   254  O O   . ARG A 1 54  ? -9.364  18.405 8.152  1.00 37.64 ? 36  ARG A O   1 
ATOM   255  C CB  . ARG A 1 54  ? -8.247  19.069 5.275  1.00 32.58 ? 36  ARG A CB  1 
ATOM   256  C CG  . ARG A 1 54  ? -8.479  17.920 4.312  1.00 35.78 ? 36  ARG A CG  1 
ATOM   257  C CD  . ARG A 1 54  ? -7.207  17.686 3.448  1.00 40.07 ? 36  ARG A CD  1 
ATOM   258  N NE  . ARG A 1 54  ? -7.308  16.489 2.589  1.00 40.99 ? 36  ARG A NE  1 
ATOM   259  C CZ  . ARG A 1 54  ? -7.727  16.453 1.320  1.00 44.91 ? 36  ARG A CZ  1 
ATOM   260  N NH1 . ARG A 1 54  ? -8.091  17.556 0.646  1.00 43.99 ? 36  ARG A NH1 1 
ATOM   261  N NH2 . ARG A 1 54  ? -7.765  15.274 0.690  1.00 45.06 ? 36  ARG A NH2 1 
ATOM   262  N N   . PRO A 1 55  ? -11.138 17.968 6.908  1.00 31.85 ? 37  PRO A N   1 
ATOM   263  C CA  . PRO A 1 55  ? -11.775 17.235 8.023  1.00 35.15 ? 37  PRO A CA  1 
ATOM   264  C C   . PRO A 1 55  ? -11.074 15.959 8.484  1.00 43.02 ? 37  PRO A C   1 
ATOM   265  O O   . PRO A 1 55  ? -10.551 15.272 7.625  1.00 41.83 ? 37  PRO A O   1 
ATOM   266  C CB  . PRO A 1 55  ? -13.132 16.893 7.432  1.00 31.98 ? 37  PRO A CB  1 
ATOM   267  C CG  . PRO A 1 55  ? -12.999 17.053 5.989  1.00 32.85 ? 37  PRO A CG  1 
ATOM   268  C CD  . PRO A 1 55  ? -12.069 18.215 5.812  1.00 30.69 ? 37  PRO A CD  1 
ATOM   269  N N   . GLU A 1 69  ? -20.182 3.018  13.376 1.00 52.97 ? 51  GLU A N   1 
ATOM   270  C CA  . GLU A 1 69  ? -20.896 4.184  13.880 1.00 53.88 ? 51  GLU A CA  1 
ATOM   271  C C   . GLU A 1 69  ? -21.691 3.812  15.153 1.00 55.70 ? 51  GLU A C   1 
ATOM   272  O O   . GLU A 1 69  ? -22.190 2.671  15.280 1.00 54.87 ? 51  GLU A O   1 
ATOM   273  C CB  . GLU A 1 69  ? -21.833 4.749  12.794 1.00 58.72 ? 51  GLU A CB  1 
ATOM   274  C CG  . GLU A 1 69  ? -23.276 4.265  12.912 1.00 54.99 ? 51  GLU A CG  1 
ATOM   275  C CD  . GLU A 1 69  ? -24.185 4.726  11.782 1.00 52.92 ? 51  GLU A CD  1 
ATOM   276  O OE1 . GLU A 1 69  ? -23.780 5.580  10.978 1.00 54.12 ? 51  GLU A OE1 1 
ATOM   277  O OE2 . GLU A 1 69  ? -25.336 4.232  11.707 1.00 48.46 ? 51  GLU A OE2 1 
ATOM   278  N N   . PRO A 1 70  ? -21.856 4.775  16.092 1.00 48.78 ? 52  PRO A N   1 
ATOM   279  C CA  . PRO A 1 70  ? -22.547 4.432  17.363 1.00 48.65 ? 52  PRO A CA  1 
ATOM   280  C C   . PRO A 1 70  ? -23.937 3.888  17.129 1.00 40.34 ? 52  PRO A C   1 
ATOM   281  O O   . PRO A 1 70  ? -24.532 4.188  16.100 1.00 49.09 ? 52  PRO A O   1 
ATOM   282  C CB  . PRO A 1 70  ? -22.639 5.786  18.089 1.00 49.80 ? 52  PRO A CB  1 
ATOM   283  C CG  . PRO A 1 70  ? -22.495 6.832  16.987 1.00 51.44 ? 52  PRO A CG  1 
ATOM   284  C CD  . PRO A 1 70  ? -21.540 6.218  15.998 1.00 54.15 ? 52  PRO A CD  1 
ATOM   285  N N   . ALA A 1 71  ? -24.471 3.146  18.097 1.00 43.83 ? 53  ALA A N   1 
ATOM   286  C CA  . ALA A 1 71  ? -25.831 2.673  18.032 1.00 43.92 ? 53  ALA A CA  1 
ATOM   287  C C   . ALA A 1 71  ? -26.754 3.875  18.115 1.00 38.73 ? 53  ALA A C   1 
ATOM   288  O O   . ALA A 1 71  ? -27.806 3.896  17.485 1.00 34.93 ? 53  ALA A O   1 
ATOM   289  C CB  . ALA A 1 71  ? -26.150 1.683  19.164 1.00 50.37 ? 53  ALA A CB  1 
ATOM   290  N N   . ARG A 1 72  ? -26.343 4.860  18.935 1.00 39.07 ? 54  ARG A N   1 
ATOM   291  C CA  . ARG A 1 72  ? -27.139 6.028  19.205 1.00 30.35 ? 54  ARG A CA  1 
ATOM   292  C C   . ARG A 1 72  ? -26.296 7.308  19.159 1.00 25.61 ? 54  ARG A C   1 
ATOM   293  O O   . ARG A 1 72  ? -25.056 7.293  19.336 1.00 29.12 ? 54  ARG A O   1 
ATOM   294  C CB  . ARG A 1 72  ? -27.755 5.895  20.590 1.00 37.37 ? 54  ARG A CB  1 
ATOM   295  C CG  . ARG A 1 72  ? -29.006 5.016  20.577 1.00 44.75 ? 54  ARG A CG  1 
ATOM   296  C CD  . ARG A 1 72  ? -29.112 4.173  21.823 1.00 50.76 ? 54  ARG A CD  1 
ATOM   297  N NE  . ARG A 1 72  ? -29.458 4.969  22.983 1.00 56.31 ? 54  ARG A NE  1 
ATOM   298  C CZ  . ARG A 1 72  ? -30.689 5.390  23.281 1.00 63.75 ? 54  ARG A CZ  1 
ATOM   299  N NH1 . ARG A 1 72  ? -31.730 5.139  22.476 1.00 62.24 ? 54  ARG A NH1 1 
ATOM   300  N NH2 . ARG A 1 72  ? -30.874 6.082  24.400 1.00 68.75 ? 54  ARG A NH2 1 
ATOM   301  N N   . VAL A 1 73  ? -27.052 8.373  18.857 1.00 24.54 ? 55  VAL A N   1 
ATOM   302  C CA  . VAL A 1 73  ? -26.530 9.719  19.026 1.00 23.27 ? 55  VAL A CA  1 
ATOM   303  C C   . VAL A 1 73  ? -27.508 10.513 19.815 1.00 21.79 ? 55  VAL A C   1 
ATOM   304  O O   . VAL A 1 73  ? -28.690 10.224 19.870 1.00 26.48 ? 55  VAL A O   1 
ATOM   305  C CB  . VAL A 1 73  ? -26.218 10.420 17.689 1.00 22.77 ? 55  VAL A CB  1 
ATOM   306  C CG1 . VAL A 1 73  ? -25.076 9.660  16.997 1.00 25.60 ? 55  VAL A CG1 1 
ATOM   307  C CG2 . VAL A 1 73  ? -27.473 10.539 16.872 1.00 23.16 ? 55  VAL A CG2 1 
ATOM   308  N N   . ARG A 1 74  ? -27.008 11.588 20.427 1.00 20.40 ? 56  ARG A N   1 
ATOM   309  C CA  . ARG A 1 74  ? -27.890 12.549 21.057 1.00 20.52 ? 56  ARG A CA  1 
ATOM   310  C C   . ARG A 1 74  ? -27.676 13.904 20.319 1.00 18.19 ? 56  ARG A C   1 
ATOM   311  O O   . ARG A 1 74  ? -26.523 14.292 20.041 1.00 20.63 ? 56  ARG A O   1 
ATOM   312  C CB  . ARG A 1 74  ? -27.464 12.769 22.517 1.00 21.24 ? 56  ARG A CB  1 
ATOM   313  C CG  . ARG A 1 74  ? -28.357 13.641 23.304 1.00 24.00 ? 56  ARG A CG  1 
ATOM   314  C CD  . ARG A 1 74  ? -27.831 13.945 24.689 1.00 25.17 ? 56  ARG A CD  1 
ATOM   315  N NE  . ARG A 1 74  ? -28.913 14.648 25.420 1.00 23.87 ? 56  ARG A NE  1 
ATOM   316  C CZ  . ARG A 1 74  ? -28.814 14.882 26.736 1.00 33.13 ? 56  ARG A CZ  1 
ATOM   317  N NH1 . ARG A 1 74  ? -27.744 14.464 27.425 1.00 33.39 ? 56  ARG A NH1 1 
ATOM   318  N NH2 . ARG A 1 74  ? -29.765 15.524 27.347 1.00 31.42 ? 56  ARG A NH2 1 
ATOM   319  N N   . CYS A 1 75  ? -28.768 14.567 19.992 1.00 19.46 ? 57  CYS A N   1 
ATOM   320  C CA  . CYS A 1 75  ? -28.711 15.854 19.323 1.00 20.14 ? 57  CYS A CA  1 
ATOM   321  C C   . CYS A 1 75  ? -29.672 16.817 19.885 1.00 18.83 ? 57  CYS A C   1 
ATOM   322  O O   . CYS A 1 75  ? -30.704 16.448 20.476 1.00 18.43 ? 57  CYS A O   1 
ATOM   323  C CB  . CYS A 1 75  ? -29.097 15.676 17.850 1.00 21.13 ? 57  CYS A CB  1 
ATOM   324  S SG  . CYS A 1 75  ? -27.936 14.624 16.927 1.00 22.51 ? 57  CYS A SG  1 
ATOM   325  N N   . SER A 1 76  ? -29.427 18.071 19.641 1.00 16.86 ? 58  SER A N   1 
ATOM   326  C CA  . SER A 1 76  ? -30.319 19.120 19.835 1.00 15.73 ? 58  SER A CA  1 
ATOM   327  C C   . SER A 1 76  ? -30.593 19.720 18.425 1.00 17.51 ? 58  SER A C   1 
ATOM   328  O O   . SER A 1 76  ? -29.804 19.497 17.512 1.00 15.97 ? 58  SER A O   1 
ATOM   329  C CB  . SER A 1 76  ? -29.785 20.245 20.711 1.00 18.05 ? 58  SER A CB  1 
ATOM   330  O OG  . SER A 1 76  ? -29.509 19.774 22.028 1.00 18.98 ? 58  SER A OG  1 
ATOM   331  N N   . HIS A 1 77  ? -31.703 20.431 18.278 1.00 15.69 ? 59  HIS A N   1 
ATOM   332  C CA  . HIS A 1 77  ? -31.999 21.124 17.023 1.00 16.09 ? 59  HIS A CA  1 
ATOM   333  C C   . HIS A 1 77  ? -32.783 22.348 17.230 1.00 15.02 ? 59  HIS A C   1 
ATOM   334  O O   . HIS A 1 77  ? -33.397 22.615 18.288 1.00 15.66 ? 59  HIS A O   1 
ATOM   335  C CB  . HIS A 1 77  ? -32.699 20.204 16.026 1.00 16.91 ? 59  HIS A CB  1 
ATOM   336  C CG  . HIS A 1 77  ? -34.134 20.033 16.286 1.00 18.43 ? 59  HIS A CG  1 
ATOM   337  N ND1 . HIS A 1 77  ? -35.017 19.904 15.245 1.00 18.70 ? 59  HIS A ND1 1 
ATOM   338  C CD2 . HIS A 1 77  ? -34.846 19.839 17.424 1.00 21.77 ? 59  HIS A CD2 1 
ATOM   339  C CE1 . HIS A 1 77  ? -36.246 19.750 15.736 1.00 20.95 ? 59  HIS A CE1 1 
ATOM   340  N NE2 . HIS A 1 77  ? -36.169 19.730 17.045 1.00 21.52 ? 59  HIS A NE2 1 
ATOM   341  N N   . LEU A 1 78  ? -32.742 23.169 16.203 1.00 13.40 ? 60  LEU A N   1 
ATOM   342  C CA  . LEU A 1 78  ? -33.526 24.348 16.084 1.00 13.62 ? 60  LEU A CA  1 
ATOM   343  C C   . LEU A 1 78  ? -34.279 24.188 14.762 1.00 16.30 ? 60  LEU A C   1 
ATOM   344  O O   . LEU A 1 78  ? -33.663 24.092 13.706 1.00 16.82 ? 60  LEU A O   1 
ATOM   345  C CB  . LEU A 1 78  ? -32.693 25.620 16.052 1.00 15.61 ? 60  LEU A CB  1 
ATOM   346  C CG  . LEU A 1 78  ? -33.359 27.007 16.147 1.00 15.56 ? 60  LEU A CG  1 
ATOM   347  C CD1 . LEU A 1 78  ? -32.231 28.038 16.461 1.00 16.47 ? 60  LEU A CD1 1 
ATOM   348  C CD2 . LEU A 1 78  ? -34.061 27.321 14.887 1.00 17.28 ? 60  LEU A CD2 1 
ATOM   349  N N   . LEU A 1 79  ? -35.614 24.194 14.822 1.00 14.07 ? 61  LEU A N   1 
ATOM   350  C CA  . LEU A 1 79  ? -36.474 24.009 13.635 1.00 15.53 ? 61  LEU A CA  1 
ATOM   351  C C   . LEU A 1 79  ? -37.130 25.323 13.285 1.00 16.14 ? 61  LEU A C   1 
ATOM   352  O O   . LEU A 1 79  ? -37.722 26.018 14.093 1.00 17.09 ? 61  LEU A O   1 
ATOM   353  C CB  . LEU A 1 79  ? -37.597 23.014 13.965 1.00 17.84 ? 61  LEU A CB  1 
ATOM   354  C CG  . LEU A 1 79  ? -38.653 22.821 12.874 1.00 17.12 ? 61  LEU A CG  1 
ATOM   355  C CD1 . LEU A 1 79  ? -38.043 22.266 11.587 1.00 20.21 ? 61  LEU A CD1 1 
ATOM   356  C CD2 . LEU A 1 79  ? -39.693 21.862 13.406 1.00 19.16 ? 61  LEU A CD2 1 
ATOM   357  N N   . VAL A 1 80  ? -37.077 25.708 11.996 1.00 15.03 ? 62  VAL A N   1 
ATOM   358  C CA  . VAL A 1 80  ? -37.845 26.835 11.494 1.00 17.45 ? 62  VAL A CA  1 
ATOM   359  C C   . VAL A 1 80  ? -38.855 26.250 10.474 1.00 16.73 ? 62  VAL A C   1 
ATOM   360  O O   . VAL A 1 80  ? -38.468 25.636 9.470  1.00 17.37 ? 62  VAL A O   1 
ATOM   361  C CB  . VAL A 1 80  ? -37.015 27.934 10.842 1.00 17.85 ? 62  VAL A CB  1 
ATOM   362  C CG1 . VAL A 1 80  ? -37.900 29.015 10.321 1.00 18.27 ? 62  VAL A CG1 1 
ATOM   363  C CG2 . VAL A 1 80  ? -36.076 28.538 11.883 1.00 16.24 ? 62  VAL A CG2 1 
ATOM   364  N N   . LYS A 1 81  ? -40.141 26.303 10.791 1.00 17.96 ? 63  LYS A N   1 
ATOM   365  C CA  . LYS A 1 81  ? -41.143 25.757 9.833  1.00 19.36 ? 63  LYS A CA  1 
ATOM   366  C C   . LYS A 1 81  ? -41.451 26.843 8.813  1.00 20.95 ? 63  LYS A C   1 
ATOM   367  O O   . LYS A 1 81  ? -41.200 28.050 8.934  1.00 19.48 ? 63  LYS A O   1 
ATOM   368  C CB  . LYS A 1 81  ? -42.381 25.394 10.681 1.00 19.73 ? 63  LYS A CB  1 
ATOM   369  C CG  . LYS A 1 81  ? -42.226 24.112 11.457 1.00 19.94 ? 63  LYS A CG  1 
ATOM   370  C CD  . LYS A 1 81  ? -43.575 23.755 12.148 1.00 22.69 ? 63  LYS A CD  1 
ATOM   371  C CE  . LYS A 1 81  ? -43.441 22.444 12.742 1.00 24.13 ? 63  LYS A CE  1 
ATOM   372  N NZ  . LYS A 1 81  ? -44.757 21.953 13.324 1.00 27.79 ? 63  LYS A NZ  1 
ATOM   373  N N   . HIS A 1 82  ? -42.189 26.386 7.799  1.00 21.91 ? 64  HIS A N   1 
ATOM   374  C CA  . HIS A 1 82  ? -42.638 27.258 6.770  1.00 21.81 ? 64  HIS A CA  1 
ATOM   375  C C   . HIS A 1 82  ? -44.020 26.822 6.276  1.00 23.15 ? 64  HIS A C   1 
ATOM   376  O O   . HIS A 1 82  ? -44.525 25.814 6.727  1.00 22.01 ? 64  HIS A O   1 
ATOM   377  C CB  . HIS A 1 82  ? -41.639 27.301 5.585  1.00 20.83 ? 64  HIS A CB  1 
ATOM   378  C CG  . HIS A 1 82  ? -41.169 25.962 5.130  1.00 23.40 ? 64  HIS A CG  1 
ATOM   379  N ND1 . HIS A 1 82  ? -41.916 25.116 4.340  1.00 24.57 ? 64  HIS A ND1 1 
ATOM   380  C CD2 . HIS A 1 82  ? -39.985 25.335 5.329  1.00 21.80 ? 64  HIS A CD2 1 
ATOM   381  C CE1 . HIS A 1 82  ? -41.237 23.997 4.134  1.00 28.50 ? 64  HIS A CE1 1 
ATOM   382  N NE2 . HIS A 1 82  ? -40.041 24.134 4.691  1.00 25.36 ? 64  HIS A NE2 1 
ATOM   383  N N   . SER A 1 83  ? -44.558 27.564 5.319  1.00 25.35 ? 65  SER A N   1 
ATOM   384  C CA  . SER A 1 83  ? -45.964 27.228 4.873  1.00 28.02 ? 65  SER A CA  1 
ATOM   385  C C   . SER A 1 83  ? -46.123 25.818 4.293  1.00 27.54 ? 65  SER A C   1 
ATOM   386  O O   . SER A 1 83  ? -47.261 25.270 4.317  1.00 30.77 ? 65  SER A O   1 
ATOM   387  C CB  . SER A 1 83  ? -46.467 28.305 3.947  1.00 29.75 ? 65  SER A CB  1 
ATOM   388  O OG  . SER A 1 83  ? -45.705 28.292 2.751  1.00 32.61 ? 65  SER A OG  1 
ATOM   389  N N   . GLN A 1 84  ? -45.067 25.159 3.788  1.00 24.91 ? 66  GLN A N   1 
ATOM   390  C CA  . GLN A 1 84  ? -45.183 23.738 3.334  1.00 26.13 ? 66  GLN A CA  1 
ATOM   391  C C   . GLN A 1 84  ? -44.801 22.618 4.292  1.00 25.19 ? 66  GLN A C   1 
ATOM   392  O O   . GLN A 1 84  ? -44.802 21.391 3.952  1.00 30.08 ? 66  GLN A O   1 
ATOM   393  C CB  . GLN A 1 84  ? -44.448 23.585 1.953  1.00 29.58 ? 66  GLN A CB  1 
ATOM   394  C CG  . GLN A 1 84  ? -45.009 24.464 0.867  1.00 33.57 ? 66  GLN A CG  1 
ATOM   395  C CD  . GLN A 1 84  ? -44.573 24.086 -0.572 1.00 38.45 ? 66  GLN A CD  1 
ATOM   396  O OE1 . GLN A 1 84  ? -43.933 23.068 -0.822 1.00 34.73 ? 66  GLN A OE1 1 
ATOM   397  N NE2 . GLN A 1 84  ? -45.079 24.856 -1.531 1.00 41.89 ? 66  GLN A NE2 1 
ATOM   398  N N   . SER A 1 85  ? -44.473 22.995 5.569  1.00 23.43 ? 67  SER A N   1 
ATOM   399  C CA  . SER A 1 85  ? -44.259 22.060 6.568  1.00 23.01 ? 67  SER A CA  1 
ATOM   400  C C   . SER A 1 85  ? -45.503 21.176 6.728  1.00 24.60 ? 67  SER A C   1 
ATOM   401  O O   . SER A 1 85  ? -46.612 21.684 6.524  1.00 29.88 ? 67  SER A O   1 
ATOM   402  C CB  . SER A 1 85  ? -43.974 22.721 7.911  1.00 25.42 ? 67  SER A CB  1 
ATOM   403  O OG  . SER A 1 85  ? -42.792 23.500 7.843  1.00 25.00 ? 67  SER A OG  1 
ATOM   404  N N   . ARG A 1 86  ? -45.271 19.925 7.078  1.00 26.81 ? 68  ARG A N   1 
ATOM   405  C CA  . ARG A 1 86  ? -46.376 18.967 7.249  1.00 28.33 ? 68  ARG A CA  1 
ATOM   406  C C   . ARG A 1 86  ? -47.459 19.531 8.182  1.00 36.58 ? 68  ARG A C   1 
ATOM   407  O O   . ARG A 1 86  ? -48.662 19.471 7.852  1.00 33.72 ? 68  ARG A O   1 
ATOM   408  C CB  . ARG A 1 86  ? -45.836 17.660 7.675  1.00 39.04 ? 68  ARG A CB  1 
ATOM   409  C CG  . ARG A 1 86  ? -46.830 16.500 7.826  1.00 50.24 ? 68  ARG A CG  1 
ATOM   410  C CD  . ARG A 1 86  ? -46.433 15.666 9.054  1.00 65.46 ? 68  ARG A CD  1 
ATOM   411  N NE  . ARG A 1 86  ? -44.962 15.624 9.204  1.00 79.07 ? 68  ARG A NE  1 
ATOM   412  C CZ  . ARG A 1 86  ? -44.214 16.360 10.051 1.00 82.22 ? 68  ARG A CZ  1 
ATOM   413  N NH1 . ARG A 1 86  ? -42.897 16.202 10.002 1.00 81.06 ? 68  ARG A NH1 1 
ATOM   414  N NH2 . ARG A 1 86  ? -44.735 17.247 10.933 1.00 77.47 ? 68  ARG A NH2 1 
ATOM   415  N N   . ARG A 1 87  ? -47.041 20.135 9.296  1.00 29.77 ? 69  ARG A N   1 
ATOM   416  C CA  . ARG A 1 87  ? -47.927 20.848 10.190 1.00 28.96 ? 69  ARG A CA  1 
ATOM   417  C C   . ARG A 1 87  ? -47.404 22.222 10.393 1.00 25.44 ? 69  ARG A C   1 
ATOM   418  O O   . ARG A 1 87  ? -46.491 22.401 11.242 1.00 26.91 ? 69  ARG A O   1 
ATOM   419  C CB  . ARG A 1 87  ? -48.004 20.151 11.545 1.00 36.37 ? 69  ARG A CB  1 
ATOM   420  C CG  . ARG A 1 87  ? -48.340 18.665 11.480 1.00 45.29 ? 69  ARG A CG  1 
ATOM   421  C CD  . ARG A 1 87  ? -48.511 18.038 12.861 1.00 57.00 ? 69  ARG A CD  1 
ATOM   422  N NE  . ARG A 1 87  ? -49.348 16.835 12.731 1.00 72.57 ? 69  ARG A NE  1 
ATOM   423  C CZ  . ARG A 1 87  ? -49.962 16.182 13.730 1.00 83.77 ? 69  ARG A CZ  1 
ATOM   424  N NH1 . ARG A 1 87  ? -49.833 16.582 15.000 1.00 86.35 ? 69  ARG A NH1 1 
ATOM   425  N NH2 . ARG A 1 87  ? -50.710 15.102 13.455 1.00 81.30 ? 69  ARG A NH2 1 
ATOM   426  N N   . PRO A 1 88  ? -47.912 23.193 9.706  1.00 23.09 ? 70  PRO A N   1 
ATOM   427  C CA  . PRO A 1 88  ? -47.535 24.578 9.675  1.00 23.33 ? 70  PRO A CA  1 
ATOM   428  C C   . PRO A 1 88  ? -48.081 25.399 10.859 1.00 23.43 ? 70  PRO A C   1 
ATOM   429  O O   . PRO A 1 88  ? -48.783 26.388 10.741 1.00 26.97 ? 70  PRO A O   1 
ATOM   430  C CB  . PRO A 1 88  ? -47.950 25.055 8.295  1.00 29.29 ? 70  PRO A CB  1 
ATOM   431  C CG  . PRO A 1 88  ? -49.135 24.254 8.064  1.00 28.32 ? 70  PRO A CG  1 
ATOM   432  C CD  . PRO A 1 88  ? -48.868 22.920 8.588  1.00 28.27 ? 70  PRO A CD  1 
ATOM   433  N N   . SER A 1 89  ? -47.577 25.021 12.016 1.00 23.00 ? 71  SER A N   1 
ATOM   434  C CA  . SER A 1 89  ? -48.060 25.517 13.312 1.00 23.26 ? 71  SER A CA  1 
ATOM   435  C C   . SER A 1 89  ? -47.001 25.197 14.329 1.00 22.47 ? 71  SER A C   1 
ATOM   436  O O   . SER A 1 89  ? -46.376 24.162 14.210 1.00 22.84 ? 71  SER A O   1 
ATOM   437  C CB  . SER A 1 89  ? -49.314 24.699 13.624 1.00 27.07 ? 71  SER A CB  1 
ATOM   438  O OG  . SER A 1 89  ? -50.016 25.260 14.696 1.00 36.17 ? 71  SER A OG  1 
ATOM   439  N N   . SER A 1 90  ? -46.893 26.014 15.366 1.00 22.39 ? 72  SER A N   1 
ATOM   440  C CA  . SER A 1 90  ? -46.056 25.640 16.509 1.00 22.66 ? 72  SER A CA  1 
ATOM   441  C C   . SER A 1 90  ? -46.496 26.369 17.727 1.00 21.30 ? 72  SER A C   1 
ATOM   442  O O   . SER A 1 90  ? -47.370 27.244 17.686 1.00 23.82 ? 72  SER A O   1 
ATOM   443  C CB  . SER A 1 90  ? -44.555 26.056 16.261 1.00 20.73 ? 72  SER A CB  1 
ATOM   444  O OG  . SER A 1 90  ? -44.378 27.392 16.327 1.00 19.97 ? 72  SER A OG  1 
ATOM   445  N N   . TRP A 1 91  ? -45.756 26.177 18.836 1.00 23.33 ? 73  TRP A N   1 
ATOM   446  C CA  . TRP A 1 91  ? -45.956 26.977 19.980 1.00 23.78 ? 73  TRP A CA  1 
ATOM   447  C C   . TRP A 1 91  ? -45.785 28.513 19.763 1.00 23.67 ? 73  TRP A C   1 
ATOM   448  O O   . TRP A 1 91  ? -46.322 29.311 20.495 1.00 25.27 ? 73  TRP A O   1 
ATOM   449  C CB  . TRP A 1 91  ? -45.144 26.421 21.164 1.00 22.72 ? 73  TRP A CB  1 
ATOM   450  C CG  . TRP A 1 91  ? -43.630 26.781 21.084 1.00 25.40 ? 73  TRP A CG  1 
ATOM   451  C CD1 . TRP A 1 91  ? -42.678 26.000 20.480 1.00 27.99 ? 73  TRP A CD1 1 
ATOM   452  C CD2 . TRP A 1 91  ? -42.929 27.971 21.557 1.00 22.48 ? 73  TRP A CD2 1 
ATOM   453  N NE1 . TRP A 1 91  ? -41.460 26.648 20.538 1.00 23.92 ? 73  TRP A NE1 1 
ATOM   454  C CE2 . TRP A 1 91  ? -41.589 27.843 21.186 1.00 22.96 ? 73  TRP A CE2 1 
ATOM   455  C CE3 . TRP A 1 91  ? -43.304 29.155 22.232 1.00 22.16 ? 73  TRP A CE3 1 
ATOM   456  C CZ2 . TRP A 1 91  ? -40.626 28.806 21.530 1.00 23.34 ? 73  TRP A CZ2 1 
ATOM   457  C CZ3 . TRP A 1 91  ? -42.330 30.116 22.577 1.00 25.51 ? 73  TRP A CZ3 1 
ATOM   458  C CH2 . TRP A 1 91  ? -40.998 29.925 22.171 1.00 25.93 ? 73  TRP A CH2 1 
ATOM   459  N N   . ARG A 1 92  ? -45.018 28.984 18.742 1.00 19.80 ? 74  ARG A N   1 
ATOM   460  C CA  . ARG A 1 92  ? -44.716 30.302 18.524 1.00 20.30 ? 74  ARG A CA  1 
ATOM   461  C C   . ARG A 1 92  ? -45.819 30.958 17.719 1.00 24.40 ? 74  ARG A C   1 
ATOM   462  O O   . ARG A 1 92  ? -46.004 32.153 17.887 1.00 26.81 ? 74  ARG A O   1 
ATOM   463  C CB  . ARG A 1 92  ? -43.434 30.428 17.662 1.00 21.33 ? 74  ARG A CB  1 
ATOM   464  C CG  . ARG A 1 92  ? -42.268 29.775 18.362 1.00 22.43 ? 74  ARG A CG  1 
ATOM   465  C CD  . ARG A 1 92  ? -40.940 30.203 17.684 1.00 23.47 ? 74  ARG A CD  1 
ATOM   466  N NE  . ARG A 1 92  ? -40.728 31.604 17.963 1.00 23.65 ? 74  ARG A NE  1 
ATOM   467  C CZ  . ARG A 1 92  ? -40.339 32.515 17.103 1.00 24.82 ? 74  ARG A CZ  1 
ATOM   468  N NH1 . ARG A 1 92  ? -39.906 32.204 15.879 1.00 28.69 ? 74  ARG A NH1 1 
ATOM   469  N NH2 . ARG A 1 92  ? -40.234 33.743 17.476 1.00 29.10 ? 74  ARG A NH2 1 
ATOM   470  N N   . GLN A 1 93  ? -46.494 30.181 16.891 1.00 24.58 ? 75  GLN A N   1 
ATOM   471  C CA  . GLN A 1 93  ? -47.374 30.791 15.896 1.00 27.59 ? 75  GLN A CA  1 
ATOM   472  C C   . GLN A 1 93  ? -48.384 29.752 15.514 1.00 24.38 ? 75  GLN A C   1 
ATOM   473  O O   . GLN A 1 93  ? -48.078 28.688 15.048 1.00 24.41 ? 75  GLN A O   1 
ATOM   474  C CB  . GLN A 1 93  ? -46.574 31.164 14.662 1.00 29.09 ? 75  GLN A CB  1 
ATOM   475  C CG  . GLN A 1 93  ? -47.217 32.132 13.790 1.00 37.81 ? 75  GLN A CG  1 
ATOM   476  C CD  . GLN A 1 93  ? -46.263 32.602 12.701 1.00 37.65 ? 75  GLN A CD  1 
ATOM   477  O OE1 . GLN A 1 93  ? -45.139 32.031 12.459 1.00 32.15 ? 75  GLN A OE1 1 
ATOM   478  N NE2 . GLN A 1 93  ? -46.698 33.620 12.022 1.00 41.63 ? 75  GLN A NE2 1 
ATOM   479  N N   . GLU A 1 94  ? -49.679 30.069 15.687 1.00 27.23 ? 76  GLU A N   1 
ATOM   480  C CA  . GLU A 1 94  ? -50.682 29.123 15.345 1.00 23.22 ? 76  GLU A CA  1 
ATOM   481  C C   . GLU A 1 94  ? -50.787 28.770 13.845 1.00 22.32 ? 76  GLU A C   1 
ATOM   482  O O   . GLU A 1 94  ? -50.968 27.631 13.528 1.00 26.37 ? 76  GLU A O   1 
ATOM   483  C CB  . GLU A 1 94  ? -52.045 29.640 15.892 1.00 25.24 ? 76  GLU A CB  1 
ATOM   484  C CG  . GLU A 1 94  ? -53.143 28.622 15.786 1.00 26.16 ? 76  GLU A CG  1 
ATOM   485  C CD  . GLU A 1 94  ? -54.378 28.951 16.621 1.00 31.72 ? 76  GLU A CD  1 
ATOM   486  O OE1 . GLU A 1 94  ? -55.149 27.976 16.812 1.00 35.49 ? 76  GLU A OE1 1 
ATOM   487  O OE2 . GLU A 1 94  ? -54.509 30.099 17.093 1.00 32.84 ? 76  GLU A OE2 1 
ATOM   488  N N   . LYS A 1 95  ? -50.661 29.785 13.014 1.00 26.86 ? 77  LYS A N   1 
ATOM   489  C CA  . LYS A 1 95  ? -50.589 29.578 11.563 1.00 31.41 ? 77  LYS A CA  1 
ATOM   490  C C   . LYS A 1 95  ? -49.231 30.116 11.059 1.00 24.21 ? 77  LYS A C   1 
ATOM   491  O O   . LYS A 1 95  ? -49.020 31.299 11.071 1.00 27.85 ? 77  LYS A O   1 
ATOM   492  C CB  . LYS A 1 95  ? -51.702 30.396 10.908 1.00 35.79 ? 77  LYS A CB  1 
ATOM   493  C CG  . LYS A 1 95  ? -51.836 30.065 9.423  1.00 40.78 ? 77  LYS A CG  1 
ATOM   494  C CD  . LYS A 1 95  ? -52.823 30.937 8.665  1.00 47.07 ? 77  LYS A CD  1 
ATOM   495  C CE  . LYS A 1 95  ? -53.232 30.179 7.405  1.00 47.99 ? 77  LYS A CE  1 
ATOM   496  N NZ  . LYS A 1 95  ? -54.206 30.999 6.666  1.00 58.54 ? 77  LYS A NZ  1 
ATOM   497  N N   . ILE A 1 96  ? -48.431 29.189 10.563 1.00 28.09 ? 78  ILE A N   1 
ATOM   498  C CA  . ILE A 1 96  ? -47.126 29.578 10.000 1.00 26.87 ? 78  ILE A CA  1 
ATOM   499  C C   . ILE A 1 96  ? -47.276 29.814 8.499  1.00 23.79 ? 78  ILE A C   1 
ATOM   500  O O   . ILE A 1 96  ? -47.563 28.849 7.770  1.00 31.33 ? 78  ILE A O   1 
ATOM   501  C CB  . ILE A 1 96  ? -46.073 28.593 10.389 1.00 26.11 ? 78  ILE A CB  1 
ATOM   502  C CG1 . ILE A 1 96  ? -45.897 28.723 11.915 1.00 28.57 ? 78  ILE A CG1 1 
ATOM   503  C CG2 . ILE A 1 96  ? -44.739 28.854 9.650  1.00 27.48 ? 78  ILE A CG2 1 
ATOM   504  C CD1 . ILE A 1 96  ? -44.921 27.804 12.523 1.00 27.55 ? 78  ILE A CD1 1 
ATOM   505  N N   . THR A 1 97  ? -47.001 31.033 8.113  1.00 28.46 ? 79  THR A N   1 
ATOM   506  C CA  . THR A 1 97  ? -47.173 31.401 6.706  1.00 30.45 ? 79  THR A CA  1 
ATOM   507  C C   . THR A 1 97  ? -45.873 31.792 6.007  1.00 31.79 ? 79  THR A C   1 
ATOM   508  O O   . THR A 1 97  ? -45.902 32.067 4.825  1.00 29.79 ? 79  THR A O   1 
ATOM   509  C CB  . THR A 1 97  ? -48.162 32.543 6.593  1.00 33.16 ? 79  THR A CB  1 
ATOM   510  O OG1 . THR A 1 97  ? -47.665 33.655 7.332  1.00 37.92 ? 79  THR A OG1 1 
ATOM   511  C CG2 . THR A 1 97  ? -49.480 32.128 7.127  1.00 39.24 ? 79  THR A CG2 1 
ATOM   512  N N   . ARG A 1 98  ? -44.713 31.820 6.689  1.00 27.79 ? 80  ARG A N   1 
ATOM   513  C CA  . ARG A 1 98  ? -43.495 32.175 5.971  1.00 23.44 ? 80  ARG A CA  1 
ATOM   514  C C   . ARG A 1 98  ? -43.186 31.198 4.900  1.00 21.20 ? 80  ARG A C   1 
ATOM   515  O O   . ARG A 1 98  ? -43.494 29.997 4.979  1.00 25.39 ? 80  ARG A O   1 
ATOM   516  C CB  . ARG A 1 98  ? -42.358 32.302 6.990  1.00 25.98 ? 80  ARG A CB  1 
ATOM   517  C CG  . ARG A 1 98  ? -41.843 30.949 7.465  1.00 24.87 ? 80  ARG A CG  1 
ATOM   518  C CD  . ARG A 1 98  ? -40.592 31.137 8.367  1.00 23.07 ? 80  ARG A CD  1 
ATOM   519  N NE  . ARG A 1 98  ? -40.812 31.846 9.619  1.00 25.11 ? 80  ARG A NE  1 
ATOM   520  C CZ  . ARG A 1 98  ? -41.152 31.255 10.799 1.00 20.54 ? 80  ARG A CZ  1 
ATOM   521  N NH1 . ARG A 1 98  ? -41.346 29.957 10.961 1.00 21.91 ? 80  ARG A NH1 1 
ATOM   522  N NH2 . ARG A 1 98  ? -41.323 32.069 11.826 1.00 23.86 ? 80  ARG A NH2 1 
ATOM   523  N N   . THR A 1 99  ? -42.515 31.661 3.805  1.00 21.57 ? 81  THR A N   1 
ATOM   524  C CA  . THR A 1 99  ? -42.097 30.830 2.756  1.00 25.44 ? 81  THR A CA  1 
ATOM   525  C C   . THR A 1 99  ? -40.870 30.017 3.123  1.00 21.29 ? 81  THR A C   1 
ATOM   526  O O   . THR A 1 99  ? -40.211 30.413 4.139  1.00 23.95 ? 81  THR A O   1 
ATOM   527  C CB  . THR A 1 99  ? -41.724 31.693 1.536  1.00 27.09 ? 81  THR A CB  1 
ATOM   528  O OG1 . THR A 1 99  ? -40.580 32.512 1.814  1.00 25.97 ? 81  THR A OG1 1 
ATOM   529  C CG2 . THR A 1 99  ? -42.857 32.643 1.132  1.00 32.39 ? 81  THR A CG2 1 
ATOM   530  N N   . LYS A 1 100 ? -40.613 28.945 2.386  1.00 27.47 ? 82  LYS A N   1 
ATOM   531  C CA  . LYS A 1 100 ? -39.416 28.136 2.565  1.00 24.92 ? 82  LYS A CA  1 
ATOM   532  C C   . LYS A 1 100 ? -38.170 29.034 2.436  1.00 27.12 ? 82  LYS A C   1 
ATOM   533  O O   . LYS A 1 100 ? -37.254 29.016 3.293  1.00 23.89 ? 82  LYS A O   1 
ATOM   534  C CB  . LYS A 1 100 ? -39.351 26.937 1.639  1.00 32.65 ? 82  LYS A CB  1 
ATOM   535  C CG  . LYS A 1 100 ? -37.988 26.230 1.670  1.00 39.46 ? 82  LYS A CG  1 
ATOM   536  C CD  . LYS A 1 100 ? -37.848 25.025 0.736  1.00 46.40 ? 82  LYS A CD  1 
ATOM   537  C CE  . LYS A 1 100 ? -39.196 24.405 0.351  1.00 50.34 ? 82  LYS A CE  1 
ATOM   538  N NZ  . LYS A 1 100 ? -39.060 23.036 -0.216 1.00 52.58 ? 82  LYS A NZ  1 
ATOM   539  N N   . GLU A 1 101 ? -38.169 29.954 1.478  1.00 24.33 ? 83  GLU A N   1 
ATOM   540  C CA  . GLU A 1 101 ? -37.057 30.915 1.412  1.00 25.68 ? 83  GLU A CA  1 
ATOM   541  C C   . GLU A 1 101 ? -36.827 31.847 2.587  1.00 22.51 ? 83  GLU A C   1 
ATOM   542  O O   . GLU A 1 101 ? -35.684 32.052 2.983  1.00 24.00 ? 83  GLU A O   1 
ATOM   543  C CB  . GLU A 1 101 ? -37.239 31.805 0.129  1.00 29.68 ? 83  GLU A CB  1 
ATOM   544  C CG  . GLU A 1 101 ? -37.281 30.969 -1.162 1.00 36.04 ? 83  GLU A CG  1 
ATOM   545  C CD  . GLU A 1 101 ? -38.598 30.147 -1.490 1.00 42.22 ? 83  GLU A CD  1 
ATOM   546  O OE1 . GLU A 1 101 ? -39.722 30.279 -0.921 1.00 32.79 ? 83  GLU A OE1 1 
ATOM   547  O OE2 . GLU A 1 101 ? -38.503 29.278 -2.394 1.00 53.33 ? 83  GLU A OE2 1 
ATOM   548  N N   . GLU A 1 102 ? -37.897 32.357 3.209  1.00 21.77 ? 84  GLU A N   1 
ATOM   549  C CA  . GLU A 1 102 ? -37.833 33.185 4.394  1.00 22.73 ? 84  GLU A CA  1 
ATOM   550  C C   . GLU A 1 102 ? -37.341 32.298 5.563  1.00 20.39 ? 84  GLU A C   1 
ATOM   551  O O   . GLU A 1 102 ? -36.495 32.775 6.349  1.00 23.59 ? 84  GLU A O   1 
ATOM   552  C CB  . GLU A 1 102 ? -39.210 33.725 4.754  1.00 25.43 ? 84  GLU A CB  1 
ATOM   553  C CG  . GLU A 1 102 ? -39.587 34.832 3.754  1.00 31.35 ? 84  GLU A CG  1 
ATOM   554  C CD  . GLU A 1 102 ? -41.030 35.322 3.939  1.00 37.49 ? 84  GLU A CD  1 
ATOM   555  O OE1 . GLU A 1 102 ? -41.916 34.521 4.238  1.00 31.06 ? 84  GLU A OE1 1 
ATOM   556  O OE2 . GLU A 1 102 ? -41.235 36.539 3.767  1.00 44.69 ? 84  GLU A OE2 1 
ATOM   557  N N   . ALA A 1 103 ? -37.812 31.050 5.607  1.00 19.74 ? 85  ALA A N   1 
ATOM   558  C CA  . ALA A 1 103 ? -37.350 30.084 6.685  1.00 20.28 ? 85  ALA A CA  1 
ATOM   559  C C   . ALA A 1 103 ? -35.839 29.869 6.556  1.00 21.74 ? 85  ALA A C   1 
ATOM   560  O O   . ALA A 1 103 ? -35.071 29.829 7.594  1.00 19.80 ? 85  ALA A O   1 
ATOM   561  C CB  . ALA A 1 103 ? -38.040 28.756 6.589  1.00 20.55 ? 85  ALA A CB  1 
ATOM   562  N N   . LEU A 1 104 ? -35.379 29.737 5.320  1.00 20.08 ? 86  LEU A N   1 
ATOM   563  C CA  . LEU A 1 104 ? -33.917 29.485 5.136  1.00 19.29 ? 86  LEU A CA  1 
ATOM   564  C C   . LEU A 1 104 ? -33.136 30.727 5.529  1.00 20.69 ? 86  LEU A C   1 
ATOM   565  O O   . LEU A 1 104 ? -31.997 30.614 6.084  1.00 20.72 ? 86  LEU A O   1 
ATOM   566  C CB  . LEU A 1 104 ? -33.665 29.098 3.707  1.00 19.14 ? 86  LEU A CB  1 
ATOM   567  C CG  . LEU A 1 104 ? -32.211 28.807 3.353  1.00 20.77 ? 86  LEU A CG  1 
ATOM   568  C CD1 . LEU A 1 104 ? -31.541 27.764 4.211  1.00 20.80 ? 86  LEU A CD1 1 
ATOM   569  C CD2 . LEU A 1 104 ? -32.094 28.394 1.913  1.00 21.98 ? 86  LEU A CD2 1 
ATOM   570  N N   . GLU A 1 105 ? -33.608 31.929 5.191  1.00 20.27 ? 87  GLU A N   1 
ATOM   571  C CA  . GLU A 1 105 ? -32.899 33.173 5.616  1.00 25.25 ? 87  GLU A CA  1 
ATOM   572  C C   . GLU A 1 105 ? -32.777 33.261 7.125  1.00 22.47 ? 87  GLU A C   1 
ATOM   573  O O   . GLU A 1 105 ? -31.716 33.636 7.695  1.00 20.33 ? 87  GLU A O   1 
ATOM   574  C CB  . GLU A 1 105 ? -33.590 34.423 5.059  1.00 27.97 ? 87  GLU A CB  1 
ATOM   575  C CG  . GLU A 1 105 ? -33.343 34.542 3.587  1.00 37.32 ? 87  GLU A CG  1 
ATOM   576  C CD  . GLU A 1 105 ? -32.386 35.681 3.287  1.00 55.98 ? 87  GLU A CD  1 
ATOM   577  O OE1 . GLU A 1 105 ? -31.202 35.564 3.707  1.00 62.14 ? 87  GLU A OE1 1 
ATOM   578  O OE2 . GLU A 1 105 ? -32.832 36.687 2.666  1.00 62.88 ? 87  GLU A OE2 1 
ATOM   579  N N   . LEU A 1 106 ? -33.840 32.836 7.817  1.00 19.35 ? 88  LEU A N   1 
ATOM   580  C CA  . LEU A 1 106 ? -33.815 32.851 9.273  1.00 19.91 ? 88  LEU A CA  1 
ATOM   581  C C   . LEU A 1 106 ? -32.771 31.845 9.803  1.00 16.64 ? 88  LEU A C   1 
ATOM   582  O O   . LEU A 1 106 ? -31.957 32.192 10.711 1.00 18.11 ? 88  LEU A O   1 
ATOM   583  C CB  . LEU A 1 106 ? -35.214 32.453 9.854  1.00 18.71 ? 88  LEU A CB  1 
ATOM   584  C CG  . LEU A 1 106 ? -36.150 33.629 9.755  1.00 23.40 ? 88  LEU A CG  1 
ATOM   585  C CD1 . LEU A 1 106 ? -37.577 33.127 9.898  1.00 24.91 ? 88  LEU A CD1 1 
ATOM   586  C CD2 . LEU A 1 106 ? -35.765 34.703 10.754 1.00 23.76 ? 88  LEU A CD2 1 
ATOM   587  N N   . ILE A 1 107 ? -32.772 30.638 9.254  1.00 17.67 ? 89  ILE A N   1 
ATOM   588  C CA  . ILE A 1 107 ? -31.822 29.586 9.655  1.00 17.10 ? 89  ILE A CA  1 
ATOM   589  C C   . ILE A 1 107 ? -30.391 30.113 9.416  1.00 18.29 ? 89  ILE A C   1 
ATOM   590  O O   . ILE A 1 107 ? -29.501 29.983 10.285 1.00 17.73 ? 89  ILE A O   1 
ATOM   591  C CB  . ILE A 1 107 ? -32.032 28.322 8.849  1.00 16.83 ? 89  ILE A CB  1 
ATOM   592  C CG1 . ILE A 1 107 ? -33.276 27.607 9.362  1.00 18.79 ? 89  ILE A CG1 1 
ATOM   593  C CG2 . ILE A 1 107 ? -30.893 27.364 8.813  1.00 16.81 ? 89  ILE A CG2 1 
ATOM   594  C CD1 . ILE A 1 107 ? -33.074 26.856 10.635 1.00 18.15 ? 89  ILE A CD1 1 
ATOM   595  N N   . ASN A 1 108 ? -30.194 30.702 8.244  1.00 17.95 ? 90  ASN A N   1 
ATOM   596  C CA  . ASN A 1 108 ? -28.806 31.149 7.930  1.00 19.59 ? 90  ASN A CA  1 
ATOM   597  C C   . ASN A 1 108 ? -28.380 32.224 8.895  1.00 18.04 ? 90  ASN A C   1 
ATOM   598  O O   . ASN A 1 108 ? -27.186 32.260 9.284  1.00 19.10 ? 90  ASN A O   1 
ATOM   599  C CB  . ASN A 1 108 ? -28.758 31.595 6.457  1.00 19.36 ? 90  ASN A CB  1 
ATOM   600  C CG  . ASN A 1 108 ? -28.726 30.429 5.486  1.00 21.15 ? 90  ASN A CG  1 
ATOM   601  O OD1 . ASN A 1 108 ? -28.273 29.315 5.782  1.00 26.25 ? 90  ASN A OD1 1 
ATOM   602  N ND2 . ASN A 1 108 ? -29.153 30.705 4.303  1.00 27.57 ? 90  ASN A ND2 1 
ATOM   603  N N   . GLY A 1 109 ? -29.204 33.160 9.296  1.00 18.42 ? 91  GLY A N   1 
ATOM   604  C CA  . GLY A 1 109 ? -28.932 34.143 10.303 1.00 17.82 ? 91  GLY A CA  1 
ATOM   605  C C   . GLY A 1 109 ? -28.569 33.576 11.636 1.00 20.37 ? 91  GLY A C   1 
ATOM   606  O O   . GLY A 1 109 ? -27.622 33.987 12.304 1.00 20.27 ? 91  GLY A O   1 
ATOM   607  N N   . TYR A 1 110 ? -29.360 32.594 12.057 1.00 16.96 ? 92  TYR A N   1 
ATOM   608  C CA  . TYR A 1 110 ? -29.025 31.930 13.297 1.00 17.53 ? 92  TYR A CA  1 
ATOM   609  C C   . TYR A 1 110 ? -27.716 31.223 13.248 1.00 15.60 ? 92  TYR A C   1 
ATOM   610  O O   . TYR A 1 110 ? -26.954 31.276 14.217 1.00 16.70 ? 92  TYR A O   1 
ATOM   611  C CB  . TYR A 1 110 ? -30.113 30.889 13.705 1.00 16.49 ? 92  TYR A CB  1 
ATOM   612  C CG  . TYR A 1 110 ? -31.476 31.459 13.937 1.00 17.80 ? 92  TYR A CG  1 
ATOM   613  C CD1 . TYR A 1 110 ? -31.677 32.713 14.489 1.00 19.89 ? 92  TYR A CD1 1 
ATOM   614  C CD2 . TYR A 1 110 ? -32.638 30.722 13.541 1.00 17.11 ? 92  TYR A CD2 1 
ATOM   615  C CE1 . TYR A 1 110 ? -32.960 33.228 14.663 1.00 22.24 ? 92  TYR A CE1 1 
ATOM   616  C CE2 . TYR A 1 110 ? -33.898 31.250 13.713 1.00 18.18 ? 92  TYR A CE2 1 
ATOM   617  C CZ  . TYR A 1 110 ? -34.049 32.471 14.264 1.00 19.63 ? 92  TYR A CZ  1 
ATOM   618  O OH  . TYR A 1 110 ? -35.321 33.033 14.448 1.00 21.25 ? 92  TYR A OH  1 
ATOM   619  N N   . ILE A 1 111 ? -27.385 30.560 12.184 1.00 14.88 ? 93  ILE A N   1 
ATOM   620  C CA  . ILE A 1 111 ? -26.071 29.910 12.017 1.00 15.80 ? 93  ILE A CA  1 
ATOM   621  C C   . ILE A 1 111 ? -24.936 30.948 12.138 1.00 17.97 ? 93  ILE A C   1 
ATOM   622  O O   . ILE A 1 111 ? -23.960 30.694 12.826 1.00 16.92 ? 93  ILE A O   1 
ATOM   623  C CB  . ILE A 1 111 ? -25.965 29.126 10.721 1.00 14.98 ? 93  ILE A CB  1 
ATOM   624  C CG1 . ILE A 1 111 ? -26.877 27.875 10.759 1.00 17.59 ? 93  ILE A CG1 1 
ATOM   625  C CG2 . ILE A 1 111 ? -24.546 28.606 10.421 1.00 17.17 ? 93  ILE A CG2 1 
ATOM   626  C CD1 . ILE A 1 111 ? -27.032 27.149 9.438  1.00 17.43 ? 93  ILE A CD1 1 
ATOM   627  N N   . GLN A 1 112 ? -25.105 32.062 11.469 1.00 18.13 ? 94  GLN A N   1 
ATOM   628  C CA  . GLN A 1 112 ? -24.064 33.121 11.576 1.00 19.26 ? 94  GLN A CA  1 
ATOM   629  C C   . GLN A 1 112 ? -23.862 33.543 12.962 1.00 20.71 ? 94  GLN A C   1 
ATOM   630  O O   . GLN A 1 112 ? -22.685 33.656 13.421 1.00 20.14 ? 94  GLN A O   1 
ATOM   631  C CB  . GLN A 1 112 ? -24.435 34.338 10.729 1.00 21.27 ? 94  GLN A CB  1 
ATOM   632  C CG  . GLN A 1 112 ? -24.388 34.008 9.290  1.00 27.18 ? 94  GLN A CG  1 
ATOM   633  C CD  . GLN A 1 112 ? -24.737 35.251 8.479  1.00 40.19 ? 94  GLN A CD  1 
ATOM   634  O OE1 . GLN A 1 112 ? -25.753 35.882 8.731  1.00 38.70 ? 94  GLN A OE1 1 
ATOM   635  N NE2 . GLN A 1 112 ? -23.831 35.679 7.619  1.00 45.20 ? 94  GLN A NE2 1 
ATOM   636  N N   . LYS A 1 113 ? -24.944 33.778 13.731 1.00 18.13 ? 95  LYS A N   1 
ATOM   637  C CA  . LYS A 1 113 ? -24.851 34.249 15.071 1.00 19.29 ? 95  LYS A CA  1 
ATOM   638  C C   . LYS A 1 113 ? -24.220 33.204 15.996 1.00 17.76 ? 95  LYS A C   1 
ATOM   639  O O   . LYS A 1 113 ? -23.487 33.536 16.904 1.00 19.89 ? 95  LYS A O   1 
ATOM   640  C CB  . LYS A 1 113 ? -26.181 34.723 15.621 1.00 25.00 ? 95  LYS A CB  1 
ATOM   641  C CG  . LYS A 1 113 ? -26.737 35.989 14.970 1.00 30.10 ? 95  LYS A CG  1 
ATOM   642  C CD  . LYS A 1 113 ? -28.164 36.231 15.488 1.00 42.71 ? 95  LYS A CD  1 
ATOM   643  C CE  . LYS A 1 113 ? -29.134 36.862 14.432 1.00 47.32 ? 95  LYS A CE  1 
ATOM   644  N NZ  . LYS A 1 113 ? -30.099 35.921 13.728 1.00 37.84 ? 95  LYS A NZ  1 
ATOM   645  N N   . ILE A 1 114 ? -24.519 31.922 15.794 1.00 16.60 ? 96  ILE A N   1 
ATOM   646  C CA  . ILE A 1 114 ? -23.942 30.863 16.569 1.00 16.09 ? 96  ILE A CA  1 
ATOM   647  C C   . ILE A 1 114 ? -22.461 30.760 16.257 1.00 15.05 ? 96  ILE A C   1 
ATOM   648  O O   . ILE A 1 114 ? -21.644 30.646 17.189 1.00 16.80 ? 96  ILE A O   1 
ATOM   649  C CB  . ILE A 1 114 ? -24.697 29.510 16.343 1.00 15.21 ? 96  ILE A CB  1 
ATOM   650  C CG1 . ILE A 1 114 ? -26.116 29.663 16.851 1.00 17.01 ? 96  ILE A CG1 1 
ATOM   651  C CG2 . ILE A 1 114 ? -23.969 28.422 17.087 1.00 18.11 ? 96  ILE A CG2 1 
ATOM   652  C CD1 . ILE A 1 114 ? -27.002 28.597 16.292 1.00 18.50 ? 96  ILE A CD1 1 
ATOM   653  N N   . LYS A 1 115 ? -22.119 30.772 15.002 1.00 14.76 ? 97  LYS A N   1 
ATOM   654  C CA  . LYS A 1 115 ? -20.677 30.687 14.609 1.00 15.50 ? 97  LYS A CA  1 
ATOM   655  C C   . LYS A 1 115 ? -19.867 31.829 15.094 1.00 17.43 ? 97  LYS A C   1 
ATOM   656  O O   . LYS A 1 115 ? -18.678 31.617 15.402 1.00 20.02 ? 97  LYS A O   1 
ATOM   657  C CB  . LYS A 1 115 ? -20.496 30.541 13.136 1.00 16.81 ? 97  LYS A CB  1 
ATOM   658  C CG  . LYS A 1 115 ? -20.884 29.130 12.705 1.00 19.03 ? 97  LYS A CG  1 
ATOM   659  C CD  . LYS A 1 115 ? -20.420 28.889 11.241 1.00 24.30 ? 97  LYS A CD  1 
ATOM   660  C CE  . LYS A 1 115 ? -20.425 27.409 10.883 1.00 26.84 ? 97  LYS A CE  1 
ATOM   661  N NZ  . LYS A 1 115 ? -19.709 27.081 9.552  1.00 24.46 ? 97  LYS A NZ  1 
ATOM   662  N N   . SER A 1 116 ? -20.445 32.993 15.127 1.00 17.12 ? 98  SER A N   1 
ATOM   663  C CA  . SER A 1 116 ? -19.714 34.209 15.600 1.00 19.23 ? 98  SER A CA  1 
ATOM   664  C C   . SER A 1 116 ? -19.485 34.206 17.110 1.00 22.07 ? 98  SER A C   1 
ATOM   665  O O   . SER A 1 116 ? -18.607 34.938 17.693 1.00 22.92 ? 98  SER A O   1 
ATOM   666  C CB  . SER A 1 116 ? -20.486 35.423 15.190 1.00 21.86 ? 98  SER A CB  1 
ATOM   667  O OG  . SER A 1 116 ? -21.617 35.669 15.934 1.00 23.10 ? 98  SER A OG  1 
ATOM   668  N N   . GLY A 1 117 ? -20.295 33.460 17.832 1.00 18.78 ? 99  GLY A N   1 
ATOM   669  C CA  . GLY A 1 117 ? -20.279 33.468 19.291 1.00 20.14 ? 99  GLY A CA  1 
ATOM   670  C C   . GLY A 1 117 ? -21.169 34.571 19.844 1.00 19.59 ? 99  GLY A C   1 
ATOM   671  O O   . GLY A 1 117 ? -21.274 34.642 21.038 1.00 27.47 ? 99  GLY A O   1 
ATOM   672  N N   . GLU A 1 118 ? -21.876 35.292 19.006 1.00 20.92 ? 100 GLU A N   1 
ATOM   673  C CA  . GLU A 1 118 ? -22.744 36.372 19.447 1.00 24.33 ? 100 GLU A CA  1 
ATOM   674  C C   . GLU A 1 118 ? -23.962 35.795 20.194 1.00 28.00 ? 100 GLU A C   1 
ATOM   675  O O   . GLU A 1 118 ? -24.536 36.487 21.034 1.00 28.30 ? 100 GLU A O   1 
ATOM   676  C CB  . GLU A 1 118 ? -23.282 37.188 18.297 1.00 30.29 ? 100 GLU A CB  1 
ATOM   677  C CG  . GLU A 1 118 ? -22.360 38.162 17.560 1.00 43.72 ? 100 GLU A CG  1 
ATOM   678  C CD  . GLU A 1 118 ? -23.044 38.514 16.250 1.00 49.95 ? 100 GLU A CD  1 
ATOM   679  O OE1 . GLU A 1 118 ? -22.560 38.113 15.161 1.00 51.10 ? 100 GLU A OE1 1 
ATOM   680  O OE2 . GLU A 1 118 ? -24.172 39.067 16.353 1.00 60.86 ? 100 GLU A OE2 1 
ATOM   681  N N   . GLU A 1 119 ? -24.397 34.566 19.851 1.00 22.16 ? 101 GLU A N   1 
ATOM   682  C CA  . GLU A 1 119 ? -25.506 33.931 20.521 1.00 24.70 ? 101 GLU A CA  1 
ATOM   683  C C   . GLU A 1 119 ? -25.179 32.476 20.633 1.00 23.68 ? 101 GLU A C   1 
ATOM   684  O O   . GLU A 1 119 ? -24.376 31.986 19.830 1.00 24.27 ? 101 GLU A O   1 
ATOM   685  C CB  . GLU A 1 119 ? -26.739 34.001 19.613 1.00 30.13 ? 101 GLU A CB  1 
ATOM   686  C CG  . GLU A 1 119 ? -27.452 35.301 19.742 1.00 39.94 ? 101 GLU A CG  1 
ATOM   687  C CD  . GLU A 1 119 ? -28.253 35.252 21.051 1.00 42.97 ? 101 GLU A CD  1 
ATOM   688  O OE1 . GLU A 1 119 ? -28.058 34.311 21.893 1.00 55.93 ? 101 GLU A OE1 1 
ATOM   689  O OE2 . GLU A 1 119 ? -29.078 36.115 21.208 1.00 53.13 ? 101 GLU A OE2 1 
ATOM   690  N N   . ASP A 1 120 ? -25.724 31.829 21.634 1.00 22.22 ? 102 ASP A N   1 
ATOM   691  C CA  . ASP A 1 120 ? -25.545 30.450 21.850 1.00 22.36 ? 102 ASP A CA  1 
ATOM   692  C C   . ASP A 1 120 ? -26.662 29.634 21.132 1.00 20.02 ? 102 ASP A C   1 
ATOM   693  O O   . ASP A 1 120 ? -27.816 30.088 21.070 1.00 20.00 ? 102 ASP A O   1 
ATOM   694  C CB  . ASP A 1 120 ? -25.733 30.137 23.385 1.00 28.58 ? 102 ASP A CB  1 
ATOM   695  C CG  . ASP A 1 120 ? -24.591 30.656 24.247 1.00 40.12 ? 102 ASP A CG  1 
ATOM   696  O OD1 . ASP A 1 120 ? -23.491 30.815 23.689 1.00 41.82 ? 102 ASP A OD1 1 
ATOM   697  O OD2 . ASP A 1 120 ? -24.788 30.853 25.468 1.00 46.47 ? 102 ASP A OD2 1 
ATOM   698  N N   . PHE A 1 121 ? -26.279 28.468 20.650 1.00 18.12 ? 103 PHE A N   1 
ATOM   699  C CA  . PHE A 1 121 ? -27.264 27.553 19.999 1.00 17.53 ? 103 PHE A CA  1 
ATOM   700  C C   . PHE A 1 121 ? -28.471 27.379 20.927 1.00 18.09 ? 103 PHE A C   1 
ATOM   701  O O   . PHE A 1 121 ? -29.634 27.428 20.483 1.00 17.55 ? 103 PHE A O   1 
ATOM   702  C CB  . PHE A 1 121 ? -26.671 26.210 19.641 1.00 18.50 ? 103 PHE A CB  1 
ATOM   703  C CG  . PHE A 1 121 ? -27.628 25.228 19.114 1.00 20.20 ? 103 PHE A CG  1 
ATOM   704  C CD1 . PHE A 1 121 ? -28.345 24.499 20.046 1.00 25.14 ? 103 PHE A CD1 1 
ATOM   705  C CD2 . PHE A 1 121 ? -27.816 25.001 17.766 1.00 25.42 ? 103 PHE A CD2 1 
ATOM   706  C CE1 . PHE A 1 121 ? -29.241 23.628 19.684 1.00 26.54 ? 103 PHE A CE1 1 
ATOM   707  C CE2 . PHE A 1 121 ? -28.836 24.046 17.395 1.00 21.92 ? 103 PHE A CE2 1 
ATOM   708  C CZ  . PHE A 1 121 ? -29.534 23.469 18.408 1.00 23.23 ? 103 PHE A CZ  1 
ATOM   709  N N   . GLU A 1 122 ? -28.179 27.092 22.185 1.00 17.71 ? 104 GLU A N   1 
ATOM   710  C CA  . GLU A 1 122 ? -29.242 26.727 23.144 1.00 17.91 ? 104 GLU A CA  1 
ATOM   711  C C   . GLU A 1 122 ? -30.235 27.855 23.362 1.00 18.26 ? 104 GLU A C   1 
ATOM   712  O O   . GLU A 1 122 ? -31.473 27.604 23.440 1.00 18.81 ? 104 GLU A O   1 
ATOM   713  C CB  . GLU A 1 122 ? -28.604 26.369 24.483 1.00 19.29 ? 104 GLU A CB  1 
ATOM   714  C CG  . GLU A 1 122 ? -27.799 25.151 24.461 1.00 21.67 ? 104 GLU A CG  1 
ATOM   715  C CD  . GLU A 1 122 ? -26.316 25.331 24.054 1.00 24.56 ? 104 GLU A CD  1 
ATOM   716  O OE1 . GLU A 1 122 ? -25.915 26.363 23.464 1.00 25.25 ? 104 GLU A OE1 1 
ATOM   717  O OE2 . GLU A 1 122 ? -25.541 24.382 24.335 1.00 31.51 ? 104 GLU A OE2 1 
ATOM   718  N N   . SER A 1 123 ? -29.739 29.055 23.419 1.00 17.99 ? 105 SER A N   1 
ATOM   719  C CA  . SER A 1 123 ? -30.519 30.256 23.641 1.00 21.32 ? 105 SER A CA  1 
ATOM   720  C C   . SER A 1 123 ? -31.423 30.487 22.402 1.00 17.77 ? 105 SER A C   1 
ATOM   721  O O   . SER A 1 123 ? -32.594 30.767 22.515 1.00 20.74 ? 105 SER A O   1 
ATOM   722  C CB  . SER A 1 123 ? -29.597 31.436 23.852 1.00 26.35 ? 105 SER A CB  1 
ATOM   723  O OG  . SER A 1 123 ? -30.356 32.604 23.865 1.00 29.28 ? 105 SER A OG  1 
ATOM   724  N N   . LEU A 1 124 ? -30.833 30.380 21.211 1.00 17.14 ? 106 LEU A N   1 
ATOM   725  C CA  . LEU A 1 124 ? -31.633 30.535 20.007 1.00 17.03 ? 106 LEU A CA  1 
ATOM   726  C C   . LEU A 1 124 ? -32.645 29.414 19.877 1.00 16.45 ? 106 LEU A C   1 
ATOM   727  O O   . LEU A 1 124 ? -33.779 29.682 19.359 1.00 17.62 ? 106 LEU A O   1 
ATOM   728  C CB  . LEU A 1 124 ? -30.746 30.639 18.750 1.00 16.79 ? 106 LEU A CB  1 
ATOM   729  C CG  . LEU A 1 124 ? -29.838 31.848 18.689 1.00 17.69 ? 106 LEU A CG  1 
ATOM   730  C CD1 . LEU A 1 124 ? -29.026 31.783 17.408 1.00 19.59 ? 106 LEU A CD1 1 
ATOM   731  C CD2 . LEU A 1 124 ? -30.614 33.099 18.821 1.00 20.21 ? 106 LEU A CD2 1 
ATOM   732  N N   . ALA A 1 125 ? -32.304 28.188 20.203 1.00 14.93 ? 107 ALA A N   1 
ATOM   733  C CA  . ALA A 1 125 ? -33.295 27.107 20.109 1.00 14.69 ? 107 ALA A CA  1 
ATOM   734  C C   . ALA A 1 125 ? -34.466 27.404 21.051 1.00 17.44 ? 107 ALA A C   1 
ATOM   735  O O   . ALA A 1 125 ? -35.667 27.203 20.653 1.00 17.23 ? 107 ALA A O   1 
ATOM   736  C CB  . ALA A 1 125 ? -32.678 25.760 20.365 1.00 16.80 ? 107 ALA A CB  1 
ATOM   737  N N   . SER A 1 126 ? -34.171 27.869 22.289 1.00 15.40 ? 108 SER A N   1 
ATOM   738  C CA  . SER A 1 126 ? -35.243 28.069 23.241 1.00 15.93 ? 108 SER A CA  1 
ATOM   739  C C   . SER A 1 126 ? -36.168 29.163 22.818 1.00 17.60 ? 108 SER A C   1 
ATOM   740  O O   . SER A 1 126 ? -37.384 29.031 23.030 1.00 20.70 ? 108 SER A O   1 
ATOM   741  C CB  . SER A 1 126 ? -34.677 28.479 24.605 1.00 18.06 ? 108 SER A CB  1 
ATOM   742  O OG  . SER A 1 126 ? -33.833 27.429 25.097 1.00 22.94 ? 108 SER A OG  1 
ATOM   743  N N   . GLN A 1 127 ? -35.662 30.165 22.146 1.00 17.26 ? 109 GLN A N   1 
ATOM   744  C CA  . GLN A 1 127 ? -36.445 31.286 21.677 1.00 18.37 ? 109 GLN A CA  1 
ATOM   745  C C   . GLN A 1 127 ? -37.175 31.049 20.389 1.00 18.55 ? 109 GLN A C   1 
ATOM   746  O O   . GLN A 1 127 ? -38.298 31.567 20.230 1.00 21.62 ? 109 GLN A O   1 
ATOM   747  C CB  . GLN A 1 127 ? -35.583 32.513 21.541 1.00 19.45 ? 109 GLN A CB  1 
ATOM   748  C CG  . GLN A 1 127 ? -34.998 32.966 22.843 1.00 19.58 ? 109 GLN A CG  1 
ATOM   749  C CD  . GLN A 1 127 ? -34.054 34.091 22.668 1.00 23.80 ? 109 GLN A CD  1 
ATOM   750  O OE1 . GLN A 1 127 ? -32.805 33.912 22.731 1.00 28.26 ? 109 GLN A OE1 1 
ATOM   751  N NE2 . GLN A 1 127 ? -34.588 35.229 22.409 1.00 23.42 ? 109 GLN A NE2 1 
ATOM   752  N N   . PHE A 1 128 ? -36.512 30.393 19.447 1.00 17.39 ? 110 PHE A N   1 
ATOM   753  C CA  . PHE A 1 128 ? -36.985 30.410 18.089 1.00 17.35 ? 110 PHE A CA  1 
ATOM   754  C C   . PHE A 1 128 ? -37.312 29.072 17.452 1.00 18.39 ? 110 PHE A C   1 
ATOM   755  O O   . PHE A 1 128 ? -37.799 29.106 16.272 1.00 20.41 ? 110 PHE A O   1 
ATOM   756  C CB  . PHE A 1 128 ? -35.946 31.187 17.213 1.00 18.27 ? 110 PHE A CB  1 
ATOM   757  C CG  . PHE A 1 128 ? -35.710 32.562 17.703 1.00 20.31 ? 110 PHE A CG  1 
ATOM   758  C CD1 . PHE A 1 128 ? -36.731 33.484 17.831 1.00 22.76 ? 110 PHE A CD1 1 
ATOM   759  C CD2 . PHE A 1 128 ? -34.461 32.961 18.143 1.00 20.71 ? 110 PHE A CD2 1 
ATOM   760  C CE1 . PHE A 1 128 ? -36.519 34.737 18.355 1.00 23.65 ? 110 PHE A CE1 1 
ATOM   761  C CE2 . PHE A 1 128 ? -34.215 34.242 18.595 1.00 23.11 ? 110 PHE A CE2 1 
ATOM   762  C CZ  . PHE A 1 128 ? -35.250 35.155 18.723 1.00 24.24 ? 110 PHE A CZ  1 
ATOM   763  N N   . SER A 1 129 ? -37.104 27.886 18.045 1.00 16.38 ? 111 SER A N   1 
ATOM   764  C CA  . SER A 1 129 ? -37.396 26.680 17.464 1.00 16.49 ? 111 SER A CA  1 
ATOM   765  C C   . SER A 1 129 ? -38.901 26.431 17.472 1.00 18.34 ? 111 SER A C   1 
ATOM   766  O O   . SER A 1 129 ? -39.551 26.548 18.514 1.00 20.20 ? 111 SER A O   1 
ATOM   767  C CB  . SER A 1 129 ? -36.735 25.545 18.121 1.00 15.31 ? 111 SER A CB  1 
ATOM   768  O OG  . SER A 1 129 ? -36.944 24.325 17.458 1.00 15.62 ? 111 SER A OG  1 
ATOM   769  N N   . ASP A 1 130 ? -39.415 26.168 16.277 1.00 16.96 ? 112 ASP A N   1 
ATOM   770  C CA  . ASP A 1 130 ? -40.860 25.843 16.098 1.00 18.64 ? 112 ASP A CA  1 
ATOM   771  C C   . ASP A 1 130 ? -41.176 24.400 16.498 1.00 20.14 ? 112 ASP A C   1 
ATOM   772  O O   . ASP A 1 130 ? -41.825 23.628 15.712 1.00 21.06 ? 112 ASP A O   1 
ATOM   773  C CB  . ASP A 1 130 ? -41.194 26.051 14.629 1.00 17.97 ? 112 ASP A CB  1 
ATOM   774  C CG  . ASP A 1 130 ? -41.387 27.488 14.239 1.00 21.22 ? 112 ASP A CG  1 
ATOM   775  O OD1 . ASP A 1 130 ? -42.055 28.243 14.984 1.00 21.48 ? 112 ASP A OD1 1 
ATOM   776  O OD2 . ASP A 1 130 ? -40.906 28.010 13.175 1.00 19.82 ? 112 ASP A OD2 1 
HETATM 777  N N   . OCS A 1 131 ? -40.838 23.976 17.734 1.00 20.04 ? 113 OCS A N   1 
HETATM 778  C CA  . OCS A 1 131 ? -40.963 22.594 18.163 1.00 18.69 ? 113 OCS A CA  1 
HETATM 779  C CB  . OCS A 1 131 ? -39.932 21.692 17.592 1.00 19.64 ? 113 OCS A CB  1 
HETATM 780  S SG  . OCS A 1 131 ? -39.983 20.041 17.724 1.00 23.52 ? 113 OCS A SG  1 
HETATM 781  C C   . OCS A 1 131 ? -40.927 22.664 19.667 1.00 20.49 ? 113 OCS A C   1 
HETATM 782  O O   . OCS A 1 131 ? -40.259 23.549 20.219 1.00 20.92 ? 113 OCS A O   1 
HETATM 783  O OD1 . OCS A 1 131 ? -38.924 19.405 16.781 1.00 27.72 ? 113 OCS A OD1 1 
HETATM 784  O OD2 . OCS A 1 131 ? -39.769 19.685 19.072 1.00 26.61 ? 113 OCS A OD2 1 
HETATM 785  O OD3 . OCS A 1 131 ? -41.385 19.734 17.326 1.00 27.37 ? 113 OCS A OD3 1 
ATOM   786  N N   . SER A 1 132 ? -41.689 21.780 20.304 1.00 21.49 ? 114 SER A N   1 
ATOM   787  C CA  . SER A 1 132 ? -41.795 21.806 21.745 1.00 21.50 ? 114 SER A CA  1 
ATOM   788  C C   . SER A 1 132 ? -40.457 21.495 22.420 1.00 19.10 ? 114 SER A C   1 
ATOM   789  O O   . SER A 1 132 ? -40.297 21.810 23.600 1.00 19.77 ? 114 SER A O   1 
ATOM   790  C CB  . SER A 1 132 ? -42.853 20.788 22.259 1.00 24.83 ? 114 SER A CB  1 
ATOM   791  O OG  . SER A 1 132 ? -42.472 19.508 21.846 1.00 27.98 ? 114 SER A OG  1 
ATOM   792  N N   . SER A 1 133 ? -39.495 20.865 21.704 1.00 21.31 ? 115 SER A N   1 
ATOM   793  C CA  . SER A 1 133 ? -38.160 20.686 22.237 1.00 19.18 ? 115 SER A CA  1 
ATOM   794  C C   . SER A 1 133 ? -37.470 22.004 22.482 1.00 17.80 ? 115 SER A C   1 
ATOM   795  O O   . SER A 1 133 ? -36.455 21.990 23.190 1.00 16.41 ? 115 SER A O   1 
ATOM   796  C CB  . SER A 1 133 ? -37.268 19.814 21.357 1.00 21.73 ? 115 SER A CB  1 
ATOM   797  O OG  . SER A 1 133 ? -37.299 20.409 20.075 1.00 20.54 ? 115 SER A OG  1 
ATOM   798  N N   . ALA A 1 134 ? -38.007 23.148 22.087 1.00 16.40 ? 116 ALA A N   1 
ATOM   799  C CA  . ALA A 1 134 ? -37.475 24.418 22.414 1.00 16.76 ? 116 ALA A CA  1 
ATOM   800  C C   . ALA A 1 134 ? -37.392 24.552 23.939 1.00 18.13 ? 116 ALA A C   1 
ATOM   801  O O   . ALA A 1 134 ? -36.485 25.225 24.474 1.00 17.27 ? 116 ALA A O   1 
ATOM   802  C CB  . ALA A 1 134 ? -38.308 25.590 21.863 1.00 17.72 ? 116 ALA A CB  1 
ATOM   803  N N   . LYS A 1 135 ? -38.391 23.978 24.660 1.00 16.60 ? 117 LYS A N   1 
ATOM   804  C CA  . LYS A 1 135 ? -38.390 24.162 26.095 1.00 16.73 ? 117 LYS A CA  1 
ATOM   805  C C   . LYS A 1 135 ? -37.296 23.384 26.814 1.00 16.93 ? 117 LYS A C   1 
ATOM   806  O O   . LYS A 1 135 ? -37.044 23.671 28.016 1.00 17.68 ? 117 LYS A O   1 
ATOM   807  C CB  . LYS A 1 135 ? -39.732 23.640 26.596 1.00 19.81 ? 117 LYS A CB  1 
ATOM   808  C CG  . LYS A 1 135 ? -40.929 24.309 26.023 1.00 28.01 ? 117 LYS A CG  1 
ATOM   809  C CD  . LYS A 1 135 ? -40.942 25.749 26.249 1.00 33.62 ? 117 LYS A CD  1 
ATOM   810  C CE  . LYS A 1 135 ? -42.086 26.271 25.333 1.00 36.58 ? 117 LYS A CE  1 
ATOM   811  N NZ  . LYS A 1 135 ? -41.756 27.534 24.719 1.00 32.46 ? 117 LYS A NZ  1 
ATOM   812  N N   . ALA A 1 136 ? -36.611 22.478 26.151 1.00 15.61 ? 118 ALA A N   1 
ATOM   813  C CA  . ALA A 1 136 ? -35.389 21.832 26.595 1.00 16.11 ? 118 ALA A CA  1 
ATOM   814  C C   . ALA A 1 136 ? -34.121 22.266 25.843 1.00 16.28 ? 118 ALA A C   1 
ATOM   815  O O   . ALA A 1 136 ? -33.218 21.435 25.633 1.00 16.58 ? 118 ALA A O   1 
ATOM   816  C CB  . ALA A 1 136 ? -35.590 20.321 26.471 1.00 17.46 ? 118 ALA A CB  1 
ATOM   817  N N   . ARG A 1 137 ? -34.099 23.507 25.445 1.00 17.08 ? 119 ARG A N   1 
ATOM   818  C CA  . ARG A 1 137 ? -32.914 24.127 24.778 1.00 18.89 ? 119 ARG A CA  1 
ATOM   819  C C   . ARG A 1 137 ? -32.646 23.414 23.484 1.00 17.84 ? 119 ARG A C   1 
ATOM   820  O O   . ARG A 1 137 ? -31.467 23.300 23.004 1.00 18.80 ? 119 ARG A O   1 
ATOM   821  C CB  . ARG A 1 137 ? -31.671 24.127 25.727 1.00 20.28 ? 119 ARG A CB  1 
ATOM   822  C CG  . ARG A 1 137 ? -31.914 24.890 26.995 1.00 24.00 ? 119 ARG A CG  1 
ATOM   823  C CD  . ARG A 1 137 ? -30.774 24.608 28.023 1.00 26.75 ? 119 ARG A CD  1 
ATOM   824  N NE  . ARG A 1 137 ? -29.833 25.695 27.921 1.00 37.17 ? 119 ARG A NE  1 
ATOM   825  C CZ  . ARG A 1 137 ? -28.488 25.637 28.115 1.00 39.84 ? 119 ARG A CZ  1 
ATOM   826  N NH1 . ARG A 1 137 ? -27.816 24.500 28.405 1.00 36.36 ? 119 ARG A NH1 1 
ATOM   827  N NH2 . ARG A 1 137 ? -27.809 26.761 27.991 1.00 38.79 ? 119 ARG A NH2 1 
ATOM   828  N N   . GLY A 1 138 ? -33.692 22.836 22.876 1.00 16.31 ? 120 GLY A N   1 
ATOM   829  C CA  . GLY A 1 138 ? -33.575 22.061 21.668 1.00 17.50 ? 120 GLY A CA  1 
ATOM   830  C C   . GLY A 1 138 ? -33.197 20.635 21.695 1.00 16.30 ? 120 GLY A C   1 
ATOM   831  O O   . GLY A 1 138 ? -33.199 19.942 20.703 1.00 19.00 ? 120 GLY A O   1 
ATOM   832  N N   . ASP A 1 139 ? -32.968 20.094 22.904 1.00 16.40 ? 121 ASP A N   1 
ATOM   833  C CA  . ASP A 1 139 ? -32.568 18.695 23.108 1.00 17.66 ? 121 ASP A CA  1 
ATOM   834  C C   . ASP A 1 139 ? -33.657 17.722 22.737 1.00 19.14 ? 121 ASP A C   1 
ATOM   835  O O   . ASP A 1 139 ? -34.819 17.871 23.171 1.00 22.61 ? 121 ASP A O   1 
ATOM   836  C CB  . ASP A 1 139 ? -32.196 18.470 24.572 1.00 18.37 ? 121 ASP A CB  1 
ATOM   837  C CG  . ASP A 1 139 ? -31.708 17.120 24.839 1.00 23.23 ? 121 ASP A CG  1 
ATOM   838  O OD1 . ASP A 1 139 ? -30.910 16.491 24.057 1.00 19.44 ? 121 ASP A OD1 1 
ATOM   839  O OD2 . ASP A 1 139 ? -32.071 16.604 25.974 1.00 25.02 ? 121 ASP A OD2 1 
ATOM   840  N N   . LEU A 1 140 ? -33.262 16.759 21.933 1.00 18.89 ? 122 LEU A N   1 
ATOM   841  C CA  . LEU A 1 140 ? -34.115 15.625 21.550 1.00 20.79 ? 122 LEU A CA  1 
ATOM   842  C C   . LEU A 1 140 ? -33.818 14.377 22.318 1.00 20.93 ? 122 LEU A C   1 
ATOM   843  O O   . LEU A 1 140 ? -34.585 13.346 22.141 1.00 26.70 ? 122 LEU A O   1 
ATOM   844  C CB  . LEU A 1 140 ? -34.003 15.306 20.070 1.00 20.47 ? 122 LEU A CB  1 
ATOM   845  C CG  . LEU A 1 140 ? -34.456 16.457 19.263 1.00 21.61 ? 122 LEU A CG  1 
ATOM   846  C CD1 . LEU A 1 140 ? -34.115 16.120 17.838 1.00 25.87 ? 122 LEU A CD1 1 
ATOM   847  C CD2 . LEU A 1 140 ? -35.929 16.753 19.409 1.00 24.60 ? 122 LEU A CD2 1 
ATOM   848  N N   . GLY A 1 141 ? -32.763 14.366 23.126 1.00 22.65 ? 123 GLY A N   1 
ATOM   849  C CA  . GLY A 1 141 ? -32.304 13.158 23.736 1.00 24.68 ? 123 GLY A CA  1 
ATOM   850  C C   . GLY A 1 141 ? -31.654 12.211 22.718 1.00 26.47 ? 123 GLY A C   1 
ATOM   851  O O   . GLY A 1 141 ? -31.308 12.601 21.563 1.00 23.90 ? 123 GLY A O   1 
ATOM   852  N N   . ALA A 1 142 ? -31.422 10.979 23.124 1.00 25.22 ? 124 ALA A N   1 
ATOM   853  C CA  . ALA A 1 142 ? -30.593 10.027 22.342 1.00 24.25 ? 124 ALA A CA  1 
ATOM   854  C C   . ALA A 1 142 ? -31.539 9.198  21.500 1.00 28.76 ? 124 ALA A C   1 
ATOM   855  O O   . ALA A 1 142 ? -32.682 8.973  21.836 1.00 28.99 ? 124 ALA A O   1 
ATOM   856  C CB  . ALA A 1 142 ? -29.794 9.147  23.271 1.00 27.23 ? 124 ALA A CB  1 
ATOM   857  N N   . PHE A 1 143 ? -31.077 8.790  20.339 1.00 24.93 ? 125 PHE A N   1 
ATOM   858  C CA  . PHE A 1 143 ? -31.942 8.065  19.400 1.00 26.23 ? 125 PHE A CA  1 
ATOM   859  C C   . PHE A 1 143 ? -31.092 7.233  18.459 1.00 26.04 ? 125 PHE A C   1 
ATOM   860  O O   . PHE A 1 143 ? -29.868 7.424  18.303 1.00 26.60 ? 125 PHE A O   1 
ATOM   861  C CB  . PHE A 1 143 ? -32.900 8.958  18.620 1.00 25.34 ? 125 PHE A CB  1 
ATOM   862  C CG  . PHE A 1 143 ? -32.184 10.007 17.774 1.00 26.89 ? 125 PHE A CG  1 
ATOM   863  C CD1 . PHE A 1 143 ? -31.758 9.719  16.480 1.00 27.62 ? 125 PHE A CD1 1 
ATOM   864  C CD2 . PHE A 1 143 ? -31.920 11.264 18.333 1.00 28.24 ? 125 PHE A CD2 1 
ATOM   865  C CE1 . PHE A 1 143 ? -31.107 10.721 15.721 1.00 28.71 ? 125 PHE A CE1 1 
ATOM   866  C CE2 . PHE A 1 143 ? -31.289 12.233 17.579 1.00 28.57 ? 125 PHE A CE2 1 
ATOM   867  C CZ  . PHE A 1 143 ? -30.900 11.932 16.275 1.00 28.30 ? 125 PHE A CZ  1 
ATOM   868  N N   . SER A 1 144 ? -31.774 6.234  17.885 1.00 29.59 ? 126 SER A N   1 
ATOM   869  C CA  . SER A 1 144 ? -31.197 5.264  16.955 1.00 31.27 ? 126 SER A CA  1 
ATOM   870  C C   . SER A 1 144 ? -31.611 5.545  15.543 1.00 26.07 ? 126 SER A C   1 
ATOM   871  O O   . SER A 1 144 ? -32.573 6.285  15.298 1.00 29.74 ? 126 SER A O   1 
ATOM   872  C CB  . SER A 1 144 ? -31.779 3.850  17.259 1.00 34.19 ? 126 SER A CB  1 
ATOM   873  O OG  . SER A 1 144 ? -31.189 3.468  18.450 1.00 37.88 ? 126 SER A OG  1 
ATOM   874  N N   . ARG A 1 145 ? -30.968 4.830  14.633 1.00 30.86 ? 127 ARG A N   1 
ATOM   875  C CA  . ARG A 1 145 ? -31.455 4.830  13.261 1.00 29.59 ? 127 ARG A CA  1 
ATOM   876  C C   . ARG A 1 145 ? -32.827 4.182  13.205 1.00 31.68 ? 127 ARG A C   1 
ATOM   877  O O   . ARG A 1 145 ? -33.099 3.256  13.977 1.00 37.58 ? 127 ARG A O   1 
ATOM   878  C CB  . ARG A 1 145 ? -30.437 4.138  12.353 1.00 29.58 ? 127 ARG A CB  1 
ATOM   879  C CG  . ARG A 1 145 ? -29.182 4.938  12.093 1.00 30.37 ? 127 ARG A CG  1 
ATOM   880  C CD  . ARG A 1 145 ? -28.637 4.544  10.771 1.00 31.40 ? 127 ARG A CD  1 
ATOM   881  N NE  . ARG A 1 145 ? -27.424 5.272  10.417 1.00 30.35 ? 127 ARG A NE  1 
ATOM   882  C CZ  . ARG A 1 145 ? -27.395 6.309  9.594  1.00 27.14 ? 127 ARG A CZ  1 
ATOM   883  N NH1 . ARG A 1 145 ? -28.491 6.837  9.121  1.00 26.40 ? 127 ARG A NH1 1 
ATOM   884  N NH2 . ARG A 1 145 ? -26.219 6.849  9.307  1.00 29.19 ? 127 ARG A NH2 1 
ATOM   885  N N   . GLY A 1 146 ? -33.716 4.731  12.413 1.00 37.12 ? 128 GLY A N   1 
ATOM   886  C CA  . GLY A 1 146 ? -35.081 4.192  12.309 1.00 40.82 ? 128 GLY A CA  1 
ATOM   887  C C   . GLY A 1 146 ? -36.129 5.095  12.924 1.00 42.67 ? 128 GLY A C   1 
ATOM   888  O O   . GLY A 1 146 ? -37.281 4.909  12.679 1.00 49.35 ? 128 GLY A O   1 
ATOM   889  N N   . GLN A 1 147 ? -35.744 6.073  13.733 1.00 37.04 ? 129 GLN A N   1 
ATOM   890  C CA  . GLN A 1 147 ? -36.694 6.794  14.559 1.00 36.96 ? 129 GLN A CA  1 
ATOM   891  C C   . GLN A 1 147 ? -37.061 8.162  14.024 1.00 39.99 ? 129 GLN A C   1 
ATOM   892  O O   . GLN A 1 147 ? -38.197 8.569  14.155 1.00 39.43 ? 129 GLN A O   1 
ATOM   893  C CB  . GLN A 1 147 ? -36.158 6.926  16.000 1.00 37.16 ? 129 GLN A CB  1 
ATOM   894  C CG  . GLN A 1 147 ? -35.722 5.645  16.698 1.00 41.31 ? 129 GLN A CG  1 
ATOM   895  C CD  . GLN A 1 147 ? -35.308 5.903  18.141 1.00 40.71 ? 129 GLN A CD  1 
ATOM   896  O OE1 . GLN A 1 147 ? -34.269 5.470  18.596 1.00 37.08 ? 129 GLN A OE1 1 
ATOM   897  N NE2 . GLN A 1 147 ? -36.109 6.679  18.841 1.00 52.40 ? 129 GLN A NE2 1 
ATOM   898  N N   . MET A 1 148 ? -36.108 8.887  13.394 1.00 31.30 ? 130 MET A N   1 
ATOM   899  C CA  A MET A 1 148 ? -36.359 10.235 12.934 0.50 32.59 ? 130 MET A CA  1 
ATOM   900  C CA  B MET A 1 148 ? -36.342 10.234 12.931 0.50 32.38 ? 130 MET A CA  1 
ATOM   901  C C   . MET A 1 148 ? -36.540 10.252 11.405 1.00 29.03 ? 130 MET A C   1 
ATOM   902  O O   . MET A 1 148 ? -36.309 9.258  10.747 1.00 34.98 ? 130 MET A O   1 
ATOM   903  C CB  A MET A 1 148 ? -35.193 11.144 13.358 0.50 30.90 ? 130 MET A CB  1 
ATOM   904  C CB  B MET A 1 148 ? -35.143 11.109 13.326 0.50 30.25 ? 130 MET A CB  1 
ATOM   905  C CG  A MET A 1 148 ? -34.997 11.274 14.878 0.50 32.45 ? 130 MET A CG  1 
ATOM   906  C CG  B MET A 1 148 ? -34.849 11.137 14.831 0.50 32.07 ? 130 MET A CG  1 
ATOM   907  S SD  A MET A 1 148 ? -35.948 12.602 15.609 0.50 37.79 ? 130 MET A SD  1 
ATOM   908  S SD  B MET A 1 148 ? -36.182 11.871 15.776 0.50 34.92 ? 130 MET A SD  1 
ATOM   909  C CE  A MET A 1 148 ? -35.487 12.373 17.334 0.50 31.64 ? 130 MET A CE  1 
ATOM   910  C CE  B MET A 1 148 ? -36.210 13.553 15.106 0.50 29.93 ? 130 MET A CE  1 
ATOM   911  N N   . GLN A 1 149 ? -36.993 11.372 10.902 1.00 27.14 ? 131 GLN A N   1 
ATOM   912  C CA  . GLN A 1 149 ? -37.059 11.603 9.434  1.00 27.54 ? 131 GLN A CA  1 
ATOM   913  C C   . GLN A 1 149 ? -35.685 11.384 8.855  1.00 29.45 ? 131 GLN A C   1 
ATOM   914  O O   . GLN A 1 149 ? -34.652 11.708 9.453  1.00 24.99 ? 131 GLN A O   1 
ATOM   915  C CB  . GLN A 1 149 ? -37.613 12.970 9.135  1.00 30.69 ? 131 GLN A CB  1 
ATOM   916  C CG  . GLN A 1 149 ? -39.094 13.139 9.460  1.00 34.09 ? 131 GLN A CG  1 
ATOM   917  C CD  . GLN A 1 149 ? -39.606 14.589 9.327  1.00 42.75 ? 131 GLN A CD  1 
ATOM   918  O OE1 . GLN A 1 149 ? -40.656 14.837 8.750  1.00 54.31 ? 131 GLN A OE1 1 
ATOM   919  N NE2 . GLN A 1 149 ? -38.870 15.527 9.866  1.00 46.80 ? 131 GLN A NE2 1 
ATOM   920  N N   . LYS A 1 150 ? -35.612 10.795 7.655  1.00 25.67 ? 132 LYS A N   1 
ATOM   921  C CA  . LYS A 1 150 ? -34.362 10.308 7.203  1.00 25.60 ? 132 LYS A CA  1 
ATOM   922  C C   . LYS A 1 150 ? -33.241 11.419 7.050  1.00 21.25 ? 132 LYS A C   1 
ATOM   923  O O   . LYS A 1 150 ? -32.049 11.079 7.427  1.00 24.53 ? 132 LYS A O   1 
ATOM   924  C CB  . LYS A 1 150 ? -34.616 9.535  5.875  1.00 28.14 ? 132 LYS A CB  1 
ATOM   925  C CG  . LYS A 1 150 ? -33.419 8.847  5.406  1.00 29.91 ? 132 LYS A CG  1 
ATOM   926  C CD  . LYS A 1 150 ? -32.979 7.670  6.224  1.00 35.21 ? 132 LYS A CD  1 
ATOM   927  C CE  . LYS A 1 150 ? -31.840 7.057  5.446  1.00 37.36 ? 132 LYS A CE  1 
ATOM   928  N NZ  . LYS A 1 150 ? -30.815 6.495  6.344  1.00 38.27 ? 132 LYS A NZ  1 
ATOM   929  N N   . PRO A 1 151 ? -33.561 12.552 6.386  1.00 22.26 ? 133 PRO A N   1 
ATOM   930  C CA  . PRO A 1 151 ? -32.485 13.586 6.258  1.00 22.67 ? 133 PRO A CA  1 
ATOM   931  C C   . PRO A 1 151 ? -31.951 13.991 7.639  1.00 20.40 ? 133 PRO A C   1 
ATOM   932  O O   . PRO A 1 151 ? -30.748 14.327 7.767  1.00 21.03 ? 133 PRO A O   1 
ATOM   933  C CB  . PRO A 1 151 ? -33.183 14.765 5.613  1.00 23.91 ? 133 PRO A CB  1 
ATOM   934  C CG  . PRO A 1 151 ? -34.434 14.184 4.946  1.00 26.20 ? 133 PRO A CG  1 
ATOM   935  C CD  . PRO A 1 151 ? -34.845 13.060 5.857  1.00 25.37 ? 133 PRO A CD  1 
ATOM   936  N N   . PHE A 1 152 ? -32.837 13.999 8.618  1.00 19.89 ? 134 PHE A N   1 
ATOM   937  C CA  . PHE A 1 152 ? -32.422 14.369 10.028 1.00 19.50 ? 134 PHE A CA  1 
ATOM   938  C C   . PHE A 1 152 ? -31.518 13.335 10.606 1.00 18.18 ? 134 PHE A C   1 
ATOM   939  O O   . PHE A 1 152 ? -30.457 13.597 11.111 1.00 18.65 ? 134 PHE A O   1 
ATOM   940  C CB  . PHE A 1 152 ? -33.706 14.679 10.864 1.00 20.41 ? 134 PHE A CB  1 
ATOM   941  C CG  . PHE A 1 152 ? -33.421 15.280 12.208 1.00 18.70 ? 134 PHE A CG  1 
ATOM   942  C CD1 . PHE A 1 152 ? -32.889 14.472 13.212 1.00 20.52 ? 134 PHE A CD1 1 
ATOM   943  C CD2 . PHE A 1 152 ? -33.551 16.650 12.425 1.00 21.19 ? 134 PHE A CD2 1 
ATOM   944  C CE1 . PHE A 1 152 ? -32.485 15.045 14.432 1.00 19.08 ? 134 PHE A CE1 1 
ATOM   945  C CE2 . PHE A 1 152 ? -33.221 17.192 13.660 1.00 20.96 ? 134 PHE A CE2 1 
ATOM   946  C CZ  . PHE A 1 152 ? -32.608 16.381 14.607 1.00 20.58 ? 134 PHE A CZ  1 
ATOM   947  N N   . GLU A 1 153 ? -31.938 12.051 10.535 1.00 19.31 ? 135 GLU A N   1 
ATOM   948  C CA  . GLU A 1 153 ? -31.129 10.964 10.927 1.00 18.76 ? 135 GLU A CA  1 
ATOM   949  C C   . GLU A 1 153 ? -29.736 10.879 10.275 1.00 18.74 ? 135 GLU A C   1 
ATOM   950  O O   . GLU A 1 153 ? -28.687 10.804 10.929 1.00 19.49 ? 135 GLU A O   1 
ATOM   951  C CB  . GLU A 1 153 ? -31.933 9.681  10.676 1.00 21.99 ? 135 GLU A CB  1 
ATOM   952  C CG  . GLU A 1 153 ? -31.090 8.490  10.829 1.00 23.41 ? 135 GLU A CG  1 
ATOM   953  C CD  . GLU A 1 153 ? -31.884 7.241  10.395 1.00 29.00 ? 135 GLU A CD  1 
ATOM   954  O OE1 . GLU A 1 153 ? -33.050 7.153  10.884 1.00 30.17 ? 135 GLU A OE1 1 
ATOM   955  O OE2 . GLU A 1 153 ? -31.343 6.493  9.559  1.00 30.50 ? 135 GLU A OE2 1 
ATOM   956  N N   . ASP A 1 154 ? -29.689 11.012 8.910  1.00 18.89 ? 136 ASP A N   1 
ATOM   957  C CA  . ASP A 1 154 ? -28.432 10.935 8.241  1.00 20.71 ? 136 ASP A CA  1 
ATOM   958  C C   . ASP A 1 154 ? -27.489 12.071 8.617  1.00 17.74 ? 136 ASP A C   1 
ATOM   959  O O   . ASP A 1 154 ? -26.346 11.812 8.814  1.00 18.18 ? 136 ASP A O   1 
ATOM   960  C CB  . ASP A 1 154 ? -28.671 10.957 6.747  1.00 23.58 ? 136 ASP A CB  1 
ATOM   961  C CG  . ASP A 1 154 ? -29.218 9.644  6.219  1.00 32.99 ? 136 ASP A CG  1 
ATOM   962  O OD1 . ASP A 1 154 ? -29.168 8.618  6.958  1.00 31.57 ? 136 ASP A OD1 1 
ATOM   963  O OD2 . ASP A 1 154 ? -29.662 9.686  5.042  1.00 29.71 ? 136 ASP A OD2 1 
ATOM   964  N N   . ALA A 1 155 ? -28.050 13.253 8.731  1.00 17.70 ? 137 ALA A N   1 
ATOM   965  C CA  . ALA A 1 155 ? -27.199 14.418 9.154  1.00 18.42 ? 137 ALA A CA  1 
ATOM   966  C C   . ALA A 1 155 ? -26.675 14.138 10.589 1.00 18.14 ? 137 ALA A C   1 
ATOM   967  O O   . ALA A 1 155 ? -25.528 14.331 10.926 1.00 18.59 ? 137 ALA A O   1 
ATOM   968  C CB  . ALA A 1 155 ? -27.972 15.697 9.076  1.00 19.14 ? 137 ALA A CB  1 
ATOM   969  N N   . SER A 1 156 ? -27.525 13.639 11.466 1.00 17.92 ? 138 SER A N   1 
ATOM   970  C CA  . SER A 1 156 ? -27.170 13.465 12.847 1.00 18.15 ? 138 SER A CA  1 
ATOM   971  C C   . SER A 1 156 ? -26.075 12.517 13.010 1.00 19.27 ? 138 SER A C   1 
ATOM   972  O O   . SER A 1 156 ? -25.127 12.659 13.796 1.00 20.44 ? 138 SER A O   1 
ATOM   973  C CB  . SER A 1 156 ? -28.381 12.966 13.662 1.00 17.29 ? 138 SER A CB  1 
ATOM   974  O OG  . SER A 1 156 ? -29.366 13.934 13.727 1.00 19.15 ? 138 SER A OG  1 
ATOM   975  N N   . PHE A 1 157 ? -26.189 11.382 12.307 1.00 17.39 ? 139 PHE A N   1 
ATOM   976  C CA  . PHE A 1 157 ? -25.144 10.383 12.368 1.00 19.91 ? 139 PHE A CA  1 
ATOM   977  C C   . PHE A 1 157 ? -23.842 10.715 11.653 1.00 22.70 ? 139 PHE A C   1 
ATOM   978  O O   . PHE A 1 157 ? -22.818 10.143 11.990 1.00 25.40 ? 139 PHE A O   1 
ATOM   979  C CB  . PHE A 1 157 ? -25.716 8.976  11.924 1.00 21.47 ? 139 PHE A CB  1 
ATOM   980  C CG  . PHE A 1 157 ? -26.517 8.261  13.021 1.00 22.49 ? 139 PHE A CG  1 
ATOM   981  C CD1 . PHE A 1 157 ? -27.815 8.528  13.183 1.00 22.46 ? 139 PHE A CD1 1 
ATOM   982  C CD2 . PHE A 1 157 ? -25.872 7.367  13.862 1.00 25.81 ? 139 PHE A CD2 1 
ATOM   983  C CE1 . PHE A 1 157 ? -28.560 7.925  14.235 1.00 25.95 ? 139 PHE A CE1 1 
ATOM   984  C CE2 . PHE A 1 157 ? -26.571 6.782  14.920 1.00 23.33 ? 139 PHE A CE2 1 
ATOM   985  C CZ  . PHE A 1 157 ? -27.896 7.057  15.073 1.00 22.99 ? 139 PHE A CZ  1 
ATOM   986  N N   . ALA A 1 158 ? -23.885 11.641 10.672 1.00 18.86 ? 140 ALA A N   1 
ATOM   987  C CA  . ALA A 1 158 ? -22.728 12.077 9.947  1.00 19.79 ? 140 ALA A CA  1 
ATOM   988  C C   . ALA A 1 158 ? -21.949 13.220 10.663 1.00 20.52 ? 140 ALA A C   1 
ATOM   989  O O   . ALA A 1 158 ? -20.762 13.369 10.427 1.00 22.15 ? 140 ALA A O   1 
ATOM   990  C CB  . ALA A 1 158 ? -23.190 12.557 8.607  1.00 19.72 ? 140 ALA A CB  1 
ATOM   991  N N   . LEU A 1 159 ? -22.578 13.885 11.622 1.00 18.82 ? 141 LEU A N   1 
ATOM   992  C CA  . LEU A 1 159 ? -21.902 14.845 12.456 1.00 18.47 ? 141 LEU A CA  1 
ATOM   993  C C   . LEU A 1 159 ? -20.947 14.213 13.364 1.00 21.77 ? 141 LEU A C   1 
ATOM   994  O O   . LEU A 1 159 ? -21.237 13.116 13.846 1.00 23.94 ? 141 LEU A O   1 
ATOM   995  C CB  . LEU A 1 159 ? -22.893 15.637 13.282 1.00 16.10 ? 141 LEU A CB  1 
ATOM   996  C CG  . LEU A 1 159 ? -23.726 16.613 12.515 1.00 16.70 ? 141 LEU A CG  1 
ATOM   997  C CD1 . LEU A 1 159 ? -24.913 17.139 13.346 1.00 18.12 ? 141 LEU A CD1 1 
ATOM   998  C CD2 . LEU A 1 159 ? -22.947 17.788 11.939 1.00 18.90 ? 141 LEU A CD2 1 
ATOM   999  N N   . ARG A 1 160 ? -19.814 14.900 13.607 1.00 20.91 ? 142 ARG A N   1 
ATOM   1000 C CA  . ARG A 1 160 ? -18.912 14.500 14.688 1.00 22.88 ? 142 ARG A CA  1 
ATOM   1001 C C   . ARG A 1 160 ? -19.498 14.979 16.030 1.00 24.17 ? 142 ARG A C   1 
ATOM   1002 O O   . ARG A 1 160 ? -20.313 15.914 16.076 1.00 22.43 ? 142 ARG A O   1 
ATOM   1003 C CB  . ARG A 1 160 ? -17.511 15.091 14.440 1.00 24.14 ? 142 ARG A CB  1 
ATOM   1004 C CG  . ARG A 1 160 ? -16.852 14.534 13.189 1.00 29.08 ? 142 ARG A CG  1 
ATOM   1005 C CD  . ARG A 1 160 ? -15.571 15.222 12.850 1.00 33.87 ? 142 ARG A CD  1 
ATOM   1006 N NE  . ARG A 1 160 ? -15.712 16.674 12.733 1.00 33.60 ? 142 ARG A NE  1 
ATOM   1007 C CZ  . ARG A 1 160 ? -15.722 17.377 11.593 1.00 34.31 ? 142 ARG A CZ  1 
ATOM   1008 N NH1 . ARG A 1 160 ? -15.616 16.804 10.410 1.00 33.95 ? 142 ARG A NH1 1 
ATOM   1009 N NH2 . ARG A 1 160 ? -15.895 18.693 11.643 1.00 28.57 ? 142 ARG A NH2 1 
ATOM   1010 N N   . THR A 1 161 ? -19.047 14.419 17.152 1.00 25.36 ? 143 THR A N   1 
ATOM   1011 C CA  . THR A 1 161 ? -19.515 14.889 18.439 1.00 26.50 ? 143 THR A CA  1 
ATOM   1012 C C   . THR A 1 161 ? -19.140 16.291 18.661 1.00 27.13 ? 143 THR A C   1 
ATOM   1013 O O   . THR A 1 161 ? -17.971 16.701 18.458 1.00 25.47 ? 143 THR A O   1 
ATOM   1014 C CB  . THR A 1 161 ? -18.979 13.998 19.584 1.00 31.71 ? 143 THR A CB  1 
ATOM   1015 O OG1 . THR A 1 161 ? -19.597 12.746 19.419 1.00 38.05 ? 143 THR A OG1 1 
ATOM   1016 C CG2 . THR A 1 161 ? -19.332 14.553 20.953 1.00 34.35 ? 143 THR A CG2 1 
ATOM   1017 N N   . GLY A 1 162 ? -20.133 17.107 19.003 1.00 23.64 ? 144 GLY A N   1 
ATOM   1018 C CA  . GLY A 1 162 ? -19.959 18.527 19.114 1.00 22.89 ? 144 GLY A CA  1 
ATOM   1019 C C   . GLY A 1 162 ? -20.083 19.440 17.910 1.00 22.19 ? 144 GLY A C   1 
ATOM   1020 O O   . GLY A 1 162 ? -20.028 20.644 18.006 1.00 23.28 ? 144 GLY A O   1 
ATOM   1021 N N   . GLU A 1 163 ? -20.260 18.838 16.723 1.00 19.32 ? 145 GLU A N   1 
ATOM   1022 C CA  . GLU A 1 163 ? -20.345 19.542 15.461 1.00 19.01 ? 145 GLU A CA  1 
ATOM   1023 C C   . GLU A 1 163 ? -21.825 19.882 15.156 1.00 18.42 ? 145 GLU A C   1 
ATOM   1024 O O   . GLU A 1 163 ? -22.780 19.174 15.599 1.00 18.84 ? 145 GLU A O   1 
ATOM   1025 C CB  . GLU A 1 163 ? -19.845 18.637 14.359 1.00 19.78 ? 145 GLU A CB  1 
ATOM   1026 C CG  . GLU A 1 163 ? -19.672 19.324 13.003 1.00 22.15 ? 145 GLU A CG  1 
ATOM   1027 C CD  . GLU A 1 163 ? -19.323 18.401 11.845 1.00 25.25 ? 145 GLU A CD  1 
ATOM   1028 O OE1 . GLU A 1 163 ? -19.274 17.156 12.046 1.00 21.58 ? 145 GLU A OE1 1 
ATOM   1029 O OE2 . GLU A 1 163 ? -19.047 18.936 10.685 1.00 24.53 ? 145 GLU A OE2 1 
ATOM   1030 N N   . MET A 1 164 ? -21.946 20.996 14.499 1.00 18.20 ? 146 MET A N   1 
ATOM   1031 C CA  . MET A 1 164 ? -23.249 21.544 14.096 1.00 15.06 ? 146 MET A CA  1 
ATOM   1032 C C   . MET A 1 164 ? -23.382 21.390 12.580 1.00 16.51 ? 146 MET A C   1 
ATOM   1033 O O   . MET A 1 164 ? -22.431 21.614 11.733 1.00 17.04 ? 146 MET A O   1 
ATOM   1034 C CB  . MET A 1 164 ? -23.344 23.000 14.456 1.00 17.75 ? 146 MET A CB  1 
ATOM   1035 C CG  . MET A 1 164 ? -24.691 23.609 14.326 1.00 19.27 ? 146 MET A CG  1 
ATOM   1036 S SD  . MET A 1 164 ? -24.765 25.316 14.894 1.00 22.02 ? 146 MET A SD  1 
ATOM   1037 C CE  . MET A 1 164 ? -23.818 26.162 13.621 1.00 27.71 ? 146 MET A CE  1 
ATOM   1038 N N   . SER A 1 165 ? -24.615 21.088 12.165 1.00 14.61 ? 147 SER A N   1 
ATOM   1039 C CA  . SER A 1 165 ? -25.002 21.054 10.771 1.00 13.36 ? 147 SER A CA  1 
ATOM   1040 C C   . SER A 1 165 ? -25.128 22.390 10.114 1.00 15.21 ? 147 SER A C   1 
ATOM   1041 O O   . SER A 1 165 ? -25.214 23.377 10.786 1.00 15.93 ? 147 SER A O   1 
ATOM   1042 C CB  . SER A 1 165 ? -26.281 20.230 10.579 1.00 13.64 ? 147 SER A CB  1 
ATOM   1043 O OG  . SER A 1 165 ? -27.389 21.027 10.950 1.00 14.32 ? 147 SER A OG  1 
ATOM   1044 N N   . GLY A 1 166 ? -25.244 22.347 8.789  1.00 14.26 ? 148 GLY A N   1 
ATOM   1045 C CA  . GLY A 1 166 ? -25.856 23.434 8.092  1.00 15.36 ? 148 GLY A CA  1 
ATOM   1046 C C   . GLY A 1 166 ? -27.362 23.320 8.089  1.00 15.71 ? 148 GLY A C   1 
ATOM   1047 O O   . GLY A 1 166 ? -27.911 22.451 8.757  1.00 16.47 ? 148 GLY A O   1 
ATOM   1048 N N   . PRO A 1 167 ? -28.005 24.055 7.194  1.00 16.34 ? 149 PRO A N   1 
ATOM   1049 C CA  . PRO A 1 167 ? -29.464 23.882 7.077  1.00 15.94 ? 149 PRO A CA  1 
ATOM   1050 C C   . PRO A 1 167 ? -29.767 22.464 6.611  1.00 18.37 ? 149 PRO A C   1 
ATOM   1051 O O   . PRO A 1 167 ? -29.256 22.014 5.551  1.00 20.14 ? 149 PRO A O   1 
ATOM   1052 C CB  . PRO A 1 167 ? -29.925 24.948 6.034  1.00 17.32 ? 149 PRO A CB  1 
ATOM   1053 C CG  . PRO A 1 167 ? -28.794 25.963 6.061  1.00 20.15 ? 149 PRO A CG  1 
ATOM   1054 C CD  . PRO A 1 167 ? -27.518 25.172 6.362  1.00 17.10 ? 149 PRO A CD  1 
ATOM   1055 N N   . VAL A 1 168 ? -30.681 21.766 7.300  1.00 16.63 ? 150 VAL A N   1 
ATOM   1056 C CA  . VAL A 1 168 ? -31.110 20.412 6.944  1.00 15.42 ? 150 VAL A CA  1 
ATOM   1057 C C   . VAL A 1 168 ? -32.596 20.427 6.685  1.00 17.94 ? 150 VAL A C   1 
ATOM   1058 O O   . VAL A 1 168 ? -33.359 20.873 7.512  1.00 17.37 ? 150 VAL A O   1 
ATOM   1059 C CB  . VAL A 1 168 ? -30.697 19.359 7.992  1.00 17.50 ? 150 VAL A CB  1 
ATOM   1060 C CG1 . VAL A 1 168 ? -31.342 17.991 7.700  1.00 20.14 ? 150 VAL A CG1 1 
ATOM   1061 C CG2 . VAL A 1 168 ? -29.171 19.297 8.088  1.00 20.87 ? 150 VAL A CG2 1 
ATOM   1062 N N   . PHE A 1 169 ? -33.035 19.979 5.507  1.00 16.81 ? 151 PHE A N   1 
ATOM   1063 C CA  . PHE A 1 169 ? -34.405 20.134 5.110  1.00 17.80 ? 151 PHE A CA  1 
ATOM   1064 C C   . PHE A 1 169 ? -35.154 18.800 5.280  1.00 17.11 ? 151 PHE A C   1 
ATOM   1065 O O   . PHE A 1 169 ? -34.645 17.692 4.969  1.00 22.06 ? 151 PHE A O   1 
ATOM   1066 C CB  . PHE A 1 169 ? -34.428 20.495 3.590  1.00 19.50 ? 151 PHE A CB  1 
ATOM   1067 C CG  . PHE A 1 169 ? -33.916 21.844 3.263  1.00 17.85 ? 151 PHE A CG  1 
ATOM   1068 C CD1 . PHE A 1 169 ? -32.533 22.011 3.089  1.00 19.28 ? 151 PHE A CD1 1 
ATOM   1069 C CD2 . PHE A 1 169 ? -34.708 22.915 3.040  1.00 23.79 ? 151 PHE A CD2 1 
ATOM   1070 C CE1 . PHE A 1 169 ? -32.014 23.264 2.792  1.00 20.68 ? 151 PHE A CE1 1 
ATOM   1071 C CE2 . PHE A 1 169 ? -34.151 24.144 2.771  1.00 25.93 ? 151 PHE A CE2 1 
ATOM   1072 C CZ  . PHE A 1 169 ? -32.804 24.300 2.634  1.00 24.96 ? 151 PHE A CZ  1 
ATOM   1073 N N   . THR A 1 170 ? -36.321 18.957 5.883  1.00 19.60 ? 152 THR A N   1 
ATOM   1074 C CA  . THR A 1 170 ? -37.195 17.783 6.109  1.00 22.28 ? 152 THR A CA  1 
ATOM   1075 C C   . THR A 1 170 ? -38.602 18.206 5.836  1.00 17.99 ? 152 THR A C   1 
ATOM   1076 O O   . THR A 1 170 ? -38.931 19.359 5.588  1.00 20.13 ? 152 THR A O   1 
ATOM   1077 C CB  . THR A 1 170 ? -37.159 17.226 7.581  1.00 22.25 ? 152 THR A CB  1 
ATOM   1078 O OG1 . THR A 1 170 ? -37.848 18.177 8.410  1.00 23.46 ? 152 THR A OG1 1 
ATOM   1079 C CG2 . THR A 1 170 ? -35.756 16.914 8.062  1.00 23.29 ? 152 THR A CG2 1 
ATOM   1080 N N   . ASP A 1 171 ? -39.515 17.198 5.847  1.00 21.76 ? 153 ASP A N   1 
ATOM   1081 C CA  . ASP A 1 171 ? -40.926 17.615 5.754  1.00 24.92 ? 153 ASP A CA  1 
ATOM   1082 C C   . ASP A 1 171 ? -41.433 18.463 6.882  1.00 24.97 ? 153 ASP A C   1 
ATOM   1083 O O   . ASP A 1 171 ? -42.459 19.092 6.755  1.00 27.14 ? 153 ASP A O   1 
ATOM   1084 C CB  . ASP A 1 171 ? -41.869 16.396 5.621  1.00 27.54 ? 153 ASP A CB  1 
ATOM   1085 C CG  . ASP A 1 171 ? -41.708 15.679 4.291  1.00 35.41 ? 153 ASP A CG  1 
ATOM   1086 O OD1 . ASP A 1 171 ? -41.112 16.201 3.370  1.00 33.25 ? 153 ASP A OD1 1 
ATOM   1087 O OD2 . ASP A 1 171 ? -42.108 14.513 4.196  1.00 47.09 ? 153 ASP A OD2 1 
ATOM   1088 N N   . SER A 1 172 ? -40.703 18.524 8.010  1.00 23.13 ? 154 SER A N   1 
ATOM   1089 C CA  . SER A 1 172 ? -41.113 19.396 9.059  1.00 22.42 ? 154 SER A CA  1 
ATOM   1090 C C   . SER A 1 172 ? -40.701 20.826 8.876  1.00 24.02 ? 154 SER A C   1 
ATOM   1091 O O   . SER A 1 172 ? -41.339 21.690 9.452  1.00 21.68 ? 154 SER A O   1 
ATOM   1092 C CB  . SER A 1 172 ? -40.611 18.974 10.452 1.00 25.65 ? 154 SER A CB  1 
ATOM   1093 O OG  . SER A 1 172 ? -40.793 17.602 10.693 1.00 30.69 ? 154 SER A OG  1 
ATOM   1094 N N   . GLY A 1 173 ? -39.618 21.076 8.109  1.00 19.98 ? 155 GLY A N   1 
ATOM   1095 C CA  . GLY A 1 173 ? -39.096 22.433 8.018  1.00 20.39 ? 155 GLY A CA  1 
ATOM   1096 C C   . GLY A 1 173 ? -37.617 22.364 7.821  1.00 18.29 ? 155 GLY A C   1 
ATOM   1097 O O   . GLY A 1 173 ? -37.099 21.423 7.232  1.00 23.15 ? 155 GLY A O   1 
ATOM   1098 N N   . ILE A 1 174 ? -36.960 23.439 8.225  1.00 16.56 ? 156 ILE A N   1 
ATOM   1099 C CA  . ILE A 1 174 ? -35.504 23.461 8.027  1.00 14.83 ? 156 ILE A CA  1 
ATOM   1100 C C   . ILE A 1 174 ? -34.915 23.411 9.486  1.00 15.75 ? 156 ILE A C   1 
ATOM   1101 O O   . ILE A 1 174 ? -35.371 24.180 10.341 1.00 17.28 ? 156 ILE A O   1 
ATOM   1102 C CB  . ILE A 1 174 ? -35.082 24.752 7.352  1.00 17.42 ? 156 ILE A CB  1 
ATOM   1103 C CG1 . ILE A 1 174 ? -35.825 24.941 5.983  1.00 20.27 ? 156 ILE A CG1 1 
ATOM   1104 C CG2 . ILE A 1 174 ? -33.605 24.725 7.024  1.00 20.66 ? 156 ILE A CG2 1 
ATOM   1105 C CD1 . ILE A 1 174 ? -35.638 26.296 5.341  1.00 20.91 ? 156 ILE A CD1 1 
ATOM   1106 N N   . HIS A 1 175 ? -33.907 22.583 9.657  1.00 14.95 ? 157 HIS A N   1 
ATOM   1107 C CA  . HIS A 1 175 ? -33.268 22.351 10.979 1.00 14.96 ? 157 HIS A CA  1 
ATOM   1108 C C   . HIS A 1 175 ? -31.799 22.847 10.957 1.00 17.15 ? 157 HIS A C   1 
ATOM   1109 O O   . HIS A 1 175 ? -31.119 22.720 9.953  1.00 17.61 ? 157 HIS A O   1 
ATOM   1110 C CB  . HIS A 1 175 ? -33.228 20.922 11.311 1.00 17.72 ? 157 HIS A CB  1 
ATOM   1111 C CG  . HIS A 1 175 ? -34.555 20.204 11.223 1.00 17.99 ? 157 HIS A CG  1 
ATOM   1112 N ND1 . HIS A 1 175 ? -35.243 19.799 12.353 1.00 19.34 ? 157 HIS A ND1 1 
ATOM   1113 C CD2 . HIS A 1 175 ? -35.306 19.859 10.155 1.00 20.12 ? 157 HIS A CD2 1 
ATOM   1114 C CE1 . HIS A 1 175 ? -36.333 19.133 11.952 1.00 22.47 ? 157 HIS A CE1 1 
ATOM   1115 N NE2 . HIS A 1 175 ? -36.388 19.165 10.630 1.00 21.48 ? 157 HIS A NE2 1 
ATOM   1116 N N   . ILE A 1 176 ? -31.337 23.287 12.110 1.00 14.09 ? 158 ILE A N   1 
ATOM   1117 C CA  . ILE A 1 176 ? -29.951 23.262 12.506 1.00 13.57 ? 158 ILE A CA  1 
ATOM   1118 C C   . ILE A 1 176 ? -29.815 22.199 13.553 1.00 14.38 ? 158 ILE A C   1 
ATOM   1119 O O   . ILE A 1 176 ? -30.576 22.176 14.555 1.00 16.56 ? 158 ILE A O   1 
ATOM   1120 C CB  . ILE A 1 176 ? -29.567 24.596 13.117 1.00 16.08 ? 158 ILE A CB  1 
ATOM   1121 C CG1 . ILE A 1 176 ? -29.842 25.776 12.214 1.00 18.61 ? 158 ILE A CG1 1 
ATOM   1122 C CG2 . ILE A 1 176 ? -28.063 24.603 13.407 1.00 17.52 ? 158 ILE A CG2 1 
ATOM   1123 C CD1 . ILE A 1 176 ? -29.805 27.134 12.897 1.00 19.93 ? 158 ILE A CD1 1 
ATOM   1124 N N   . ILE A 1 177 ? -28.880 21.324 13.378 1.00 13.24 ? 159 ILE A N   1 
ATOM   1125 C CA  . ILE A 1 177 ? -28.718 20.132 14.223 1.00 14.49 ? 159 ILE A CA  1 
ATOM   1126 C C   . ILE A 1 177 ? -27.356 20.234 14.980 1.00 15.91 ? 159 ILE A C   1 
ATOM   1127 O O   . ILE A 1 177 ? -26.339 20.517 14.308 1.00 16.53 ? 159 ILE A O   1 
ATOM   1128 C CB  . ILE A 1 177 ? -28.742 18.794 13.426 1.00 15.03 ? 159 ILE A CB  1 
ATOM   1129 C CG1 . ILE A 1 177 ? -30.027 18.768 12.622 1.00 17.93 ? 159 ILE A CG1 1 
ATOM   1130 C CG2 . ILE A 1 177 ? -28.593 17.658 14.368 1.00 14.99 ? 159 ILE A CG2 1 
ATOM   1131 C CD1 . ILE A 1 177 ? -30.163 17.597 11.685 1.00 18.29 ? 159 ILE A CD1 1 
ATOM   1132 N N   . LEU A 1 178 ? -27.329 20.019 16.271 1.00 14.73 ? 160 LEU A N   1 
ATOM   1133 C CA  . LEU A 1 178 ? -26.071 19.976 17.025 1.00 16.91 ? 160 LEU A CA  1 
ATOM   1134 C C   . LEU A 1 178 ? -25.989 18.606 17.615 1.00 14.47 ? 160 LEU A C   1 
ATOM   1135 O O   . LEU A 1 178 ? -26.819 18.188 18.462 1.00 16.77 ? 160 LEU A O   1 
ATOM   1136 C CB  . LEU A 1 178 ? -26.098 21.057 18.125 1.00 16.65 ? 160 LEU A CB  1 
ATOM   1137 C CG  . LEU A 1 178 ? -24.909 21.043 19.070 1.00 19.41 ? 160 LEU A CG  1 
ATOM   1138 C CD1 . LEU A 1 178 ? -23.662 21.408 18.268 1.00 22.70 ? 160 LEU A CD1 1 
ATOM   1139 C CD2 . LEU A 1 178 ? -25.189 21.907 20.238 1.00 19.18 ? 160 LEU A CD2 1 
ATOM   1140 N N   . ARG A 1 179 ? -24.950 17.860 17.283 1.00 16.67 ? 161 ARG A N   1 
ATOM   1141 C CA  . ARG A 1 179 ? -24.690 16.595 17.897 1.00 19.11 ? 161 ARG A CA  1 
ATOM   1142 C C   . ARG A 1 179 ? -23.976 16.754 19.211 1.00 18.67 ? 161 ARG A C   1 
ATOM   1143 O O   . ARG A 1 179 ? -22.885 17.285 19.253 1.00 20.77 ? 161 ARG A O   1 
ATOM   1144 C CB  . ARG A 1 179 ? -23.907 15.663 16.958 1.00 20.07 ? 161 ARG A CB  1 
ATOM   1145 C CG  . ARG A 1 179 ? -23.608 14.345 17.633 1.00 22.08 ? 161 ARG A CG  1 
ATOM   1146 C CD  . ARG A 1 179 ? -22.970 13.317 16.688 1.00 23.28 ? 161 ARG A CD  1 
ATOM   1147 N NE  . ARG A 1 179 ? -22.631 12.184 17.568 1.00 24.71 ? 161 ARG A NE  1 
ATOM   1148 C CZ  . ARG A 1 179 ? -21.688 11.302 17.276 1.00 29.68 ? 161 ARG A CZ  1 
ATOM   1149 N NH1 . ARG A 1 179 ? -20.946 11.418 16.163 1.00 30.24 ? 161 ARG A NH1 1 
ATOM   1150 N NH2 . ARG A 1 179 ? -21.419 10.324 18.136 1.00 28.52 ? 161 ARG A NH2 1 
ATOM   1151 N N   . THR A 1 180 ? -24.596 16.296 20.286 1.00 19.13 ? 162 THR A N   1 
ATOM   1152 C CA  . THR A 1 180 ? -24.054 16.529 21.623 1.00 21.76 ? 162 THR A CA  1 
ATOM   1153 C C   . THR A 1 180 ? -23.379 15.278 22.186 1.00 24.13 ? 162 THR A C   1 
ATOM   1154 O O   . THR A 1 180 ? -22.601 15.387 23.107 1.00 29.84 ? 162 THR A O   1 
ATOM   1155 C CB  . THR A 1 180 ? -25.107 17.099 22.539 1.00 22.86 ? 162 THR A CB  1 
ATOM   1156 O OG1 . THR A 1 180 ? -26.231 16.230 22.606 1.00 23.70 ? 162 THR A OG1 1 
ATOM   1157 C CG2 . THR A 1 180 ? -25.605 18.517 22.080 1.00 22.23 ? 162 THR A CG2 1 
ATOM   1158 N N   . GLU A 1 181 ? -23.716 14.124 21.694 1.00 25.26 ? 163 GLU A N   1 
ATOM   1159 C CA  . GLU A 1 181 ? -23.092 12.849 22.116 1.00 29.61 ? 163 GLU A CA  1 
ATOM   1160 C C   . GLU A 1 181 ? -23.199 11.846 20.964 1.00 34.11 ? 163 GLU A C   1 
ATOM   1161 O O   . GLU A 1 181 ? -24.060 11.932 20.075 1.00 27.82 ? 163 GLU A O   1 
ATOM   1162 C CB  . GLU A 1 181 ? -23.815 12.235 23.324 1.00 32.43 ? 163 GLU A CB  1 
ATOM   1163 C CG  . GLU A 1 181 ? -23.952 13.123 24.552 1.00 33.50 ? 163 GLU A CG  1 
ATOM   1164 C CD  . GLU A 1 181 ? -24.802 12.474 25.674 1.00 41.22 ? 163 GLU A CD  1 
ATOM   1165 O OE1 . GLU A 1 181 ? -25.292 11.317 25.465 1.00 40.63 ? 163 GLU A OE1 1 
ATOM   1166 O OE2 . GLU A 1 181 ? -24.983 13.162 26.731 1.00 38.89 ? 163 GLU A OE2 1 
ATOM   1167 O OXT . GLU A 1 181 ? -22.395 10.859 20.937 1.00 34.65 ? 163 GLU A OXT 1 
HETATM 1168 C C2  . 1PG B 2 .   ? -22.348 26.994 8.224  1.00 22.08 ? 300 1PG A C2  1 
HETATM 1169 C C1  . 1PG B 2 .   ? -21.309 24.688 9.029  1.00 16.59 ? 300 1PG A C1  1 
HETATM 1170 O O1  . 1PG B 2 .   ? -22.495 25.430 8.341  1.00 32.62 ? 300 1PG A O1  1 
HETATM 1171 O O2  . 1PG B 2 .   ? -21.920 29.357 7.562  1.00 31.32 ? 300 1PG A O2  1 
HETATM 1172 C C3  . 1PG B 2 .   ? -22.475 28.034 7.164  1.00 27.44 ? 300 1PG A C3  1 
HETATM 1173 C C4  . 1PG B 2 .   ? -20.552 29.261 7.814  1.00 24.18 ? 300 1PG A C4  1 
HETATM 1174 C C5  . 1PG B 2 .   ? -19.834 30.600 7.946  1.00 27.93 ? 300 1PG A C5  1 
HETATM 1175 O O3  . 1PG B 2 .   ? -18.451 30.431 8.301  1.00 33.45 ? 300 1PG A O3  1 
HETATM 1176 C C6  . 1PG B 2 .   ? -17.930 29.450 7.391  1.00 25.38 ? 300 1PG A C6  1 
HETATM 1177 C C7  . 1PG B 2 .   ? -16.465 29.084 7.558  1.00 35.94 ? 300 1PG A C7  1 
HETATM 1178 O O4  . 1PG B 2 .   ? -16.120 28.262 6.397  1.00 34.39 ? 300 1PG A O4  1 
HETATM 1179 C C8  . 1PG B 2 .   ? -16.414 29.012 5.248  1.00 23.48 ? 300 1PG A C8  1 
HETATM 1180 C C9  . 1PG B 2 .   ? -15.885 28.404 4.003  1.00 26.77 ? 300 1PG A C9  1 
HETATM 1181 O O5  . 1PG B 2 .   ? -16.441 29.120 2.891  1.00 35.69 ? 300 1PG A O5  1 
HETATM 1182 C C10 . 1PG B 2 .   ? -17.846 29.192 2.898  1.00 33.51 ? 300 1PG A C10 1 
HETATM 1183 C C11 . 1PG B 2 .   ? -18.431 29.699 1.601  1.00 41.91 ? 300 1PG A C11 1 
HETATM 1184 O O6  . 1PG B 2 .   ? -19.790 29.179 1.673  1.00 47.77 ? 300 1PG A O6  1 
HETATM 1185 O O   . HOH C 3 .   ? -8.154  28.438 5.767  1.00 28.55 ? 401 HOH A O   1 
HETATM 1186 O O   . HOH C 3 .   ? -33.302 17.453 27.994 1.00 35.62 ? 402 HOH A O   1 
HETATM 1187 O O   . HOH C 3 .   ? -10.658 25.912 12.033 1.00 31.49 ? 403 HOH A O   1 
HETATM 1188 O O   . HOH C 3 .   ? -12.281 34.207 6.002  1.00 28.72 ? 404 HOH A O   1 
HETATM 1189 O O   . HOH C 3 .   ? -23.419 27.078 23.375 1.00 33.91 ? 405 HOH A O   1 
HETATM 1190 O O   . HOH C 3 .   ? -19.592 19.824 -6.371 1.00 37.62 ? 406 HOH A O   1 
HETATM 1191 O O   . HOH C 3 .   ? -56.718 30.764 18.305 1.00 38.49 ? 407 HOH A O   1 
HETATM 1192 O O   . HOH C 3 .   ? -18.057 27.961 -2.938 1.00 30.09 ? 408 HOH A O   1 
HETATM 1193 O O   . HOH C 3 .   ? -37.171 35.753 22.486 1.00 35.52 ? 409 HOH A O   1 
HETATM 1194 O O   . HOH C 3 .   ? -18.147 21.379 10.265 1.00 27.98 ? 410 HOH A O   1 
HETATM 1195 O O   . HOH C 3 .   ? -39.127 33.642 21.650 1.00 33.10 ? 411 HOH A O   1 
HETATM 1196 O O   . HOH C 3 .   ? -20.696 23.063 17.157 1.00 33.21 ? 412 HOH A O   1 
HETATM 1197 O O   . HOH C 3 .   ? -8.735  26.222 4.166  1.00 26.71 ? 413 HOH A O   1 
HETATM 1198 O O   . HOH C 3 .   ? -34.626 10.545 22.839 1.00 39.40 ? 414 HOH A O   1 
HETATM 1199 O O   . HOH C 3 .   ? -38.964 27.954 24.934 1.00 24.07 ? 415 HOH A O   1 
HETATM 1200 O O   . HOH C 3 .   ? -53.106 32.319 17.722 1.00 37.78 ? 416 HOH A O   1 
HETATM 1201 O O   . HOH C 3 .   ? -26.604 18.689 0.599  1.00 21.08 ? 417 HOH A O   1 
HETATM 1202 O O   . HOH C 3 .   ? -35.076 25.996 27.045 1.00 25.35 ? 418 HOH A O   1 
HETATM 1203 O O   . HOH C 3 .   ? -16.506 35.209 -7.543 1.00 40.16 ? 419 HOH A O   1 
HETATM 1204 O O   . HOH C 3 .   ? -29.158 14.690 5.513  1.00 25.20 ? 420 HOH A O   1 
HETATM 1205 O O   . HOH C 3 .   ? -50.995 32.398 13.785 1.00 38.08 ? 421 HOH A O   1 
HETATM 1206 O O   . HOH C 3 .   ? -17.259 29.367 14.703 1.00 24.07 ? 422 HOH A O   1 
HETATM 1207 O O   . HOH C 3 .   ? -38.063 22.240 4.423  1.00 28.75 ? 423 HOH A O   1 
HETATM 1208 O O   . HOH C 3 .   ? -23.746 37.247 12.824 1.00 50.89 ? 424 HOH A O   1 
HETATM 1209 O O   . HOH C 3 .   ? -43.417 19.002 3.851  1.00 39.98 ? 425 HOH A O   1 
HETATM 1210 O O   . HOH C 3 .   ? -44.220 28.519 25.544 1.00 31.91 ? 426 HOH A O   1 
HETATM 1211 O O   . HOH C 3 .   ? -35.316 23.503 30.193 1.00 20.79 ? 427 HOH A O   1 
HETATM 1212 O O   . HOH C 3 .   ? -17.034 27.133 10.334 1.00 35.11 ? 428 HOH A O   1 
HETATM 1213 O O   . HOH C 3 .   ? -30.048 12.102 3.690  1.00 47.66 ? 429 HOH A O   1 
HETATM 1214 O O   . HOH C 3 .   ? -19.597 24.191 -1.876 1.00 31.94 ? 430 HOH A O   1 
HETATM 1215 O O   . HOH C 3 .   ? -46.208 31.634 22.055 1.00 28.50 ? 431 HOH A O   1 
HETATM 1216 O O   . HOH C 3 .   ? -22.000 29.982 19.887 1.00 30.00 ? 432 HOH A O   1 
HETATM 1217 O O   . HOH C 3 .   ? -37.925 9.926  6.320  1.00 40.26 ? 433 HOH A O   1 
HETATM 1218 O O   . HOH C 3 .   ? -19.657 22.673 14.233 1.00 33.95 ? 434 HOH A O   1 
HETATM 1219 O O   . HOH C 3 .   ? -25.105 31.096 7.689  1.00 29.32 ? 435 HOH A O   1 
HETATM 1220 O O   . HOH C 3 .   ? -50.329 32.510 17.079 1.00 35.49 ? 436 HOH A O   1 
HETATM 1221 O O   . HOH C 3 .   ? -27.551 29.234 26.496 1.00 47.89 ? 437 HOH A O   1 
HETATM 1222 O O   . HOH C 3 .   ? -12.254 24.667 10.260 1.00 28.45 ? 438 HOH A O   1 
HETATM 1223 O O   . HOH C 3 .   ? -48.329 28.262 22.425 1.00 35.05 ? 439 HOH A O   1 
HETATM 1224 O O   . HOH C 3 .   ? -27.395 14.182 1.093  1.00 39.78 ? 440 HOH A O   1 
HETATM 1225 O O   . HOH C 3 .   ? -10.827 31.700 9.329  1.00 29.34 ? 441 HOH A O   1 
HETATM 1226 O O   . HOH C 3 .   ? -28.135 23.915 3.283  1.00 36.17 ? 442 HOH A O   1 
HETATM 1227 O O   . HOH C 3 .   ? -37.645 17.618 2.770  1.00 33.42 ? 443 HOH A O   1 
HETATM 1228 O O   . HOH C 3 .   ? -6.792  32.564 -3.420 1.00 39.79 ? 444 HOH A O   1 
HETATM 1229 O O   . HOH C 3 .   ? -26.023 9.008  5.192  1.00 36.86 ? 445 HOH A O   1 
HETATM 1230 O O   . HOH C 3 .   ? -27.684 18.380 25.560 1.00 28.53 ? 446 HOH A O   1 
HETATM 1231 O O   . HOH C 3 .   ? -33.502 25.514 29.796 1.00 34.59 ? 447 HOH A O   1 
HETATM 1232 O O   . HOH C 3 .   ? -38.872 18.330 25.476 1.00 49.69 ? 448 HOH A O   1 
HETATM 1233 O O   . HOH C 3 .   ? -42.285 21.582 28.309 1.00 36.38 ? 449 HOH A O   1 
HETATM 1234 O O   . HOH C 3 .   ? -44.752 32.438 9.654  1.00 31.71 ? 450 HOH A O   1 
HETATM 1235 O O   . HOH C 3 .   ? -35.965 22.647 19.209 1.00 19.02 ? 451 HOH A O   1 
HETATM 1236 O O   . HOH C 3 .   ? -38.096 14.479 5.762  1.00 29.53 ? 452 HOH A O   1 
HETATM 1237 O O   . HOH C 3 .   ? -42.765 30.701 14.014 1.00 25.65 ? 453 HOH A O   1 
HETATM 1238 O O   . HOH C 3 .   ? -19.064 15.427 9.885  1.00 24.11 ? 454 HOH A O   1 
HETATM 1239 O O   . HOH C 3 .   ? -36.624 35.412 6.630  1.00 31.93 ? 455 HOH A O   1 
HETATM 1240 O O   . HOH C 3 .   ? -39.074 29.968 14.196 1.00 22.74 ? 456 HOH A O   1 
HETATM 1241 O O   . HOH C 3 .   ? -20.483 23.192 11.282 1.00 28.49 ? 457 HOH A O   1 
HETATM 1242 O O   . HOH C 3 .   ? -29.318 21.905 23.644 1.00 23.27 ? 458 HOH A O   1 
HETATM 1243 O O   . HOH C 3 .   ? -44.465 23.573 18.887 1.00 25.72 ? 459 HOH A O   1 
HETATM 1244 O O   . HOH C 3 .   ? -32.031 34.942 11.671 1.00 24.95 ? 460 HOH A O   1 
HETATM 1245 O O   . HOH C 3 .   ? -20.510 17.672 8.860  1.00 22.56 ? 461 HOH A O   1 
HETATM 1246 O O   . HOH C 3 .   ? -25.319 9.433  8.106  1.00 26.99 ? 462 HOH A O   1 
HETATM 1247 O O   . HOH C 3 .   ? -28.599 17.518 23.126 1.00 21.58 ? 463 HOH A O   1 
HETATM 1248 O O   . HOH C 3 .   ? -37.665 32.048 13.248 1.00 26.28 ? 464 HOH A O   1 
HETATM 1249 O O   . HOH C 3 .   ? -17.375 12.012 16.559 1.00 38.76 ? 465 HOH A O   1 
HETATM 1250 O O   . HOH C 3 .   ? -14.340 26.728 9.767  1.00 28.58 ? 466 HOH A O   1 
HETATM 1251 O O   . HOH C 3 .   ? -22.697 25.040 4.291  1.00 31.59 ? 467 HOH A O   1 
HETATM 1252 O O   . HOH C 3 .   ? -40.835 34.784 9.223  1.00 35.98 ? 468 HOH A O   1 
HETATM 1253 O O   . HOH C 3 .   ? -43.252 27.368 1.770  1.00 39.94 ? 469 HOH A O   1 
HETATM 1254 O O   . HOH C 3 .   ? -35.521 35.665 15.048 1.00 32.34 ? 470 HOH A O   1 
HETATM 1255 O O   . HOH C 3 .   ? -33.604 8.205  13.406 1.00 33.56 ? 471 HOH A O   1 
HETATM 1256 O O   . HOH C 3 .   ? -22.646 8.732  8.585  1.00 37.45 ? 472 HOH A O   1 
HETATM 1257 O O   . HOH C 3 .   ? -43.847 20.451 18.885 1.00 35.74 ? 473 HOH A O   1 
HETATM 1258 O O   . HOH C 3 .   ? -20.090 12.394 6.178  1.00 32.78 ? 474 HOH A O   1 
HETATM 1259 O O   . HOH C 3 .   ? -23.258 8.425  20.770 1.00 41.73 ? 475 HOH A O   1 
HETATM 1260 O O   . HOH C 3 .   ? -39.247 34.498 13.240 1.00 41.26 ? 476 HOH A O   1 
HETATM 1261 O O   . HOH C 3 .   ? -13.578 17.082 -3.440 1.00 35.90 ? 477 HOH A O   1 
HETATM 1262 O O   . HOH C 3 .   ? -6.849  28.467 -0.122 1.00 33.02 ? 478 HOH A O   1 
HETATM 1263 O O   . HOH C 3 .   ? -14.900 14.685 -2.630 1.00 40.17 ? 479 HOH A O   1 
HETATM 1264 O O   . HOH C 3 .   ? -28.814 3.296  15.119 1.00 37.28 ? 480 HOH A O   1 
HETATM 1265 O O   . HOH C 3 .   ? -19.974 10.845 12.544 1.00 41.70 ? 481 HOH A O   1 
HETATM 1266 O O   . HOH C 3 .   ? -41.565 18.601 14.495 1.00 39.87 ? 482 HOH A O   1 
HETATM 1267 O O   . HOH C 3 .   ? -44.174 22.203 16.212 1.00 34.52 ? 483 HOH A O   1 
HETATM 1268 O O   . HOH C 3 .   ? -38.739 35.781 15.353 1.00 52.18 ? 484 HOH A O   1 
HETATM 1269 O O   . HOH C 3 .   ? -18.298 30.420 -1.691 1.00 36.81 ? 485 HOH A O   1 
HETATM 1270 O O   . HOH C 3 .   ? -49.924 28.224 6.702  1.00 43.14 ? 486 HOH A O   1 
HETATM 1271 O O   . HOH C 3 .   ? -19.323 28.400 5.169  1.00 30.03 ? 487 HOH A O   1 
HETATM 1272 O O   . HOH C 3 .   ? -37.253 13.732 12.582 1.00 36.03 ? 488 HOH A O   1 
HETATM 1273 O O   . HOH C 3 .   ? -33.475 32.318 1.510  1.00 37.49 ? 489 HOH A O   1 
HETATM 1274 O O   . HOH C 3 .   ? -41.416 20.536 25.956 1.00 35.58 ? 490 HOH A O   1 
HETATM 1275 O O   . HOH C 3 .   ? -25.856 28.454 6.426  1.00 33.46 ? 491 HOH A O   1 
HETATM 1276 O O   . HOH C 3 .   ? -48.321 22.643 4.800  1.00 37.13 ? 492 HOH A O   1 
HETATM 1277 O O   . HOH C 3 .   ? -28.339 28.190 2.688  1.00 33.68 ? 493 HOH A O   1 
HETATM 1278 O O   . HOH C 3 .   ? -40.209 34.318 -0.054 1.00 39.69 ? 494 HOH A O   1 
HETATM 1279 O O   . HOH C 3 .   ? -16.714 14.065 9.357  1.00 36.03 ? 495 HOH A O   1 
HETATM 1280 O O   . HOH C 3 .   ? -17.118 10.615 6.571  1.00 43.12 ? 496 HOH A O   1 
HETATM 1281 O O   . HOH C 3 .   ? -44.163 23.947 23.609 1.00 35.16 ? 497 HOH A O   1 
HETATM 1282 O O   . HOH C 3 .   ? -39.112 18.288 13.861 1.00 41.13 ? 498 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   HIS 1   -17 ?   ?   ?   A . n 
A 1 2   HIS 2   -16 ?   ?   ?   A . n 
A 1 3   HIS 3   -15 ?   ?   ?   A . n 
A 1 4   HIS 4   -14 ?   ?   ?   A . n 
A 1 5   HIS 5   -13 ?   ?   ?   A . n 
A 1 6   HIS 6   -12 ?   ?   ?   A . n 
A 1 7   HIS 7   -11 ?   ?   ?   A . n 
A 1 8   HIS 8   -10 ?   ?   ?   A . n 
A 1 9   GLY 9   -9  ?   ?   ?   A . n 
A 1 10  GLY 10  -8  ?   ?   ?   A . n 
A 1 11  LEU 11  -7  ?   ?   ?   A . n 
A 1 12  VAL 12  -6  ?   ?   ?   A . n 
A 1 13  PRO 13  -5  ?   ?   ?   A . n 
A 1 14  ARG 14  -4  ?   ?   ?   A . n 
A 1 15  GLY 15  -3  ?   ?   ?   A . n 
A 1 16  SER 16  -2  ?   ?   ?   A . n 
A 1 17  HIS 17  -1  ?   ?   ?   A . n 
A 1 18  GLY 18  0   ?   ?   ?   A . n 
A 1 19  MET 19  1   ?   ?   ?   A . n 
A 1 20  ALA 20  2   ?   ?   ?   A . n 
A 1 21  ASP 21  3   ?   ?   ?   A . n 
A 1 22  GLU 22  4   ?   ?   ?   A . n 
A 1 23  GLU 23  5   ?   ?   ?   A . n 
A 1 24  LYS 24  6   6   LYS LYS A . n 
A 1 25  LEU 25  7   7   LEU LEU A . n 
A 1 26  PRO 26  8   8   PRO PRO A . n 
A 1 27  PRO 27  9   9   PRO PRO A . n 
A 1 28  GLY 28  10  10  GLY GLY A . n 
A 1 29  TRP 29  11  11  TRP TRP A . n 
A 1 30  GLU 30  12  12  GLU GLU A . n 
A 1 31  LYS 31  13  13  LYS LYS A . n 
A 1 32  ALA 32  14  14  ALA ALA A . n 
A 1 33  MET 33  15  15  MET MET A . n 
A 1 34  SER 34  16  16  SER SER A . n 
A 1 35  ARG 35  17  17  ARG ARG A . n 
A 1 36  SER 36  18  18  SER SER A . n 
A 1 37  SER 37  19  19  SER SER A . n 
A 1 38  GLY 38  20  20  GLY GLY A . n 
A 1 39  ARG 39  21  21  ARG ARG A . n 
A 1 40  VAL 40  22  22  VAL VAL A . n 
A 1 41  TYR 41  23  23  TYR TYR A . n 
A 1 42  TYR 42  24  24  TYR TYR A . n 
A 1 43  PHE 43  25  25  PHE PHE A . n 
A 1 44  ASN 44  26  26  ASN ASN A . n 
A 1 45  HIS 45  27  27  HIS HIS A . n 
A 1 46  ILE 46  28  28  ILE ILE A . n 
A 1 47  THR 47  29  29  THR THR A . n 
A 1 48  ASN 48  30  30  ASN ASN A . n 
A 1 49  ALA 49  31  31  ALA ALA A . n 
A 1 50  SER 50  32  32  SER SER A . n 
A 1 51  GLN 51  33  33  GLN GLN A . n 
A 1 52  TRP 52  34  34  TRP TRP A . n 
A 1 53  GLU 53  35  35  GLU GLU A . n 
A 1 54  ARG 54  36  36  ARG ARG A . n 
A 1 55  PRO 55  37  37  PRO PRO A . n 
A 1 56  SER 56  38  ?   ?   ?   A . n 
A 1 57  GLY 57  39  ?   ?   ?   A . n 
A 1 58  ASN 58  40  ?   ?   ?   A . n 
A 1 59  SER 59  41  ?   ?   ?   A . n 
A 1 60  SER 60  42  ?   ?   ?   A . n 
A 1 61  SER 61  43  ?   ?   ?   A . n 
A 1 62  GLY 62  44  ?   ?   ?   A . n 
A 1 63  GLY 63  45  ?   ?   ?   A . n 
A 1 64  LYS 64  46  ?   ?   ?   A . n 
A 1 65  ASN 65  47  ?   ?   ?   A . n 
A 1 66  GLY 66  48  ?   ?   ?   A . n 
A 1 67  GLN 67  49  ?   ?   ?   A . n 
A 1 68  GLY 68  50  ?   ?   ?   A . n 
A 1 69  GLU 69  51  51  GLU GLU A . n 
A 1 70  PRO 70  52  52  PRO PRO A . n 
A 1 71  ALA 71  53  53  ALA ALA A . n 
A 1 72  ARG 72  54  54  ARG ARG A . n 
A 1 73  VAL 73  55  55  VAL VAL A . n 
A 1 74  ARG 74  56  56  ARG ARG A . n 
A 1 75  CYS 75  57  57  CYS CYS A . n 
A 1 76  SER 76  58  58  SER SER A . n 
A 1 77  HIS 77  59  59  HIS HIS A . n 
A 1 78  LEU 78  60  60  LEU LEU A . n 
A 1 79  LEU 79  61  61  LEU LEU A . n 
A 1 80  VAL 80  62  62  VAL VAL A . n 
A 1 81  LYS 81  63  63  LYS LYS A . n 
A 1 82  HIS 82  64  64  HIS HIS A . n 
A 1 83  SER 83  65  65  SER SER A . n 
A 1 84  GLN 84  66  66  GLN GLN A . n 
A 1 85  SER 85  67  67  SER SER A . n 
A 1 86  ARG 86  68  68  ARG ARG A . n 
A 1 87  ARG 87  69  69  ARG ARG A . n 
A 1 88  PRO 88  70  70  PRO PRO A . n 
A 1 89  SER 89  71  71  SER SER A . n 
A 1 90  SER 90  72  72  SER SER A . n 
A 1 91  TRP 91  73  73  TRP TRP A . n 
A 1 92  ARG 92  74  74  ARG ARG A . n 
A 1 93  GLN 93  75  75  GLN GLN A . n 
A 1 94  GLU 94  76  76  GLU GLU A . n 
A 1 95  LYS 95  77  77  LYS LYS A . n 
A 1 96  ILE 96  78  78  ILE ILE A . n 
A 1 97  THR 97  79  79  THR THR A . n 
A 1 98  ARG 98  80  80  ARG ARG A . n 
A 1 99  THR 99  81  81  THR THR A . n 
A 1 100 LYS 100 82  82  LYS LYS A . n 
A 1 101 GLU 101 83  83  GLU GLU A . n 
A 1 102 GLU 102 84  84  GLU GLU A . n 
A 1 103 ALA 103 85  85  ALA ALA A . n 
A 1 104 LEU 104 86  86  LEU LEU A . n 
A 1 105 GLU 105 87  87  GLU GLU A . n 
A 1 106 LEU 106 88  88  LEU LEU A . n 
A 1 107 ILE 107 89  89  ILE ILE A . n 
A 1 108 ASN 108 90  90  ASN ASN A . n 
A 1 109 GLY 109 91  91  GLY GLY A . n 
A 1 110 TYR 110 92  92  TYR TYR A . n 
A 1 111 ILE 111 93  93  ILE ILE A . n 
A 1 112 GLN 112 94  94  GLN GLN A . n 
A 1 113 LYS 113 95  95  LYS LYS A . n 
A 1 114 ILE 114 96  96  ILE ILE A . n 
A 1 115 LYS 115 97  97  LYS LYS A . n 
A 1 116 SER 116 98  98  SER SER A . n 
A 1 117 GLY 117 99  99  GLY GLY A . n 
A 1 118 GLU 118 100 100 GLU GLU A . n 
A 1 119 GLU 119 101 101 GLU GLU A . n 
A 1 120 ASP 120 102 102 ASP ASP A . n 
A 1 121 PHE 121 103 103 PHE PHE A . n 
A 1 122 GLU 122 104 104 GLU GLU A . n 
A 1 123 SER 123 105 105 SER SER A . n 
A 1 124 LEU 124 106 106 LEU LEU A . n 
A 1 125 ALA 125 107 107 ALA ALA A . n 
A 1 126 SER 126 108 108 SER SER A . n 
A 1 127 GLN 127 109 109 GLN GLN A . n 
A 1 128 PHE 128 110 110 PHE PHE A . n 
A 1 129 SER 129 111 111 SER SER A . n 
A 1 130 ASP 130 112 112 ASP ASP A . n 
A 1 131 OCS 131 113 113 OCS OCS A . n 
A 1 132 SER 132 114 114 SER SER A . n 
A 1 133 SER 133 115 115 SER SER A . n 
A 1 134 ALA 134 116 116 ALA ALA A . n 
A 1 135 LYS 135 117 117 LYS LYS A . n 
A 1 136 ALA 136 118 118 ALA ALA A . n 
A 1 137 ARG 137 119 119 ARG ARG A . n 
A 1 138 GLY 138 120 120 GLY GLY A . n 
A 1 139 ASP 139 121 121 ASP ASP A . n 
A 1 140 LEU 140 122 122 LEU LEU A . n 
A 1 141 GLY 141 123 123 GLY GLY A . n 
A 1 142 ALA 142 124 124 ALA ALA A . n 
A 1 143 PHE 143 125 125 PHE PHE A . n 
A 1 144 SER 144 126 126 SER SER A . n 
A 1 145 ARG 145 127 127 ARG ARG A . n 
A 1 146 GLY 146 128 128 GLY GLY A . n 
A 1 147 GLN 147 129 129 GLN GLN A . n 
A 1 148 MET 148 130 130 MET MET A . n 
A 1 149 GLN 149 131 131 GLN GLN A . n 
A 1 150 LYS 150 132 132 LYS LYS A . n 
A 1 151 PRO 151 133 133 PRO PRO A . n 
A 1 152 PHE 152 134 134 PHE PHE A . n 
A 1 153 GLU 153 135 135 GLU GLU A . n 
A 1 154 ASP 154 136 136 ASP ASP A . n 
A 1 155 ALA 155 137 137 ALA ALA A . n 
A 1 156 SER 156 138 138 SER SER A . n 
A 1 157 PHE 157 139 139 PHE PHE A . n 
A 1 158 ALA 158 140 140 ALA ALA A . n 
A 1 159 LEU 159 141 141 LEU LEU A . n 
A 1 160 ARG 160 142 142 ARG ARG A . n 
A 1 161 THR 161 143 143 THR THR A . n 
A 1 162 GLY 162 144 144 GLY GLY A . n 
A 1 163 GLU 163 145 145 GLU GLU A . n 
A 1 164 MET 164 146 146 MET MET A . n 
A 1 165 SER 165 147 147 SER SER A . n 
A 1 166 GLY 166 148 148 GLY GLY A . n 
A 1 167 PRO 167 149 149 PRO PRO A . n 
A 1 168 VAL 168 150 150 VAL VAL A . n 
A 1 169 PHE 169 151 151 PHE PHE A . n 
A 1 170 THR 170 152 152 THR THR A . n 
A 1 171 ASP 171 153 153 ASP ASP A . n 
A 1 172 SER 172 154 154 SER SER A . n 
A 1 173 GLY 173 155 155 GLY GLY A . n 
A 1 174 ILE 174 156 156 ILE ILE A . n 
A 1 175 HIS 175 157 157 HIS HIS A . n 
A 1 176 ILE 176 158 158 ILE ILE A . n 
A 1 177 ILE 177 159 159 ILE ILE A . n 
A 1 178 LEU 178 160 160 LEU LEU A . n 
A 1 179 ARG 179 161 161 ARG ARG A . n 
A 1 180 THR 180 162 162 THR THR A . n 
A 1 181 GLU 181 163 163 GLU GLU A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 1PG 1  300 300 1PG 1PG A . 
C 3 HOH 1  401 64  HOH HOH A . 
C 3 HOH 2  402 23  HOH HOH A . 
C 3 HOH 3  403 85  HOH HOH A . 
C 3 HOH 4  404 29  HOH HOH A . 
C 3 HOH 5  405 67  HOH HOH A . 
C 3 HOH 6  406 71  HOH HOH A . 
C 3 HOH 7  407 52  HOH HOH A . 
C 3 HOH 8  408 37  HOH HOH A . 
C 3 HOH 9  409 36  HOH HOH A . 
C 3 HOH 10 410 16  HOH HOH A . 
C 3 HOH 11 411 45  HOH HOH A . 
C 3 HOH 12 412 55  HOH HOH A . 
C 3 HOH 13 413 32  HOH HOH A . 
C 3 HOH 14 414 84  HOH HOH A . 
C 3 HOH 15 415 1   HOH HOH A . 
C 3 HOH 16 416 77  HOH HOH A . 
C 3 HOH 17 417 5   HOH HOH A . 
C 3 HOH 18 418 22  HOH HOH A . 
C 3 HOH 19 419 98  HOH HOH A . 
C 3 HOH 20 420 17  HOH HOH A . 
C 3 HOH 21 421 26  HOH HOH A . 
C 3 HOH 22 422 25  HOH HOH A . 
C 3 HOH 23 423 27  HOH HOH A . 
C 3 HOH 24 424 74  HOH HOH A . 
C 3 HOH 25 425 57  HOH HOH A . 
C 3 HOH 26 426 43  HOH HOH A . 
C 3 HOH 27 427 7   HOH HOH A . 
C 3 HOH 28 428 46  HOH HOH A . 
C 3 HOH 29 429 87  HOH HOH A . 
C 3 HOH 30 430 34  HOH HOH A . 
C 3 HOH 31 431 28  HOH HOH A . 
C 3 HOH 32 432 10  HOH HOH A . 
C 3 HOH 33 433 48  HOH HOH A . 
C 3 HOH 34 434 35  HOH HOH A . 
C 3 HOH 35 435 24  HOH HOH A . 
C 3 HOH 36 436 76  HOH HOH A . 
C 3 HOH 37 437 54  HOH HOH A . 
C 3 HOH 38 438 79  HOH HOH A . 
C 3 HOH 39 439 56  HOH HOH A . 
C 3 HOH 40 440 81  HOH HOH A . 
C 3 HOH 41 441 78  HOH HOH A . 
C 3 HOH 42 442 96  HOH HOH A . 
C 3 HOH 43 443 51  HOH HOH A . 
C 3 HOH 44 444 97  HOH HOH A . 
C 3 HOH 45 445 93  HOH HOH A . 
C 3 HOH 46 446 61  HOH HOH A . 
C 3 HOH 47 447 73  HOH HOH A . 
C 3 HOH 48 448 53  HOH HOH A . 
C 3 HOH 49 449 33  HOH HOH A . 
C 3 HOH 50 450 2   HOH HOH A . 
C 3 HOH 51 451 3   HOH HOH A . 
C 3 HOH 52 452 4   HOH HOH A . 
C 3 HOH 53 453 6   HOH HOH A . 
C 3 HOH 54 454 8   HOH HOH A . 
C 3 HOH 55 455 9   HOH HOH A . 
C 3 HOH 56 456 11  HOH HOH A . 
C 3 HOH 57 457 12  HOH HOH A . 
C 3 HOH 58 458 13  HOH HOH A . 
C 3 HOH 59 459 14  HOH HOH A . 
C 3 HOH 60 460 15  HOH HOH A . 
C 3 HOH 61 461 18  HOH HOH A . 
C 3 HOH 62 462 19  HOH HOH A . 
C 3 HOH 63 463 20  HOH HOH A . 
C 3 HOH 64 464 21  HOH HOH A . 
C 3 HOH 65 465 30  HOH HOH A . 
C 3 HOH 66 466 31  HOH HOH A . 
C 3 HOH 67 467 38  HOH HOH A . 
C 3 HOH 68 468 39  HOH HOH A . 
C 3 HOH 69 469 40  HOH HOH A . 
C 3 HOH 70 470 41  HOH HOH A . 
C 3 HOH 71 471 42  HOH HOH A . 
C 3 HOH 72 472 44  HOH HOH A . 
C 3 HOH 73 473 47  HOH HOH A . 
C 3 HOH 74 474 49  HOH HOH A . 
C 3 HOH 75 475 50  HOH HOH A . 
C 3 HOH 76 476 58  HOH HOH A . 
C 3 HOH 77 477 59  HOH HOH A . 
C 3 HOH 78 478 60  HOH HOH A . 
C 3 HOH 79 479 62  HOH HOH A . 
C 3 HOH 80 480 63  HOH HOH A . 
C 3 HOH 81 481 65  HOH HOH A . 
C 3 HOH 82 482 66  HOH HOH A . 
C 3 HOH 83 483 68  HOH HOH A . 
C 3 HOH 84 484 69  HOH HOH A . 
C 3 HOH 85 485 70  HOH HOH A . 
C 3 HOH 86 486 72  HOH HOH A . 
C 3 HOH 87 487 75  HOH HOH A . 
C 3 HOH 88 488 80  HOH HOH A . 
C 3 HOH 89 489 82  HOH HOH A . 
C 3 HOH 90 490 83  HOH HOH A . 
C 3 HOH 91 491 86  HOH HOH A . 
C 3 HOH 92 492 88  HOH HOH A . 
C 3 HOH 93 493 89  HOH HOH A . 
C 3 HOH 94 494 90  HOH HOH A . 
C 3 HOH 95 495 91  HOH HOH A . 
C 3 HOH 96 496 92  HOH HOH A . 
C 3 HOH 97 497 94  HOH HOH A . 
C 3 HOH 98 498 95  HOH HOH A . 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    A 
_pdbx_struct_mod_residue.label_comp_id    OCS 
_pdbx_struct_mod_residue.label_seq_id     131 
_pdbx_struct_mod_residue.auth_asym_id     A 
_pdbx_struct_mod_residue.auth_comp_id     OCS 
_pdbx_struct_mod_residue.auth_seq_id      113 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   CYS 
_pdbx_struct_mod_residue.details          'modified residue' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_audit_revision_history.ordinal             1 
_pdbx_audit_revision_history.data_content_type   'Structure model' 
_pdbx_audit_revision_history.major_revision      1 
_pdbx_audit_revision_history.minor_revision      0 
_pdbx_audit_revision_history.revision_date       2015-04-08 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_software.citation_id            ? 
_software.classification         refinement 
_software.compiler_name          ? 
_software.compiler_version       ? 
_software.contact_author         ? 
_software.contact_author_email   ? 
_software.date                   ? 
_software.description            ? 
_software.dependencies           ? 
_software.hardware               ? 
_software.language               ? 
_software.location               ? 
_software.mods                   ? 
_software.name                   REFMAC 
_software.os                     ? 
_software.os_version             ? 
_software.type                   ? 
_software.version                5.8.0049 
_software.pdbx_ordinal           1 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE A ARG 17  ? ? CZ A ARG 17  ? ? NH2 A ARG 17  ? ? 117.03 120.30 -3.27 0.50 N 
2 1 NE A ARG 68  ? ? CZ A ARG 68  ? ? NH2 A ARG 68  ? ? 123.56 120.30 3.26  0.50 N 
3 1 C  A ARG 69  ? ? N  A PRO 70  ? ? CA  A PRO 70  ? ? 129.24 119.30 9.94  1.50 Y 
4 1 NE A ARG 80  ? ? CZ A ARG 80  ? ? NH1 A ARG 80  ? ? 124.63 120.30 4.33  0.50 N 
5 1 NE A ARG 80  ? ? CZ A ARG 80  ? ? NH2 A ARG 80  ? ? 115.98 120.30 -4.32 0.50 N 
6 1 CB A ASP 112 ? ? CG A ASP 112 ? ? OD2 A ASP 112 ? ? 123.94 118.30 5.64  0.90 N 
7 1 NE A ARG 119 ? ? CZ A ARG 119 ? ? NH1 A ARG 119 ? ? 123.91 120.30 3.61  0.50 N 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A HIS -17 ? A HIS 1  
2  1 Y 1 A HIS -16 ? A HIS 2  
3  1 Y 1 A HIS -15 ? A HIS 3  
4  1 Y 1 A HIS -14 ? A HIS 4  
5  1 Y 1 A HIS -13 ? A HIS 5  
6  1 Y 1 A HIS -12 ? A HIS 6  
7  1 Y 1 A HIS -11 ? A HIS 7  
8  1 Y 1 A HIS -10 ? A HIS 8  
9  1 Y 1 A GLY -9  ? A GLY 9  
10 1 Y 1 A GLY -8  ? A GLY 10 
11 1 Y 1 A LEU -7  ? A LEU 11 
12 1 Y 1 A VAL -6  ? A VAL 12 
13 1 Y 1 A PRO -5  ? A PRO 13 
14 1 Y 1 A ARG -4  ? A ARG 14 
15 1 Y 1 A GLY -3  ? A GLY 15 
16 1 Y 1 A SER -2  ? A SER 16 
17 1 Y 1 A HIS -1  ? A HIS 17 
18 1 Y 1 A GLY 0   ? A GLY 18 
19 1 Y 1 A MET 1   ? A MET 19 
20 1 Y 1 A ALA 2   ? A ALA 20 
21 1 Y 1 A ASP 3   ? A ASP 21 
22 1 Y 1 A GLU 4   ? A GLU 22 
23 1 Y 1 A GLU 5   ? A GLU 23 
24 1 Y 1 A SER 38  ? A SER 56 
25 1 Y 1 A GLY 39  ? A GLY 57 
26 1 Y 1 A ASN 40  ? A ASN 58 
27 1 Y 1 A SER 41  ? A SER 59 
28 1 Y 1 A SER 42  ? A SER 60 
29 1 Y 1 A SER 43  ? A SER 61 
30 1 Y 1 A GLY 44  ? A GLY 62 
31 1 Y 1 A GLY 45  ? A GLY 63 
32 1 Y 1 A LYS 46  ? A LYS 64 
33 1 Y 1 A ASN 47  ? A ASN 65 
34 1 Y 1 A GLY 48  ? A GLY 66 
35 1 Y 1 A GLN 49  ? A GLN 67 
36 1 Y 1 A GLY 50  ? A GLY 68 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '2-(2-{2-[2-(2-METHOXY-ETHOXY)-ETHOXY]-ETHOXY}-ETHOXY)-ETHANOL' 1PG 
3 water                                                           HOH 
#