data_4UHW
# 
_entry.id   4UHW 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4UHW         
PDBE  EBI-63392    
WWPDB D_1290063392 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          4UHX 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.details        'HUMAN ALDEHYDE OXIDASE IN COMPLEX WITH PHTHALAZINE AND THIORIDAZINE' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4UHW 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2015-03-26 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Coelho, C.'       1 
'Romao, M.J.'      2 
'Santos-Silva, T.' 3 
# 
_citation.id                        primary 
_citation.title                     'Structural Insights Into Xenobiotic and Inhibitor Binding to Human Aldehyde Oxidase' 
_citation.journal_abbrev            Nat.Chem.Biol. 
_citation.journal_volume            11 
_citation.page_first                779 
_citation.page_last                 ? 
_citation.year                      2015 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1552-4450 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   26322824 
_citation.pdbx_database_id_DOI      10.1038/NCHEMBIO.1895 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Coelho, C.'       1 
primary 'Foti, A.'         2 
primary 'Hartmann, T.'     3 
primary 'Santos-Silva, T.' 4 
primary 'Leimkuhler, S.'   5 
primary 'Romao, M.J.'      6 
# 
_cell.entry_id           4UHW 
_cell.length_a           148.930 
_cell.length_b           148.930 
_cell.length_c           133.250 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4UHW 
_symmetry.space_group_name_H-M             'P 42 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                94 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'ALDEHYDE OXIDASE' 148096.500 1  '1.2.3.1, 1.17.3.-' ? ? ? 
2 non-polymer syn 'MALONATE ION' 102.046    2  ?                   ? ? ? 
3 non-polymer syn 'FE2/S2 (INORGANIC) CLUSTER' 175.820    2  ?                   ? ? ? 
4 non-polymer syn 
'PHOSPHONIC ACIDMONO-(2-AMINO-5,6-DIMERCAPTO-4-OXO-3,7,8A,9,10,10A-HEXAHYDRO-4H-8-OXA-1,3,9,10-TETRAAZA-ANTHRACEN-7-YLMETHYL)ESTER' 
395.352    1  ?                   ? ? ? 
5 non-polymer syn 'DIOXOTHIOMOLYBDENUM(VI) ION' 161.012    1  ?                   ? ? ? 
6 non-polymer syn 'FLAVIN-ADENINE DINUCLEOTIDE' 785.550    1  ?                   ? ? ? 
7 water       nat water 18.015     43 ?                   ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'ALDEHYDE OXIDASE 1, AZAHETEROCYCLE HYDROXYLASE' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MDRASELLFYVNGRKVIEKNVDPETMLLPYLRKKLRLTGTKYGCGGGGCGACTVMISRYNPITKRIRHHPANACLIPICS
LYGAAVTTVEGIGSTHTRIHPVQERIAKCHGTQCGFCTPGMVMSIYTLLRNHPEPTLDQLTDALGGNLCRCTGYRPIIDA
CKTFCKTSGCCQSKENGVCCLDQGINGLPEFEEGSKTSPKLFAEEEFLPLDPTQELIFPPELMIMAEKQSQRTRVFGSER
MMWFSPVTLKELLEFKFKYPQAPVIMGNTSVGPEVKFKGVFHPVIISPDRIEELSVVNHAYNGLTLGAGLSLAQVKDILA
DVVQKLPEEKTQMYHALLKHLGTLAGSQIRNMASLGGHIISRHPDSDLNPILAVGNCTLNLLSKEGKRQIPLNEQFLSKC
PNADLKPQEILVSVNIPYSRKWEFVSAFRQAQRQENALAIVNSGMRVFFGEGDGIIRELCISYGGVGPATICAKNSCQKL
IGRHWNEQMLDIACRLILNEVSLLGSAPGGKVEFKRTLIISFLFKFYLEVSQILKKMDPVHYPSLADKYESALEDLHSKH
HCSTLKYQNIGPKQHPEDPIGHPIMHLSGVKHATGEAIYCDDMPLVDQELFLTFVTSSRAHAKIVSIDLSEALSMPGVVD
IMTAEHLSDVNSFCFFTEAEKFLATDKVFCVGQLVCAVLADSEVQAKRAAKRVKIVYQDLEPLILTIEESIQHNSSFKPE
RKLEYGNVDEAFKVVDQILEGEIHMGGQEHFYMETQSMLVVPKGEDQEMDVYVSTQFPKYIQDIVASTLKLPANKVMCHV
RRVGGAFGGKVLKTGIIAAVTAFAANKHGRAVRCVLERGEDMLITGGRHPYLGKYKAGFMNDGRILALDMEHYSNAGASL
DESLFVIEMGLLKMDNAYKFPNLRCRGWACRTNLPSNTAFRGFGFPQAALITESCITEVAAKCGLSPEKVRIINMYKEID
QTPYKQEINAKNLIQCWRECMAMSSYSLRKVAVEKFNAENYWKKKGLAMVPLKFPVGLGSRAAGQAAALVHIYLDGSVLV
THGGIEMGQGVHTKMIQVVSRELRMPMSNVHLRGTSTETVPNANISGGSVVADLNGLAVKDACQTLLKRLEPIISKNPKG
TWKDWAQTAFDESINLSAVGYFRGYESDMNWEKGEGQPFEYFVYGAACSEVEIDCLTGDHKNIRTDIVMDVGCSINPAID
IGQIEGAFIQGMGLYTIEELNYSPQGILHTRGPDQYKIPAICDMPTELHIALLPPSQNSNTLYSSKGLGESGVFLGCSVF
FAIHDAVSAARQERGLHGPLTLNSPLTPEKIRMACEDKFTKMIPRDEPGSYVPWNVPI
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MDRASELLFYVNGRKVIEKNVDPETMLLPYLRKKLRLTGTKYGCGGGGCGACTVMISRYNPITKRIRHHPANACLIPICS
LYGAAVTTVEGIGSTHTRIHPVQERIAKCHGTQCGFCTPGMVMSIYTLLRNHPEPTLDQLTDALGGNLCRCTGYRPIIDA
CKTFCKTSGCCQSKENGVCCLDQGINGLPEFEEGSKTSPKLFAEEEFLPLDPTQELIFPPELMIMAEKQSQRTRVFGSER
MMWFSPVTLKELLEFKFKYPQAPVIMGNTSVGPEVKFKGVFHPVIISPDRIEELSVVNHAYNGLTLGAGLSLAQVKDILA
DVVQKLPEEKTQMYHALLKHLGTLAGSQIRNMASLGGHIISRHPDSDLNPILAVGNCTLNLLSKEGKRQIPLNEQFLSKC
PNADLKPQEILVSVNIPYSRKWEFVSAFRQAQRQENALAIVNSGMRVFFGEGDGIIRELCISYGGVGPATICAKNSCQKL
IGRHWNEQMLDIACRLILNEVSLLGSAPGGKVEFKRTLIISFLFKFYLEVSQILKKMDPVHYPSLADKYESALEDLHSKH
HCSTLKYQNIGPKQHPEDPIGHPIMHLSGVKHATGEAIYCDDMPLVDQELFLTFVTSSRAHAKIVSIDLSEALSMPGVVD
IMTAEHLSDVNSFCFFTEAEKFLATDKVFCVGQLVCAVLADSEVQAKRAAKRVKIVYQDLEPLILTIEESIQHNSSFKPE
RKLEYGNVDEAFKVVDQILEGEIHMGGQEHFYMETQSMLVVPKGEDQEMDVYVSTQFPKYIQDIVASTLKLPANKVMCHV
RRVGGAFGGKVLKTGIIAAVTAFAANKHGRAVRCVLERGEDMLITGGRHPYLGKYKAGFMNDGRILALDMEHYSNAGASL
DESLFVIEMGLLKMDNAYKFPNLRCRGWACRTNLPSNTAFRGFGFPQAALITESCITEVAAKCGLSPEKVRIINMYKEID
QTPYKQEINAKNLIQCWRECMAMSSYSLRKVAVEKFNAENYWKKKGLAMVPLKFPVGLGSRAAGQAAALVHIYLDGSVLV
THGGIEMGQGVHTKMIQVVSRELRMPMSNVHLRGTSTETVPNANISGGSVVADLNGLAVKDACQTLLKRLEPIISKNPKG
TWKDWAQTAFDESINLSAVGYFRGYESDMNWEKGEGQPFEYFVYGAACSEVEIDCLTGDHKNIRTDIVMDVGCSINPAID
IGQIEGAFIQGMGLYTIEELNYSPQGILHTRGPDQYKIPAICDMPTELHIALLPPSQNSNTLYSSKGLGESGVFLGCSVF
FAIHDAVSAARQERGLHGPLTLNSPLTPEKIRMACEDKFTKMIPRDEPGSYVPWNVPI
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    MET n 
1 2    ASP n 
1 3    ARG n 
1 4    ALA n 
1 5    SER n 
1 6    GLU n 
1 7    LEU n 
1 8    LEU n 
1 9    PHE n 
1 10   TYR n 
1 11   VAL n 
1 12   ASN n 
1 13   GLY n 
1 14   ARG n 
1 15   LYS n 
1 16   VAL n 
1 17   ILE n 
1 18   GLU n 
1 19   LYS n 
1 20   ASN n 
1 21   VAL n 
1 22   ASP n 
1 23   PRO n 
1 24   GLU n 
1 25   THR n 
1 26   MET n 
1 27   LEU n 
1 28   LEU n 
1 29   PRO n 
1 30   TYR n 
1 31   LEU n 
1 32   ARG n 
1 33   LYS n 
1 34   LYS n 
1 35   LEU n 
1 36   ARG n 
1 37   LEU n 
1 38   THR n 
1 39   GLY n 
1 40   THR n 
1 41   LYS n 
1 42   TYR n 
1 43   GLY n 
1 44   CYS n 
1 45   GLY n 
1 46   GLY n 
1 47   GLY n 
1 48   GLY n 
1 49   CYS n 
1 50   GLY n 
1 51   ALA n 
1 52   CYS n 
1 53   THR n 
1 54   VAL n 
1 55   MET n 
1 56   ILE n 
1 57   SER n 
1 58   ARG n 
1 59   TYR n 
1 60   ASN n 
1 61   PRO n 
1 62   ILE n 
1 63   THR n 
1 64   LYS n 
1 65   ARG n 
1 66   ILE n 
1 67   ARG n 
1 68   HIS n 
1 69   HIS n 
1 70   PRO n 
1 71   ALA n 
1 72   ASN n 
1 73   ALA n 
1 74   CYS n 
1 75   LEU n 
1 76   ILE n 
1 77   PRO n 
1 78   ILE n 
1 79   CYS n 
1 80   SER n 
1 81   LEU n 
1 82   TYR n 
1 83   GLY n 
1 84   ALA n 
1 85   ALA n 
1 86   VAL n 
1 87   THR n 
1 88   THR n 
1 89   VAL n 
1 90   GLU n 
1 91   GLY n 
1 92   ILE n 
1 93   GLY n 
1 94   SER n 
1 95   THR n 
1 96   HIS n 
1 97   THR n 
1 98   ARG n 
1 99   ILE n 
1 100  HIS n 
1 101  PRO n 
1 102  VAL n 
1 103  GLN n 
1 104  GLU n 
1 105  ARG n 
1 106  ILE n 
1 107  ALA n 
1 108  LYS n 
1 109  CYS n 
1 110  HIS n 
1 111  GLY n 
1 112  THR n 
1 113  GLN n 
1 114  CYS n 
1 115  GLY n 
1 116  PHE n 
1 117  CYS n 
1 118  THR n 
1 119  PRO n 
1 120  GLY n 
1 121  MET n 
1 122  VAL n 
1 123  MET n 
1 124  SER n 
1 125  ILE n 
1 126  TYR n 
1 127  THR n 
1 128  LEU n 
1 129  LEU n 
1 130  ARG n 
1 131  ASN n 
1 132  HIS n 
1 133  PRO n 
1 134  GLU n 
1 135  PRO n 
1 136  THR n 
1 137  LEU n 
1 138  ASP n 
1 139  GLN n 
1 140  LEU n 
1 141  THR n 
1 142  ASP n 
1 143  ALA n 
1 144  LEU n 
1 145  GLY n 
1 146  GLY n 
1 147  ASN n 
1 148  LEU n 
1 149  CYS n 
1 150  ARG n 
1 151  CYS n 
1 152  THR n 
1 153  GLY n 
1 154  TYR n 
1 155  ARG n 
1 156  PRO n 
1 157  ILE n 
1 158  ILE n 
1 159  ASP n 
1 160  ALA n 
1 161  CYS n 
1 162  LYS n 
1 163  THR n 
1 164  PHE n 
1 165  CYS n 
1 166  LYS n 
1 167  THR n 
1 168  SER n 
1 169  GLY n 
1 170  CYS n 
1 171  CYS n 
1 172  GLN n 
1 173  SER n 
1 174  LYS n 
1 175  GLU n 
1 176  ASN n 
1 177  GLY n 
1 178  VAL n 
1 179  CYS n 
1 180  CYS n 
1 181  LEU n 
1 182  ASP n 
1 183  GLN n 
1 184  GLY n 
1 185  ILE n 
1 186  ASN n 
1 187  GLY n 
1 188  LEU n 
1 189  PRO n 
1 190  GLU n 
1 191  PHE n 
1 192  GLU n 
1 193  GLU n 
1 194  GLY n 
1 195  SER n 
1 196  LYS n 
1 197  THR n 
1 198  SER n 
1 199  PRO n 
1 200  LYS n 
1 201  LEU n 
1 202  PHE n 
1 203  ALA n 
1 204  GLU n 
1 205  GLU n 
1 206  GLU n 
1 207  PHE n 
1 208  LEU n 
1 209  PRO n 
1 210  LEU n 
1 211  ASP n 
1 212  PRO n 
1 213  THR n 
1 214  GLN n 
1 215  GLU n 
1 216  LEU n 
1 217  ILE n 
1 218  PHE n 
1 219  PRO n 
1 220  PRO n 
1 221  GLU n 
1 222  LEU n 
1 223  MET n 
1 224  ILE n 
1 225  MET n 
1 226  ALA n 
1 227  GLU n 
1 228  LYS n 
1 229  GLN n 
1 230  SER n 
1 231  GLN n 
1 232  ARG n 
1 233  THR n 
1 234  ARG n 
1 235  VAL n 
1 236  PHE n 
1 237  GLY n 
1 238  SER n 
1 239  GLU n 
1 240  ARG n 
1 241  MET n 
1 242  MET n 
1 243  TRP n 
1 244  PHE n 
1 245  SER n 
1 246  PRO n 
1 247  VAL n 
1 248  THR n 
1 249  LEU n 
1 250  LYS n 
1 251  GLU n 
1 252  LEU n 
1 253  LEU n 
1 254  GLU n 
1 255  PHE n 
1 256  LYS n 
1 257  PHE n 
1 258  LYS n 
1 259  TYR n 
1 260  PRO n 
1 261  GLN n 
1 262  ALA n 
1 263  PRO n 
1 264  VAL n 
1 265  ILE n 
1 266  MET n 
1 267  GLY n 
1 268  ASN n 
1 269  THR n 
1 270  SER n 
1 271  VAL n 
1 272  GLY n 
1 273  PRO n 
1 274  GLU n 
1 275  VAL n 
1 276  LYS n 
1 277  PHE n 
1 278  LYS n 
1 279  GLY n 
1 280  VAL n 
1 281  PHE n 
1 282  HIS n 
1 283  PRO n 
1 284  VAL n 
1 285  ILE n 
1 286  ILE n 
1 287  SER n 
1 288  PRO n 
1 289  ASP n 
1 290  ARG n 
1 291  ILE n 
1 292  GLU n 
1 293  GLU n 
1 294  LEU n 
1 295  SER n 
1 296  VAL n 
1 297  VAL n 
1 298  ASN n 
1 299  HIS n 
1 300  ALA n 
1 301  TYR n 
1 302  ASN n 
1 303  GLY n 
1 304  LEU n 
1 305  THR n 
1 306  LEU n 
1 307  GLY n 
1 308  ALA n 
1 309  GLY n 
1 310  LEU n 
1 311  SER n 
1 312  LEU n 
1 313  ALA n 
1 314  GLN n 
1 315  VAL n 
1 316  LYS n 
1 317  ASP n 
1 318  ILE n 
1 319  LEU n 
1 320  ALA n 
1 321  ASP n 
1 322  VAL n 
1 323  VAL n 
1 324  GLN n 
1 325  LYS n 
1 326  LEU n 
1 327  PRO n 
1 328  GLU n 
1 329  GLU n 
1 330  LYS n 
1 331  THR n 
1 332  GLN n 
1 333  MET n 
1 334  TYR n 
1 335  HIS n 
1 336  ALA n 
1 337  LEU n 
1 338  LEU n 
1 339  LYS n 
1 340  HIS n 
1 341  LEU n 
1 342  GLY n 
1 343  THR n 
1 344  LEU n 
1 345  ALA n 
1 346  GLY n 
1 347  SER n 
1 348  GLN n 
1 349  ILE n 
1 350  ARG n 
1 351  ASN n 
1 352  MET n 
1 353  ALA n 
1 354  SER n 
1 355  LEU n 
1 356  GLY n 
1 357  GLY n 
1 358  HIS n 
1 359  ILE n 
1 360  ILE n 
1 361  SER n 
1 362  ARG n 
1 363  HIS n 
1 364  PRO n 
1 365  ASP n 
1 366  SER n 
1 367  ASP n 
1 368  LEU n 
1 369  ASN n 
1 370  PRO n 
1 371  ILE n 
1 372  LEU n 
1 373  ALA n 
1 374  VAL n 
1 375  GLY n 
1 376  ASN n 
1 377  CYS n 
1 378  THR n 
1 379  LEU n 
1 380  ASN n 
1 381  LEU n 
1 382  LEU n 
1 383  SER n 
1 384  LYS n 
1 385  GLU n 
1 386  GLY n 
1 387  LYS n 
1 388  ARG n 
1 389  GLN n 
1 390  ILE n 
1 391  PRO n 
1 392  LEU n 
1 393  ASN n 
1 394  GLU n 
1 395  GLN n 
1 396  PHE n 
1 397  LEU n 
1 398  SER n 
1 399  LYS n 
1 400  CYS n 
1 401  PRO n 
1 402  ASN n 
1 403  ALA n 
1 404  ASP n 
1 405  LEU n 
1 406  LYS n 
1 407  PRO n 
1 408  GLN n 
1 409  GLU n 
1 410  ILE n 
1 411  LEU n 
1 412  VAL n 
1 413  SER n 
1 414  VAL n 
1 415  ASN n 
1 416  ILE n 
1 417  PRO n 
1 418  TYR n 
1 419  SER n 
1 420  ARG n 
1 421  LYS n 
1 422  TRP n 
1 423  GLU n 
1 424  PHE n 
1 425  VAL n 
1 426  SER n 
1 427  ALA n 
1 428  PHE n 
1 429  ARG n 
1 430  GLN n 
1 431  ALA n 
1 432  GLN n 
1 433  ARG n 
1 434  GLN n 
1 435  GLU n 
1 436  ASN n 
1 437  ALA n 
1 438  LEU n 
1 439  ALA n 
1 440  ILE n 
1 441  VAL n 
1 442  ASN n 
1 443  SER n 
1 444  GLY n 
1 445  MET n 
1 446  ARG n 
1 447  VAL n 
1 448  PHE n 
1 449  PHE n 
1 450  GLY n 
1 451  GLU n 
1 452  GLY n 
1 453  ASP n 
1 454  GLY n 
1 455  ILE n 
1 456  ILE n 
1 457  ARG n 
1 458  GLU n 
1 459  LEU n 
1 460  CYS n 
1 461  ILE n 
1 462  SER n 
1 463  TYR n 
1 464  GLY n 
1 465  GLY n 
1 466  VAL n 
1 467  GLY n 
1 468  PRO n 
1 469  ALA n 
1 470  THR n 
1 471  ILE n 
1 472  CYS n 
1 473  ALA n 
1 474  LYS n 
1 475  ASN n 
1 476  SER n 
1 477  CYS n 
1 478  GLN n 
1 479  LYS n 
1 480  LEU n 
1 481  ILE n 
1 482  GLY n 
1 483  ARG n 
1 484  HIS n 
1 485  TRP n 
1 486  ASN n 
1 487  GLU n 
1 488  GLN n 
1 489  MET n 
1 490  LEU n 
1 491  ASP n 
1 492  ILE n 
1 493  ALA n 
1 494  CYS n 
1 495  ARG n 
1 496  LEU n 
1 497  ILE n 
1 498  LEU n 
1 499  ASN n 
1 500  GLU n 
1 501  VAL n 
1 502  SER n 
1 503  LEU n 
1 504  LEU n 
1 505  GLY n 
1 506  SER n 
1 507  ALA n 
1 508  PRO n 
1 509  GLY n 
1 510  GLY n 
1 511  LYS n 
1 512  VAL n 
1 513  GLU n 
1 514  PHE n 
1 515  LYS n 
1 516  ARG n 
1 517  THR n 
1 518  LEU n 
1 519  ILE n 
1 520  ILE n 
1 521  SER n 
1 522  PHE n 
1 523  LEU n 
1 524  PHE n 
1 525  LYS n 
1 526  PHE n 
1 527  TYR n 
1 528  LEU n 
1 529  GLU n 
1 530  VAL n 
1 531  SER n 
1 532  GLN n 
1 533  ILE n 
1 534  LEU n 
1 535  LYS n 
1 536  LYS n 
1 537  MET n 
1 538  ASP n 
1 539  PRO n 
1 540  VAL n 
1 541  HIS n 
1 542  TYR n 
1 543  PRO n 
1 544  SER n 
1 545  LEU n 
1 546  ALA n 
1 547  ASP n 
1 548  LYS n 
1 549  TYR n 
1 550  GLU n 
1 551  SER n 
1 552  ALA n 
1 553  LEU n 
1 554  GLU n 
1 555  ASP n 
1 556  LEU n 
1 557  HIS n 
1 558  SER n 
1 559  LYS n 
1 560  HIS n 
1 561  HIS n 
1 562  CYS n 
1 563  SER n 
1 564  THR n 
1 565  LEU n 
1 566  LYS n 
1 567  TYR n 
1 568  GLN n 
1 569  ASN n 
1 570  ILE n 
1 571  GLY n 
1 572  PRO n 
1 573  LYS n 
1 574  GLN n 
1 575  HIS n 
1 576  PRO n 
1 577  GLU n 
1 578  ASP n 
1 579  PRO n 
1 580  ILE n 
1 581  GLY n 
1 582  HIS n 
1 583  PRO n 
1 584  ILE n 
1 585  MET n 
1 586  HIS n 
1 587  LEU n 
1 588  SER n 
1 589  GLY n 
1 590  VAL n 
1 591  LYS n 
1 592  HIS n 
1 593  ALA n 
1 594  THR n 
1 595  GLY n 
1 596  GLU n 
1 597  ALA n 
1 598  ILE n 
1 599  TYR n 
1 600  CYS n 
1 601  ASP n 
1 602  ASP n 
1 603  MET n 
1 604  PRO n 
1 605  LEU n 
1 606  VAL n 
1 607  ASP n 
1 608  GLN n 
1 609  GLU n 
1 610  LEU n 
1 611  PHE n 
1 612  LEU n 
1 613  THR n 
1 614  PHE n 
1 615  VAL n 
1 616  THR n 
1 617  SER n 
1 618  SER n 
1 619  ARG n 
1 620  ALA n 
1 621  HIS n 
1 622  ALA n 
1 623  LYS n 
1 624  ILE n 
1 625  VAL n 
1 626  SER n 
1 627  ILE n 
1 628  ASP n 
1 629  LEU n 
1 630  SER n 
1 631  GLU n 
1 632  ALA n 
1 633  LEU n 
1 634  SER n 
1 635  MET n 
1 636  PRO n 
1 637  GLY n 
1 638  VAL n 
1 639  VAL n 
1 640  ASP n 
1 641  ILE n 
1 642  MET n 
1 643  THR n 
1 644  ALA n 
1 645  GLU n 
1 646  HIS n 
1 647  LEU n 
1 648  SER n 
1 649  ASP n 
1 650  VAL n 
1 651  ASN n 
1 652  SER n 
1 653  PHE n 
1 654  CYS n 
1 655  PHE n 
1 656  PHE n 
1 657  THR n 
1 658  GLU n 
1 659  ALA n 
1 660  GLU n 
1 661  LYS n 
1 662  PHE n 
1 663  LEU n 
1 664  ALA n 
1 665  THR n 
1 666  ASP n 
1 667  LYS n 
1 668  VAL n 
1 669  PHE n 
1 670  CYS n 
1 671  VAL n 
1 672  GLY n 
1 673  GLN n 
1 674  LEU n 
1 675  VAL n 
1 676  CYS n 
1 677  ALA n 
1 678  VAL n 
1 679  LEU n 
1 680  ALA n 
1 681  ASP n 
1 682  SER n 
1 683  GLU n 
1 684  VAL n 
1 685  GLN n 
1 686  ALA n 
1 687  LYS n 
1 688  ARG n 
1 689  ALA n 
1 690  ALA n 
1 691  LYS n 
1 692  ARG n 
1 693  VAL n 
1 694  LYS n 
1 695  ILE n 
1 696  VAL n 
1 697  TYR n 
1 698  GLN n 
1 699  ASP n 
1 700  LEU n 
1 701  GLU n 
1 702  PRO n 
1 703  LEU n 
1 704  ILE n 
1 705  LEU n 
1 706  THR n 
1 707  ILE n 
1 708  GLU n 
1 709  GLU n 
1 710  SER n 
1 711  ILE n 
1 712  GLN n 
1 713  HIS n 
1 714  ASN n 
1 715  SER n 
1 716  SER n 
1 717  PHE n 
1 718  LYS n 
1 719  PRO n 
1 720  GLU n 
1 721  ARG n 
1 722  LYS n 
1 723  LEU n 
1 724  GLU n 
1 725  TYR n 
1 726  GLY n 
1 727  ASN n 
1 728  VAL n 
1 729  ASP n 
1 730  GLU n 
1 731  ALA n 
1 732  PHE n 
1 733  LYS n 
1 734  VAL n 
1 735  VAL n 
1 736  ASP n 
1 737  GLN n 
1 738  ILE n 
1 739  LEU n 
1 740  GLU n 
1 741  GLY n 
1 742  GLU n 
1 743  ILE n 
1 744  HIS n 
1 745  MET n 
1 746  GLY n 
1 747  GLY n 
1 748  GLN n 
1 749  GLU n 
1 750  HIS n 
1 751  PHE n 
1 752  TYR n 
1 753  MET n 
1 754  GLU n 
1 755  THR n 
1 756  GLN n 
1 757  SER n 
1 758  MET n 
1 759  LEU n 
1 760  VAL n 
1 761  VAL n 
1 762  PRO n 
1 763  LYS n 
1 764  GLY n 
1 765  GLU n 
1 766  ASP n 
1 767  GLN n 
1 768  GLU n 
1 769  MET n 
1 770  ASP n 
1 771  VAL n 
1 772  TYR n 
1 773  VAL n 
1 774  SER n 
1 775  THR n 
1 776  GLN n 
1 777  PHE n 
1 778  PRO n 
1 779  LYS n 
1 780  TYR n 
1 781  ILE n 
1 782  GLN n 
1 783  ASP n 
1 784  ILE n 
1 785  VAL n 
1 786  ALA n 
1 787  SER n 
1 788  THR n 
1 789  LEU n 
1 790  LYS n 
1 791  LEU n 
1 792  PRO n 
1 793  ALA n 
1 794  ASN n 
1 795  LYS n 
1 796  VAL n 
1 797  MET n 
1 798  CYS n 
1 799  HIS n 
1 800  VAL n 
1 801  ARG n 
1 802  ARG n 
1 803  VAL n 
1 804  GLY n 
1 805  GLY n 
1 806  ALA n 
1 807  PHE n 
1 808  GLY n 
1 809  GLY n 
1 810  LYS n 
1 811  VAL n 
1 812  LEU n 
1 813  LYS n 
1 814  THR n 
1 815  GLY n 
1 816  ILE n 
1 817  ILE n 
1 818  ALA n 
1 819  ALA n 
1 820  VAL n 
1 821  THR n 
1 822  ALA n 
1 823  PHE n 
1 824  ALA n 
1 825  ALA n 
1 826  ASN n 
1 827  LYS n 
1 828  HIS n 
1 829  GLY n 
1 830  ARG n 
1 831  ALA n 
1 832  VAL n 
1 833  ARG n 
1 834  CYS n 
1 835  VAL n 
1 836  LEU n 
1 837  GLU n 
1 838  ARG n 
1 839  GLY n 
1 840  GLU n 
1 841  ASP n 
1 842  MET n 
1 843  LEU n 
1 844  ILE n 
1 845  THR n 
1 846  GLY n 
1 847  GLY n 
1 848  ARG n 
1 849  HIS n 
1 850  PRO n 
1 851  TYR n 
1 852  LEU n 
1 853  GLY n 
1 854  LYS n 
1 855  TYR n 
1 856  LYS n 
1 857  ALA n 
1 858  GLY n 
1 859  PHE n 
1 860  MET n 
1 861  ASN n 
1 862  ASP n 
1 863  GLY n 
1 864  ARG n 
1 865  ILE n 
1 866  LEU n 
1 867  ALA n 
1 868  LEU n 
1 869  ASP n 
1 870  MET n 
1 871  GLU n 
1 872  HIS n 
1 873  TYR n 
1 874  SER n 
1 875  ASN n 
1 876  ALA n 
1 877  GLY n 
1 878  ALA n 
1 879  SER n 
1 880  LEU n 
1 881  ASP n 
1 882  GLU n 
1 883  SER n 
1 884  LEU n 
1 885  PHE n 
1 886  VAL n 
1 887  ILE n 
1 888  GLU n 
1 889  MET n 
1 890  GLY n 
1 891  LEU n 
1 892  LEU n 
1 893  LYS n 
1 894  MET n 
1 895  ASP n 
1 896  ASN n 
1 897  ALA n 
1 898  TYR n 
1 899  LYS n 
1 900  PHE n 
1 901  PRO n 
1 902  ASN n 
1 903  LEU n 
1 904  ARG n 
1 905  CYS n 
1 906  ARG n 
1 907  GLY n 
1 908  TRP n 
1 909  ALA n 
1 910  CYS n 
1 911  ARG n 
1 912  THR n 
1 913  ASN n 
1 914  LEU n 
1 915  PRO n 
1 916  SER n 
1 917  ASN n 
1 918  THR n 
1 919  ALA n 
1 920  PHE n 
1 921  ARG n 
1 922  GLY n 
1 923  PHE n 
1 924  GLY n 
1 925  PHE n 
1 926  PRO n 
1 927  GLN n 
1 928  ALA n 
1 929  ALA n 
1 930  LEU n 
1 931  ILE n 
1 932  THR n 
1 933  GLU n 
1 934  SER n 
1 935  CYS n 
1 936  ILE n 
1 937  THR n 
1 938  GLU n 
1 939  VAL n 
1 940  ALA n 
1 941  ALA n 
1 942  LYS n 
1 943  CYS n 
1 944  GLY n 
1 945  LEU n 
1 946  SER n 
1 947  PRO n 
1 948  GLU n 
1 949  LYS n 
1 950  VAL n 
1 951  ARG n 
1 952  ILE n 
1 953  ILE n 
1 954  ASN n 
1 955  MET n 
1 956  TYR n 
1 957  LYS n 
1 958  GLU n 
1 959  ILE n 
1 960  ASP n 
1 961  GLN n 
1 962  THR n 
1 963  PRO n 
1 964  TYR n 
1 965  LYS n 
1 966  GLN n 
1 967  GLU n 
1 968  ILE n 
1 969  ASN n 
1 970  ALA n 
1 971  LYS n 
1 972  ASN n 
1 973  LEU n 
1 974  ILE n 
1 975  GLN n 
1 976  CYS n 
1 977  TRP n 
1 978  ARG n 
1 979  GLU n 
1 980  CYS n 
1 981  MET n 
1 982  ALA n 
1 983  MET n 
1 984  SER n 
1 985  SER n 
1 986  TYR n 
1 987  SER n 
1 988  LEU n 
1 989  ARG n 
1 990  LYS n 
1 991  VAL n 
1 992  ALA n 
1 993  VAL n 
1 994  GLU n 
1 995  LYS n 
1 996  PHE n 
1 997  ASN n 
1 998  ALA n 
1 999  GLU n 
1 1000 ASN n 
1 1001 TYR n 
1 1002 TRP n 
1 1003 LYS n 
1 1004 LYS n 
1 1005 LYS n 
1 1006 GLY n 
1 1007 LEU n 
1 1008 ALA n 
1 1009 MET n 
1 1010 VAL n 
1 1011 PRO n 
1 1012 LEU n 
1 1013 LYS n 
1 1014 PHE n 
1 1015 PRO n 
1 1016 VAL n 
1 1017 GLY n 
1 1018 LEU n 
1 1019 GLY n 
1 1020 SER n 
1 1021 ARG n 
1 1022 ALA n 
1 1023 ALA n 
1 1024 GLY n 
1 1025 GLN n 
1 1026 ALA n 
1 1027 ALA n 
1 1028 ALA n 
1 1029 LEU n 
1 1030 VAL n 
1 1031 HIS n 
1 1032 ILE n 
1 1033 TYR n 
1 1034 LEU n 
1 1035 ASP n 
1 1036 GLY n 
1 1037 SER n 
1 1038 VAL n 
1 1039 LEU n 
1 1040 VAL n 
1 1041 THR n 
1 1042 HIS n 
1 1043 GLY n 
1 1044 GLY n 
1 1045 ILE n 
1 1046 GLU n 
1 1047 MET n 
1 1048 GLY n 
1 1049 GLN n 
1 1050 GLY n 
1 1051 VAL n 
1 1052 HIS n 
1 1053 THR n 
1 1054 LYS n 
1 1055 MET n 
1 1056 ILE n 
1 1057 GLN n 
1 1058 VAL n 
1 1059 VAL n 
1 1060 SER n 
1 1061 ARG n 
1 1062 GLU n 
1 1063 LEU n 
1 1064 ARG n 
1 1065 MET n 
1 1066 PRO n 
1 1067 MET n 
1 1068 SER n 
1 1069 ASN n 
1 1070 VAL n 
1 1071 HIS n 
1 1072 LEU n 
1 1073 ARG n 
1 1074 GLY n 
1 1075 THR n 
1 1076 SER n 
1 1077 THR n 
1 1078 GLU n 
1 1079 THR n 
1 1080 VAL n 
1 1081 PRO n 
1 1082 ASN n 
1 1083 ALA n 
1 1084 ASN n 
1 1085 ILE n 
1 1086 SER n 
1 1087 GLY n 
1 1088 GLY n 
1 1089 SER n 
1 1090 VAL n 
1 1091 VAL n 
1 1092 ALA n 
1 1093 ASP n 
1 1094 LEU n 
1 1095 ASN n 
1 1096 GLY n 
1 1097 LEU n 
1 1098 ALA n 
1 1099 VAL n 
1 1100 LYS n 
1 1101 ASP n 
1 1102 ALA n 
1 1103 CYS n 
1 1104 GLN n 
1 1105 THR n 
1 1106 LEU n 
1 1107 LEU n 
1 1108 LYS n 
1 1109 ARG n 
1 1110 LEU n 
1 1111 GLU n 
1 1112 PRO n 
1 1113 ILE n 
1 1114 ILE n 
1 1115 SER n 
1 1116 LYS n 
1 1117 ASN n 
1 1118 PRO n 
1 1119 LYS n 
1 1120 GLY n 
1 1121 THR n 
1 1122 TRP n 
1 1123 LYS n 
1 1124 ASP n 
1 1125 TRP n 
1 1126 ALA n 
1 1127 GLN n 
1 1128 THR n 
1 1129 ALA n 
1 1130 PHE n 
1 1131 ASP n 
1 1132 GLU n 
1 1133 SER n 
1 1134 ILE n 
1 1135 ASN n 
1 1136 LEU n 
1 1137 SER n 
1 1138 ALA n 
1 1139 VAL n 
1 1140 GLY n 
1 1141 TYR n 
1 1142 PHE n 
1 1143 ARG n 
1 1144 GLY n 
1 1145 TYR n 
1 1146 GLU n 
1 1147 SER n 
1 1148 ASP n 
1 1149 MET n 
1 1150 ASN n 
1 1151 TRP n 
1 1152 GLU n 
1 1153 LYS n 
1 1154 GLY n 
1 1155 GLU n 
1 1156 GLY n 
1 1157 GLN n 
1 1158 PRO n 
1 1159 PHE n 
1 1160 GLU n 
1 1161 TYR n 
1 1162 PHE n 
1 1163 VAL n 
1 1164 TYR n 
1 1165 GLY n 
1 1166 ALA n 
1 1167 ALA n 
1 1168 CYS n 
1 1169 SER n 
1 1170 GLU n 
1 1171 VAL n 
1 1172 GLU n 
1 1173 ILE n 
1 1174 ASP n 
1 1175 CYS n 
1 1176 LEU n 
1 1177 THR n 
1 1178 GLY n 
1 1179 ASP n 
1 1180 HIS n 
1 1181 LYS n 
1 1182 ASN n 
1 1183 ILE n 
1 1184 ARG n 
1 1185 THR n 
1 1186 ASP n 
1 1187 ILE n 
1 1188 VAL n 
1 1189 MET n 
1 1190 ASP n 
1 1191 VAL n 
1 1192 GLY n 
1 1193 CYS n 
1 1194 SER n 
1 1195 ILE n 
1 1196 ASN n 
1 1197 PRO n 
1 1198 ALA n 
1 1199 ILE n 
1 1200 ASP n 
1 1201 ILE n 
1 1202 GLY n 
1 1203 GLN n 
1 1204 ILE n 
1 1205 GLU n 
1 1206 GLY n 
1 1207 ALA n 
1 1208 PHE n 
1 1209 ILE n 
1 1210 GLN n 
1 1211 GLY n 
1 1212 MET n 
1 1213 GLY n 
1 1214 LEU n 
1 1215 TYR n 
1 1216 THR n 
1 1217 ILE n 
1 1218 GLU n 
1 1219 GLU n 
1 1220 LEU n 
1 1221 ASN n 
1 1222 TYR n 
1 1223 SER n 
1 1224 PRO n 
1 1225 GLN n 
1 1226 GLY n 
1 1227 ILE n 
1 1228 LEU n 
1 1229 HIS n 
1 1230 THR n 
1 1231 ARG n 
1 1232 GLY n 
1 1233 PRO n 
1 1234 ASP n 
1 1235 GLN n 
1 1236 TYR n 
1 1237 LYS n 
1 1238 ILE n 
1 1239 PRO n 
1 1240 ALA n 
1 1241 ILE n 
1 1242 CYS n 
1 1243 ASP n 
1 1244 MET n 
1 1245 PRO n 
1 1246 THR n 
1 1247 GLU n 
1 1248 LEU n 
1 1249 HIS n 
1 1250 ILE n 
1 1251 ALA n 
1 1252 LEU n 
1 1253 LEU n 
1 1254 PRO n 
1 1255 PRO n 
1 1256 SER n 
1 1257 GLN n 
1 1258 ASN n 
1 1259 SER n 
1 1260 ASN n 
1 1261 THR n 
1 1262 LEU n 
1 1263 TYR n 
1 1264 SER n 
1 1265 SER n 
1 1266 LYS n 
1 1267 GLY n 
1 1268 LEU n 
1 1269 GLY n 
1 1270 GLU n 
1 1271 SER n 
1 1272 GLY n 
1 1273 VAL n 
1 1274 PHE n 
1 1275 LEU n 
1 1276 GLY n 
1 1277 CYS n 
1 1278 SER n 
1 1279 VAL n 
1 1280 PHE n 
1 1281 PHE n 
1 1282 ALA n 
1 1283 ILE n 
1 1284 HIS n 
1 1285 ASP n 
1 1286 ALA n 
1 1287 VAL n 
1 1288 SER n 
1 1289 ALA n 
1 1290 ALA n 
1 1291 ARG n 
1 1292 GLN n 
1 1293 GLU n 
1 1294 ARG n 
1 1295 GLY n 
1 1296 LEU n 
1 1297 HIS n 
1 1298 GLY n 
1 1299 PRO n 
1 1300 LEU n 
1 1301 THR n 
1 1302 LEU n 
1 1303 ASN n 
1 1304 SER n 
1 1305 PRO n 
1 1306 LEU n 
1 1307 THR n 
1 1308 PRO n 
1 1309 GLU n 
1 1310 LYS n 
1 1311 ILE n 
1 1312 ARG n 
1 1313 MET n 
1 1314 ALA n 
1 1315 CYS n 
1 1316 GLU n 
1 1317 ASP n 
1 1318 LYS n 
1 1319 PHE n 
1 1320 THR n 
1 1321 LYS n 
1 1322 MET n 
1 1323 ILE n 
1 1324 PRO n 
1 1325 ARG n 
1 1326 ASP n 
1 1327 GLU n 
1 1328 PRO n 
1 1329 GLY n 
1 1330 SER n 
1 1331 TYR n 
1 1332 VAL n 
1 1333 PRO n 
1 1334 TRP n 
1 1335 ASN n 
1 1336 VAL n 
1 1337 PRO n 
1 1338 ILE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                LIVER 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               TP1000 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    AOXA_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          Q06278 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              4UHW 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 1338 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q06278 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  1338 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       1338 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2'         89.093  
ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1'     175.209 
ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3'        132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'         133.103 
CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S'       121.158 
FAD non-polymer         . 'FLAVIN-ADENINE DINUCLEOTIDE' ? 'C27 H33 N9 O15 P2'  785.550 
FES non-polymer         . 'FE2/S2 (INORGANIC) CLUSTER' ? 'Fe2 S2'             175.820 
GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3'       146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'         147.129 
GLY 'peptide linking'   y GLYCINE ? 'C2 H5 N O2'         75.067  
HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1'     156.162 
HOH non-polymer         . WATER ? 'H2 O'               18.015  
ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2'        131.173 
LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2'        131.173 
LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1'     147.195 
MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S'      149.211 
MLI non-polymer         . 'MALONATE ION' ? 'C3 H2 O4 -2'        102.046 
MOS non-polymer         . 'DIOXOTHIOMOLYBDENUM(VI) ION' ? 'H Mo O2 S'          161.012 
MTE non-polymer         . 
'PHOSPHONIC ACIDMONO-(2-AMINO-5,6-DIMERCAPTO-4-OXO-3,7,8A,9,10,10A-HEXAHYDRO-4H-8-OXA-1,3,9,10-TETRAAZA-ANTHRACEN-7-YLMETHYL)ESTER' 
? 'C10 H14 N5 O6 P S2' 395.352 
PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2'        165.189 
PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2'         115.130 
SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3'         105.093 
THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3'         119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2'      204.225 
TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3'        181.189 
VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2'        117.146 
# 
_exptl.entry_id          4UHW 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.46 
_exptl_crystal.density_percent_sol   50.1 
_exptl_crystal.description           NONE 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'DECTRIS PILATUS 6M' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'DIAMOND BEAMLINE I02' 
_diffrn_source.pdbx_synchrotron_site       Diamond 
_diffrn_source.pdbx_synchrotron_beamline   I02 
_diffrn_source.pdbx_wavelength             0.9 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4UHW 
_reflns.observed_criterion_sigma_I   1.5 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             74.46 
_reflns.d_resolution_high            2.60 
_reflns.number_obs                   46600 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         100.0 
_reflns.pdbx_Rmerge_I_obs            0.26 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        11.20 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              16.5 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.60 
_reflns_shell.d_res_low              2.69 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           1.18 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.50 
_reflns_shell.pdbx_redundancy        15.8 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4UHW 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     44241 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             105.31 
_refine.ls_d_res_high                            2.60 
_refine.ls_percent_reflns_obs                    99.97 
_refine.ls_R_factor_obs                          0.19099 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.18875 
_refine.ls_R_factor_R_free                       0.23300 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  2359 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.959 
_refine.correlation_coeff_Fo_to_Fc_free          0.938 
_refine.B_iso_mean                               75.477 
_refine.aniso_B[1][1]                            0.11 
_refine.aniso_B[2][2]                            0.11 
_refine.aniso_B[3][3]                            -0.22 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.00 
_refine.pdbx_solvent_ion_probe_radii             0.70 
_refine.pdbx_solvent_shrinkage_radii             0.70 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 3ZYV' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.826 
_refine.pdbx_overall_ESU_R_Free                  0.295 
_refine.overall_SU_ML                            0.268 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             28.157 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        9988 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         103 
_refine_hist.number_atoms_solvent             43 
_refine_hist.number_atoms_total               10134 
_refine_hist.d_res_high                       2.60 
_refine_hist.d_res_low                        105.31 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.008  0.019  ? 10304 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.002  0.020  ? 9925  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.286  1.979  ? 13937 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            0.897  3.000  ? 22901 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.206  5.000  ? 1281  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       35.827 24.182 ? 428   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       14.142 15.000 ? 1800  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       15.574 15.000 ? 56    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.071  0.200  ? 1554  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.004  0.021  ? 11511 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001  0.020  ? 2273  'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  1.122  4.624  ? 5145  'X-RAY DIFFRACTION' ? 
r_mcbond_other               1.122  4.624  ? 5144  'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.957  6.930  ? 6419  'X-RAY DIFFRACTION' ? 
r_mcangle_other              1.957  6.930  ? 6420  'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.169  4.828  ? 5159  'X-RAY DIFFRACTION' ? 
r_scbond_other               1.169  4.828  ? 5157  'X-RAY DIFFRACTION' ? 
r_scangle_it                 ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scangle_other              2.009  7.180  ? 7514  'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       3.713  36.875 ? 11123 'X-RAY DIFFRACTION' ? 
r_long_range_B_other         3.707  36.868 ? 11118 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.600 
_refine_ls_shell.d_res_low                        2.668 
_refine_ls_shell.number_reflns_R_work             3221 
_refine_ls_shell.R_factor_R_work                  0.339 
_refine_ls_shell.percent_reflns_obs               99.91 
_refine_ls_shell.R_factor_R_free                  0.361 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             160 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  4UHW 
_struct.title                     'Human aldehyde oxidase' 
_struct.pdbx_descriptor           'ALDEHYDE OXIDASE (E.C.1.2.3.1, 1.17.3.-)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4UHW 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            'OXIDOREDUCTASE, DRUG METABOLISM, MOLYBDENUM ENZYMES, XANTHINE OXIDASE ENZYMES' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
F N N 4 ? 
G N N 5 ? 
H N N 6 ? 
I N N 7 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  MET A 26   ? LYS A 34   ? MET A 26   LYS A 34   1 ? 9  
HELX_P HELX_P2  2  CYS A 74   ? ILE A 76   ? CYS A 74   ILE A 76   5 ? 3  
HELX_P HELX_P3  3  ILE A 78   ? TYR A 82   ? ILE A 78   TYR A 82   5 ? 5  
HELX_P HELX_P4  4  THR A 88   ? GLY A 93   ? THR A 88   GLY A 93   1 ? 6  
HELX_P HELX_P5  5  HIS A 100  ? CYS A 109  ? HIS A 100  CYS A 109  1 ? 10 
HELX_P HELX_P6  6  CYS A 117  ? HIS A 132  ? CYS A 117  HIS A 132  1 ? 16 
HELX_P HELX_P7  7  THR A 136  ? LEU A 144  ? THR A 136  LEU A 144  1 ? 9  
HELX_P HELX_P8  8  GLY A 145  ? ASN A 147  ? GLY A 145  ASN A 147  5 ? 3  
HELX_P HELX_P9  9  TYR A 154  ? THR A 163  ? TYR A 154  THR A 163  1 ? 10 
HELX_P HELX_P10 10 ALA A 203  ? PHE A 207  ? ALA A 203  PHE A 207  5 ? 5  
HELX_P HELX_P11 11 PRO A 219  ? GLU A 227  ? PRO A 219  GLU A 227  1 ? 9  
HELX_P HELX_P12 12 THR A 248  ? TYR A 259  ? THR A 248  TYR A 259  1 ? 12 
HELX_P HELX_P13 13 SER A 270  ? LYS A 278  ? SER A 270  LYS A 278  1 ? 9  
HELX_P HELX_P14 14 ILE A 291  ? SER A 295  ? ILE A 291  SER A 295  5 ? 5  
HELX_P HELX_P15 15 SER A 311  ? LEU A 326  ? SER A 311  LEU A 326  1 ? 16 
HELX_P HELX_P16 16 THR A 331  ? LEU A 344  ? THR A 331  LEU A 344  1 ? 14 
HELX_P HELX_P17 17 GLY A 346  ? ALA A 353  ? GLY A 346  ALA A 353  1 ? 8  
HELX_P HELX_P18 18 SER A 354  ? ARG A 362  ? SER A 354  ARG A 362  1 ? 9  
HELX_P HELX_P19 19 LEU A 368  ? GLY A 375  ? LEU A 368  GLY A 375  1 ? 8  
HELX_P HELX_P20 20 ASN A 393  ? SER A 398  ? ASN A 393  SER A 398  1 ? 6  
HELX_P HELX_P21 21 ALA A 473  ? ILE A 481  ? ALA A 473  ILE A 481  1 ? 9  
HELX_P HELX_P22 22 ASN A 486  ? ASN A 499  ? ASN A 486  ASN A 499  1 ? 14 
HELX_P HELX_P23 23 LYS A 511  ? ASP A 538  ? LYS A 511  ASP A 538  1 ? 28 
HELX_P HELX_P24 24 TYR A 549  ? LEU A 553  ? TYR A 549  LEU A 553  5 ? 5  
HELX_P HELX_P25 25 SER A 588  ? THR A 594  ? SER A 588  THR A 594  1 ? 7  
HELX_P HELX_P26 26 TYR A 599  ? MET A 603  ? TYR A 599  MET A 603  5 ? 5  
HELX_P HELX_P27 27 LEU A 629  ? SER A 634  ? LEU A 629  SER A 634  1 ? 6  
HELX_P HELX_P28 28 THR A 643  ? LEU A 647  ? THR A 643  LEU A 647  5 ? 5  
HELX_P HELX_P29 29 LEU A 647  ? ASN A 651  ? LEU A 647  ASN A 651  5 ? 5  
HELX_P HELX_P30 30 SER A 682  ? LYS A 691  ? SER A 682  LYS A 691  1 ? 10 
HELX_P HELX_P31 31 GLU A 708  ? GLN A 712  ? GLU A 708  GLN A 712  5 ? 5  
HELX_P HELX_P32 32 ASN A 727  ? PHE A 732  ? ASN A 727  PHE A 732  1 ? 6  
HELX_P HELX_P33 33 LYS A 733  ? VAL A 735  ? LYS A 733  VAL A 735  5 ? 3  
HELX_P HELX_P34 34 PHE A 777  ? LYS A 790  ? PHE A 777  LYS A 790  1 ? 14 
HELX_P HELX_P35 35 PRO A 792  ? ASN A 794  ? PRO A 792  ASN A 794  5 ? 3  
HELX_P HELX_P36 36 VAL A 811  ? GLY A 829  ? VAL A 811  GLY A 829  1 ? 19 
HELX_P HELX_P37 37 GLU A 837  ? THR A 845  ? GLU A 837  THR A 845  1 ? 9  
HELX_P HELX_P38 38 SER A 883  ? MET A 894  ? SER A 883  MET A 894  1 ? 12 
HELX_P HELX_P39 39 GLY A 924  ? GLY A 944  ? GLY A 924  GLY A 944  1 ? 21 
HELX_P HELX_P40 40 SER A 946  ? MET A 955  ? SER A 946  MET A 955  1 ? 10 
HELX_P HELX_P41 41 ALA A 970  ? SER A 985  ? ALA A 970  SER A 985  1 ? 16 
HELX_P HELX_P42 42 SER A 985  ? ASN A 1000 ? SER A 985  ASN A 1000 1 ? 16 
HELX_P HELX_P43 43 ARG A 1021 ? GLN A 1025 ? ARG A 1021 GLN A 1025 5 ? 5  
HELX_P HELX_P44 44 GLY A 1050 ? LEU A 1063 ? GLY A 1050 LEU A 1063 1 ? 14 
HELX_P HELX_P45 45 PRO A 1066 ? SER A 1068 ? PRO A 1066 SER A 1068 5 ? 3  
HELX_P HELX_P46 46 VAL A 1090 ? LYS A 1116 ? VAL A 1090 LYS A 1116 1 ? 27 
HELX_P HELX_P47 47 THR A 1121 ? GLU A 1132 ? THR A 1121 GLU A 1132 1 ? 12 
HELX_P HELX_P48 48 ASN A 1196 ? THR A 1216 ? ASN A 1196 THR A 1216 1 ? 21 
HELX_P HELX_P49 49 ARG A 1231 ? GLN A 1235 ? ARG A 1231 GLN A 1235 5 ? 5  
HELX_P HELX_P50 50 ALA A 1240 ? MET A 1244 ? ALA A 1240 MET A 1244 5 ? 5  
HELX_P HELX_P51 51 THR A 1261 ? SER A 1264 ? THR A 1261 SER A 1264 5 ? 4  
HELX_P HELX_P52 52 GLU A 1270 ? LEU A 1275 ? GLU A 1270 LEU A 1275 5 ? 6  
HELX_P HELX_P53 53 GLY A 1276 ? ARG A 1294 ? GLY A 1276 ARG A 1294 1 ? 19 
HELX_P HELX_P54 54 THR A 1307 ? CYS A 1315 ? THR A 1307 CYS A 1315 1 ? 9  
HELX_P HELX_P55 55 ASP A 1317 ? ILE A 1323 ? ASP A 1317 ILE A 1323 1 ? 7  
HELX_P HELX_P56 56 GLU A 1327 ? TYR A 1331 ? GLU A 1327 TYR A 1331 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? A CYS 49  SG    ? ? ? 1_555 E FES . FE1 ? ? A CYS 49   A FES 3002 1_555 ? ? ? ? ? ? ? 2.316 ? 
metalc2 metalc ? ? A CYS 52  SG    ? ? ? 1_555 E FES . FE2 ? ? A CYS 52   A FES 3002 1_555 ? ? ? ? ? ? ? 2.078 ? 
metalc3 metalc ? ? A CYS 74  SG    ? ? ? 1_555 E FES . FE2 ? ? A CYS 74   A FES 3002 1_555 ? ? ? ? ? ? ? 2.515 ? 
metalc4 metalc ? ? A CYS 114 SG    ? ? ? 1_555 D FES . FE2 ? ? A CYS 114  A FES 3001 1_555 ? ? ? ? ? ? ? 2.414 ? 
metalc5 metalc ? ? A CYS 117 SG    ? ? ? 1_555 D FES . FE1 ? ? A CYS 117  A FES 3001 1_555 ? ? ? ? ? ? ? 2.086 ? 
metalc6 metalc ? ? A CYS 149 SG    ? ? ? 1_555 D FES . FE1 ? ? A CYS 149  A FES 3001 1_555 ? ? ? ? ? ? ? 2.415 ? 
metalc7 metalc ? ? A CYS 151 SG    ? ? ? 1_555 D FES . FE2 ? ? A CYS 151  A FES 3001 1_555 ? ? ? ? ? ? ? 2.444 ? 
metalc8 metalc ? ? F MTE .   "S2'" ? ? ? 1_555 G MOS . MO  ? ? A MTE 3003 A MOS 3004 1_555 ? ? ? ? ? ? ? 2.458 ? 
metalc9 metalc ? ? F MTE .   "S1'" ? ? ? 1_555 G MOS . MO  ? ? A MTE 3003 A MOS 3004 1_555 ? ? ? ? ? ? ? 2.430 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 701  A . ? GLU 701  A PRO 702  A ? PRO 702  A 1 1.35 
2 SER 1304 A . ? SER 1304 A PRO 1305 A ? PRO 1305 A 1 1.27 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 5 ? 
AB ? 3 ? 
AC ? 5 ? 
AD ? 4 ? 
AE ? 5 ? 
AF ? 8 ? 
AG ? 3 ? 
AH ? 5 ? 
AI ? 2 ? 
AJ ? 4 ? 
AK ? 2 ? 
AL ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? parallel      
AA 3 4 ? anti-parallel 
AA 4 5 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? parallel      
AC 1 2 ? anti-parallel 
AC 2 3 ? anti-parallel 
AC 3 4 ? anti-parallel 
AC 4 5 ? anti-parallel 
AD 1 2 ? anti-parallel 
AD 2 3 ? anti-parallel 
AD 3 4 ? anti-parallel 
AE 1 2 ? parallel      
AE 2 3 ? parallel      
AE 3 4 ? anti-parallel 
AE 4 5 ? anti-parallel 
AF 1 2 ? anti-parallel 
AF 2 3 ? anti-parallel 
AF 3 4 ? parallel      
AF 4 5 ? anti-parallel 
AF 5 6 ? anti-parallel 
AF 6 7 ? parallel      
AF 7 8 ? anti-parallel 
AG 1 2 ? anti-parallel 
AG 2 3 ? anti-parallel 
AH 1 2 ? anti-parallel 
AH 2 3 ? parallel      
AH 3 4 ? anti-parallel 
AH 4 5 ? anti-parallel 
AI 1 2 ? anti-parallel 
AJ 1 2 ? parallel      
AJ 2 3 ? anti-parallel 
AJ 3 4 ? anti-parallel 
AK 1 2 ? anti-parallel 
AL 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 ARG A 14   ? LYS A 19   ? ARG A 14   LYS A 19   
AA 2 GLU A 6    ? VAL A 11   ? GLU A 6    VAL A 11   
AA 3 ALA A 85   ? THR A 87   ? ALA A 85   THR A 87   
AA 4 THR A 53   ? ASN A 60   ? THR A 53   ASN A 60   
AA 5 ARG A 65   ? ASN A 72   ? ARG A 65   ASN A 72   
AB 1 ARG A 234  ? GLY A 237  ? ARG A 234  GLY A 237  
AB 2 MET A 242  ? SER A 245  ? MET A 242  SER A 245  
AB 3 VAL A 284  ? ILE A 286  ? VAL A 284  ILE A 286  
AC 1 VAL A 297  ? HIS A 299  ? VAL A 297  HIS A 299  
AC 2 GLY A 303  ? GLY A 307  ? GLY A 303  GLY A 307  
AC 3 ILE A 410  ? PRO A 417  ? ILE A 410  PRO A 417  
AC 4 THR A 378  ? LEU A 382  ? THR A 378  LEU A 382  
AC 5 LYS A 387  ? PRO A 391  ? LYS A 387  PRO A 391  
AD 1 GLU A 423  ? GLN A 430  ? GLU A 423  GLN A 430  
AD 2 VAL A 441  ? PHE A 448  ? VAL A 441  PHE A 448  
AD 3 GLU A 458  ? GLY A 464  ? GLU A 458  GLY A 464  
AD 4 ILE A 471  ? CYS A 472  ? ILE A 471  CYS A 472  
AE 1 CYS A 562  ? LYS A 566  ? CYS A 562  LYS A 566  
AE 2 GLU A 1247 ? LEU A 1252 ? GLU A 1247 LEU A 1252 
AE 3 HIS A 1180 ? ASP A 1190 ? HIS A 1180 ASP A 1190 
AE 4 TYR A 1161 ? ASP A 1174 ? TYR A 1161 ASP A 1174 
AE 5 LYS A 1003 ? VAL A 1016 ? LYS A 1003 VAL A 1016 
AF 1 VAL A 638  ? MET A 642  ? VAL A 638  MET A 642  
AF 2 LEU A 674  ? ALA A 680  ? LEU A 674  ALA A 680  
AF 3 LEU A 610  ? THR A 616  ? LEU A 610  THR A 616  
AF 4 VAL A 832  ? VAL A 835  ? VAL A 832  VAL A 835  
AF 5 SER A 757  ? PRO A 762  ? SER A 757  PRO A 762  
AF 6 MET A 769  ? VAL A 773  ? MET A 769  VAL A 773  
AF 7 VAL A 796  ? VAL A 800  ? VAL A 796  VAL A 800  
AF 8 THR A 1075 ? SER A 1076 ? THR A 1075 SER A 1076 
AG 1 LYS A 667  ? VAL A 668  ? LYS A 667  VAL A 668  
AG 2 ALA A 622  ? ASP A 628  ? ALA A 622  ASP A 628  
AG 3 LYS A 694  ? ASP A 699  ? LYS A 694  ASP A 699  
AH 1 ARG A 721  ? TYR A 725  ? ARG A 721  TYR A 725  
AH 2 ASN A 902  ? ARG A 911  ? ASN A 902  ARG A 911  
AH 3 ILE A 865  ? GLY A 877  ? ILE A 865  GLY A 877  
AH 4 TYR A 851  ? PHE A 859  ? TYR A 851  PHE A 859  
AH 5 GLN A 737  ? MET A 745  ? GLN A 737  MET A 745  
AI 1 ILE A 959  ? GLN A 961  ? ILE A 959  GLN A 961  
AI 2 GLU A 967  ? ASN A 969  ? GLU A 967  ASN A 969  
AJ 1 VAL A 1070 ? HIS A 1071 ? VAL A 1070 HIS A 1071 
AJ 2 VAL A 1038 ? HIS A 1042 ? VAL A 1038 HIS A 1042 
AJ 3 ALA A 1026 ? ILE A 1032 ? ALA A 1026 ILE A 1032 
AJ 4 SER A 1137 ? PHE A 1142 ? SER A 1137 PHE A 1142 
AK 1 ASP A 1148 ? ASN A 1150 ? ASP A 1148 ASN A 1150 
AK 2 GLU A 1155 ? GLN A 1157 ? GLU A 1155 GLN A 1157 
AL 1 ASN A 1221 ? TYR A 1222 ? ASN A 1221 TYR A 1222 
AL 2 LEU A 1228 ? HIS A 1229 ? LEU A 1228 HIS A 1229 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N GLU A 18   ? N GLU A 18   O LEU A 7    ? O LEU A 7    
AA 2 3 O TYR A 10   ? O TYR A 10   N VAL A 86   ? N VAL A 86   
AA 3 4 N THR A 87   ? N THR A 87   O MET A 55   ? O MET A 55   
AA 4 5 N ASN A 60   ? N ASN A 60   O ARG A 65   ? O ARG A 65   
AB 1 2 N PHE A 236  ? N PHE A 236  O TRP A 243  ? O TRP A 243  
AB 2 3 N PHE A 244  ? N PHE A 244  O ILE A 285  ? O ILE A 285  
AC 1 2 N ASN A 298  ? N ASN A 298  O THR A 305  ? O THR A 305  
AC 2 3 N LEU A 306  ? N LEU A 306  O VAL A 414  ? O VAL A 414  
AC 3 4 N ASN A 415  ? N ASN A 415  O THR A 378  ? O THR A 378  
AC 4 5 N LEU A 381  ? N LEU A 381  O ARG A 388  ? O ARG A 388  
AD 1 2 N GLN A 430  ? N GLN A 430  O VAL A 441  ? O VAL A 441  
AD 2 3 N PHE A 448  ? N PHE A 448  O GLU A 458  ? O GLU A 458  
AD 3 4 N TYR A 463  ? N TYR A 463  O ILE A 471  ? O ILE A 471  
AE 1 2 N THR A 564  ? N THR A 564  O LEU A 1248 ? O LEU A 1248 
AE 2 3 N GLU A 1247 ? N GLU A 1247 O ILE A 1183 ? O ILE A 1183 
AE 3 4 N ASP A 1190 ? N ASP A 1190 O TYR A 1164 ? O TYR A 1164 
AE 4 5 N ILE A 1173 ? N ILE A 1173 O LYS A 1004 ? O LYS A 1004 
AF 1 2 N MET A 642  ? N MET A 642  O ALA A 677  ? O ALA A 677  
AF 2 3 N ALA A 680  ? N ALA A 680  O PHE A 611  ? O PHE A 611  
AF 3 4 N LEU A 612  ? N LEU A 612  O ARG A 833  ? O ARG A 833  
AF 4 5 N CYS A 834  ? N CYS A 834  O MET A 758  ? O MET A 758  
AF 5 6 N VAL A 761  ? N VAL A 761  O ASP A 770  ? O ASP A 770  
AF 6 7 N VAL A 771  ? N VAL A 771  O MET A 797  ? O MET A 797  
AF 7 8 N VAL A 800  ? N VAL A 800  O THR A 1075 ? O THR A 1075 
AG 1 2 N VAL A 668  ? N VAL A 668  O ALA A 622  ? O ALA A 622  
AG 2 3 N ASP A 628  ? N ASP A 628  O LYS A 694  ? O LYS A 694  
AH 1 2 N TYR A 725  ? N TYR A 725  O LEU A 903  ? O LEU A 903  
AH 2 3 N ASN A 902  ? N ASN A 902  O LEU A 866  ? O LEU A 866  
AH 3 4 N TYR A 873  ? N TYR A 873  O LEU A 852  ? O LEU A 852  
AH 4 5 N PHE A 859  ? N PHE A 859  O GLN A 737  ? O GLN A 737  
AI 1 2 N ASP A 960  ? N ASP A 960  O ILE A 968  ? O ILE A 968  
AJ 1 2 N HIS A 1071 ? N HIS A 1071 O VAL A 1038 ? O VAL A 1038 
AJ 2 3 N THR A 1041 ? N THR A 1041 O LEU A 1029 ? O LEU A 1029 
AJ 3 4 N VAL A 1030 ? N VAL A 1030 O ALA A 1138 ? O ALA A 1138 
AK 1 2 N ASN A 1150 ? N ASN A 1150 O GLU A 1155 ? O GLU A 1155 
AL 1 2 N ASN A 1221 ? N ASN A 1221 O HIS A 1229 ? O HIS A 1229 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE FES A 3001' 
AC2 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE FES A 3002' 
AC3 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE MTE A 3003' 
AC4 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE MOS A 3004' 
AC5 Software ? ? ? ? 24 'BINDING SITE FOR RESIDUE FAD A 3006' 
AC6 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE MLI A 2337' 
AC7 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE MLI A 2338' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 8  GLN A 113  ? GLN A 113  . ? 1_555 ? 
2  AC1 8  CYS A 114  ? CYS A 114  . ? 1_555 ? 
3  AC1 8  GLY A 115  ? GLY A 115  . ? 1_555 ? 
4  AC1 8  CYS A 117  ? CYS A 117  . ? 1_555 ? 
5  AC1 8  CYS A 149  ? CYS A 149  . ? 1_555 ? 
6  AC1 8  ARG A 150  ? ARG A 150  . ? 1_555 ? 
7  AC1 8  CYS A 151  ? CYS A 151  . ? 1_555 ? 
8  AC1 8  MET A 753  ? MET A 753  . ? 1_555 ? 
9  AC2 8  GLY A 43   ? GLY A 43   . ? 1_555 ? 
10 AC2 8  CYS A 44   ? CYS A 44   . ? 1_555 ? 
11 AC2 8  GLY A 45   ? GLY A 45   . ? 1_555 ? 
12 AC2 8  GLY A 47   ? GLY A 47   . ? 1_555 ? 
13 AC2 8  CYS A 49   ? CYS A 49   . ? 1_555 ? 
14 AC2 8  GLY A 50   ? GLY A 50   . ? 1_555 ? 
15 AC2 8  CYS A 52   ? CYS A 52   . ? 1_555 ? 
16 AC2 8  CYS A 74   ? CYS A 74   . ? 1_555 ? 
17 AC3 18 GLN A 113  ? GLN A 113  . ? 1_555 ? 
18 AC3 18 CYS A 151  ? CYS A 151  . ? 1_555 ? 
19 AC3 18 GLY A 805  ? GLY A 805  . ? 1_555 ? 
20 AC3 18 ALA A 806  ? ALA A 806  . ? 1_555 ? 
21 AC3 18 PHE A 807  ? PHE A 807  . ? 1_555 ? 
22 AC3 18 ARG A 921  ? ARG A 921  . ? 1_555 ? 
23 AC3 18 MET A 1047 ? MET A 1047 . ? 1_555 ? 
24 AC3 18 GLY A 1048 ? GLY A 1048 . ? 1_555 ? 
25 AC3 18 GLN A 1049 ? GLN A 1049 . ? 1_555 ? 
26 AC3 18 GLY A 1087 ? GLY A 1087 . ? 1_555 ? 
27 AC3 18 GLY A 1088 ? GLY A 1088 . ? 1_555 ? 
28 AC3 18 SER A 1089 ? SER A 1089 . ? 1_555 ? 
29 AC3 18 VAL A 1090 ? VAL A 1090 . ? 1_555 ? 
30 AC3 18 VAL A 1091 ? VAL A 1091 . ? 1_555 ? 
31 AC3 18 ALA A 1092 ? ALA A 1092 . ? 1_555 ? 
32 AC3 18 GLN A 1203 ? GLN A 1203 . ? 1_555 ? 
33 AC3 18 LEU A 1268 ? LEU A 1268 . ? 1_555 ? 
34 AC3 18 MOS G .    ? MOS A 3004 . ? 1_555 ? 
35 AC4 8  GLN A 776  ? GLN A 776  . ? 1_555 ? 
36 AC4 8  GLY A 808  ? GLY A 808  . ? 1_555 ? 
37 AC4 8  PHE A 920  ? PHE A 920  . ? 1_555 ? 
38 AC4 8  ARG A 921  ? ARG A 921  . ? 1_555 ? 
39 AC4 8  GLY A 1087 ? GLY A 1087 . ? 1_555 ? 
40 AC4 8  GLY A 1088 ? GLY A 1088 . ? 1_555 ? 
41 AC4 8  GLU A 1270 ? GLU A 1270 . ? 1_555 ? 
42 AC4 8  MTE F .    ? MTE A 3003 . ? 1_555 ? 
43 AC5 24 GLY A 46   ? GLY A 46   . ? 1_555 ? 
44 AC5 24 GLY A 47   ? GLY A 47   . ? 1_555 ? 
45 AC5 24 PRO A 263  ? PRO A 263  . ? 1_555 ? 
46 AC5 24 VAL A 264  ? VAL A 264  . ? 1_555 ? 
47 AC5 24 MET A 266  ? MET A 266  . ? 1_555 ? 
48 AC5 24 GLY A 267  ? GLY A 267  . ? 1_555 ? 
49 AC5 24 ASN A 268  ? ASN A 268  . ? 1_555 ? 
50 AC5 24 THR A 269  ? THR A 269  . ? 1_555 ? 
51 AC5 24 SER A 270  ? SER A 270  . ? 1_555 ? 
52 AC5 24 VAL A 271  ? VAL A 271  . ? 1_555 ? 
53 AC5 24 LEU A 344  ? LEU A 344  . ? 1_555 ? 
54 AC5 24 ALA A 345  ? ALA A 345  . ? 1_555 ? 
55 AC5 24 ALA A 353  ? ALA A 353  . ? 1_555 ? 
56 AC5 24 SER A 354  ? SER A 354  . ? 1_555 ? 
57 AC5 24 GLY A 357  ? GLY A 357  . ? 1_555 ? 
58 AC5 24 HIS A 358  ? HIS A 358  . ? 1_555 ? 
59 AC5 24 ILE A 360  ? ILE A 360  . ? 1_555 ? 
60 AC5 24 SER A 361  ? SER A 361  . ? 1_555 ? 
61 AC5 24 HIS A 363  ? HIS A 363  . ? 1_555 ? 
62 AC5 24 SER A 366  ? SER A 366  . ? 1_555 ? 
63 AC5 24 ASP A 367  ? ASP A 367  . ? 1_555 ? 
64 AC5 24 ILE A 410  ? ILE A 410  . ? 1_555 ? 
65 AC5 24 LEU A 411  ? LEU A 411  . ? 1_555 ? 
66 AC5 24 LEU A 438  ? LEU A 438  . ? 1_555 ? 
67 AC6 8  ARG A 32   ? ARG A 32   . ? 1_555 ? 
68 AC6 8  LYS A 33   ? LYS A 33   . ? 1_555 ? 
69 AC6 8  THR A 38   ? THR A 38   . ? 1_555 ? 
70 AC6 8  ASP A 601  ? ASP A 601  . ? 1_555 ? 
71 AC6 8  MET A 603  ? MET A 603  . ? 1_555 ? 
72 AC6 8  LEU A 605  ? LEU A 605  . ? 1_555 ? 
73 AC6 8  ARG A 833  ? ARG A 833  . ? 1_555 ? 
74 AC6 8  HOH I .    ? HOH A 2019 . ? 1_555 ? 
75 AC7 9  CYS A 44   ? CYS A 44   . ? 1_555 ? 
76 AC7 9  GLY A 48   ? GLY A 48   . ? 1_555 ? 
77 AC7 9  CYS A 49   ? CYS A 49   . ? 1_555 ? 
78 AC7 9  LEU A 148  ? LEU A 148  . ? 1_555 ? 
79 AC7 9  ARG A 433  ? ARG A 433  . ? 1_555 ? 
80 AC7 9  PHE A 751  ? PHE A 751  . ? 1_555 ? 
81 AC7 9  TYR A 1236 ? TYR A 1236 . ? 1_555 ? 
82 AC7 9  LYS A 1237 ? LYS A 1237 . ? 1_555 ? 
83 AC7 9  ILE A 1238 ? ILE A 1238 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4UHW 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4UHW 
_atom_sites.fract_transf_matrix[1][1]   0.006715 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006715 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007505 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
FE 
MO 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . ALA A 1 4    ? -65.456 -53.096 -59.216 1.00 95.09  ? 4    ALA A N     1 
ATOM   2     C  CA    . ALA A 1 4    ? -66.216 -52.969 -60.496 1.00 94.76  ? 4    ALA A CA    1 
ATOM   3     C  C     . ALA A 1 4    ? -66.266 -51.509 -60.971 1.00 92.18  ? 4    ALA A C     1 
ATOM   4     O  O     . ALA A 1 4    ? -65.803 -51.202 -62.073 1.00 93.42  ? 4    ALA A O     1 
ATOM   5     C  CB    . ALA A 1 4    ? -67.625 -53.545 -60.347 1.00 95.55  ? 4    ALA A CB    1 
ATOM   6     N  N     . SER A 1 5    ? -66.789 -50.614 -60.131 1.00 89.02  ? 5    SER A N     1 
ATOM   7     C  CA    . SER A 1 5    ? -67.106 -49.244 -60.560 1.00 86.87  ? 5    SER A CA    1 
ATOM   8     C  C     . SER A 1 5    ? -65.892 -48.425 -61.004 1.00 83.75  ? 5    SER A C     1 
ATOM   9     O  O     . SER A 1 5    ? -64.742 -48.767 -60.711 1.00 82.03  ? 5    SER A O     1 
ATOM   10    C  CB    . SER A 1 5    ? -67.865 -48.481 -59.471 1.00 86.13  ? 5    SER A CB    1 
ATOM   11    O  OG    . SER A 1 5    ? -69.035 -49.177 -59.091 1.00 86.47  ? 5    SER A OG    1 
ATOM   12    N  N     . GLU A 1 6    ? -66.189 -47.356 -61.741 1.00 82.24  ? 6    GLU A N     1 
ATOM   13    C  CA    . GLU A 1 6    ? -65.197 -46.408 -62.232 1.00 80.40  ? 6    GLU A CA    1 
ATOM   14    C  C     . GLU A 1 6    ? -65.384 -45.087 -61.515 1.00 77.01  ? 6    GLU A C     1 
ATOM   15    O  O     . GLU A 1 6    ? -66.513 -44.663 -61.271 1.00 76.21  ? 6    GLU A O     1 
ATOM   16    C  CB    . GLU A 1 6    ? -65.365 -46.191 -63.730 1.00 82.74  ? 6    GLU A CB    1 
ATOM   17    C  CG    . GLU A 1 6    ? -65.087 -47.441 -64.553 1.00 86.27  ? 6    GLU A CG    1 
ATOM   18    C  CD    . GLU A 1 6    ? -65.340 -47.258 -66.042 1.00 88.67  ? 6    GLU A CD    1 
ATOM   19    O  OE1   . GLU A 1 6    ? -65.517 -46.103 -66.500 1.00 90.33  ? 6    GLU A OE1   1 
ATOM   20    O  OE2   . GLU A 1 6    ? -65.355 -48.282 -66.761 1.00 90.39  ? 6    GLU A OE2   1 
ATOM   21    N  N     . LEU A 1 7    ? -64.270 -44.448 -61.170 1.00 72.57  ? 7    LEU A N     1 
ATOM   22    C  CA    . LEU A 1 7    ? -64.299 -43.154 -60.504 1.00 69.67  ? 7    LEU A CA    1 
ATOM   23    C  C     . LEU A 1 7    ? -64.276 -42.085 -61.586 1.00 67.71  ? 7    LEU A C     1 
ATOM   24    O  O     . LEU A 1 7    ? -63.407 -42.106 -62.447 1.00 67.15  ? 7    LEU A O     1 
ATOM   25    C  CB    . LEU A 1 7    ? -63.099 -43.019 -59.563 1.00 67.87  ? 7    LEU A CB    1 
ATOM   26    C  CG    . LEU A 1 7    ? -62.960 -41.756 -58.721 1.00 66.95  ? 7    LEU A CG    1 
ATOM   27    C  CD1   . LEU A 1 7    ? -64.179 -41.515 -57.843 1.00 68.07  ? 7    LEU A CD1   1 
ATOM   28    C  CD2   . LEU A 1 7    ? -61.705 -41.879 -57.872 1.00 66.05  ? 7    LEU A CD2   1 
ATOM   29    N  N     . LEU A 1 8    ? -65.248 -41.178 -61.549 1.00 66.77  ? 8    LEU A N     1 
ATOM   30    C  CA    . LEU A 1 8    ? -65.394 -40.125 -62.543 1.00 66.33  ? 8    LEU A CA    1 
ATOM   31    C  C     . LEU A 1 8    ? -65.619 -38.792 -61.836 1.00 64.89  ? 8    LEU A C     1 
ATOM   32    O  O     . LEU A 1 8    ? -66.620 -38.594 -61.139 1.00 64.68  ? 8    LEU A O     1 
ATOM   33    C  CB    . LEU A 1 8    ? -66.545 -40.451 -63.495 1.00 69.95  ? 8    LEU A CB    1 
ATOM   34    C  CG    . LEU A 1 8    ? -67.167 -39.412 -64.460 1.00 73.11  ? 8    LEU A CG    1 
ATOM   35    C  CD1   . LEU A 1 8    ? -66.241 -38.273 -64.887 1.00 73.58  ? 8    LEU A CD1   1 
ATOM   36    C  CD2   . LEU A 1 8    ? -67.714 -40.113 -65.702 1.00 74.51  ? 8    LEU A CD2   1 
ATOM   37    N  N     . PHE A 1 9    ? -64.661 -37.889 -62.013 1.00 62.23  ? 9    PHE A N     1 
ATOM   38    C  CA    . PHE A 1 9    ? -64.781 -36.532 -61.522 1.00 60.58  ? 9    PHE A CA    1 
ATOM   39    C  C     . PHE A 1 9    ? -64.048 -35.588 -62.447 1.00 58.06  ? 9    PHE A C     1 
ATOM   40    O  O     . PHE A 1 9    ? -63.495 -36.022 -63.441 1.00 57.67  ? 9    PHE A O     1 
ATOM   41    C  CB    . PHE A 1 9    ? -64.296 -36.433 -60.067 1.00 60.38  ? 9    PHE A CB    1 
ATOM   42    C  CG    . PHE A 1 9    ? -62.857 -36.796 -59.854 1.00 58.72  ? 9    PHE A CG    1 
ATOM   43    C  CD1   . PHE A 1 9    ? -62.465 -38.125 -59.815 1.00 59.20  ? 9    PHE A CD1   1 
ATOM   44    C  CD2   . PHE A 1 9    ? -61.909 -35.811 -59.620 1.00 58.00  ? 9    PHE A CD2   1 
ATOM   45    C  CE1   . PHE A 1 9    ? -61.146 -38.469 -59.590 1.00 57.76  ? 9    PHE A CE1   1 
ATOM   46    C  CE2   . PHE A 1 9    ? -60.589 -36.144 -59.390 1.00 56.98  ? 9    PHE A CE2   1 
ATOM   47    C  CZ    . PHE A 1 9    ? -60.208 -37.477 -59.378 1.00 57.37  ? 9    PHE A CZ    1 
ATOM   48    N  N     . TYR A 1 10   ? -64.097 -34.299 -62.136 1.00 57.09  ? 10   TYR A N     1 
ATOM   49    C  CA    . TYR A 1 10   ? -63.434 -33.276 -62.924 1.00 56.45  ? 10   TYR A CA    1 
ATOM   50    C  C     . TYR A 1 10   ? -62.383 -32.579 -62.095 1.00 54.12  ? 10   TYR A C     1 
ATOM   51    O  O     . TYR A 1 10   ? -62.531 -32.443 -60.881 1.00 52.98  ? 10   TYR A O     1 
ATOM   52    C  CB    . TYR A 1 10   ? -64.449 -32.264 -63.436 1.00 58.23  ? 10   TYR A CB    1 
ATOM   53    C  CG    . TYR A 1 10   ? -65.119 -32.700 -64.713 1.00 60.91  ? 10   TYR A CG    1 
ATOM   54    C  CD1   . TYR A 1 10   ? -65.917 -33.840 -64.762 1.00 62.83  ? 10   TYR A CD1   1 
ATOM   55    C  CD2   . TYR A 1 10   ? -64.950 -31.976 -65.883 1.00 62.76  ? 10   TYR A CD2   1 
ATOM   56    C  CE1   . TYR A 1 10   ? -66.527 -34.240 -65.943 1.00 64.37  ? 10   TYR A CE1   1 
ATOM   57    C  CE2   . TYR A 1 10   ? -65.549 -32.368 -67.069 1.00 64.07  ? 10   TYR A CE2   1 
ATOM   58    C  CZ    . TYR A 1 10   ? -66.338 -33.493 -67.089 1.00 65.29  ? 10   TYR A CZ    1 
ATOM   59    O  OH    . TYR A 1 10   ? -66.928 -33.860 -68.266 1.00 68.59  ? 10   TYR A OH    1 
ATOM   60    N  N     . VAL A 1 11   ? -61.312 -32.162 -62.767 1.00 52.87  ? 11   VAL A N     1 
ATOM   61    C  CA    . VAL A 1 11   ? -60.261 -31.338 -62.171 1.00 51.13  ? 11   VAL A CA    1 
ATOM   62    C  C     . VAL A 1 11   ? -59.963 -30.244 -63.171 1.00 50.68  ? 11   VAL A C     1 
ATOM   63    O  O     . VAL A 1 11   ? -59.644 -30.527 -64.313 1.00 49.74  ? 11   VAL A O     1 
ATOM   64    C  CB    . VAL A 1 11   ? -58.982 -32.149 -61.869 1.00 50.25  ? 11   VAL A CB    1 
ATOM   65    C  CG1   . VAL A 1 11   ? -57.914 -31.265 -61.232 1.00 49.46  ? 11   VAL A CG1   1 
ATOM   66    C  CG2   . VAL A 1 11   ? -59.306 -33.312 -60.952 1.00 50.57  ? 11   VAL A CG2   1 
ATOM   67    N  N     . ASN A 1 12   ? -60.103 -28.999 -62.746 1.00 51.85  ? 12   ASN A N     1 
ATOM   68    C  CA    . ASN A 1 12   ? -59.887 -27.838 -63.611 1.00 53.54  ? 12   ASN A CA    1 
ATOM   69    C  C     . ASN A 1 12   ? -60.605 -27.920 -64.957 1.00 55.24  ? 12   ASN A C     1 
ATOM   70    O  O     . ASN A 1 12   ? -60.018 -27.678 -66.003 1.00 56.05  ? 12   ASN A O     1 
ATOM   71    C  CB    . ASN A 1 12   ? -58.386 -27.603 -63.799 1.00 52.41  ? 12   ASN A CB    1 
ATOM   72    C  CG    . ASN A 1 12   ? -57.665 -27.367 -62.486 1.00 52.40  ? 12   ASN A CG    1 
ATOM   73    O  OD1   . ASN A 1 12   ? -58.243 -26.844 -61.532 1.00 52.42  ? 12   ASN A OD1   1 
ATOM   74    N  ND2   . ASN A 1 12   ? -56.391 -27.755 -62.425 1.00 52.18  ? 12   ASN A ND2   1 
ATOM   75    N  N     . GLY A 1 13   ? -61.872 -28.312 -64.923 1.00 57.92  ? 13   GLY A N     1 
ATOM   76    C  CA    . GLY A 1 13   ? -62.687 -28.409 -66.130 1.00 60.60  ? 13   GLY A CA    1 
ATOM   77    C  C     . GLY A 1 13   ? -62.520 -29.661 -66.975 1.00 62.78  ? 13   GLY A C     1 
ATOM   78    O  O     . GLY A 1 13   ? -63.364 -29.928 -67.825 1.00 64.97  ? 13   GLY A O     1 
ATOM   79    N  N     . ARG A 1 14   ? -61.461 -30.437 -66.757 1.00 64.35  ? 14   ARG A N     1 
ATOM   80    C  CA    . ARG A 1 14   ? -61.202 -31.629 -67.557 1.00 67.26  ? 14   ARG A CA    1 
ATOM   81    C  C     . ARG A 1 14   ? -61.688 -32.880 -66.839 1.00 66.62  ? 14   ARG A C     1 
ATOM   82    O  O     . ARG A 1 14   ? -61.431 -33.071 -65.655 1.00 65.82  ? 14   ARG A O     1 
ATOM   83    C  CB    . ARG A 1 14   ? -59.710 -31.780 -67.843 1.00 69.56  ? 14   ARG A CB    1 
ATOM   84    C  CG    . ARG A 1 14   ? -59.100 -30.670 -68.678 1.00 73.64  ? 14   ARG A CG    1 
ATOM   85    C  CD    . ARG A 1 14   ? -57.587 -30.759 -68.584 1.00 78.26  ? 14   ARG A CD    1 
ATOM   86    N  NE    . ARG A 1 14   ? -56.881 -29.801 -69.440 1.00 84.00  ? 14   ARG A NE    1 
ATOM   87    C  CZ    . ARG A 1 14   ? -56.710 -28.498 -69.183 1.00 87.50  ? 14   ARG A CZ    1 
ATOM   88    N  NH1   . ARG A 1 14   ? -57.216 -27.923 -68.084 1.00 88.76  ? 14   ARG A NH1   1 
ATOM   89    N  NH2   . ARG A 1 14   ? -56.027 -27.751 -70.049 1.00 88.75  ? 14   ARG A NH2   1 
ATOM   90    N  N     . LYS A 1 15   ? -62.367 -33.742 -67.584 1.00 67.98  ? 15   LYS A N     1 
ATOM   91    C  CA    . LYS A 1 15   ? -62.816 -35.035 -67.084 1.00 68.60  ? 15   LYS A CA    1 
ATOM   92    C  C     . LYS A 1 15   ? -61.638 -35.928 -66.679 1.00 65.67  ? 15   LYS A C     1 
ATOM   93    O  O     . LYS A 1 15   ? -60.591 -35.909 -67.313 1.00 64.43  ? 15   LYS A O     1 
ATOM   94    C  CB    . LYS A 1 15   ? -63.665 -35.710 -68.163 1.00 71.92  ? 15   LYS A CB    1 
ATOM   95    C  CG    . LYS A 1 15   ? -64.176 -37.107 -67.836 1.00 74.65  ? 15   LYS A CG    1 
ATOM   96    C  CD    . LYS A 1 15   ? -65.444 -37.426 -68.626 1.00 78.06  ? 15   LYS A CD    1 
ATOM   97    C  CE    . LYS A 1 15   ? -65.286 -38.634 -69.532 1.00 80.42  ? 15   LYS A CE    1 
ATOM   98    N  NZ    . LYS A 1 15   ? -66.557 -38.934 -70.255 1.00 83.59  ? 15   LYS A NZ    1 
ATOM   99    N  N     . VAL A 1 16   ? -61.820 -36.677 -65.599 1.00 64.66  ? 16   VAL A N     1 
ATOM   100   C  CA    . VAL A 1 16   ? -60.843 -37.640 -65.114 1.00 64.04  ? 16   VAL A CA    1 
ATOM   101   C  C     . VAL A 1 16   ? -61.579 -38.948 -64.895 1.00 67.28  ? 16   VAL A C     1 
ATOM   102   O  O     . VAL A 1 16   ? -62.649 -38.966 -64.293 1.00 68.81  ? 16   VAL A O     1 
ATOM   103   C  CB    . VAL A 1 16   ? -60.222 -37.175 -63.786 1.00 63.01  ? 16   VAL A CB    1 
ATOM   104   C  CG1   . VAL A 1 16   ? -59.521 -38.322 -63.054 1.00 62.75  ? 16   VAL A CG1   1 
ATOM   105   C  CG2   . VAL A 1 16   ? -59.264 -36.021 -64.033 1.00 62.37  ? 16   VAL A CG2   1 
ATOM   106   N  N     . ILE A 1 17   ? -61.004 -40.037 -65.391 1.00 69.49  ? 17   ILE A N     1 
ATOM   107   C  CA    . ILE A 1 17   ? -61.557 -41.370 -65.209 1.00 71.10  ? 17   ILE A CA    1 
ATOM   108   C  C     . ILE A 1 17   ? -60.458 -42.255 -64.662 1.00 71.53  ? 17   ILE A C     1 
ATOM   109   O  O     . ILE A 1 17   ? -59.367 -42.293 -65.211 1.00 72.00  ? 17   ILE A O     1 
ATOM   110   C  CB    . ILE A 1 17   ? -62.118 -41.948 -66.530 1.00 72.69  ? 17   ILE A CB    1 
ATOM   111   C  CG1   . ILE A 1 17   ? -63.476 -41.280 -66.845 1.00 74.18  ? 17   ILE A CG1   1 
ATOM   112   C  CG2   . ILE A 1 17   ? -62.218 -43.479 -66.456 1.00 74.18  ? 17   ILE A CG2   1 
ATOM   113   C  CD1   . ILE A 1 17   ? -64.381 -42.024 -67.815 1.00 75.61  ? 17   ILE A CD1   1 
ATOM   114   N  N     . GLU A 1 18   ? -60.749 -42.950 -63.572 1.00 74.30  ? 18   GLU A N     1 
ATOM   115   C  CA    . GLU A 1 18   ? -59.869 -43.986 -63.063 1.00 76.84  ? 18   GLU A CA    1 
ATOM   116   C  C     . GLU A 1 18   ? -60.675 -45.266 -62.969 1.00 78.61  ? 18   GLU A C     1 
ATOM   117   O  O     . GLU A 1 18   ? -61.742 -45.301 -62.347 1.00 80.52  ? 18   GLU A O     1 
ATOM   118   C  CB    . GLU A 1 18   ? -59.277 -43.601 -61.701 1.00 78.25  ? 18   GLU A CB    1 
ATOM   119   C  CG    . GLU A 1 18   ? -58.124 -42.597 -61.775 1.00 78.70  ? 18   GLU A CG    1 
ATOM   120   C  CD    . GLU A 1 18   ? -56.797 -43.186 -62.268 1.00 80.22  ? 18   GLU A CD    1 
ATOM   121   O  OE1   . GLU A 1 18   ? -56.757 -44.350 -62.739 1.00 82.01  ? 18   GLU A OE1   1 
ATOM   122   O  OE2   . GLU A 1 18   ? -55.773 -42.470 -62.190 1.00 79.66  ? 18   GLU A OE2   1 
ATOM   123   N  N     . LYS A 1 19   ? -60.177 -46.301 -63.637 1.00 79.86  ? 19   LYS A N     1 
ATOM   124   C  CA    . LYS A 1 19   ? -60.749 -47.630 -63.562 1.00 81.07  ? 19   LYS A CA    1 
ATOM   125   C  C     . LYS A 1 19   ? -59.899 -48.413 -62.578 1.00 79.01  ? 19   LYS A C     1 
ATOM   126   O  O     . LYS A 1 19   ? -58.695 -48.186 -62.478 1.00 77.77  ? 19   LYS A O     1 
ATOM   127   C  CB    . LYS A 1 19   ? -60.756 -48.277 -64.944 1.00 83.40  ? 19   LYS A CB    1 
ATOM   128   C  CG    . LYS A 1 19   ? -61.473 -47.445 -66.006 1.00 85.21  ? 19   LYS A CG    1 
ATOM   129   C  CD    . LYS A 1 19   ? -62.043 -48.320 -67.117 1.00 88.44  ? 19   LYS A CD    1 
ATOM   130   C  CE    . LYS A 1 19   ? -62.653 -47.500 -68.248 1.00 89.84  ? 19   LYS A CE    1 
ATOM   131   N  NZ    . LYS A 1 19   ? -61.629 -46.763 -69.043 1.00 89.60  ? 19   LYS A NZ    1 
ATOM   132   N  N     . ASN A 1 20   ? -60.540 -49.304 -61.829 1.00 79.58  ? 20   ASN A N     1 
ATOM   133   C  CA    . ASN A 1 20   ? -59.877 -50.091 -60.785 1.00 80.65  ? 20   ASN A CA    1 
ATOM   134   C  C     . ASN A 1 20   ? -59.038 -49.238 -59.820 1.00 78.24  ? 20   ASN A C     1 
ATOM   135   O  O     . ASN A 1 20   ? -57.928 -49.616 -59.454 1.00 79.67  ? 20   ASN A O     1 
ATOM   136   C  CB    . ASN A 1 20   ? -59.013 -51.186 -61.418 1.00 82.66  ? 20   ASN A CB    1 
ATOM   137   C  CG    . ASN A 1 20   ? -59.751 -51.966 -62.493 1.00 86.28  ? 20   ASN A CG    1 
ATOM   138   O  OD1   . ASN A 1 20   ? -60.865 -52.447 -62.276 1.00 89.03  ? 20   ASN A OD1   1 
ATOM   139   N  ND2   . ASN A 1 20   ? -59.130 -52.095 -63.663 1.00 87.06  ? 20   ASN A ND2   1 
ATOM   140   N  N     . VAL A 1 21   ? -59.584 -48.095 -59.412 1.00 75.60  ? 21   VAL A N     1 
ATOM   141   C  CA    . VAL A 1 21   ? -58.877 -47.149 -58.547 1.00 73.13  ? 21   VAL A CA    1 
ATOM   142   C  C     . VAL A 1 21   ? -58.599 -47.710 -57.151 1.00 72.21  ? 21   VAL A C     1 
ATOM   143   O  O     . VAL A 1 21   ? -59.432 -48.408 -56.586 1.00 73.22  ? 21   VAL A O     1 
ATOM   144   C  CB    . VAL A 1 21   ? -59.646 -45.808 -58.426 1.00 73.26  ? 21   VAL A CB    1 
ATOM   145   C  CG1   . VAL A 1 21   ? -60.948 -45.968 -57.644 1.00 75.71  ? 21   VAL A CG1   1 
ATOM   146   C  CG2   . VAL A 1 21   ? -58.771 -44.731 -57.791 1.00 71.85  ? 21   VAL A CG2   1 
ATOM   147   N  N     . ASP A 1 22   ? -57.417 -47.403 -56.616 1.00 71.32  ? 22   ASP A N     1 
ATOM   148   C  CA    . ASP A 1 22   ? -57.061 -47.759 -55.244 1.00 71.40  ? 22   ASP A CA    1 
ATOM   149   C  C     . ASP A 1 22   ? -57.805 -46.781 -54.324 1.00 70.56  ? 22   ASP A C     1 
ATOM   150   O  O     . ASP A 1 22   ? -57.593 -45.573 -54.438 1.00 68.56  ? 22   ASP A O     1 
ATOM   151   C  CB    . ASP A 1 22   ? -55.545 -47.660 -55.036 1.00 71.09  ? 22   ASP A CB    1 
ATOM   152   C  CG    . ASP A 1 22   ? -55.091 -48.073 -53.620 1.00 73.78  ? 22   ASP A CG    1 
ATOM   153   O  OD1   . ASP A 1 22   ? -55.908 -48.552 -52.798 1.00 74.30  ? 22   ASP A OD1   1 
ATOM   154   O  OD2   . ASP A 1 22   ? -53.881 -47.912 -53.325 1.00 75.38  ? 22   ASP A OD2   1 
ATOM   155   N  N     . PRO A 1 23   ? -58.688 -47.296 -53.426 1.00 70.18  ? 23   PRO A N     1 
ATOM   156   C  CA    . PRO A 1 23   ? -59.440 -46.410 -52.513 1.00 68.96  ? 23   PRO A CA    1 
ATOM   157   C  C     . PRO A 1 23   ? -58.588 -45.567 -51.558 1.00 66.58  ? 23   PRO A C     1 
ATOM   158   O  O     . PRO A 1 23   ? -59.039 -44.492 -51.131 1.00 66.68  ? 23   PRO A O     1 
ATOM   159   C  CB    . PRO A 1 23   ? -60.306 -47.380 -51.707 1.00 70.19  ? 23   PRO A CB    1 
ATOM   160   C  CG    . PRO A 1 23   ? -60.375 -48.616 -52.521 1.00 71.37  ? 23   PRO A CG    1 
ATOM   161   C  CD    . PRO A 1 23   ? -59.071 -48.709 -53.233 1.00 70.36  ? 23   PRO A CD    1 
ATOM   162   N  N     . GLU A 1 24   ? -57.380 -46.056 -51.245 1.00 63.71  ? 24   GLU A N     1 
ATOM   163   C  CA    . GLU A 1 24   ? -56.422 -45.354 -50.376 1.00 61.29  ? 24   GLU A CA    1 
ATOM   164   C  C     . GLU A 1 24   ? -55.748 -44.139 -51.009 1.00 59.10  ? 24   GLU A C     1 
ATOM   165   O  O     . GLU A 1 24   ? -55.041 -43.422 -50.319 1.00 60.27  ? 24   GLU A O     1 
ATOM   166   C  CB    . GLU A 1 24   ? -55.349 -46.323 -49.855 1.00 60.56  ? 24   GLU A CB    1 
ATOM   167   C  CG    . GLU A 1 24   ? -55.867 -47.252 -48.776 1.00 61.96  ? 24   GLU A CG    1 
ATOM   168   C  CD    . GLU A 1 24   ? -54.834 -48.264 -48.320 1.00 63.40  ? 24   GLU A CD    1 
ATOM   169   O  OE1   . GLU A 1 24   ? -54.451 -49.148 -49.131 1.00 64.78  ? 24   GLU A OE1   1 
ATOM   170   O  OE2   . GLU A 1 24   ? -54.417 -48.194 -47.141 1.00 63.27  ? 24   GLU A OE2   1 
ATOM   171   N  N     . THR A 1 25   ? -55.953 -43.904 -52.301 1.00 57.87  ? 25   THR A N     1 
ATOM   172   C  CA    . THR A 1 25   ? -55.437 -42.711 -52.967 1.00 56.94  ? 25   THR A CA    1 
ATOM   173   C  C     . THR A 1 25   ? -56.035 -41.416 -52.408 1.00 57.47  ? 25   THR A C     1 
ATOM   174   O  O     . THR A 1 25   ? -57.238 -41.178 -52.534 1.00 58.17  ? 25   THR A O     1 
ATOM   175   C  CB    . THR A 1 25   ? -55.748 -42.749 -54.480 1.00 57.02  ? 25   THR A CB    1 
ATOM   176   O  OG1   . THR A 1 25   ? -55.356 -44.014 -55.029 1.00 58.10  ? 25   THR A OG1   1 
ATOM   177   C  CG2   . THR A 1 25   ? -55.038 -41.611 -55.220 1.00 55.73  ? 25   THR A CG2   1 
ATOM   178   N  N     . MET A 1 26   ? -55.194 -40.586 -51.796 1.00 57.44  ? 26   MET A N     1 
ATOM   179   C  CA    . MET A 1 26   ? -55.595 -39.235 -51.401 1.00 57.72  ? 26   MET A CA    1 
ATOM   180   C  C     . MET A 1 26   ? -55.434 -38.262 -52.566 1.00 55.03  ? 26   MET A C     1 
ATOM   181   O  O     . MET A 1 26   ? -54.599 -38.476 -53.438 1.00 54.46  ? 26   MET A O     1 
ATOM   182   C  CB    . MET A 1 26   ? -54.792 -38.765 -50.189 1.00 59.46  ? 26   MET A CB    1 
ATOM   183   C  CG    . MET A 1 26   ? -55.006 -39.584 -48.914 1.00 62.16  ? 26   MET A CG    1 
ATOM   184   S  SD    . MET A 1 26   ? -56.719 -39.721 -48.319 1.00 65.63  ? 26   MET A SD    1 
ATOM   185   C  CE    . MET A 1 26   ? -57.032 -41.445 -48.700 1.00 64.96  ? 26   MET A CE    1 
ATOM   186   N  N     . LEU A 1 27   ? -56.231 -37.192 -52.563 1.00 53.58  ? 27   LEU A N     1 
ATOM   187   C  CA    . LEU A 1 27   ? -56.290 -36.237 -53.681 1.00 52.33  ? 27   LEU A CA    1 
ATOM   188   C  C     . LEU A 1 27   ? -54.985 -35.484 -53.896 1.00 51.72  ? 27   LEU A C     1 
ATOM   189   O  O     . LEU A 1 27   ? -54.605 -35.244 -55.042 1.00 53.40  ? 27   LEU A O     1 
ATOM   190   C  CB    . LEU A 1 27   ? -57.440 -35.232 -53.507 1.00 52.52  ? 27   LEU A CB    1 
ATOM   191   C  CG    . LEU A 1 27   ? -57.607 -34.113 -54.559 1.00 51.99  ? 27   LEU A CG    1 
ATOM   192   C  CD1   . LEU A 1 27   ? -57.875 -34.658 -55.952 1.00 52.43  ? 27   LEU A CD1   1 
ATOM   193   C  CD2   . LEU A 1 27   ? -58.719 -33.163 -54.171 1.00 52.58  ? 27   LEU A CD2   1 
ATOM   194   N  N     . LEU A 1 28   ? -54.304 -35.100 -52.822 1.00 50.41  ? 28   LEU A N     1 
ATOM   195   C  CA    . LEU A 1 28   ? -53.076 -34.301 -52.956 1.00 48.99  ? 28   LEU A CA    1 
ATOM   196   C  C     . LEU A 1 28   ? -51.979 -35.007 -53.756 1.00 47.53  ? 28   LEU A C     1 
ATOM   197   O  O     . LEU A 1 28   ? -51.495 -34.449 -54.730 1.00 47.09  ? 28   LEU A O     1 
ATOM   198   C  CB    . LEU A 1 28   ? -52.550 -33.829 -51.588 1.00 48.52  ? 28   LEU A CB    1 
ATOM   199   C  CG    . LEU A 1 28   ? -51.274 -32.978 -51.594 1.00 47.03  ? 28   LEU A CG    1 
ATOM   200   C  CD1   . LEU A 1 28   ? -51.415 -31.807 -52.551 1.00 46.54  ? 28   LEU A CD1   1 
ATOM   201   C  CD2   . LEU A 1 28   ? -50.950 -32.499 -50.188 1.00 47.25  ? 28   LEU A CD2   1 
ATOM   202   N  N     . PRO A 1 29   ? -51.587 -36.227 -53.360 1.00 47.80  ? 29   PRO A N     1 
ATOM   203   C  CA    . PRO A 1 29   ? -50.613 -36.925 -54.219 1.00 47.66  ? 29   PRO A CA    1 
ATOM   204   C  C     . PRO A 1 29   ? -51.142 -37.264 -55.620 1.00 47.18  ? 29   PRO A C     1 
ATOM   205   O  O     . PRO A 1 29   ? -50.359 -37.322 -56.557 1.00 46.82  ? 29   PRO A O     1 
ATOM   206   C  CB    . PRO A 1 29   ? -50.277 -38.198 -53.427 1.00 47.42  ? 29   PRO A CB    1 
ATOM   207   C  CG    . PRO A 1 29   ? -51.399 -38.375 -52.478 1.00 48.53  ? 29   PRO A CG    1 
ATOM   208   C  CD    . PRO A 1 29   ? -51.885 -36.997 -52.140 1.00 48.41  ? 29   PRO A CD    1 
ATOM   209   N  N     . TYR A 1 30   ? -52.450 -37.474 -55.758 1.00 47.65  ? 30   TYR A N     1 
ATOM   210   C  CA    . TYR A 1 30   ? -53.047 -37.753 -57.068 1.00 48.40  ? 30   TYR A CA    1 
ATOM   211   C  C     . TYR A 1 30   ? -52.912 -36.568 -58.020 1.00 48.12  ? 30   TYR A C     1 
ATOM   212   O  O     . TYR A 1 30   ? -52.460 -36.739 -59.151 1.00 48.41  ? 30   TYR A O     1 
ATOM   213   C  CB    . TYR A 1 30   ? -54.522 -38.130 -56.934 1.00 49.04  ? 30   TYR A CB    1 
ATOM   214   C  CG    . TYR A 1 30   ? -55.132 -38.550 -58.235 1.00 49.54  ? 30   TYR A CG    1 
ATOM   215   C  CD1   . TYR A 1 30   ? -55.041 -39.866 -58.665 1.00 50.33  ? 30   TYR A CD1   1 
ATOM   216   C  CD2   . TYR A 1 30   ? -55.789 -37.631 -59.050 1.00 50.18  ? 30   TYR A CD2   1 
ATOM   217   C  CE1   . TYR A 1 30   ? -55.594 -40.262 -59.868 1.00 51.42  ? 30   TYR A CE1   1 
ATOM   218   C  CE2   . TYR A 1 30   ? -56.341 -38.012 -60.260 1.00 51.27  ? 30   TYR A CE2   1 
ATOM   219   C  CZ    . TYR A 1 30   ? -56.243 -39.330 -60.670 1.00 51.82  ? 30   TYR A CZ    1 
ATOM   220   O  OH    . TYR A 1 30   ? -56.793 -39.712 -61.875 1.00 53.18  ? 30   TYR A OH    1 
ATOM   221   N  N     . LEU A 1 31   ? -53.323 -35.385 -57.560 1.00 48.32  ? 31   LEU A N     1 
ATOM   222   C  CA    . LEU A 1 31   ? -53.140 -34.138 -58.313 1.00 49.11  ? 31   LEU A CA    1 
ATOM   223   C  C     . LEU A 1 31   ? -51.703 -33.930 -58.770 1.00 48.50  ? 31   LEU A C     1 
ATOM   224   O  O     . LEU A 1 31   ? -51.459 -33.636 -59.937 1.00 48.51  ? 31   LEU A O     1 
ATOM   225   C  CB    . LEU A 1 31   ? -53.526 -32.933 -57.461 1.00 49.93  ? 31   LEU A CB    1 
ATOM   226   C  CG    . LEU A 1 31   ? -55.007 -32.706 -57.192 1.00 51.38  ? 31   LEU A CG    1 
ATOM   227   C  CD1   . LEU A 1 31   ? -55.184 -31.597 -56.170 1.00 51.24  ? 31   LEU A CD1   1 
ATOM   228   C  CD2   . LEU A 1 31   ? -55.736 -32.368 -58.478 1.00 52.83  ? 31   LEU A CD2   1 
ATOM   229   N  N     . ARG A 1 32   ? -50.765 -34.096 -57.842 1.00 48.44  ? 32   ARG A N     1 
ATOM   230   C  CA    . ARG A 1 32   ? -49.353 -33.803 -58.099 1.00 49.00  ? 32   ARG A CA    1 
ATOM   231   C  C     . ARG A 1 32   ? -48.638 -34.847 -58.940 1.00 50.61  ? 32   ARG A C     1 
ATOM   232   O  O     . ARG A 1 32   ? -47.808 -34.490 -59.775 1.00 51.75  ? 32   ARG A O     1 
ATOM   233   C  CB    . ARG A 1 32   ? -48.594 -33.636 -56.784 1.00 48.11  ? 32   ARG A CB    1 
ATOM   234   C  CG    . ARG A 1 32   ? -49.073 -32.476 -55.924 1.00 47.35  ? 32   ARG A CG    1 
ATOM   235   C  CD    . ARG A 1 32   ? -48.342 -32.464 -54.593 1.00 46.50  ? 32   ARG A CD    1 
ATOM   236   N  NE    . ARG A 1 32   ? -46.914 -32.333 -54.828 1.00 45.82  ? 32   ARG A NE    1 
ATOM   237   C  CZ    . ARG A 1 32   ? -46.290 -31.223 -55.206 1.00 44.93  ? 32   ARG A CZ    1 
ATOM   238   N  NH1   . ARG A 1 32   ? -46.941 -30.074 -55.368 1.00 45.20  ? 32   ARG A NH1   1 
ATOM   239   N  NH2   . ARG A 1 32   ? -44.984 -31.269 -55.422 1.00 45.55  ? 32   ARG A NH2   1 
ATOM   240   N  N     . LYS A 1 33   ? -48.932 -36.125 -58.703 1.00 52.43  ? 33   LYS A N     1 
ATOM   241   C  CA    . LYS A 1 33   ? -48.198 -37.220 -59.339 1.00 53.36  ? 33   LYS A CA    1 
ATOM   242   C  C     . LYS A 1 33   ? -48.901 -37.760 -60.570 1.00 53.17  ? 33   LYS A C     1 
ATOM   243   O  O     . LYS A 1 33   ? -48.266 -37.932 -61.613 1.00 54.20  ? 33   LYS A O     1 
ATOM   244   C  CB    . LYS A 1 33   ? -47.929 -38.334 -58.337 1.00 56.01  ? 33   LYS A CB    1 
ATOM   245   C  CG    . LYS A 1 33   ? -47.036 -37.883 -57.194 1.00 58.76  ? 33   LYS A CG    1 
ATOM   246   C  CD    . LYS A 1 33   ? -46.751 -38.992 -56.187 1.00 63.26  ? 33   LYS A CD    1 
ATOM   247   C  CE    . LYS A 1 33   ? -45.763 -38.508 -55.115 1.00 66.92  ? 33   LYS A CE    1 
ATOM   248   N  NZ    . LYS A 1 33   ? -45.064 -39.586 -54.335 1.00 68.06  ? 33   LYS A NZ    1 
ATOM   249   N  N     . LYS A 1 34   ? -50.203 -38.007 -60.469 1.00 53.08  ? 34   LYS A N     1 
ATOM   250   C  CA    . LYS A 1 34   ? -50.949 -38.597 -61.581 1.00 53.57  ? 34   LYS A CA    1 
ATOM   251   C  C     . LYS A 1 34   ? -51.457 -37.559 -62.585 1.00 52.42  ? 34   LYS A C     1 
ATOM   252   O  O     . LYS A 1 34   ? -51.505 -37.841 -63.764 1.00 51.79  ? 34   LYS A O     1 
ATOM   253   C  CB    . LYS A 1 34   ? -52.087 -39.469 -61.052 1.00 56.01  ? 34   LYS A CB    1 
ATOM   254   C  CG    . LYS A 1 34   ? -52.996 -40.078 -62.112 1.00 59.64  ? 34   LYS A CG    1 
ATOM   255   C  CD    . LYS A 1 34   ? -52.298 -41.057 -63.043 1.00 61.39  ? 34   LYS A CD    1 
ATOM   256   C  CE    . LYS A 1 34   ? -53.253 -41.555 -64.116 1.00 63.60  ? 34   LYS A CE    1 
ATOM   257   N  NZ    . LYS A 1 34   ? -53.185 -43.035 -64.245 1.00 65.88  ? 34   LYS A NZ    1 
ATOM   258   N  N     . LEU A 1 35   ? -51.853 -36.375 -62.130 1.00 52.61  ? 35   LEU A N     1 
ATOM   259   C  CA    . LEU A 1 35   ? -52.269 -35.309 -63.047 1.00 52.83  ? 35   LEU A CA    1 
ATOM   260   C  C     . LEU A 1 35   ? -51.182 -34.274 -63.324 1.00 52.47  ? 35   LEU A C     1 
ATOM   261   O  O     . LEU A 1 35   ? -51.371 -33.429 -64.179 1.00 52.46  ? 35   LEU A O     1 
ATOM   262   C  CB    . LEU A 1 35   ? -53.513 -34.584 -62.530 1.00 53.24  ? 35   LEU A CB    1 
ATOM   263   C  CG    . LEU A 1 35   ? -54.749 -35.390 -62.126 1.00 54.20  ? 35   LEU A CG    1 
ATOM   264   C  CD1   . LEU A 1 35   ? -55.925 -34.443 -61.940 1.00 54.42  ? 35   LEU A CD1   1 
ATOM   265   C  CD2   . LEU A 1 35   ? -55.097 -36.474 -63.131 1.00 54.60  ? 35   LEU A CD2   1 
ATOM   266   N  N     . ARG A 1 36   ? -50.067 -34.319 -62.600 1.00 52.58  ? 36   ARG A N     1 
ATOM   267   C  CA    . ARG A 1 36   ? -48.965 -33.367 -62.793 1.00 53.19  ? 36   ARG A CA    1 
ATOM   268   C  C     . ARG A 1 36   ? -49.384 -31.915 -62.570 1.00 52.55  ? 36   ARG A C     1 
ATOM   269   O  O     . ARG A 1 36   ? -48.949 -31.011 -63.282 1.00 54.43  ? 36   ARG A O     1 
ATOM   270   C  CB    . ARG A 1 36   ? -48.287 -33.539 -64.177 1.00 53.62  ? 36   ARG A CB    1 
ATOM   271   C  CG    . ARG A 1 36   ? -47.428 -34.779 -64.321 1.00 53.20  ? 36   ARG A CG    1 
ATOM   272   C  CD    . ARG A 1 36   ? -48.240 -36.039 -64.519 1.00 54.45  ? 36   ARG A CD    1 
ATOM   273   N  NE    . ARG A 1 36   ? -47.382 -37.140 -64.946 1.00 55.41  ? 36   ARG A NE    1 
ATOM   274   C  CZ    . ARG A 1 36   ? -47.795 -38.384 -65.192 1.00 55.71  ? 36   ARG A CZ    1 
ATOM   275   N  NH1   . ARG A 1 36   ? -49.071 -38.728 -65.051 1.00 56.05  ? 36   ARG A NH1   1 
ATOM   276   N  NH2   . ARG A 1 36   ? -46.915 -39.301 -65.571 1.00 55.22  ? 36   ARG A NH2   1 
ATOM   277   N  N     . LEU A 1 37   ? -50.227 -31.702 -61.571 1.00 51.86  ? 37   LEU A N     1 
ATOM   278   C  CA    . LEU A 1 37   ? -50.614 -30.362 -61.145 1.00 50.88  ? 37   LEU A CA    1 
ATOM   279   C  C     . LEU A 1 37   ? -49.941 -30.134 -59.802 1.00 50.15  ? 37   LEU A C     1 
ATOM   280   O  O     . LEU A 1 37   ? -50.440 -30.540 -58.767 1.00 51.29  ? 37   LEU A O     1 
ATOM   281   C  CB    . LEU A 1 37   ? -52.133 -30.265 -61.033 1.00 51.27  ? 37   LEU A CB    1 
ATOM   282   C  CG    . LEU A 1 37   ? -52.858 -30.472 -62.362 1.00 51.05  ? 37   LEU A CG    1 
ATOM   283   C  CD1   . LEU A 1 37   ? -54.299 -30.874 -62.111 1.00 51.41  ? 37   LEU A CD1   1 
ATOM   284   C  CD2   . LEU A 1 37   ? -52.764 -29.232 -63.234 1.00 50.61  ? 37   LEU A CD2   1 
ATOM   285   N  N     . THR A 1 38   ? -48.783 -29.498 -59.831 1.00 50.20  ? 38   THR A N     1 
ATOM   286   C  CA    . THR A 1 38   ? -47.937 -29.374 -58.649 1.00 49.30  ? 38   THR A CA    1 
ATOM   287   C  C     . THR A 1 38   ? -48.124 -28.042 -57.911 1.00 48.99  ? 38   THR A C     1 
ATOM   288   O  O     . THR A 1 38   ? -47.374 -27.747 -56.981 1.00 48.29  ? 38   THR A O     1 
ATOM   289   C  CB    . THR A 1 38   ? -46.445 -29.600 -59.031 1.00 48.69  ? 38   THR A CB    1 
ATOM   290   O  OG1   . THR A 1 38   ? -46.053 -28.686 -60.061 1.00 46.84  ? 38   THR A OG1   1 
ATOM   291   C  CG2   . THR A 1 38   ? -46.232 -31.046 -59.524 1.00 48.14  ? 38   THR A CG2   1 
ATOM   292   N  N     . GLY A 1 39   ? -49.118 -27.248 -58.314 1.00 48.73  ? 39   GLY A N     1 
ATOM   293   C  CA    . GLY A 1 39   ? -49.445 -26.002 -57.619 1.00 49.49  ? 39   GLY A CA    1 
ATOM   294   C  C     . GLY A 1 39   ? -49.912 -26.231 -56.184 1.00 49.31  ? 39   GLY A C     1 
ATOM   295   O  O     . GLY A 1 39   ? -49.533 -25.497 -55.275 1.00 50.05  ? 39   GLY A O     1 
ATOM   296   N  N     . THR A 1 40   ? -50.728 -27.257 -55.987 1.00 48.35  ? 40   THR A N     1 
ATOM   297   C  CA    . THR A 1 40   ? -51.173 -27.662 -54.664 1.00 49.05  ? 40   THR A CA    1 
ATOM   298   C  C     . THR A 1 40   ? -50.016 -28.340 -53.907 1.00 49.85  ? 40   THR A C     1 
ATOM   299   O  O     . THR A 1 40   ? -49.488 -29.351 -54.357 1.00 50.19  ? 40   THR A O     1 
ATOM   300   C  CB    . THR A 1 40   ? -52.368 -28.622 -54.783 1.00 49.15  ? 40   THR A CB    1 
ATOM   301   O  OG1   . THR A 1 40   ? -53.331 -28.067 -55.683 1.00 50.53  ? 40   THR A OG1   1 
ATOM   302   C  CG2   . THR A 1 40   ? -53.028 -28.851 -53.453 1.00 49.55  ? 40   THR A CG2   1 
ATOM   303   N  N     . LYS A 1 41   ? -49.650 -27.786 -52.753 1.00 50.36  ? 41   LYS A N     1 
ATOM   304   C  CA    . LYS A 1 41   ? -48.443 -28.178 -52.028 1.00 50.34  ? 41   LYS A CA    1 
ATOM   305   C  C     . LYS A 1 41   ? -48.729 -29.009 -50.795 1.00 50.50  ? 41   LYS A C     1 
ATOM   306   O  O     . LYS A 1 41   ? -49.807 -28.913 -50.212 1.00 50.93  ? 41   LYS A O     1 
ATOM   307   C  CB    . LYS A 1 41   ? -47.702 -26.929 -51.553 1.00 51.14  ? 41   LYS A CB    1 
ATOM   308   C  CG    . LYS A 1 41   ? -47.458 -25.866 -52.612 1.00 51.38  ? 41   LYS A CG    1 
ATOM   309   C  CD    . LYS A 1 41   ? -46.720 -26.416 -53.812 1.00 51.31  ? 41   LYS A CD    1 
ATOM   310   C  CE    . LYS A 1 41   ? -46.282 -25.278 -54.710 1.00 52.41  ? 41   LYS A CE    1 
ATOM   311   N  NZ    . LYS A 1 41   ? -45.750 -25.739 -56.016 1.00 52.95  ? 41   LYS A NZ    1 
ATOM   312   N  N     . TYR A 1 42   ? -47.739 -29.805 -50.393 1.00 51.16  ? 42   TYR A N     1 
ATOM   313   C  CA    . TYR A 1 42   ? -47.740 -30.450 -49.083 1.00 51.73  ? 42   TYR A CA    1 
ATOM   314   C  C     . TYR A 1 42   ? -47.066 -29.495 -48.105 1.00 52.57  ? 42   TYR A C     1 
ATOM   315   O  O     . TYR A 1 42   ? -45.940 -29.058 -48.337 1.00 51.98  ? 42   TYR A O     1 
ATOM   316   C  CB    . TYR A 1 42   ? -47.019 -31.808 -49.109 1.00 50.75  ? 42   TYR A CB    1 
ATOM   317   C  CG    . TYR A 1 42   ? -46.831 -32.420 -47.734 1.00 51.16  ? 42   TYR A CG    1 
ATOM   318   C  CD1   . TYR A 1 42   ? -45.730 -32.069 -46.945 1.00 51.57  ? 42   TYR A CD1   1 
ATOM   319   C  CD2   . TYR A 1 42   ? -47.757 -33.340 -47.205 1.00 51.36  ? 42   TYR A CD2   1 
ATOM   320   C  CE1   . TYR A 1 42   ? -45.549 -32.603 -45.676 1.00 52.72  ? 42   TYR A CE1   1 
ATOM   321   C  CE2   . TYR A 1 42   ? -47.579 -33.890 -45.930 1.00 52.08  ? 42   TYR A CE2   1 
ATOM   322   C  CZ    . TYR A 1 42   ? -46.469 -33.513 -45.168 1.00 53.11  ? 42   TYR A CZ    1 
ATOM   323   O  OH    . TYR A 1 42   ? -46.242 -34.019 -43.900 1.00 55.08  ? 42   TYR A OH    1 
ATOM   324   N  N     . GLY A 1 43   ? -47.768 -29.178 -47.020 1.00 55.09  ? 43   GLY A N     1 
ATOM   325   C  CA    . GLY A 1 43   ? -47.222 -28.373 -45.926 1.00 56.60  ? 43   GLY A CA    1 
ATOM   326   C  C     . GLY A 1 43   ? -47.103 -29.160 -44.636 1.00 58.44  ? 43   GLY A C     1 
ATOM   327   O  O     . GLY A 1 43   ? -46.078 -29.088 -43.968 1.00 60.67  ? 43   GLY A O     1 
ATOM   328   N  N     . CYS A 1 44   ? -48.153 -29.894 -44.275 1.00 60.24  ? 44   CYS A N     1 
ATOM   329   C  CA    . CYS A 1 44   ? -48.159 -30.694 -43.045 1.00 63.31  ? 44   CYS A CA    1 
ATOM   330   C  C     . CYS A 1 44   ? -49.008 -31.981 -43.036 1.00 63.75  ? 44   CYS A C     1 
ATOM   331   O  O     . CYS A 1 44   ? -48.810 -32.809 -42.160 1.00 65.78  ? 44   CYS A O     1 
ATOM   332   C  CB    . CYS A 1 44   ? -48.519 -29.808 -41.837 1.00 65.43  ? 44   CYS A CB    1 
ATOM   333   S  SG    . CYS A 1 44   ? -50.263 -29.357 -41.681 1.00 68.81  ? 44   CYS A SG    1 
ATOM   334   N  N     . GLY A 1 45   ? -49.943 -32.167 -43.967 1.00 64.30  ? 45   GLY A N     1 
ATOM   335   C  CA    . GLY A 1 45   ? -50.686 -33.434 -44.068 1.00 66.28  ? 45   GLY A CA    1 
ATOM   336   C  C     . GLY A 1 45   ? -51.670 -33.768 -42.942 1.00 68.67  ? 45   GLY A C     1 
ATOM   337   O  O     . GLY A 1 45   ? -52.152 -34.904 -42.845 1.00 68.53  ? 45   GLY A O     1 
ATOM   338   N  N     . GLY A 1 46   ? -51.967 -32.788 -42.089 1.00 69.33  ? 46   GLY A N     1 
ATOM   339   C  CA    . GLY A 1 46   ? -52.984 -32.927 -41.059 1.00 68.87  ? 46   GLY A CA    1 
ATOM   340   C  C     . GLY A 1 46   ? -54.119 -31.927 -41.167 1.00 67.54  ? 46   GLY A C     1 
ATOM   341   O  O     . GLY A 1 46   ? -54.987 -31.920 -40.305 1.00 69.18  ? 46   GLY A O     1 
ATOM   342   N  N     . GLY A 1 47   ? -54.128 -31.090 -42.207 1.00 65.73  ? 47   GLY A N     1 
ATOM   343   C  CA    . GLY A 1 47   ? -55.183 -30.085 -42.395 1.00 65.40  ? 47   GLY A CA    1 
ATOM   344   C  C     . GLY A 1 47   ? -54.957 -28.745 -41.700 1.00 64.74  ? 47   GLY A C     1 
ATOM   345   O  O     . GLY A 1 47   ? -55.838 -27.871 -41.735 1.00 64.34  ? 47   GLY A O     1 
ATOM   346   N  N     . GLY A 1 48   ? -53.784 -28.571 -41.087 1.00 62.56  ? 48   GLY A N     1 
ATOM   347   C  CA    . GLY A 1 48   ? -53.501 -27.398 -40.261 1.00 61.51  ? 48   GLY A CA    1 
ATOM   348   C  C     . GLY A 1 48   ? -53.089 -26.142 -41.014 1.00 59.53  ? 48   GLY A C     1 
ATOM   349   O  O     . GLY A 1 48   ? -53.483 -25.024 -40.644 1.00 59.07  ? 48   GLY A O     1 
ATOM   350   N  N     . CYS A 1 49   ? -52.305 -26.324 -42.074 1.00 57.04  ? 49   CYS A N     1 
ATOM   351   C  CA    . CYS A 1 49   ? -51.579 -25.224 -42.712 1.00 54.53  ? 49   CYS A CA    1 
ATOM   352   C  C     . CYS A 1 49   ? -52.300 -24.609 -43.900 1.00 51.90  ? 49   CYS A C     1 
ATOM   353   O  O     . CYS A 1 49   ? -52.070 -23.458 -44.207 1.00 52.76  ? 49   CYS A O     1 
ATOM   354   C  CB    . CYS A 1 49   ? -50.185 -25.693 -43.150 1.00 54.12  ? 49   CYS A CB    1 
ATOM   355   S  SG    . CYS A 1 49   ? -50.166 -26.638 -44.694 1.00 55.19  ? 49   CYS A SG    1 
ATOM   356   N  N     . GLY A 1 50   ? -53.115 -25.383 -44.601 1.00 50.40  ? 50   GLY A N     1 
ATOM   357   C  CA    . GLY A 1 50   ? -53.857 -24.877 -45.752 1.00 50.19  ? 50   GLY A CA    1 
ATOM   358   C  C     . GLY A 1 50   ? -53.083 -24.752 -47.051 1.00 49.50  ? 50   GLY A C     1 
ATOM   359   O  O     . GLY A 1 50   ? -53.573 -24.149 -48.000 1.00 50.23  ? 50   GLY A O     1 
ATOM   360   N  N     . ALA A 1 51   ? -51.896 -25.339 -47.122 1.00 48.96  ? 51   ALA A N     1 
ATOM   361   C  CA    . ALA A 1 51   ? -51.085 -25.289 -48.339 1.00 49.02  ? 51   ALA A CA    1 
ATOM   362   C  C     . ALA A 1 51   ? -51.683 -26.116 -49.481 1.00 49.25  ? 51   ALA A C     1 
ATOM   363   O  O     . ALA A 1 51   ? -51.433 -25.841 -50.654 1.00 49.74  ? 51   ALA A O     1 
ATOM   364   C  CB    . ALA A 1 51   ? -49.662 -25.746 -48.034 1.00 49.02  ? 51   ALA A CB    1 
ATOM   365   N  N     . CYS A 1 52   ? -52.477 -27.122 -49.129 1.00 50.09  ? 52   CYS A N     1 
ATOM   366   C  CA    . CYS A 1 52   ? -53.149 -27.973 -50.091 1.00 49.71  ? 52   CYS A CA    1 
ATOM   367   C  C     . CYS A 1 52   ? -54.616 -27.595 -50.323 1.00 50.17  ? 52   CYS A C     1 
ATOM   368   O  O     . CYS A 1 52   ? -55.426 -28.457 -50.678 1.00 50.76  ? 52   CYS A O     1 
ATOM   369   C  CB    . CYS A 1 52   ? -53.099 -29.388 -49.566 1.00 50.77  ? 52   CYS A CB    1 
ATOM   370   S  SG    . CYS A 1 52   ? -53.996 -29.540 -48.012 1.00 52.38  ? 52   CYS A SG    1 
ATOM   371   N  N     . THR A 1 53   ? -54.965 -26.321 -50.144 1.00 50.38  ? 53   THR A N     1 
ATOM   372   C  CA    . THR A 1 53   ? -56.364 -25.885 -50.250 1.00 51.06  ? 53   THR A CA    1 
ATOM   373   C  C     . THR A 1 53   ? -56.834 -25.939 -51.710 1.00 51.18  ? 53   THR A C     1 
ATOM   374   O  O     . THR A 1 53   ? -56.128 -25.494 -52.607 1.00 51.62  ? 53   THR A O     1 
ATOM   375   C  CB    . THR A 1 53   ? -56.588 -24.467 -49.652 1.00 50.97  ? 53   THR A CB    1 
ATOM   376   O  OG1   . THR A 1 53   ? -56.253 -24.472 -48.259 1.00 50.69  ? 53   THR A OG1   1 
ATOM   377   C  CG2   . THR A 1 53   ? -58.039 -24.028 -49.781 1.00 51.93  ? 53   THR A CG2   1 
ATOM   378   N  N     . VAL A 1 54   ? -58.020 -26.502 -51.928 1.00 51.77  ? 54   VAL A N     1 
ATOM   379   C  CA    . VAL A 1 54   ? -58.663 -26.541 -53.248 1.00 51.99  ? 54   VAL A CA    1 
ATOM   380   C  C     . VAL A 1 54   ? -60.138 -26.164 -53.126 1.00 53.22  ? 54   VAL A C     1 
ATOM   381   O  O     . VAL A 1 54   ? -60.664 -26.101 -52.021 1.00 54.77  ? 54   VAL A O     1 
ATOM   382   C  CB    . VAL A 1 54   ? -58.544 -27.937 -53.886 1.00 51.76  ? 54   VAL A CB    1 
ATOM   383   C  CG1   . VAL A 1 54   ? -57.082 -28.272 -54.147 1.00 51.38  ? 54   VAL A CG1   1 
ATOM   384   C  CG2   . VAL A 1 54   ? -59.191 -29.019 -53.023 1.00 52.07  ? 54   VAL A CG2   1 
ATOM   385   N  N     . MET A 1 55   ? -60.796 -25.918 -54.255 1.00 53.34  ? 55   MET A N     1 
ATOM   386   C  CA    . MET A 1 55   ? -62.252 -25.754 -54.292 1.00 54.53  ? 55   MET A CA    1 
ATOM   387   C  C     . MET A 1 55   ? -62.919 -27.056 -54.729 1.00 54.76  ? 55   MET A C     1 
ATOM   388   O  O     . MET A 1 55   ? -62.424 -27.738 -55.616 1.00 55.77  ? 55   MET A O     1 
ATOM   389   C  CB    . MET A 1 55   ? -62.647 -24.629 -55.250 1.00 55.27  ? 55   MET A CB    1 
ATOM   390   C  CG    . MET A 1 55   ? -64.028 -24.066 -54.955 1.00 57.23  ? 55   MET A CG    1 
ATOM   391   S  SD    . MET A 1 55   ? -64.512 -22.667 -55.989 1.00 58.15  ? 55   MET A SD    1 
ATOM   392   C  CE    . MET A 1 55   ? -64.946 -23.474 -57.529 1.00 58.61  ? 55   MET A CE    1 
ATOM   393   N  N     . ILE A 1 56   ? -64.035 -27.397 -54.098 1.00 55.23  ? 56   ILE A N     1 
ATOM   394   C  CA    . ILE A 1 56   ? -64.854 -28.541 -54.489 1.00 55.62  ? 56   ILE A CA    1 
ATOM   395   C  C     . ILE A 1 56   ? -66.229 -27.989 -54.848 1.00 57.40  ? 56   ILE A C     1 
ATOM   396   O  O     . ILE A 1 56   ? -66.796 -27.219 -54.082 1.00 57.69  ? 56   ILE A O     1 
ATOM   397   C  CB    . ILE A 1 56   ? -65.018 -29.564 -53.341 1.00 55.30  ? 56   ILE A CB    1 
ATOM   398   C  CG1   . ILE A 1 56   ? -63.664 -29.938 -52.727 1.00 54.27  ? 56   ILE A CG1   1 
ATOM   399   C  CG2   . ILE A 1 56   ? -65.749 -30.813 -53.827 1.00 55.72  ? 56   ILE A CG2   1 
ATOM   400   C  CD1   . ILE A 1 56   ? -62.728 -30.668 -53.665 1.00 53.82  ? 56   ILE A CD1   1 
ATOM   401   N  N     . SER A 1 57   ? -66.748 -28.385 -56.008 1.00 58.46  ? 57   SER A N     1 
ATOM   402   C  CA    . SER A 1 57   ? -68.046 -27.946 -56.500 1.00 59.96  ? 57   SER A CA    1 
ATOM   403   C  C     . SER A 1 57   ? -68.946 -29.157 -56.688 1.00 61.67  ? 57   SER A C     1 
ATOM   404   O  O     . SER A 1 57   ? -68.468 -30.212 -57.075 1.00 62.23  ? 57   SER A O     1 
ATOM   405   C  CB    . SER A 1 57   ? -67.876 -27.216 -57.827 1.00 60.03  ? 57   SER A CB    1 
ATOM   406   O  OG    . SER A 1 57   ? -67.154 -26.004 -57.662 1.00 59.47  ? 57   SER A OG    1 
ATOM   407   N  N     . ARG A 1 58   ? -70.238 -29.006 -56.406 1.00 63.88  ? 58   ARG A N     1 
ATOM   408   C  CA    . ARG A 1 58   ? -71.225 -30.076 -56.596 1.00 66.33  ? 58   ARG A CA    1 
ATOM   409   C  C     . ARG A 1 58   ? -72.560 -29.489 -57.022 1.00 69.38  ? 58   ARG A C     1 
ATOM   410   O  O     . ARG A 1 58   ? -72.924 -28.410 -56.576 1.00 70.73  ? 58   ARG A O     1 
ATOM   411   C  CB    . ARG A 1 58   ? -71.429 -30.855 -55.300 1.00 67.13  ? 58   ARG A CB    1 
ATOM   412   C  CG    . ARG A 1 58   ? -70.255 -31.717 -54.881 1.00 67.08  ? 58   ARG A CG    1 
ATOM   413   C  CD    . ARG A 1 58   ? -70.475 -32.330 -53.512 1.00 67.92  ? 58   ARG A CD    1 
ATOM   414   N  NE    . ARG A 1 58   ? -69.262 -32.985 -53.027 1.00 68.57  ? 58   ARG A NE    1 
ATOM   415   C  CZ    . ARG A 1 58   ? -68.824 -34.189 -53.409 1.00 68.80  ? 58   ARG A CZ    1 
ATOM   416   N  NH1   . ARG A 1 58   ? -69.494 -34.920 -54.303 1.00 69.65  ? 58   ARG A NH1   1 
ATOM   417   N  NH2   . ARG A 1 58   ? -67.693 -34.669 -52.889 1.00 67.85  ? 58   ARG A NH2   1 
ATOM   418   N  N     . TYR A 1 59   ? -73.287 -30.191 -57.882 1.00 71.86  ? 59   TYR A N     1 
ATOM   419   C  CA    . TYR A 1 59   ? -74.612 -29.752 -58.295 1.00 75.17  ? 59   TYR A CA    1 
ATOM   420   C  C     . TYR A 1 59   ? -75.625 -30.486 -57.458 1.00 77.33  ? 59   TYR A C     1 
ATOM   421   O  O     . TYR A 1 59   ? -75.675 -31.714 -57.475 1.00 76.55  ? 59   TYR A O     1 
ATOM   422   C  CB    . TYR A 1 59   ? -74.858 -30.055 -59.768 1.00 77.32  ? 59   TYR A CB    1 
ATOM   423   C  CG    . TYR A 1 59   ? -76.195 -29.567 -60.284 1.00 79.97  ? 59   TYR A CG    1 
ATOM   424   C  CD1   . TYR A 1 59   ? -76.415 -28.212 -60.513 1.00 81.61  ? 59   TYR A CD1   1 
ATOM   425   C  CD2   . TYR A 1 59   ? -77.234 -30.456 -60.566 1.00 81.58  ? 59   TYR A CD2   1 
ATOM   426   C  CE1   . TYR A 1 59   ? -77.635 -27.751 -60.995 1.00 84.05  ? 59   TYR A CE1   1 
ATOM   427   C  CE2   . TYR A 1 59   ? -78.457 -30.003 -61.046 1.00 83.89  ? 59   TYR A CE2   1 
ATOM   428   C  CZ    . TYR A 1 59   ? -78.654 -28.649 -61.255 1.00 84.95  ? 59   TYR A CZ    1 
ATOM   429   O  OH    . TYR A 1 59   ? -79.856 -28.171 -61.726 1.00 87.33  ? 59   TYR A OH    1 
ATOM   430   N  N     . ASN A 1 60   ? -76.429 -29.732 -56.719 1.00 80.54  ? 60   ASN A N     1 
ATOM   431   C  CA    . ASN A 1 60   ? -77.564 -30.301 -56.014 1.00 83.59  ? 60   ASN A CA    1 
ATOM   432   C  C     . ASN A 1 60   ? -78.734 -30.470 -57.000 1.00 85.56  ? 60   ASN A C     1 
ATOM   433   O  O     . ASN A 1 60   ? -79.292 -29.475 -57.474 1.00 85.05  ? 60   ASN A O     1 
ATOM   434   C  CB    . ASN A 1 60   ? -77.956 -29.402 -54.851 1.00 85.16  ? 60   ASN A CB    1 
ATOM   435   C  CG    . ASN A 1 60   ? -79.022 -30.017 -53.967 1.00 86.60  ? 60   ASN A CG    1 
ATOM   436   O  OD1   . ASN A 1 60   ? -79.837 -30.824 -54.412 1.00 87.36  ? 60   ASN A OD1   1 
ATOM   437   N  ND2   . ASN A 1 60   ? -79.028 -29.620 -52.704 1.00 87.30  ? 60   ASN A ND2   1 
ATOM   438   N  N     . PRO A 1 61   ? -79.108 -31.727 -57.306 1.00 87.44  ? 61   PRO A N     1 
ATOM   439   C  CA    . PRO A 1 61   ? -80.129 -31.954 -58.329 1.00 90.07  ? 61   PRO A CA    1 
ATOM   440   C  C     . PRO A 1 61   ? -81.561 -31.596 -57.891 1.00 92.97  ? 61   PRO A C     1 
ATOM   441   O  O     . PRO A 1 61   ? -82.363 -31.209 -58.744 1.00 92.84  ? 61   PRO A O     1 
ATOM   442   C  CB    . PRO A 1 61   ? -79.993 -33.448 -58.631 1.00 90.53  ? 61   PRO A CB    1 
ATOM   443   C  CG    . PRO A 1 61   ? -79.512 -34.040 -57.354 1.00 90.13  ? 61   PRO A CG    1 
ATOM   444   C  CD    . PRO A 1 61   ? -78.673 -32.990 -56.677 1.00 87.95  ? 61   PRO A CD    1 
ATOM   445   N  N     . ILE A 1 62   ? -81.882 -31.717 -56.598 1.00 94.54  ? 62   ILE A N     1 
ATOM   446   C  CA    . ILE A 1 62   ? -83.207 -31.297 -56.100 1.00 98.04  ? 62   ILE A CA    1 
ATOM   447   C  C     . ILE A 1 62   ? -83.351 -29.761 -55.995 1.00 97.61  ? 62   ILE A C     1 
ATOM   448   O  O     . ILE A 1 62   ? -84.359 -29.218 -56.452 1.00 99.10  ? 62   ILE A O     1 
ATOM   449   C  CB    . ILE A 1 62   ? -83.657 -32.031 -54.792 1.00 99.73  ? 62   ILE A CB    1 
ATOM   450   C  CG1   . ILE A 1 62   ? -82.776 -31.698 -53.571 1.00 99.31  ? 62   ILE A CG1   1 
ATOM   451   C  CG2   . ILE A 1 62   ? -83.694 -33.539 -55.012 1.00 99.82  ? 62   ILE A CG2   1 
ATOM   452   C  CD1   . ILE A 1 62   ? -83.336 -32.199 -52.253 1.00 99.98  ? 62   ILE A CD1   1 
ATOM   453   N  N     . THR A 1 63   ? -82.356 -29.067 -55.433 1.00 95.17  ? 63   THR A N     1 
ATOM   454   C  CA    . THR A 1 63   ? -82.422 -27.595 -55.284 1.00 95.17  ? 63   THR A CA    1 
ATOM   455   C  C     . THR A 1 63   ? -81.943 -26.815 -56.518 1.00 95.56  ? 63   THR A C     1 
ATOM   456   O  O     . THR A 1 63   ? -82.107 -25.598 -56.572 1.00 94.60  ? 63   THR A O     1 
ATOM   457   C  CB    . THR A 1 63   ? -81.638 -27.082 -54.053 1.00 94.09  ? 63   THR A CB    1 
ATOM   458   O  OG1   . THR A 1 63   ? -80.227 -27.147 -54.299 1.00 92.57  ? 63   THR A OG1   1 
ATOM   459   C  CG2   . THR A 1 63   ? -81.991 -27.882 -52.804 1.00 94.13  ? 63   THR A CG2   1 
ATOM   460   N  N     . LYS A 1 64   ? -81.364 -27.519 -57.496 1.00 97.09  ? 64   LYS A N     1 
ATOM   461   C  CA    . LYS A 1 64   ? -80.879 -26.938 -58.765 1.00 97.11  ? 64   LYS A CA    1 
ATOM   462   C  C     . LYS A 1 64   ? -79.718 -25.947 -58.571 1.00 93.26  ? 64   LYS A C     1 
ATOM   463   O  O     . LYS A 1 64   ? -79.524 -25.054 -59.397 1.00 91.51  ? 64   LYS A O     1 
ATOM   464   C  CB    . LYS A 1 64   ? -82.017 -26.269 -59.579 1.00 100.58 ? 64   LYS A CB    1 
ATOM   465   C  CG    . LYS A 1 64   ? -83.402 -26.929 -59.538 1.00 104.48 ? 64   LYS A CG    1 
ATOM   466   C  CD    . LYS A 1 64   ? -83.477 -28.321 -60.174 1.00 105.93 ? 64   LYS A CD    1 
ATOM   467   C  CE    . LYS A 1 64   ? -84.111 -28.337 -61.564 1.00 107.15 ? 64   LYS A CE    1 
ATOM   468   N  NZ    . LYS A 1 64   ? -83.095 -28.106 -62.630 1.00 106.63 ? 64   LYS A NZ    1 
ATOM   469   N  N     . ARG A 1 65   ? -78.944 -26.123 -57.499 1.00 90.72  ? 65   ARG A N     1 
ATOM   470   C  CA    . ARG A 1 65   ? -77.894 -25.174 -57.125 1.00 89.39  ? 65   ARG A CA    1 
ATOM   471   C  C     . ARG A 1 65   ? -76.517 -25.828 -57.090 1.00 83.97  ? 65   ARG A C     1 
ATOM   472   O  O     . ARG A 1 65   ? -76.373 -26.980 -56.669 1.00 82.00  ? 65   ARG A O     1 
ATOM   473   C  CB    . ARG A 1 65   ? -78.199 -24.554 -55.762 1.00 93.23  ? 65   ARG A CB    1 
ATOM   474   C  CG    . ARG A 1 65   ? -79.534 -23.822 -55.698 1.00 98.90  ? 65   ARG A CG    1 
ATOM   475   C  CD    . ARG A 1 65   ? -79.938 -23.409 -54.285 1.00 102.24 ? 65   ARG A CD    1 
ATOM   476   N  NE    . ARG A 1 65   ? -79.397 -22.095 -53.926 1.00 104.05 ? 65   ARG A NE    1 
ATOM   477   C  CZ    . ARG A 1 65   ? -78.193 -21.855 -53.394 1.00 104.74 ? 65   ARG A CZ    1 
ATOM   478   N  NH1   . ARG A 1 65   ? -77.329 -22.837 -53.114 1.00 105.33 ? 65   ARG A NH1   1 
ATOM   479   N  NH2   . ARG A 1 65   ? -77.842 -20.597 -53.127 1.00 105.80 ? 65   ARG A NH2   1 
ATOM   480   N  N     . ILE A 1 66   ? -75.516 -25.074 -57.543 1.00 80.08  ? 66   ILE A N     1 
ATOM   481   C  CA    . ILE A 1 66   ? -74.114 -25.481 -57.500 1.00 76.25  ? 66   ILE A CA    1 
ATOM   482   C  C     . ILE A 1 66   ? -73.512 -24.898 -56.222 1.00 73.88  ? 66   ILE A C     1 
ATOM   483   O  O     . ILE A 1 66   ? -73.515 -23.690 -56.053 1.00 72.29  ? 66   ILE A O     1 
ATOM   484   C  CB    . ILE A 1 66   ? -73.315 -24.950 -58.724 1.00 75.03  ? 66   ILE A CB    1 
ATOM   485   C  CG1   . ILE A 1 66   ? -73.960 -25.376 -60.054 1.00 75.31  ? 66   ILE A CG1   1 
ATOM   486   C  CG2   . ILE A 1 66   ? -71.869 -25.435 -58.677 1.00 73.25  ? 66   ILE A CG2   1 
ATOM   487   C  CD1   . ILE A 1 66   ? -73.627 -24.465 -61.220 1.00 74.72  ? 66   ILE A CD1   1 
ATOM   488   N  N     . ARG A 1 67   ? -73.002 -25.756 -55.339 1.00 73.73  ? 67   ARG A N     1 
ATOM   489   C  CA    . ARG A 1 67   ? -72.393 -25.354 -54.059 1.00 74.05  ? 67   ARG A CA    1 
ATOM   490   C  C     . ARG A 1 67   ? -70.862 -25.479 -54.153 1.00 69.40  ? 67   ARG A C     1 
ATOM   491   O  O     . ARG A 1 67   ? -70.362 -26.516 -54.558 1.00 66.80  ? 67   ARG A O     1 
ATOM   492   C  CB    . ARG A 1 67   ? -72.948 -26.245 -52.930 1.00 78.48  ? 67   ARG A CB    1 
ATOM   493   C  CG    . ARG A 1 67   ? -72.561 -25.860 -51.494 1.00 83.02  ? 67   ARG A CG    1 
ATOM   494   C  CD    . ARG A 1 67   ? -72.491 -27.079 -50.557 1.00 87.24  ? 67   ARG A CD    1 
ATOM   495   N  NE    . ARG A 1 67   ? -71.651 -26.849 -49.362 1.00 90.13  ? 67   ARG A NE    1 
ATOM   496   C  CZ    . ARG A 1 67   ? -71.079 -27.799 -48.602 1.00 90.60  ? 67   ARG A CZ    1 
ATOM   497   N  NH1   . ARG A 1 67   ? -71.225 -29.099 -48.877 1.00 90.79  ? 67   ARG A NH1   1 
ATOM   498   N  NH2   . ARG A 1 67   ? -70.343 -27.445 -47.544 1.00 89.74  ? 67   ARG A NH2   1 
ATOM   499   N  N     . HIS A 1 68   ? -70.140 -24.416 -53.792 1.00 67.49  ? 68   HIS A N     1 
ATOM   500   C  CA    . HIS A 1 68   ? -68.662 -24.376 -53.803 1.00 64.49  ? 68   HIS A CA    1 
ATOM   501   C  C     . HIS A 1 68   ? -68.129 -24.296 -52.376 1.00 62.66  ? 68   HIS A C     1 
ATOM   502   O  O     . HIS A 1 68   ? -68.460 -23.367 -51.658 1.00 63.96  ? 68   HIS A O     1 
ATOM   503   C  CB    . HIS A 1 68   ? -68.133 -23.135 -54.550 1.00 63.62  ? 68   HIS A CB    1 
ATOM   504   C  CG    . HIS A 1 68   ? -68.713 -22.929 -55.913 1.00 63.85  ? 68   HIS A CG    1 
ATOM   505   N  ND1   . HIS A 1 68   ? -68.305 -23.650 -57.014 1.00 63.99  ? 68   HIS A ND1   1 
ATOM   506   C  CD2   . HIS A 1 68   ? -69.640 -22.053 -56.362 1.00 65.08  ? 68   HIS A CD2   1 
ATOM   507   C  CE1   . HIS A 1 68   ? -68.970 -23.242 -58.079 1.00 64.12  ? 68   HIS A CE1   1 
ATOM   508   N  NE2   . HIS A 1 68   ? -69.786 -22.273 -57.711 1.00 65.37  ? 68   HIS A NE2   1 
ATOM   509   N  N     . HIS A 1 69   ? -67.290 -25.234 -51.964 1.00 61.34  ? 69   HIS A N     1 
ATOM   510   C  CA    . HIS A 1 69   ? -66.663 -25.152 -50.645 1.00 60.91  ? 69   HIS A CA    1 
ATOM   511   C  C     . HIS A 1 69   ? -65.149 -25.407 -50.703 1.00 58.72  ? 69   HIS A C     1 
ATOM   512   O  O     . HIS A 1 69   ? -64.696 -26.182 -51.529 1.00 57.29  ? 69   HIS A O     1 
ATOM   513   C  CB    . HIS A 1 69   ? -67.364 -26.090 -49.645 1.00 62.20  ? 69   HIS A CB    1 
ATOM   514   C  CG    . HIS A 1 69   ? -67.127 -27.552 -49.883 1.00 62.71  ? 69   HIS A CG    1 
ATOM   515   N  ND1   . HIS A 1 69   ? -65.994 -28.204 -49.442 1.00 61.89  ? 69   HIS A ND1   1 
ATOM   516   C  CD2   . HIS A 1 69   ? -67.897 -28.495 -50.476 1.00 63.50  ? 69   HIS A CD2   1 
ATOM   517   C  CE1   . HIS A 1 69   ? -66.061 -29.479 -49.780 1.00 61.98  ? 69   HIS A CE1   1 
ATOM   518   N  NE2   . HIS A 1 69   ? -67.208 -29.681 -50.405 1.00 63.42  ? 69   HIS A NE2   1 
ATOM   519   N  N     . PRO A 1 70   ? -64.367 -24.732 -49.834 1.00 57.96  ? 70   PRO A N     1 
ATOM   520   C  CA    . PRO A 1 70   ? -62.937 -25.003 -49.774 1.00 56.98  ? 70   PRO A CA    1 
ATOM   521   C  C     . PRO A 1 70   ? -62.656 -26.280 -48.996 1.00 57.15  ? 70   PRO A C     1 
ATOM   522   O  O     . PRO A 1 70   ? -63.483 -26.697 -48.185 1.00 57.39  ? 70   PRO A O     1 
ATOM   523   C  CB    . PRO A 1 70   ? -62.377 -23.780 -49.045 1.00 56.57  ? 70   PRO A CB    1 
ATOM   524   C  CG    . PRO A 1 70   ? -63.485 -23.337 -48.161 1.00 57.33  ? 70   PRO A CG    1 
ATOM   525   C  CD    . PRO A 1 70   ? -64.761 -23.689 -48.867 1.00 58.06  ? 70   PRO A CD    1 
ATOM   526   N  N     . ALA A 1 71   ? -61.501 -26.894 -49.260 1.00 56.63  ? 71   ALA A N     1 
ATOM   527   C  CA    . ALA A 1 71   ? -61.104 -28.139 -48.589 1.00 55.82  ? 71   ALA A CA    1 
ATOM   528   C  C     . ALA A 1 71   ? -59.605 -28.343 -48.681 1.00 54.20  ? 71   ALA A C     1 
ATOM   529   O  O     . ALA A 1 71   ? -58.971 -27.811 -49.584 1.00 52.81  ? 71   ALA A O     1 
ATOM   530   C  CB    . ALA A 1 71   ? -61.836 -29.324 -49.202 1.00 56.11  ? 71   ALA A CB    1 
ATOM   531   N  N     . ASN A 1 72   ? -59.052 -29.105 -47.736 1.00 54.65  ? 72   ASN A N     1 
ATOM   532   C  CA    . ASN A 1 72   ? -57.632 -29.476 -47.745 1.00 54.33  ? 72   ASN A CA    1 
ATOM   533   C  C     . ASN A 1 72   ? -57.467 -30.799 -48.467 1.00 52.87  ? 72   ASN A C     1 
ATOM   534   O  O     . ASN A 1 72   ? -57.971 -31.819 -48.011 1.00 52.47  ? 72   ASN A O     1 
ATOM   535   C  CB    . ASN A 1 72   ? -57.099 -29.610 -46.326 1.00 55.79  ? 72   ASN A CB    1 
ATOM   536   C  CG    . ASN A 1 72   ? -57.266 -28.339 -45.517 1.00 58.51  ? 72   ASN A CG    1 
ATOM   537   O  OD1   . ASN A 1 72   ? -57.891 -28.357 -44.450 1.00 61.10  ? 72   ASN A OD1   1 
ATOM   538   N  ND2   . ASN A 1 72   ? -56.721 -27.228 -46.013 1.00 58.68  ? 72   ASN A ND2   1 
ATOM   539   N  N     . ALA A 1 73   ? -56.763 -30.776 -49.593 1.00 51.63  ? 73   ALA A N     1 
ATOM   540   C  CA    . ALA A 1 73   ? -56.663 -31.947 -50.461 1.00 51.95  ? 73   ALA A CA    1 
ATOM   541   C  C     . ALA A 1 73   ? -55.950 -33.150 -49.820 1.00 51.68  ? 73   ALA A C     1 
ATOM   542   O  O     . ALA A 1 73   ? -56.244 -34.298 -50.184 1.00 50.37  ? 73   ALA A O     1 
ATOM   543   C  CB    . ALA A 1 73   ? -55.987 -31.572 -51.773 1.00 51.50  ? 73   ALA A CB    1 
ATOM   544   N  N     . CYS A 1 74   ? -55.038 -32.894 -48.873 1.00 51.03  ? 74   CYS A N     1 
ATOM   545   C  CA    . CYS A 1 74   ? -54.315 -33.964 -48.177 1.00 51.37  ? 74   CYS A CA    1 
ATOM   546   C  C     . CYS A 1 74   ? -55.242 -34.981 -47.508 1.00 53.43  ? 74   CYS A C     1 
ATOM   547   O  O     . CYS A 1 74   ? -54.933 -36.177 -47.485 1.00 54.42  ? 74   CYS A O     1 
ATOM   548   C  CB    . CYS A 1 74   ? -53.334 -33.389 -47.144 1.00 51.56  ? 74   CYS A CB    1 
ATOM   549   S  SG    . CYS A 1 74   ? -54.052 -32.377 -45.816 1.00 52.19  ? 74   CYS A SG    1 
ATOM   550   N  N     . LEU A 1 75   ? -56.384 -34.511 -46.996 1.00 54.94  ? 75   LEU A N     1 
ATOM   551   C  CA    . LEU A 1 75   ? -57.353 -35.361 -46.284 1.00 55.49  ? 75   LEU A CA    1 
ATOM   552   C  C     . LEU A 1 75   ? -58.531 -35.872 -47.130 1.00 56.14  ? 75   LEU A C     1 
ATOM   553   O  O     . LEU A 1 75   ? -59.376 -36.593 -46.602 1.00 57.50  ? 75   LEU A O     1 
ATOM   554   C  CB    . LEU A 1 75   ? -57.890 -34.627 -45.041 1.00 56.31  ? 75   LEU A CB    1 
ATOM   555   C  CG    . LEU A 1 75   ? -56.887 -34.350 -43.917 1.00 56.24  ? 75   LEU A CG    1 
ATOM   556   C  CD1   . LEU A 1 75   ? -57.474 -33.362 -42.925 1.00 57.23  ? 75   LEU A CD1   1 
ATOM   557   C  CD2   . LEU A 1 75   ? -56.470 -35.628 -43.210 1.00 56.70  ? 75   LEU A CD2   1 
ATOM   558   N  N     . ILE A 1 76   ? -58.600 -35.524 -48.416 1.00 55.65  ? 76   ILE A N     1 
ATOM   559   C  CA    . ILE A 1 76   ? -59.680 -36.004 -49.291 1.00 55.85  ? 76   ILE A CA    1 
ATOM   560   C  C     . ILE A 1 76   ? -59.276 -37.294 -50.002 1.00 56.46  ? 76   ILE A C     1 
ATOM   561   O  O     . ILE A 1 76   ? -58.349 -37.279 -50.791 1.00 56.96  ? 76   ILE A O     1 
ATOM   562   C  CB    . ILE A 1 76   ? -60.053 -34.958 -50.358 1.00 55.79  ? 76   ILE A CB    1 
ATOM   563   C  CG1   . ILE A 1 76   ? -60.510 -33.654 -49.674 1.00 56.06  ? 76   ILE A CG1   1 
ATOM   564   C  CG2   . ILE A 1 76   ? -61.131 -35.511 -51.295 1.00 56.30  ? 76   ILE A CG2   1 
ATOM   565   C  CD1   . ILE A 1 76   ? -60.607 -32.451 -50.586 1.00 55.85  ? 76   ILE A CD1   1 
ATOM   566   N  N     . PRO A 1 77   ? -59.972 -38.411 -49.737 1.00 58.09  ? 77   PRO A N     1 
ATOM   567   C  CA    . PRO A 1 77   ? -59.773 -39.602 -50.572 1.00 58.89  ? 77   PRO A CA    1 
ATOM   568   C  C     . PRO A 1 77   ? -60.523 -39.434 -51.879 1.00 59.44  ? 77   PRO A C     1 
ATOM   569   O  O     . PRO A 1 77   ? -61.694 -39.070 -51.845 1.00 60.75  ? 77   PRO A O     1 
ATOM   570   C  CB    . PRO A 1 77   ? -60.409 -40.727 -49.753 1.00 60.34  ? 77   PRO A CB    1 
ATOM   571   C  CG    . PRO A 1 77   ? -61.379 -40.050 -48.854 1.00 60.34  ? 77   PRO A CG    1 
ATOM   572   C  CD    . PRO A 1 77   ? -61.003 -38.618 -48.709 1.00 58.75  ? 77   PRO A CD    1 
ATOM   573   N  N     . ILE A 1 78   ? -59.871 -39.707 -53.008 1.00 59.46  ? 78   ILE A N     1 
ATOM   574   C  CA    . ILE A 1 78   ? -60.464 -39.428 -54.325 1.00 59.57  ? 78   ILE A CA    1 
ATOM   575   C  C     . ILE A 1 78   ? -61.780 -40.168 -54.605 1.00 60.69  ? 78   ILE A C     1 
ATOM   576   O  O     . ILE A 1 78   ? -62.630 -39.657 -55.347 1.00 59.50  ? 78   ILE A O     1 
ATOM   577   C  CB    . ILE A 1 78   ? -59.472 -39.605 -55.509 1.00 59.14  ? 78   ILE A CB    1 
ATOM   578   C  CG1   . ILE A 1 78   ? -58.931 -41.035 -55.618 1.00 60.12  ? 78   ILE A CG1   1 
ATOM   579   C  CG2   . ILE A 1 78   ? -58.326 -38.624 -55.390 1.00 58.04  ? 78   ILE A CG2   1 
ATOM   580   C  CD1   . ILE A 1 78   ? -58.205 -41.310 -56.927 1.00 59.73  ? 78   ILE A CD1   1 
ATOM   581   N  N     . CYS A 1 79   ? -61.976 -41.331 -53.987 1.00 61.60  ? 79   CYS A N     1 
ATOM   582   C  CA    . CYS A 1 79   ? -63.261 -42.027 -54.111 1.00 64.47  ? 79   CYS A CA    1 
ATOM   583   C  C     . CYS A 1 79   ? -64.469 -41.223 -53.601 1.00 65.16  ? 79   CYS A C     1 
ATOM   584   O  O     . CYS A 1 79   ? -65.590 -41.519 -53.988 1.00 68.74  ? 79   CYS A O     1 
ATOM   585   C  CB    . CYS A 1 79   ? -63.206 -43.406 -53.447 1.00 66.68  ? 79   CYS A CB    1 
ATOM   586   S  SG    . CYS A 1 79   ? -62.139 -44.578 -54.326 1.00 67.95  ? 79   CYS A SG    1 
ATOM   587   N  N     . SER A 1 80   ? -64.239 -40.222 -52.746 1.00 64.38  ? 80   SER A N     1 
ATOM   588   C  CA    . SER A 1 80   ? -65.269 -39.244 -52.357 1.00 63.99  ? 80   SER A CA    1 
ATOM   589   C  C     . SER A 1 80   ? -65.637 -38.212 -53.407 1.00 63.41  ? 80   SER A C     1 
ATOM   590   O  O     . SER A 1 80   ? -66.658 -37.546 -53.266 1.00 65.71  ? 80   SER A O     1 
ATOM   591   C  CB    . SER A 1 80   ? -64.819 -38.464 -51.130 1.00 63.75  ? 80   SER A CB    1 
ATOM   592   O  OG    . SER A 1 80   ? -64.597 -39.357 -50.067 1.00 66.06  ? 80   SER A OG    1 
ATOM   593   N  N     . LEU A 1 81   ? -64.811 -38.044 -54.435 1.00 61.65  ? 81   LEU A N     1 
ATOM   594   C  CA    . LEU A 1 81   ? -65.015 -36.979 -55.414 1.00 60.03  ? 81   LEU A CA    1 
ATOM   595   C  C     . LEU A 1 81   ? -65.909 -37.379 -56.575 1.00 59.25  ? 81   LEU A C     1 
ATOM   596   O  O     . LEU A 1 81   ? -66.167 -36.546 -57.440 1.00 59.56  ? 81   LEU A O     1 
ATOM   597   C  CB    . LEU A 1 81   ? -63.664 -36.486 -55.935 1.00 59.33  ? 81   LEU A CB    1 
ATOM   598   C  CG    . LEU A 1 81   ? -62.765 -35.926 -54.830 1.00 59.27  ? 81   LEU A CG    1 
ATOM   599   C  CD1   . LEU A 1 81   ? -61.345 -35.691 -55.322 1.00 58.49  ? 81   LEU A CD1   1 
ATOM   600   C  CD2   . LEU A 1 81   ? -63.364 -34.648 -54.244 1.00 59.98  ? 81   LEU A CD2   1 
ATOM   601   N  N     . TYR A 1 82   ? -66.395 -38.623 -56.599 1.00 58.04  ? 82   TYR A N     1 
ATOM   602   C  CA    . TYR A 1 82   ? -67.263 -39.079 -57.677 1.00 58.62  ? 82   TYR A CA    1 
ATOM   603   C  C     . TYR A 1 82   ? -68.336 -38.051 -58.009 1.00 59.65  ? 82   TYR A C     1 
ATOM   604   O  O     . TYR A 1 82   ? -69.096 -37.656 -57.143 1.00 60.65  ? 82   TYR A O     1 
ATOM   605   C  CB    . TYR A 1 82   ? -67.965 -40.392 -57.331 1.00 59.40  ? 82   TYR A CB    1 
ATOM   606   C  CG    . TYR A 1 82   ? -68.711 -40.930 -58.524 1.00 60.11  ? 82   TYR A CG    1 
ATOM   607   C  CD1   . TYR A 1 82   ? -69.998 -40.470 -58.845 1.00 61.56  ? 82   TYR A CD1   1 
ATOM   608   C  CD2   . TYR A 1 82   ? -68.117 -41.852 -59.374 1.00 59.64  ? 82   TYR A CD2   1 
ATOM   609   C  CE1   . TYR A 1 82   ? -70.673 -40.944 -59.963 1.00 62.20  ? 82   TYR A CE1   1 
ATOM   610   C  CE2   . TYR A 1 82   ? -68.790 -42.331 -60.493 1.00 60.87  ? 82   TYR A CE2   1 
ATOM   611   C  CZ    . TYR A 1 82   ? -70.061 -41.878 -60.779 1.00 61.75  ? 82   TYR A CZ    1 
ATOM   612   O  OH    . TYR A 1 82   ? -70.706 -42.351 -61.886 1.00 63.42  ? 82   TYR A OH    1 
ATOM   613   N  N     . GLY A 1 83   ? -68.401 -37.639 -59.269 1.00 60.04  ? 83   GLY A N     1 
ATOM   614   C  CA    . GLY A 1 83   ? -69.417 -36.702 -59.722 1.00 59.73  ? 83   GLY A CA    1 
ATOM   615   C  C     . GLY A 1 83   ? -69.179 -35.252 -59.339 1.00 58.84  ? 83   GLY A C     1 
ATOM   616   O  O     . GLY A 1 83   ? -70.026 -34.426 -59.608 1.00 59.92  ? 83   GLY A O     1 
ATOM   617   N  N     . ALA A 1 84   ? -68.034 -34.927 -58.743 1.00 57.50  ? 84   ALA A N     1 
ATOM   618   C  CA    . ALA A 1 84   ? -67.735 -33.563 -58.295 1.00 57.37  ? 84   ALA A CA    1 
ATOM   619   C  C     . ALA A 1 84   ? -66.673 -32.926 -59.180 1.00 56.43  ? 84   ALA A C     1 
ATOM   620   O  O     . ALA A 1 84   ? -66.069 -33.599 -60.014 1.00 55.69  ? 84   ALA A O     1 
ATOM   621   C  CB    . ALA A 1 84   ? -67.245 -33.591 -56.857 1.00 57.40  ? 84   ALA A CB    1 
ATOM   622   N  N     . ALA A 1 85   ? -66.428 -31.635 -58.969 1.00 55.74  ? 85   ALA A N     1 
ATOM   623   C  CA    . ALA A 1 85   ? -65.442 -30.880 -59.750 1.00 54.58  ? 85   ALA A CA    1 
ATOM   624   C  C     . ALA A 1 85   ? -64.460 -30.225 -58.811 1.00 52.80  ? 85   ALA A C     1 
ATOM   625   O  O     . ALA A 1 85   ? -64.854 -29.403 -57.989 1.00 53.25  ? 85   ALA A O     1 
ATOM   626   C  CB    . ALA A 1 85   ? -66.131 -29.823 -60.602 1.00 55.54  ? 85   ALA A CB    1 
ATOM   627   N  N     . VAL A 1 86   ? -63.188 -30.592 -58.936 1.00 51.53  ? 86   VAL A N     1 
ATOM   628   C  CA    . VAL A 1 86   ? -62.114 -29.991 -58.147 1.00 49.97  ? 86   VAL A CA    1 
ATOM   629   C  C     . VAL A 1 86   ? -61.589 -28.814 -58.936 1.00 49.38  ? 86   VAL A C     1 
ATOM   630   O  O     . VAL A 1 86   ? -61.593 -28.857 -60.157 1.00 50.51  ? 86   VAL A O     1 
ATOM   631   C  CB    . VAL A 1 86   ? -60.972 -30.991 -57.907 1.00 49.45  ? 86   VAL A CB    1 
ATOM   632   C  CG1   . VAL A 1 86   ? -59.835 -30.368 -57.080 1.00 48.69  ? 86   VAL A CG1   1 
ATOM   633   C  CG2   . VAL A 1 86   ? -61.518 -32.248 -57.245 1.00 49.87  ? 86   VAL A CG2   1 
ATOM   634   N  N     . THR A 1 87   ? -61.168 -27.759 -58.247 1.00 49.34  ? 87   THR A N     1 
ATOM   635   C  CA    . THR A 1 87   ? -60.442 -26.652 -58.885 1.00 49.78  ? 87   THR A CA    1 
ATOM   636   C  C     . THR A 1 87   ? -59.181 -26.351 -58.074 1.00 48.65  ? 87   THR A C     1 
ATOM   637   O  O     . THR A 1 87   ? -59.265 -26.067 -56.888 1.00 48.72  ? 87   THR A O     1 
ATOM   638   C  CB    . THR A 1 87   ? -61.299 -25.375 -58.998 1.00 50.90  ? 87   THR A CB    1 
ATOM   639   O  OG1   . THR A 1 87   ? -62.567 -25.684 -59.587 1.00 51.87  ? 87   THR A OG1   1 
ATOM   640   C  CG2   . THR A 1 87   ? -60.604 -24.329 -59.852 1.00 50.85  ? 87   THR A CG2   1 
ATOM   641   N  N     . THR A 1 88   ? -58.022 -26.452 -58.719 1.00 48.02  ? 88   THR A N     1 
ATOM   642   C  CA    . THR A 1 88   ? -56.733 -26.132 -58.105 1.00 47.10  ? 88   THR A CA    1 
ATOM   643   C  C     . THR A 1 88   ? -56.349 -24.725 -58.516 1.00 47.73  ? 88   THR A C     1 
ATOM   644   O  O     . THR A 1 88   ? -57.080 -24.081 -59.283 1.00 47.47  ? 88   THR A O     1 
ATOM   645   C  CB    . THR A 1 88   ? -55.618 -27.092 -58.572 1.00 46.21  ? 88   THR A CB    1 
ATOM   646   O  OG1   . THR A 1 88   ? -55.300 -26.846 -59.951 1.00 45.53  ? 88   THR A OG1   1 
ATOM   647   C  CG2   . THR A 1 88   ? -56.040 -28.529 -58.389 1.00 46.09  ? 88   THR A CG2   1 
ATOM   648   N  N     . VAL A 1 89   ? -55.203 -24.259 -58.008 1.00 48.25  ? 89   VAL A N     1 
ATOM   649   C  CA    . VAL A 1 89   ? -54.653 -22.940 -58.371 1.00 49.20  ? 89   VAL A CA    1 
ATOM   650   C  C     . VAL A 1 89   ? -54.455 -22.768 -59.882 1.00 50.41  ? 89   VAL A C     1 
ATOM   651   O  O     . VAL A 1 89   ? -54.769 -21.710 -60.431 1.00 51.99  ? 89   VAL A O     1 
ATOM   652   C  CB    . VAL A 1 89   ? -53.348 -22.627 -57.603 1.00 48.19  ? 89   VAL A CB    1 
ATOM   653   C  CG1   . VAL A 1 89   ? -52.198 -23.527 -58.043 1.00 47.70  ? 89   VAL A CG1   1 
ATOM   654   C  CG2   . VAL A 1 89   ? -52.984 -21.166 -57.760 1.00 48.28  ? 89   VAL A CG2   1 
ATOM   655   N  N     . GLU A 1 90   ? -53.991 -23.829 -60.544 1.00 51.49  ? 90   GLU A N     1 
ATOM   656   C  CA    . GLU A 1 90   ? -53.775 -23.837 -62.002 1.00 52.07  ? 90   GLU A CA    1 
ATOM   657   C  C     . GLU A 1 90   ? -55.075 -23.619 -62.776 1.00 53.09  ? 90   GLU A C     1 
ATOM   658   O  O     . GLU A 1 90   ? -55.057 -23.041 -63.854 1.00 54.50  ? 90   GLU A O     1 
ATOM   659   C  CB    . GLU A 1 90   ? -53.134 -25.159 -62.457 1.00 51.93  ? 90   GLU A CB    1 
ATOM   660   C  CG    . GLU A 1 90   ? -51.740 -25.429 -61.886 1.00 52.20  ? 90   GLU A CG    1 
ATOM   661   C  CD    . GLU A 1 90   ? -51.692 -26.428 -60.721 1.00 53.18  ? 90   GLU A CD    1 
ATOM   662   O  OE1   . GLU A 1 90   ? -52.701 -26.621 -59.989 1.00 54.37  ? 90   GLU A OE1   1 
ATOM   663   O  OE2   . GLU A 1 90   ? -50.604 -27.030 -60.523 1.00 53.50  ? 90   GLU A OE2   1 
ATOM   664   N  N     . GLY A 1 91   ? -56.192 -24.085 -62.221 1.00 53.22  ? 91   GLY A N     1 
ATOM   665   C  CA    . GLY A 1 91   ? -57.498 -23.950 -62.850 1.00 54.26  ? 91   GLY A CA    1 
ATOM   666   C  C     . GLY A 1 91   ? -58.071 -22.550 -62.981 1.00 54.48  ? 91   GLY A C     1 
ATOM   667   O  O     . GLY A 1 91   ? -58.853 -22.296 -63.886 1.00 55.38  ? 91   GLY A O     1 
ATOM   668   N  N     . ILE A 1 92   ? -57.707 -21.641 -62.087 1.00 55.13  ? 92   ILE A N     1 
ATOM   669   C  CA    . ILE A 1 92   ? -58.300 -20.286 -62.098 1.00 55.96  ? 92   ILE A CA    1 
ATOM   670   C  C     . ILE A 1 92   ? -57.562 -19.316 -63.019 1.00 56.14  ? 92   ILE A C     1 
ATOM   671   O  O     . ILE A 1 92   ? -58.116 -18.319 -63.430 1.00 57.35  ? 92   ILE A O     1 
ATOM   672   C  CB    . ILE A 1 92   ? -58.502 -19.721 -60.670 1.00 55.59  ? 92   ILE A CB    1 
ATOM   673   C  CG1   . ILE A 1 92   ? -57.183 -19.341 -59.974 1.00 54.41  ? 92   ILE A CG1   1 
ATOM   674   C  CG2   . ILE A 1 92   ? -59.256 -20.744 -59.827 1.00 55.92  ? 92   ILE A CG2   1 
ATOM   675   C  CD1   . ILE A 1 92   ? -57.381 -18.631 -58.647 1.00 53.67  ? 92   ILE A CD1   1 
ATOM   676   N  N     . GLY A 1 93   ? -56.319 -19.621 -63.355 1.00 57.30  ? 93   GLY A N     1 
ATOM   677   C  CA    . GLY A 1 93   ? -55.622 -18.895 -64.412 1.00 58.30  ? 93   GLY A CA    1 
ATOM   678   C  C     . GLY A 1 93   ? -54.147 -19.224 -64.453 1.00 57.10  ? 93   GLY A C     1 
ATOM   679   O  O     . GLY A 1 93   ? -53.635 -19.875 -63.544 1.00 56.65  ? 93   GLY A O     1 
ATOM   680   N  N     . SER A 1 94   ? -53.475 -18.757 -65.503 1.00 57.02  ? 94   SER A N     1 
ATOM   681   C  CA    . SER A 1 94   ? -52.039 -18.914 -65.643 1.00 57.19  ? 94   SER A CA    1 
ATOM   682   C  C     . SER A 1 94   ? -51.419 -17.809 -66.500 1.00 59.16  ? 94   SER A C     1 
ATOM   683   O  O     . SER A 1 94   ? -52.129 -17.023 -67.130 1.00 60.66  ? 94   SER A O     1 
ATOM   684   C  CB    . SER A 1 94   ? -51.739 -20.271 -66.270 1.00 56.73  ? 94   SER A CB    1 
ATOM   685   O  OG    . SER A 1 94   ? -52.252 -20.327 -67.588 1.00 57.54  ? 94   SER A OG    1 
ATOM   686   N  N     . THR A 1 95   ? -50.087 -17.787 -66.535 1.00 59.20  ? 95   THR A N     1 
ATOM   687   C  CA    . THR A 1 95   ? -49.322 -16.880 -67.390 1.00 60.49  ? 95   THR A CA    1 
ATOM   688   C  C     . THR A 1 95   ? -49.433 -17.219 -68.879 1.00 62.67  ? 95   THR A C     1 
ATOM   689   O  O     . THR A 1 95   ? -49.126 -16.377 -69.716 1.00 65.74  ? 95   THR A O     1 
ATOM   690   C  CB    . THR A 1 95   ? -47.817 -16.895 -67.049 1.00 59.87  ? 95   THR A CB    1 
ATOM   691   O  OG1   . THR A 1 95   ? -47.282 -18.194 -67.332 1.00 60.23  ? 95   THR A OG1   1 
ATOM   692   C  CG2   . THR A 1 95   ? -47.553 -16.521 -65.572 1.00 58.10  ? 95   THR A CG2   1 
ATOM   693   N  N     . HIS A 1 96   ? -49.843 -18.440 -69.211 1.00 63.61  ? 96   HIS A N     1 
ATOM   694   C  CA    . HIS A 1 96   ? -50.077 -18.827 -70.609 1.00 66.31  ? 96   HIS A CA    1 
ATOM   695   C  C     . HIS A 1 96   ? -51.581 -18.922 -70.965 1.00 66.74  ? 96   HIS A C     1 
ATOM   696   O  O     . HIS A 1 96   ? -51.950 -19.581 -71.934 1.00 67.51  ? 96   HIS A O     1 
ATOM   697   C  CB    . HIS A 1 96   ? -49.324 -20.132 -70.937 1.00 67.01  ? 96   HIS A CB    1 
ATOM   698   C  CG    . HIS A 1 96   ? -49.714 -21.289 -70.075 1.00 69.20  ? 96   HIS A CG    1 
ATOM   699   N  ND1   . HIS A 1 96   ? -48.994 -21.658 -68.956 1.00 68.94  ? 96   HIS A ND1   1 
ATOM   700   C  CD2   . HIS A 1 96   ? -50.765 -22.144 -70.148 1.00 71.60  ? 96   HIS A CD2   1 
ATOM   701   C  CE1   . HIS A 1 96   ? -49.578 -22.697 -68.383 1.00 69.82  ? 96   HIS A CE1   1 
ATOM   702   N  NE2   . HIS A 1 96   ? -50.653 -23.013 -69.087 1.00 72.02  ? 96   HIS A NE2   1 
ATOM   703   N  N     . THR A 1 97   ? -52.440 -18.273 -70.178 1.00 67.32  ? 97   THR A N     1 
ATOM   704   C  CA    . THR A 1 97   ? -53.855 -18.068 -70.535 1.00 67.05  ? 97   THR A CA    1 
ATOM   705   C  C     . THR A 1 97   ? -54.173 -16.630 -70.125 1.00 67.03  ? 97   THR A C     1 
ATOM   706   O  O     . THR A 1 97   ? -53.639 -15.700 -70.719 1.00 65.87  ? 97   THR A O     1 
ATOM   707   C  CB    . THR A 1 97   ? -54.787 -19.117 -69.880 1.00 66.67  ? 97   THR A CB    1 
ATOM   708   O  OG1   . THR A 1 97   ? -54.633 -19.086 -68.456 1.00 66.24  ? 97   THR A OG1   1 
ATOM   709   C  CG2   . THR A 1 97   ? -54.472 -20.523 -70.378 1.00 66.06  ? 97   THR A CG2   1 
ATOM   710   N  N     . ARG A 1 98   ? -55.012 -16.433 -69.116 1.00 69.15  ? 98   ARG A N     1 
ATOM   711   C  CA    . ARG A 1 98   ? -55.095 -15.146 -68.437 1.00 71.88  ? 98   ARG A CA    1 
ATOM   712   C  C     . ARG A 1 98   ? -54.930 -15.397 -66.941 1.00 68.81  ? 98   ARG A C     1 
ATOM   713   O  O     . ARG A 1 98   ? -55.369 -16.423 -66.423 1.00 67.75  ? 98   ARG A O     1 
ATOM   714   C  CB    . ARG A 1 98   ? -56.409 -14.407 -68.753 1.00 77.16  ? 98   ARG A CB    1 
ATOM   715   C  CG    . ARG A 1 98   ? -57.681 -15.092 -68.281 1.00 82.31  ? 98   ARG A CG    1 
ATOM   716   C  CD    . ARG A 1 98   ? -58.924 -14.233 -68.503 1.00 89.73  ? 98   ARG A CD    1 
ATOM   717   N  NE    . ARG A 1 98   ? -58.988 -13.027 -67.658 1.00 95.20  ? 98   ARG A NE    1 
ATOM   718   C  CZ    . ARG A 1 98   ? -59.260 -12.992 -66.342 1.00 97.32  ? 98   ARG A CZ    1 
ATOM   719   N  NH1   . ARG A 1 98   ? -59.482 -14.106 -65.634 1.00 97.13  ? 98   ARG A NH1   1 
ATOM   720   N  NH2   . ARG A 1 98   ? -59.294 -11.816 -65.716 1.00 98.36  ? 98   ARG A NH2   1 
ATOM   721   N  N     . ILE A 1 99   ? -54.277 -14.458 -66.267 1.00 66.59  ? 99   ILE A N     1 
ATOM   722   C  CA    . ILE A 1 99   ? -54.116 -14.485 -64.820 1.00 64.13  ? 99   ILE A CA    1 
ATOM   723   C  C     . ILE A 1 99   ? -55.436 -14.055 -64.170 1.00 63.76  ? 99   ILE A C     1 
ATOM   724   O  O     . ILE A 1 99   ? -56.099 -13.137 -64.647 1.00 64.99  ? 99   ILE A O     1 
ATOM   725   C  CB    . ILE A 1 99   ? -52.961 -13.551 -64.407 1.00 64.24  ? 99   ILE A CB    1 
ATOM   726   C  CG1   . ILE A 1 99   ? -51.636 -14.088 -64.964 1.00 63.62  ? 99   ILE A CG1   1 
ATOM   727   C  CG2   . ILE A 1 99   ? -52.867 -13.419 -62.896 1.00 64.86  ? 99   ILE A CG2   1 
ATOM   728   C  CD1   . ILE A 1 99   ? -50.588 -13.023 -65.196 1.00 63.87  ? 99   ILE A CD1   1 
ATOM   729   N  N     . HIS A 1 100  ? -55.828 -14.736 -63.100 1.00 62.10  ? 100  HIS A N     1 
ATOM   730   C  CA    . HIS A 1 100  ? -57.034 -14.372 -62.354 1.00 61.77  ? 100  HIS A CA    1 
ATOM   731   C  C     . HIS A 1 100  ? -56.731 -13.168 -61.454 1.00 60.61  ? 100  HIS A C     1 
ATOM   732   O  O     . HIS A 1 100  ? -55.595 -13.026 -61.013 1.00 60.65  ? 100  HIS A O     1 
ATOM   733   C  CB    . HIS A 1 100  ? -57.520 -15.554 -61.511 1.00 61.32  ? 100  HIS A CB    1 
ATOM   734   C  CG    . HIS A 1 100  ? -58.933 -15.408 -61.047 1.00 62.42  ? 100  HIS A CG    1 
ATOM   735   N  ND1   . HIS A 1 100  ? -59.257 -14.932 -59.797 1.00 63.02  ? 100  HIS A ND1   1 
ATOM   736   C  CD2   . HIS A 1 100  ? -60.107 -15.621 -61.683 1.00 62.69  ? 100  HIS A CD2   1 
ATOM   737   C  CE1   . HIS A 1 100  ? -60.569 -14.883 -59.670 1.00 63.24  ? 100  HIS A CE1   1 
ATOM   738   N  NE2   . HIS A 1 100  ? -61.109 -15.295 -60.802 1.00 63.82  ? 100  HIS A NE2   1 
ATOM   739   N  N     . PRO A 1 101  ? -57.727 -12.296 -61.175 1.00 60.76  ? 101  PRO A N     1 
ATOM   740   C  CA    . PRO A 1 101  ? -57.405 -11.116 -60.340 1.00 60.74  ? 101  PRO A CA    1 
ATOM   741   C  C     . PRO A 1 101  ? -56.865 -11.425 -58.938 1.00 58.95  ? 101  PRO A C     1 
ATOM   742   O  O     . PRO A 1 101  ? -55.956 -10.759 -58.476 1.00 58.72  ? 101  PRO A O     1 
ATOM   743   C  CB    . PRO A 1 101  ? -58.738 -10.365 -60.264 1.00 61.41  ? 101  PRO A CB    1 
ATOM   744   C  CG    . PRO A 1 101  ? -59.416 -10.733 -61.529 1.00 62.01  ? 101  PRO A CG    1 
ATOM   745   C  CD    . PRO A 1 101  ? -59.073 -12.174 -61.761 1.00 61.01  ? 101  PRO A CD    1 
ATOM   746   N  N     . VAL A 1 102  ? -57.423 -12.428 -58.281 1.00 59.13  ? 102  VAL A N     1 
ATOM   747   C  CA    . VAL A 1 102  ? -56.881 -12.942 -57.010 1.00 58.97  ? 102  VAL A CA    1 
ATOM   748   C  C     . VAL A 1 102  ? -55.383 -13.268 -57.112 1.00 58.50  ? 102  VAL A C     1 
ATOM   749   O  O     . VAL A 1 102  ? -54.618 -12.961 -56.192 1.00 59.27  ? 102  VAL A O     1 
ATOM   750   C  CB    . VAL A 1 102  ? -57.643 -14.203 -56.527 1.00 59.51  ? 102  VAL A CB    1 
ATOM   751   C  CG1   . VAL A 1 102  ? -57.004 -14.772 -55.261 1.00 58.89  ? 102  VAL A CG1   1 
ATOM   752   C  CG2   . VAL A 1 102  ? -59.128 -13.892 -56.300 1.00 60.64  ? 102  VAL A CG2   1 
ATOM   753   N  N     . GLN A 1 103  ? -54.975 -13.879 -58.227 1.00 57.21  ? 103  GLN A N     1 
ATOM   754   C  CA    . GLN A 1 103  ? -53.568 -14.190 -58.482 1.00 55.53  ? 103  GLN A CA    1 
ATOM   755   C  C     . GLN A 1 103  ? -52.729 -12.942 -58.760 1.00 56.48  ? 103  GLN A C     1 
ATOM   756   O  O     . GLN A 1 103  ? -51.623 -12.802 -58.231 1.00 56.12  ? 103  GLN A O     1 
ATOM   757   C  CB    . GLN A 1 103  ? -53.434 -15.153 -59.659 1.00 54.80  ? 103  GLN A CB    1 
ATOM   758   C  CG    . GLN A 1 103  ? -54.030 -16.532 -59.430 1.00 53.90  ? 103  GLN A CG    1 
ATOM   759   C  CD    . GLN A 1 103  ? -54.089 -17.352 -60.702 1.00 53.99  ? 103  GLN A CD    1 
ATOM   760   O  OE1   . GLN A 1 103  ? -54.349 -16.819 -61.781 1.00 54.17  ? 103  GLN A OE1   1 
ATOM   761   N  NE2   . GLN A 1 103  ? -53.848 -18.660 -60.586 1.00 53.55  ? 103  GLN A NE2   1 
ATOM   762   N  N     . GLU A 1 104  ? -53.242 -12.056 -59.608 1.00 57.80  ? 104  GLU A N     1 
ATOM   763   C  CA    . GLU A 1 104  ? -52.587 -10.773 -59.888 1.00 59.75  ? 104  GLU A CA    1 
ATOM   764   C  C     . GLU A 1 104  ? -52.293 -9.968  -58.620 1.00 58.94  ? 104  GLU A C     1 
ATOM   765   O  O     . GLU A 1 104  ? -51.186 -9.463  -58.452 1.00 58.00  ? 104  GLU A O     1 
ATOM   766   C  CB    . GLU A 1 104  ? -53.464 -9.929  -60.828 1.00 63.73  ? 104  GLU A CB    1 
ATOM   767   C  CG    . GLU A 1 104  ? -52.879 -8.580  -61.265 1.00 66.26  ? 104  GLU A CG    1 
ATOM   768   C  CD    . GLU A 1 104  ? -53.867 -7.708  -62.038 1.00 69.87  ? 104  GLU A CD    1 
ATOM   769   O  OE1   . GLU A 1 104  ? -55.105 -7.837  -61.843 1.00 73.88  ? 104  GLU A OE1   1 
ATOM   770   O  OE2   . GLU A 1 104  ? -53.403 -6.864  -62.838 1.00 71.51  ? 104  GLU A OE2   1 
ATOM   771   N  N     . ARG A 1 105  ? -53.283 -9.864  -57.738 1.00 58.82  ? 105  ARG A N     1 
ATOM   772   C  CA    . ARG A 1 105  ? -53.244 -8.902  -56.630 1.00 59.38  ? 105  ARG A CA    1 
ATOM   773   C  C     . ARG A 1 105  ? -52.457 -9.372  -55.437 1.00 58.14  ? 105  ARG A C     1 
ATOM   774   O  O     . ARG A 1 105  ? -51.703 -8.599  -54.862 1.00 57.96  ? 105  ARG A O     1 
ATOM   775   C  CB    . ARG A 1 105  ? -54.651 -8.560  -56.176 1.00 61.01  ? 105  ARG A CB    1 
ATOM   776   C  CG    . ARG A 1 105  ? -55.432 -7.877  -57.266 1.00 62.42  ? 105  ARG A CG    1 
ATOM   777   C  CD    . ARG A 1 105  ? -56.783 -7.456  -56.765 1.00 63.53  ? 105  ARG A CD    1 
ATOM   778   N  NE    . ARG A 1 105  ? -57.684 -7.162  -57.868 1.00 64.55  ? 105  ARG A NE    1 
ATOM   779   C  CZ    . ARG A 1 105  ? -58.908 -6.671  -57.724 1.00 64.46  ? 105  ARG A CZ    1 
ATOM   780   N  NH1   . ARG A 1 105  ? -59.395 -6.411  -56.514 1.00 64.67  ? 105  ARG A NH1   1 
ATOM   781   N  NH2   . ARG A 1 105  ? -59.652 -6.444  -58.801 1.00 65.40  ? 105  ARG A NH2   1 
ATOM   782   N  N     . ILE A 1 106  ? -52.638 -10.627 -55.046 1.00 57.15  ? 106  ILE A N     1 
ATOM   783   C  CA    . ILE A 1 106  ? -51.799 -11.199 -53.997 1.00 57.10  ? 106  ILE A CA    1 
ATOM   784   C  C     . ILE A 1 106  ? -50.310 -11.081 -54.341 1.00 55.23  ? 106  ILE A C     1 
ATOM   785   O  O     . ILE A 1 106  ? -49.513 -10.835 -53.452 1.00 56.17  ? 106  ILE A O     1 
ATOM   786   C  CB    . ILE A 1 106  ? -52.167 -12.663 -53.673 1.00 58.21  ? 106  ILE A CB    1 
ATOM   787   C  CG1   . ILE A 1 106  ? -51.491 -13.107 -52.369 1.00 59.66  ? 106  ILE A CG1   1 
ATOM   788   C  CG2   . ILE A 1 106  ? -51.787 -13.603 -54.810 1.00 57.84  ? 106  ILE A CG2   1 
ATOM   789   C  CD1   . ILE A 1 106  ? -52.175 -14.287 -51.707 1.00 60.77  ? 106  ILE A CD1   1 
ATOM   790   N  N     . ALA A 1 107  ? -49.959 -11.223 -55.621 1.00 53.62  ? 107  ALA A N     1 
ATOM   791   C  CA    . ALA A 1 107  ? -48.592 -11.036 -56.091 1.00 52.95  ? 107  ALA A CA    1 
ATOM   792   C  C     . ALA A 1 107  ? -48.193 -9.560  -56.110 1.00 54.67  ? 107  ALA A C     1 
ATOM   793   O  O     . ALA A 1 107  ? -47.184 -9.181  -55.514 1.00 55.27  ? 107  ALA A O     1 
ATOM   794   C  CB    . ALA A 1 107  ? -48.411 -11.636 -57.472 1.00 52.07  ? 107  ALA A CB    1 
ATOM   795   N  N     . LYS A 1 108  ? -48.968 -8.727  -56.791 1.00 55.67  ? 108  LYS A N     1 
ATOM   796   C  CA    . LYS A 1 108  ? -48.615 -7.307  -56.917 1.00 57.36  ? 108  LYS A CA    1 
ATOM   797   C  C     . LYS A 1 108  ? -48.716 -6.476  -55.622 1.00 57.18  ? 108  LYS A C     1 
ATOM   798   O  O     . LYS A 1 108  ? -48.081 -5.435  -55.519 1.00 57.72  ? 108  LYS A O     1 
ATOM   799   C  CB    . LYS A 1 108  ? -49.403 -6.658  -58.048 1.00 59.46  ? 108  LYS A CB    1 
ATOM   800   C  CG    . LYS A 1 108  ? -48.955 -7.170  -59.407 1.00 60.30  ? 108  LYS A CG    1 
ATOM   801   C  CD    . LYS A 1 108  ? -49.617 -6.392  -60.526 1.00 62.21  ? 108  LYS A CD    1 
ATOM   802   C  CE    . LYS A 1 108  ? -49.293 -7.011  -61.872 1.00 62.94  ? 108  LYS A CE    1 
ATOM   803   N  NZ    . LYS A 1 108  ? -50.188 -6.481  -62.938 1.00 64.23  ? 108  LYS A NZ    1 
ATOM   804   N  N     . CYS A 1 109  ? -49.462 -6.959  -54.629 1.00 56.86  ? 109  CYS A N     1 
ATOM   805   C  CA    . CYS A 1 109  ? -49.428 -6.392  -53.273 1.00 56.54  ? 109  CYS A CA    1 
ATOM   806   C  C     . CYS A 1 109  ? -48.285 -6.951  -52.403 1.00 55.45  ? 109  CYS A C     1 
ATOM   807   O  O     . CYS A 1 109  ? -48.252 -6.692  -51.202 1.00 56.12  ? 109  CYS A O     1 
ATOM   808   C  CB    . CYS A 1 109  ? -50.774 -6.621  -52.579 1.00 57.16  ? 109  CYS A CB    1 
ATOM   809   S  SG    . CYS A 1 109  ? -52.186 -5.904  -53.467 1.00 59.94  ? 109  CYS A SG    1 
ATOM   810   N  N     . HIS A 1 110  ? -47.358 -7.699  -53.011 1.00 53.86  ? 110  HIS A N     1 
ATOM   811   C  CA    . HIS A 1 110  ? -46.186 -8.281  -52.344 1.00 52.86  ? 110  HIS A CA    1 
ATOM   812   C  C     . HIS A 1 110  ? -46.569 -9.273  -51.266 1.00 52.97  ? 110  HIS A C     1 
ATOM   813   O  O     . HIS A 1 110  ? -45.917 -9.361  -50.223 1.00 53.53  ? 110  HIS A O     1 
ATOM   814   C  CB    . HIS A 1 110  ? -45.264 -7.195  -51.798 1.00 52.82  ? 110  HIS A CB    1 
ATOM   815   C  CG    . HIS A 1 110  ? -44.981 -6.120  -52.787 1.00 53.78  ? 110  HIS A CG    1 
ATOM   816   N  ND1   . HIS A 1 110  ? -44.124 -6.301  -53.847 1.00 54.10  ? 110  HIS A ND1   1 
ATOM   817   C  CD2   . HIS A 1 110  ? -45.480 -4.872  -52.914 1.00 55.31  ? 110  HIS A CD2   1 
ATOM   818   C  CE1   . HIS A 1 110  ? -44.086 -5.201  -54.575 1.00 54.66  ? 110  HIS A CE1   1 
ATOM   819   N  NE2   . HIS A 1 110  ? -44.899 -4.317  -54.028 1.00 56.51  ? 110  HIS A NE2   1 
ATOM   820   N  N     . GLY A 1 111  ? -47.618 -10.043 -51.544 1.00 53.17  ? 111  GLY A N     1 
ATOM   821   C  CA    . GLY A 1 111  ? -48.143 -11.022 -50.595 1.00 53.35  ? 111  GLY A CA    1 
ATOM   822   C  C     . GLY A 1 111  ? -47.524 -12.399 -50.714 1.00 51.98  ? 111  GLY A C     1 
ATOM   823   O  O     . GLY A 1 111  ? -48.080 -13.357 -50.175 1.00 51.44  ? 111  GLY A O     1 
ATOM   824   N  N     . THR A 1 112  ? -46.400 -12.499 -51.432 1.00 50.88  ? 112  THR A N     1 
ATOM   825   C  CA    . THR A 1 112  ? -45.635 -13.736 -51.557 1.00 49.48  ? 112  THR A CA    1 
ATOM   826   C  C     . THR A 1 112  ? -44.161 -13.424 -51.353 1.00 49.49  ? 112  THR A C     1 
ATOM   827   O  O     . THR A 1 112  ? -43.648 -12.436 -51.877 1.00 48.84  ? 112  THR A O     1 
ATOM   828   C  CB    . THR A 1 112  ? -45.818 -14.413 -52.938 1.00 48.67  ? 112  THR A CB    1 
ATOM   829   O  OG1   . THR A 1 112  ? -44.890 -13.875 -53.886 1.00 48.21  ? 112  THR A OG1   1 
ATOM   830   C  CG2   . THR A 1 112  ? -47.248 -14.239 -53.467 1.00 49.23  ? 112  THR A CG2   1 
ATOM   831   N  N     . GLN A 1 113  ? -43.487 -14.277 -50.594 1.00 49.80  ? 113  GLN A N     1 
ATOM   832   C  CA    . GLN A 1 113  ? -42.061 -14.160 -50.392 1.00 49.05  ? 113  GLN A CA    1 
ATOM   833   C  C     . GLN A 1 113  ? -41.438 -15.441 -50.914 1.00 49.40  ? 113  GLN A C     1 
ATOM   834   O  O     . GLN A 1 113  ? -41.035 -15.461 -52.078 1.00 49.88  ? 113  GLN A O     1 
ATOM   835   C  CB    . GLN A 1 113  ? -41.753 -13.858 -48.937 1.00 48.84  ? 113  GLN A CB    1 
ATOM   836   C  CG    . GLN A 1 113  ? -42.000 -12.395 -48.587 1.00 49.20  ? 113  GLN A CG    1 
ATOM   837   C  CD    . GLN A 1 113  ? -41.416 -11.961 -47.250 1.00 49.80  ? 113  GLN A CD    1 
ATOM   838   O  OE1   . GLN A 1 113  ? -40.372 -12.454 -46.817 1.00 51.74  ? 113  GLN A OE1   1 
ATOM   839   N  NE2   . GLN A 1 113  ? -42.078 -11.022 -46.599 1.00 49.64  ? 113  GLN A NE2   1 
ATOM   840   N  N     . CYS A 1 114  ? -41.399 -16.517 -50.120 1.00 49.40  ? 114  CYS A N     1 
ATOM   841   C  CA    . CYS A 1 114  ? -40.924 -17.808 -50.656 1.00 48.44  ? 114  CYS A CA    1 
ATOM   842   C  C     . CYS A 1 114  ? -41.928 -18.376 -51.622 1.00 46.52  ? 114  CYS A C     1 
ATOM   843   O  O     . CYS A 1 114  ? -41.564 -19.115 -52.528 1.00 46.61  ? 114  CYS A O     1 
ATOM   844   C  CB    . CYS A 1 114  ? -40.624 -18.827 -49.562 1.00 49.76  ? 114  CYS A CB    1 
ATOM   845   S  SG    . CYS A 1 114  ? -42.050 -19.791 -49.036 1.00 51.96  ? 114  CYS A SG    1 
ATOM   846   N  N     . GLY A 1 115  ? -43.195 -18.040 -51.406 1.00 45.95  ? 115  GLY A N     1 
ATOM   847   C  CA    . GLY A 1 115  ? -44.271 -18.373 -52.332 1.00 44.34  ? 115  GLY A CA    1 
ATOM   848   C  C     . GLY A 1 115  ? -44.933 -19.712 -52.113 1.00 43.03  ? 115  GLY A C     1 
ATOM   849   O  O     . GLY A 1 115  ? -45.870 -20.052 -52.817 1.00 44.13  ? 115  GLY A O     1 
ATOM   850   N  N     . PHE A 1 116  ? -44.466 -20.480 -51.144 1.00 42.66  ? 116  PHE A N     1 
ATOM   851   C  CA    . PHE A 1 116  ? -44.913 -21.850 -51.006 1.00 43.62  ? 116  PHE A CA    1 
ATOM   852   C  C     . PHE A 1 116  ? -46.351 -21.943 -50.515 1.00 44.12  ? 116  PHE A C     1 
ATOM   853   O  O     . PHE A 1 116  ? -47.069 -22.850 -50.904 1.00 45.09  ? 116  PHE A O     1 
ATOM   854   C  CB    . PHE A 1 116  ? -43.976 -22.630 -50.090 1.00 43.62  ? 116  PHE A CB    1 
ATOM   855   C  CG    . PHE A 1 116  ? -44.061 -24.112 -50.266 1.00 42.98  ? 116  PHE A CG    1 
ATOM   856   C  CD1   . PHE A 1 116  ? -43.390 -24.737 -51.305 1.00 42.89  ? 116  PHE A CD1   1 
ATOM   857   C  CD2   . PHE A 1 116  ? -44.807 -24.882 -49.394 1.00 43.46  ? 116  PHE A CD2   1 
ATOM   858   C  CE1   . PHE A 1 116  ? -43.447 -26.115 -51.467 1.00 42.44  ? 116  PHE A CE1   1 
ATOM   859   C  CE2   . PHE A 1 116  ? -44.876 -26.255 -49.548 1.00 43.62  ? 116  PHE A CE2   1 
ATOM   860   C  CZ    . PHE A 1 116  ? -44.194 -26.873 -50.592 1.00 42.92  ? 116  PHE A CZ    1 
ATOM   861   N  N     . CYS A 1 117  ? -46.764 -20.989 -49.687 1.00 45.74  ? 117  CYS A N     1 
ATOM   862   C  CA    . CYS A 1 117  ? -48.143 -20.891 -49.197 1.00 46.37  ? 117  CYS A CA    1 
ATOM   863   C  C     . CYS A 1 117  ? -49.116 -20.185 -50.148 1.00 46.51  ? 117  CYS A C     1 
ATOM   864   O  O     . CYS A 1 117  ? -50.304 -20.062 -49.819 1.00 46.26  ? 117  CYS A O     1 
ATOM   865   C  CB    . CYS A 1 117  ? -48.162 -20.119 -47.879 1.00 47.34  ? 117  CYS A CB    1 
ATOM   866   S  SG    . CYS A 1 117  ? -47.917 -18.340 -48.095 1.00 48.92  ? 117  CYS A SG    1 
ATOM   867   N  N     . THR A 1 118  ? -48.636 -19.697 -51.295 1.00 46.10  ? 118  THR A N     1 
ATOM   868   C  CA    . THR A 1 118  ? -49.445 -18.794 -52.105 1.00 47.29  ? 118  THR A CA    1 
ATOM   869   C  C     . THR A 1 118  ? -50.634 -19.509 -52.751 1.00 49.11  ? 118  THR A C     1 
ATOM   870   O  O     . THR A 1 118  ? -51.736 -18.966 -52.724 1.00 52.13  ? 118  THR A O     1 
ATOM   871   C  CB    . THR A 1 118  ? -48.621 -18.025 -53.160 1.00 46.53  ? 118  THR A CB    1 
ATOM   872   O  OG1   . THR A 1 118  ? -47.450 -17.474 -52.552 1.00 45.29  ? 118  THR A OG1   1 
ATOM   873   C  CG2   . THR A 1 118  ? -49.431 -16.873 -53.740 1.00 47.80  ? 118  THR A CG2   1 
ATOM   874   N  N     . PRO A 1 119  ? -50.431 -20.722 -53.318 1.00 48.80  ? 119  PRO A N     1 
ATOM   875   C  CA    . PRO A 1 119  ? -51.582 -21.383 -53.934 1.00 49.44  ? 119  PRO A CA    1 
ATOM   876   C  C     . PRO A 1 119  ? -52.729 -21.654 -52.966 1.00 49.54  ? 119  PRO A C     1 
ATOM   877   O  O     . PRO A 1 119  ? -53.882 -21.522 -53.343 1.00 50.32  ? 119  PRO A O     1 
ATOM   878   C  CB    . PRO A 1 119  ? -50.973 -22.681 -54.490 1.00 48.36  ? 119  PRO A CB    1 
ATOM   879   C  CG    . PRO A 1 119  ? -49.591 -22.260 -54.866 1.00 47.00  ? 119  PRO A CG    1 
ATOM   880   C  CD    . PRO A 1 119  ? -49.186 -21.433 -53.671 1.00 47.94  ? 119  PRO A CD    1 
ATOM   881   N  N     . GLY A 1 120  ? -52.405 -22.001 -51.729 1.00 49.83  ? 120  GLY A N     1 
ATOM   882   C  CA    . GLY A 1 120  ? -53.408 -22.198 -50.691 1.00 50.31  ? 120  GLY A CA    1 
ATOM   883   C  C     . GLY A 1 120  ? -54.166 -20.928 -50.382 1.00 51.56  ? 120  GLY A C     1 
ATOM   884   O  O     . GLY A 1 120  ? -55.388 -20.963 -50.261 1.00 51.44  ? 120  GLY A O     1 
ATOM   885   N  N     . MET A 1 121  ? -53.436 -19.812 -50.271 1.00 51.80  ? 121  MET A N     1 
ATOM   886   C  CA    . MET A 1 121  ? -54.034 -18.498 -50.002 1.00 52.53  ? 121  MET A CA    1 
ATOM   887   C  C     . MET A 1 121  ? -54.958 -18.115 -51.144 1.00 52.42  ? 121  MET A C     1 
ATOM   888   O  O     . MET A 1 121  ? -56.061 -17.612 -50.934 1.00 52.29  ? 121  MET A O     1 
ATOM   889   C  CB    . MET A 1 121  ? -52.965 -17.414 -49.860 1.00 53.11  ? 121  MET A CB    1 
ATOM   890   C  CG    . MET A 1 121  ? -52.012 -17.591 -48.686 1.00 54.01  ? 121  MET A CG    1 
ATOM   891   S  SD    . MET A 1 121  ? -52.712 -17.199 -47.079 1.00 55.95  ? 121  MET A SD    1 
ATOM   892   C  CE    . MET A 1 121  ? -51.323 -17.549 -45.998 1.00 55.09  ? 121  MET A CE    1 
ATOM   893   N  N     . VAL A 1 122  ? -54.493 -18.374 -52.359 1.00 51.99  ? 122  VAL A N     1 
ATOM   894   C  CA    . VAL A 1 122  ? -55.247 -18.045 -53.570 1.00 52.53  ? 122  VAL A CA    1 
ATOM   895   C  C     . VAL A 1 122  ? -56.574 -18.818 -53.634 1.00 52.98  ? 122  VAL A C     1 
ATOM   896   O  O     . VAL A 1 122  ? -57.631 -18.245 -53.920 1.00 53.26  ? 122  VAL A O     1 
ATOM   897   C  CB    . VAL A 1 122  ? -54.373 -18.260 -54.829 1.00 51.31  ? 122  VAL A CB    1 
ATOM   898   C  CG1   . VAL A 1 122  ? -55.200 -18.257 -56.107 1.00 51.72  ? 122  VAL A CG1   1 
ATOM   899   C  CG2   . VAL A 1 122  ? -53.282 -17.190 -54.892 1.00 50.96  ? 122  VAL A CG2   1 
ATOM   900   N  N     . MET A 1 123  ? -56.523 -20.106 -53.336 1.00 52.34  ? 123  MET A N     1 
ATOM   901   C  CA    . MET A 1 123  ? -57.722 -20.926 -53.396 1.00 52.35  ? 123  MET A CA    1 
ATOM   902   C  C     . MET A 1 123  ? -58.724 -20.645 -52.266 1.00 53.04  ? 123  MET A C     1 
ATOM   903   O  O     . MET A 1 123  ? -59.924 -20.769 -52.482 1.00 54.92  ? 123  MET A O     1 
ATOM   904   C  CB    . MET A 1 123  ? -57.334 -22.401 -53.491 1.00 51.63  ? 123  MET A CB    1 
ATOM   905   C  CG    . MET A 1 123  ? -56.645 -22.732 -54.806 1.00 51.00  ? 123  MET A CG    1 
ATOM   906   S  SD    . MET A 1 123  ? -57.510 -22.123 -56.281 1.00 52.66  ? 123  MET A SD    1 
ATOM   907   C  CE    . MET A 1 123  ? -59.109 -22.931 -56.136 1.00 52.33  ? 123  MET A CE    1 
ATOM   908   N  N     . SER A 1 124  ? -58.248 -20.252 -51.087 1.00 52.04  ? 124  SER A N     1 
ATOM   909   C  CA    . SER A 1 124  ? -59.131 -19.756 -50.032 1.00 52.48  ? 124  SER A CA    1 
ATOM   910   C  C     . SER A 1 124  ? -59.846 -18.458 -50.425 1.00 54.12  ? 124  SER A C     1 
ATOM   911   O  O     . SER A 1 124  ? -61.049 -18.325 -50.215 1.00 55.52  ? 124  SER A O     1 
ATOM   912   C  CB    . SER A 1 124  ? -58.352 -19.529 -48.756 1.00 52.01  ? 124  SER A CB    1 
ATOM   913   O  OG    . SER A 1 124  ? -57.882 -20.766 -48.258 1.00 52.47  ? 124  SER A OG    1 
ATOM   914   N  N     . ILE A 1 125  ? -59.106 -17.519 -51.011 1.00 54.42  ? 125  ILE A N     1 
ATOM   915   C  CA    . ILE A 1 125  ? -59.668 -16.247 -51.468 1.00 55.04  ? 125  ILE A CA    1 
ATOM   916   C  C     . ILE A 1 125  ? -60.571 -16.438 -52.678 1.00 55.64  ? 125  ILE A C     1 
ATOM   917   O  O     . ILE A 1 125  ? -61.647 -15.859 -52.737 1.00 58.32  ? 125  ILE A O     1 
ATOM   918   C  CB    . ILE A 1 125  ? -58.560 -15.233 -51.808 1.00 55.00  ? 125  ILE A CB    1 
ATOM   919   C  CG1   . ILE A 1 125  ? -57.800 -14.849 -50.531 1.00 54.49  ? 125  ILE A CG1   1 
ATOM   920   C  CG2   . ILE A 1 125  ? -59.138 -13.984 -52.481 1.00 56.00  ? 125  ILE A CG2   1 
ATOM   921   C  CD1   . ILE A 1 125  ? -56.459 -14.198 -50.787 1.00 54.28  ? 125  ILE A CD1   1 
ATOM   922   N  N     . TYR A 1 126  ? -60.128 -17.240 -53.640 1.00 55.18  ? 126  TYR A N     1 
ATOM   923   C  CA    . TYR A 1 126  ? -60.946 -17.569 -54.809 1.00 55.19  ? 126  TYR A CA    1 
ATOM   924   C  C     . TYR A 1 126  ? -62.297 -18.134 -54.389 1.00 56.10  ? 126  TYR A C     1 
ATOM   925   O  O     . TYR A 1 126  ? -63.338 -17.620 -54.789 1.00 56.79  ? 126  TYR A O     1 
ATOM   926   C  CB    . TYR A 1 126  ? -60.236 -18.584 -55.715 1.00 53.86  ? 126  TYR A CB    1 
ATOM   927   C  CG    . TYR A 1 126  ? -61.023 -18.896 -56.960 1.00 54.01  ? 126  TYR A CG    1 
ATOM   928   C  CD1   . TYR A 1 126  ? -61.051 -17.996 -58.025 1.00 54.22  ? 126  TYR A CD1   1 
ATOM   929   C  CD2   . TYR A 1 126  ? -61.766 -20.074 -57.071 1.00 54.50  ? 126  TYR A CD2   1 
ATOM   930   C  CE1   . TYR A 1 126  ? -61.785 -18.262 -59.175 1.00 55.28  ? 126  TYR A CE1   1 
ATOM   931   C  CE2   . TYR A 1 126  ? -62.512 -20.349 -58.221 1.00 55.61  ? 126  TYR A CE2   1 
ATOM   932   C  CZ    . TYR A 1 126  ? -62.515 -19.439 -59.271 1.00 56.16  ? 126  TYR A CZ    1 
ATOM   933   O  OH    . TYR A 1 126  ? -63.237 -19.686 -60.422 1.00 58.19  ? 126  TYR A OH    1 
ATOM   934   N  N     . THR A 1 127  ? -62.261 -19.181 -53.569 1.00 56.35  ? 127  THR A N     1 
ATOM   935   C  CA    . THR A 1 127  ? -63.469 -19.890 -53.153 1.00 57.78  ? 127  THR A CA    1 
ATOM   936   C  C     . THR A 1 127  ? -64.453 -18.959 -52.447 1.00 60.06  ? 127  THR A C     1 
ATOM   937   O  O     . THR A 1 127  ? -65.666 -19.037 -52.689 1.00 61.19  ? 127  THR A O     1 
ATOM   938   C  CB    . THR A 1 127  ? -63.140 -21.102 -52.257 1.00 56.94  ? 127  THR A CB    1 
ATOM   939   O  OG1   . THR A 1 127  ? -62.273 -21.990 -52.967 1.00 55.48  ? 127  THR A OG1   1 
ATOM   940   C  CG2   . THR A 1 127  ? -64.401 -21.865 -51.876 1.00 57.78  ? 127  THR A CG2   1 
ATOM   941   N  N     . LEU A 1 128  ? -63.937 -18.068 -51.603 1.00 60.67  ? 128  LEU A N     1 
ATOM   942   C  CA    . LEU A 1 128  ? -64.799 -17.133 -50.909 1.00 62.51  ? 128  LEU A CA    1 
ATOM   943   C  C     . LEU A 1 128  ? -65.412 -16.124 -51.868 1.00 63.64  ? 128  LEU A C     1 
ATOM   944   O  O     . LEU A 1 128  ? -66.600 -15.829 -51.752 1.00 65.89  ? 128  LEU A O     1 
ATOM   945   C  CB    . LEU A 1 128  ? -64.087 -16.416 -49.764 1.00 63.13  ? 128  LEU A CB    1 
ATOM   946   C  CG    . LEU A 1 128  ? -65.095 -15.553 -48.973 1.00 65.49  ? 128  LEU A CG    1 
ATOM   947   C  CD1   . LEU A 1 128  ? -64.990 -15.809 -47.485 1.00 66.59  ? 128  LEU A CD1   1 
ATOM   948   C  CD2   . LEU A 1 128  ? -64.979 -14.063 -49.295 1.00 66.09  ? 128  LEU A CD2   1 
ATOM   949   N  N     . LEU A 1 129  ? -64.626 -15.596 -52.799 1.00 62.28  ? 129  LEU A N     1 
ATOM   950   C  CA    . LEU A 1 129  ? -65.179 -14.689 -53.811 1.00 63.08  ? 129  LEU A CA    1 
ATOM   951   C  C     . LEU A 1 129  ? -66.206 -15.354 -54.753 1.00 62.80  ? 129  LEU A C     1 
ATOM   952   O  O     . LEU A 1 129  ? -67.080 -14.676 -55.289 1.00 63.56  ? 129  LEU A O     1 
ATOM   953   C  CB    . LEU A 1 129  ? -64.061 -14.036 -54.620 1.00 63.27  ? 129  LEU A CB    1 
ATOM   954   C  CG    . LEU A 1 129  ? -63.289 -12.951 -53.872 1.00 63.89  ? 129  LEU A CG    1 
ATOM   955   C  CD1   . LEU A 1 129  ? -61.960 -12.684 -54.564 1.00 63.04  ? 129  LEU A CD1   1 
ATOM   956   C  CD2   . LEU A 1 129  ? -64.112 -11.669 -53.749 1.00 65.55  ? 129  LEU A CD2   1 
ATOM   957   N  N     . ARG A 1 130  ? -66.103 -16.663 -54.953 1.00 61.79  ? 130  ARG A N     1 
ATOM   958   C  CA    . ARG A 1 130  ? -67.128 -17.402 -55.703 1.00 63.34  ? 130  ARG A CA    1 
ATOM   959   C  C     . ARG A 1 130  ? -68.467 -17.502 -54.951 1.00 64.26  ? 130  ARG A C     1 
ATOM   960   O  O     . ARG A 1 130  ? -69.504 -17.638 -55.587 1.00 65.20  ? 130  ARG A O     1 
ATOM   961   C  CB    . ARG A 1 130  ? -66.635 -18.816 -56.084 1.00 62.33  ? 130  ARG A CB    1 
ATOM   962   C  CG    . ARG A 1 130  ? -65.507 -18.861 -57.112 1.00 61.49  ? 130  ARG A CG    1 
ATOM   963   C  CD    . ARG A 1 130  ? -65.897 -18.238 -58.445 1.00 62.18  ? 130  ARG A CD    1 
ATOM   964   N  NE    . ARG A 1 130  ? -67.124 -18.821 -58.978 1.00 62.85  ? 130  ARG A NE    1 
ATOM   965   C  CZ    . ARG A 1 130  ? -67.208 -19.948 -59.686 1.00 62.34  ? 130  ARG A CZ    1 
ATOM   966   N  NH1   . ARG A 1 130  ? -66.128 -20.660 -59.990 1.00 61.99  ? 130  ARG A NH1   1 
ATOM   967   N  NH2   . ARG A 1 130  ? -68.393 -20.367 -60.104 1.00 62.93  ? 130  ARG A NH2   1 
ATOM   968   N  N     . ASN A 1 131  ? -68.428 -17.473 -53.617 1.00 64.28  ? 131  ASN A N     1 
ATOM   969   C  CA    . ASN A 1 131  ? -69.631 -17.493 -52.769 1.00 65.32  ? 131  ASN A CA    1 
ATOM   970   C  C     . ASN A 1 131  ? -70.141 -16.100 -52.400 1.00 67.46  ? 131  ASN A C     1 
ATOM   971   O  O     . ASN A 1 131  ? -71.347 -15.901 -52.292 1.00 68.91  ? 131  ASN A O     1 
ATOM   972   C  CB    . ASN A 1 131  ? -69.376 -18.299 -51.488 1.00 63.85  ? 131  ASN A CB    1 
ATOM   973   C  CG    . ASN A 1 131  ? -69.130 -19.770 -51.764 1.00 62.35  ? 131  ASN A CG    1 
ATOM   974   O  OD1   . ASN A 1 131  ? -68.054 -20.286 -51.500 1.00 60.82  ? 131  ASN A OD1   1 
ATOM   975   N  ND2   . ASN A 1 131  ? -70.126 -20.446 -52.305 1.00 62.71  ? 131  ASN A ND2   1 
ATOM   976   N  N     . HIS A 1 132  ? -69.220 -15.157 -52.204 1.00 68.52  ? 132  HIS A N     1 
ATOM   977   C  CA    . HIS A 1 132  ? -69.537 -13.766 -51.873 1.00 70.78  ? 132  HIS A CA    1 
ATOM   978   C  C     . HIS A 1 132  ? -68.753 -12.826 -52.787 1.00 72.29  ? 132  HIS A C     1 
ATOM   979   O  O     . HIS A 1 132  ? -67.718 -12.296 -52.379 1.00 72.38  ? 132  HIS A O     1 
ATOM   980   C  CB    . HIS A 1 132  ? -69.193 -13.477 -50.414 1.00 70.51  ? 132  HIS A CB    1 
ATOM   981   C  CG    . HIS A 1 132  ? -69.900 -14.366 -49.449 1.00 71.69  ? 132  HIS A CG    1 
ATOM   982   N  ND1   . HIS A 1 132  ? -71.227 -14.198 -49.120 1.00 74.53  ? 132  HIS A ND1   1 
ATOM   983   C  CD2   . HIS A 1 132  ? -69.470 -15.441 -48.751 1.00 71.68  ? 132  HIS A CD2   1 
ATOM   984   C  CE1   . HIS A 1 132  ? -71.583 -15.128 -48.253 1.00 75.05  ? 132  HIS A CE1   1 
ATOM   985   N  NE2   . HIS A 1 132  ? -70.535 -15.898 -48.015 1.00 73.54  ? 132  HIS A NE2   1 
ATOM   986   N  N     . PRO A 1 133  ? -69.243 -12.609 -54.027 1.00 75.08  ? 133  PRO A N     1 
ATOM   987   C  CA    . PRO A 1 133  ? -68.569 -11.738 -55.012 1.00 76.52  ? 133  PRO A CA    1 
ATOM   988   C  C     . PRO A 1 133  ? -68.252 -10.310 -54.539 1.00 79.53  ? 133  PRO A C     1 
ATOM   989   O  O     . PRO A 1 133  ? -67.305 -9.704  -55.035 1.00 80.71  ? 133  PRO A O     1 
ATOM   990   C  CB    . PRO A 1 133  ? -69.566 -11.686 -56.179 1.00 77.45  ? 133  PRO A CB    1 
ATOM   991   C  CG    . PRO A 1 133  ? -70.401 -12.907 -56.034 1.00 77.40  ? 133  PRO A CG    1 
ATOM   992   C  CD    . PRO A 1 133  ? -70.500 -13.167 -54.563 1.00 76.53  ? 133  PRO A CD    1 
ATOM   993   N  N     . GLU A 1 134  ? -69.048 -9.786  -53.608 1.00 83.67  ? 134  GLU A N     1 
ATOM   994   C  CA    . GLU A 1 134  ? -68.839 -8.465  -53.021 1.00 85.70  ? 134  GLU A CA    1 
ATOM   995   C  C     . GLU A 1 134  ? -68.747 -8.631  -51.502 1.00 83.29  ? 134  GLU A C     1 
ATOM   996   O  O     . GLU A 1 134  ? -69.707 -8.334  -50.784 1.00 84.52  ? 134  GLU A O     1 
ATOM   997   C  CB    . GLU A 1 134  ? -69.990 -7.533  -53.421 1.00 90.95  ? 134  GLU A CB    1 
ATOM   998   C  CG    . GLU A 1 134  ? -70.166 -7.421  -54.933 1.00 94.48  ? 134  GLU A CG    1 
ATOM   999   C  CD    . GLU A 1 134  ? -70.922 -6.174  -55.360 1.00 99.42  ? 134  GLU A CD    1 
ATOM   1000  O  OE1   . GLU A 1 134  ? -72.040 -5.939  -54.843 1.00 102.92 ? 134  GLU A OE1   1 
ATOM   1001  O  OE2   . GLU A 1 134  ? -70.397 -5.430  -56.222 1.00 101.97 ? 134  GLU A OE2   1 
ATOM   1002  N  N     . PRO A 1 135  ? -67.588 -9.119  -51.010 1.00 79.09  ? 135  PRO A N     1 
ATOM   1003  C  CA    . PRO A 1 135  ? -67.426 -9.498  -49.606 1.00 76.80  ? 135  PRO A CA    1 
ATOM   1004  C  C     . PRO A 1 135  ? -67.112 -8.347  -48.664 1.00 75.26  ? 135  PRO A C     1 
ATOM   1005  O  O     . PRO A 1 135  ? -66.844 -7.224  -49.111 1.00 74.07  ? 135  PRO A O     1 
ATOM   1006  C  CB    . PRO A 1 135  ? -66.216 -10.435 -49.654 1.00 75.79  ? 135  PRO A CB    1 
ATOM   1007  C  CG    . PRO A 1 135  ? -65.369 -9.862  -50.736 1.00 75.41  ? 135  PRO A CG    1 
ATOM   1008  C  CD    . PRO A 1 135  ? -66.332 -9.324  -51.765 1.00 77.49  ? 135  PRO A CD    1 
ATOM   1009  N  N     . THR A 1 136  ? -67.162 -8.658  -47.367 1.00 74.07  ? 136  THR A N     1 
ATOM   1010  C  CA    . THR A 1 136  ? -66.564 -7.835  -46.314 1.00 73.82  ? 136  THR A CA    1 
ATOM   1011  C  C     . THR A 1 136  ? -65.224 -8.458  -45.899 1.00 72.58  ? 136  THR A C     1 
ATOM   1012  O  O     . THR A 1 136  ? -65.023 -9.663  -46.050 1.00 71.84  ? 136  THR A O     1 
ATOM   1013  C  CB    . THR A 1 136  ? -67.478 -7.735  -45.080 1.00 73.78  ? 136  THR A CB    1 
ATOM   1014  O  OG1   . THR A 1 136  ? -67.774 -9.046  -44.594 1.00 72.73  ? 136  THR A OG1   1 
ATOM   1015  C  CG2   . THR A 1 136  ? -68.770 -7.025  -45.429 1.00 75.02  ? 136  THR A CG2   1 
ATOM   1016  N  N     . LEU A 1 137  ? -64.318 -7.632  -45.374 1.00 72.22  ? 137  LEU A N     1 
ATOM   1017  C  CA    . LEU A 1 137  ? -62.987 -8.086  -44.955 1.00 70.67  ? 137  LEU A CA    1 
ATOM   1018  C  C     . LEU A 1 137  ? -63.040 -9.185  -43.880 1.00 71.14  ? 137  LEU A C     1 
ATOM   1019  O  O     . LEU A 1 137  ? -62.188 -10.077 -43.867 1.00 70.89  ? 137  LEU A O     1 
ATOM   1020  C  CB    . LEU A 1 137  ? -62.141 -6.897  -44.473 1.00 70.35  ? 137  LEU A CB    1 
ATOM   1021  C  CG    . LEU A 1 137  ? -60.661 -7.164  -44.156 1.00 69.65  ? 137  LEU A CG    1 
ATOM   1022  C  CD1   . LEU A 1 137  ? -59.869 -7.592  -45.387 1.00 68.43  ? 137  LEU A CD1   1 
ATOM   1023  C  CD2   . LEU A 1 137  ? -60.023 -5.940  -43.527 1.00 70.21  ? 137  LEU A CD2   1 
ATOM   1024  N  N     . ASP A 1 138  ? -64.047 -9.119  -43.006 1.00 73.25  ? 138  ASP A N     1 
ATOM   1025  C  CA    . ASP A 1 138  ? -64.303 -10.142 -41.971 1.00 73.56  ? 138  ASP A CA    1 
ATOM   1026  C  C     . ASP A 1 138  ? -64.345 -11.543 -42.591 1.00 71.38  ? 138  ASP A C     1 
ATOM   1027  O  O     . ASP A 1 138  ? -63.709 -12.476 -42.104 1.00 69.14  ? 138  ASP A O     1 
ATOM   1028  C  CB    . ASP A 1 138  ? -65.652 -9.916  -41.252 1.00 77.17  ? 138  ASP A CB    1 
ATOM   1029  C  CG    . ASP A 1 138  ? -65.901 -8.462  -40.858 1.00 81.86  ? 138  ASP A CG    1 
ATOM   1030  O  OD1   . ASP A 1 138  ? -65.218 -7.559  -41.403 1.00 84.16  ? 138  ASP A OD1   1 
ATOM   1031  O  OD2   . ASP A 1 138  ? -66.811 -8.219  -40.021 1.00 85.32  ? 138  ASP A OD2   1 
ATOM   1032  N  N     . GLN A 1 139  ? -65.105 -11.656 -43.676 1.00 70.69  ? 139  GLN A N     1 
ATOM   1033  C  CA    . GLN A 1 139  ? -65.325 -12.921 -44.370 1.00 70.58  ? 139  GLN A CA    1 
ATOM   1034  C  C     . GLN A 1 139  ? -64.043 -13.450 -45.016 1.00 70.78  ? 139  GLN A C     1 
ATOM   1035  O  O     . GLN A 1 139  ? -63.737 -14.645 -44.917 1.00 70.16  ? 139  GLN A O     1 
ATOM   1036  C  CB    . GLN A 1 139  ? -66.406 -12.756 -45.442 1.00 70.04  ? 139  GLN A CB    1 
ATOM   1037  C  CG    . GLN A 1 139  ? -67.790 -12.427 -44.904 1.00 70.63  ? 139  GLN A CG    1 
ATOM   1038  C  CD    . GLN A 1 139  ? -68.739 -12.035 -46.014 1.00 70.57  ? 139  GLN A CD    1 
ATOM   1039  O  OE1   . GLN A 1 139  ? -68.518 -11.042 -46.712 1.00 70.07  ? 139  GLN A OE1   1 
ATOM   1040  N  NE2   . GLN A 1 139  ? -69.792 -12.822 -46.198 1.00 70.67  ? 139  GLN A NE2   1 
ATOM   1041  N  N     . LEU A 1 140  ? -63.306 -12.547 -45.663 1.00 71.74  ? 140  LEU A N     1 
ATOM   1042  C  CA    . LEU A 1 140  ? -62.020 -12.868 -46.276 1.00 71.60  ? 140  LEU A CA    1 
ATOM   1043  C  C     . LEU A 1 140  ? -60.971 -13.336 -45.259 1.00 71.78  ? 140  LEU A C     1 
ATOM   1044  O  O     . LEU A 1 140  ? -60.311 -14.349 -45.479 1.00 70.79  ? 140  LEU A O     1 
ATOM   1045  C  CB    . LEU A 1 140  ? -61.485 -11.674 -47.089 1.00 71.52  ? 140  LEU A CB    1 
ATOM   1046  C  CG    . LEU A 1 140  ? -62.097 -11.475 -48.484 1.00 72.21  ? 140  LEU A CG    1 
ATOM   1047  C  CD1   . LEU A 1 140  ? -61.672 -10.155 -49.121 1.00 72.17  ? 140  LEU A CD1   1 
ATOM   1048  C  CD2   . LEU A 1 140  ? -61.730 -12.632 -49.410 1.00 72.56  ? 140  LEU A CD2   1 
ATOM   1049  N  N     . THR A 1 141  ? -60.823 -12.614 -44.152 1.00 72.67  ? 141  THR A N     1 
ATOM   1050  C  CA    . THR A 1 141  ? -59.846 -13.003 -43.134 1.00 72.51  ? 141  THR A CA    1 
ATOM   1051  C  C     . THR A 1 141  ? -60.293 -14.250 -42.362 1.00 73.79  ? 141  THR A C     1 
ATOM   1052  O  O     . THR A 1 141  ? -59.451 -14.975 -41.831 1.00 74.09  ? 141  THR A O     1 
ATOM   1053  C  CB    . THR A 1 141  ? -59.558 -11.860 -42.151 1.00 72.69  ? 141  THR A CB    1 
ATOM   1054  O  OG1   . THR A 1 141  ? -60.763 -11.506 -41.475 1.00 74.01  ? 141  THR A OG1   1 
ATOM   1055  C  CG2   . THR A 1 141  ? -58.995 -10.637 -42.885 1.00 72.86  ? 141  THR A CG2   1 
ATOM   1056  N  N     . ASP A 1 142  ? -61.606 -14.492 -42.288 1.00 75.24  ? 142  ASP A N     1 
ATOM   1057  C  CA    . ASP A 1 142  ? -62.133 -15.772 -41.787 1.00 75.15  ? 142  ASP A CA    1 
ATOM   1058  C  C     . ASP A 1 142  ? -61.767 -16.928 -42.718 1.00 71.66  ? 142  ASP A C     1 
ATOM   1059  O  O     . ASP A 1 142  ? -61.377 -17.993 -42.244 1.00 70.93  ? 142  ASP A O     1 
ATOM   1060  C  CB    . ASP A 1 142  ? -63.659 -15.734 -41.586 1.00 79.27  ? 142  ASP A CB    1 
ATOM   1061  C  CG    . ASP A 1 142  ? -64.068 -15.127 -40.240 1.00 83.92  ? 142  ASP A CG    1 
ATOM   1062  O  OD1   . ASP A 1 142  ? -63.445 -15.461 -39.207 1.00 86.10  ? 142  ASP A OD1   1 
ATOM   1063  O  OD2   . ASP A 1 142  ? -65.033 -14.327 -40.205 1.00 88.80  ? 142  ASP A OD2   1 
ATOM   1064  N  N     . ALA A 1 143  ? -61.884 -16.718 -44.028 1.00 68.23  ? 143  ALA A N     1 
ATOM   1065  C  CA    . ALA A 1 143  ? -61.491 -17.734 -45.018 1.00 65.96  ? 143  ALA A CA    1 
ATOM   1066  C  C     . ALA A 1 143  ? -60.010 -18.130 -44.932 1.00 63.71  ? 143  ALA A C     1 
ATOM   1067  O  O     . ALA A 1 143  ? -59.657 -19.287 -45.171 1.00 61.72  ? 143  ALA A O     1 
ATOM   1068  C  CB    . ALA A 1 143  ? -61.820 -17.259 -46.429 1.00 66.22  ? 143  ALA A CB    1 
ATOM   1069  N  N     . LEU A 1 144  ? -59.170 -17.157 -44.584 1.00 62.74  ? 144  LEU A N     1 
ATOM   1070  C  CA    . LEU A 1 144  ? -57.734 -17.350 -44.411 1.00 61.31  ? 144  LEU A CA    1 
ATOM   1071  C  C     . LEU A 1 144  ? -57.308 -17.761 -42.989 1.00 61.21  ? 144  LEU A C     1 
ATOM   1072  O  O     . LEU A 1 144  ? -56.107 -17.855 -42.710 1.00 61.72  ? 144  LEU A O     1 
ATOM   1073  C  CB    . LEU A 1 144  ? -56.991 -16.077 -44.823 1.00 60.72  ? 144  LEU A CB    1 
ATOM   1074  C  CG    . LEU A 1 144  ? -57.162 -15.682 -46.285 1.00 60.36  ? 144  LEU A CG    1 
ATOM   1075  C  CD1   . LEU A 1 144  ? -56.594 -14.294 -46.527 1.00 61.50  ? 144  LEU A CD1   1 
ATOM   1076  C  CD2   . LEU A 1 144  ? -56.495 -16.701 -47.190 1.00 59.74  ? 144  LEU A CD2   1 
ATOM   1077  N  N     . GLY A 1 145  ? -58.265 -18.025 -42.101 1.00 60.77  ? 145  GLY A N     1 
ATOM   1078  C  CA    . GLY A 1 145  ? -57.957 -18.549 -40.770 1.00 60.73  ? 145  GLY A CA    1 
ATOM   1079  C  C     . GLY A 1 145  ? -57.226 -19.879 -40.793 1.00 60.45  ? 145  GLY A C     1 
ATOM   1080  O  O     . GLY A 1 145  ? -56.419 -20.162 -39.913 1.00 60.38  ? 145  GLY A O     1 
ATOM   1081  N  N     . GLY A 1 146  ? -57.508 -20.692 -41.807 1.00 60.94  ? 146  GLY A N     1 
ATOM   1082  C  CA    . GLY A 1 146  ? -56.834 -21.975 -41.985 1.00 61.13  ? 146  GLY A CA    1 
ATOM   1083  C  C     . GLY A 1 146  ? -55.494 -21.960 -42.716 1.00 59.68  ? 146  GLY A C     1 
ATOM   1084  O  O     . GLY A 1 146  ? -54.854 -23.008 -42.807 1.00 60.55  ? 146  GLY A O     1 
ATOM   1085  N  N     . ASN A 1 147  ? -55.073 -20.794 -43.222 1.00 57.63  ? 147  ASN A N     1 
ATOM   1086  C  CA    . ASN A 1 147  ? -53.888 -20.662 -44.077 1.00 55.68  ? 147  ASN A CA    1 
ATOM   1087  C  C     . ASN A 1 147  ? -52.718 -20.039 -43.319 1.00 55.98  ? 147  ASN A C     1 
ATOM   1088  O  O     . ASN A 1 147  ? -52.831 -18.907 -42.841 1.00 59.68  ? 147  ASN A O     1 
ATOM   1089  C  CB    . ASN A 1 147  ? -54.197 -19.797 -45.301 1.00 54.36  ? 147  ASN A CB    1 
ATOM   1090  C  CG    . ASN A 1 147  ? -55.152 -20.465 -46.268 1.00 54.26  ? 147  ASN A CG    1 
ATOM   1091  O  OD1   . ASN A 1 147  ? -54.738 -21.048 -47.267 1.00 54.61  ? 147  ASN A OD1   1 
ATOM   1092  N  ND2   . ASN A 1 147  ? -56.431 -20.399 -45.972 1.00 54.19  ? 147  ASN A ND2   1 
ATOM   1093  N  N     . LEU A 1 148  ? -51.598 -20.758 -43.236 1.00 54.61  ? 148  LEU A N     1 
ATOM   1094  C  CA    . LEU A 1 148  ? -50.401 -20.297 -42.524 1.00 53.42  ? 148  LEU A CA    1 
ATOM   1095  C  C     . LEU A 1 148  ? -49.322 -19.780 -43.472 1.00 52.06  ? 148  LEU A C     1 
ATOM   1096  O  O     . LEU A 1 148  ? -49.199 -20.255 -44.595 1.00 51.93  ? 148  LEU A O     1 
ATOM   1097  C  CB    . LEU A 1 148  ? -49.822 -21.434 -41.689 1.00 53.28  ? 148  LEU A CB    1 
ATOM   1098  C  CG    . LEU A 1 148  ? -50.761 -22.052 -40.657 1.00 54.95  ? 148  LEU A CG    1 
ATOM   1099  C  CD1   . LEU A 1 148  ? -50.042 -23.183 -39.943 1.00 55.92  ? 148  LEU A CD1   1 
ATOM   1100  C  CD2   . LEU A 1 148  ? -51.274 -21.029 -39.650 1.00 55.82  ? 148  LEU A CD2   1 
ATOM   1101  N  N     . CYS A 1 149  ? -48.527 -18.827 -42.989 1.00 51.71  ? 149  CYS A N     1 
ATOM   1102  C  CA    . CYS A 1 149  ? -47.423 -18.239 -43.748 1.00 50.42  ? 149  CYS A CA    1 
ATOM   1103  C  C     . CYS A 1 149  ? -46.304 -17.821 -42.809 1.00 51.05  ? 149  CYS A C     1 
ATOM   1104  O  O     . CYS A 1 149  ? -46.543 -17.104 -41.843 1.00 54.07  ? 149  CYS A O     1 
ATOM   1105  C  CB    . CYS A 1 149  ? -47.889 -17.031 -44.552 1.00 49.13  ? 149  CYS A CB    1 
ATOM   1106  S  SG    . CYS A 1 149  ? -46.555 -16.251 -45.491 1.00 47.64  ? 149  CYS A SG    1 
ATOM   1107  N  N     . ARG A 1 150  ? -45.086 -18.256 -43.116 1.00 50.40  ? 150  ARG A N     1 
ATOM   1108  C  CA    . ARG A 1 150  ? -43.919 -18.042 -42.273 1.00 50.37  ? 150  ARG A CA    1 
ATOM   1109  C  C     . ARG A 1 150  ? -43.074 -16.842 -42.700 1.00 51.00  ? 150  ARG A C     1 
ATOM   1110  O  O     . ARG A 1 150  ? -42.136 -16.477 -41.987 1.00 52.41  ? 150  ARG A O     1 
ATOM   1111  C  CB    . ARG A 1 150  ? -43.046 -19.299 -42.320 1.00 50.53  ? 150  ARG A CB    1 
ATOM   1112  C  CG    . ARG A 1 150  ? -41.947 -19.401 -41.273 1.00 51.01  ? 150  ARG A CG    1 
ATOM   1113  C  CD    . ARG A 1 150  ? -42.502 -19.258 -39.872 1.00 52.38  ? 150  ARG A CD    1 
ATOM   1114  N  NE    . ARG A 1 150  ? -41.709 -19.954 -38.861 1.00 53.25  ? 150  ARG A NE    1 
ATOM   1115  C  CZ    . ARG A 1 150  ? -41.678 -19.647 -37.562 1.00 54.56  ? 150  ARG A CZ    1 
ATOM   1116  N  NH1   . ARG A 1 150  ? -42.390 -18.624 -37.064 1.00 55.33  ? 150  ARG A NH1   1 
ATOM   1117  N  NH2   . ARG A 1 150  ? -40.921 -20.373 -36.740 1.00 54.97  ? 150  ARG A NH2   1 
ATOM   1118  N  N     . CYS A 1 151  ? -43.382 -16.237 -43.851 1.00 50.23  ? 151  CYS A N     1 
ATOM   1119  C  CA    . CYS A 1 151  ? -42.548 -15.175 -44.412 1.00 49.28  ? 151  CYS A CA    1 
ATOM   1120  C  C     . CYS A 1 151  ? -43.174 -13.778 -44.275 1.00 50.61  ? 151  CYS A C     1 
ATOM   1121  O  O     . CYS A 1 151  ? -42.554 -12.892 -43.733 1.00 49.76  ? 151  CYS A O     1 
ATOM   1122  C  CB    . CYS A 1 151  ? -42.246 -15.461 -45.880 1.00 48.70  ? 151  CYS A CB    1 
ATOM   1123  S  SG    . CYS A 1 151  ? -41.422 -17.034 -46.271 1.00 48.04  ? 151  CYS A SG    1 
ATOM   1124  N  N     . THR A 1 152  ? -44.411 -13.598 -44.734 1.00 51.48  ? 152  THR A N     1 
ATOM   1125  C  CA    . THR A 1 152  ? -44.973 -12.263 -45.015 1.00 51.97  ? 152  THR A CA    1 
ATOM   1126  C  C     . THR A 1 152  ? -45.451 -11.439 -43.822 1.00 54.50  ? 152  THR A C     1 
ATOM   1127  O  O     . THR A 1 152  ? -45.547 -10.202 -43.915 1.00 55.91  ? 152  THR A O     1 
ATOM   1128  C  CB    . THR A 1 152  ? -46.184 -12.351 -45.970 1.00 51.71  ? 152  THR A CB    1 
ATOM   1129  O  OG1   . THR A 1 152  ? -47.261 -13.052 -45.332 1.00 51.00  ? 152  THR A OG1   1 
ATOM   1130  C  CG2   . THR A 1 152  ? -45.807 -13.047 -47.283 1.00 51.62  ? 152  THR A CG2   1 
ATOM   1131  N  N     . GLY A 1 153  ? -45.796 -12.112 -42.729 1.00 55.77  ? 153  GLY A N     1 
ATOM   1132  C  CA    . GLY A 1 153  ? -46.518 -11.472 -41.629 1.00 56.74  ? 153  GLY A CA    1 
ATOM   1133  C  C     . GLY A 1 153  ? -47.987 -11.207 -41.932 1.00 57.42  ? 153  GLY A C     1 
ATOM   1134  O  O     . GLY A 1 153  ? -48.639 -10.500 -41.183 1.00 59.45  ? 153  GLY A O     1 
ATOM   1135  N  N     . TYR A 1 154  ? -48.507 -11.757 -43.032 1.00 57.73  ? 154  TYR A N     1 
ATOM   1136  C  CA    . TYR A 1 154  ? -49.923 -11.653 -43.432 1.00 57.91  ? 154  TYR A CA    1 
ATOM   1137  C  C     . TYR A 1 154  ? -50.419 -10.279 -43.909 1.00 60.15  ? 154  TYR A C     1 
ATOM   1138  O  O     . TYR A 1 154  ? -51.354 -10.228 -44.706 1.00 60.89  ? 154  TYR A O     1 
ATOM   1139  C  CB    . TYR A 1 154  ? -50.854 -12.206 -42.343 1.00 57.19  ? 154  TYR A CB    1 
ATOM   1140  C  CG    . TYR A 1 154  ? -50.524 -13.617 -41.898 1.00 55.37  ? 154  TYR A CG    1 
ATOM   1141  C  CD1   . TYR A 1 154  ? -50.995 -14.720 -42.606 1.00 54.54  ? 154  TYR A CD1   1 
ATOM   1142  C  CD2   . TYR A 1 154  ? -49.753 -13.853 -40.757 1.00 54.41  ? 154  TYR A CD2   1 
ATOM   1143  C  CE1   . TYR A 1 154  ? -50.704 -16.013 -42.193 1.00 53.37  ? 154  TYR A CE1   1 
ATOM   1144  C  CE2   . TYR A 1 154  ? -49.460 -15.144 -40.333 1.00 52.73  ? 154  TYR A CE2   1 
ATOM   1145  C  CZ    . TYR A 1 154  ? -49.931 -16.220 -41.056 1.00 52.44  ? 154  TYR A CZ    1 
ATOM   1146  O  OH    . TYR A 1 154  ? -49.649 -17.511 -40.657 1.00 50.99  ? 154  TYR A OH    1 
ATOM   1147  N  N     . ARG A 1 155  ? -49.803 -9.187  -43.450 1.00 62.87  ? 155  ARG A N     1 
ATOM   1148  C  CA    . ARG A 1 155  ? -50.222 -7.811  -43.798 1.00 64.39  ? 155  ARG A CA    1 
ATOM   1149  C  C     . ARG A 1 155  ? -50.448 -7.595  -45.310 1.00 63.09  ? 155  ARG A C     1 
ATOM   1150  O  O     . ARG A 1 155  ? -51.484 -7.050  -45.691 1.00 64.06  ? 155  ARG A O     1 
ATOM   1151  C  CB    . ARG A 1 155  ? -49.223 -6.780  -43.220 1.00 66.34  ? 155  ARG A CB    1 
ATOM   1152  C  CG    . ARG A 1 155  ? -49.623 -5.300  -43.297 1.00 69.10  ? 155  ARG A CG    1 
ATOM   1153  C  CD    . ARG A 1 155  ? -49.285 -4.605  -44.623 1.00 71.04  ? 155  ARG A CD    1 
ATOM   1154  N  NE    . ARG A 1 155  ? -47.889 -4.788  -45.036 1.00 73.31  ? 155  ARG A NE    1 
ATOM   1155  C  CZ    . ARG A 1 155  ? -47.403 -4.581  -46.268 1.00 75.13  ? 155  ARG A CZ    1 
ATOM   1156  N  NH1   . ARG A 1 155  ? -48.170 -4.127  -47.263 1.00 76.85  ? 155  ARG A NH1   1 
ATOM   1157  N  NH2   . ARG A 1 155  ? -46.115 -4.813  -46.508 1.00 74.03  ? 155  ARG A NH2   1 
ATOM   1158  N  N     . PRO A 1 156  ? -49.496 -8.015  -46.171 1.00 60.64  ? 156  PRO A N     1 
ATOM   1159  C  CA    . PRO A 1 156  ? -49.728 -7.783  -47.612 1.00 60.33  ? 156  PRO A CA    1 
ATOM   1160  C  C     . PRO A 1 156  ? -50.836 -8.635  -48.244 1.00 59.06  ? 156  PRO A C     1 
ATOM   1161  O  O     . PRO A 1 156  ? -51.464 -8.202  -49.213 1.00 58.50  ? 156  PRO A O     1 
ATOM   1162  C  CB    . PRO A 1 156  ? -48.362 -8.083  -48.245 1.00 58.96  ? 156  PRO A CB    1 
ATOM   1163  C  CG    . PRO A 1 156  ? -47.671 -8.954  -47.269 1.00 58.84  ? 156  PRO A CG    1 
ATOM   1164  C  CD    . PRO A 1 156  ? -48.126 -8.491  -45.918 1.00 59.61  ? 156  PRO A CD    1 
ATOM   1165  N  N     . ILE A 1 157  ? -51.062 -9.829  -47.697 1.00 58.31  ? 157  ILE A N     1 
ATOM   1166  C  CA    . ILE A 1 157  ? -52.181 -10.684 -48.098 1.00 57.71  ? 157  ILE A CA    1 
ATOM   1167  C  C     . ILE A 1 157  ? -53.502 -10.020 -47.652 1.00 59.37  ? 157  ILE A C     1 
ATOM   1168  O  O     . ILE A 1 157  ? -54.476 -10.038 -48.403 1.00 57.99  ? 157  ILE A O     1 
ATOM   1169  C  CB    . ILE A 1 157  ? -52.052 -12.123 -47.517 1.00 56.98  ? 157  ILE A CB    1 
ATOM   1170  C  CG1   . ILE A 1 157  ? -50.775 -12.831 -48.016 1.00 55.60  ? 157  ILE A CG1   1 
ATOM   1171  C  CG2   . ILE A 1 157  ? -53.256 -12.983 -47.891 1.00 58.17  ? 157  ILE A CG2   1 
ATOM   1172  C  CD1   . ILE A 1 157  ? -50.352 -14.036 -47.186 1.00 53.77  ? 157  ILE A CD1   1 
ATOM   1173  N  N     . ILE A 1 158  ? -53.518 -9.422  -46.451 1.00 61.10  ? 158  ILE A N     1 
ATOM   1174  C  CA    . ILE A 1 158  ? -54.684 -8.652  -45.961 1.00 64.14  ? 158  ILE A CA    1 
ATOM   1175  C  C     . ILE A 1 158  ? -54.989 -7.443  -46.875 1.00 66.08  ? 158  ILE A C     1 
ATOM   1176  O  O     . ILE A 1 158  ? -56.156 -7.162  -47.171 1.00 66.17  ? 158  ILE A O     1 
ATOM   1177  C  CB    . ILE A 1 158  ? -54.517 -8.162  -44.482 1.00 65.28  ? 158  ILE A CB    1 
ATOM   1178  C  CG1   . ILE A 1 158  ? -54.320 -9.325  -43.492 1.00 65.77  ? 158  ILE A CG1   1 
ATOM   1179  C  CG2   . ILE A 1 158  ? -55.718 -7.331  -44.032 1.00 66.52  ? 158  ILE A CG2   1 
ATOM   1180  C  CD1   . ILE A 1 158  ? -55.362 -10.426 -43.558 1.00 66.94  ? 158  ILE A CD1   1 
ATOM   1181  N  N     . ASP A 1 159  ? -53.945 -6.736  -47.313 1.00 66.97  ? 159  ASP A N     1 
ATOM   1182  C  CA    . ASP A 1 159  ? -54.102 -5.616  -48.246 1.00 68.44  ? 159  ASP A CA    1 
ATOM   1183  C  C     . ASP A 1 159  ? -54.709 -6.070  -49.571 1.00 66.30  ? 159  ASP A C     1 
ATOM   1184  O  O     . ASP A 1 159  ? -55.559 -5.383  -50.129 1.00 66.85  ? 159  ASP A O     1 
ATOM   1185  C  CB    . ASP A 1 159  ? -52.755 -4.907  -48.512 1.00 70.93  ? 159  ASP A CB    1 
ATOM   1186  C  CG    . ASP A 1 159  ? -52.254 -4.070  -47.313 1.00 73.12  ? 159  ASP A CG    1 
ATOM   1187  O  OD1   . ASP A 1 159  ? -53.062 -3.664  -46.438 1.00 75.50  ? 159  ASP A OD1   1 
ATOM   1188  O  OD2   . ASP A 1 159  ? -51.031 -3.806  -47.262 1.00 72.85  ? 159  ASP A OD2   1 
ATOM   1189  N  N     . ALA A 1 160  ? -54.270 -7.222  -50.067 1.00 64.68  ? 160  ALA A N     1 
ATOM   1190  C  CA    . ALA A 1 160  ? -54.817 -7.781  -51.308 1.00 64.21  ? 160  ALA A CA    1 
ATOM   1191  C  C     . ALA A 1 160  ? -56.315 -8.074  -51.176 1.00 64.61  ? 160  ALA A C     1 
ATOM   1192  O  O     . ALA A 1 160  ? -57.100 -7.732  -52.060 1.00 64.42  ? 160  ALA A O     1 
ATOM   1193  C  CB    . ALA A 1 160  ? -54.059 -9.032  -51.713 1.00 62.07  ? 160  ALA A CB    1 
ATOM   1194  N  N     . CYS A 1 161  ? -56.693 -8.689  -50.060 1.00 64.50  ? 161  CYS A N     1 
ATOM   1195  C  CA    . CYS A 1 161  ? -58.096 -8.915  -49.718 1.00 65.62  ? 161  CYS A CA    1 
ATOM   1196  C  C     . CYS A 1 161  ? -58.931 -7.630  -49.661 1.00 67.92  ? 161  CYS A C     1 
ATOM   1197  O  O     . CYS A 1 161  ? -60.054 -7.604  -50.163 1.00 70.91  ? 161  CYS A O     1 
ATOM   1198  C  CB    . CYS A 1 161  ? -58.196 -9.644  -48.379 1.00 65.25  ? 161  CYS A CB    1 
ATOM   1199  S  SG    . CYS A 1 161  ? -57.513 -11.313 -48.412 1.00 64.65  ? 161  CYS A SG    1 
ATOM   1200  N  N     . LYS A 1 162  ? -58.393 -6.570  -49.061 1.00 68.34  ? 162  LYS A N     1 
ATOM   1201  C  CA    . LYS A 1 162  ? -59.116 -5.292  -48.975 1.00 69.41  ? 162  LYS A CA    1 
ATOM   1202  C  C     . LYS A 1 162  ? -59.500 -4.707  -50.325 1.00 68.31  ? 162  LYS A C     1 
ATOM   1203  O  O     . LYS A 1 162  ? -60.565 -4.102  -50.439 1.00 69.92  ? 162  LYS A O     1 
ATOM   1204  C  CB    . LYS A 1 162  ? -58.320 -4.253  -48.193 1.00 71.71  ? 162  LYS A CB    1 
ATOM   1205  C  CG    . LYS A 1 162  ? -58.344 -4.493  -46.702 1.00 73.76  ? 162  LYS A CG    1 
ATOM   1206  C  CD    . LYS A 1 162  ? -57.507 -3.465  -45.971 1.00 76.61  ? 162  LYS A CD    1 
ATOM   1207  C  CE    . LYS A 1 162  ? -57.722 -3.570  -44.472 1.00 78.50  ? 162  LYS A CE    1 
ATOM   1208  N  NZ    . LYS A 1 162  ? -56.711 -2.785  -43.719 1.00 79.89  ? 162  LYS A NZ    1 
ATOM   1209  N  N     . THR A 1 163  ? -58.664 -4.913  -51.343 1.00 66.04  ? 163  THR A N     1 
ATOM   1210  C  CA    . THR A 1 163  ? -58.941 -4.414  -52.704 1.00 65.98  ? 163  THR A CA    1 
ATOM   1211  C  C     . THR A 1 163  ? -60.196 -5.041  -53.332 1.00 66.88  ? 163  THR A C     1 
ATOM   1212  O  O     . THR A 1 163  ? -60.747 -4.485  -54.285 1.00 67.97  ? 163  THR A O     1 
ATOM   1213  C  CB    . THR A 1 163  ? -57.741 -4.602  -53.671 1.00 65.12  ? 163  THR A CB    1 
ATOM   1214  O  OG1   . THR A 1 163  ? -57.565 -5.986  -53.986 1.00 64.16  ? 163  THR A OG1   1 
ATOM   1215  C  CG2   . THR A 1 163  ? -56.438 -4.070  -53.064 1.00 64.95  ? 163  THR A CG2   1 
ATOM   1216  N  N     . PHE A 1 164  ? -60.628 -6.194  -52.808 1.00 66.71  ? 164  PHE A N     1 
ATOM   1217  C  CA    . PHE A 1 164  ? -61.900 -6.828  -53.192 1.00 67.72  ? 164  PHE A CA    1 
ATOM   1218  C  C     . PHE A 1 164  ? -63.137 -6.357  -52.401 1.00 71.02  ? 164  PHE A C     1 
ATOM   1219  O  O     . PHE A 1 164  ? -64.250 -6.733  -52.756 1.00 70.71  ? 164  PHE A O     1 
ATOM   1220  C  CB    . PHE A 1 164  ? -61.792 -8.361  -53.077 1.00 65.21  ? 164  PHE A CB    1 
ATOM   1221  C  CG    . PHE A 1 164  ? -60.869 -8.978  -54.081 1.00 62.96  ? 164  PHE A CG    1 
ATOM   1222  C  CD1   . PHE A 1 164  ? -61.265 -9.118  -55.407 1.00 62.73  ? 164  PHE A CD1   1 
ATOM   1223  C  CD2   . PHE A 1 164  ? -59.604 -9.429  -53.707 1.00 60.90  ? 164  PHE A CD2   1 
ATOM   1224  C  CE1   . PHE A 1 164  ? -60.412 -9.682  -56.345 1.00 61.76  ? 164  PHE A CE1   1 
ATOM   1225  C  CE2   . PHE A 1 164  ? -58.752 -9.996  -54.638 1.00 59.63  ? 164  PHE A CE2   1 
ATOM   1226  C  CZ    . PHE A 1 164  ? -59.155 -10.124 -55.960 1.00 60.03  ? 164  PHE A CZ    1 
ATOM   1227  N  N     . CYS A 1 165  ? -62.959 -5.565  -51.342 1.00 75.05  ? 165  CYS A N     1 
ATOM   1228  C  CA    . CYS A 1 165  ? -64.085 -5.108  -50.505 1.00 79.51  ? 165  CYS A CA    1 
ATOM   1229  C  C     . CYS A 1 165  ? -64.556 -3.718  -50.922 1.00 83.92  ? 165  CYS A C     1 
ATOM   1230  O  O     . CYS A 1 165  ? -63.744 -2.804  -51.058 1.00 84.60  ? 165  CYS A O     1 
ATOM   1231  C  CB    . CYS A 1 165  ? -63.668 -5.072  -49.039 1.00 79.40  ? 165  CYS A CB    1 
ATOM   1232  S  SG    . CYS A 1 165  ? -63.038 -6.642  -48.412 1.00 78.57  ? 165  CYS A SG    1 
ATOM   1233  N  N     . LYS A 1 166  ? -65.861 -3.555  -51.121 1.00 89.66  ? 166  LYS A N     1 
ATOM   1234  C  CA    . LYS A 1 166  ? -66.422 -2.252  -51.479 1.00 95.71  ? 166  LYS A CA    1 
ATOM   1235  C  C     . LYS A 1 166  ? -66.593 -1.421  -50.203 1.00 100.44 ? 166  LYS A C     1 
ATOM   1236  O  O     . LYS A 1 166  ? -67.701 -1.276  -49.674 1.00 102.14 ? 166  LYS A O     1 
ATOM   1237  C  CB    . LYS A 1 166  ? -67.742 -2.412  -52.252 1.00 97.06  ? 166  LYS A CB    1 
ATOM   1238  C  CG    . LYS A 1 166  ? -68.390 -1.113  -52.728 1.00 99.42  ? 166  LYS A CG    1 
ATOM   1239  C  CD    . LYS A 1 166  ? -67.409 -0.124  -53.358 1.00 99.32  ? 166  LYS A CD    1 
ATOM   1240  C  CE    . LYS A 1 166  ? -68.134 0.994   -54.097 1.00 101.04 ? 166  LYS A CE    1 
ATOM   1241  N  NZ    . LYS A 1 166  ? -69.124 1.721   -53.247 1.00 102.19 ? 166  LYS A NZ    1 
ATOM   1242  N  N     . THR A 1 167  ? -65.467 -0.886  -49.724 1.00 103.79 ? 167  THR A N     1 
ATOM   1243  C  CA    . THR A 1 167  ? -65.390 -0.155  -48.453 1.00 105.73 ? 167  THR A CA    1 
ATOM   1244  C  C     . THR A 1 167  ? -65.594 1.344   -48.670 1.00 105.65 ? 167  THR A C     1 
ATOM   1245  O  O     . THR A 1 167  ? -66.721 1.826   -48.666 1.00 106.11 ? 167  THR A O     1 
ATOM   1246  C  CB    . THR A 1 167  ? -64.026 -0.383  -47.755 1.00 105.11 ? 167  THR A CB    1 
ATOM   1247  O  OG1   . THR A 1 167  ? -62.966 0.122   -48.580 1.00 105.53 ? 167  THR A OG1   1 
ATOM   1248  C  CG2   . THR A 1 167  ? -63.792 -1.868  -47.485 1.00 102.71 ? 167  THR A CG2   1 
ATOM   1249  N  N     . PRO A 1 199  ? -47.787 7.473   -50.227 1.00 98.09  ? 199  PRO A N     1 
ATOM   1250  C  CA    . PRO A 1 199  ? -46.929 6.797   -51.205 1.00 97.26  ? 199  PRO A CA    1 
ATOM   1251  C  C     . PRO A 1 199  ? -46.934 5.252   -51.066 1.00 95.55  ? 199  PRO A C     1 
ATOM   1252  O  O     . PRO A 1 199  ? -46.229 4.698   -50.220 1.00 94.44  ? 199  PRO A O     1 
ATOM   1253  C  CB    . PRO A 1 199  ? -45.548 7.411   -50.925 1.00 97.61  ? 199  PRO A CB    1 
ATOM   1254  C  CG    . PRO A 1 199  ? -45.854 8.796   -50.430 1.00 99.48  ? 199  PRO A CG    1 
ATOM   1255  C  CD    . PRO A 1 199  ? -47.234 8.776   -49.811 1.00 99.84  ? 199  PRO A CD    1 
ATOM   1256  N  N     . LYS A 1 200  ? -47.721 4.582   -51.914 1.00 93.81  ? 200  LYS A N     1 
ATOM   1257  C  CA    . LYS A 1 200  ? -48.005 3.137   -51.802 1.00 91.23  ? 200  LYS A CA    1 
ATOM   1258  C  C     . LYS A 1 200  ? -46.969 2.247   -52.492 1.00 86.46  ? 200  LYS A C     1 
ATOM   1259  O  O     . LYS A 1 200  ? -46.267 2.691   -53.403 1.00 85.50  ? 200  LYS A O     1 
ATOM   1260  C  CB    . LYS A 1 200  ? -49.376 2.821   -52.417 1.00 93.57  ? 200  LYS A CB    1 
ATOM   1261  C  CG    . LYS A 1 200  ? -50.550 3.578   -51.819 1.00 96.86  ? 200  LYS A CG    1 
ATOM   1262  C  CD    . LYS A 1 200  ? -50.947 3.022   -50.460 1.00 98.30  ? 200  LYS A CD    1 
ATOM   1263  C  CE    . LYS A 1 200  ? -52.054 3.860   -49.838 1.00 100.28 ? 200  LYS A CE    1 
ATOM   1264  N  NZ    . LYS A 1 200  ? -52.489 3.296   -48.534 1.00 100.68 ? 200  LYS A NZ    1 
ATOM   1265  N  N     . LEU A 1 201  ? -46.920 0.977   -52.072 1.00 81.90  ? 201  LEU A N     1 
ATOM   1266  C  CA    . LEU A 1 201  ? -46.000 -0.032  -52.644 1.00 77.71  ? 201  LEU A CA    1 
ATOM   1267  C  C     . LEU A 1 201  ? -46.526 -0.748  -53.896 1.00 75.11  ? 201  LEU A C     1 
ATOM   1268  O  O     . LEU A 1 201  ? -45.797 -1.548  -54.496 1.00 72.03  ? 201  LEU A O     1 
ATOM   1269  C  CB    . LEU A 1 201  ? -45.645 -1.089  -51.591 1.00 75.74  ? 201  LEU A CB    1 
ATOM   1270  C  CG    . LEU A 1 201  ? -44.822 -0.611  -50.397 1.00 75.93  ? 201  LEU A CG    1 
ATOM   1271  C  CD1   . LEU A 1 201  ? -44.868 -1.648  -49.284 1.00 74.74  ? 201  LEU A CD1   1 
ATOM   1272  C  CD2   . LEU A 1 201  ? -43.381 -0.315  -50.805 1.00 75.62  ? 201  LEU A CD2   1 
ATOM   1273  N  N     . PHE A 1 202  ? -47.778 -0.475  -54.270 1.00 73.71  ? 202  PHE A N     1 
ATOM   1274  C  CA    . PHE A 1 202  ? -48.408 -1.060  -55.461 1.00 72.41  ? 202  PHE A CA    1 
ATOM   1275  C  C     . PHE A 1 202  ? -49.534 -0.157  -55.956 1.00 74.26  ? 202  PHE A C     1 
ATOM   1276  O  O     . PHE A 1 202  ? -50.135 0.561   -55.160 1.00 74.67  ? 202  PHE A O     1 
ATOM   1277  C  CB    . PHE A 1 202  ? -48.958 -2.453  -55.141 1.00 69.80  ? 202  PHE A CB    1 
ATOM   1278  C  CG    . PHE A 1 202  ? -49.868 -2.488  -53.941 1.00 69.17  ? 202  PHE A CG    1 
ATOM   1279  C  CD1   . PHE A 1 202  ? -49.347 -2.656  -52.663 1.00 68.63  ? 202  PHE A CD1   1 
ATOM   1280  C  CD2   . PHE A 1 202  ? -51.238 -2.339  -54.086 1.00 68.49  ? 202  PHE A CD2   1 
ATOM   1281  C  CE1   . PHE A 1 202  ? -50.177 -2.670  -51.556 1.00 68.62  ? 202  PHE A CE1   1 
ATOM   1282  C  CE2   . PHE A 1 202  ? -52.071 -2.354  -52.984 1.00 68.65  ? 202  PHE A CE2   1 
ATOM   1283  C  CZ    . PHE A 1 202  ? -51.542 -2.521  -51.716 1.00 68.53  ? 202  PHE A CZ    1 
ATOM   1284  N  N     . ALA A 1 203  ? -49.815 -0.208  -57.258 1.00 75.84  ? 203  ALA A N     1 
ATOM   1285  C  CA    . ALA A 1 203  ? -50.862 0.616   -57.885 1.00 78.00  ? 203  ALA A CA    1 
ATOM   1286  C  C     . ALA A 1 203  ? -52.210 -0.129  -57.925 1.00 80.02  ? 203  ALA A C     1 
ATOM   1287  O  O     . ALA A 1 203  ? -52.459 -0.924  -58.832 1.00 80.23  ? 203  ALA A O     1 
ATOM   1288  C  CB    . ALA A 1 203  ? -50.433 1.038   -59.286 1.00 77.13  ? 203  ALA A CB    1 
ATOM   1289  N  N     . GLU A 1 204  ? -53.065 0.135   -56.934 1.00 83.23  ? 204  GLU A N     1 
ATOM   1290  C  CA    . GLU A 1 204  ? -54.366 -0.532  -56.809 1.00 84.92  ? 204  GLU A CA    1 
ATOM   1291  C  C     . GLU A 1 204  ? -55.263 -0.239  -58.009 1.00 87.00  ? 204  GLU A C     1 
ATOM   1292  O  O     . GLU A 1 204  ? -55.913 -1.143  -58.533 1.00 87.40  ? 204  GLU A O     1 
ATOM   1293  C  CB    . GLU A 1 204  ? -55.075 -0.106  -55.517 1.00 87.05  ? 204  GLU A CB    1 
ATOM   1294  C  CG    . GLU A 1 204  ? -56.357 -0.888  -55.227 1.00 89.05  ? 204  GLU A CG    1 
ATOM   1295  C  CD    . GLU A 1 204  ? -57.075 -0.472  -53.944 1.00 90.72  ? 204  GLU A CD    1 
ATOM   1296  O  OE1   . GLU A 1 204  ? -56.436 0.109   -53.031 1.00 90.65  ? 204  GLU A OE1   1 
ATOM   1297  O  OE2   . GLU A 1 204  ? -58.295 -0.744  -53.849 1.00 90.64  ? 204  GLU A OE2   1 
ATOM   1298  N  N     . GLU A 1 205  ? -55.289 1.026   -58.425 1.00 88.63  ? 205  GLU A N     1 
ATOM   1299  C  CA    . GLU A 1 205  ? -56.042 1.480   -59.609 1.00 90.27  ? 205  GLU A CA    1 
ATOM   1300  C  C     . GLU A 1 205  ? -55.709 0.755   -60.933 1.00 88.60  ? 205  GLU A C     1 
ATOM   1301  O  O     . GLU A 1 205  ? -56.524 0.758   -61.851 1.00 90.05  ? 205  GLU A O     1 
ATOM   1302  C  CB    . GLU A 1 205  ? -55.927 3.017   -59.784 1.00 93.08  ? 205  GLU A CB    1 
ATOM   1303  C  CG    . GLU A 1 205  ? -54.598 3.576   -60.320 1.00 94.65  ? 205  GLU A CG    1 
ATOM   1304  C  CD    . GLU A 1 205  ? -53.423 3.527   -59.337 1.00 95.44  ? 205  GLU A CD    1 
ATOM   1305  O  OE1   . GLU A 1 205  ? -53.571 3.052   -58.186 1.00 95.14  ? 205  GLU A OE1   1 
ATOM   1306  O  OE2   . GLU A 1 205  ? -52.321 3.969   -59.726 1.00 97.40  ? 205  GLU A OE2   1 
ATOM   1307  N  N     . GLU A 1 206  ? -54.524 0.160   -61.041 1.00 86.00  ? 206  GLU A N     1 
ATOM   1308  C  CA    . GLU A 1 206  ? -54.156 -0.608  -62.234 1.00 87.25  ? 206  GLU A CA    1 
ATOM   1309  C  C     . GLU A 1 206  ? -54.588 -2.087  -62.202 1.00 86.71  ? 206  GLU A C     1 
ATOM   1310  O  O     . GLU A 1 206  ? -54.430 -2.781  -63.207 1.00 84.43  ? 206  GLU A O     1 
ATOM   1311  C  CB    . GLU A 1 206  ? -52.644 -0.499  -62.497 1.00 88.56  ? 206  GLU A CB    1 
ATOM   1312  C  CG    . GLU A 1 206  ? -52.192 0.892   -62.941 1.00 90.50  ? 206  GLU A CG    1 
ATOM   1313  C  CD    . GLU A 1 206  ? -50.674 1.062   -62.960 1.00 91.34  ? 206  GLU A CD    1 
ATOM   1314  O  OE1   . GLU A 1 206  ? -49.958 0.145   -63.425 1.00 90.22  ? 206  GLU A OE1   1 
ATOM   1315  O  OE2   . GLU A 1 206  ? -50.193 2.127   -62.512 1.00 92.64  ? 206  GLU A OE2   1 
ATOM   1316  N  N     . PHE A 1 207  ? -55.127 -2.571  -61.076 1.00 87.77  ? 207  PHE A N     1 
ATOM   1317  C  CA    . PHE A 1 207  ? -55.604 -3.960  -60.980 1.00 86.90  ? 207  PHE A CA    1 
ATOM   1318  C  C     . PHE A 1 207  ? -56.921 -4.103  -61.722 1.00 91.00  ? 207  PHE A C     1 
ATOM   1319  O  O     . PHE A 1 207  ? -57.861 -3.349  -61.474 1.00 90.58  ? 207  PHE A O     1 
ATOM   1320  C  CB    . PHE A 1 207  ? -55.837 -4.410  -59.529 1.00 85.08  ? 207  PHE A CB    1 
ATOM   1321  C  CG    . PHE A 1 207  ? -54.615 -4.381  -58.642 1.00 82.72  ? 207  PHE A CG    1 
ATOM   1322  C  CD1   . PHE A 1 207  ? -53.313 -4.399  -59.154 1.00 82.01  ? 207  PHE A CD1   1 
ATOM   1323  C  CD2   . PHE A 1 207  ? -54.781 -4.375  -57.258 1.00 81.69  ? 207  PHE A CD2   1 
ATOM   1324  C  CE1   . PHE A 1 207  ? -52.217 -4.379  -58.300 1.00 81.93  ? 207  PHE A CE1   1 
ATOM   1325  C  CE2   . PHE A 1 207  ? -53.689 -4.362  -56.404 1.00 81.19  ? 207  PHE A CE2   1 
ATOM   1326  C  CZ    . PHE A 1 207  ? -52.405 -4.365  -56.924 1.00 81.17  ? 207  PHE A CZ    1 
ATOM   1327  N  N     . LEU A 1 208  ? -56.986 -5.090  -62.612 1.00 95.59  ? 208  LEU A N     1 
ATOM   1328  C  CA    . LEU A 1 208  ? -58.180 -5.324  -63.426 1.00 99.45  ? 208  LEU A CA    1 
ATOM   1329  C  C     . LEU A 1 208  ? -59.294 -5.935  -62.571 1.00 98.34  ? 208  LEU A C     1 
ATOM   1330  O  O     . LEU A 1 208  ? -59.016 -6.783  -61.713 1.00 97.04  ? 208  LEU A O     1 
ATOM   1331  C  CB    . LEU A 1 208  ? -57.846 -6.214  -64.633 1.00 102.52 ? 208  LEU A CB    1 
ATOM   1332  C  CG    . LEU A 1 208  ? -57.400 -7.667  -64.383 1.00 102.87 ? 208  LEU A CG    1 
ATOM   1333  C  CD1   . LEU A 1 208  ? -58.533 -8.644  -64.681 1.00 104.49 ? 208  LEU A CD1   1 
ATOM   1334  C  CD2   . LEU A 1 208  ? -56.166 -8.024  -65.209 1.00 102.10 ? 208  LEU A CD2   1 
ATOM   1335  N  N     . PRO A 1 209  ? -60.553 -5.509  -62.803 1.00 99.62  ? 209  PRO A N     1 
ATOM   1336  C  CA    . PRO A 1 209  ? -61.662 -5.831  -61.894 1.00 99.61  ? 209  PRO A CA    1 
ATOM   1337  C  C     . PRO A 1 209  ? -62.124 -7.284  -61.963 1.00 97.56  ? 209  PRO A C     1 
ATOM   1338  O  O     . PRO A 1 209  ? -62.022 -7.916  -63.018 1.00 96.70  ? 209  PRO A O     1 
ATOM   1339  C  CB    . PRO A 1 209  ? -62.782 -4.901  -62.372 1.00 101.07 ? 209  PRO A CB    1 
ATOM   1340  C  CG    . PRO A 1 209  ? -62.521 -4.741  -63.829 1.00 101.82 ? 209  PRO A CG    1 
ATOM   1341  C  CD    . PRO A 1 209  ? -61.025 -4.779  -63.997 1.00 100.64 ? 209  PRO A CD    1 
ATOM   1342  N  N     . LEU A 1 210  ? -62.634 -7.789  -60.839 1.00 96.48  ? 210  LEU A N     1 
ATOM   1343  C  CA    . LEU A 1 210  ? -63.177 -9.144  -60.766 1.00 95.67  ? 210  LEU A CA    1 
ATOM   1344  C  C     . LEU A 1 210  ? -64.481 -9.195  -61.537 1.00 97.91  ? 210  LEU A C     1 
ATOM   1345  O  O     . LEU A 1 210  ? -65.495 -8.668  -61.082 1.00 100.97 ? 210  LEU A O     1 
ATOM   1346  C  CB    . LEU A 1 210  ? -63.429 -9.574  -59.316 1.00 94.60  ? 210  LEU A CB    1 
ATOM   1347  C  CG    . LEU A 1 210  ? -63.882 -11.035 -59.128 1.00 93.82  ? 210  LEU A CG    1 
ATOM   1348  C  CD1   . LEU A 1 210  ? -62.679 -11.969 -59.078 1.00 90.87  ? 210  LEU A CD1   1 
ATOM   1349  C  CD2   . LEU A 1 210  ? -64.743 -11.191 -57.879 1.00 94.42  ? 210  LEU A CD2   1 
ATOM   1350  N  N     . ASP A 1 211  ? -64.442 -9.821  -62.707 1.00 98.48  ? 211  ASP A N     1 
ATOM   1351  C  CA    . ASP A 1 211  ? -65.633 -10.027 -63.509 1.00 100.96 ? 211  ASP A CA    1 
ATOM   1352  C  C     . ASP A 1 211  ? -66.359 -11.289 -63.019 1.00 102.66 ? 211  ASP A C     1 
ATOM   1353  O  O     . ASP A 1 211  ? -65.913 -12.409 -63.315 1.00 101.45 ? 211  ASP A O     1 
ATOM   1354  C  CB    . ASP A 1 211  ? -65.253 -10.155 -64.980 1.00 100.75 ? 211  ASP A CB    1 
ATOM   1355  C  CG    . ASP A 1 211  ? -66.458 -10.201 -65.892 1.00 102.90 ? 211  ASP A CG    1 
ATOM   1356  O  OD1   . ASP A 1 211  ? -67.602 -9.968  -65.435 1.00 100.08 ? 211  ASP A OD1   1 
ATOM   1357  O  OD2   . ASP A 1 211  ? -66.250 -10.473 -67.088 1.00 105.68 ? 211  ASP A OD2   1 
ATOM   1358  N  N     . PRO A 1 212  ? -67.484 -11.123 -62.284 1.00 105.62 ? 212  PRO A N     1 
ATOM   1359  C  CA    . PRO A 1 212  ? -68.124 -12.312 -61.702 1.00 106.18 ? 212  PRO A CA    1 
ATOM   1360  C  C     . PRO A 1 212  ? -68.847 -13.214 -62.721 1.00 106.11 ? 212  PRO A C     1 
ATOM   1361  O  O     . PRO A 1 212  ? -69.114 -14.381 -62.415 1.00 105.54 ? 212  PRO A O     1 
ATOM   1362  C  CB    . PRO A 1 212  ? -69.125 -11.725 -60.683 1.00 107.45 ? 212  PRO A CB    1 
ATOM   1363  C  CG    . PRO A 1 212  ? -69.019 -10.235 -60.785 1.00 108.21 ? 212  PRO A CG    1 
ATOM   1364  C  CD    . PRO A 1 212  ? -68.321 -9.927  -62.074 1.00 107.48 ? 212  PRO A CD    1 
ATOM   1365  N  N     . THR A 1 213  ? -69.149 -12.682 -63.909 1.00 105.10 ? 213  THR A N     1 
ATOM   1366  C  CA    . THR A 1 213  ? -69.824 -13.441 -64.964 1.00 104.41 ? 213  THR A CA    1 
ATOM   1367  C  C     . THR A 1 213  ? -68.884 -14.253 -65.866 1.00 100.06 ? 213  THR A C     1 
ATOM   1368  O  O     . THR A 1 213  ? -69.333 -15.221 -66.474 1.00 101.36 ? 213  THR A O     1 
ATOM   1369  C  CB    . THR A 1 213  ? -70.695 -12.522 -65.850 1.00 107.13 ? 213  THR A CB    1 
ATOM   1370  O  OG1   . THR A 1 213  ? -69.937 -11.369 -66.230 1.00 109.07 ? 213  THR A OG1   1 
ATOM   1371  C  CG2   . THR A 1 213  ? -71.965 -12.088 -65.107 1.00 107.50 ? 213  THR A CG2   1 
ATOM   1372  N  N     . GLN A 1 214  ? -67.604 -13.881 -65.959 1.00 97.15  ? 214  GLN A N     1 
ATOM   1373  C  CA    . GLN A 1 214  ? -66.620 -14.666 -66.755 1.00 95.05  ? 214  GLN A CA    1 
ATOM   1374  C  C     . GLN A 1 214  ? -65.843 -15.706 -65.922 1.00 89.39  ? 214  GLN A C     1 
ATOM   1375  O  O     . GLN A 1 214  ? -64.737 -16.099 -66.287 1.00 86.07  ? 214  GLN A O     1 
ATOM   1376  C  CB    . GLN A 1 214  ? -65.661 -13.735 -67.533 1.00 95.87  ? 214  GLN A CB    1 
ATOM   1377  C  CG    . GLN A 1 214  ? -66.036 -13.499 -68.997 1.00 97.49  ? 214  GLN A CG    1 
ATOM   1378  C  CD    . GLN A 1 214  ? -67.470 -13.023 -69.207 1.00 99.34  ? 214  GLN A CD    1 
ATOM   1379  O  OE1   . GLN A 1 214  ? -68.114 -13.397 -70.183 1.00 102.08 ? 214  GLN A OE1   1 
ATOM   1380  N  NE2   . GLN A 1 214  ? -67.969 -12.193 -68.305 1.00 98.73  ? 214  GLN A NE2   1 
ATOM   1381  N  N     . GLU A 1 215  ? -66.444 -16.174 -64.827 1.00 86.74  ? 215  GLU A N     1 
ATOM   1382  C  CA    . GLU A 1 215  ? -65.841 -17.203 -63.985 1.00 83.83  ? 215  GLU A CA    1 
ATOM   1383  C  C     . GLU A 1 215  ? -65.969 -18.597 -64.631 1.00 80.51  ? 215  GLU A C     1 
ATOM   1384  O  O     . GLU A 1 215  ? -66.581 -18.759 -65.692 1.00 80.67  ? 215  GLU A O     1 
ATOM   1385  C  CB    . GLU A 1 215  ? -66.453 -17.171 -62.565 1.00 84.94  ? 215  GLU A CB    1 
ATOM   1386  C  CG    . GLU A 1 215  ? -66.250 -15.852 -61.791 1.00 86.26  ? 215  GLU A CG    1 
ATOM   1387  C  CD    . GLU A 1 215  ? -64.793 -15.515 -61.422 1.00 85.56  ? 215  GLU A CD    1 
ATOM   1388  O  OE1   . GLU A 1 215  ? -63.897 -16.395 -61.489 1.00 84.74  ? 215  GLU A OE1   1 
ATOM   1389  O  OE2   . GLU A 1 215  ? -64.536 -14.346 -61.051 1.00 84.91  ? 215  GLU A OE2   1 
ATOM   1390  N  N     . LEU A 1 216  ? -65.360 -19.591 -63.990 1.00 75.99  ? 216  LEU A N     1 
ATOM   1391  C  CA    . LEU A 1 216  ? -65.340 -20.963 -64.490 1.00 72.61  ? 216  LEU A CA    1 
ATOM   1392  C  C     . LEU A 1 216  ? -66.723 -21.608 -64.450 1.00 72.72  ? 216  LEU A C     1 
ATOM   1393  O  O     . LEU A 1 216  ? -67.393 -21.580 -63.416 1.00 72.49  ? 216  LEU A O     1 
ATOM   1394  C  CB    . LEU A 1 216  ? -64.409 -21.826 -63.640 1.00 70.28  ? 216  LEU A CB    1 
ATOM   1395  C  CG    . LEU A 1 216  ? -62.936 -21.469 -63.506 1.00 67.08  ? 216  LEU A CG    1 
ATOM   1396  C  CD1   . LEU A 1 216  ? -62.339 -22.369 -62.445 1.00 65.76  ? 216  LEU A CD1   1 
ATOM   1397  C  CD2   . LEU A 1 216  ? -62.218 -21.620 -64.831 1.00 66.23  ? 216  LEU A CD2   1 
ATOM   1398  N  N     . ILE A 1 217  ? -67.112 -22.228 -65.560 1.00 72.39  ? 217  ILE A N     1 
ATOM   1399  C  CA    . ILE A 1 217  ? -68.389 -22.925 -65.664 1.00 72.84  ? 217  ILE A CA    1 
ATOM   1400  C  C     . ILE A 1 217  ? -68.267 -24.271 -64.969 1.00 71.19  ? 217  ILE A C     1 
ATOM   1401  O  O     . ILE A 1 217  ? -67.313 -24.998 -65.206 1.00 71.92  ? 217  ILE A O     1 
ATOM   1402  C  CB    . ILE A 1 217  ? -68.799 -23.192 -67.138 1.00 74.31  ? 217  ILE A CB    1 
ATOM   1403  C  CG1   . ILE A 1 217  ? -68.769 -21.905 -67.985 1.00 75.25  ? 217  ILE A CG1   1 
ATOM   1404  C  CG2   . ILE A 1 217  ? -70.172 -23.863 -67.206 1.00 75.84  ? 217  ILE A CG2   1 
ATOM   1405  C  CD1   . ILE A 1 217  ? -69.506 -20.727 -67.385 1.00 77.03  ? 217  ILE A CD1   1 
ATOM   1406  N  N     . PHE A 1 218  ? -69.229 -24.599 -64.114 1.00 71.09  ? 218  PHE A N     1 
ATOM   1407  C  CA    . PHE A 1 218  ? -69.339 -25.945 -63.565 1.00 70.71  ? 218  PHE A CA    1 
ATOM   1408  C  C     . PHE A 1 218  ? -69.527 -26.931 -64.730 1.00 72.94  ? 218  PHE A C     1 
ATOM   1409  O  O     . PHE A 1 218  ? -70.419 -26.726 -65.559 1.00 74.07  ? 218  PHE A O     1 
ATOM   1410  C  CB    . PHE A 1 218  ? -70.527 -26.030 -62.608 1.00 70.38  ? 218  PHE A CB    1 
ATOM   1411  C  CG    . PHE A 1 218  ? -70.703 -27.380 -61.970 1.00 69.22  ? 218  PHE A CG    1 
ATOM   1412  C  CD1   . PHE A 1 218  ? -69.962 -27.737 -60.851 1.00 67.44  ? 218  PHE A CD1   1 
ATOM   1413  C  CD2   . PHE A 1 218  ? -71.619 -28.291 -62.482 1.00 69.61  ? 218  PHE A CD2   1 
ATOM   1414  C  CE1   . PHE A 1 218  ? -70.131 -28.978 -60.258 1.00 67.03  ? 218  PHE A CE1   1 
ATOM   1415  C  CE2   . PHE A 1 218  ? -71.790 -29.534 -61.896 1.00 69.08  ? 218  PHE A CE2   1 
ATOM   1416  C  CZ    . PHE A 1 218  ? -71.045 -29.879 -60.783 1.00 67.94  ? 218  PHE A CZ    1 
ATOM   1417  N  N     . PRO A 1 219  ? -68.684 -27.984 -64.813 1.00 73.33  ? 219  PRO A N     1 
ATOM   1418  C  CA    . PRO A 1 219  ? -68.781 -28.900 -65.960 1.00 74.66  ? 219  PRO A CA    1 
ATOM   1419  C  C     . PRO A 1 219  ? -70.212 -29.428 -66.191 1.00 77.14  ? 219  PRO A C     1 
ATOM   1420  O  O     . PRO A 1 219  ? -70.805 -29.998 -65.271 1.00 77.33  ? 219  PRO A O     1 
ATOM   1421  C  CB    . PRO A 1 219  ? -67.824 -30.034 -65.587 1.00 73.57  ? 219  PRO A CB    1 
ATOM   1422  C  CG    . PRO A 1 219  ? -66.820 -29.390 -64.699 1.00 72.06  ? 219  PRO A CG    1 
ATOM   1423  C  CD    . PRO A 1 219  ? -67.573 -28.355 -63.916 1.00 72.03  ? 219  PRO A CD    1 
ATOM   1424  N  N     . PRO A 1 220  ? -70.775 -29.202 -67.397 1.00 79.41  ? 220  PRO A N     1 
ATOM   1425  C  CA    . PRO A 1 220  ? -72.137 -29.649 -67.722 1.00 80.68  ? 220  PRO A CA    1 
ATOM   1426  C  C     . PRO A 1 220  ? -72.423 -31.144 -67.563 1.00 80.43  ? 220  PRO A C     1 
ATOM   1427  O  O     . PRO A 1 220  ? -73.539 -31.494 -67.202 1.00 81.34  ? 220  PRO A O     1 
ATOM   1428  C  CB    . PRO A 1 220  ? -72.289 -29.248 -69.190 1.00 82.11  ? 220  PRO A CB    1 
ATOM   1429  C  CG    . PRO A 1 220  ? -71.425 -28.051 -69.331 1.00 81.27  ? 220  PRO A CG    1 
ATOM   1430  C  CD    . PRO A 1 220  ? -70.237 -28.319 -68.453 1.00 79.60  ? 220  PRO A CD    1 
ATOM   1431  N  N     . GLU A 1 221  ? -71.447 -32.008 -67.838 1.00 79.90  ? 221  GLU A N     1 
ATOM   1432  C  CA    . GLU A 1 221  ? -71.649 -33.460 -67.710 1.00 81.73  ? 221  GLU A CA    1 
ATOM   1433  C  C     . GLU A 1 221  ? -72.084 -33.861 -66.302 1.00 80.71  ? 221  GLU A C     1 
ATOM   1434  O  O     . GLU A 1 221  ? -72.958 -34.717 -66.147 1.00 81.86  ? 221  GLU A O     1 
ATOM   1435  C  CB    . GLU A 1 221  ? -70.387 -34.249 -68.101 1.00 83.19  ? 221  GLU A CB    1 
ATOM   1436  C  CG    . GLU A 1 221  ? -70.615 -35.764 -68.204 1.00 86.04  ? 221  GLU A CG    1 
ATOM   1437  C  CD    . GLU A 1 221  ? -69.391 -36.556 -68.666 1.00 87.75  ? 221  GLU A CD    1 
ATOM   1438  O  OE1   . GLU A 1 221  ? -68.244 -36.125 -68.411 1.00 87.04  ? 221  GLU A OE1   1 
ATOM   1439  O  OE2   . GLU A 1 221  ? -69.575 -37.636 -69.276 1.00 90.49  ? 221  GLU A OE2   1 
ATOM   1440  N  N     . LEU A 1 222  ? -71.477 -33.232 -65.297 1.00 78.70  ? 222  LEU A N     1 
ATOM   1441  C  CA    . LEU A 1 222  ? -71.798 -33.478 -63.886 1.00 78.56  ? 222  LEU A CA    1 
ATOM   1442  C  C     . LEU A 1 222  ? -73.220 -33.036 -63.514 1.00 80.51  ? 222  LEU A C     1 
ATOM   1443  O  O     . LEU A 1 222  ? -73.844 -33.644 -62.645 1.00 79.01  ? 222  LEU A O     1 
ATOM   1444  C  CB    . LEU A 1 222  ? -70.797 -32.766 -62.972 1.00 76.85  ? 222  LEU A CB    1 
ATOM   1445  C  CG    . LEU A 1 222  ? -69.308 -33.082 -63.126 1.00 75.55  ? 222  LEU A CG    1 
ATOM   1446  C  CD1   . LEU A 1 222  ? -68.518 -32.274 -62.111 1.00 74.59  ? 222  LEU A CD1   1 
ATOM   1447  C  CD2   . LEU A 1 222  ? -69.023 -34.569 -62.981 1.00 75.47  ? 222  LEU A CD2   1 
ATOM   1448  N  N     . MET A 1 223  ? -73.713 -31.972 -64.152 1.00 82.72  ? 223  MET A N     1 
ATOM   1449  C  CA    . MET A 1 223  ? -75.127 -31.596 -64.051 1.00 86.05  ? 223  MET A CA    1 
ATOM   1450  C  C     . MET A 1 223  ? -76.023 -32.676 -64.632 1.00 87.54  ? 223  MET A C     1 
ATOM   1451  O  O     . MET A 1 223  ? -77.029 -33.039 -64.022 1.00 88.25  ? 223  MET A O     1 
ATOM   1452  C  CB    . MET A 1 223  ? -75.422 -30.269 -64.755 1.00 89.06  ? 223  MET A CB    1 
ATOM   1453  C  CG    . MET A 1 223  ? -75.135 -29.052 -63.896 1.00 91.09  ? 223  MET A CG    1 
ATOM   1454  S  SD    . MET A 1 223  ? -75.851 -27.523 -64.531 1.00 97.37  ? 223  MET A SD    1 
ATOM   1455  C  CE    . MET A 1 223  ? -77.615 -27.833 -64.401 1.00 98.23  ? 223  MET A CE    1 
ATOM   1456  N  N     . ILE A 1 224  ? -75.645 -33.188 -65.803 1.00 87.75  ? 224  ILE A N     1 
ATOM   1457  C  CA    . ILE A 1 224  ? -76.408 -34.240 -66.477 1.00 88.32  ? 224  ILE A CA    1 
ATOM   1458  C  C     . ILE A 1 224  ? -76.380 -35.543 -65.675 1.00 88.85  ? 224  ILE A C     1 
ATOM   1459  O  O     . ILE A 1 224  ? -77.398 -36.216 -65.592 1.00 91.89  ? 224  ILE A O     1 
ATOM   1460  C  CB    . ILE A 1 224  ? -75.930 -34.467 -67.938 1.00 87.82  ? 224  ILE A CB    1 
ATOM   1461  C  CG1   . ILE A 1 224  ? -76.102 -33.187 -68.787 1.00 88.19  ? 224  ILE A CG1   1 
ATOM   1462  C  CG2   . ILE A 1 224  ? -76.666 -35.639 -68.590 1.00 88.69  ? 224  ILE A CG2   1 
ATOM   1463  C  CD1   . ILE A 1 224  ? -77.496 -32.583 -68.803 1.00 89.80  ? 224  ILE A CD1   1 
ATOM   1464  N  N     . MET A 1 225  ? -75.241 -35.893 -65.080 1.00 88.02  ? 225  MET A N     1 
ATOM   1465  C  CA    . MET A 1 225  ? -75.169 -37.076 -64.211 1.00 88.35  ? 225  MET A CA    1 
ATOM   1466  C  C     . MET A 1 225  ? -76.035 -36.923 -62.979 1.00 89.09  ? 225  MET A C     1 
ATOM   1467  O  O     . MET A 1 225  ? -76.755 -37.846 -62.608 1.00 90.30  ? 225  MET A O     1 
ATOM   1468  C  CB    . MET A 1 225  ? -73.747 -37.335 -63.747 1.00 87.87  ? 225  MET A CB    1 
ATOM   1469  C  CG    . MET A 1 225  ? -72.827 -37.851 -64.828 1.00 88.16  ? 225  MET A CG    1 
ATOM   1470  S  SD    . MET A 1 225  ? -71.137 -37.859 -64.221 1.00 88.43  ? 225  MET A SD    1 
ATOM   1471  C  CE    . MET A 1 225  ? -71.276 -39.020 -62.860 1.00 88.12  ? 225  MET A CE    1 
ATOM   1472  N  N     . ALA A 1 226  ? -75.938 -35.759 -62.343 1.00 89.86  ? 226  ALA A N     1 
ATOM   1473  C  CA    . ALA A 1 226  ? -76.750 -35.434 -61.168 1.00 91.93  ? 226  ALA A CA    1 
ATOM   1474  C  C     . ALA A 1 226  ? -78.252 -35.453 -61.476 1.00 95.72  ? 226  ALA A C     1 
ATOM   1475  O  O     . ALA A 1 226  ? -79.038 -35.970 -60.677 1.00 95.18  ? 226  ALA A O     1 
ATOM   1476  C  CB    . ALA A 1 226  ? -76.341 -34.079 -60.608 1.00 91.11  ? 226  ALA A CB    1 
ATOM   1477  N  N     . GLU A 1 227  ? -78.635 -34.907 -62.636 1.00 99.87  ? 227  GLU A N     1 
ATOM   1478  C  CA    . GLU A 1 227  ? -80.033 -34.915 -63.118 1.00 103.49 ? 227  GLU A CA    1 
ATOM   1479  C  C     . GLU A 1 227  ? -80.442 -36.310 -63.607 1.00 105.79 ? 227  GLU A C     1 
ATOM   1480  O  O     . GLU A 1 227  ? -80.701 -36.507 -64.790 1.00 108.72 ? 227  GLU A O     1 
ATOM   1481  C  CB    . GLU A 1 227  ? -80.231 -33.895 -64.257 1.00 104.07 ? 227  GLU A CB    1 
ATOM   1482  C  CG    . GLU A 1 227  ? -80.128 -32.426 -63.859 1.00 104.24 ? 227  GLU A CG    1 
ATOM   1483  C  CD    . GLU A 1 227  ? -79.804 -31.488 -65.029 1.00 105.04 ? 227  GLU A CD    1 
ATOM   1484  O  OE1   . GLU A 1 227  ? -79.541 -31.958 -66.165 1.00 105.19 ? 227  GLU A OE1   1 
ATOM   1485  O  OE2   . GLU A 1 227  ? -79.802 -30.257 -64.810 1.00 105.45 ? 227  GLU A OE2   1 
ATOM   1486  N  N     . LYS A 1 228  ? -80.501 -37.254 -62.671 1.00 106.85 ? 228  LYS A N     1 
ATOM   1487  C  CA    . LYS A 1 228  ? -80.808 -38.685 -62.885 1.00 108.75 ? 228  LYS A CA    1 
ATOM   1488  C  C     . LYS A 1 228  ? -80.179 -39.423 -61.714 1.00 107.81 ? 228  LYS A C     1 
ATOM   1489  O  O     . LYS A 1 228  ? -79.062 -39.938 -61.802 1.00 108.16 ? 228  LYS A O     1 
ATOM   1490  C  CB    . LYS A 1 228  ? -80.348 -39.283 -64.238 1.00 110.02 ? 228  LYS A CB    1 
ATOM   1491  C  CG    . LYS A 1 228  ? -78.893 -39.061 -64.659 1.00 109.32 ? 228  LYS A CG    1 
ATOM   1492  C  CD    . LYS A 1 228  ? -78.651 -39.366 -66.137 1.00 111.38 ? 228  LYS A CD    1 
ATOM   1493  C  CE    . LYS A 1 228  ? -79.402 -38.422 -67.075 1.00 113.63 ? 228  LYS A CE    1 
ATOM   1494  N  NZ    . LYS A 1 228  ? -78.904 -38.484 -68.476 1.00 114.57 ? 228  LYS A NZ    1 
ATOM   1495  N  N     . GLN A 1 229  ? -80.905 -39.434 -60.601 1.00 108.43 ? 229  GLN A N     1 
ATOM   1496  C  CA    . GLN A 1 229  ? -80.383 -39.960 -59.345 1.00 107.07 ? 229  GLN A CA    1 
ATOM   1497  C  C     . GLN A 1 229  ? -80.222 -41.477 -59.443 1.00 104.72 ? 229  GLN A C     1 
ATOM   1498  O  O     . GLN A 1 229  ? -81.182 -42.232 -59.288 1.00 104.82 ? 229  GLN A O     1 
ATOM   1499  C  CB    . GLN A 1 229  ? -81.277 -39.574 -58.149 1.00 108.77 ? 229  GLN A CB    1 
ATOM   1500  C  CG    . GLN A 1 229  ? -81.207 -38.105 -57.732 1.00 108.75 ? 229  GLN A CG    1 
ATOM   1501  C  CD    . GLN A 1 229  ? -82.175 -37.210 -58.496 1.00 110.41 ? 229  GLN A CD    1 
ATOM   1502  O  OE1   . GLN A 1 229  ? -82.237 -37.250 -59.725 1.00 111.60 ? 229  GLN A OE1   1 
ATOM   1503  N  NE2   . GLN A 1 229  ? -82.928 -36.392 -57.768 1.00 111.02 ? 229  GLN A NE2   1 
ATOM   1504  N  N     . SER A 1 230  ? -78.997 -41.899 -59.749 1.00 101.78 ? 230  SER A N     1 
ATOM   1505  C  CA    . SER A 1 230  ? -78.621 -43.302 -59.688 1.00 99.71  ? 230  SER A CA    1 
ATOM   1506  C  C     . SER A 1 230  ? -78.757 -43.782 -58.248 1.00 98.81  ? 230  SER A C     1 
ATOM   1507  O  O     . SER A 1 230  ? -78.335 -43.093 -57.324 1.00 97.89  ? 230  SER A O     1 
ATOM   1508  C  CB    . SER A 1 230  ? -77.180 -43.492 -60.164 1.00 96.97  ? 230  SER A CB    1 
ATOM   1509  O  OG    . SER A 1 230  ? -76.772 -44.840 -60.013 1.00 96.90  ? 230  SER A OG    1 
ATOM   1510  N  N     . GLN A 1 231  ? -79.380 -44.942 -58.070 1.00 99.88  ? 231  GLN A N     1 
ATOM   1511  C  CA    . GLN A 1 231  ? -79.460 -45.611 -56.770 1.00 99.44  ? 231  GLN A CA    1 
ATOM   1512  C  C     . GLN A 1 231  ? -78.322 -46.620 -56.591 1.00 96.24  ? 231  GLN A C     1 
ATOM   1513  O  O     . GLN A 1 231  ? -78.066 -47.058 -55.466 1.00 95.41  ? 231  GLN A O     1 
ATOM   1514  C  CB    . GLN A 1 231  ? -80.808 -46.337 -56.618 1.00 103.57 ? 231  GLN A CB    1 
ATOM   1515  C  CG    . GLN A 1 231  ? -82.052 -45.512 -56.941 1.00 104.73 ? 231  GLN A CG    1 
ATOM   1516  C  CD    . GLN A 1 231  ? -82.206 -44.304 -56.043 1.00 104.18 ? 231  GLN A CD    1 
ATOM   1517  O  OE1   . GLN A 1 231  ? -83.022 -44.313 -55.121 1.00 106.80 ? 231  GLN A OE1   1 
ATOM   1518  N  NE2   . GLN A 1 231  ? -81.421 -43.258 -56.301 1.00 100.98 ? 231  GLN A NE2   1 
ATOM   1519  N  N     . ARG A 1 232  ? -77.655 -46.986 -57.695 1.00 93.89  ? 232  ARG A N     1 
ATOM   1520  C  CA    . ARG A 1 232  ? -76.580 -47.979 -57.689 1.00 90.89  ? 232  ARG A CA    1 
ATOM   1521  C  C     . ARG A 1 232  ? -75.443 -47.514 -56.791 1.00 85.13  ? 232  ARG A C     1 
ATOM   1522  O  O     . ARG A 1 232  ? -74.910 -46.422 -56.982 1.00 82.85  ? 232  ARG A O     1 
ATOM   1523  C  CB    . ARG A 1 232  ? -76.059 -48.212 -59.112 1.00 93.28  ? 232  ARG A CB    1 
ATOM   1524  C  CG    . ARG A 1 232  ? -74.990 -49.297 -59.229 1.00 95.55  ? 232  ARG A CG    1 
ATOM   1525  C  CD    . ARG A 1 232  ? -74.809 -49.780 -60.663 1.00 98.26  ? 232  ARG A CD    1 
ATOM   1526  N  NE    . ARG A 1 232  ? -76.058 -50.302 -61.234 1.00 103.42 ? 232  ARG A NE    1 
ATOM   1527  C  CZ    . ARG A 1 232  ? -76.599 -51.502 -60.979 1.00 107.63 ? 232  ARG A CZ    1 
ATOM   1528  N  NH1   . ARG A 1 232  ? -76.012 -52.369 -60.150 1.00 109.02 ? 232  ARG A NH1   1 
ATOM   1529  N  NH2   . ARG A 1 232  ? -77.750 -51.845 -61.562 1.00 109.27 ? 232  ARG A NH2   1 
ATOM   1530  N  N     . THR A 1 233  ? -75.092 -48.342 -55.810 1.00 81.23  ? 233  THR A N     1 
ATOM   1531  C  CA    . THR A 1 233  ? -74.039 -48.015 -54.857 1.00 77.29  ? 233  THR A CA    1 
ATOM   1532  C  C     . THR A 1 233  ? -72.695 -48.447 -55.420 1.00 73.57  ? 233  THR A C     1 
ATOM   1533  O  O     . THR A 1 233  ? -72.562 -49.539 -55.953 1.00 73.04  ? 233  THR A O     1 
ATOM   1534  C  CB    . THR A 1 233  ? -74.292 -48.637 -53.470 1.00 77.96  ? 233  THR A CB    1 
ATOM   1535  O  OG1   . THR A 1 233  ? -74.108 -50.051 -53.508 1.00 78.06  ? 233  THR A OG1   1 
ATOM   1536  C  CG2   . THR A 1 233  ? -75.705 -48.325 -53.015 1.00 79.54  ? 233  THR A CG2   1 
ATOM   1537  N  N     . ARG A 1 234  ? -71.710 -47.568 -55.286 1.00 70.48  ? 234  ARG A N     1 
ATOM   1538  C  CA    . ARG A 1 234  ? -70.435 -47.705 -55.959 1.00 68.61  ? 234  ARG A CA    1 
ATOM   1539  C  C     . ARG A 1 234  ? -69.467 -48.487 -55.108 1.00 66.87  ? 234  ARG A C     1 
ATOM   1540  O  O     . ARG A 1 234  ? -69.500 -48.413 -53.885 1.00 65.39  ? 234  ARG A O     1 
ATOM   1541  C  CB    . ARG A 1 234  ? -69.863 -46.331 -56.284 1.00 67.82  ? 234  ARG A CB    1 
ATOM   1542  C  CG    . ARG A 1 234  ? -70.809 -45.473 -57.109 1.00 68.88  ? 234  ARG A CG    1 
ATOM   1543  C  CD    . ARG A 1 234  ? -70.152 -44.174 -57.533 1.00 68.65  ? 234  ARG A CD    1 
ATOM   1544  N  NE    . ARG A 1 234  ? -69.998 -43.237 -56.413 1.00 68.65  ? 234  ARG A NE    1 
ATOM   1545  C  CZ    . ARG A 1 234  ? -70.899 -42.335 -56.022 1.00 68.14  ? 234  ARG A CZ    1 
ATOM   1546  N  NH1   . ARG A 1 234  ? -72.074 -42.199 -56.641 1.00 68.52  ? 234  ARG A NH1   1 
ATOM   1547  N  NH2   . ARG A 1 234  ? -70.613 -41.558 -54.989 1.00 68.01  ? 234  ARG A NH2   1 
ATOM   1548  N  N     . VAL A 1 235  ? -68.608 -49.240 -55.781 1.00 66.35  ? 235  VAL A N     1 
ATOM   1549  C  CA    . VAL A 1 235  ? -67.687 -50.156 -55.133 1.00 66.25  ? 235  VAL A CA    1 
ATOM   1550  C  C     . VAL A 1 235  ? -66.314 -49.943 -55.747 1.00 65.28  ? 235  VAL A C     1 
ATOM   1551  O  O     . VAL A 1 235  ? -66.179 -49.896 -56.965 1.00 65.62  ? 235  VAL A O     1 
ATOM   1552  C  CB    . VAL A 1 235  ? -68.140 -51.628 -55.300 1.00 67.17  ? 235  VAL A CB    1 
ATOM   1553  C  CG1   . VAL A 1 235  ? -67.218 -52.574 -54.534 1.00 66.94  ? 235  VAL A CG1   1 
ATOM   1554  C  CG2   . VAL A 1 235  ? -69.582 -51.794 -54.832 1.00 67.87  ? 235  VAL A CG2   1 
ATOM   1555  N  N     . PHE A 1 236  ? -65.318 -49.777 -54.887 1.00 65.21  ? 236  PHE A N     1 
ATOM   1556  C  CA    . PHE A 1 236  ? -63.930 -49.627 -55.282 1.00 65.20  ? 236  PHE A CA    1 
ATOM   1557  C  C     . PHE A 1 236  ? -63.123 -50.531 -54.376 1.00 66.84  ? 236  PHE A C     1 
ATOM   1558  O  O     . PHE A 1 236  ? -63.316 -50.530 -53.162 1.00 67.57  ? 236  PHE A O     1 
ATOM   1559  C  CB    . PHE A 1 236  ? -63.458 -48.181 -55.121 1.00 63.72  ? 236  PHE A CB    1 
ATOM   1560  C  CG    . PHE A 1 236  ? -64.336 -47.180 -55.809 1.00 64.38  ? 236  PHE A CG    1 
ATOM   1561  C  CD1   . PHE A 1 236  ? -64.331 -47.067 -57.191 1.00 64.67  ? 236  PHE A CD1   1 
ATOM   1562  C  CD2   . PHE A 1 236  ? -65.174 -46.344 -55.075 1.00 64.71  ? 236  PHE A CD2   1 
ATOM   1563  C  CE1   . PHE A 1 236  ? -65.154 -46.144 -57.830 1.00 65.50  ? 236  PHE A CE1   1 
ATOM   1564  C  CE2   . PHE A 1 236  ? -65.992 -45.418 -55.706 1.00 64.67  ? 236  PHE A CE2   1 
ATOM   1565  C  CZ    . PHE A 1 236  ? -65.989 -45.320 -57.085 1.00 65.06  ? 236  PHE A CZ    1 
ATOM   1566  N  N     . GLY A 1 237  ? -62.214 -51.292 -54.970 1.00 68.83  ? 237  GLY A N     1 
ATOM   1567  C  CA    . GLY A 1 237  ? -61.458 -52.302 -54.248 1.00 70.43  ? 237  GLY A CA    1 
ATOM   1568  C  C     . GLY A 1 237  ? -59.980 -52.217 -54.545 1.00 70.57  ? 237  GLY A C     1 
ATOM   1569  O  O     . GLY A 1 237  ? -59.561 -51.607 -55.528 1.00 70.95  ? 237  GLY A O     1 
ATOM   1570  N  N     . SER A 1 238  ? -59.194 -52.802 -53.652 1.00 71.43  ? 238  SER A N     1 
ATOM   1571  C  CA    . SER A 1 238  ? -57.795 -53.100 -53.902 1.00 70.65  ? 238  SER A CA    1 
ATOM   1572  C  C     . SER A 1 238  ? -57.513 -54.373 -53.121 1.00 74.04  ? 238  SER A C     1 
ATOM   1573  O  O     . SER A 1 238  ? -58.448 -55.006 -52.620 1.00 75.86  ? 238  SER A O     1 
ATOM   1574  C  CB    . SER A 1 238  ? -56.912 -51.950 -53.443 1.00 68.19  ? 238  SER A CB    1 
ATOM   1575  O  OG    . SER A 1 238  ? -56.756 -51.959 -52.044 1.00 67.30  ? 238  SER A OG    1 
ATOM   1576  N  N     . GLU A 1 239  ? -56.246 -54.753 -53.006 1.00 76.23  ? 239  GLU A N     1 
ATOM   1577  C  CA    . GLU A 1 239  ? -55.893 -55.932 -52.219 1.00 79.62  ? 239  GLU A CA    1 
ATOM   1578  C  C     . GLU A 1 239  ? -56.036 -55.697 -50.711 1.00 78.26  ? 239  GLU A C     1 
ATOM   1579  O  O     . GLU A 1 239  ? -56.277 -56.644 -49.968 1.00 80.01  ? 239  GLU A O     1 
ATOM   1580  C  CB    . GLU A 1 239  ? -54.473 -56.405 -52.551 1.00 83.23  ? 239  GLU A CB    1 
ATOM   1581  C  CG    . GLU A 1 239  ? -54.282 -57.899 -52.367 1.00 88.15  ? 239  GLU A CG    1 
ATOM   1582  C  CD    . GLU A 1 239  ? -55.078 -58.711 -53.378 1.00 92.40  ? 239  GLU A CD    1 
ATOM   1583  O  OE1   . GLU A 1 239  ? -54.727 -58.664 -54.582 1.00 95.74  ? 239  GLU A OE1   1 
ATOM   1584  O  OE2   . GLU A 1 239  ? -56.057 -59.385 -52.967 1.00 93.86  ? 239  GLU A OE2   1 
ATOM   1585  N  N     . ARG A 1 240  ? -55.899 -54.443 -50.272 1.00 76.03  ? 240  ARG A N     1 
ATOM   1586  C  CA    . ARG A 1 240  ? -55.897 -54.087 -48.847 1.00 75.14  ? 240  ARG A CA    1 
ATOM   1587  C  C     . ARG A 1 240  ? -57.242 -53.582 -48.318 1.00 74.59  ? 240  ARG A C     1 
ATOM   1588  O  O     . ARG A 1 240  ? -57.530 -53.760 -47.131 1.00 72.81  ? 240  ARG A O     1 
ATOM   1589  C  CB    . ARG A 1 240  ? -54.836 -53.013 -48.584 1.00 74.52  ? 240  ARG A CB    1 
ATOM   1590  C  CG    . ARG A 1 240  ? -53.412 -53.434 -48.909 1.00 74.68  ? 240  ARG A CG    1 
ATOM   1591  C  CD    . ARG A 1 240  ? -52.505 -52.234 -49.116 1.00 74.15  ? 240  ARG A CD    1 
ATOM   1592  N  NE    . ARG A 1 240  ? -52.618 -51.264 -48.025 1.00 75.08  ? 240  ARG A NE    1 
ATOM   1593  C  CZ    . ARG A 1 240  ? -51.984 -51.325 -46.850 1.00 76.02  ? 240  ARG A CZ    1 
ATOM   1594  N  NH1   . ARG A 1 240  ? -51.157 -52.329 -46.554 1.00 77.34  ? 240  ARG A NH1   1 
ATOM   1595  N  NH2   . ARG A 1 240  ? -52.186 -50.365 -45.948 1.00 74.98  ? 240  ARG A NH2   1 
ATOM   1596  N  N     . MET A 1 241  ? -58.048 -52.963 -49.189 1.00 74.62  ? 241  MET A N     1 
ATOM   1597  C  CA    . MET A 1 241  ? -59.228 -52.198 -48.773 1.00 75.50  ? 241  MET A CA    1 
ATOM   1598  C  C     . MET A 1 241  ? -60.437 -52.335 -49.716 1.00 75.45  ? 241  MET A C     1 
ATOM   1599  O  O     . MET A 1 241  ? -60.280 -52.391 -50.938 1.00 75.17  ? 241  MET A O     1 
ATOM   1600  C  CB    . MET A 1 241  ? -58.850 -50.718 -48.651 1.00 76.73  ? 241  MET A CB    1 
ATOM   1601  C  CG    . MET A 1 241  ? -59.956 -49.817 -48.115 1.00 79.19  ? 241  MET A CG    1 
ATOM   1602  S  SD    . MET A 1 241  ? -59.463 -48.091 -47.994 1.00 81.77  ? 241  MET A SD    1 
ATOM   1603  C  CE    . MET A 1 241  ? -58.545 -48.102 -46.455 1.00 81.37  ? 241  MET A CE    1 
ATOM   1604  N  N     . MET A 1 242  ? -61.633 -52.378 -49.117 1.00 75.55  ? 242  MET A N     1 
ATOM   1605  C  CA    . MET A 1 242  ? -62.923 -52.274 -49.812 1.00 75.50  ? 242  MET A CA    1 
ATOM   1606  C  C     . MET A 1 242  ? -63.602 -50.953 -49.441 1.00 71.38  ? 242  MET A C     1 
ATOM   1607  O  O     . MET A 1 242  ? -63.667 -50.592 -48.271 1.00 70.57  ? 242  MET A O     1 
ATOM   1608  C  CB    . MET A 1 242  ? -63.847 -53.425 -49.402 1.00 80.61  ? 242  MET A CB    1 
ATOM   1609  C  CG    . MET A 1 242  ? -63.409 -54.793 -49.890 1.00 84.74  ? 242  MET A CG    1 
ATOM   1610  S  SD    . MET A 1 242  ? -63.688 -55.027 -51.664 1.00 91.10  ? 242  MET A SD    1 
ATOM   1611  C  CE    . MET A 1 242  ? -65.416 -55.523 -51.682 1.00 91.39  ? 242  MET A CE    1 
ATOM   1612  N  N     . TRP A 1 243  ? -64.124 -50.249 -50.437 1.00 67.82  ? 243  TRP A N     1 
ATOM   1613  C  CA    . TRP A 1 243  ? -64.766 -48.953 -50.242 1.00 65.71  ? 243  TRP A CA    1 
ATOM   1614  C  C     . TRP A 1 243  ? -66.146 -48.980 -50.885 1.00 65.99  ? 243  TRP A C     1 
ATOM   1615  O  O     . TRP A 1 243  ? -66.250 -49.111 -52.103 1.00 66.37  ? 243  TRP A O     1 
ATOM   1616  C  CB    . TRP A 1 243  ? -63.903 -47.879 -50.897 1.00 63.99  ? 243  TRP A CB    1 
ATOM   1617  C  CG    . TRP A 1 243  ? -64.430 -46.477 -50.830 1.00 63.33  ? 243  TRP A CG    1 
ATOM   1618  C  CD1   . TRP A 1 243  ? -65.541 -45.974 -51.452 1.00 63.75  ? 243  TRP A CD1   1 
ATOM   1619  C  CD2   . TRP A 1 243  ? -63.828 -45.380 -50.142 1.00 62.78  ? 243  TRP A CD2   1 
ATOM   1620  N  NE1   . TRP A 1 243  ? -65.678 -44.639 -51.173 1.00 63.90  ? 243  TRP A NE1   1 
ATOM   1621  C  CE2   . TRP A 1 243  ? -64.642 -44.245 -50.370 1.00 63.13  ? 243  TRP A CE2   1 
ATOM   1622  C  CE3   . TRP A 1 243  ? -62.690 -45.248 -49.333 1.00 61.59  ? 243  TRP A CE3   1 
ATOM   1623  C  CZ2   . TRP A 1 243  ? -64.351 -42.993 -49.824 1.00 62.44  ? 243  TRP A CZ2   1 
ATOM   1624  C  CZ3   . TRP A 1 243  ? -62.401 -44.009 -48.791 1.00 61.19  ? 243  TRP A CZ3   1 
ATOM   1625  C  CH2   . TRP A 1 243  ? -63.228 -42.896 -49.040 1.00 61.63  ? 243  TRP A CH2   1 
ATOM   1626  N  N     . PHE A 1 244  ? -67.194 -48.839 -50.071 1.00 66.20  ? 244  PHE A N     1 
ATOM   1627  C  CA    . PHE A 1 244  ? -68.584 -48.797 -50.548 1.00 65.82  ? 244  PHE A CA    1 
ATOM   1628  C  C     . PHE A 1 244  ? -69.138 -47.398 -50.390 1.00 64.85  ? 244  PHE A C     1 
ATOM   1629  O  O     . PHE A 1 244  ? -69.098 -46.849 -49.304 1.00 64.27  ? 244  PHE A O     1 
ATOM   1630  C  CB    . PHE A 1 244  ? -69.443 -49.756 -49.741 1.00 66.98  ? 244  PHE A CB    1 
ATOM   1631  C  CG    . PHE A 1 244  ? -68.941 -51.156 -49.760 1.00 67.96  ? 244  PHE A CG    1 
ATOM   1632  C  CD1   . PHE A 1 244  ? -69.200 -51.980 -50.848 1.00 69.31  ? 244  PHE A CD1   1 
ATOM   1633  C  CD2   . PHE A 1 244  ? -68.182 -51.646 -48.712 1.00 68.08  ? 244  PHE A CD2   1 
ATOM   1634  C  CE1   . PHE A 1 244  ? -68.727 -53.281 -50.884 1.00 69.88  ? 244  PHE A CE1   1 
ATOM   1635  C  CE2   . PHE A 1 244  ? -67.705 -52.943 -48.736 1.00 69.28  ? 244  PHE A CE2   1 
ATOM   1636  C  CZ    . PHE A 1 244  ? -67.980 -53.765 -49.822 1.00 70.07  ? 244  PHE A CZ    1 
ATOM   1637  N  N     . SER A 1 245  ? -69.640 -46.820 -51.473 1.00 65.52  ? 245  SER A N     1 
ATOM   1638  C  CA    . SER A 1 245  ? -70.345 -45.550 -51.408 1.00 66.84  ? 245  SER A CA    1 
ATOM   1639  C  C     . SER A 1 245  ? -71.828 -45.787 -51.633 1.00 69.29  ? 245  SER A C     1 
ATOM   1640  O  O     . SER A 1 245  ? -72.276 -45.811 -52.775 1.00 69.16  ? 245  SER A O     1 
ATOM   1641  C  CB    . SER A 1 245  ? -69.802 -44.578 -52.438 1.00 66.23  ? 245  SER A CB    1 
ATOM   1642  O  OG    . SER A 1 245  ? -68.507 -44.169 -52.063 1.00 66.37  ? 245  SER A OG    1 
ATOM   1643  N  N     . PRO A 1 246  ? -72.597 -45.986 -50.544 1.00 71.63  ? 246  PRO A N     1 
ATOM   1644  C  CA    . PRO A 1 246  ? -74.035 -46.099 -50.726 1.00 74.07  ? 246  PRO A CA    1 
ATOM   1645  C  C     . PRO A 1 246  ? -74.632 -44.736 -51.038 1.00 75.01  ? 246  PRO A C     1 
ATOM   1646  O  O     . PRO A 1 246  ? -74.197 -43.729 -50.488 1.00 74.05  ? 246  PRO A O     1 
ATOM   1647  C  CB    . PRO A 1 246  ? -74.524 -46.646 -49.389 1.00 75.04  ? 246  PRO A CB    1 
ATOM   1648  C  CG    . PRO A 1 246  ? -73.516 -46.183 -48.404 1.00 73.63  ? 246  PRO A CG    1 
ATOM   1649  C  CD    . PRO A 1 246  ? -72.207 -46.145 -49.130 1.00 71.60  ? 246  PRO A CD    1 
ATOM   1650  N  N     . VAL A 1 247  ? -75.596 -44.718 -51.947 1.00 77.38  ? 247  VAL A N     1 
ATOM   1651  C  CA    . VAL A 1 247  ? -76.206 -43.484 -52.430 1.00 78.39  ? 247  VAL A CA    1 
ATOM   1652  C  C     . VAL A 1 247  ? -77.699 -43.372 -52.042 1.00 79.85  ? 247  VAL A C     1 
ATOM   1653  O  O     . VAL A 1 247  ? -78.349 -42.380 -52.381 1.00 80.46  ? 247  VAL A O     1 
ATOM   1654  C  CB    . VAL A 1 247  ? -75.969 -43.354 -53.956 1.00 78.89  ? 247  VAL A CB    1 
ATOM   1655  C  CG1   . VAL A 1 247  ? -76.913 -44.249 -54.736 1.00 80.82  ? 247  VAL A CG1   1 
ATOM   1656  C  CG2   . VAL A 1 247  ? -76.073 -41.907 -54.425 1.00 79.66  ? 247  VAL A CG2   1 
ATOM   1657  N  N     . THR A 1 248  ? -78.230 -44.380 -51.335 1.00 80.17  ? 248  THR A N     1 
ATOM   1658  C  CA    . THR A 1 248  ? -79.541 -44.300 -50.679 1.00 80.55  ? 248  THR A CA    1 
ATOM   1659  C  C     . THR A 1 248  ? -79.379 -44.609 -49.186 1.00 80.88  ? 248  THR A C     1 
ATOM   1660  O  O     . THR A 1 248  ? -78.371 -45.188 -48.753 1.00 78.26  ? 248  THR A O     1 
ATOM   1661  C  CB    . THR A 1 248  ? -80.590 -45.268 -51.294 1.00 81.16  ? 248  THR A CB    1 
ATOM   1662  O  OG1   . THR A 1 248  ? -80.325 -46.613 -50.886 1.00 80.87  ? 248  THR A OG1   1 
ATOM   1663  C  CG2   . THR A 1 248  ? -80.596 -45.205 -52.813 1.00 80.87  ? 248  THR A CG2   1 
ATOM   1664  N  N     . LEU A 1 249  ? -80.382 -44.205 -48.411 1.00 82.27  ? 249  LEU A N     1 
ATOM   1665  C  CA    . LEU A 1 249  ? -80.434 -44.507 -46.985 1.00 83.38  ? 249  LEU A CA    1 
ATOM   1666  C  C     . LEU A 1 249  ? -80.595 -46.009 -46.749 1.00 85.38  ? 249  LEU A C     1 
ATOM   1667  O  O     . LEU A 1 249  ? -79.934 -46.569 -45.879 1.00 84.23  ? 249  LEU A O     1 
ATOM   1668  C  CB    . LEU A 1 249  ? -81.581 -43.741 -46.321 1.00 84.73  ? 249  LEU A CB    1 
ATOM   1669  C  CG    . LEU A 1 249  ? -81.833 -43.980 -44.828 1.00 85.84  ? 249  LEU A CG    1 
ATOM   1670  C  CD1   . LEU A 1 249  ? -80.565 -43.746 -44.017 1.00 84.76  ? 249  LEU A CD1   1 
ATOM   1671  C  CD2   . LEU A 1 249  ? -82.965 -43.094 -44.334 1.00 86.80  ? 249  LEU A CD2   1 
ATOM   1672  N  N     . LYS A 1 250  ? -81.475 -46.647 -47.524 1.00 88.76  ? 250  LYS A N     1 
ATOM   1673  C  CA    . LYS A 1 250  ? -81.670 -48.105 -47.468 1.00 91.86  ? 250  LYS A CA    1 
ATOM   1674  C  C     . LYS A 1 250  ? -80.328 -48.824 -47.513 1.00 89.35  ? 250  LYS A C     1 
ATOM   1675  O  O     . LYS A 1 250  ? -80.021 -49.647 -46.659 1.00 89.40  ? 250  LYS A O     1 
ATOM   1676  C  CB    . LYS A 1 250  ? -82.519 -48.601 -48.649 1.00 96.03  ? 250  LYS A CB    1 
ATOM   1677  C  CG    . LYS A 1 250  ? -83.966 -48.105 -48.681 1.00 100.46 ? 250  LYS A CG    1 
ATOM   1678  C  CD    . LYS A 1 250  ? -84.483 -47.868 -50.106 1.00 102.76 ? 250  LYS A CD    1 
ATOM   1679  C  CE    . LYS A 1 250  ? -83.824 -46.654 -50.768 1.00 101.19 ? 250  LYS A CE    1 
ATOM   1680  N  NZ    . LYS A 1 250  ? -84.599 -46.107 -51.916 1.00 101.68 ? 250  LYS A NZ    1 
ATOM   1681  N  N     . GLU A 1 251  ? -79.529 -48.470 -48.510 1.00 87.41  ? 251  GLU A N     1 
ATOM   1682  C  CA    . GLU A 1 251  ? -78.236 -49.098 -48.750 1.00 86.44  ? 251  GLU A CA    1 
ATOM   1683  C  C     . GLU A 1 251  ? -77.229 -48.849 -47.629 1.00 83.37  ? 251  GLU A C     1 
ATOM   1684  O  O     . GLU A 1 251  ? -76.541 -49.771 -47.201 1.00 81.60  ? 251  GLU A O     1 
ATOM   1685  C  CB    . GLU A 1 251  ? -77.663 -48.592 -50.067 1.00 87.67  ? 251  GLU A CB    1 
ATOM   1686  C  CG    . GLU A 1 251  ? -78.468 -49.027 -51.283 1.00 89.95  ? 251  GLU A CG    1 
ATOM   1687  C  CD    . GLU A 1 251  ? -78.179 -50.452 -51.690 1.00 92.52  ? 251  GLU A CD    1 
ATOM   1688  O  OE1   . GLU A 1 251  ? -76.986 -50.818 -51.816 1.00 94.86  ? 251  GLU A OE1   1 
ATOM   1689  O  OE2   . GLU A 1 251  ? -79.152 -51.209 -51.891 1.00 95.89  ? 251  GLU A OE2   1 
ATOM   1690  N  N     . LEU A 1 252  ? -77.155 -47.608 -47.156 1.00 81.60  ? 252  LEU A N     1 
ATOM   1691  C  CA    . LEU A 1 252  ? -76.269 -47.245 -46.046 1.00 80.43  ? 252  LEU A CA    1 
ATOM   1692  C  C     . LEU A 1 252  ? -76.452 -48.154 -44.821 1.00 81.91  ? 252  LEU A C     1 
ATOM   1693  O  O     . LEU A 1 252  ? -75.466 -48.631 -44.246 1.00 81.14  ? 252  LEU A O     1 
ATOM   1694  C  CB    . LEU A 1 252  ? -76.481 -45.775 -45.663 1.00 79.79  ? 252  LEU A CB    1 
ATOM   1695  C  CG    . LEU A 1 252  ? -75.727 -45.232 -44.445 1.00 78.93  ? 252  LEU A CG    1 
ATOM   1696  C  CD1   . LEU A 1 252  ? -74.231 -45.476 -44.542 1.00 77.70  ? 252  LEU A CD1   1 
ATOM   1697  C  CD2   . LEU A 1 252  ? -76.012 -43.750 -44.292 1.00 79.04  ? 252  LEU A CD2   1 
ATOM   1698  N  N     . LEU A 1 253  ? -77.712 -48.395 -44.447 1.00 84.20  ? 253  LEU A N     1 
ATOM   1699  C  CA    . LEU A 1 253  ? -78.059 -49.278 -43.318 1.00 85.28  ? 253  LEU A CA    1 
ATOM   1700  C  C     . LEU A 1 253  ? -77.755 -50.736 -43.630 1.00 86.39  ? 253  LEU A C     1 
ATOM   1701  O  O     . LEU A 1 253  ? -77.402 -51.505 -42.735 1.00 87.15  ? 253  LEU A O     1 
ATOM   1702  C  CB    . LEU A 1 253  ? -79.541 -49.157 -42.951 1.00 86.55  ? 253  LEU A CB    1 
ATOM   1703  C  CG    . LEU A 1 253  ? -80.086 -47.788 -42.534 1.00 86.27  ? 253  LEU A CG    1 
ATOM   1704  C  CD1   . LEU A 1 253  ? -81.597 -47.880 -42.377 1.00 88.11  ? 253  LEU A CD1   1 
ATOM   1705  C  CD2   . LEU A 1 253  ? -79.428 -47.284 -41.258 1.00 85.07  ? 253  LEU A CD2   1 
ATOM   1706  N  N     . GLU A 1 254  ? -77.920 -51.109 -44.897 1.00 87.04  ? 254  GLU A N     1 
ATOM   1707  C  CA    . GLU A 1 254  ? -77.535 -52.429 -45.371 1.00 88.59  ? 254  GLU A CA    1 
ATOM   1708  C  C     . GLU A 1 254  ? -76.034 -52.657 -45.199 1.00 86.36  ? 254  GLU A C     1 
ATOM   1709  O  O     . GLU A 1 254  ? -75.629 -53.713 -44.712 1.00 88.33  ? 254  GLU A O     1 
ATOM   1710  C  CB    . GLU A 1 254  ? -77.947 -52.622 -46.843 1.00 90.74  ? 254  GLU A CB    1 
ATOM   1711  C  CG    . GLU A 1 254  ? -77.751 -54.025 -47.390 1.00 92.68  ? 254  GLU A CG    1 
ATOM   1712  C  CD    . GLU A 1 254  ? -78.413 -55.073 -46.521 1.00 96.03  ? 254  GLU A CD    1 
ATOM   1713  O  OE1   . GLU A 1 254  ? -79.645 -54.982 -46.316 1.00 96.90  ? 254  GLU A OE1   1 
ATOM   1714  O  OE2   . GLU A 1 254  ? -77.694 -55.969 -46.029 1.00 98.14  ? 254  GLU A OE2   1 
ATOM   1715  N  N     . PHE A 1 255  ? -75.221 -51.669 -45.577 1.00 82.27  ? 255  PHE A N     1 
ATOM   1716  C  CA    . PHE A 1 255  ? -73.765 -51.771 -45.415 1.00 80.28  ? 255  PHE A CA    1 
ATOM   1717  C  C     . PHE A 1 255  ? -73.320 -51.674 -43.957 1.00 79.64  ? 255  PHE A C     1 
ATOM   1718  O  O     . PHE A 1 255  ? -72.417 -52.398 -43.537 1.00 78.71  ? 255  PHE A O     1 
ATOM   1719  C  CB    . PHE A 1 255  ? -73.021 -50.762 -46.313 1.00 78.54  ? 255  PHE A CB    1 
ATOM   1720  C  CG    . PHE A 1 255  ? -72.972 -51.186 -47.757 1.00 78.31  ? 255  PHE A CG    1 
ATOM   1721  C  CD1   . PHE A 1 255  ? -72.163 -52.246 -48.149 1.00 78.15  ? 255  PHE A CD1   1 
ATOM   1722  C  CD2   . PHE A 1 255  ? -73.764 -50.567 -48.715 1.00 79.07  ? 255  PHE A CD2   1 
ATOM   1723  C  CE1   . PHE A 1 255  ? -72.136 -52.669 -49.466 1.00 78.36  ? 255  PHE A CE1   1 
ATOM   1724  C  CE2   . PHE A 1 255  ? -73.744 -50.990 -50.037 1.00 79.25  ? 255  PHE A CE2   1 
ATOM   1725  C  CZ    . PHE A 1 255  ? -72.927 -52.042 -50.411 1.00 78.80  ? 255  PHE A CZ    1 
ATOM   1726  N  N     . LYS A 1 256  ? -73.972 -50.819 -43.178 1.00 80.47  ? 256  LYS A N     1 
ATOM   1727  C  CA    . LYS A 1 256  ? -73.679 -50.734 -41.746 1.00 80.71  ? 256  LYS A CA    1 
ATOM   1728  C  C     . LYS A 1 256  ? -73.992 -52.036 -40.992 1.00 81.52  ? 256  LYS A C     1 
ATOM   1729  O  O     . LYS A 1 256  ? -73.350 -52.327 -39.992 1.00 80.77  ? 256  LYS A O     1 
ATOM   1730  C  CB    . LYS A 1 256  ? -74.419 -49.554 -41.109 1.00 81.43  ? 256  LYS A CB    1 
ATOM   1731  C  CG    . LYS A 1 256  ? -73.943 -49.173 -39.711 1.00 81.36  ? 256  LYS A CG    1 
ATOM   1732  C  CD    . LYS A 1 256  ? -72.527 -48.614 -39.700 1.00 79.97  ? 256  LYS A CD    1 
ATOM   1733  C  CE    . LYS A 1 256  ? -72.144 -48.136 -38.309 1.00 79.90  ? 256  LYS A CE    1 
ATOM   1734  N  NZ    . LYS A 1 256  ? -70.716 -48.423 -38.028 1.00 79.55  ? 256  LYS A NZ    1 
ATOM   1735  N  N     . PHE A 1 257  ? -74.954 -52.822 -41.471 1.00 83.01  ? 257  PHE A N     1 
ATOM   1736  C  CA    . PHE A 1 257  ? -75.202 -54.149 -40.895 1.00 85.57  ? 257  PHE A CA    1 
ATOM   1737  C  C     . PHE A 1 257  ? -74.110 -55.175 -41.237 1.00 85.69  ? 257  PHE A C     1 
ATOM   1738  O  O     . PHE A 1 257  ? -73.621 -55.870 -40.351 1.00 85.53  ? 257  PHE A O     1 
ATOM   1739  C  CB    . PHE A 1 257  ? -76.561 -54.697 -41.331 1.00 87.87  ? 257  PHE A CB    1 
ATOM   1740  C  CG    . PHE A 1 257  ? -76.981 -55.914 -40.563 1.00 90.35  ? 257  PHE A CG    1 
ATOM   1741  C  CD1   . PHE A 1 257  ? -77.638 -55.785 -39.342 1.00 91.80  ? 257  PHE A CD1   1 
ATOM   1742  C  CD2   . PHE A 1 257  ? -76.696 -57.197 -41.045 1.00 91.48  ? 257  PHE A CD2   1 
ATOM   1743  C  CE1   . PHE A 1 257  ? -78.018 -56.909 -38.621 1.00 93.94  ? 257  PHE A CE1   1 
ATOM   1744  C  CE2   . PHE A 1 257  ? -77.071 -58.327 -40.328 1.00 92.90  ? 257  PHE A CE2   1 
ATOM   1745  C  CZ    . PHE A 1 257  ? -77.730 -58.182 -39.114 1.00 94.45  ? 257  PHE A CZ    1 
ATOM   1746  N  N     . LYS A 1 258  ? -73.754 -55.284 -42.518 1.00 85.82  ? 258  LYS A N     1 
ATOM   1747  C  CA    . LYS A 1 258  ? -72.769 -56.280 -42.979 1.00 86.15  ? 258  LYS A CA    1 
ATOM   1748  C  C     . LYS A 1 258  ? -71.389 -56.061 -42.388 1.00 83.69  ? 258  LYS A C     1 
ATOM   1749  O  O     . LYS A 1 258  ? -70.695 -57.009 -42.027 1.00 82.84  ? 258  LYS A O     1 
ATOM   1750  C  CB    . LYS A 1 258  ? -72.613 -56.231 -44.496 1.00 87.74  ? 258  LYS A CB    1 
ATOM   1751  C  CG    . LYS A 1 258  ? -73.801 -56.704 -45.305 1.00 91.25  ? 258  LYS A CG    1 
ATOM   1752  C  CD    . LYS A 1 258  ? -73.453 -56.637 -46.784 1.00 93.04  ? 258  LYS A CD    1 
ATOM   1753  C  CE    . LYS A 1 258  ? -74.681 -56.612 -47.678 1.00 96.05  ? 258  LYS A CE    1 
ATOM   1754  N  NZ    . LYS A 1 258  ? -74.325 -56.027 -49.001 1.00 96.32  ? 258  LYS A NZ    1 
ATOM   1755  N  N     . TYR A 1 259  ? -70.993 -54.799 -42.325 1.00 81.60  ? 259  TYR A N     1 
ATOM   1756  C  CA    . TYR A 1 259  ? -69.666 -54.423 -41.904 1.00 80.37  ? 259  TYR A CA    1 
ATOM   1757  C  C     . TYR A 1 259  ? -69.808 -53.489 -40.708 1.00 80.36  ? 259  TYR A C     1 
ATOM   1758  O  O     . TYR A 1 259  ? -69.484 -52.304 -40.804 1.00 79.18  ? 259  TYR A O     1 
ATOM   1759  C  CB    . TYR A 1 259  ? -68.951 -53.752 -43.073 1.00 79.37  ? 259  TYR A CB    1 
ATOM   1760  C  CG    . TYR A 1 259  ? -68.944 -54.577 -44.352 1.00 79.39  ? 259  TYR A CG    1 
ATOM   1761  C  CD1   . TYR A 1 259  ? -67.954 -55.537 -44.584 1.00 78.87  ? 259  TYR A CD1   1 
ATOM   1762  C  CD2   . TYR A 1 259  ? -69.914 -54.384 -45.335 1.00 79.61  ? 259  TYR A CD2   1 
ATOM   1763  C  CE1   . TYR A 1 259  ? -67.929 -56.280 -45.754 1.00 79.12  ? 259  TYR A CE1   1 
ATOM   1764  C  CE2   . TYR A 1 259  ? -69.906 -55.128 -46.505 1.00 80.35  ? 259  TYR A CE2   1 
ATOM   1765  C  CZ    . TYR A 1 259  ? -68.909 -56.073 -46.714 1.00 80.30  ? 259  TYR A CZ    1 
ATOM   1766  O  OH    . TYR A 1 259  ? -68.891 -56.813 -47.878 1.00 80.71  ? 259  TYR A OH    1 
ATOM   1767  N  N     . PRO A 1 260  ? -70.292 -54.023 -39.563 1.00 82.34  ? 260  PRO A N     1 
ATOM   1768  C  CA    . PRO A 1 260  ? -70.618 -53.158 -38.426 1.00 82.69  ? 260  PRO A CA    1 
ATOM   1769  C  C     . PRO A 1 260  ? -69.439 -52.326 -37.926 1.00 81.66  ? 260  PRO A C     1 
ATOM   1770  O  O     . PRO A 1 260  ? -69.648 -51.196 -37.492 1.00 81.73  ? 260  PRO A O     1 
ATOM   1771  C  CB    . PRO A 1 260  ? -71.103 -54.147 -37.354 1.00 83.80  ? 260  PRO A CB    1 
ATOM   1772  C  CG    . PRO A 1 260  ? -70.450 -55.432 -37.697 1.00 83.69  ? 260  PRO A CG    1 
ATOM   1773  C  CD    . PRO A 1 260  ? -70.388 -55.451 -39.196 1.00 83.49  ? 260  PRO A CD    1 
ATOM   1774  N  N     . GLN A 1 261  ? -68.223 -52.868 -38.029 1.00 81.19  ? 261  GLN A N     1 
ATOM   1775  C  CA    . GLN A 1 261  ? -67.020 -52.198 -37.530 1.00 79.85  ? 261  GLN A CA    1 
ATOM   1776  C  C     . GLN A 1 261  ? -66.359 -51.277 -38.554 1.00 76.32  ? 261  GLN A C     1 
ATOM   1777  O  O     . GLN A 1 261  ? -65.345 -50.664 -38.241 1.00 75.79  ? 261  GLN A O     1 
ATOM   1778  C  CB    . GLN A 1 261  ? -66.000 -53.234 -37.019 1.00 81.51  ? 261  GLN A CB    1 
ATOM   1779  C  CG    . GLN A 1 261  ? -66.567 -54.309 -36.089 1.00 84.78  ? 261  GLN A CG    1 
ATOM   1780  C  CD    . GLN A 1 261  ? -67.377 -53.736 -34.930 1.00 87.84  ? 261  GLN A CD    1 
ATOM   1781  O  OE1   . GLN A 1 261  ? -67.037 -52.689 -34.376 1.00 89.71  ? 261  GLN A OE1   1 
ATOM   1782  N  NE2   . GLN A 1 261  ? -68.455 -54.422 -34.560 1.00 90.31  ? 261  GLN A NE2   1 
ATOM   1783  N  N     . ALA A 1 262  ? -66.915 -51.167 -39.762 1.00 74.91  ? 262  ALA A N     1 
ATOM   1784  C  CA    . ALA A 1 262  ? -66.395 -50.229 -40.768 1.00 72.55  ? 262  ALA A CA    1 
ATOM   1785  C  C     . ALA A 1 262  ? -66.769 -48.793 -40.402 1.00 71.66  ? 262  ALA A C     1 
ATOM   1786  O  O     . ALA A 1 262  ? -67.916 -48.547 -40.009 1.00 72.96  ? 262  ALA A O     1 
ATOM   1787  C  CB    . ALA A 1 262  ? -66.934 -50.563 -42.149 1.00 72.38  ? 262  ALA A CB    1 
ATOM   1788  N  N     . PRO A 1 263  ? -65.811 -47.844 -40.516 1.00 69.74  ? 263  PRO A N     1 
ATOM   1789  C  CA    . PRO A 1 263  ? -66.155 -46.451 -40.268 1.00 69.15  ? 263  PRO A CA    1 
ATOM   1790  C  C     . PRO A 1 263  ? -67.005 -45.897 -41.387 1.00 69.28  ? 263  PRO A C     1 
ATOM   1791  O  O     . PRO A 1 263  ? -66.897 -46.347 -42.530 1.00 69.15  ? 263  PRO A O     1 
ATOM   1792  C  CB    . PRO A 1 263  ? -64.796 -45.748 -40.260 1.00 67.73  ? 263  PRO A CB    1 
ATOM   1793  C  CG    . PRO A 1 263  ? -63.941 -46.587 -41.126 1.00 66.85  ? 263  PRO A CG    1 
ATOM   1794  C  CD    . PRO A 1 263  ? -64.379 -47.987 -40.836 1.00 68.24  ? 263  PRO A CD    1 
ATOM   1795  N  N     . VAL A 1 264  ? -67.857 -44.942 -41.039 1.00 70.00  ? 264  VAL A N     1 
ATOM   1796  C  CA    . VAL A 1 264  ? -68.652 -44.213 -42.008 1.00 70.28  ? 264  VAL A CA    1 
ATOM   1797  C  C     . VAL A 1 264  ? -67.927 -42.890 -42.228 1.00 67.99  ? 264  VAL A C     1 
ATOM   1798  O  O     . VAL A 1 264  ? -67.998 -42.008 -41.384 1.00 68.16  ? 264  VAL A O     1 
ATOM   1799  C  CB    . VAL A 1 264  ? -70.101 -43.999 -41.505 1.00 72.34  ? 264  VAL A CB    1 
ATOM   1800  C  CG1   . VAL A 1 264  ? -70.921 -43.208 -42.520 1.00 72.77  ? 264  VAL A CG1   1 
ATOM   1801  C  CG2   . VAL A 1 264  ? -70.761 -45.343 -41.219 1.00 73.61  ? 264  VAL A CG2   1 
ATOM   1802  N  N     . ILE A 1 265  ? -67.209 -42.770 -43.340 1.00 66.24  ? 265  ILE A N     1 
ATOM   1803  C  CA    . ILE A 1 265  ? -66.403 -41.573 -43.612 1.00 65.17  ? 265  ILE A CA    1 
ATOM   1804  C  C     . ILE A 1 265  ? -67.276 -40.481 -44.213 1.00 64.11  ? 265  ILE A C     1 
ATOM   1805  O  O     . ILE A 1 265  ? -67.961 -40.712 -45.211 1.00 63.43  ? 265  ILE A O     1 
ATOM   1806  C  CB    . ILE A 1 265  ? -65.223 -41.870 -44.575 1.00 64.67  ? 265  ILE A CB    1 
ATOM   1807  C  CG1   . ILE A 1 265  ? -64.307 -42.965 -44.003 1.00 65.66  ? 265  ILE A CG1   1 
ATOM   1808  C  CG2   . ILE A 1 265  ? -64.417 -40.610 -44.863 1.00 63.12  ? 265  ILE A CG2   1 
ATOM   1809  C  CD1   . ILE A 1 265  ? -63.762 -42.698 -42.612 1.00 66.19  ? 265  ILE A CD1   1 
ATOM   1810  N  N     . MET A 1 266  ? -67.246 -39.301 -43.591 1.00 63.64  ? 266  MET A N     1 
ATOM   1811  C  CA    . MET A 1 266  ? -67.902 -38.111 -44.127 1.00 64.06  ? 266  MET A CA    1 
ATOM   1812  C  C     . MET A 1 266  ? -66.825 -37.127 -44.565 1.00 62.36  ? 266  MET A C     1 
ATOM   1813  O  O     . MET A 1 266  ? -66.565 -36.992 -45.759 1.00 63.53  ? 266  MET A O     1 
ATOM   1814  C  CB    . MET A 1 266  ? -68.869 -37.490 -43.107 1.00 66.04  ? 266  MET A CB    1 
ATOM   1815  C  CG    . MET A 1 266  ? -69.917 -38.444 -42.552 1.00 68.10  ? 266  MET A CG    1 
ATOM   1816  S  SD    . MET A 1 266  ? -71.033 -39.093 -43.803 1.00 70.48  ? 266  MET A SD    1 
ATOM   1817  C  CE    . MET A 1 266  ? -72.139 -37.706 -44.041 1.00 71.33  ? 266  MET A CE    1 
ATOM   1818  N  N     . GLY A 1 267  ? -66.170 -36.473 -43.613 1.00 61.06  ? 267  GLY A N     1 
ATOM   1819  C  CA    . GLY A 1 267  ? -65.138 -35.480 -43.921 1.00 58.87  ? 267  GLY A CA    1 
ATOM   1820  C  C     . GLY A 1 267  ? -63.729 -36.024 -43.857 1.00 56.84  ? 267  GLY A C     1 
ATOM   1821  O  O     . GLY A 1 267  ? -62.795 -35.397 -44.366 1.00 55.55  ? 267  GLY A O     1 
ATOM   1822  N  N     . ASN A 1 268  ? -63.576 -37.175 -43.203 1.00 56.38  ? 268  ASN A N     1 
ATOM   1823  C  CA    . ASN A 1 268  ? -62.280 -37.820 -42.987 1.00 55.33  ? 268  ASN A CA    1 
ATOM   1824  C  C     . ASN A 1 268  ? -61.252 -36.988 -42.204 1.00 54.48  ? 268  ASN A C     1 
ATOM   1825  O  O     . ASN A 1 268  ? -60.055 -37.265 -42.271 1.00 53.12  ? 268  ASN A O     1 
ATOM   1826  C  CB    . ASN A 1 268  ? -61.699 -38.291 -44.331 1.00 54.17  ? 268  ASN A CB    1 
ATOM   1827  C  CG    . ASN A 1 268  ? -60.688 -39.410 -44.176 1.00 53.73  ? 268  ASN A CG    1 
ATOM   1828  O  OD1   . ASN A 1 268  ? -60.882 -40.356 -43.414 1.00 54.63  ? 268  ASN A OD1   1 
ATOM   1829  N  ND2   . ASN A 1 268  ? -59.594 -39.300 -44.896 1.00 53.22  ? 268  ASN A ND2   1 
ATOM   1830  N  N     . THR A 1 269  ? -61.722 -36.004 -41.432 1.00 55.54  ? 269  THR A N     1 
ATOM   1831  C  CA    . THR A 1 269  ? -60.839 -35.151 -40.623 1.00 55.32  ? 269  THR A CA    1 
ATOM   1832  C  C     . THR A 1 269  ? -60.628 -35.718 -39.211 1.00 56.07  ? 269  THR A C     1 
ATOM   1833  O  O     . THR A 1 269  ? -59.906 -35.125 -38.419 1.00 56.37  ? 269  THR A O     1 
ATOM   1834  C  CB    . THR A 1 269  ? -61.369 -33.703 -40.511 1.00 55.30  ? 269  THR A CB    1 
ATOM   1835  O  OG1   . THR A 1 269  ? -62.525 -33.677 -39.675 1.00 57.03  ? 269  THR A OG1   1 
ATOM   1836  C  CG2   . THR A 1 269  ? -61.741 -33.141 -41.862 1.00 54.88  ? 269  THR A CG2   1 
ATOM   1837  N  N     . SER A 1 270  ? -61.280 -36.833 -38.885 1.00 57.13  ? 270  SER A N     1 
ATOM   1838  C  CA    . SER A 1 270  ? -60.976 -37.572 -37.662 1.00 58.40  ? 270  SER A CA    1 
ATOM   1839  C  C     . SER A 1 270  ? -60.274 -38.881 -37.977 1.00 59.50  ? 270  SER A C     1 
ATOM   1840  O  O     . SER A 1 270  ? -59.223 -39.168 -37.400 1.00 59.78  ? 270  SER A O     1 
ATOM   1841  C  CB    . SER A 1 270  ? -62.242 -37.842 -36.867 1.00 59.53  ? 270  SER A CB    1 
ATOM   1842  O  OG    . SER A 1 270  ? -61.938 -38.365 -35.593 1.00 59.29  ? 270  SER A OG    1 
ATOM   1843  N  N     . VAL A 1 271  ? -60.850 -39.666 -38.886 1.00 61.23  ? 271  VAL A N     1 
ATOM   1844  C  CA    . VAL A 1 271  ? -60.267 -40.950 -39.291 1.00 62.67  ? 271  VAL A CA    1 
ATOM   1845  C  C     . VAL A 1 271  ? -58.956 -40.756 -40.047 1.00 64.29  ? 271  VAL A C     1 
ATOM   1846  O  O     . VAL A 1 271  ? -57.995 -41.475 -39.796 1.00 65.54  ? 271  VAL A O     1 
ATOM   1847  C  CB    . VAL A 1 271  ? -61.229 -41.775 -40.171 1.00 63.11  ? 271  VAL A CB    1 
ATOM   1848  C  CG1   . VAL A 1 271  ? -60.574 -43.075 -40.633 1.00 63.79  ? 271  VAL A CG1   1 
ATOM   1849  C  CG2   . VAL A 1 271  ? -62.513 -42.074 -39.422 1.00 64.07  ? 271  VAL A CG2   1 
ATOM   1850  N  N     . GLY A 1 272  ? -58.927 -39.792 -40.967 1.00 66.08  ? 272  GLY A N     1 
ATOM   1851  C  CA    . GLY A 1 272  ? -57.746 -39.507 -41.781 1.00 65.97  ? 272  GLY A CA    1 
ATOM   1852  C  C     . GLY A 1 272  ? -56.477 -39.276 -40.988 1.00 67.22  ? 272  GLY A C     1 
ATOM   1853  O  O     . GLY A 1 272  ? -55.522 -40.032 -41.134 1.00 68.40  ? 272  GLY A O     1 
ATOM   1854  N  N     . PRO A 1 273  ? -56.457 -38.242 -40.131 1.00 69.30  ? 273  PRO A N     1 
ATOM   1855  C  CA    . PRO A 1 273  ? -55.250 -37.938 -39.356 1.00 70.81  ? 273  PRO A CA    1 
ATOM   1856  C  C     . PRO A 1 273  ? -54.731 -39.056 -38.448 1.00 73.71  ? 273  PRO A C     1 
ATOM   1857  O  O     . PRO A 1 273  ? -53.530 -39.091 -38.173 1.00 76.16  ? 273  PRO A O     1 
ATOM   1858  C  CB    . PRO A 1 273  ? -55.667 -36.725 -38.515 1.00 69.99  ? 273  PRO A CB    1 
ATOM   1859  C  CG    . PRO A 1 273  ? -56.722 -36.068 -39.317 1.00 69.53  ? 273  PRO A CG    1 
ATOM   1860  C  CD    . PRO A 1 273  ? -57.481 -37.196 -39.960 1.00 70.32  ? 273  PRO A CD    1 
ATOM   1861  N  N     . GLU A 1 274  ? -55.601 -39.951 -37.988 1.00 76.67  ? 274  GLU A N     1 
ATOM   1862  C  CA    . GLU A 1 274  ? -55.168 -41.027 -37.093 1.00 81.44  ? 274  GLU A CA    1 
ATOM   1863  C  C     . GLU A 1 274  ? -54.628 -42.267 -37.813 1.00 83.52  ? 274  GLU A C     1 
ATOM   1864  O  O     . GLU A 1 274  ? -53.790 -42.984 -37.260 1.00 85.34  ? 274  GLU A O     1 
ATOM   1865  C  CB    . GLU A 1 274  ? -56.252 -41.383 -36.072 1.00 85.07  ? 274  GLU A CB    1 
ATOM   1866  C  CG    . GLU A 1 274  ? -57.512 -42.046 -36.599 1.00 88.21  ? 274  GLU A CG    1 
ATOM   1867  C  CD    . GLU A 1 274  ? -58.579 -42.200 -35.524 1.00 92.17  ? 274  GLU A CD    1 
ATOM   1868  O  OE1   . GLU A 1 274  ? -58.330 -41.817 -34.359 1.00 95.05  ? 274  GLU A OE1   1 
ATOM   1869  O  OE2   . GLU A 1 274  ? -59.681 -42.701 -35.842 1.00 95.18  ? 274  GLU A OE2   1 
ATOM   1870  N  N     . VAL A 1 275  ? -55.081 -42.526 -39.037 1.00 84.87  ? 275  VAL A N     1 
ATOM   1871  C  CA    . VAL A 1 275  ? -54.436 -43.558 -39.862 1.00 85.22  ? 275  VAL A CA    1 
ATOM   1872  C  C     . VAL A 1 275  ? -53.052 -43.100 -40.346 1.00 84.09  ? 275  VAL A C     1 
ATOM   1873  O  O     . VAL A 1 275  ? -52.164 -43.927 -40.528 1.00 82.23  ? 275  VAL A O     1 
ATOM   1874  C  CB    . VAL A 1 275  ? -55.321 -44.056 -41.044 1.00 85.11  ? 275  VAL A CB    1 
ATOM   1875  C  CG1   . VAL A 1 275  ? -56.621 -44.668 -40.521 1.00 86.10  ? 275  VAL A CG1   1 
ATOM   1876  C  CG2   . VAL A 1 275  ? -55.607 -42.965 -42.077 1.00 84.16  ? 275  VAL A CG2   1 
ATOM   1877  N  N     . LYS A 1 276  ? -52.876 -41.789 -40.530 1.00 86.11  ? 276  LYS A N     1 
ATOM   1878  C  CA    . LYS A 1 276  ? -51.595 -41.219 -40.981 1.00 87.82  ? 276  LYS A CA    1 
ATOM   1879  C  C     . LYS A 1 276  ? -50.475 -41.364 -39.959 1.00 88.67  ? 276  LYS A C     1 
ATOM   1880  O  O     . LYS A 1 276  ? -49.369 -41.765 -40.316 1.00 85.08  ? 276  LYS A O     1 
ATOM   1881  C  CB    . LYS A 1 276  ? -51.744 -39.739 -41.359 1.00 88.45  ? 276  LYS A CB    1 
ATOM   1882  C  CG    . LYS A 1 276  ? -52.454 -39.533 -42.681 1.00 90.72  ? 276  LYS A CG    1 
ATOM   1883  C  CD    . LYS A 1 276  ? -52.445 -38.077 -43.103 1.00 93.44  ? 276  LYS A CD    1 
ATOM   1884  C  CE    . LYS A 1 276  ? -53.303 -37.862 -44.344 1.00 94.98  ? 276  LYS A CE    1 
ATOM   1885  N  NZ    . LYS A 1 276  ? -53.194 -36.469 -44.863 1.00 94.94  ? 276  LYS A NZ    1 
ATOM   1886  N  N     . PHE A 1 277  ? -50.761 -41.024 -38.702 1.00 93.05  ? 277  PHE A N     1 
ATOM   1887  C  CA    . PHE A 1 277  ? -49.753 -41.089 -37.638 1.00 95.97  ? 277  PHE A CA    1 
ATOM   1888  C  C     . PHE A 1 277  ? -50.305 -41.531 -36.280 1.00 95.06  ? 277  PHE A C     1 
ATOM   1889  O  O     . PHE A 1 277  ? -49.917 -40.989 -35.247 1.00 95.81  ? 277  PHE A O     1 
ATOM   1890  C  CB    . PHE A 1 277  ? -48.961 -39.760 -37.544 1.00 98.36  ? 277  PHE A CB    1 
ATOM   1891  C  CG    . PHE A 1 277  ? -49.795 -38.517 -37.749 1.00 101.07 ? 277  PHE A CG    1 
ATOM   1892  C  CD1   . PHE A 1 277  ? -50.787 -38.159 -36.834 1.00 103.56 ? 277  PHE A CD1   1 
ATOM   1893  C  CD2   . PHE A 1 277  ? -49.568 -37.682 -38.853 1.00 101.59 ? 277  PHE A CD2   1 
ATOM   1894  C  CE1   . PHE A 1 277  ? -51.542 -37.004 -37.022 1.00 105.24 ? 277  PHE A CE1   1 
ATOM   1895  C  CE2   . PHE A 1 277  ? -50.324 -36.532 -39.047 1.00 102.01 ? 277  PHE A CE2   1 
ATOM   1896  C  CZ    . PHE A 1 277  ? -51.312 -36.193 -38.131 1.00 104.52 ? 277  PHE A CZ    1 
ATOM   1897  N  N     . LYS A 1 278  ? -51.212 -42.511 -36.290 1.00 95.16  ? 278  LYS A N     1 
ATOM   1898  C  CA    . LYS A 1 278  ? -51.487 -43.342 -35.102 1.00 98.65  ? 278  LYS A CA    1 
ATOM   1899  C  C     . LYS A 1 278  ? -51.646 -44.835 -35.452 1.00 99.70  ? 278  LYS A C     1 
ATOM   1900  O  O     . LYS A 1 278  ? -52.282 -45.586 -34.704 1.00 100.93 ? 278  LYS A O     1 
ATOM   1901  C  CB    . LYS A 1 278  ? -52.714 -42.833 -34.318 1.00 101.30 ? 278  LYS A CB    1 
ATOM   1902  C  CG    . LYS A 1 278  ? -52.718 -41.334 -34.055 1.00 102.31 ? 278  LYS A CG    1 
ATOM   1903  C  CD    . LYS A 1 278  ? -53.859 -40.864 -33.165 1.00 104.01 ? 278  LYS A CD    1 
ATOM   1904  C  CE    . LYS A 1 278  ? -53.934 -39.338 -33.169 1.00 104.44 ? 278  LYS A CE    1 
ATOM   1905  N  NZ    . LYS A 1 278  ? -54.710 -38.779 -32.025 1.00 105.46 ? 278  LYS A NZ    1 
ATOM   1906  N  N     . GLY A 1 279  ? -51.054 -45.260 -36.572 1.00 98.85  ? 279  GLY A N     1 
ATOM   1907  C  CA    . GLY A 1 279  ? -51.024 -46.667 -36.985 1.00 99.55  ? 279  GLY A CA    1 
ATOM   1908  C  C     . GLY A 1 279  ? -52.343 -47.418 -37.098 1.00 100.52 ? 279  GLY A C     1 
ATOM   1909  O  O     . GLY A 1 279  ? -52.363 -48.642 -36.942 1.00 102.93 ? 279  GLY A O     1 
ATOM   1910  N  N     . VAL A 1 280  ? -53.432 -46.699 -37.380 1.00 100.03 ? 280  VAL A N     1 
ATOM   1911  C  CA    . VAL A 1 280  ? -54.780 -47.291 -37.505 1.00 99.94  ? 280  VAL A CA    1 
ATOM   1912  C  C     . VAL A 1 280  ? -55.041 -47.696 -38.967 1.00 96.16  ? 280  VAL A C     1 
ATOM   1913  O  O     . VAL A 1 280  ? -54.556 -47.031 -39.896 1.00 93.99  ? 280  VAL A O     1 
ATOM   1914  C  CB    . VAL A 1 280  ? -55.877 -46.308 -37.003 1.00 101.99 ? 280  VAL A CB    1 
ATOM   1915  C  CG1   . VAL A 1 280  ? -57.282 -46.886 -37.190 1.00 102.51 ? 280  VAL A CG1   1 
ATOM   1916  C  CG2   . VAL A 1 280  ? -55.634 -45.939 -35.539 1.00 102.65 ? 280  VAL A CG2   1 
ATOM   1917  N  N     . PHE A 1 281  ? -55.790 -48.788 -39.165 1.00 90.64  ? 281  PHE A N     1 
ATOM   1918  C  CA    . PHE A 1 281  ? -56.097 -49.283 -40.512 1.00 84.87  ? 281  PHE A CA    1 
ATOM   1919  C  C     . PHE A 1 281  ? -57.472 -49.947 -40.608 1.00 83.19  ? 281  PHE A C     1 
ATOM   1920  O  O     . PHE A 1 281  ? -57.834 -50.741 -39.746 1.00 86.62  ? 281  PHE A O     1 
ATOM   1921  C  CB    . PHE A 1 281  ? -55.020 -50.255 -40.967 1.00 82.31  ? 281  PHE A CB    1 
ATOM   1922  C  CG    . PHE A 1 281  ? -55.278 -50.824 -42.322 1.00 81.38  ? 281  PHE A CG    1 
ATOM   1923  C  CD1   . PHE A 1 281  ? -55.177 -50.017 -43.448 1.00 79.32  ? 281  PHE A CD1   1 
ATOM   1924  C  CD2   . PHE A 1 281  ? -55.661 -52.154 -42.476 1.00 82.36  ? 281  PHE A CD2   1 
ATOM   1925  C  CE1   . PHE A 1 281  ? -55.432 -50.528 -44.708 1.00 79.17  ? 281  PHE A CE1   1 
ATOM   1926  C  CE2   . PHE A 1 281  ? -55.914 -52.674 -43.736 1.00 82.18  ? 281  PHE A CE2   1 
ATOM   1927  C  CZ    . PHE A 1 281  ? -55.800 -51.859 -44.852 1.00 80.95  ? 281  PHE A CZ    1 
ATOM   1928  N  N     . HIS A 1 282  ? -58.216 -49.633 -41.673 1.00 78.52  ? 282  HIS A N     1 
ATOM   1929  C  CA    . HIS A 1 282  ? -59.578 -50.142 -41.872 1.00 76.62  ? 282  HIS A CA    1 
ATOM   1930  C  C     . HIS A 1 282  ? -59.692 -50.868 -43.207 1.00 73.12  ? 282  HIS A C     1 
ATOM   1931  O  O     . HIS A 1 282  ? -59.621 -50.231 -44.254 1.00 71.29  ? 282  HIS A O     1 
ATOM   1932  C  CB    . HIS A 1 282  ? -60.601 -49.001 -41.858 1.00 76.73  ? 282  HIS A CB    1 
ATOM   1933  C  CG    . HIS A 1 282  ? -60.618 -48.216 -40.588 1.00 77.44  ? 282  HIS A CG    1 
ATOM   1934  N  ND1   . HIS A 1 282  ? -60.195 -46.905 -40.521 1.00 77.19  ? 282  HIS A ND1   1 
ATOM   1935  C  CD2   . HIS A 1 282  ? -61.001 -48.554 -39.336 1.00 79.04  ? 282  HIS A CD2   1 
ATOM   1936  C  CE1   . HIS A 1 282  ? -60.323 -46.467 -39.282 1.00 78.03  ? 282  HIS A CE1   1 
ATOM   1937  N  NE2   . HIS A 1 282  ? -60.810 -47.448 -38.543 1.00 79.08  ? 282  HIS A NE2   1 
ATOM   1938  N  N     . PRO A 1 283  ? -59.902 -52.193 -43.181 1.00 71.89  ? 283  PRO A N     1 
ATOM   1939  C  CA    . PRO A 1 283  ? -60.071 -52.887 -44.450 1.00 71.67  ? 283  PRO A CA    1 
ATOM   1940  C  C     . PRO A 1 283  ? -61.335 -52.456 -45.192 1.00 71.61  ? 283  PRO A C     1 
ATOM   1941  O  O     . PRO A 1 283  ? -61.304 -52.330 -46.405 1.00 72.59  ? 283  PRO A O     1 
ATOM   1942  C  CB    . PRO A 1 283  ? -60.158 -54.361 -44.043 1.00 72.94  ? 283  PRO A CB    1 
ATOM   1943  C  CG    . PRO A 1 283  ? -60.659 -54.346 -42.648 1.00 73.66  ? 283  PRO A CG    1 
ATOM   1944  C  CD    . PRO A 1 283  ? -60.139 -53.083 -42.029 1.00 73.07  ? 283  PRO A CD    1 
ATOM   1945  N  N     . VAL A 1 284  ? -62.430 -52.229 -44.473 1.00 71.17  ? 284  VAL A N     1 
ATOM   1946  C  CA    . VAL A 1 284  ? -63.681 -51.802 -45.097 1.00 70.58  ? 284  VAL A CA    1 
ATOM   1947  C  C     . VAL A 1 284  ? -63.971 -50.352 -44.700 1.00 69.17  ? 284  VAL A C     1 
ATOM   1948  O  O     . VAL A 1 284  ? -63.842 -49.998 -43.531 1.00 68.43  ? 284  VAL A O     1 
ATOM   1949  C  CB    . VAL A 1 284  ? -64.854 -52.732 -44.705 1.00 71.98  ? 284  VAL A CB    1 
ATOM   1950  C  CG1   . VAL A 1 284  ? -66.133 -52.327 -45.430 1.00 72.29  ? 284  VAL A CG1   1 
ATOM   1951  C  CG2   . VAL A 1 284  ? -64.497 -54.184 -45.009 1.00 72.39  ? 284  VAL A CG2   1 
ATOM   1952  N  N     . ILE A 1 285  ? -64.322 -49.525 -45.689 1.00 68.03  ? 285  ILE A N     1 
ATOM   1953  C  CA    . ILE A 1 285  ? -64.810 -48.158 -45.480 1.00 67.43  ? 285  ILE A CA    1 
ATOM   1954  C  C     . ILE A 1 285  ? -66.208 -48.045 -46.079 1.00 68.68  ? 285  ILE A C     1 
ATOM   1955  O  O     . ILE A 1 285  ? -66.464 -48.605 -47.142 1.00 68.55  ? 285  ILE A O     1 
ATOM   1956  C  CB    . ILE A 1 285  ? -63.921 -47.117 -46.195 1.00 66.15  ? 285  ILE A CB    1 
ATOM   1957  C  CG1   . ILE A 1 285  ? -62.469 -47.172 -45.687 1.00 65.80  ? 285  ILE A CG1   1 
ATOM   1958  C  CG2   . ILE A 1 285  ? -64.496 -45.711 -46.053 1.00 65.69  ? 285  ILE A CG2   1 
ATOM   1959  C  CD1   . ILE A 1 285  ? -62.289 -46.838 -44.220 1.00 66.22  ? 285  ILE A CD1   1 
ATOM   1960  N  N     . ILE A 1 286  ? -67.102 -47.316 -45.401 1.00 69.47  ? 286  ILE A N     1 
ATOM   1961  C  CA    . ILE A 1 286  ? -68.390 -46.903 -45.979 1.00 69.75  ? 286  ILE A CA    1 
ATOM   1962  C  C     . ILE A 1 286  ? -68.401 -45.375 -46.077 1.00 68.76  ? 286  ILE A C     1 
ATOM   1963  O  O     . ILE A 1 286  ? -68.127 -44.689 -45.103 1.00 68.81  ? 286  ILE A O     1 
ATOM   1964  C  CB    . ILE A 1 286  ? -69.585 -47.404 -45.149 1.00 71.46  ? 286  ILE A CB    1 
ATOM   1965  C  CG1   . ILE A 1 286  ? -69.569 -48.936 -45.041 1.00 72.05  ? 286  ILE A CG1   1 
ATOM   1966  C  CG2   . ILE A 1 286  ? -70.901 -46.931 -45.764 1.00 72.36  ? 286  ILE A CG2   1 
ATOM   1967  C  CD1   . ILE A 1 286  ? -70.295 -49.457 -43.820 1.00 73.46  ? 286  ILE A CD1   1 
ATOM   1968  N  N     . SER A 1 287  ? -68.705 -44.851 -47.260 1.00 69.00  ? 287  SER A N     1 
ATOM   1969  C  CA    . SER A 1 287  ? -68.575 -43.424 -47.545 1.00 69.07  ? 287  SER A CA    1 
ATOM   1970  C  C     . SER A 1 287  ? -69.772 -42.977 -48.357 1.00 70.16  ? 287  SER A C     1 
ATOM   1971  O  O     . SER A 1 287  ? -69.691 -42.900 -49.588 1.00 69.02  ? 287  SER A O     1 
ATOM   1972  C  CB    . SER A 1 287  ? -67.280 -43.148 -48.311 1.00 69.00  ? 287  SER A CB    1 
ATOM   1973  O  OG    . SER A 1 287  ? -67.169 -41.779 -48.658 1.00 69.17  ? 287  SER A OG    1 
ATOM   1974  N  N     . PRO A 1 288  ? -70.889 -42.682 -47.670 1.00 72.42  ? 288  PRO A N     1 
ATOM   1975  C  CA    . PRO A 1 288  ? -72.142 -42.418 -48.354 1.00 74.83  ? 288  PRO A CA    1 
ATOM   1976  C  C     . PRO A 1 288  ? -72.133 -41.105 -49.109 1.00 76.54  ? 288  PRO A C     1 
ATOM   1977  O  O     . PRO A 1 288  ? -71.493 -40.156 -48.668 1.00 76.58  ? 288  PRO A O     1 
ATOM   1978  C  CB    . PRO A 1 288  ? -73.149 -42.349 -47.209 1.00 75.67  ? 288  PRO A CB    1 
ATOM   1979  C  CG    . PRO A 1 288  ? -72.365 -41.839 -46.065 1.00 74.51  ? 288  PRO A CG    1 
ATOM   1980  C  CD    . PRO A 1 288  ? -71.015 -42.471 -46.216 1.00 73.29  ? 288  PRO A CD    1 
ATOM   1981  N  N     . ASP A 1 289  ? -72.848 -41.052 -50.231 1.00 80.39  ? 289  ASP A N     1 
ATOM   1982  C  CA    . ASP A 1 289  ? -73.011 -39.802 -50.973 1.00 83.26  ? 289  ASP A CA    1 
ATOM   1983  C  C     . ASP A 1 289  ? -74.093 -38.979 -50.270 1.00 86.13  ? 289  ASP A C     1 
ATOM   1984  O  O     . ASP A 1 289  ? -74.497 -39.322 -49.157 1.00 87.91  ? 289  ASP A O     1 
ATOM   1985  C  CB    . ASP A 1 289  ? -73.359 -40.062 -52.447 1.00 84.78  ? 289  ASP A CB    1 
ATOM   1986  C  CG    . ASP A 1 289  ? -72.659 -39.090 -53.394 1.00 85.34  ? 289  ASP A CG    1 
ATOM   1987  O  OD1   . ASP A 1 289  ? -72.447 -37.911 -53.026 1.00 85.39  ? 289  ASP A OD1   1 
ATOM   1988  O  OD2   . ASP A 1 289  ? -72.315 -39.512 -54.516 1.00 86.41  ? 289  ASP A OD2   1 
ATOM   1989  N  N     . ARG A 1 290  ? -74.557 -37.895 -50.887 1.00 87.67  ? 290  ARG A N     1 
ATOM   1990  C  CA    . ARG A 1 290  ? -75.536 -37.045 -50.230 1.00 90.36  ? 290  ARG A CA    1 
ATOM   1991  C  C     . ARG A 1 290  ? -76.873 -37.777 -50.077 1.00 90.48  ? 290  ARG A C     1 
ATOM   1992  O  O     . ARG A 1 290  ? -77.654 -37.864 -51.023 1.00 91.28  ? 290  ARG A O     1 
ATOM   1993  C  CB    . ARG A 1 290  ? -75.706 -35.721 -50.972 1.00 92.80  ? 290  ARG A CB    1 
ATOM   1994  C  CG    . ARG A 1 290  ? -76.412 -34.670 -50.134 1.00 96.18  ? 290  ARG A CG    1 
ATOM   1995  C  CD    . ARG A 1 290  ? -76.445 -33.322 -50.830 1.00 98.31  ? 290  ARG A CD    1 
ATOM   1996  N  NE    . ARG A 1 290  ? -76.574 -32.234 -49.863 1.00 99.92  ? 290  ARG A NE    1 
ATOM   1997  C  CZ    . ARG A 1 290  ? -77.690 -31.907 -49.210 1.00 102.44 ? 290  ARG A CZ    1 
ATOM   1998  N  NH1   . ARG A 1 290  ? -78.830 -32.581 -49.399 1.00 104.14 ? 290  ARG A NH1   1 
ATOM   1999  N  NH2   . ARG A 1 290  ? -77.667 -30.886 -48.353 1.00 103.05 ? 290  ARG A NH2   1 
ATOM   2000  N  N     . ILE A 1 291  ? -77.089 -38.338 -48.886 1.00 89.65  ? 291  ILE A N     1 
ATOM   2001  C  CA    . ILE A 1 291  ? -78.372 -38.927 -48.497 1.00 90.76  ? 291  ILE A CA    1 
ATOM   2002  C  C     . ILE A 1 291  ? -79.199 -37.785 -47.897 1.00 91.39  ? 291  ILE A C     1 
ATOM   2003  O  O     . ILE A 1 291  ? -78.756 -37.145 -46.945 1.00 90.73  ? 291  ILE A O     1 
ATOM   2004  C  CB    . ILE A 1 291  ? -78.213 -40.048 -47.431 1.00 90.71  ? 291  ILE A CB    1 
ATOM   2005  C  CG1   . ILE A 1 291  ? -77.186 -41.119 -47.847 1.00 89.25  ? 291  ILE A CG1   1 
ATOM   2006  C  CG2   . ILE A 1 291  ? -79.564 -40.679 -47.111 1.00 92.90  ? 291  ILE A CG2   1 
ATOM   2007  C  CD1   . ILE A 1 291  ? -77.466 -41.818 -49.154 1.00 89.42  ? 291  ILE A CD1   1 
ATOM   2008  N  N     . GLU A 1 292  ? -80.390 -37.539 -48.443 1.00 92.74  ? 292  GLU A N     1 
ATOM   2009  C  CA    . GLU A 1 292  ? -81.217 -36.385 -48.044 1.00 93.80  ? 292  GLU A CA    1 
ATOM   2010  C  C     . GLU A 1 292  ? -81.573 -36.380 -46.550 1.00 92.40  ? 292  GLU A C     1 
ATOM   2011  O  O     . GLU A 1 292  ? -81.514 -35.333 -45.903 1.00 91.85  ? 292  GLU A O     1 
ATOM   2012  C  CB    . GLU A 1 292  ? -82.491 -36.317 -48.908 1.00 97.05  ? 292  GLU A CB    1 
ATOM   2013  C  CG    . GLU A 1 292  ? -83.383 -35.085 -48.713 1.00 100.27 ? 292  GLU A CG    1 
ATOM   2014  C  CD    . GLU A 1 292  ? -82.714 -33.746 -49.050 1.00 101.02 ? 292  GLU A CD    1 
ATOM   2015  O  OE1   . GLU A 1 292  ? -81.651 -33.722 -49.722 1.00 98.61  ? 292  GLU A OE1   1 
ATOM   2016  O  OE2   . GLU A 1 292  ? -83.275 -32.697 -48.644 1.00 102.94 ? 292  GLU A OE2   1 
ATOM   2017  N  N     . GLU A 1 293  ? -81.894 -37.552 -46.007 1.00 91.35  ? 293  GLU A N     1 
ATOM   2018  C  CA    . GLU A 1 293  ? -82.246 -37.693 -44.586 1.00 90.91  ? 293  GLU A CA    1 
ATOM   2019  C  C     . GLU A 1 293  ? -81.098 -37.344 -43.635 1.00 88.84  ? 293  GLU A C     1 
ATOM   2020  O  O     . GLU A 1 293  ? -81.349 -36.945 -42.501 1.00 90.18  ? 293  GLU A O     1 
ATOM   2021  C  CB    . GLU A 1 293  ? -82.736 -39.112 -44.276 1.00 91.92  ? 293  GLU A CB    1 
ATOM   2022  C  CG    . GLU A 1 293  ? -84.084 -39.470 -44.894 1.00 94.21  ? 293  GLU A CG    1 
ATOM   2023  C  CD    . GLU A 1 293  ? -84.008 -40.022 -46.314 1.00 94.50  ? 293  GLU A CD    1 
ATOM   2024  O  OE1   . GLU A 1 293  ? -82.918 -39.995 -46.936 1.00 92.67  ? 293  GLU A OE1   1 
ATOM   2025  O  OE2   . GLU A 1 293  ? -85.060 -40.485 -46.816 1.00 97.21  ? 293  GLU A OE2   1 
ATOM   2026  N  N     . LEU A 1 294  ? -79.855 -37.501 -44.102 1.00 86.63  ? 294  LEU A N     1 
ATOM   2027  C  CA    . LEU A 1 294  ? -78.643 -37.106 -43.351 1.00 84.52  ? 294  LEU A CA    1 
ATOM   2028  C  C     . LEU A 1 294  ? -78.322 -35.598 -43.394 1.00 83.29  ? 294  LEU A C     1 
ATOM   2029  O  O     . LEU A 1 294  ? -77.399 -35.147 -42.715 1.00 81.18  ? 294  LEU A O     1 
ATOM   2030  C  CB    . LEU A 1 294  ? -77.410 -37.907 -43.836 1.00 82.85  ? 294  LEU A CB    1 
ATOM   2031  C  CG    . LEU A 1 294  ? -76.958 -39.101 -42.987 1.00 82.85  ? 294  LEU A CG    1 
ATOM   2032  C  CD1   . LEU A 1 294  ? -78.089 -40.088 -42.771 1.00 84.68  ? 294  LEU A CD1   1 
ATOM   2033  C  CD2   . LEU A 1 294  ? -75.770 -39.795 -43.634 1.00 81.66  ? 294  LEU A CD2   1 
ATOM   2034  N  N     . SER A 1 295  ? -79.059 -34.826 -44.186 1.00 83.97  ? 295  SER A N     1 
ATOM   2035  C  CA    . SER A 1 295  ? -78.790 -33.402 -44.342 1.00 84.63  ? 295  SER A CA    1 
ATOM   2036  C  C     . SER A 1 295  ? -80.061 -32.574 -44.112 1.00 85.30  ? 295  SER A C     1 
ATOM   2037  O  O     . SER A 1 295  ? -80.269 -31.540 -44.744 1.00 86.01  ? 295  SER A O     1 
ATOM   2038  C  CB    . SER A 1 295  ? -78.207 -33.163 -45.734 1.00 84.85  ? 295  SER A CB    1 
ATOM   2039  O  OG    . SER A 1 295  ? -79.092 -33.653 -46.726 1.00 87.88  ? 295  SER A OG    1 
ATOM   2040  N  N     . VAL A 1 296  ? -80.889 -33.026 -43.175 1.00 85.27  ? 296  VAL A N     1 
ATOM   2041  C  CA    . VAL A 1 296  ? -82.153 -32.373 -42.858 1.00 85.88  ? 296  VAL A CA    1 
ATOM   2042  C  C     . VAL A 1 296  ? -81.935 -31.102 -42.022 1.00 85.68  ? 296  VAL A C     1 
ATOM   2043  O  O     . VAL A 1 296  ? -80.980 -31.021 -41.242 1.00 84.02  ? 296  VAL A O     1 
ATOM   2044  C  CB    . VAL A 1 296  ? -83.103 -33.350 -42.118 1.00 87.24  ? 296  VAL A CB    1 
ATOM   2045  C  CG1   . VAL A 1 296  ? -82.664 -33.580 -40.669 1.00 86.86  ? 296  VAL A CG1   1 
ATOM   2046  C  CG2   . VAL A 1 296  ? -84.544 -32.856 -42.177 1.00 89.20  ? 296  VAL A CG2   1 
ATOM   2047  N  N     . VAL A 1 297  ? -82.819 -30.117 -42.218 1.00 86.91  ? 297  VAL A N     1 
ATOM   2048  C  CA    . VAL A 1 297  ? -82.872 -28.882 -41.412 1.00 86.96  ? 297  VAL A CA    1 
ATOM   2049  C  C     . VAL A 1 297  ? -84.333 -28.589 -41.064 1.00 89.20  ? 297  VAL A C     1 
ATOM   2050  O  O     . VAL A 1 297  ? -85.011 -27.852 -41.777 1.00 89.79  ? 297  VAL A O     1 
ATOM   2051  C  CB    . VAL A 1 297  ? -82.243 -27.671 -42.150 1.00 84.83  ? 297  VAL A CB    1 
ATOM   2052  C  CG1   . VAL A 1 297  ? -82.359 -26.394 -41.316 1.00 84.68  ? 297  VAL A CG1   1 
ATOM   2053  C  CG2   . VAL A 1 297  ? -80.789 -27.958 -42.494 1.00 82.88  ? 297  VAL A CG2   1 
ATOM   2054  N  N     . ASN A 1 298  ? -84.809 -29.184 -39.974 1.00 91.26  ? 298  ASN A N     1 
ATOM   2055  C  CA    . ASN A 1 298  ? -86.180 -28.976 -39.506 1.00 95.34  ? 298  ASN A CA    1 
ATOM   2056  C  C     . ASN A 1 298  ? -86.248 -27.866 -38.456 1.00 95.23  ? 298  ASN A C     1 
ATOM   2057  O  O     . ASN A 1 298  ? -85.552 -27.934 -37.446 1.00 93.65  ? 298  ASN A O     1 
ATOM   2058  C  CB    . ASN A 1 298  ? -86.749 -30.275 -38.925 1.00 97.85  ? 298  ASN A CB    1 
ATOM   2059  C  CG    . ASN A 1 298  ? -88.165 -30.109 -38.381 1.00 102.27 ? 298  ASN A CG    1 
ATOM   2060  O  OD1   . ASN A 1 298  ? -89.023 -29.488 -39.018 1.00 104.63 ? 298  ASN A OD1   1 
ATOM   2061  N  ND2   . ASN A 1 298  ? -88.418 -30.666 -37.196 1.00 103.99 ? 298  ASN A ND2   1 
ATOM   2062  N  N     . HIS A 1 299  ? -87.079 -26.852 -38.711 1.00 96.83  ? 299  HIS A N     1 
ATOM   2063  C  CA    . HIS A 1 299  ? -87.409 -25.818 -37.721 1.00 97.78  ? 299  HIS A CA    1 
ATOM   2064  C  C     . HIS A 1 299  ? -88.655 -26.258 -36.966 1.00 99.26  ? 299  HIS A C     1 
ATOM   2065  O  O     . HIS A 1 299  ? -89.779 -25.947 -37.365 1.00 100.38 ? 299  HIS A O     1 
ATOM   2066  C  CB    . HIS A 1 299  ? -87.660 -24.462 -38.390 1.00 98.11  ? 299  HIS A CB    1 
ATOM   2067  C  CG    . HIS A 1 299  ? -86.515 -23.973 -39.212 1.00 97.04  ? 299  HIS A CG    1 
ATOM   2068  N  ND1   . HIS A 1 299  ? -85.368 -23.452 -38.654 1.00 96.75  ? 299  HIS A ND1   1 
ATOM   2069  C  CD2   . HIS A 1 299  ? -86.338 -23.925 -40.554 1.00 97.07  ? 299  HIS A CD2   1 
ATOM   2070  C  CE1   . HIS A 1 299  ? -84.530 -23.105 -39.617 1.00 95.42  ? 299  HIS A CE1   1 
ATOM   2071  N  NE2   . HIS A 1 299  ? -85.096 -23.379 -40.779 1.00 95.67  ? 299  HIS A NE2   1 
ATOM   2072  N  N     . ALA A 1 300  ? -88.453 -26.991 -35.876 1.00 99.48  ? 300  ALA A N     1 
ATOM   2073  C  CA    . ALA A 1 300  ? -89.566 -27.473 -35.058 1.00 100.78 ? 300  ALA A CA    1 
ATOM   2074  C  C     . ALA A 1 300  ? -90.124 -26.376 -34.144 1.00 102.01 ? 300  ALA A C     1 
ATOM   2075  O  O     . ALA A 1 300  ? -89.557 -25.286 -34.012 1.00 101.11 ? 300  ALA A O     1 
ATOM   2076  C  CB    . ALA A 1 300  ? -89.143 -28.687 -34.237 1.00 100.72 ? 300  ALA A CB    1 
ATOM   2077  N  N     . TYR A 1 301  ? -91.256 -26.693 -33.529 1.00 103.67 ? 301  TYR A N     1 
ATOM   2078  C  CA    . TYR A 1 301  ? -91.887 -25.853 -32.521 1.00 104.48 ? 301  TYR A CA    1 
ATOM   2079  C  C     . TYR A 1 301  ? -91.054 -25.792 -31.234 1.00 103.62 ? 301  TYR A C     1 
ATOM   2080  O  O     . TYR A 1 301  ? -90.917 -24.730 -30.632 1.00 103.92 ? 301  TYR A O     1 
ATOM   2081  C  CB    . TYR A 1 301  ? -93.274 -26.419 -32.222 1.00 106.73 ? 301  TYR A CB    1 
ATOM   2082  C  CG    . TYR A 1 301  ? -94.084 -25.655 -31.212 1.00 108.89 ? 301  TYR A CG    1 
ATOM   2083  C  CD1   . TYR A 1 301  ? -94.017 -25.969 -29.851 1.00 109.84 ? 301  TYR A CD1   1 
ATOM   2084  C  CD2   . TYR A 1 301  ? -94.957 -24.645 -31.616 1.00 110.72 ? 301  TYR A CD2   1 
ATOM   2085  C  CE1   . TYR A 1 301  ? -94.781 -25.278 -28.917 1.00 112.36 ? 301  TYR A CE1   1 
ATOM   2086  C  CE2   . TYR A 1 301  ? -95.729 -23.952 -30.691 1.00 113.22 ? 301  TYR A CE2   1 
ATOM   2087  C  CZ    . TYR A 1 301  ? -95.637 -24.269 -29.345 1.00 113.91 ? 301  TYR A CZ    1 
ATOM   2088  O  OH    . TYR A 1 301  ? -96.402 -23.582 -28.431 1.00 117.10 ? 301  TYR A OH    1 
ATOM   2089  N  N     . ASN A 1 302  ? -90.534 -26.944 -30.814 1.00 102.74 ? 302  ASN A N     1 
ATOM   2090  C  CA    . ASN A 1 302  ? -89.716 -27.068 -29.598 1.00 102.31 ? 302  ASN A CA    1 
ATOM   2091  C  C     . ASN A 1 302  ? -88.213 -26.775 -29.794 1.00 99.68  ? 302  ASN A C     1 
ATOM   2092  O  O     . ASN A 1 302  ? -87.487 -26.605 -28.814 1.00 99.00  ? 302  ASN A O     1 
ATOM   2093  C  CB    . ASN A 1 302  ? -89.899 -28.470 -28.978 1.00 104.02 ? 302  ASN A CB    1 
ATOM   2094  C  CG    . ASN A 1 302  ? -89.343 -29.597 -29.862 1.00 104.87 ? 302  ASN A CG    1 
ATOM   2095  O  OD1   . ASN A 1 302  ? -89.723 -29.747 -31.030 1.00 105.39 ? 302  ASN A OD1   1 
ATOM   2096  N  ND2   . ASN A 1 302  ? -88.441 -30.397 -29.302 1.00 104.58 ? 302  ASN A ND2   1 
ATOM   2097  N  N     . GLY A 1 303  ? -87.751 -26.716 -31.046 1.00 97.62  ? 303  GLY A N     1 
ATOM   2098  C  CA    . GLY A 1 303  ? -86.319 -26.597 -31.348 1.00 94.44  ? 303  GLY A CA    1 
ATOM   2099  C  C     . GLY A 1 303  ? -85.999 -26.834 -32.815 1.00 92.72  ? 303  GLY A C     1 
ATOM   2100  O  O     . GLY A 1 303  ? -86.818 -26.551 -33.689 1.00 93.45  ? 303  GLY A O     1 
ATOM   2101  N  N     . LEU A 1 304  ? -84.797 -27.333 -33.090 1.00 90.14  ? 304  LEU A N     1 
ATOM   2102  C  CA    . LEU A 1 304  ? -84.443 -27.765 -34.443 1.00 88.30  ? 304  LEU A CA    1 
ATOM   2103  C  C     . LEU A 1 304  ? -83.652 -29.057 -34.455 1.00 85.72  ? 304  LEU A C     1 
ATOM   2104  O  O     . LEU A 1 304  ? -82.885 -29.350 -33.534 1.00 84.89  ? 304  LEU A O     1 
ATOM   2105  C  CB    . LEU A 1 304  ? -83.699 -26.681 -35.230 1.00 87.25  ? 304  LEU A CB    1 
ATOM   2106  C  CG    . LEU A 1 304  ? -82.608 -25.846 -34.577 1.00 87.09  ? 304  LEU A CG    1 
ATOM   2107  C  CD1   . LEU A 1 304  ? -81.488 -26.684 -33.983 1.00 86.75  ? 304  LEU A CD1   1 
ATOM   2108  C  CD2   . LEU A 1 304  ? -82.050 -24.896 -35.623 1.00 86.59  ? 304  LEU A CD2   1 
ATOM   2109  N  N     . THR A 1 305  ? -83.864 -29.821 -35.519 1.00 83.66  ? 305  THR A N     1 
ATOM   2110  C  CA    . THR A 1 305  ? -83.186 -31.078 -35.721 1.00 82.58  ? 305  THR A CA    1 
ATOM   2111  C  C     . THR A 1 305  ? -82.248 -30.861 -36.913 1.00 78.69  ? 305  THR A C     1 
ATOM   2112  O  O     . THR A 1 305  ? -82.690 -30.424 -37.977 1.00 77.55  ? 305  THR A O     1 
ATOM   2113  C  CB    . THR A 1 305  ? -84.196 -32.232 -35.944 1.00 84.87  ? 305  THR A CB    1 
ATOM   2114  O  OG1   . THR A 1 305  ? -84.627 -32.265 -37.310 1.00 86.67  ? 305  THR A OG1   1 
ATOM   2115  C  CG2   . THR A 1 305  ? -85.423 -32.063 -35.050 1.00 86.64  ? 305  THR A CG2   1 
ATOM   2116  N  N     . LEU A 1 306  ? -80.956 -31.118 -36.708 1.00 75.99  ? 306  LEU A N     1 
ATOM   2117  C  CA    . LEU A 1 306  ? -79.931 -30.922 -37.747 1.00 74.02  ? 306  LEU A CA    1 
ATOM   2118  C  C     . LEU A 1 306  ? -79.374 -32.257 -38.227 1.00 72.79  ? 306  LEU A C     1 
ATOM   2119  O  O     . LEU A 1 306  ? -79.006 -33.105 -37.413 1.00 72.20  ? 306  LEU A O     1 
ATOM   2120  C  CB    . LEU A 1 306  ? -78.779 -30.054 -37.221 1.00 72.24  ? 306  LEU A CB    1 
ATOM   2121  C  CG    . LEU A 1 306  ? -79.099 -28.613 -36.819 1.00 72.18  ? 306  LEU A CG    1 
ATOM   2122  C  CD1   . LEU A 1 306  ? -77.822 -27.940 -36.353 1.00 70.66  ? 306  LEU A CD1   1 
ATOM   2123  C  CD2   . LEU A 1 306  ? -79.737 -27.829 -37.955 1.00 72.23  ? 306  LEU A CD2   1 
ATOM   2124  N  N     . GLY A 1 307  ? -79.299 -32.421 -39.547 1.00 72.41  ? 307  GLY A N     1 
ATOM   2125  C  CA    . GLY A 1 307  ? -78.730 -33.617 -40.165 1.00 71.62  ? 307  GLY A CA    1 
ATOM   2126  C  C     . GLY A 1 307  ? -77.280 -33.891 -39.783 1.00 70.03  ? 307  GLY A C     1 
ATOM   2127  O  O     . GLY A 1 307  ? -76.458 -32.974 -39.673 1.00 68.59  ? 307  GLY A O     1 
ATOM   2128  N  N     . ALA A 1 308  ? -76.974 -35.168 -39.591 1.00 69.99  ? 308  ALA A N     1 
ATOM   2129  C  CA    . ALA A 1 308  ? -75.638 -35.609 -39.200 1.00 68.93  ? 308  ALA A CA    1 
ATOM   2130  C  C     . ALA A 1 308  ? -74.598 -35.403 -40.300 1.00 67.96  ? 308  ALA A C     1 
ATOM   2131  O  O     . ALA A 1 308  ? -73.406 -35.300 -40.006 1.00 68.26  ? 308  ALA A O     1 
ATOM   2132  C  CB    . ALA A 1 308  ? -75.681 -37.071 -38.791 1.00 69.37  ? 308  ALA A CB    1 
ATOM   2133  N  N     . GLY A 1 309  ? -75.047 -35.362 -41.556 1.00 67.93  ? 309  GLY A N     1 
ATOM   2134  C  CA    . GLY A 1 309  ? -74.179 -35.108 -42.707 1.00 66.46  ? 309  GLY A CA    1 
ATOM   2135  C  C     . GLY A 1 309  ? -74.023 -33.654 -43.139 1.00 65.63  ? 309  GLY A C     1 
ATOM   2136  O  O     . GLY A 1 309  ? -73.443 -33.390 -44.189 1.00 64.43  ? 309  GLY A O     1 
ATOM   2137  N  N     . LEU A 1 310  ? -74.550 -32.712 -42.361 1.00 66.11  ? 310  LEU A N     1 
ATOM   2138  C  CA    . LEU A 1 310  ? -74.292 -31.297 -42.601 1.00 65.42  ? 310  LEU A CA    1 
ATOM   2139  C  C     . LEU A 1 310  ? -72.858 -31.021 -42.187 1.00 63.45  ? 310  LEU A C     1 
ATOM   2140  O  O     . LEU A 1 310  ? -72.380 -31.590 -41.205 1.00 62.58  ? 310  LEU A O     1 
ATOM   2141  C  CB    . LEU A 1 310  ? -75.214 -30.414 -41.760 1.00 67.25  ? 310  LEU A CB    1 
ATOM   2142  C  CG    . LEU A 1 310  ? -76.726 -30.512 -41.955 1.00 69.26  ? 310  LEU A CG    1 
ATOM   2143  C  CD1   . LEU A 1 310  ? -77.439 -29.871 -40.775 1.00 70.54  ? 310  LEU A CD1   1 
ATOM   2144  C  CD2   . LEU A 1 310  ? -77.154 -29.859 -43.256 1.00 69.55  ? 310  LEU A CD2   1 
ATOM   2145  N  N     . SER A 1 311  ? -72.178 -30.147 -42.920 1.00 62.32  ? 311  SER A N     1 
ATOM   2146  C  CA    . SER A 1 311  ? -70.833 -29.736 -42.533 1.00 62.10  ? 311  SER A CA    1 
ATOM   2147  C  C     . SER A 1 311  ? -70.945 -28.786 -41.360 1.00 63.62  ? 311  SER A C     1 
ATOM   2148  O  O     . SER A 1 311  ? -72.016 -28.206 -41.127 1.00 65.50  ? 311  SER A O     1 
ATOM   2149  C  CB    . SER A 1 311  ? -70.080 -29.067 -43.685 1.00 60.64  ? 311  SER A CB    1 
ATOM   2150  O  OG    . SER A 1 311  ? -70.605 -27.793 -43.985 1.00 60.40  ? 311  SER A OG    1 
ATOM   2151  N  N     . LEU A 1 312  ? -69.848 -28.626 -40.627 1.00 63.01  ? 312  LEU A N     1 
ATOM   2152  C  CA    . LEU A 1 312  ? -69.808 -27.675 -39.513 1.00 63.63  ? 312  LEU A CA    1 
ATOM   2153  C  C     . LEU A 1 312  ? -69.974 -26.241 -40.015 1.00 64.57  ? 312  LEU A C     1 
ATOM   2154  O  O     . LEU A 1 312  ? -70.530 -25.402 -39.304 1.00 67.04  ? 312  LEU A O     1 
ATOM   2155  C  CB    . LEU A 1 312  ? -68.506 -27.795 -38.722 1.00 62.62  ? 312  LEU A CB    1 
ATOM   2156  C  CG    . LEU A 1 312  ? -68.213 -29.149 -38.076 1.00 62.59  ? 312  LEU A CG    1 
ATOM   2157  C  CD1   . LEU A 1 312  ? -66.891 -29.097 -37.328 1.00 62.00  ? 312  LEU A CD1   1 
ATOM   2158  C  CD2   . LEU A 1 312  ? -69.344 -29.561 -37.151 1.00 64.26  ? 312  LEU A CD2   1 
ATOM   2159  N  N     . ALA A 1 313  ? -69.502 -25.969 -41.234 1.00 63.99  ? 313  ALA A N     1 
ATOM   2160  C  CA    . ALA A 1 313  ? -69.666 -24.660 -41.862 1.00 64.01  ? 313  ALA A CA    1 
ATOM   2161  C  C     . ALA A 1 313  ? -71.141 -24.344 -42.116 1.00 65.84  ? 313  ALA A C     1 
ATOM   2162  O  O     . ALA A 1 313  ? -71.612 -23.267 -41.762 1.00 66.16  ? 313  ALA A O     1 
ATOM   2163  C  CB    . ALA A 1 313  ? -68.876 -24.592 -43.157 1.00 62.23  ? 313  ALA A CB    1 
ATOM   2164  N  N     . GLN A 1 314  ? -71.857 -25.291 -42.717 1.00 67.04  ? 314  GLN A N     1 
ATOM   2165  C  CA    . GLN A 1 314  ? -73.309 -25.173 -42.920 1.00 69.87  ? 314  GLN A CA    1 
ATOM   2166  C  C     . GLN A 1 314  ? -74.121 -25.047 -41.630 1.00 70.55  ? 314  GLN A C     1 
ATOM   2167  O  O     . GLN A 1 314  ? -75.167 -24.405 -41.624 1.00 71.45  ? 314  GLN A O     1 
ATOM   2168  C  CB    . GLN A 1 314  ? -73.842 -26.381 -43.676 1.00 71.57  ? 314  GLN A CB    1 
ATOM   2169  C  CG    . GLN A 1 314  ? -73.435 -26.425 -45.129 1.00 72.22  ? 314  GLN A CG    1 
ATOM   2170  C  CD    . GLN A 1 314  ? -73.844 -27.720 -45.783 1.00 74.80  ? 314  GLN A CD    1 
ATOM   2171  O  OE1   . GLN A 1 314  ? -73.993 -28.746 -45.119 1.00 76.67  ? 314  GLN A OE1   1 
ATOM   2172  N  NE2   . GLN A 1 314  ? -74.034 -27.683 -47.093 1.00 77.32  ? 314  GLN A NE2   1 
ATOM   2173  N  N     . VAL A 1 315  ? -73.662 -25.698 -40.565 1.00 69.97  ? 315  VAL A N     1 
ATOM   2174  C  CA    . VAL A 1 315  ? -74.292 -25.579 -39.253 1.00 70.76  ? 315  VAL A CA    1 
ATOM   2175  C  C     . VAL A 1 315  ? -74.073 -24.177 -38.718 1.00 71.15  ? 315  VAL A C     1 
ATOM   2176  O  O     . VAL A 1 315  ? -74.971 -23.612 -38.123 1.00 72.63  ? 315  VAL A O     1 
ATOM   2177  C  CB    . VAL A 1 315  ? -73.774 -26.655 -38.265 1.00 70.42  ? 315  VAL A CB    1 
ATOM   2178  C  CG1   . VAL A 1 315  ? -74.158 -26.350 -36.820 1.00 71.08  ? 315  VAL A CG1   1 
ATOM   2179  C  CG2   . VAL A 1 315  ? -74.312 -28.023 -38.665 1.00 71.23  ? 315  VAL A CG2   1 
ATOM   2180  N  N     . LYS A 1 316  ? -72.892 -23.614 -38.937 1.00 71.34  ? 316  LYS A N     1 
ATOM   2181  C  CA    . LYS A 1 316  ? -72.620 -22.241 -38.510 1.00 72.76  ? 316  LYS A CA    1 
ATOM   2182  C  C     . LYS A 1 316  ? -73.561 -21.252 -39.203 1.00 73.03  ? 316  LYS A C     1 
ATOM   2183  O  O     . LYS A 1 316  ? -74.044 -20.321 -38.567 1.00 75.65  ? 316  LYS A O     1 
ATOM   2184  C  CB    . LYS A 1 316  ? -71.151 -21.864 -38.743 1.00 73.62  ? 316  LYS A CB    1 
ATOM   2185  C  CG    . LYS A 1 316  ? -70.617 -20.832 -37.759 1.00 75.73  ? 316  LYS A CG    1 
ATOM   2186  C  CD    . LYS A 1 316  ? -69.092 -20.763 -37.767 1.00 76.56  ? 316  LYS A CD    1 
ATOM   2187  C  CE    . LYS A 1 316  ? -68.544 -19.927 -38.914 1.00 77.04  ? 316  LYS A CE    1 
ATOM   2188  N  NZ    . LYS A 1 316  ? -68.890 -18.482 -38.783 1.00 78.83  ? 316  LYS A NZ    1 
ATOM   2189  N  N     . ASP A 1 317  ? -73.860 -21.490 -40.477 1.00 72.23  ? 317  ASP A N     1 
ATOM   2190  C  CA    . ASP A 1 317  ? -74.790 -20.638 -41.240 1.00 74.00  ? 317  ASP A CA    1 
ATOM   2191  C  C     . ASP A 1 317  ? -76.261 -20.765 -40.844 1.00 74.98  ? 317  ASP A C     1 
ATOM   2192  O  O     . ASP A 1 317  ? -76.965 -19.759 -40.724 1.00 76.09  ? 317  ASP A O     1 
ATOM   2193  C  CB    . ASP A 1 317  ? -74.667 -20.917 -42.738 1.00 74.23  ? 317  ASP A CB    1 
ATOM   2194  C  CG    . ASP A 1 317  ? -73.343 -20.456 -43.304 1.00 74.02  ? 317  ASP A CG    1 
ATOM   2195  O  OD1   . ASP A 1 317  ? -72.817 -19.426 -42.829 1.00 74.05  ? 317  ASP A OD1   1 
ATOM   2196  O  OD2   . ASP A 1 317  ? -72.834 -21.119 -44.232 1.00 74.96  ? 317  ASP A OD2   1 
ATOM   2197  N  N     . ILE A 1 318  ? -76.718 -22.002 -40.686 1.00 73.81  ? 318  ILE A N     1 
ATOM   2198  C  CA    . ILE A 1 318  ? -78.071 -22.295 -40.215 1.00 74.12  ? 318  ILE A CA    1 
ATOM   2199  C  C     . ILE A 1 318  ? -78.342 -21.587 -38.873 1.00 75.09  ? 318  ILE A C     1 
ATOM   2200  O  O     . ILE A 1 318  ? -79.372 -20.923 -38.711 1.00 75.71  ? 318  ILE A O     1 
ATOM   2201  C  CB    . ILE A 1 318  ? -78.271 -23.823 -40.093 1.00 73.74  ? 318  ILE A CB    1 
ATOM   2202  C  CG1   . ILE A 1 318  ? -78.370 -24.446 -41.484 1.00 73.16  ? 318  ILE A CG1   1 
ATOM   2203  C  CG2   . ILE A 1 318  ? -79.516 -24.181 -39.287 1.00 76.01  ? 318  ILE A CG2   1 
ATOM   2204  C  CD1   . ILE A 1 318  ? -77.999 -25.914 -41.523 1.00 72.67  ? 318  ILE A CD1   1 
ATOM   2205  N  N     . LEU A 1 319  ? -77.406 -21.722 -37.935 1.00 74.39  ? 319  LEU A N     1 
ATOM   2206  C  CA    . LEU A 1 319  ? -77.546 -21.145 -36.598 1.00 75.23  ? 319  LEU A CA    1 
ATOM   2207  C  C     . LEU A 1 319  ? -77.378 -19.629 -36.571 1.00 76.38  ? 319  LEU A C     1 
ATOM   2208  O  O     . LEU A 1 319  ? -77.890 -18.983 -35.672 1.00 78.63  ? 319  LEU A O     1 
ATOM   2209  C  CB    . LEU A 1 319  ? -76.543 -21.772 -35.626 1.00 73.65  ? 319  LEU A CB    1 
ATOM   2210  C  CG    . LEU A 1 319  ? -76.573 -23.274 -35.355 1.00 73.20  ? 319  LEU A CG    1 
ATOM   2211  C  CD1   . LEU A 1 319  ? -75.485 -23.614 -34.349 1.00 72.33  ? 319  LEU A CD1   1 
ATOM   2212  C  CD2   . LEU A 1 319  ? -77.928 -23.742 -34.854 1.00 75.10  ? 319  LEU A CD2   1 
ATOM   2213  N  N     . ALA A 1 320  ? -76.620 -19.065 -37.508 1.00 76.65  ? 320  ALA A N     1 
ATOM   2214  C  CA    . ALA A 1 320  ? -76.476 -17.605 -37.601 1.00 77.13  ? 320  ALA A CA    1 
ATOM   2215  C  C     . ALA A 1 320  ? -77.802 -16.963 -37.994 1.00 79.75  ? 320  ALA A C     1 
ATOM   2216  O  O     . ALA A 1 320  ? -78.180 -15.927 -37.453 1.00 82.79  ? 320  ALA A O     1 
ATOM   2217  C  CB    . ALA A 1 320  ? -75.399 -17.241 -38.609 1.00 75.36  ? 320  ALA A CB    1 
ATOM   2218  N  N     . ASP A 1 321  ? -78.497 -17.605 -38.931 1.00 80.63  ? 321  ASP A N     1 
ATOM   2219  C  CA    . ASP A 1 321  ? -79.806 -17.172 -39.409 1.00 83.48  ? 321  ASP A CA    1 
ATOM   2220  C  C     . ASP A 1 321  ? -80.877 -17.331 -38.315 1.00 85.18  ? 321  ASP A C     1 
ATOM   2221  O  O     . ASP A 1 321  ? -81.656 -16.411 -38.065 1.00 86.37  ? 321  ASP A O     1 
ATOM   2222  C  CB    . ASP A 1 321  ? -80.187 -17.984 -40.660 1.00 84.31  ? 321  ASP A CB    1 
ATOM   2223  C  CG    . ASP A 1 321  ? -81.242 -17.299 -41.524 1.00 86.77  ? 321  ASP A CG    1 
ATOM   2224  O  OD1   . ASP A 1 321  ? -82.281 -16.862 -40.992 1.00 89.61  ? 321  ASP A OD1   1 
ATOM   2225  O  OD2   . ASP A 1 321  ? -81.041 -17.221 -42.757 1.00 87.49  ? 321  ASP A OD2   1 
ATOM   2226  N  N     . VAL A 1 322  ? -80.905 -18.497 -37.676 1.00 84.58  ? 322  VAL A N     1 
ATOM   2227  C  CA    . VAL A 1 322  ? -81.845 -18.788 -36.589 1.00 85.71  ? 322  VAL A CA    1 
ATOM   2228  C  C     . VAL A 1 322  ? -81.696 -17.792 -35.440 1.00 86.60  ? 322  VAL A C     1 
ATOM   2229  O  O     . VAL A 1 322  ? -82.685 -17.278 -34.939 1.00 88.77  ? 322  VAL A O     1 
ATOM   2230  C  CB    . VAL A 1 322  ? -81.661 -20.236 -36.074 1.00 85.57  ? 322  VAL A CB    1 
ATOM   2231  C  CG1   . VAL A 1 322  ? -82.337 -20.454 -34.722 1.00 87.01  ? 322  VAL A CG1   1 
ATOM   2232  C  CG2   . VAL A 1 322  ? -82.181 -21.235 -37.110 1.00 85.35  ? 322  VAL A CG2   1 
ATOM   2233  N  N     . VAL A 1 323  ? -80.459 -17.529 -35.038 1.00 86.43  ? 323  VAL A N     1 
ATOM   2234  C  CA    . VAL A 1 323  ? -80.142 -16.510 -34.020 1.00 87.05  ? 323  VAL A CA    1 
ATOM   2235  C  C     . VAL A 1 323  ? -80.729 -15.114 -34.322 1.00 89.18  ? 323  VAL A C     1 
ATOM   2236  O  O     . VAL A 1 323  ? -81.173 -14.434 -33.405 1.00 89.82  ? 323  VAL A O     1 
ATOM   2237  C  CB    . VAL A 1 323  ? -78.606 -16.454 -33.772 1.00 84.30  ? 323  VAL A CB    1 
ATOM   2238  C  CG1   . VAL A 1 323  ? -78.147 -15.133 -33.167 1.00 84.95  ? 323  VAL A CG1   1 
ATOM   2239  C  CG2   . VAL A 1 323  ? -78.192 -17.609 -32.873 1.00 83.66  ? 323  VAL A CG2   1 
ATOM   2240  N  N     . GLN A 1 324  ? -80.724 -14.697 -35.588 1.00 91.28  ? 324  GLN A N     1 
ATOM   2241  C  CA    . GLN A 1 324  ? -81.298 -13.400 -35.991 1.00 94.42  ? 324  GLN A CA    1 
ATOM   2242  C  C     . GLN A 1 324  ? -82.823 -13.420 -36.188 1.00 96.06  ? 324  GLN A C     1 
ATOM   2243  O  O     . GLN A 1 324  ? -83.471 -12.384 -36.053 1.00 97.60  ? 324  GLN A O     1 
ATOM   2244  C  CB    . GLN A 1 324  ? -80.626 -12.878 -37.274 1.00 95.22  ? 324  GLN A CB    1 
ATOM   2245  C  CG    . GLN A 1 324  ? -79.169 -12.446 -37.112 1.00 95.47  ? 324  GLN A CG    1 
ATOM   2246  C  CD    . GLN A 1 324  ? -78.978 -11.224 -36.212 1.00 98.05  ? 324  GLN A CD    1 
ATOM   2247  O  OE1   . GLN A 1 324  ? -79.924 -10.494 -35.898 1.00 101.07 ? 324  GLN A OE1   1 
ATOM   2248  N  NE2   . GLN A 1 324  ? -77.741 -11.000 -35.792 1.00 97.96  ? 324  GLN A NE2   1 
ATOM   2249  N  N     . LYS A 1 325  ? -83.381 -14.585 -36.513 1.00 96.78  ? 325  LYS A N     1 
ATOM   2250  C  CA    . LYS A 1 325  ? -84.821 -14.737 -36.795 1.00 99.36  ? 325  LYS A CA    1 
ATOM   2251  C  C     . LYS A 1 325  ? -85.663 -15.058 -35.558 1.00 100.21 ? 325  LYS A C     1 
ATOM   2252  O  O     . LYS A 1 325  ? -86.886 -14.927 -35.612 1.00 101.87 ? 325  LYS A O     1 
ATOM   2253  C  CB    . LYS A 1 325  ? -85.059 -15.814 -37.884 1.00 100.50 ? 325  LYS A CB    1 
ATOM   2254  C  CG    . LYS A 1 325  ? -85.096 -15.299 -39.328 1.00 101.72 ? 325  LYS A CG    1 
ATOM   2255  C  CD    . LYS A 1 325  ? -83.917 -14.390 -39.671 1.00 101.98 ? 325  LYS A CD    1 
ATOM   2256  C  CE    . LYS A 1 325  ? -83.838 -14.052 -41.153 1.00 102.49 ? 325  LYS A CE    1 
ATOM   2257  N  NZ    . LYS A 1 325  ? -82.497 -13.485 -41.496 1.00 101.87 ? 325  LYS A NZ    1 
ATOM   2258  N  N     . LEU A 1 326  ? -85.024 -15.489 -34.468 1.00 99.28  ? 326  LEU A N     1 
ATOM   2259  C  CA    . LEU A 1 326  ? -85.719 -15.826 -33.218 1.00 100.69 ? 326  LEU A CA    1 
ATOM   2260  C  C     . LEU A 1 326  ? -85.298 -14.885 -32.081 1.00 100.90 ? 326  LEU A C     1 
ATOM   2261  O  O     . LEU A 1 326  ? -84.221 -14.283 -32.152 1.00 99.80  ? 326  LEU A O     1 
ATOM   2262  C  CB    . LEU A 1 326  ? -85.447 -17.286 -32.830 1.00 100.46 ? 326  LEU A CB    1 
ATOM   2263  C  CG    . LEU A 1 326  ? -86.420 -18.326 -33.401 1.00 101.30 ? 326  LEU A CG    1 
ATOM   2264  C  CD1   . LEU A 1 326  ? -86.431 -18.316 -34.927 1.00 100.77 ? 326  LEU A CD1   1 
ATOM   2265  C  CD2   . LEU A 1 326  ? -86.074 -19.709 -32.864 1.00 100.66 ? 326  LEU A CD2   1 
ATOM   2266  N  N     . PRO A 1 327  ? -86.144 -14.758 -31.030 1.00 101.93 ? 327  PRO A N     1 
ATOM   2267  C  CA    . PRO A 1 327  ? -85.824 -13.894 -29.886 1.00 102.13 ? 327  PRO A CA    1 
ATOM   2268  C  C     . PRO A 1 327  ? -84.780 -14.527 -28.972 1.00 101.57 ? 327  PRO A C     1 
ATOM   2269  O  O     . PRO A 1 327  ? -84.673 -15.756 -28.911 1.00 99.71  ? 327  PRO A O     1 
ATOM   2270  C  CB    . PRO A 1 327  ? -87.165 -13.747 -29.174 1.00 104.01 ? 327  PRO A CB    1 
ATOM   2271  C  CG    . PRO A 1 327  ? -87.887 -15.010 -29.481 1.00 104.30 ? 327  PRO A CG    1 
ATOM   2272  C  CD    . PRO A 1 327  ? -87.452 -15.423 -30.856 1.00 103.21 ? 327  PRO A CD    1 
ATOM   2273  N  N     . GLU A 1 328  ? -84.052 -13.689 -28.236 1.00 102.94 ? 328  GLU A N     1 
ATOM   2274  C  CA    . GLU A 1 328  ? -82.763 -14.083 -27.653 1.00 104.04 ? 328  GLU A CA    1 
ATOM   2275  C  C     . GLU A 1 328  ? -82.801 -14.818 -26.294 1.00 105.15 ? 328  GLU A C     1 
ATOM   2276  O  O     . GLU A 1 328  ? -81.829 -14.760 -25.532 1.00 105.53 ? 328  GLU A O     1 
ATOM   2277  C  CB    . GLU A 1 328  ? -81.821 -12.866 -27.577 1.00 104.96 ? 328  GLU A CB    1 
ATOM   2278  C  CG    . GLU A 1 328  ? -80.353 -13.231 -27.810 1.00 104.83 ? 328  GLU A CG    1 
ATOM   2279  C  CD    . GLU A 1 328  ? -79.382 -12.081 -27.590 1.00 105.84 ? 328  GLU A CD    1 
ATOM   2280  O  OE1   . GLU A 1 328  ? -79.698 -11.150 -26.809 1.00 107.66 ? 328  GLU A OE1   1 
ATOM   2281  O  OE2   . GLU A 1 328  ? -78.283 -12.123 -28.196 1.00 104.64 ? 328  GLU A OE2   1 
ATOM   2282  N  N     . GLU A 1 329  ? -83.905 -15.490 -25.975 1.00 106.17 ? 329  GLU A N     1 
ATOM   2283  C  CA    . GLU A 1 329  ? -83.906 -16.473 -24.881 1.00 106.48 ? 329  GLU A CA    1 
ATOM   2284  C  C     . GLU A 1 329  ? -84.347 -17.876 -25.305 1.00 104.21 ? 329  GLU A C     1 
ATOM   2285  O  O     . GLU A 1 329  ? -84.387 -18.775 -24.466 1.00 101.49 ? 329  GLU A O     1 
ATOM   2286  C  CB    . GLU A 1 329  ? -84.758 -15.968 -23.720 1.00 109.88 ? 329  GLU A CB    1 
ATOM   2287  C  CG    . GLU A 1 329  ? -84.230 -16.372 -22.349 1.00 111.86 ? 329  GLU A CG    1 
ATOM   2288  C  CD    . GLU A 1 329  ? -84.841 -15.555 -21.217 1.00 115.19 ? 329  GLU A CD    1 
ATOM   2289  O  OE1   . GLU A 1 329  ? -85.937 -14.975 -21.405 1.00 116.80 ? 329  GLU A OE1   1 
ATOM   2290  O  OE2   . GLU A 1 329  ? -84.229 -15.509 -20.125 1.00 115.45 ? 329  GLU A OE2   1 
ATOM   2291  N  N     . LYS A 1 330  ? -84.683 -18.044 -26.589 1.00 103.54 ? 330  LYS A N     1 
ATOM   2292  C  CA    . LYS A 1 330  ? -84.806 -19.357 -27.234 1.00 103.22 ? 330  LYS A CA    1 
ATOM   2293  C  C     . LYS A 1 330  ? -83.561 -19.720 -28.057 1.00 98.57  ? 330  LYS A C     1 
ATOM   2294  O  O     . LYS A 1 330  ? -83.458 -20.853 -28.530 1.00 97.79  ? 330  LYS A O     1 
ATOM   2295  C  CB    . LYS A 1 330  ? -86.048 -19.408 -28.137 1.00 106.61 ? 330  LYS A CB    1 
ATOM   2296  C  CG    . LYS A 1 330  ? -87.368 -19.484 -27.377 1.00 111.50 ? 330  LYS A CG    1 
ATOM   2297  C  CD    . LYS A 1 330  ? -88.565 -19.691 -28.300 1.00 114.54 ? 330  LYS A CD    1 
ATOM   2298  C  CE    . LYS A 1 330  ? -88.868 -18.447 -29.125 1.00 115.87 ? 330  LYS A CE    1 
ATOM   2299  N  NZ    . LYS A 1 330  ? -90.141 -18.568 -29.887 1.00 118.03 ? 330  LYS A NZ    1 
ATOM   2300  N  N     . THR A 1 331  ? -82.625 -18.777 -28.213 1.00 94.79  ? 331  THR A N     1 
ATOM   2301  C  CA    . THR A 1 331  ? -81.420 -18.975 -29.021 1.00 91.03  ? 331  THR A CA    1 
ATOM   2302  C  C     . THR A 1 331  ? -80.188 -19.033 -28.124 1.00 88.49  ? 331  THR A C     1 
ATOM   2303  O  O     . THR A 1 331  ? -79.153 -18.456 -28.446 1.00 86.72  ? 331  THR A O     1 
ATOM   2304  C  CB    . THR A 1 331  ? -81.251 -17.834 -30.057 1.00 90.61  ? 331  THR A CB    1 
ATOM   2305  O  OG1   . THR A 1 331  ? -80.995 -16.586 -29.389 1.00 90.59  ? 331  THR A OG1   1 
ATOM   2306  C  CG2   . THR A 1 331  ? -82.496 -17.702 -30.928 1.00 91.69  ? 331  THR A CG2   1 
ATOM   2307  N  N     . GLN A 1 332  ? -80.296 -19.732 -26.997 1.00 87.84  ? 332  GLN A N     1 
ATOM   2308  C  CA    . GLN A 1 332  ? -79.227 -19.724 -26.005 1.00 86.80  ? 332  GLN A CA    1 
ATOM   2309  C  C     . GLN A 1 332  ? -78.171 -20.760 -26.336 1.00 85.84  ? 332  GLN A C     1 
ATOM   2310  O  O     . GLN A 1 332  ? -76.976 -20.467 -26.300 1.00 85.63  ? 332  GLN A O     1 
ATOM   2311  C  CB    . GLN A 1 332  ? -79.781 -19.973 -24.609 1.00 87.59  ? 332  GLN A CB    1 
ATOM   2312  C  CG    . GLN A 1 332  ? -78.903 -19.420 -23.501 1.00 86.79  ? 332  GLN A CG    1 
ATOM   2313  C  CD    . GLN A 1 332  ? -79.075 -17.928 -23.272 1.00 86.43  ? 332  GLN A CD    1 
ATOM   2314  O  OE1   . GLN A 1 332  ? -80.154 -17.369 -23.477 1.00 87.01  ? 332  GLN A OE1   1 
ATOM   2315  N  NE2   . GLN A 1 332  ? -78.006 -17.278 -22.834 1.00 85.70  ? 332  GLN A NE2   1 
ATOM   2316  N  N     . MET A 1 333  ? -78.619 -21.977 -26.634 1.00 86.33  ? 333  MET A N     1 
ATOM   2317  C  CA    . MET A 1 333  ? -77.730 -23.037 -27.109 1.00 84.39  ? 333  MET A CA    1 
ATOM   2318  C  C     . MET A 1 333  ? -77.068 -22.656 -28.416 1.00 81.92  ? 333  MET A C     1 
ATOM   2319  O  O     . MET A 1 333  ? -75.872 -22.872 -28.586 1.00 81.42  ? 333  MET A O     1 
ATOM   2320  C  CB    . MET A 1 333  ? -78.488 -24.354 -27.309 1.00 85.65  ? 333  MET A CB    1 
ATOM   2321  C  CG    . MET A 1 333  ? -78.712 -25.144 -26.035 1.00 87.31  ? 333  MET A CG    1 
ATOM   2322  S  SD    . MET A 1 333  ? -77.160 -25.796 -25.385 1.00 87.54  ? 333  MET A SD    1 
ATOM   2323  C  CE    . MET A 1 333  ? -76.745 -27.039 -26.614 1.00 85.96  ? 333  MET A CE    1 
ATOM   2324  N  N     . TYR A 1 334  ? -77.844 -22.073 -29.323 1.00 81.32  ? 334  TYR A N     1 
ATOM   2325  C  CA    . TYR A 1 334  ? -77.351 -21.752 -30.662 1.00 79.74  ? 334  TYR A CA    1 
ATOM   2326  C  C     . TYR A 1 334  ? -76.299 -20.646 -30.649 1.00 79.45  ? 334  TYR A C     1 
ATOM   2327  O  O     . TYR A 1 334  ? -75.475 -20.587 -31.555 1.00 79.04  ? 334  TYR A O     1 
ATOM   2328  C  CB    . TYR A 1 334  ? -78.493 -21.396 -31.625 1.00 80.42  ? 334  TYR A CB    1 
ATOM   2329  C  CG    . TYR A 1 334  ? -79.691 -22.325 -31.543 1.00 81.68  ? 334  TYR A CG    1 
ATOM   2330  C  CD1   . TYR A 1 334  ? -79.531 -23.711 -31.454 1.00 81.29  ? 334  TYR A CD1   1 
ATOM   2331  C  CD2   . TYR A 1 334  ? -80.988 -21.816 -31.536 1.00 83.00  ? 334  TYR A CD2   1 
ATOM   2332  C  CE1   . TYR A 1 334  ? -80.629 -24.553 -31.368 1.00 82.14  ? 334  TYR A CE1   1 
ATOM   2333  C  CE2   . TYR A 1 334  ? -82.086 -22.653 -31.451 1.00 83.98  ? 334  TYR A CE2   1 
ATOM   2334  C  CZ    . TYR A 1 334  ? -81.902 -24.021 -31.368 1.00 83.41  ? 334  TYR A CZ    1 
ATOM   2335  O  OH    . TYR A 1 334  ? -82.979 -24.867 -31.284 1.00 84.09  ? 334  TYR A OH    1 
ATOM   2336  N  N     . HIS A 1 335  ? -76.311 -19.786 -29.633 1.00 80.82  ? 335  HIS A N     1 
ATOM   2337  C  CA    . HIS A 1 335  ? -75.236 -18.801 -29.461 1.00 81.22  ? 335  HIS A CA    1 
ATOM   2338  C  C     . HIS A 1 335  ? -73.911 -19.401 -29.002 1.00 77.74  ? 335  HIS A C     1 
ATOM   2339  O  O     . HIS A 1 335  ? -72.854 -18.997 -29.476 1.00 75.63  ? 335  HIS A O     1 
ATOM   2340  C  CB    . HIS A 1 335  ? -75.647 -17.691 -28.499 1.00 85.08  ? 335  HIS A CB    1 
ATOM   2341  C  CG    . HIS A 1 335  ? -76.159 -16.476 -29.191 1.00 88.82  ? 335  HIS A CG    1 
ATOM   2342  N  ND1   . HIS A 1 335  ? -77.467 -16.054 -29.085 1.00 93.21  ? 335  HIS A ND1   1 
ATOM   2343  C  CD2   . HIS A 1 335  ? -75.541 -15.599 -30.015 1.00 89.70  ? 335  HIS A CD2   1 
ATOM   2344  C  CE1   . HIS A 1 335  ? -77.630 -14.957 -29.803 1.00 94.25  ? 335  HIS A CE1   1 
ATOM   2345  N  NE2   . HIS A 1 335  ? -76.478 -14.663 -30.381 1.00 93.09  ? 335  HIS A NE2   1 
ATOM   2346  N  N     . ALA A 1 336  ? -73.976 -20.336 -28.064 1.00 76.80  ? 336  ALA A N     1 
ATOM   2347  C  CA    . ALA A 1 336  ? -72.784 -20.998 -27.549 1.00 75.59  ? 336  ALA A CA    1 
ATOM   2348  C  C     . ALA A 1 336  ? -72.107 -21.863 -28.620 1.00 74.40  ? 336  ALA A C     1 
ATOM   2349  O  O     . ALA A 1 336  ? -70.870 -21.913 -28.689 1.00 72.71  ? 336  ALA A O     1 
ATOM   2350  C  CB    . ALA A 1 336  ? -73.133 -21.833 -26.328 1.00 76.30  ? 336  ALA A CB    1 
ATOM   2351  N  N     . LEU A 1 337  ? -72.918 -22.532 -29.444 1.00 74.35  ? 337  LEU A N     1 
ATOM   2352  C  CA    . LEU A 1 337  ? -72.410 -23.291 -30.595 1.00 73.50  ? 337  LEU A CA    1 
ATOM   2353  C  C     . LEU A 1 337  ? -71.767 -22.378 -31.648 1.00 72.99  ? 337  LEU A C     1 
ATOM   2354  O  O     . LEU A 1 337  ? -70.678 -22.684 -32.129 1.00 73.12  ? 337  LEU A O     1 
ATOM   2355  C  CB    . LEU A 1 337  ? -73.512 -24.148 -31.238 1.00 73.36  ? 337  LEU A CB    1 
ATOM   2356  C  CG    . LEU A 1 337  ? -74.052 -25.304 -30.383 1.00 74.10  ? 337  LEU A CG    1 
ATOM   2357  C  CD1   . LEU A 1 337  ? -75.379 -25.818 -30.916 1.00 74.68  ? 337  LEU A CD1   1 
ATOM   2358  C  CD2   . LEU A 1 337  ? -73.051 -26.442 -30.283 1.00 73.22  ? 337  LEU A CD2   1 
ATOM   2359  N  N     . LEU A 1 338  ? -72.422 -21.268 -31.996 1.00 73.62  ? 338  LEU A N     1 
ATOM   2360  C  CA    . LEU A 1 338  ? -71.817 -20.268 -32.901 1.00 72.69  ? 338  LEU A CA    1 
ATOM   2361  C  C     . LEU A 1 338  ? -70.487 -19.731 -32.403 1.00 71.55  ? 338  LEU A C     1 
ATOM   2362  O  O     . LEU A 1 338  ? -69.578 -19.505 -33.206 1.00 70.02  ? 338  LEU A O     1 
ATOM   2363  C  CB    . LEU A 1 338  ? -72.720 -19.055 -33.137 1.00 74.42  ? 338  LEU A CB    1 
ATOM   2364  C  CG    . LEU A 1 338  ? -73.270 -18.900 -34.553 1.00 75.18  ? 338  LEU A CG    1 
ATOM   2365  C  CD1   . LEU A 1 338  ? -74.729 -19.283 -34.537 1.00 77.38  ? 338  LEU A CD1   1 
ATOM   2366  C  CD2   . LEU A 1 338  ? -73.113 -17.475 -35.076 1.00 75.42  ? 338  LEU A CD2   1 
ATOM   2367  N  N     . LYS A 1 339  ? -70.401 -19.488 -31.094 1.00 72.31  ? 339  LYS A N     1 
ATOM   2368  C  CA    . LYS A 1 339  ? -69.183 -18.957 -30.476 1.00 72.67  ? 339  LYS A CA    1 
ATOM   2369  C  C     . LYS A 1 339  ? -68.008 -19.893 -30.719 1.00 70.73  ? 339  LYS A C     1 
ATOM   2370  O  O     . LYS A 1 339  ? -66.960 -19.473 -31.198 1.00 70.17  ? 339  LYS A O     1 
ATOM   2371  C  CB    . LYS A 1 339  ? -69.377 -18.735 -28.968 1.00 74.37  ? 339  LYS A CB    1 
ATOM   2372  C  CG    . LYS A 1 339  ? -68.139 -18.221 -28.241 1.00 74.88  ? 339  LYS A CG    1 
ATOM   2373  C  CD    . LYS A 1 339  ? -68.436 -17.944 -26.774 1.00 77.29  ? 339  LYS A CD    1 
ATOM   2374  C  CE    . LYS A 1 339  ? -67.185 -17.525 -26.010 1.00 77.70  ? 339  LYS A CE    1 
ATOM   2375  N  NZ    . LYS A 1 339  ? -67.456 -17.373 -24.551 1.00 79.44  ? 339  LYS A NZ    1 
ATOM   2376  N  N     . HIS A 1 340  ? -68.200 -21.163 -30.398 1.00 70.43  ? 340  HIS A N     1 
ATOM   2377  C  CA    . HIS A 1 340  ? -67.135 -22.141 -30.535 1.00 69.16  ? 340  HIS A CA    1 
ATOM   2378  C  C     . HIS A 1 340  ? -66.885 -22.603 -31.965 1.00 67.84  ? 340  HIS A C     1 
ATOM   2379  O  O     . HIS A 1 340  ? -65.783 -23.073 -32.246 1.00 66.77  ? 340  HIS A O     1 
ATOM   2380  C  CB    . HIS A 1 340  ? -67.369 -23.318 -29.593 1.00 69.48  ? 340  HIS A CB    1 
ATOM   2381  C  CG    . HIS A 1 340  ? -66.897 -23.053 -28.202 1.00 69.71  ? 340  HIS A CG    1 
ATOM   2382  N  ND1   . HIS A 1 340  ? -66.681 -24.057 -27.284 1.00 70.32  ? 340  HIS A ND1   1 
ATOM   2383  C  CD2   . HIS A 1 340  ? -66.559 -21.897 -27.586 1.00 69.45  ? 340  HIS A CD2   1 
ATOM   2384  C  CE1   . HIS A 1 340  ? -66.258 -23.528 -26.152 1.00 70.73  ? 340  HIS A CE1   1 
ATOM   2385  N  NE2   . HIS A 1 340  ? -66.168 -22.219 -26.312 1.00 70.77  ? 340  HIS A NE2   1 
ATOM   2386  N  N     . LEU A 1 341  ? -67.880 -22.460 -32.846 1.00 67.40  ? 341  LEU A N     1 
ATOM   2387  C  CA    . LEU A 1 341  ? -67.704 -22.730 -34.282 1.00 66.67  ? 341  LEU A CA    1 
ATOM   2388  C  C     . LEU A 1 341  ? -66.923 -21.627 -35.011 1.00 66.22  ? 341  LEU A C     1 
ATOM   2389  O  O     . LEU A 1 341  ? -66.275 -21.889 -36.027 1.00 65.85  ? 341  LEU A O     1 
ATOM   2390  C  CB    . LEU A 1 341  ? -69.054 -22.954 -34.977 1.00 67.24  ? 341  LEU A CB    1 
ATOM   2391  C  CG    . LEU A 1 341  ? -69.778 -24.276 -34.704 1.00 67.83  ? 341  LEU A CG    1 
ATOM   2392  C  CD1   . LEU A 1 341  ? -71.231 -24.199 -35.152 1.00 68.88  ? 341  LEU A CD1   1 
ATOM   2393  C  CD2   . LEU A 1 341  ? -69.082 -25.426 -35.401 1.00 67.08  ? 341  LEU A CD2   1 
ATOM   2394  N  N     . GLY A 1 342  ? -66.990 -20.400 -34.509 1.00 67.18  ? 342  GLY A N     1 
ATOM   2395  C  CA    . GLY A 1 342  ? -66.184 -19.307 -35.048 1.00 66.95  ? 342  GLY A CA    1 
ATOM   2396  C  C     . GLY A 1 342  ? -64.684 -19.539 -34.948 1.00 65.83  ? 342  GLY A C     1 
ATOM   2397  O  O     . GLY A 1 342  ? -63.935 -19.109 -35.824 1.00 63.62  ? 342  GLY A O     1 
ATOM   2398  N  N     . THR A 1 343  ? -64.262 -20.212 -33.876 1.00 66.80  ? 343  THR A N     1 
ATOM   2399  C  CA    . THR A 1 343  ? -62.851 -20.522 -33.604 1.00 67.17  ? 343  THR A CA    1 
ATOM   2400  C  C     . THR A 1 343  ? -62.407 -21.924 -34.038 1.00 66.42  ? 343  THR A C     1 
ATOM   2401  O  O     . THR A 1 343  ? -61.210 -22.171 -34.170 1.00 67.76  ? 343  THR A O     1 
ATOM   2402  C  CB    . THR A 1 343  ? -62.555 -20.407 -32.095 1.00 68.69  ? 343  THR A CB    1 
ATOM   2403  O  OG1   . THR A 1 343  ? -63.464 -21.241 -31.354 1.00 70.56  ? 343  THR A OG1   1 
ATOM   2404  C  CG2   . THR A 1 343  ? -62.694 -18.969 -31.640 1.00 69.37  ? 343  THR A CG2   1 
ATOM   2405  N  N     . LEU A 1 344  ? -63.366 -22.823 -34.260 1.00 66.10  ? 344  LEU A N     1 
ATOM   2406  C  CA    . LEU A 1 344  ? -63.099 -24.233 -34.536 1.00 65.38  ? 344  LEU A CA    1 
ATOM   2407  C  C     . LEU A 1 344  ? -62.313 -24.436 -35.837 1.00 64.69  ? 344  LEU A C     1 
ATOM   2408  O  O     . LEU A 1 344  ? -62.844 -24.198 -36.920 1.00 65.02  ? 344  LEU A O     1 
ATOM   2409  C  CB    . LEU A 1 344  ? -64.424 -24.994 -34.602 1.00 66.02  ? 344  LEU A CB    1 
ATOM   2410  C  CG    . LEU A 1 344  ? -64.355 -26.513 -34.494 1.00 66.84  ? 344  LEU A CG    1 
ATOM   2411  C  CD1   . LEU A 1 344  ? -65.629 -27.048 -33.854 1.00 68.28  ? 344  LEU A CD1   1 
ATOM   2412  C  CD2   . LEU A 1 344  ? -64.076 -27.199 -35.835 1.00 66.37  ? 344  LEU A CD2   1 
ATOM   2413  N  N     . ALA A 1 345  ? -61.054 -24.877 -35.719 1.00 64.00  ? 345  ALA A N     1 
ATOM   2414  C  CA    . ALA A 1 345  ? -60.170 -25.145 -36.878 1.00 62.54  ? 345  ALA A CA    1 
ATOM   2415  C  C     . ALA A 1 345  ? -60.096 -23.914 -37.787 1.00 60.64  ? 345  ALA A C     1 
ATOM   2416  O  O     . ALA A 1 345  ? -59.987 -22.812 -37.274 1.00 63.16  ? 345  ALA A O     1 
ATOM   2417  C  CB    . ALA A 1 345  ? -60.630 -26.397 -37.631 1.00 62.73  ? 345  ALA A CB    1 
ATOM   2418  N  N     . GLY A 1 346  ? -60.140 -24.094 -39.105 1.00 58.64  ? 346  GLY A N     1 
ATOM   2419  C  CA    . GLY A 1 346  ? -60.345 -23.000 -40.049 1.00 57.31  ? 346  GLY A CA    1 
ATOM   2420  C  C     . GLY A 1 346  ? -61.448 -23.362 -41.032 1.00 57.19  ? 346  GLY A C     1 
ATOM   2421  O  O     . GLY A 1 346  ? -62.179 -24.332 -40.830 1.00 57.70  ? 346  GLY A O     1 
ATOM   2422  N  N     . SER A 1 347  ? -61.537 -22.593 -42.115 1.00 56.40  ? 347  SER A N     1 
ATOM   2423  C  CA    . SER A 1 347  ? -62.644 -22.680 -43.073 1.00 56.17  ? 347  SER A CA    1 
ATOM   2424  C  C     . SER A 1 347  ? -62.708 -24.006 -43.840 1.00 55.11  ? 347  SER A C     1 
ATOM   2425  O  O     . SER A 1 347  ? -63.798 -24.519 -44.106 1.00 56.02  ? 347  SER A O     1 
ATOM   2426  C  CB    . SER A 1 347  ? -62.554 -21.518 -44.061 1.00 56.25  ? 347  SER A CB    1 
ATOM   2427  O  OG    . SER A 1 347  ? -63.792 -21.281 -44.698 1.00 57.25  ? 347  SER A OG    1 
ATOM   2428  N  N     . GLN A 1 348  ? -61.541 -24.571 -44.144 1.00 53.51  ? 348  GLN A N     1 
ATOM   2429  C  CA    . GLN A 1 348  ? -61.428 -25.794 -44.950 1.00 52.88  ? 348  GLN A CA    1 
ATOM   2430  C  C     . GLN A 1 348  ? -61.936 -27.013 -44.182 1.00 53.21  ? 348  GLN A C     1 
ATOM   2431  O  O     . GLN A 1 348  ? -62.755 -27.786 -44.685 1.00 54.17  ? 348  GLN A O     1 
ATOM   2432  C  CB    . GLN A 1 348  ? -59.971 -26.052 -45.363 1.00 51.93  ? 348  GLN A CB    1 
ATOM   2433  C  CG    . GLN A 1 348  ? -59.289 -24.949 -46.167 1.00 51.28  ? 348  GLN A CG    1 
ATOM   2434  C  CD    . GLN A 1 348  ? -58.634 -23.892 -45.295 1.00 50.87  ? 348  GLN A CD    1 
ATOM   2435  O  OE1   . GLN A 1 348  ? -59.155 -23.538 -44.239 1.00 52.15  ? 348  GLN A OE1   1 
ATOM   2436  N  NE2   . GLN A 1 348  ? -57.497 -23.384 -45.732 1.00 50.05  ? 348  GLN A NE2   1 
ATOM   2437  N  N     . ILE A 1 349  ? -61.450 -27.169 -42.956 1.00 52.86  ? 349  ILE A N     1 
ATOM   2438  C  CA    . ILE A 1 349  ? -61.873 -28.262 -42.089 1.00 53.63  ? 349  ILE A CA    1 
ATOM   2439  C  C     . ILE A 1 349  ? -63.345 -28.139 -41.695 1.00 55.31  ? 349  ILE A C     1 
ATOM   2440  O  O     . ILE A 1 349  ? -64.055 -29.144 -41.665 1.00 56.71  ? 349  ILE A O     1 
ATOM   2441  C  CB    . ILE A 1 349  ? -60.973 -28.357 -40.839 1.00 53.50  ? 349  ILE A CB    1 
ATOM   2442  C  CG1   . ILE A 1 349  ? -59.551 -28.774 -41.247 1.00 52.32  ? 349  ILE A CG1   1 
ATOM   2443  C  CG2   . ILE A 1 349  ? -61.545 -29.307 -39.787 1.00 54.20  ? 349  ILE A CG2   1 
ATOM   2444  C  CD1   . ILE A 1 349  ? -59.422 -30.149 -41.866 1.00 52.43  ? 349  ILE A CD1   1 
ATOM   2445  N  N     . ARG A 1 350  ? -63.816 -26.931 -41.401 1.00 56.01  ? 350  ARG A N     1 
ATOM   2446  C  CA    . ARG A 1 350  ? -65.249 -26.743 -41.113 1.00 57.55  ? 350  ARG A CA    1 
ATOM   2447  C  C     . ARG A 1 350  ? -66.135 -27.170 -42.290 1.00 58.10  ? 350  ARG A C     1 
ATOM   2448  O  O     . ARG A 1 350  ? -67.194 -27.745 -42.078 1.00 59.18  ? 350  ARG A O     1 
ATOM   2449  C  CB    . ARG A 1 350  ? -65.567 -25.294 -40.745 1.00 57.48  ? 350  ARG A CB    1 
ATOM   2450  C  CG    . ARG A 1 350  ? -65.135 -24.897 -39.352 1.00 57.44  ? 350  ARG A CG    1 
ATOM   2451  C  CD    . ARG A 1 350  ? -65.751 -23.559 -38.959 1.00 58.46  ? 350  ARG A CD    1 
ATOM   2452  N  NE    . ARG A 1 350  ? -65.234 -22.429 -39.741 1.00 57.11  ? 350  ARG A NE    1 
ATOM   2453  C  CZ    . ARG A 1 350  ? -64.119 -21.742 -39.472 1.00 55.47  ? 350  ARG A CZ    1 
ATOM   2454  N  NH1   . ARG A 1 350  ? -63.335 -22.038 -38.434 1.00 54.31  ? 350  ARG A NH1   1 
ATOM   2455  N  NH2   . ARG A 1 350  ? -63.776 -20.735 -40.266 1.00 55.31  ? 350  ARG A NH2   1 
ATOM   2456  N  N     . ASN A 1 351  ? -65.699 -26.882 -43.516 1.00 57.73  ? 351  ASN A N     1 
ATOM   2457  C  CA    . ASN A 1 351  ? -66.457 -27.258 -44.710 1.00 58.43  ? 351  ASN A CA    1 
ATOM   2458  C  C     . ASN A 1 351  ? -66.370 -28.727 -45.066 1.00 59.19  ? 351  ASN A C     1 
ATOM   2459  O  O     . ASN A 1 351  ? -67.195 -29.211 -45.831 1.00 61.12  ? 351  ASN A O     1 
ATOM   2460  C  CB    . ASN A 1 351  ? -66.024 -26.429 -45.915 1.00 57.57  ? 351  ASN A CB    1 
ATOM   2461  C  CG    . ASN A 1 351  ? -66.725 -25.102 -45.974 1.00 57.92  ? 351  ASN A CG    1 
ATOM   2462  O  OD1   . ASN A 1 351  ? -67.864 -25.009 -46.436 1.00 58.55  ? 351  ASN A OD1   1 
ATOM   2463  N  ND2   . ASN A 1 351  ? -66.053 -24.063 -45.508 1.00 57.47  ? 351  ASN A ND2   1 
ATOM   2464  N  N     . MET A 1 352  ? -65.362 -29.420 -44.548 1.00 59.58  ? 352  MET A N     1 
ATOM   2465  C  CA    . MET A 1 352  ? -65.225 -30.871 -44.728 1.00 60.16  ? 352  MET A CA    1 
ATOM   2466  C  C     . MET A 1 352  ? -65.896 -31.656 -43.611 1.00 59.63  ? 352  MET A C     1 
ATOM   2467  O  O     . MET A 1 352  ? -66.624 -32.608 -43.876 1.00 60.42  ? 352  MET A O     1 
ATOM   2468  C  CB    . MET A 1 352  ? -63.745 -31.251 -44.780 1.00 61.21  ? 352  MET A CB    1 
ATOM   2469  C  CG    . MET A 1 352  ? -63.016 -30.693 -45.990 1.00 61.60  ? 352  MET A CG    1 
ATOM   2470  S  SD    . MET A 1 352  ? -61.230 -30.771 -45.797 1.00 62.68  ? 352  MET A SD    1 
ATOM   2471  C  CE    . MET A 1 352  ? -60.951 -32.519 -46.102 1.00 61.41  ? 352  MET A CE    1 
ATOM   2472  N  N     . ALA A 1 353  ? -65.642 -31.246 -42.369 1.00 59.15  ? 353  ALA A N     1 
ATOM   2473  C  CA    . ALA A 1 353  ? -66.108 -31.967 -41.179 1.00 59.65  ? 353  ALA A CA    1 
ATOM   2474  C  C     . ALA A 1 353  ? -67.628 -31.939 -41.022 1.00 60.47  ? 353  ALA A C     1 
ATOM   2475  O  O     . ALA A 1 353  ? -68.247 -30.888 -41.176 1.00 60.91  ? 353  ALA A O     1 
ATOM   2476  C  CB    . ALA A 1 353  ? -65.460 -31.393 -39.933 1.00 59.53  ? 353  ALA A CB    1 
ATOM   2477  N  N     . SER A 1 354  ? -68.209 -33.099 -40.708 1.00 60.41  ? 354  SER A N     1 
ATOM   2478  C  CA    . SER A 1 354  ? -69.644 -33.232 -40.480 1.00 61.03  ? 354  SER A CA    1 
ATOM   2479  C  C     . SER A 1 354  ? -69.971 -33.162 -39.001 1.00 62.14  ? 354  SER A C     1 
ATOM   2480  O  O     . SER A 1 354  ? -69.096 -33.369 -38.145 1.00 61.53  ? 354  SER A O     1 
ATOM   2481  C  CB    . SER A 1 354  ? -70.177 -34.544 -41.056 1.00 60.87  ? 354  SER A CB    1 
ATOM   2482  O  OG    . SER A 1 354  ? -69.763 -35.650 -40.286 1.00 60.66  ? 354  SER A OG    1 
ATOM   2483  N  N     . LEU A 1 355  ? -71.244 -32.880 -38.724 1.00 62.82  ? 355  LEU A N     1 
ATOM   2484  C  CA    . LEU A 1 355  ? -71.740 -32.767 -37.364 1.00 63.98  ? 355  LEU A CA    1 
ATOM   2485  C  C     . LEU A 1 355  ? -71.792 -34.127 -36.689 1.00 64.64  ? 355  LEU A C     1 
ATOM   2486  O  O     . LEU A 1 355  ? -71.407 -34.251 -35.528 1.00 65.92  ? 355  LEU A O     1 
ATOM   2487  C  CB    . LEU A 1 355  ? -73.138 -32.142 -37.357 1.00 65.81  ? 355  LEU A CB    1 
ATOM   2488  C  CG    . LEU A 1 355  ? -73.777 -31.847 -35.994 1.00 67.04  ? 355  LEU A CG    1 
ATOM   2489  C  CD1   . LEU A 1 355  ? -73.015 -30.771 -35.237 1.00 66.15  ? 355  LEU A CD1   1 
ATOM   2490  C  CD2   . LEU A 1 355  ? -75.222 -31.432 -36.194 1.00 69.01  ? 355  LEU A CD2   1 
ATOM   2491  N  N     . GLY A 1 356  ? -72.293 -35.131 -37.408 1.00 64.29  ? 356  GLY A N     1 
ATOM   2492  C  CA    . GLY A 1 356  ? -72.309 -36.510 -36.925 1.00 64.75  ? 356  GLY A CA    1 
ATOM   2493  C  C     . GLY A 1 356  ? -70.910 -37.055 -36.667 1.00 63.80  ? 356  GLY A C     1 
ATOM   2494  O  O     . GLY A 1 356  ? -70.674 -37.729 -35.662 1.00 63.83  ? 356  GLY A O     1 
ATOM   2495  N  N     . GLY A 1 357  ? -69.983 -36.762 -37.579 1.00 62.60  ? 357  GLY A N     1 
ATOM   2496  C  CA    . GLY A 1 357  ? -68.574 -37.099 -37.392 1.00 61.62  ? 357  GLY A CA    1 
ATOM   2497  C  C     . GLY A 1 357  ? -68.035 -36.517 -36.103 1.00 61.88  ? 357  GLY A C     1 
ATOM   2498  O  O     . GLY A 1 357  ? -67.413 -37.215 -35.311 1.00 61.65  ? 357  GLY A O     1 
ATOM   2499  N  N     . HIS A 1 358  ? -68.300 -35.237 -35.882 1.00 62.45  ? 358  HIS A N     1 
ATOM   2500  C  CA    . HIS A 1 358  ? -67.833 -34.567 -34.679 1.00 63.30  ? 358  HIS A CA    1 
ATOM   2501  C  C     . HIS A 1 358  ? -68.313 -35.265 -33.408 1.00 65.07  ? 358  HIS A C     1 
ATOM   2502  O  O     . HIS A 1 358  ? -67.519 -35.582 -32.520 1.00 65.74  ? 358  HIS A O     1 
ATOM   2503  C  CB    . HIS A 1 358  ? -68.299 -33.118 -34.652 1.00 63.45  ? 358  HIS A CB    1 
ATOM   2504  C  CG    . HIS A 1 358  ? -67.670 -32.329 -33.560 1.00 63.51  ? 358  HIS A CG    1 
ATOM   2505  N  ND1   . HIS A 1 358  ? -66.633 -31.456 -33.781 1.00 63.59  ? 358  HIS A ND1   1 
ATOM   2506  C  CD2   . HIS A 1 358  ? -67.892 -32.325 -32.227 1.00 64.64  ? 358  HIS A CD2   1 
ATOM   2507  C  CE1   . HIS A 1 358  ? -66.258 -30.926 -32.632 1.00 63.88  ? 358  HIS A CE1   1 
ATOM   2508  N  NE2   . HIS A 1 358  ? -67.007 -31.438 -31.673 1.00 64.52  ? 358  HIS A NE2   1 
ATOM   2509  N  N     . ILE A 1 359  ? -69.617 -35.496 -33.341 1.00 66.73  ? 359  ILE A N     1 
ATOM   2510  C  CA    . ILE A 1 359  ? -70.251 -36.094 -32.171 1.00 68.26  ? 359  ILE A CA    1 
ATOM   2511  C  C     . ILE A 1 359  ? -69.751 -37.518 -31.926 1.00 68.33  ? 359  ILE A C     1 
ATOM   2512  O  O     . ILE A 1 359  ? -69.452 -37.867 -30.794 1.00 69.34  ? 359  ILE A O     1 
ATOM   2513  C  CB    . ILE A 1 359  ? -71.791 -36.093 -32.309 1.00 69.91  ? 359  ILE A CB    1 
ATOM   2514  C  CG1   . ILE A 1 359  ? -72.336 -34.656 -32.294 1.00 70.07  ? 359  ILE A CG1   1 
ATOM   2515  C  CG2   . ILE A 1 359  ? -72.441 -36.899 -31.189 1.00 71.99  ? 359  ILE A CG2   1 
ATOM   2516  C  CD1   . ILE A 1 359  ? -73.800 -34.545 -32.675 1.00 71.15  ? 359  ILE A CD1   1 
ATOM   2517  N  N     . ILE A 1 360  ? -69.658 -38.328 -32.978 1.00 67.91  ? 360  ILE A N     1 
ATOM   2518  C  CA    . ILE A 1 360  ? -69.270 -39.739 -32.839 1.00 68.71  ? 360  ILE A CA    1 
ATOM   2519  C  C     . ILE A 1 360  ? -67.771 -39.904 -32.548 1.00 68.36  ? 360  ILE A C     1 
ATOM   2520  O  O     . ILE A 1 360  ? -67.387 -40.818 -31.810 1.00 68.86  ? 360  ILE A O     1 
ATOM   2521  C  CB    . ILE A 1 360  ? -69.684 -40.571 -34.082 1.00 68.79  ? 360  ILE A CB    1 
ATOM   2522  C  CG1   . ILE A 1 360  ? -71.209 -40.562 -34.281 1.00 70.23  ? 360  ILE A CG1   1 
ATOM   2523  C  CG2   . ILE A 1 360  ? -69.194 -42.016 -33.984 1.00 69.23  ? 360  ILE A CG2   1 
ATOM   2524  C  CD1   . ILE A 1 360  ? -72.019 -41.327 -33.249 1.00 72.03  ? 360  ILE A CD1   1 
ATOM   2525  N  N     . SER A 1 361  ? -66.940 -39.033 -33.131 1.00 67.97  ? 361  SER A N     1 
ATOM   2526  C  CA    . SER A 1 361  ? -65.491 -38.993 -32.871 1.00 66.93  ? 361  SER A CA    1 
ATOM   2527  C  C     . SER A 1 361  ? -65.165 -38.988 -31.385 1.00 68.00  ? 361  SER A C     1 
ATOM   2528  O  O     . SER A 1 361  ? -64.289 -39.722 -30.929 1.00 68.49  ? 361  SER A O     1 
ATOM   2529  C  CB    . SER A 1 361  ? -64.876 -37.743 -33.487 1.00 66.01  ? 361  SER A CB    1 
ATOM   2530  O  OG    . SER A 1 361  ? -65.142 -37.662 -34.867 1.00 65.95  ? 361  SER A OG    1 
ATOM   2531  N  N     . ARG A 1 362  ? -65.879 -38.145 -30.643 1.00 68.62  ? 362  ARG A N     1 
ATOM   2532  C  CA    . ARG A 1 362  ? -65.719 -38.025 -29.202 1.00 69.45  ? 362  ARG A CA    1 
ATOM   2533  C  C     . ARG A 1 362  ? -64.287 -37.705 -28.794 1.00 68.15  ? 362  ARG A C     1 
ATOM   2534  O  O     . ARG A 1 362  ? -63.719 -38.351 -27.911 1.00 67.37  ? 362  ARG A O     1 
ATOM   2535  C  CB    . ARG A 1 362  ? -66.256 -39.278 -28.500 1.00 71.19  ? 362  ARG A CB    1 
ATOM   2536  C  CG    . ARG A 1 362  ? -67.709 -39.131 -28.112 1.00 73.30  ? 362  ARG A CG    1 
ATOM   2537  C  CD    . ARG A 1 362  ? -68.365 -40.469 -27.827 1.00 75.46  ? 362  ARG A CD    1 
ATOM   2538  N  NE    . ARG A 1 362  ? -68.642 -41.260 -29.030 1.00 74.62  ? 362  ARG A NE    1 
ATOM   2539  C  CZ    . ARG A 1 362  ? -69.415 -42.345 -29.063 1.00 75.70  ? 362  ARG A CZ    1 
ATOM   2540  N  NH1   . ARG A 1 362  ? -70.004 -42.817 -27.962 1.00 77.13  ? 362  ARG A NH1   1 
ATOM   2541  N  NH2   . ARG A 1 362  ? -69.599 -42.973 -30.213 1.00 76.10  ? 362  ARG A NH2   1 
ATOM   2542  N  N     . HIS A 1 363  ? -63.717 -36.692 -29.445 1.00 67.99  ? 363  HIS A N     1 
ATOM   2543  C  CA    . HIS A 1 363  ? -62.391 -36.184 -29.077 1.00 68.79  ? 363  HIS A CA    1 
ATOM   2544  C  C     . HIS A 1 363  ? -62.486 -35.513 -27.701 1.00 69.94  ? 363  HIS A C     1 
ATOM   2545  O  O     . HIS A 1 363  ? -63.431 -34.761 -27.462 1.00 70.08  ? 363  HIS A O     1 
ATOM   2546  C  CB    . HIS A 1 363  ? -61.892 -35.158 -30.096 1.00 68.30  ? 363  HIS A CB    1 
ATOM   2547  C  CG    . HIS A 1 363  ? -61.665 -35.714 -31.464 1.00 69.36  ? 363  HIS A CG    1 
ATOM   2548  N  ND1   . HIS A 1 363  ? -61.482 -34.911 -32.569 1.00 70.05  ? 363  HIS A ND1   1 
ATOM   2549  C  CD2   . HIS A 1 363  ? -61.589 -36.990 -31.910 1.00 70.21  ? 363  HIS A CD2   1 
ATOM   2550  C  CE1   . HIS A 1 363  ? -61.297 -35.665 -33.637 1.00 68.83  ? 363  HIS A CE1   1 
ATOM   2551  N  NE2   . HIS A 1 363  ? -61.355 -36.931 -33.264 1.00 70.01  ? 363  HIS A NE2   1 
ATOM   2552  N  N     . PRO A 1 364  ? -61.516 -35.765 -26.795 1.00 70.24  ? 364  PRO A N     1 
ATOM   2553  C  CA    . PRO A 1 364  ? -61.594 -35.150 -25.451 1.00 71.40  ? 364  PRO A CA    1 
ATOM   2554  C  C     . PRO A 1 364  ? -61.577 -33.610 -25.462 1.00 71.54  ? 364  PRO A C     1 
ATOM   2555  O  O     . PRO A 1 364  ? -62.180 -32.978 -24.578 1.00 72.16  ? 364  PRO A O     1 
ATOM   2556  C  CB    . PRO A 1 364  ? -60.354 -35.701 -24.734 1.00 71.40  ? 364  PRO A CB    1 
ATOM   2557  C  CG    . PRO A 1 364  ? -59.424 -36.129 -25.819 1.00 69.85  ? 364  PRO A CG    1 
ATOM   2558  C  CD    . PRO A 1 364  ? -60.279 -36.547 -26.977 1.00 69.32  ? 364  PRO A CD    1 
ATOM   2559  N  N     . ASP A 1 365  ? -60.895 -33.044 -26.463 1.00 70.46  ? 365  ASP A N     1 
ATOM   2560  C  CA    . ASP A 1 365  ? -60.779 -31.587 -26.689 1.00 70.30  ? 365  ASP A CA    1 
ATOM   2561  C  C     . ASP A 1 365  ? -61.867 -30.989 -27.598 1.00 69.22  ? 365  ASP A C     1 
ATOM   2562  O  O     . ASP A 1 365  ? -61.840 -29.785 -27.867 1.00 70.61  ? 365  ASP A O     1 
ATOM   2563  C  CB    . ASP A 1 365  ? -59.385 -31.239 -27.258 1.00 70.00  ? 365  ASP A CB    1 
ATOM   2564  C  CG    . ASP A 1 365  ? -58.996 -32.109 -28.459 1.00 70.93  ? 365  ASP A CG    1 
ATOM   2565  O  OD1   . ASP A 1 365  ? -59.527 -33.235 -28.560 1.00 71.89  ? 365  ASP A OD1   1 
ATOM   2566  O  OD2   . ASP A 1 365  ? -58.148 -31.697 -29.287 1.00 72.08  ? 365  ASP A OD2   1 
ATOM   2567  N  N     . SER A 1 366  ? -62.806 -31.814 -28.070 1.00 67.72  ? 366  SER A N     1 
ATOM   2568  C  CA    . SER A 1 366  ? -63.991 -31.350 -28.811 1.00 67.14  ? 366  SER A CA    1 
ATOM   2569  C  C     . SER A 1 366  ? -64.623 -30.077 -28.225 1.00 67.62  ? 366  SER A C     1 
ATOM   2570  O  O     . SER A 1 366  ? -64.914 -30.027 -27.030 1.00 70.41  ? 366  SER A O     1 
ATOM   2571  C  CB    . SER A 1 366  ? -65.045 -32.459 -28.827 1.00 67.61  ? 366  SER A CB    1 
ATOM   2572  O  OG    . SER A 1 366  ? -66.304 -31.975 -29.254 1.00 67.90  ? 366  SER A OG    1 
ATOM   2573  N  N     . ASP A 1 367  ? -64.838 -29.071 -29.068 1.00 66.03  ? 367  ASP A N     1 
ATOM   2574  C  CA    . ASP A 1 367  ? -65.406 -27.781 -28.652 1.00 66.70  ? 367  ASP A CA    1 
ATOM   2575  C  C     . ASP A 1 367  ? -66.932 -27.727 -28.612 1.00 67.94  ? 367  ASP A C     1 
ATOM   2576  O  O     . ASP A 1 367  ? -67.503 -26.818 -28.007 1.00 69.09  ? 367  ASP A O     1 
ATOM   2577  C  CB    . ASP A 1 367  ? -64.922 -26.665 -29.580 1.00 65.60  ? 367  ASP A CB    1 
ATOM   2578  C  CG    . ASP A 1 367  ? -63.515 -26.236 -29.287 1.00 65.58  ? 367  ASP A CG    1 
ATOM   2579  O  OD1   . ASP A 1 367  ? -63.168 -26.076 -28.097 1.00 67.64  ? 367  ASP A OD1   1 
ATOM   2580  O  OD2   . ASP A 1 367  ? -62.753 -26.013 -30.246 1.00 64.12  ? 367  ASP A OD2   1 
ATOM   2581  N  N     . LEU A 1 368  ? -67.584 -28.671 -29.277 1.00 67.26  ? 368  LEU A N     1 
ATOM   2582  C  CA    . LEU A 1 368  ? -69.030 -28.667 -29.405 1.00 68.67  ? 368  LEU A CA    1 
ATOM   2583  C  C     . LEU A 1 368  ? -69.718 -29.673 -28.490 1.00 70.22  ? 368  LEU A C     1 
ATOM   2584  O  O     . LEU A 1 368  ? -70.836 -29.429 -28.049 1.00 71.46  ? 368  LEU A O     1 
ATOM   2585  C  CB    . LEU A 1 368  ? -69.410 -28.945 -30.853 1.00 68.21  ? 368  LEU A CB    1 
ATOM   2586  C  CG    . LEU A 1 368  ? -68.699 -28.096 -31.909 1.00 67.34  ? 368  LEU A CG    1 
ATOM   2587  C  CD1   . LEU A 1 368  ? -69.130 -28.533 -33.307 1.00 66.77  ? 368  LEU A CD1   1 
ATOM   2588  C  CD2   . LEU A 1 368  ? -68.941 -26.604 -31.684 1.00 67.80  ? 368  LEU A CD2   1 
ATOM   2589  N  N     . ASN A 1 369  ? -69.066 -30.805 -28.220 1.00 70.28  ? 369  ASN A N     1 
ATOM   2590  C  CA    . ASN A 1 369  ? -69.640 -31.847 -27.356 1.00 70.73  ? 369  ASN A CA    1 
ATOM   2591  C  C     . ASN A 1 369  ? -69.932 -31.419 -25.920 1.00 71.56  ? 369  ASN A C     1 
ATOM   2592  O  O     . ASN A 1 369  ? -70.991 -31.779 -25.402 1.00 72.98  ? 369  ASN A O     1 
ATOM   2593  C  CB    . ASN A 1 369  ? -68.766 -33.108 -27.349 1.00 69.63  ? 369  ASN A CB    1 
ATOM   2594  C  CG    . ASN A 1 369  ? -68.772 -33.833 -28.683 1.00 68.71  ? 369  ASN A CG    1 
ATOM   2595  O  OD1   . ASN A 1 369  ? -69.661 -33.632 -29.522 1.00 67.57  ? 369  ASN A OD1   1 
ATOM   2596  N  ND2   . ASN A 1 369  ? -67.767 -34.689 -28.888 1.00 68.11  ? 369  ASN A ND2   1 
ATOM   2597  N  N     . PRO A 1 370  ? -69.011 -30.658 -25.271 1.00 70.74  ? 370  PRO A N     1 
ATOM   2598  C  CA    . PRO A 1 370  ? -69.345 -30.184 -23.923 1.00 71.18  ? 370  PRO A CA    1 
ATOM   2599  C  C     . PRO A 1 370  ? -70.533 -29.241 -23.901 1.00 71.33  ? 370  PRO A C     1 
ATOM   2600  O  O     . PRO A 1 370  ? -71.248 -29.210 -22.912 1.00 72.60  ? 370  PRO A O     1 
ATOM   2601  C  CB    . PRO A 1 370  ? -68.071 -29.469 -23.458 1.00 70.64  ? 370  PRO A CB    1 
ATOM   2602  C  CG    . PRO A 1 370  ? -67.326 -29.150 -24.696 1.00 69.51  ? 370  PRO A CG    1 
ATOM   2603  C  CD    . PRO A 1 370  ? -67.634 -30.275 -25.641 1.00 69.32  ? 370  PRO A CD    1 
ATOM   2604  N  N     . ILE A 1 371  ? -70.748 -28.496 -24.982 1.00 70.35  ? 371  ILE A N     1 
ATOM   2605  C  CA    . ILE A 1 371  ? -71.907 -27.615 -25.079 1.00 72.11  ? 371  ILE A CA    1 
ATOM   2606  C  C     . ILE A 1 371  ? -73.176 -28.422 -25.351 1.00 72.81  ? 371  ILE A C     1 
ATOM   2607  O  O     . ILE A 1 371  ? -74.199 -28.185 -24.720 1.00 75.25  ? 371  ILE A O     1 
ATOM   2608  C  CB    . ILE A 1 371  ? -71.738 -26.525 -26.154 1.00 71.53  ? 371  ILE A CB    1 
ATOM   2609  C  CG1   . ILE A 1 371  ? -70.525 -25.646 -25.829 1.00 71.28  ? 371  ILE A CG1   1 
ATOM   2610  C  CG2   . ILE A 1 371  ? -72.998 -25.660 -26.239 1.00 72.66  ? 371  ILE A CG2   1 
ATOM   2611  C  CD1   . ILE A 1 371  ? -70.044 -24.814 -26.997 1.00 70.26  ? 371  ILE A CD1   1 
ATOM   2612  N  N     . LEU A 1 372  ? -73.117 -29.359 -26.290 1.00 71.73  ? 372  LEU A N     1 
ATOM   2613  C  CA    . LEU A 1 372  ? -74.261 -30.235 -26.567 1.00 72.55  ? 372  LEU A CA    1 
ATOM   2614  C  C     . LEU A 1 372  ? -74.625 -31.062 -25.333 1.00 74.01  ? 372  LEU A C     1 
ATOM   2615  O  O     . LEU A 1 372  ? -75.809 -31.283 -25.059 1.00 75.13  ? 372  LEU A O     1 
ATOM   2616  C  CB    . LEU A 1 372  ? -73.972 -31.165 -27.751 1.00 71.38  ? 372  LEU A CB    1 
ATOM   2617  C  CG    . LEU A 1 372  ? -73.800 -30.503 -29.124 1.00 70.09  ? 372  LEU A CG    1 
ATOM   2618  C  CD1   . LEU A 1 372  ? -73.001 -31.400 -30.055 1.00 69.13  ? 372  LEU A CD1   1 
ATOM   2619  C  CD2   . LEU A 1 372  ? -75.135 -30.142 -29.755 1.00 70.61  ? 372  LEU A CD2   1 
ATOM   2620  N  N     . ALA A 1 373  ? -73.601 -31.483 -24.585 1.00 73.83  ? 373  ALA A N     1 
ATOM   2621  C  CA    . ALA A 1 373  ? -73.775 -32.306 -23.388 1.00 75.41  ? 373  ALA A CA    1 
ATOM   2622  C  C     . ALA A 1 373  ? -74.712 -31.670 -22.386 1.00 77.31  ? 373  ALA A C     1 
ATOM   2623  O  O     . ALA A 1 373  ? -75.594 -32.340 -21.865 1.00 79.05  ? 373  ALA A O     1 
ATOM   2624  C  CB    . ALA A 1 373  ? -72.431 -32.587 -22.729 1.00 75.07  ? 373  ALA A CB    1 
ATOM   2625  N  N     . VAL A 1 374  ? -74.520 -30.376 -22.137 1.00 77.76  ? 374  VAL A N     1 
ATOM   2626  C  CA    . VAL A 1 374  ? -75.319 -29.635 -21.148 1.00 79.77  ? 374  VAL A CA    1 
ATOM   2627  C  C     . VAL A 1 374  ? -76.739 -29.229 -21.594 1.00 81.52  ? 374  VAL A C     1 
ATOM   2628  O  O     . VAL A 1 374  ? -77.539 -28.809 -20.750 1.00 83.15  ? 374  VAL A O     1 
ATOM   2629  C  CB    . VAL A 1 374  ? -74.577 -28.364 -20.643 1.00 78.91  ? 374  VAL A CB    1 
ATOM   2630  C  CG1   . VAL A 1 374  ? -73.240 -28.737 -20.019 1.00 78.23  ? 374  VAL A CG1   1 
ATOM   2631  C  CG2   . VAL A 1 374  ? -74.396 -27.322 -21.743 1.00 77.40  ? 374  VAL A CG2   1 
ATOM   2632  N  N     . GLY A 1 375  ? -77.049 -29.353 -22.891 1.00 81.52  ? 375  GLY A N     1 
ATOM   2633  C  CA    . GLY A 1 375  ? -78.253 -28.747 -23.486 1.00 82.71  ? 375  GLY A CA    1 
ATOM   2634  C  C     . GLY A 1 375  ? -79.457 -29.629 -23.771 1.00 84.20  ? 375  GLY A C     1 
ATOM   2635  O  O     . GLY A 1 375  ? -80.300 -29.253 -24.588 1.00 85.06  ? 375  GLY A O     1 
ATOM   2636  N  N     . ASN A 1 376  ? -79.552 -30.774 -23.090 1.00 85.44  ? 376  ASN A N     1 
ATOM   2637  C  CA    . ASN A 1 376  ? -80.623 -31.757 -23.303 1.00 87.07  ? 376  ASN A CA    1 
ATOM   2638  C  C     . ASN A 1 376  ? -80.765 -32.164 -24.766 1.00 86.85  ? 376  ASN A C     1 
ATOM   2639  O  O     . ASN A 1 376  ? -81.865 -32.163 -25.311 1.00 87.49  ? 376  ASN A O     1 
ATOM   2640  C  CB    . ASN A 1 376  ? -81.974 -31.233 -22.777 1.00 88.81  ? 376  ASN A CB    1 
ATOM   2641  C  CG    . ASN A 1 376  ? -81.948 -30.885 -21.297 1.00 89.92  ? 376  ASN A CG    1 
ATOM   2642  O  OD1   . ASN A 1 376  ? -82.459 -29.839 -20.890 1.00 90.71  ? 376  ASN A OD1   1 
ATOM   2643  N  ND2   . ASN A 1 376  ? -81.370 -31.765 -20.483 1.00 89.74  ? 376  ASN A ND2   1 
ATOM   2644  N  N     . CYS A 1 377  ? -79.647 -32.489 -25.407 1.00 87.03  ? 377  CYS A N     1 
ATOM   2645  C  CA    . CYS A 1 377  ? -79.659 -32.874 -26.826 1.00 87.19  ? 377  CYS A CA    1 
ATOM   2646  C  C     . CYS A 1 377  ? -79.852 -34.363 -26.987 1.00 86.31  ? 377  CYS A C     1 
ATOM   2647  O  O     . CYS A 1 377  ? -79.330 -35.151 -26.201 1.00 86.40  ? 377  CYS A O     1 
ATOM   2648  C  CB    . CYS A 1 377  ? -78.375 -32.447 -27.517 1.00 86.53  ? 377  CYS A CB    1 
ATOM   2649  S  SG    . CYS A 1 377  ? -78.223 -30.655 -27.545 1.00 89.71  ? 377  CYS A SG    1 
ATOM   2650  N  N     . THR A 1 378  ? -80.610 -34.740 -28.009 1.00 85.82  ? 378  THR A N     1 
ATOM   2651  C  CA    . THR A 1 378  ? -80.897 -36.145 -28.282 1.00 85.74  ? 378  THR A CA    1 
ATOM   2652  C  C     . THR A 1 378  ? -80.486 -36.491 -29.711 1.00 83.28  ? 378  THR A C     1 
ATOM   2653  O  O     . THR A 1 378  ? -80.416 -35.622 -30.582 1.00 82.11  ? 378  THR A O     1 
ATOM   2654  C  CB    . THR A 1 378  ? -82.379 -36.507 -28.001 1.00 87.51  ? 378  THR A CB    1 
ATOM   2655  O  OG1   . THR A 1 378  ? -83.252 -35.728 -28.823 1.00 88.22  ? 378  THR A OG1   1 
ATOM   2656  C  CG2   . THR A 1 378  ? -82.727 -36.259 -26.540 1.00 88.28  ? 378  THR A CG2   1 
ATOM   2657  N  N     . LEU A 1 379  ? -80.188 -37.770 -29.913 1.00 82.26  ? 379  LEU A N     1 
ATOM   2658  C  CA    . LEU A 1 379  ? -79.664 -38.281 -31.162 1.00 80.39  ? 379  LEU A CA    1 
ATOM   2659  C  C     . LEU A 1 379  ? -80.717 -39.157 -31.796 1.00 81.50  ? 379  LEU A C     1 
ATOM   2660  O  O     . LEU A 1 379  ? -81.317 -39.991 -31.128 1.00 82.57  ? 379  LEU A O     1 
ATOM   2661  C  CB    . LEU A 1 379  ? -78.408 -39.109 -30.900 1.00 79.42  ? 379  LEU A CB    1 
ATOM   2662  C  CG    . LEU A 1 379  ? -77.294 -38.432 -30.097 1.00 78.69  ? 379  LEU A CG    1 
ATOM   2663  C  CD1   . LEU A 1 379  ? -76.125 -39.387 -29.949 1.00 77.68  ? 379  LEU A CD1   1 
ATOM   2664  C  CD2   . LEU A 1 379  ? -76.842 -37.132 -30.752 1.00 77.57  ? 379  LEU A CD2   1 
ATOM   2665  N  N     . ASN A 1 380  ? -80.942 -38.953 -33.087 1.00 81.61  ? 380  ASN A N     1 
ATOM   2666  C  CA    . ASN A 1 380  ? -81.875 -39.762 -33.854 1.00 82.81  ? 380  ASN A CA    1 
ATOM   2667  C  C     . ASN A 1 380  ? -81.090 -40.866 -34.550 1.00 82.61  ? 380  ASN A C     1 
ATOM   2668  O  O     . ASN A 1 380  ? -80.428 -40.630 -35.566 1.00 81.46  ? 380  ASN A O     1 
ATOM   2669  C  CB    . ASN A 1 380  ? -82.643 -38.887 -34.849 1.00 82.77  ? 380  ASN A CB    1 
ATOM   2670  C  CG    . ASN A 1 380  ? -83.641 -37.968 -34.162 1.00 83.49  ? 380  ASN A CG    1 
ATOM   2671  O  OD1   . ASN A 1 380  ? -84.569 -38.428 -33.491 1.00 84.55  ? 380  ASN A OD1   1 
ATOM   2672  N  ND2   . ASN A 1 380  ? -83.452 -36.665 -34.323 1.00 82.27  ? 380  ASN A ND2   1 
ATOM   2673  N  N     . LEU A 1 381  ? -81.137 -42.058 -33.956 1.00 83.52  ? 381  LEU A N     1 
ATOM   2674  C  CA    . LEU A 1 381  ? -80.442 -43.231 -34.475 1.00 82.82  ? 381  LEU A CA    1 
ATOM   2675  C  C     . LEU A 1 381  ? -81.356 -43.966 -35.432 1.00 84.35  ? 381  LEU A C     1 
ATOM   2676  O  O     . LEU A 1 381  ? -82.581 -43.878 -35.326 1.00 85.59  ? 381  LEU A O     1 
ATOM   2677  C  CB    . LEU A 1 381  ? -80.026 -44.172 -33.342 1.00 83.16  ? 381  LEU A CB    1 
ATOM   2678  C  CG    . LEU A 1 381  ? -78.748 -43.850 -32.562 1.00 82.19  ? 381  LEU A CG    1 
ATOM   2679  C  CD1   . LEU A 1 381  ? -78.434 -42.364 -32.458 1.00 81.25  ? 381  LEU A CD1   1 
ATOM   2680  C  CD2   . LEU A 1 381  ? -78.834 -44.480 -31.180 1.00 83.52  ? 381  LEU A CD2   1 
ATOM   2681  N  N     . LEU A 1 382  ? -80.751 -44.690 -36.365 1.00 83.94  ? 382  LEU A N     1 
ATOM   2682  C  CA    . LEU A 1 382  ? -81.501 -45.489 -37.318 1.00 85.48  ? 382  LEU A CA    1 
ATOM   2683  C  C     . LEU A 1 382  ? -80.708 -46.733 -37.679 1.00 86.27  ? 382  LEU A C     1 
ATOM   2684  O  O     . LEU A 1 382  ? -79.539 -46.646 -38.035 1.00 84.18  ? 382  LEU A O     1 
ATOM   2685  C  CB    . LEU A 1 382  ? -81.826 -44.666 -38.563 1.00 84.60  ? 382  LEU A CB    1 
ATOM   2686  C  CG    . LEU A 1 382  ? -82.821 -45.267 -39.563 1.00 85.92  ? 382  LEU A CG    1 
ATOM   2687  C  CD1   . LEU A 1 382  ? -84.203 -45.454 -38.949 1.00 87.48  ? 382  LEU A CD1   1 
ATOM   2688  C  CD2   . LEU A 1 382  ? -82.899 -44.390 -40.804 1.00 85.44  ? 382  LEU A CD2   1 
ATOM   2689  N  N     . SER A 1 383  ? -81.366 -47.885 -37.560 1.00 90.41  ? 383  SER A N     1 
ATOM   2690  C  CA    . SER A 1 383  ? -80.806 -49.191 -37.895 1.00 91.35  ? 383  SER A CA    1 
ATOM   2691  C  C     . SER A 1 383  ? -81.656 -49.807 -38.995 1.00 93.47  ? 383  SER A C     1 
ATOM   2692  O  O     . SER A 1 383  ? -82.676 -49.251 -39.406 1.00 94.65  ? 383  SER A O     1 
ATOM   2693  C  CB    . SER A 1 383  ? -80.817 -50.091 -36.647 1.00 92.77  ? 383  SER A CB    1 
ATOM   2694  O  OG    . SER A 1 383  ? -80.708 -51.471 -36.955 1.00 93.00  ? 383  SER A OG    1 
ATOM   2695  N  N     . LYS A 1 384  ? -81.233 -50.974 -39.458 1.00 94.97  ? 384  LYS A N     1 
ATOM   2696  C  CA    . LYS A 1 384  ? -82.045 -51.784 -40.352 1.00 96.64  ? 384  LYS A CA    1 
ATOM   2697  C  C     . LYS A 1 384  ? -83.288 -52.292 -39.607 1.00 98.55  ? 384  LYS A C     1 
ATOM   2698  O  O     . LYS A 1 384  ? -84.343 -52.472 -40.211 1.00 98.13  ? 384  LYS A O     1 
ATOM   2699  C  CB    . LYS A 1 384  ? -81.223 -52.949 -40.904 1.00 97.89  ? 384  LYS A CB    1 
ATOM   2700  C  CG    . LYS A 1 384  ? -81.727 -53.447 -42.236 1.00 100.23 ? 384  LYS A CG    1 
ATOM   2701  C  CD    . LYS A 1 384  ? -80.858 -54.559 -42.788 1.00 101.28 ? 384  LYS A CD    1 
ATOM   2702  C  CE    . LYS A 1 384  ? -81.605 -55.306 -43.883 1.00 104.03 ? 384  LYS A CE    1 
ATOM   2703  N  NZ    . LYS A 1 384  ? -80.845 -56.471 -44.409 1.00 105.23 ? 384  LYS A NZ    1 
ATOM   2704  N  N     . GLU A 1 385  ? -83.148 -52.480 -38.291 1.00 99.29  ? 385  GLU A N     1 
ATOM   2705  C  CA    . GLU A 1 385  ? -84.223 -52.964 -37.416 1.00 100.81 ? 385  GLU A CA    1 
ATOM   2706  C  C     . GLU A 1 385  ? -85.231 -51.851 -37.070 1.00 100.31 ? 385  GLU A C     1 
ATOM   2707  O  O     . GLU A 1 385  ? -86.425 -52.120 -36.932 1.00 102.24 ? 385  GLU A O     1 
ATOM   2708  C  CB    . GLU A 1 385  ? -83.648 -53.582 -36.123 1.00 102.00 ? 385  GLU A CB    1 
ATOM   2709  C  CG    . GLU A 1 385  ? -82.490 -54.581 -36.298 1.00 102.66 ? 385  GLU A CG    1 
ATOM   2710  C  CD    . GLU A 1 385  ? -82.817 -55.788 -37.185 1.00 104.35 ? 385  GLU A CD    1 
ATOM   2711  O  OE1   . GLU A 1 385  ? -83.937 -56.336 -37.067 1.00 106.88 ? 385  GLU A OE1   1 
ATOM   2712  O  OE2   . GLU A 1 385  ? -81.944 -56.206 -37.990 1.00 102.76 ? 385  GLU A OE2   1 
ATOM   2713  N  N     . GLY A 1 386  ? -84.762 -50.613 -36.924 1.00 97.99  ? 386  GLY A N     1 
ATOM   2714  C  CA    . GLY A 1 386  ? -85.667 -49.479 -36.729 1.00 96.73  ? 386  GLY A CA    1 
ATOM   2715  C  C     . GLY A 1 386  ? -85.066 -48.131 -36.350 1.00 94.45  ? 386  GLY A C     1 
ATOM   2716  O  O     . GLY A 1 386  ? -83.842 -47.962 -36.246 1.00 91.93  ? 386  GLY A O     1 
ATOM   2717  N  N     . LYS A 1 387  ? -85.976 -47.172 -36.167 1.00 94.29  ? 387  LYS A N     1 
ATOM   2718  C  CA    . LYS A 1 387  ? -85.696 -45.852 -35.603 1.00 92.44  ? 387  LYS A CA    1 
ATOM   2719  C  C     . LYS A 1 387  ? -85.498 -46.015 -34.095 1.00 91.71  ? 387  LYS A C     1 
ATOM   2720  O  O     . LYS A 1 387  ? -86.019 -46.947 -33.499 1.00 94.07  ? 387  LYS A O     1 
ATOM   2721  C  CB    . LYS A 1 387  ? -86.864 -44.894 -35.926 1.00 93.59  ? 387  LYS A CB    1 
ATOM   2722  C  CG    . LYS A 1 387  ? -86.732 -43.456 -35.439 1.00 94.61  ? 387  LYS A CG    1 
ATOM   2723  C  CD    . LYS A 1 387  ? -85.566 -42.718 -36.108 1.00 94.31  ? 387  LYS A CD    1 
ATOM   2724  C  CE    . LYS A 1 387  ? -85.118 -41.425 -35.416 1.00 93.62  ? 387  LYS A CE    1 
ATOM   2725  N  NZ    . LYS A 1 387  ? -85.384 -41.288 -33.947 1.00 94.62  ? 387  LYS A NZ    1 
ATOM   2726  N  N     . ARG A 1 388  ? -84.727 -45.120 -33.491 1.00 90.12  ? 388  ARG A N     1 
ATOM   2727  C  CA    . ARG A 1 388  ? -84.399 -45.176 -32.055 1.00 89.86  ? 388  ARG A CA    1 
ATOM   2728  C  C     . ARG A 1 388  ? -83.739 -43.854 -31.632 1.00 87.99  ? 388  ARG A C     1 
ATOM   2729  O  O     . ARG A 1 388  ? -83.021 -43.234 -32.422 1.00 86.51  ? 388  ARG A O     1 
ATOM   2730  C  CB    . ARG A 1 388  ? -83.453 -46.347 -31.774 1.00 89.68  ? 388  ARG A CB    1 
ATOM   2731  C  CG    . ARG A 1 388  ? -83.124 -46.603 -30.310 1.00 90.33  ? 388  ARG A CG    1 
ATOM   2732  C  CD    . ARG A 1 388  ? -81.950 -47.561 -30.199 1.00 90.34  ? 388  ARG A CD    1 
ATOM   2733  N  NE    . ARG A 1 388  ? -81.216 -47.382 -28.948 1.00 91.18  ? 388  ARG A NE    1 
ATOM   2734  C  CZ    . ARG A 1 388  ? -79.932 -47.696 -28.747 1.00 90.98  ? 388  ARG A CZ    1 
ATOM   2735  N  NH1   . ARG A 1 388  ? -79.178 -48.217 -29.715 1.00 89.67  ? 388  ARG A NH1   1 
ATOM   2736  N  NH2   . ARG A 1 388  ? -79.383 -47.473 -27.553 1.00 92.04  ? 388  ARG A NH2   1 
ATOM   2737  N  N     . GLN A 1 389  ? -83.972 -43.441 -30.389 1.00 87.83  ? 389  GLN A N     1 
ATOM   2738  C  CA    . GLN A 1 389  ? -83.518 -42.142 -29.903 1.00 86.34  ? 389  GLN A CA    1 
ATOM   2739  C  C     . GLN A 1 389  ? -82.800 -42.262 -28.567 1.00 85.57  ? 389  GLN A C     1 
ATOM   2740  O  O     . GLN A 1 389  ? -83.352 -42.804 -27.622 1.00 87.15  ? 389  GLN A O     1 
ATOM   2741  C  CB    . GLN A 1 389  ? -84.708 -41.198 -29.779 1.00 87.63  ? 389  GLN A CB    1 
ATOM   2742  C  CG    . GLN A 1 389  ? -84.328 -39.729 -29.791 1.00 87.40  ? 389  GLN A CG    1 
ATOM   2743  C  CD    . GLN A 1 389  ? -85.510 -38.828 -29.487 1.00 89.60  ? 389  GLN A CD    1 
ATOM   2744  O  OE1   . GLN A 1 389  ? -86.613 -39.028 -29.998 1.00 90.69  ? 389  GLN A OE1   1 
ATOM   2745  N  NE2   . GLN A 1 389  ? -85.285 -37.830 -28.646 1.00 90.20  ? 389  GLN A NE2   1 
ATOM   2746  N  N     . ILE A 1 390  ? -81.573 -41.756 -28.490 1.00 83.81  ? 390  ILE A N     1 
ATOM   2747  C  CA    . ILE A 1 390  ? -80.818 -41.758 -27.239 1.00 84.02  ? 390  ILE A CA    1 
ATOM   2748  C  C     . ILE A 1 390  ? -80.388 -40.346 -26.869 1.00 83.53  ? 390  ILE A C     1 
ATOM   2749  O  O     . ILE A 1 390  ? -80.221 -39.503 -27.745 1.00 82.10  ? 390  ILE A O     1 
ATOM   2750  C  CB    . ILE A 1 390  ? -79.583 -42.688 -27.288 1.00 82.96  ? 390  ILE A CB    1 
ATOM   2751  C  CG1   . ILE A 1 390  ? -78.596 -42.259 -28.380 1.00 81.07  ? 390  ILE A CG1   1 
ATOM   2752  C  CG2   . ILE A 1 390  ? -80.028 -44.132 -27.484 1.00 84.24  ? 390  ILE A CG2   1 
ATOM   2753  C  CD1   . ILE A 1 390  ? -77.253 -42.964 -28.338 1.00 80.24  ? 390  ILE A CD1   1 
ATOM   2754  N  N     . PRO A 1 391  ? -80.217 -40.082 -25.564 1.00 85.01  ? 391  PRO A N     1 
ATOM   2755  C  CA    . PRO A 1 391  ? -79.740 -38.771 -25.126 1.00 84.69  ? 391  PRO A CA    1 
ATOM   2756  C  C     . PRO A 1 391  ? -78.230 -38.637 -25.270 1.00 83.09  ? 391  PRO A C     1 
ATOM   2757  O  O     . PRO A 1 391  ? -77.512 -39.622 -25.106 1.00 82.00  ? 391  PRO A O     1 
ATOM   2758  C  CB    . PRO A 1 391  ? -80.152 -38.728 -23.652 1.00 86.51  ? 391  PRO A CB    1 
ATOM   2759  C  CG    . PRO A 1 391  ? -80.161 -40.153 -23.221 1.00 87.11  ? 391  PRO A CG    1 
ATOM   2760  C  CD    . PRO A 1 391  ? -80.536 -40.965 -24.423 1.00 86.57  ? 391  PRO A CD    1 
ATOM   2761  N  N     . LEU A 1 392  ? -77.773 -37.421 -25.576 1.00 83.18  ? 392  LEU A N     1 
ATOM   2762  C  CA    . LEU A 1 392  ? -76.342 -37.096 -25.695 1.00 82.24  ? 392  LEU A CA    1 
ATOM   2763  C  C     . LEU A 1 392  ? -75.825 -36.609 -24.342 1.00 83.32  ? 392  LEU A C     1 
ATOM   2764  O  O     . LEU A 1 392  ? -75.887 -35.415 -24.023 1.00 82.46  ? 392  LEU A O     1 
ATOM   2765  C  CB    . LEU A 1 392  ? -76.111 -36.057 -26.802 1.00 81.14  ? 392  LEU A CB    1 
ATOM   2766  C  CG    . LEU A 1 392  ? -74.779 -35.309 -26.953 1.00 79.41  ? 392  LEU A CG    1 
ATOM   2767  C  CD1   . LEU A 1 392  ? -73.542 -36.182 -26.849 1.00 78.54  ? 392  LEU A CD1   1 
ATOM   2768  C  CD2   . LEU A 1 392  ? -74.793 -34.596 -28.293 1.00 78.52  ? 392  LEU A CD2   1 
ATOM   2769  N  N     . ASN A 1 393  ? -75.311 -37.562 -23.566 1.00 85.02  ? 393  ASN A N     1 
ATOM   2770  C  CA    . ASN A 1 393  ? -74.935 -37.359 -22.164 1.00 87.07  ? 393  ASN A CA    1 
ATOM   2771  C  C     . ASN A 1 393  ? -73.484 -37.785 -21.910 1.00 87.57  ? 393  ASN A C     1 
ATOM   2772  O  O     . ASN A 1 393  ? -72.763 -38.093 -22.854 1.00 86.62  ? 393  ASN A O     1 
ATOM   2773  C  CB    . ASN A 1 393  ? -75.928 -38.104 -21.251 1.00 88.56  ? 393  ASN A CB    1 
ATOM   2774  C  CG    . ASN A 1 393  ? -76.062 -39.580 -21.588 1.00 88.70  ? 393  ASN A CG    1 
ATOM   2775  O  OD1   . ASN A 1 393  ? -75.138 -40.207 -22.111 1.00 89.03  ? 393  ASN A OD1   1 
ATOM   2776  N  ND2   . ASN A 1 393  ? -77.220 -40.144 -21.290 1.00 89.54  ? 393  ASN A ND2   1 
ATOM   2777  N  N     . GLU A 1 394  ? -73.058 -37.781 -20.647 1.00 90.56  ? 394  GLU A N     1 
ATOM   2778  C  CA    . GLU A 1 394  ? -71.692 -38.157 -20.277 1.00 91.93  ? 394  GLU A CA    1 
ATOM   2779  C  C     . GLU A 1 394  ? -71.356 -39.582 -20.665 1.00 91.27  ? 394  GLU A C     1 
ATOM   2780  O  O     . GLU A 1 394  ? -70.286 -39.819 -21.222 1.00 91.86  ? 394  GLU A O     1 
ATOM   2781  C  CB    . GLU A 1 394  ? -71.478 -38.012 -18.773 1.00 95.61  ? 394  GLU A CB    1 
ATOM   2782  C  CG    . GLU A 1 394  ? -70.036 -38.225 -18.320 1.00 97.02  ? 394  GLU A CG    1 
ATOM   2783  C  CD    . GLU A 1 394  ? -69.929 -38.370 -16.817 1.00 100.07 ? 394  GLU A CD    1 
ATOM   2784  O  OE1   . GLU A 1 394  ? -70.627 -39.239 -16.259 1.00 100.87 ? 394  GLU A OE1   1 
ATOM   2785  O  OE2   . GLU A 1 394  ? -69.142 -37.624 -16.195 1.00 102.57 ? 394  GLU A OE2   1 
ATOM   2786  N  N     . GLN A 1 395  ? -72.249 -40.521 -20.339 1.00 91.25  ? 395  GLN A N     1 
ATOM   2787  C  CA    . GLN A 1 395  ? -72.039 -41.938 -20.659 1.00 90.47  ? 395  GLN A CA    1 
ATOM   2788  C  C     . GLN A 1 395  ? -71.764 -42.139 -22.140 1.00 88.29  ? 395  GLN A C     1 
ATOM   2789  O  O     . GLN A 1 395  ? -70.864 -42.904 -22.509 1.00 86.78  ? 395  GLN A O     1 
ATOM   2790  C  CB    . GLN A 1 395  ? -73.241 -42.805 -20.265 1.00 92.04  ? 395  GLN A CB    1 
ATOM   2791  C  CG    . GLN A 1 395  ? -73.354 -43.110 -18.784 1.00 93.62  ? 395  GLN A CG    1 
ATOM   2792  C  CD    . GLN A 1 395  ? -74.391 -42.258 -18.093 1.00 95.19  ? 395  GLN A CD    1 
ATOM   2793  O  OE1   . GLN A 1 395  ? -74.498 -41.058 -18.346 1.00 94.91  ? 395  GLN A OE1   1 
ATOM   2794  N  NE2   . GLN A 1 395  ? -75.168 -42.875 -17.216 1.00 97.23  ? 395  GLN A NE2   1 
ATOM   2795  N  N     . PHE A 1 396  ? -72.546 -41.449 -22.973 1.00 87.10  ? 396  PHE A N     1 
ATOM   2796  C  CA    . PHE A 1 396  ? -72.350 -41.471 -24.418 1.00 85.41  ? 396  PHE A CA    1 
ATOM   2797  C  C     . PHE A 1 396  ? -70.954 -40.963 -24.781 1.00 84.07  ? 396  PHE A C     1 
ATOM   2798  O  O     . PHE A 1 396  ? -70.247 -41.605 -25.557 1.00 82.49  ? 396  PHE A O     1 
ATOM   2799  C  CB    . PHE A 1 396  ? -73.423 -40.649 -25.138 1.00 84.86  ? 396  PHE A CB    1 
ATOM   2800  C  CG    . PHE A 1 396  ? -73.177 -40.499 -26.613 1.00 83.96  ? 396  PHE A CG    1 
ATOM   2801  C  CD1   . PHE A 1 396  ? -73.529 -41.509 -27.501 1.00 84.27  ? 396  PHE A CD1   1 
ATOM   2802  C  CD2   . PHE A 1 396  ? -72.566 -39.354 -27.118 1.00 82.62  ? 396  PHE A CD2   1 
ATOM   2803  C  CE1   . PHE A 1 396  ? -73.288 -41.375 -28.861 1.00 82.18  ? 396  PHE A CE1   1 
ATOM   2804  C  CE2   . PHE A 1 396  ? -72.325 -39.215 -28.474 1.00 80.77  ? 396  PHE A CE2   1 
ATOM   2805  C  CZ    . PHE A 1 396  ? -72.689 -40.226 -29.347 1.00 80.74  ? 396  PHE A CZ    1 
ATOM   2806  N  N     . LEU A 1 397  ? -70.561 -39.828 -24.203 1.00 84.43  ? 397  LEU A N     1 
ATOM   2807  C  CA    . LEU A 1 397  ? -69.236 -39.242 -24.452 1.00 83.74  ? 397  LEU A CA    1 
ATOM   2808  C  C     . LEU A 1 397  ? -68.091 -40.086 -23.855 1.00 84.56  ? 397  LEU A C     1 
ATOM   2809  O  O     . LEU A 1 397  ? -66.960 -40.015 -24.338 1.00 83.56  ? 397  LEU A O     1 
ATOM   2810  C  CB    . LEU A 1 397  ? -69.184 -37.780 -23.971 1.00 83.07  ? 397  LEU A CB    1 
ATOM   2811  C  CG    . LEU A 1 397  ? -70.170 -36.821 -24.672 1.00 82.27  ? 397  LEU A CG    1 
ATOM   2812  C  CD1   . LEU A 1 397  ? -70.274 -35.487 -23.951 1.00 82.22  ? 397  LEU A CD1   1 
ATOM   2813  C  CD2   . LEU A 1 397  ? -69.816 -36.598 -26.136 1.00 80.28  ? 397  LEU A CD2   1 
ATOM   2814  N  N     . SER A 1 398  ? -68.398 -40.888 -22.830 1.00 86.70  ? 398  SER A N     1 
ATOM   2815  C  CA    . SER A 1 398  ? -67.464 -41.878 -22.269 1.00 87.92  ? 398  SER A CA    1 
ATOM   2816  C  C     . SER A 1 398  ? -67.398 -43.218 -23.031 1.00 89.22  ? 398  SER A C     1 
ATOM   2817  O  O     . SER A 1 398  ? -66.566 -44.061 -22.701 1.00 89.06  ? 398  SER A O     1 
ATOM   2818  C  CB    . SER A 1 398  ? -67.829 -42.157 -20.814 1.00 89.59  ? 398  SER A CB    1 
ATOM   2819  O  OG    . SER A 1 398  ? -67.875 -40.954 -20.067 1.00 90.55  ? 398  SER A OG    1 
ATOM   2820  N  N     . LYS A 1 399  ? -68.262 -43.403 -24.035 1.00 90.73  ? 399  LYS A N     1 
ATOM   2821  C  CA    . LYS A 1 399  ? -68.352 -44.628 -24.845 1.00 92.42  ? 399  LYS A CA    1 
ATOM   2822  C  C     . LYS A 1 399  ? -68.726 -45.867 -24.036 1.00 96.40  ? 399  LYS A C     1 
ATOM   2823  O  O     . LYS A 1 399  ? -68.233 -46.970 -24.300 1.00 96.80  ? 399  LYS A O     1 
ATOM   2824  C  CB    . LYS A 1 399  ? -67.073 -44.866 -25.657 1.00 90.92  ? 399  LYS A CB    1 
ATOM   2825  C  CG    . LYS A 1 399  ? -66.777 -43.763 -26.651 1.00 89.81  ? 399  LYS A CG    1 
ATOM   2826  C  CD    . LYS A 1 399  ? -65.537 -44.066 -27.478 1.00 88.63  ? 399  LYS A CD    1 
ATOM   2827  C  CE    . LYS A 1 399  ? -65.587 -43.324 -28.799 1.00 87.66  ? 399  LYS A CE    1 
ATOM   2828  N  NZ    . LYS A 1 399  ? -64.261 -43.311 -29.462 1.00 87.15  ? 399  LYS A NZ    1 
ATOM   2829  N  N     . CYS A 1 400  ? -69.600 -45.678 -23.051 1.00 100.56 ? 400  CYS A N     1 
ATOM   2830  C  CA    . CYS A 1 400  ? -70.239 -46.794 -22.369 1.00 104.96 ? 400  CYS A CA    1 
ATOM   2831  C  C     . CYS A 1 400  ? -71.218 -47.411 -23.364 1.00 106.56 ? 400  CYS A C     1 
ATOM   2832  O  O     . CYS A 1 400  ? -72.092 -46.699 -23.877 1.00 108.17 ? 400  CYS A O     1 
ATOM   2833  C  CB    . CYS A 1 400  ? -70.995 -46.330 -21.123 1.00 106.74 ? 400  CYS A CB    1 
ATOM   2834  S  SG    . CYS A 1 400  ? -69.941 -45.644 -19.826 1.00 109.29 ? 400  CYS A SG    1 
ATOM   2835  N  N     . PRO A 1 401  ? -71.096 -48.731 -23.629 1.00 107.24 ? 401  PRO A N     1 
ATOM   2836  C  CA    . PRO A 1 401  ? -71.884 -49.341 -24.706 1.00 106.18 ? 401  PRO A CA    1 
ATOM   2837  C  C     . PRO A 1 401  ? -73.403 -49.304 -24.457 1.00 106.07 ? 401  PRO A C     1 
ATOM   2838  O  O     . PRO A 1 401  ? -74.176 -49.457 -25.401 1.00 106.69 ? 401  PRO A O     1 
ATOM   2839  C  CB    . PRO A 1 401  ? -71.356 -50.777 -24.748 1.00 106.69 ? 401  PRO A CB    1 
ATOM   2840  C  CG    . PRO A 1 401  ? -70.950 -51.057 -23.344 1.00 108.55 ? 401  PRO A CG    1 
ATOM   2841  C  CD    . PRO A 1 401  ? -70.443 -49.755 -22.788 1.00 108.27 ? 401  PRO A CD    1 
ATOM   2842  N  N     . ASN A 1 402  ? -73.811 -49.078 -23.209 1.00 105.04 ? 402  ASN A N     1 
ATOM   2843  C  CA    . ASN A 1 402  ? -75.219 -48.924 -22.860 1.00 105.36 ? 402  ASN A CA    1 
ATOM   2844  C  C     . ASN A 1 402  ? -75.807 -47.632 -23.436 1.00 103.26 ? 402  ASN A C     1 
ATOM   2845  O  O     . ASN A 1 402  ? -76.948 -47.625 -23.898 1.00 103.36 ? 402  ASN A O     1 
ATOM   2846  C  CB    . ASN A 1 402  ? -75.407 -48.958 -21.338 1.00 107.26 ? 402  ASN A CB    1 
ATOM   2847  C  CG    . ASN A 1 402  ? -75.023 -50.300 -20.728 1.00 108.95 ? 402  ASN A CG    1 
ATOM   2848  O  OD1   . ASN A 1 402  ? -75.887 -51.084 -20.326 1.00 109.37 ? 402  ASN A OD1   1 
ATOM   2849  N  ND2   . ASN A 1 402  ? -73.719 -50.572 -20.660 1.00 108.31 ? 402  ASN A ND2   1 
ATOM   2850  N  N     . ALA A 1 403  ? -75.021 -46.551 -23.407 1.00 100.22 ? 403  ALA A N     1 
ATOM   2851  C  CA    . ALA A 1 403  ? -75.433 -45.248 -23.953 1.00 98.02  ? 403  ALA A CA    1 
ATOM   2852  C  C     . ALA A 1 403  ? -74.915 -44.993 -25.369 1.00 95.69  ? 403  ALA A C     1 
ATOM   2853  O  O     . ALA A 1 403  ? -75.339 -44.034 -26.013 1.00 94.15  ? 403  ALA A O     1 
ATOM   2854  C  CB    . ALA A 1 403  ? -74.989 -44.125 -23.026 1.00 97.31  ? 403  ALA A CB    1 
ATOM   2855  N  N     . ASP A 1 404  ? -74.003 -45.841 -25.844 1.00 94.22  ? 404  ASP A N     1 
ATOM   2856  C  CA    . ASP A 1 404  ? -73.448 -45.728 -27.193 1.00 91.84  ? 404  ASP A CA    1 
ATOM   2857  C  C     . ASP A 1 404  ? -74.458 -46.228 -28.236 1.00 90.16  ? 404  ASP A C     1 
ATOM   2858  O  O     . ASP A 1 404  ? -75.473 -46.835 -27.895 1.00 90.57  ? 404  ASP A O     1 
ATOM   2859  C  CB    . ASP A 1 404  ? -72.139 -46.546 -27.281 1.00 91.90  ? 404  ASP A CB    1 
ATOM   2860  C  CG    . ASP A 1 404  ? -71.268 -46.187 -28.493 1.00 90.95  ? 404  ASP A CG    1 
ATOM   2861  O  OD1   . ASP A 1 404  ? -71.578 -45.223 -29.231 1.00 89.73  ? 404  ASP A OD1   1 
ATOM   2862  O  OD2   . ASP A 1 404  ? -70.251 -46.883 -28.708 1.00 92.00  ? 404  ASP A OD2   1 
ATOM   2863  N  N     . LEU A 1 405  ? -74.181 -45.926 -29.503 1.00 87.52  ? 405  LEU A N     1 
ATOM   2864  C  CA    . LEU A 1 405  ? -74.818 -46.599 -30.633 1.00 86.58  ? 405  LEU A CA    1 
ATOM   2865  C  C     . LEU A 1 405  ? -74.414 -48.059 -30.592 1.00 86.59  ? 405  LEU A C     1 
ATOM   2866  O  O     . LEU A 1 405  ? -73.288 -48.380 -30.222 1.00 86.22  ? 405  LEU A O     1 
ATOM   2867  C  CB    . LEU A 1 405  ? -74.339 -46.026 -31.975 1.00 84.70  ? 405  LEU A CB    1 
ATOM   2868  C  CG    . LEU A 1 405  ? -74.845 -44.691 -32.526 1.00 83.84  ? 405  LEU A CG    1 
ATOM   2869  C  CD1   . LEU A 1 405  ? -74.542 -43.519 -31.611 1.00 83.24  ? 405  LEU A CD1   1 
ATOM   2870  C  CD2   . LEU A 1 405  ? -74.235 -44.455 -33.901 1.00 81.95  ? 405  LEU A CD2   1 
ATOM   2871  N  N     . LYS A 1 406  ? -75.327 -48.942 -30.974 1.00 88.25  ? 406  LYS A N     1 
ATOM   2872  C  CA    . LYS A 1 406  ? -74.978 -50.352 -31.187 1.00 89.09  ? 406  LYS A CA    1 
ATOM   2873  C  C     . LYS A 1 406  ? -74.256 -50.444 -32.538 1.00 87.23  ? 406  LYS A C     1 
ATOM   2874  O  O     . LYS A 1 406  ? -74.481 -49.590 -33.403 1.00 86.57  ? 406  LYS A O     1 
ATOM   2875  C  CB    . LYS A 1 406  ? -76.198 -51.291 -31.100 1.00 91.68  ? 406  LYS A CB    1 
ATOM   2876  C  CG    . LYS A 1 406  ? -77.455 -50.835 -31.830 1.00 92.85  ? 406  LYS A CG    1 
ATOM   2877  C  CD    . LYS A 1 406  ? -78.544 -51.903 -31.911 1.00 95.19  ? 406  LYS A CD    1 
ATOM   2878  C  CE    . LYS A 1 406  ? -79.726 -51.607 -30.993 1.00 96.89  ? 406  LYS A CE    1 
ATOM   2879  N  NZ    . LYS A 1 406  ? -79.346 -51.623 -29.555 1.00 98.09  ? 406  LYS A NZ    1 
ATOM   2880  N  N     . PRO A 1 407  ? -73.378 -51.460 -32.727 1.00 86.29  ? 407  PRO A N     1 
ATOM   2881  C  CA    . PRO A 1 407  ? -72.477 -51.463 -33.901 1.00 83.91  ? 407  PRO A CA    1 
ATOM   2882  C  C     . PRO A 1 407  ? -73.140 -51.364 -35.292 1.00 82.96  ? 407  PRO A C     1 
ATOM   2883  O  O     . PRO A 1 407  ? -72.497 -50.887 -36.238 1.00 81.35  ? 407  PRO A O     1 
ATOM   2884  C  CB    . PRO A 1 407  ? -71.710 -52.791 -33.758 1.00 84.20  ? 407  PRO A CB    1 
ATOM   2885  C  CG    . PRO A 1 407  ? -71.832 -53.158 -32.318 1.00 85.72  ? 407  PRO A CG    1 
ATOM   2886  C  CD    . PRO A 1 407  ? -73.196 -52.680 -31.912 1.00 87.03  ? 407  PRO A CD    1 
ATOM   2887  N  N     . GLN A 1 408  ? -74.398 -51.795 -35.407 1.00 83.50  ? 408  GLN A N     1 
ATOM   2888  C  CA    . GLN A 1 408  ? -75.095 -51.841 -36.695 1.00 83.67  ? 408  GLN A CA    1 
ATOM   2889  C  C     . GLN A 1 408  ? -75.954 -50.607 -37.037 1.00 82.14  ? 408  GLN A C     1 
ATOM   2890  O  O     . GLN A 1 408  ? -76.703 -50.656 -38.010 1.00 81.79  ? 408  GLN A O     1 
ATOM   2891  C  CB    . GLN A 1 408  ? -75.919 -53.146 -36.818 1.00 86.68  ? 408  GLN A CB    1 
ATOM   2892  C  CG    . GLN A 1 408  ? -77.280 -53.208 -36.110 1.00 90.25  ? 408  GLN A CG    1 
ATOM   2893  C  CD    . GLN A 1 408  ? -77.208 -53.571 -34.626 1.00 92.86  ? 408  GLN A CD    1 
ATOM   2894  O  OE1   . GLN A 1 408  ? -76.230 -53.256 -33.942 1.00 93.63  ? 408  GLN A OE1   1 
ATOM   2895  N  NE2   . GLN A 1 408  ? -78.261 -54.222 -34.119 1.00 95.16  ? 408  GLN A NE2   1 
ATOM   2896  N  N     . GLU A 1 409  ? -75.847 -49.514 -36.274 1.00 81.15  ? 409  GLU A N     1 
ATOM   2897  C  CA    . GLU A 1 409  ? -76.680 -48.323 -36.526 1.00 80.89  ? 409  GLU A CA    1 
ATOM   2898  C  C     . GLU A 1 409  ? -75.886 -47.040 -36.751 1.00 77.82  ? 409  GLU A C     1 
ATOM   2899  O  O     . GLU A 1 409  ? -74.693 -46.968 -36.439 1.00 77.23  ? 409  GLU A O     1 
ATOM   2900  C  CB    . GLU A 1 409  ? -77.749 -48.154 -35.428 1.00 83.94  ? 409  GLU A CB    1 
ATOM   2901  C  CG    . GLU A 1 409  ? -77.312 -47.561 -34.091 1.00 84.58  ? 409  GLU A CG    1 
ATOM   2902  C  CD    . GLU A 1 409  ? -78.313 -47.834 -32.951 1.00 86.73  ? 409  GLU A CD    1 
ATOM   2903  O  OE1   . GLU A 1 409  ? -79.471 -48.244 -33.205 1.00 87.74  ? 409  GLU A OE1   1 
ATOM   2904  O  OE2   . GLU A 1 409  ? -77.934 -47.656 -31.773 1.00 86.54  ? 409  GLU A OE2   1 
ATOM   2905  N  N     . ILE A 1 410  ? -76.574 -46.048 -37.322 1.00 76.20  ? 410  ILE A N     1 
ATOM   2906  C  CA    . ILE A 1 410  ? -75.977 -44.772 -37.736 1.00 74.11  ? 410  ILE A CA    1 
ATOM   2907  C  C     . ILE A 1 410  ? -76.748 -43.570 -37.208 1.00 73.64  ? 410  ILE A C     1 
ATOM   2908  O  O     . ILE A 1 410  ? -77.961 -43.624 -37.038 1.00 74.41  ? 410  ILE A O     1 
ATOM   2909  C  CB    . ILE A 1 410  ? -75.858 -44.635 -39.278 1.00 73.43  ? 410  ILE A CB    1 
ATOM   2910  C  CG1   . ILE A 1 410  ? -77.225 -44.726 -39.987 1.00 74.63  ? 410  ILE A CG1   1 
ATOM   2911  C  CG2   . ILE A 1 410  ? -74.895 -45.672 -39.831 1.00 73.42  ? 410  ILE A CG2   1 
ATOM   2912  C  CD1   . ILE A 1 410  ? -77.820 -43.399 -40.406 1.00 74.52  ? 410  ILE A CD1   1 
ATOM   2913  N  N     . LEU A 1 411  ? -76.021 -42.481 -36.985 1.00 71.51  ? 411  LEU A N     1 
ATOM   2914  C  CA    . LEU A 1 411  ? -76.594 -41.226 -36.507 1.00 71.24  ? 411  LEU A CA    1 
ATOM   2915  C  C     . LEU A 1 411  ? -77.215 -40.451 -37.676 1.00 70.86  ? 411  LEU A C     1 
ATOM   2916  O  O     . LEU A 1 411  ? -76.522 -40.083 -38.611 1.00 70.15  ? 411  LEU A O     1 
ATOM   2917  C  CB    . LEU A 1 411  ? -75.498 -40.414 -35.815 1.00 69.78  ? 411  LEU A CB    1 
ATOM   2918  C  CG    . LEU A 1 411  ? -75.748 -38.970 -35.398 1.00 70.00  ? 411  LEU A CG    1 
ATOM   2919  C  CD1   . LEU A 1 411  ? -77.077 -38.811 -34.680 1.00 72.12  ? 411  LEU A CD1   1 
ATOM   2920  C  CD2   . LEU A 1 411  ? -74.591 -38.509 -34.524 1.00 69.16  ? 411  LEU A CD2   1 
ATOM   2921  N  N     . VAL A 1 412  ? -78.523 -40.218 -37.620 1.00 72.55  ? 412  VAL A N     1 
ATOM   2922  C  CA    . VAL A 1 412  ? -79.251 -39.518 -38.694 1.00 72.86  ? 412  VAL A CA    1 
ATOM   2923  C  C     . VAL A 1 412  ? -79.242 -38.008 -38.484 1.00 72.11  ? 412  VAL A C     1 
ATOM   2924  O  O     . VAL A 1 412  ? -78.983 -37.245 -39.414 1.00 70.11  ? 412  VAL A O     1 
ATOM   2925  C  CB    . VAL A 1 412  ? -80.726 -39.990 -38.787 1.00 74.54  ? 412  VAL A CB    1 
ATOM   2926  C  CG1   . VAL A 1 412  ? -81.467 -39.284 -39.922 1.00 74.57  ? 412  VAL A CG1   1 
ATOM   2927  C  CG2   . VAL A 1 412  ? -80.780 -41.494 -38.983 1.00 75.58  ? 412  VAL A CG2   1 
ATOM   2928  N  N     . SER A 1 413  ? -79.564 -37.596 -37.262 1.00 73.69  ? 413  SER A N     1 
ATOM   2929  C  CA    . SER A 1 413  ? -79.682 -36.183 -36.918 1.00 74.63  ? 413  SER A CA    1 
ATOM   2930  C  C     . SER A 1 413  ? -79.675 -35.981 -35.407 1.00 76.16  ? 413  SER A C     1 
ATOM   2931  O  O     . SER A 1 413  ? -79.949 -36.912 -34.647 1.00 76.62  ? 413  SER A O     1 
ATOM   2932  C  CB    . SER A 1 413  ? -80.980 -35.603 -37.497 1.00 75.87  ? 413  SER A CB    1 
ATOM   2933  O  OG    . SER A 1 413  ? -82.130 -36.196 -36.906 1.00 77.60  ? 413  SER A OG    1 
ATOM   2934  N  N     . VAL A 1 414  ? -79.386 -34.748 -34.994 1.00 77.02  ? 414  VAL A N     1 
ATOM   2935  C  CA    . VAL A 1 414  ? -79.384 -34.357 -33.574 1.00 78.78  ? 414  VAL A CA    1 
ATOM   2936  C  C     . VAL A 1 414  ? -80.433 -33.269 -33.341 1.00 80.14  ? 414  VAL A C     1 
ATOM   2937  O  O     . VAL A 1 414  ? -80.595 -32.378 -34.176 1.00 80.03  ? 414  VAL A O     1 
ATOM   2938  C  CB    . VAL A 1 414  ? -77.980 -33.889 -33.089 1.00 77.80  ? 414  VAL A CB    1 
ATOM   2939  C  CG1   . VAL A 1 414  ? -77.370 -32.845 -34.020 1.00 76.63  ? 414  VAL A CG1   1 
ATOM   2940  C  CG2   . VAL A 1 414  ? -78.026 -33.365 -31.652 1.00 78.69  ? 414  VAL A CG2   1 
ATOM   2941  N  N     . ASN A 1 415  ? -81.133 -33.357 -32.210 1.00 81.51  ? 415  ASN A N     1 
ATOM   2942  C  CA    . ASN A 1 415  ? -82.115 -32.352 -31.807 1.00 83.23  ? 415  ASN A CA    1 
ATOM   2943  C  C     . ASN A 1 415  ? -81.477 -31.435 -30.776 1.00 81.94  ? 415  ASN A C     1 
ATOM   2944  O  O     . ASN A 1 415  ? -81.030 -31.908 -29.729 1.00 81.50  ? 415  ASN A O     1 
ATOM   2945  C  CB    . ASN A 1 415  ? -83.358 -33.008 -31.191 1.00 86.14  ? 415  ASN A CB    1 
ATOM   2946  C  CG    . ASN A 1 415  ? -83.864 -34.190 -31.998 1.00 87.38  ? 415  ASN A CG    1 
ATOM   2947  O  OD1   . ASN A 1 415  ? -84.560 -34.022 -32.993 1.00 88.92  ? 415  ASN A OD1   1 
ATOM   2948  N  ND2   . ASN A 1 415  ? -83.528 -35.401 -31.554 1.00 88.04  ? 415  ASN A ND2   1 
ATOM   2949  N  N     . ILE A 1 416  ? -81.401 -30.141 -31.084 1.00 81.22  ? 416  ILE A N     1 
ATOM   2950  C  CA    . ILE A 1 416  ? -80.995 -29.129 -30.112 1.00 81.20  ? 416  ILE A CA    1 
ATOM   2951  C  C     . ILE A 1 416  ? -82.254 -28.319 -29.806 1.00 82.74  ? 416  ILE A C     1 
ATOM   2952  O  O     . ILE A 1 416  ? -82.761 -27.623 -30.685 1.00 83.39  ? 416  ILE A O     1 
ATOM   2953  C  CB    . ILE A 1 416  ? -79.865 -28.209 -30.643 1.00 79.69  ? 416  ILE A CB    1 
ATOM   2954  C  CG1   . ILE A 1 416  ? -78.648 -29.022 -31.093 1.00 78.22  ? 416  ILE A CG1   1 
ATOM   2955  C  CG2   . ILE A 1 416  ? -79.408 -27.233 -29.567 1.00 80.50  ? 416  ILE A CG2   1 
ATOM   2956  C  CD1   . ILE A 1 416  ? -78.512 -29.131 -32.594 1.00 77.66  ? 416  ILE A CD1   1 
ATOM   2957  N  N     . PRO A 1 417  ? -82.775 -28.415 -28.568 1.00 84.14  ? 417  PRO A N     1 
ATOM   2958  C  CA    . PRO A 1 417  ? -84.011 -27.707 -28.240 1.00 85.95  ? 417  PRO A CA    1 
ATOM   2959  C  C     . PRO A 1 417  ? -83.792 -26.213 -27.989 1.00 85.72  ? 417  PRO A C     1 
ATOM   2960  O  O     . PRO A 1 417  ? -82.673 -25.790 -27.679 1.00 84.44  ? 417  PRO A O     1 
ATOM   2961  C  CB    . PRO A 1 417  ? -84.469 -28.405 -26.962 1.00 87.01  ? 417  PRO A CB    1 
ATOM   2962  C  CG    . PRO A 1 417  ? -83.199 -28.795 -26.291 1.00 85.82  ? 417  PRO A CG    1 
ATOM   2963  C  CD    . PRO A 1 417  ? -82.222 -29.109 -27.389 1.00 84.36  ? 417  PRO A CD    1 
ATOM   2964  N  N     . TYR A 1 418  ? -84.863 -25.432 -28.131 1.00 87.03  ? 418  TYR A N     1 
ATOM   2965  C  CA    . TYR A 1 418  ? -84.848 -24.014 -27.771 1.00 87.69  ? 418  TYR A CA    1 
ATOM   2966  C  C     . TYR A 1 418  ? -84.663 -23.876 -26.273 1.00 87.68  ? 418  TYR A C     1 
ATOM   2967  O  O     . TYR A 1 418  ? -85.109 -24.725 -25.511 1.00 88.54  ? 418  TYR A O     1 
ATOM   2968  C  CB    . TYR A 1 418  ? -86.167 -23.322 -28.129 1.00 90.40  ? 418  TYR A CB    1 
ATOM   2969  C  CG    . TYR A 1 418  ? -86.532 -23.265 -29.597 1.00 91.41  ? 418  TYR A CG    1 
ATOM   2970  C  CD1   . TYR A 1 418  ? -85.563 -23.065 -30.583 1.00 90.62  ? 418  TYR A CD1   1 
ATOM   2971  C  CD2   . TYR A 1 418  ? -87.864 -23.361 -30.001 1.00 93.74  ? 418  TYR A CD2   1 
ATOM   2972  C  CE1   . TYR A 1 418  ? -85.909 -22.999 -31.931 1.00 91.12  ? 418  TYR A CE1   1 
ATOM   2973  C  CE2   . TYR A 1 418  ? -88.217 -23.292 -31.342 1.00 94.12  ? 418  TYR A CE2   1 
ATOM   2974  C  CZ    . TYR A 1 418  ? -87.243 -23.111 -32.301 1.00 92.69  ? 418  TYR A CZ    1 
ATOM   2975  O  OH    . TYR A 1 418  ? -87.619 -23.047 -33.620 1.00 93.37  ? 418  TYR A OH    1 
ATOM   2976  N  N     . SER A 1 419  ? -84.018 -22.799 -25.853 1.00 87.12  ? 419  SER A N     1 
ATOM   2977  C  CA    . SER A 1 419  ? -83.906 -22.485 -24.433 1.00 88.41  ? 419  SER A CA    1 
ATOM   2978  C  C     . SER A 1 419  ? -85.244 -21.955 -23.903 1.00 91.13  ? 419  SER A C     1 
ATOM   2979  O  O     . SER A 1 419  ? -85.985 -21.280 -24.618 1.00 92.47  ? 419  SER A O     1 
ATOM   2980  C  CB    . SER A 1 419  ? -82.783 -21.475 -24.192 1.00 87.64  ? 419  SER A CB    1 
ATOM   2981  O  OG    . SER A 1 419  ? -82.611 -20.625 -25.317 1.00 87.38  ? 419  SER A OG    1 
ATOM   2982  N  N     . ARG A 1 420  ? -85.564 -22.294 -22.660 1.00 91.97  ? 420  ARG A N     1 
ATOM   2983  C  CA    . ARG A 1 420  ? -86.718 -21.726 -21.987 1.00 94.00  ? 420  ARG A CA    1 
ATOM   2984  C  C     . ARG A 1 420  ? -86.319 -20.389 -21.376 1.00 94.65  ? 420  ARG A C     1 
ATOM   2985  O  O     . ARG A 1 420  ? -85.135 -20.106 -21.199 1.00 94.49  ? 420  ARG A O     1 
ATOM   2986  C  CB    . ARG A 1 420  ? -87.205 -22.669 -20.893 1.00 95.55  ? 420  ARG A CB    1 
ATOM   2987  C  CG    . ARG A 1 420  ? -87.669 -24.029 -21.403 1.00 95.41  ? 420  ARG A CG    1 
ATOM   2988  C  CD    . ARG A 1 420  ? -87.701 -25.048 -20.278 1.00 96.00  ? 420  ARG A CD    1 
ATOM   2989  N  NE    . ARG A 1 420  ? -86.357 -25.375 -19.795 1.00 94.67  ? 420  ARG A NE    1 
ATOM   2990  C  CZ    . ARG A 1 420  ? -86.082 -26.070 -18.689 1.00 95.27  ? 420  ARG A CZ    1 
ATOM   2991  N  NH1   . ARG A 1 420  ? -87.052 -26.537 -17.905 1.00 97.43  ? 420  ARG A NH1   1 
ATOM   2992  N  NH2   . ARG A 1 420  ? -84.815 -26.298 -18.354 1.00 94.07  ? 420  ARG A NH2   1 
ATOM   2993  N  N     . LYS A 1 421  ? -87.306 -19.562 -21.059 1.00 96.60  ? 421  LYS A N     1 
ATOM   2994  C  CA    . LYS A 1 421  ? -87.054 -18.315 -20.340 1.00 97.12  ? 421  LYS A CA    1 
ATOM   2995  C  C     . LYS A 1 421  ? -86.545 -18.604 -18.911 1.00 96.50  ? 421  LYS A C     1 
ATOM   2996  O  O     . LYS A 1 421  ? -87.046 -19.500 -18.232 1.00 96.41  ? 421  LYS A O     1 
ATOM   2997  C  CB    . LYS A 1 421  ? -88.308 -17.435 -20.341 1.00 100.13 ? 421  LYS A CB    1 
ATOM   2998  C  CG    . LYS A 1 421  ? -88.193 -16.157 -19.522 1.00 102.42 ? 421  LYS A CG    1 
ATOM   2999  C  CD    . LYS A 1 421  ? -89.004 -15.016 -20.116 1.00 104.16 ? 421  LYS A CD    1 
ATOM   3000  C  CE    . LYS A 1 421  ? -89.139 -13.864 -19.127 1.00 106.33 ? 421  LYS A CE    1 
ATOM   3001  N  NZ    . LYS A 1 421  ? -90.142 -12.847 -19.552 1.00 108.33 ? 421  LYS A NZ    1 
ATOM   3002  N  N     . TRP A 1 422  ? -85.543 -17.827 -18.494 1.00 95.12  ? 422  TRP A N     1 
ATOM   3003  C  CA    . TRP A 1 422  ? -84.718 -18.068 -17.296 1.00 94.46  ? 422  TRP A CA    1 
ATOM   3004  C  C     . TRP A 1 422  ? -83.765 -19.266 -17.430 1.00 92.29  ? 422  TRP A C     1 
ATOM   3005  O  O     . TRP A 1 422  ? -83.301 -19.822 -16.429 1.00 91.52  ? 422  TRP A O     1 
ATOM   3006  C  CB    . TRP A 1 422  ? -85.562 -18.167 -16.025 1.00 96.59  ? 422  TRP A CB    1 
ATOM   3007  C  CG    . TRP A 1 422  ? -86.477 -17.018 -15.835 1.00 98.05  ? 422  TRP A CG    1 
ATOM   3008  C  CD1   . TRP A 1 422  ? -87.815 -16.990 -16.080 1.00 99.37  ? 422  TRP A CD1   1 
ATOM   3009  C  CD2   . TRP A 1 422  ? -86.125 -15.718 -15.358 1.00 98.56  ? 422  TRP A CD2   1 
ATOM   3010  N  NE1   . TRP A 1 422  ? -88.327 -15.750 -15.781 1.00 100.79 ? 422  TRP A NE1   1 
ATOM   3011  C  CE2   . TRP A 1 422  ? -87.311 -14.947 -15.336 1.00 99.95  ? 422  TRP A CE2   1 
ATOM   3012  C  CE3   . TRP A 1 422  ? -84.926 -15.127 -14.942 1.00 97.32  ? 422  TRP A CE3   1 
ATOM   3013  C  CZ2   . TRP A 1 422  ? -87.334 -13.618 -14.916 1.00 100.02 ? 422  TRP A CZ2   1 
ATOM   3014  C  CZ3   . TRP A 1 422  ? -84.953 -13.799 -14.516 1.00 98.13  ? 422  TRP A CZ3   1 
ATOM   3015  C  CH2   . TRP A 1 422  ? -86.151 -13.061 -14.511 1.00 99.21  ? 422  TRP A CH2   1 
ATOM   3016  N  N     . GLU A 1 423  ? -83.458 -19.636 -18.670 1.00 90.50  ? 423  GLU A N     1 
ATOM   3017  C  CA    . GLU A 1 423  ? -82.437 -20.619 -18.948 1.00 89.45  ? 423  GLU A CA    1 
ATOM   3018  C  C     . GLU A 1 423  ? -81.320 -19.924 -19.712 1.00 87.02  ? 423  GLU A C     1 
ATOM   3019  O  O     . GLU A 1 423  ? -81.579 -19.173 -20.662 1.00 85.48  ? 423  GLU A O     1 
ATOM   3020  C  CB    . GLU A 1 423  ? -82.998 -21.781 -19.757 1.00 90.30  ? 423  GLU A CB    1 
ATOM   3021  C  CG    . GLU A 1 423  ? -82.087 -22.994 -19.777 1.00 90.20  ? 423  GLU A CG    1 
ATOM   3022  C  CD    . GLU A 1 423  ? -82.753 -24.212 -20.379 1.00 91.38  ? 423  GLU A CD    1 
ATOM   3023  O  OE1   . GLU A 1 423  ? -83.346 -24.101 -21.472 1.00 92.00  ? 423  GLU A OE1   1 
ATOM   3024  O  OE2   . GLU A 1 423  ? -82.689 -25.287 -19.749 1.00 92.40  ? 423  GLU A OE2   1 
ATOM   3025  N  N     . PHE A 1 424  ? -80.088 -20.186 -19.278 1.00 85.90  ? 424  PHE A N     1 
ATOM   3026  C  CA    . PHE A 1 424  ? -78.896 -19.502 -19.775 1.00 85.57  ? 424  PHE A CA    1 
ATOM   3027  C  C     . PHE A 1 424  ? -77.770 -20.505 -20.021 1.00 84.98  ? 424  PHE A C     1 
ATOM   3028  O  O     . PHE A 1 424  ? -77.585 -21.444 -19.248 1.00 86.53  ? 424  PHE A O     1 
ATOM   3029  C  CB    . PHE A 1 424  ? -78.454 -18.431 -18.777 1.00 85.82  ? 424  PHE A CB    1 
ATOM   3030  C  CG    . PHE A 1 424  ? -79.570 -17.522 -18.356 1.00 87.57  ? 424  PHE A CG    1 
ATOM   3031  C  CD1   . PHE A 1 424  ? -80.217 -16.729 -19.297 1.00 87.60  ? 424  PHE A CD1   1 
ATOM   3032  C  CD2   . PHE A 1 424  ? -80.016 -17.489 -17.033 1.00 88.90  ? 424  PHE A CD2   1 
ATOM   3033  C  CE1   . PHE A 1 424  ? -81.274 -15.910 -18.924 1.00 89.41  ? 424  PHE A CE1   1 
ATOM   3034  C  CE2   . PHE A 1 424  ? -81.063 -16.664 -16.660 1.00 90.21  ? 424  PHE A CE2   1 
ATOM   3035  C  CZ    . PHE A 1 424  ? -81.693 -15.874 -17.606 1.00 90.23  ? 424  PHE A CZ    1 
ATOM   3036  N  N     . VAL A 1 425  ? -77.013 -20.290 -21.089 1.00 83.30  ? 425  VAL A N     1 
ATOM   3037  C  CA    . VAL A 1 425  ? -76.019 -21.248 -21.544 1.00 82.71  ? 425  VAL A CA    1 
ATOM   3038  C  C     . VAL A 1 425  ? -74.771 -20.483 -21.951 1.00 81.55  ? 425  VAL A C     1 
ATOM   3039  O  O     . VAL A 1 425  ? -74.861 -19.466 -22.644 1.00 80.12  ? 425  VAL A O     1 
ATOM   3040  C  CB    . VAL A 1 425  ? -76.522 -22.095 -22.744 1.00 82.79  ? 425  VAL A CB    1 
ATOM   3041  C  CG1   . VAL A 1 425  ? -75.416 -23.023 -23.263 1.00 81.19  ? 425  VAL A CG1   1 
ATOM   3042  C  CG2   . VAL A 1 425  ? -77.757 -22.898 -22.358 1.00 83.94  ? 425  VAL A CG2   1 
ATOM   3043  N  N     . SER A 1 426  ? -73.615 -20.995 -21.534 1.00 81.74  ? 426  SER A N     1 
ATOM   3044  C  CA    . SER A 1 426  ? -72.345 -20.350 -21.820 1.00 81.75  ? 426  SER A CA    1 
ATOM   3045  C  C     . SER A 1 426  ? -71.233 -21.363 -22.096 1.00 79.85  ? 426  SER A C     1 
ATOM   3046  O  O     . SER A 1 426  ? -71.174 -22.426 -21.470 1.00 80.42  ? 426  SER A O     1 
ATOM   3047  C  CB    . SER A 1 426  ? -71.970 -19.441 -20.652 1.00 84.00  ? 426  SER A CB    1 
ATOM   3048  O  OG    . SER A 1 426  ? -71.359 -18.258 -21.125 1.00 85.06  ? 426  SER A OG    1 
ATOM   3049  N  N     . ALA A 1 427  ? -70.355 -21.014 -23.033 1.00 77.72  ? 427  ALA A N     1 
ATOM   3050  C  CA    . ALA A 1 427  ? -69.234 -21.869 -23.418 1.00 75.77  ? 427  ALA A CA    1 
ATOM   3051  C  C     . ALA A 1 427  ? -67.933 -21.089 -23.445 1.00 74.00  ? 427  ALA A C     1 
ATOM   3052  O  O     . ALA A 1 427  ? -67.889 -19.979 -23.965 1.00 73.60  ? 427  ALA A O     1 
ATOM   3053  C  CB    . ALA A 1 427  ? -69.491 -22.481 -24.777 1.00 75.12  ? 427  ALA A CB    1 
ATOM   3054  N  N     . PHE A 1 428  ? -66.877 -21.677 -22.893 1.00 73.24  ? 428  PHE A N     1 
ATOM   3055  C  CA    . PHE A 1 428  ? -65.569 -21.031 -22.841 1.00 72.71  ? 428  PHE A CA    1 
ATOM   3056  C  C     . PHE A 1 428  ? -64.496 -21.968 -23.369 1.00 70.81  ? 428  PHE A C     1 
ATOM   3057  O  O     . PHE A 1 428  ? -64.695 -23.169 -23.406 1.00 70.58  ? 428  PHE A O     1 
ATOM   3058  C  CB    . PHE A 1 428  ? -65.258 -20.629 -21.409 1.00 74.33  ? 428  PHE A CB    1 
ATOM   3059  C  CG    . PHE A 1 428  ? -66.318 -19.769 -20.781 1.00 76.35  ? 428  PHE A CG    1 
ATOM   3060  C  CD1   . PHE A 1 428  ? -66.375 -18.401 -21.049 1.00 76.41  ? 428  PHE A CD1   1 
ATOM   3061  C  CD2   . PHE A 1 428  ? -67.272 -20.325 -19.926 1.00 78.32  ? 428  PHE A CD2   1 
ATOM   3062  C  CE1   . PHE A 1 428  ? -67.357 -17.603 -20.470 1.00 77.75  ? 428  PHE A CE1   1 
ATOM   3063  C  CE2   . PHE A 1 428  ? -68.255 -19.531 -19.348 1.00 79.21  ? 428  PHE A CE2   1 
ATOM   3064  C  CZ    . PHE A 1 428  ? -68.296 -18.168 -19.622 1.00 79.17  ? 428  PHE A CZ    1 
ATOM   3065  N  N     . ARG A 1 429  ? -63.371 -21.409 -23.797 1.00 69.89  ? 429  ARG A N     1 
ATOM   3066  C  CA    . ARG A 1 429  ? -62.229 -22.217 -24.243 1.00 68.85  ? 429  ARG A CA    1 
ATOM   3067  C  C     . ARG A 1 429  ? -60.916 -21.457 -24.174 1.00 67.78  ? 429  ARG A C     1 
ATOM   3068  O  O     . ARG A 1 429  ? -60.886 -20.239 -24.343 1.00 67.28  ? 429  ARG A O     1 
ATOM   3069  C  CB    . ARG A 1 429  ? -62.439 -22.714 -25.678 1.00 68.25  ? 429  ARG A CB    1 
ATOM   3070  C  CG    . ARG A 1 429  ? -62.151 -21.693 -26.781 1.00 67.34  ? 429  ARG A CG    1 
ATOM   3071  C  CD    . ARG A 1 429  ? -62.702 -22.161 -28.113 1.00 67.10  ? 429  ARG A CD    1 
ATOM   3072  N  NE    . ARG A 1 429  ? -62.046 -23.390 -28.546 1.00 66.96  ? 429  ARG A NE    1 
ATOM   3073  C  CZ    . ARG A 1 429  ? -60.863 -23.453 -29.167 1.00 66.50  ? 429  ARG A CZ    1 
ATOM   3074  N  NH1   . ARG A 1 429  ? -60.163 -22.353 -29.441 1.00 66.16  ? 429  ARG A NH1   1 
ATOM   3075  N  NH2   . ARG A 1 429  ? -60.364 -24.639 -29.517 1.00 65.73  ? 429  ARG A NH2   1 
ATOM   3076  N  N     . GLN A 1 430  ? -59.831 -22.190 -23.956 1.00 67.37  ? 430  GLN A N     1 
ATOM   3077  C  CA    . GLN A 1 430  ? -58.499 -21.614 -24.028 1.00 67.56  ? 430  GLN A CA    1 
ATOM   3078  C  C     . GLN A 1 430  ? -57.553 -22.546 -24.755 1.00 67.68  ? 430  GLN A C     1 
ATOM   3079  O  O     . GLN A 1 430  ? -57.398 -23.706 -24.359 1.00 67.48  ? 430  GLN A O     1 
ATOM   3080  C  CB    . GLN A 1 430  ? -57.952 -21.311 -22.632 1.00 68.72  ? 430  GLN A CB    1 
ATOM   3081  C  CG    . GLN A 1 430  ? -56.665 -20.496 -22.632 1.00 68.45  ? 430  GLN A CG    1 
ATOM   3082  C  CD    . GLN A 1 430  ? -56.777 -19.223 -23.455 1.00 67.76  ? 430  GLN A CD    1 
ATOM   3083  O  OE1   . GLN A 1 430  ? -57.759 -18.492 -23.358 1.00 68.56  ? 430  GLN A OE1   1 
ATOM   3084  N  NE2   . GLN A 1 430  ? -55.784 -18.969 -24.285 1.00 67.24  ? 430  GLN A NE2   1 
ATOM   3085  N  N     . ALA A 1 431  ? -56.918 -22.018 -25.807 1.00 67.98  ? 431  ALA A N     1 
ATOM   3086  C  CA    . ALA A 1 431  ? -55.929 -22.744 -26.598 1.00 67.41  ? 431  ALA A CA    1 
ATOM   3087  C  C     . ALA A 1 431  ? -54.602 -21.971 -26.568 1.00 68.18  ? 431  ALA A C     1 
ATOM   3088  O  O     . ALA A 1 431  ? -54.409 -21.130 -25.689 1.00 69.59  ? 431  ALA A O     1 
ATOM   3089  C  CB    . ALA A 1 431  ? -56.450 -22.934 -28.014 1.00 66.65  ? 431  ALA A CB    1 
ATOM   3090  N  N     . GLN A 1 432  ? -53.689 -22.277 -27.497 1.00 68.28  ? 432  GLN A N     1 
ATOM   3091  C  CA    . GLN A 1 432  ? -52.366 -21.632 -27.584 1.00 68.03  ? 432  GLN A CA    1 
ATOM   3092  C  C     . GLN A 1 432  ? -52.419 -20.290 -28.310 1.00 68.67  ? 432  GLN A C     1 
ATOM   3093  O  O     . GLN A 1 432  ? -51.632 -19.383 -28.012 1.00 68.59  ? 432  GLN A O     1 
ATOM   3094  C  CB    . GLN A 1 432  ? -51.394 -22.551 -28.325 1.00 66.85  ? 432  GLN A CB    1 
ATOM   3095  C  CG    . GLN A 1 432  ? -49.927 -22.212 -28.120 1.00 66.02  ? 432  GLN A CG    1 
ATOM   3096  C  CD    . GLN A 1 432  ? -49.409 -22.650 -26.773 1.00 66.42  ? 432  GLN A CD    1 
ATOM   3097  O  OE1   . GLN A 1 432  ? -50.127 -23.274 -25.997 1.00 67.74  ? 432  GLN A OE1   1 
ATOM   3098  N  NE2   . GLN A 1 432  ? -48.148 -22.335 -26.490 1.00 65.70  ? 432  GLN A NE2   1 
ATOM   3099  N  N     . ARG A 1 433  ? -53.295 -20.215 -29.310 1.00 69.62  ? 433  ARG A N     1 
ATOM   3100  C  CA    . ARG A 1 433  ? -53.682 -18.967 -29.966 1.00 71.10  ? 433  ARG A CA    1 
ATOM   3101  C  C     . ARG A 1 433  ? -55.206 -18.997 -30.137 1.00 72.73  ? 433  ARG A C     1 
ATOM   3102  O  O     . ARG A 1 433  ? -55.841 -20.002 -29.812 1.00 71.86  ? 433  ARG A O     1 
ATOM   3103  C  CB    . ARG A 1 433  ? -52.950 -18.802 -31.304 1.00 70.73  ? 433  ARG A CB    1 
ATOM   3104  C  CG    . ARG A 1 433  ? -53.450 -19.705 -32.418 1.00 70.05  ? 433  ARG A CG    1 
ATOM   3105  C  CD    . ARG A 1 433  ? -52.459 -19.855 -33.561 1.00 69.16  ? 433  ARG A CD    1 
ATOM   3106  N  NE    . ARG A 1 433  ? -52.897 -20.953 -34.424 1.00 69.74  ? 433  ARG A NE    1 
ATOM   3107  C  CZ    . ARG A 1 433  ? -52.146 -21.607 -35.312 1.00 68.48  ? 433  ARG A CZ    1 
ATOM   3108  N  NH1   . ARG A 1 433  ? -50.874 -21.288 -35.504 1.00 68.53  ? 433  ARG A NH1   1 
ATOM   3109  N  NH2   . ARG A 1 433  ? -52.678 -22.610 -36.017 1.00 67.98  ? 433  ARG A NH2   1 
ATOM   3110  N  N     . GLN A 1 434  ? -55.786 -17.911 -30.645 1.00 75.38  ? 434  GLN A N     1 
ATOM   3111  C  CA    . GLN A 1 434  ? -57.250 -17.714 -30.575 1.00 77.64  ? 434  GLN A CA    1 
ATOM   3112  C  C     . GLN A 1 434  ? -58.069 -18.573 -31.540 1.00 77.39  ? 434  GLN A C     1 
ATOM   3113  O  O     . GLN A 1 434  ? -59.239 -18.845 -31.260 1.00 78.05  ? 434  GLN A O     1 
ATOM   3114  C  CB    . GLN A 1 434  ? -57.636 -16.223 -30.696 1.00 78.59  ? 434  GLN A CB    1 
ATOM   3115  C  CG    . GLN A 1 434  ? -57.652 -15.518 -29.339 1.00 81.56  ? 434  GLN A CG    1 
ATOM   3116  C  CD    . GLN A 1 434  ? -57.675 -13.991 -29.410 1.00 83.56  ? 434  GLN A CD    1 
ATOM   3117  O  OE1   . GLN A 1 434  ? -57.594 -13.391 -30.486 1.00 85.77  ? 434  GLN A OE1   1 
ATOM   3118  N  NE2   . GLN A 1 434  ? -57.777 -13.357 -28.250 1.00 83.04  ? 434  GLN A NE2   1 
ATOM   3119  N  N     . GLU A 1 435  ? -57.473 -18.998 -32.654 1.00 77.09  ? 435  GLU A N     1 
ATOM   3120  C  CA    . GLU A 1 435  ? -58.153 -19.903 -33.587 1.00 77.01  ? 435  GLU A CA    1 
ATOM   3121  C  C     . GLU A 1 435  ? -57.208 -20.879 -34.303 1.00 73.63  ? 435  GLU A C     1 
ATOM   3122  O  O     . GLU A 1 435  ? -55.983 -20.734 -34.271 1.00 71.22  ? 435  GLU A O     1 
ATOM   3123  C  CB    . GLU A 1 435  ? -58.990 -19.107 -34.594 1.00 80.58  ? 435  GLU A CB    1 
ATOM   3124  C  CG    . GLU A 1 435  ? -58.245 -18.007 -35.341 1.00 83.31  ? 435  GLU A CG    1 
ATOM   3125  C  CD    . GLU A 1 435  ? -59.065 -17.410 -36.486 1.00 87.38  ? 435  GLU A CD    1 
ATOM   3126  O  OE1   . GLU A 1 435  ? -60.320 -17.384 -36.393 1.00 90.83  ? 435  GLU A OE1   1 
ATOM   3127  O  OE2   . GLU A 1 435  ? -58.456 -16.960 -37.484 1.00 87.71  ? 435  GLU A OE2   1 
ATOM   3128  N  N     . ASN A 1 436  ? -57.810 -21.886 -34.927 1.00 70.48  ? 436  ASN A N     1 
ATOM   3129  C  CA    . ASN A 1 436  ? -57.083 -22.974 -35.550 1.00 68.66  ? 436  ASN A CA    1 
ATOM   3130  C  C     . ASN A 1 436  ? -56.049 -23.577 -34.586 1.00 68.11  ? 436  ASN A C     1 
ATOM   3131  O  O     . ASN A 1 436  ? -54.876 -23.758 -34.918 1.00 68.40  ? 436  ASN A O     1 
ATOM   3132  C  CB    . ASN A 1 436  ? -56.457 -22.500 -36.871 1.00 67.71  ? 436  ASN A CB    1 
ATOM   3133  C  CG    . ASN A 1 436  ? -56.119 -23.646 -37.825 1.00 65.55  ? 436  ASN A CG    1 
ATOM   3134  O  OD1   . ASN A 1 436  ? -56.400 -24.814 -37.563 1.00 65.29  ? 436  ASN A OD1   1 
ATOM   3135  N  ND2   . ASN A 1 436  ? -55.504 -23.304 -38.942 1.00 64.57  ? 436  ASN A ND2   1 
ATOM   3136  N  N     . ALA A 1 437  ? -56.516 -23.871 -33.379 1.00 68.34  ? 437  ALA A N     1 
ATOM   3137  C  CA    . ALA A 1 437  ? -55.713 -24.530 -32.354 1.00 67.46  ? 437  ALA A CA    1 
ATOM   3138  C  C     . ALA A 1 437  ? -56.639 -25.243 -31.378 1.00 67.28  ? 437  ALA A C     1 
ATOM   3139  O  O     . ALA A 1 437  ? -57.701 -24.739 -31.039 1.00 67.48  ? 437  ALA A O     1 
ATOM   3140  C  CB    . ALA A 1 437  ? -54.838 -23.522 -31.623 1.00 67.83  ? 437  ALA A CB    1 
ATOM   3141  N  N     . LEU A 1 438  ? -56.216 -26.416 -30.931 1.00 67.58  ? 438  LEU A N     1 
ATOM   3142  C  CA    . LEU A 1 438  ? -57.037 -27.272 -30.093 1.00 68.35  ? 438  LEU A CA    1 
ATOM   3143  C  C     . LEU A 1 438  ? -57.028 -26.771 -28.662 1.00 68.60  ? 438  LEU A C     1 
ATOM   3144  O  O     . LEU A 1 438  ? -56.029 -26.229 -28.191 1.00 68.64  ? 438  LEU A O     1 
ATOM   3145  C  CB    . LEU A 1 438  ? -56.543 -28.720 -30.171 1.00 69.25  ? 438  LEU A CB    1 
ATOM   3146  C  CG    . LEU A 1 438  ? -56.579 -29.338 -31.584 1.00 68.90  ? 438  LEU A CG    1 
ATOM   3147  C  CD1   . LEU A 1 438  ? -55.873 -30.687 -31.633 1.00 68.46  ? 438  LEU A CD1   1 
ATOM   3148  C  CD2   . LEU A 1 438  ? -58.014 -29.452 -32.098 1.00 69.86  ? 438  LEU A CD2   1 
ATOM   3149  N  N     . ALA A 1 439  ? -58.153 -26.962 -27.979 1.00 68.78  ? 439  ALA A N     1 
ATOM   3150  C  CA    . ALA A 1 439  ? -58.358 -26.405 -26.651 1.00 69.41  ? 439  ALA A CA    1 
ATOM   3151  C  C     . ALA A 1 439  ? -57.537 -27.144 -25.599 1.00 69.74  ? 439  ALA A C     1 
ATOM   3152  O  O     . ALA A 1 439  ? -57.427 -28.371 -25.628 1.00 70.78  ? 439  ALA A O     1 
ATOM   3153  C  CB    . ALA A 1 439  ? -59.838 -26.446 -26.289 1.00 70.73  ? 439  ALA A CB    1 
ATOM   3154  N  N     . ILE A 1 440  ? -56.960 -26.384 -24.674 1.00 69.96  ? 440  ILE A N     1 
ATOM   3155  C  CA    . ILE A 1 440  ? -56.273 -26.948 -23.517 1.00 70.03  ? 440  ILE A CA    1 
ATOM   3156  C  C     . ILE A 1 440  ? -57.366 -27.371 -22.537 1.00 71.45  ? 440  ILE A C     1 
ATOM   3157  O  O     . ILE A 1 440  ? -57.351 -28.487 -22.007 1.00 72.70  ? 440  ILE A O     1 
ATOM   3158  C  CB    . ILE A 1 440  ? -55.315 -25.925 -22.870 1.00 69.65  ? 440  ILE A CB    1 
ATOM   3159  C  CG1   . ILE A 1 440  ? -54.255 -25.472 -23.880 1.00 68.07  ? 440  ILE A CG1   1 
ATOM   3160  C  CG2   . ILE A 1 440  ? -54.635 -26.516 -21.639 1.00 70.67  ? 440  ILE A CG2   1 
ATOM   3161  C  CD1   . ILE A 1 440  ? -53.764 -24.065 -23.647 1.00 68.06  ? 440  ILE A CD1   1 
ATOM   3162  N  N     . VAL A 1 441  ? -58.301 -26.456 -22.297 1.00 71.30  ? 441  VAL A N     1 
ATOM   3163  C  CA    . VAL A 1 441  ? -59.541 -26.749 -21.581 1.00 72.34  ? 441  VAL A CA    1 
ATOM   3164  C  C     . VAL A 1 441  ? -60.662 -25.969 -22.251 1.00 72.57  ? 441  VAL A C     1 
ATOM   3165  O  O     . VAL A 1 441  ? -60.462 -24.826 -22.676 1.00 72.73  ? 441  VAL A O     1 
ATOM   3166  C  CB    . VAL A 1 441  ? -59.485 -26.320 -20.093 1.00 73.22  ? 441  VAL A CB    1 
ATOM   3167  C  CG1   . VAL A 1 441  ? -60.782 -26.688 -19.369 1.00 74.38  ? 441  VAL A CG1   1 
ATOM   3168  C  CG2   . VAL A 1 441  ? -58.285 -26.940 -19.387 1.00 73.35  ? 441  VAL A CG2   1 
ATOM   3169  N  N     . ASN A 1 442  ? -61.837 -26.578 -22.337 1.00 72.52  ? 442  ASN A N     1 
ATOM   3170  C  CA    . ASN A 1 442  ? -63.040 -25.853 -22.734 1.00 73.26  ? 442  ASN A CA    1 
ATOM   3171  C  C     . ASN A 1 442  ? -64.213 -26.263 -21.864 1.00 74.44  ? 442  ASN A C     1 
ATOM   3172  O  O     . ASN A 1 442  ? -64.069 -27.123 -20.998 1.00 74.63  ? 442  ASN A O     1 
ATOM   3173  C  CB    . ASN A 1 442  ? -63.335 -26.059 -24.222 1.00 72.92  ? 442  ASN A CB    1 
ATOM   3174  C  CG    . ASN A 1 442  ? -63.369 -27.515 -24.617 1.00 73.71  ? 442  ASN A CG    1 
ATOM   3175  O  OD1   . ASN A 1 442  ? -63.557 -28.394 -23.781 1.00 75.03  ? 442  ASN A OD1   1 
ATOM   3176  N  ND2   . ASN A 1 442  ? -63.171 -27.781 -25.901 1.00 73.95  ? 442  ASN A ND2   1 
ATOM   3177  N  N     . SER A 1 443  ? -65.363 -25.634 -22.071 1.00 75.33  ? 443  SER A N     1 
ATOM   3178  C  CA    . SER A 1 443  ? -66.534 -25.948 -21.269 1.00 77.39  ? 443  SER A CA    1 
ATOM   3179  C  C     . SER A 1 443  ? -67.859 -25.533 -21.885 1.00 77.55  ? 443  SER A C     1 
ATOM   3180  O  O     . SER A 1 443  ? -67.922 -24.647 -22.730 1.00 76.97  ? 443  SER A O     1 
ATOM   3181  C  CB    . SER A 1 443  ? -66.426 -25.296 -19.893 1.00 78.89  ? 443  SER A CB    1 
ATOM   3182  O  OG    . SER A 1 443  ? -67.540 -25.669 -19.103 1.00 81.52  ? 443  SER A OG    1 
ATOM   3183  N  N     . GLY A 1 444  ? -68.903 -26.224 -21.445 1.00 78.77  ? 444  GLY A N     1 
ATOM   3184  C  CA    . GLY A 1 444  ? -70.286 -25.814 -21.629 1.00 80.28  ? 444  GLY A CA    1 
ATOM   3185  C  C     . GLY A 1 444  ? -70.893 -25.826 -20.242 1.00 82.64  ? 444  GLY A C     1 
ATOM   3186  O  O     . GLY A 1 444  ? -70.563 -26.700 -19.430 1.00 83.01  ? 444  GLY A O     1 
ATOM   3187  N  N     . MET A 1 445  ? -71.732 -24.834 -19.949 1.00 84.81  ? 445  MET A N     1 
ATOM   3188  C  CA    . MET A 1 445  ? -72.404 -24.724 -18.641 1.00 86.91  ? 445  MET A CA    1 
ATOM   3189  C  C     . MET A 1 445  ? -73.813 -24.197 -18.844 1.00 87.55  ? 445  MET A C     1 
ATOM   3190  O  O     . MET A 1 445  ? -74.020 -23.314 -19.677 1.00 87.38  ? 445  MET A O     1 
ATOM   3191  C  CB    . MET A 1 445  ? -71.632 -23.793 -17.700 1.00 87.93  ? 445  MET A CB    1 
ATOM   3192  C  CG    . MET A 1 445  ? -70.223 -24.267 -17.357 1.00 88.07  ? 445  MET A CG    1 
ATOM   3193  S  SD    . MET A 1 445  ? -69.236 -23.036 -16.487 1.00 88.75  ? 445  MET A SD    1 
ATOM   3194  C  CE    . MET A 1 445  ? -67.567 -23.638 -16.724 1.00 86.75  ? 445  MET A CE    1 
ATOM   3195  N  N     . ARG A 1 446  ? -74.772 -24.749 -18.097 1.00 89.25  ? 446  ARG A N     1 
ATOM   3196  C  CA    . ARG A 1 446  ? -76.183 -24.331 -18.162 1.00 89.89  ? 446  ARG A CA    1 
ATOM   3197  C  C     . ARG A 1 446  ? -76.746 -24.125 -16.771 1.00 92.14  ? 446  ARG A C     1 
ATOM   3198  O  O     . ARG A 1 446  ? -76.380 -24.850 -15.851 1.00 92.50  ? 446  ARG A O     1 
ATOM   3199  C  CB    . ARG A 1 446  ? -77.036 -25.381 -18.879 1.00 89.60  ? 446  ARG A CB    1 
ATOM   3200  C  CG    . ARG A 1 446  ? -78.486 -24.962 -19.094 1.00 90.29  ? 446  ARG A CG    1 
ATOM   3201  C  CD    . ARG A 1 446  ? -79.209 -25.875 -20.071 1.00 89.79  ? 446  ARG A CD    1 
ATOM   3202  N  NE    . ARG A 1 446  ? -79.377 -27.225 -19.542 1.00 90.28  ? 446  ARG A NE    1 
ATOM   3203  C  CZ    . ARG A 1 446  ? -80.264 -27.586 -18.610 1.00 92.36  ? 446  ARG A CZ    1 
ATOM   3204  N  NH1   . ARG A 1 446  ? -81.101 -26.704 -18.054 1.00 93.40  ? 446  ARG A NH1   1 
ATOM   3205  N  NH2   . ARG A 1 446  ? -80.309 -28.854 -18.216 1.00 92.72  ? 446  ARG A NH2   1 
ATOM   3206  N  N     . VAL A 1 447  ? -77.637 -23.138 -16.638 1.00 93.93  ? 447  VAL A N     1 
ATOM   3207  C  CA    . VAL A 1 447  ? -78.446 -22.922 -15.424 1.00 96.32  ? 447  VAL A CA    1 
ATOM   3208  C  C     . VAL A 1 447  ? -79.906 -22.737 -15.813 1.00 97.04  ? 447  VAL A C     1 
ATOM   3209  O  O     . VAL A 1 447  ? -80.202 -22.174 -16.870 1.00 97.60  ? 447  VAL A O     1 
ATOM   3210  C  CB    . VAL A 1 447  ? -78.008 -21.682 -14.599 1.00 97.27  ? 447  VAL A CB    1 
ATOM   3211  C  CG1   . VAL A 1 447  ? -76.665 -21.927 -13.931 1.00 97.16  ? 447  VAL A CG1   1 
ATOM   3212  C  CG2   . VAL A 1 447  ? -77.965 -20.410 -15.446 1.00 96.41  ? 447  VAL A CG2   1 
ATOM   3213  N  N     . PHE A 1 448  ? -80.807 -23.214 -14.964 1.00 97.02  ? 448  PHE A N     1 
ATOM   3214  C  CA    . PHE A 1 448  ? -82.223 -22.942 -15.118 1.00 97.66  ? 448  PHE A CA    1 
ATOM   3215  C  C     . PHE A 1 448  ? -82.736 -22.460 -13.776 1.00 98.91  ? 448  PHE A C     1 
ATOM   3216  O  O     . PHE A 1 448  ? -82.471 -23.094 -12.749 1.00 99.40  ? 448  PHE A O     1 
ATOM   3217  C  CB    . PHE A 1 448  ? -82.973 -24.195 -15.560 1.00 98.28  ? 448  PHE A CB    1 
ATOM   3218  C  CG    . PHE A 1 448  ? -84.462 -23.998 -15.689 1.00 100.21 ? 448  PHE A CG    1 
ATOM   3219  C  CD1   . PHE A 1 448  ? -84.981 -23.130 -16.650 1.00 100.29 ? 448  PHE A CD1   1 
ATOM   3220  C  CD2   . PHE A 1 448  ? -85.348 -24.676 -14.853 1.00 101.83 ? 448  PHE A CD2   1 
ATOM   3221  C  CE1   . PHE A 1 448  ? -86.351 -22.939 -16.775 1.00 101.61 ? 448  PHE A CE1   1 
ATOM   3222  C  CE2   . PHE A 1 448  ? -86.719 -24.490 -14.977 1.00 103.59 ? 448  PHE A CE2   1 
ATOM   3223  C  CZ    . PHE A 1 448  ? -87.221 -23.622 -15.939 1.00 103.29 ? 448  PHE A CZ    1 
ATOM   3224  N  N     . PHE A 1 449  ? -83.452 -21.336 -13.790 1.00 98.92  ? 449  PHE A N     1 
ATOM   3225  C  CA    . PHE A 1 449  ? -84.043 -20.761 -12.576 1.00 100.09 ? 449  PHE A CA    1 
ATOM   3226  C  C     . PHE A 1 449  ? -85.548 -21.015 -12.451 1.00 102.60 ? 449  PHE A C     1 
ATOM   3227  O  O     . PHE A 1 449  ? -86.024 -21.275 -11.350 1.00 104.98 ? 449  PHE A O     1 
ATOM   3228  C  CB    . PHE A 1 449  ? -83.739 -19.268 -12.496 1.00 98.50  ? 449  PHE A CB    1 
ATOM   3229  C  CG    . PHE A 1 449  ? -82.282 -18.966 -12.304 1.00 96.14  ? 449  PHE A CG    1 
ATOM   3230  C  CD1   . PHE A 1 449  ? -81.681 -19.159 -11.067 1.00 96.23  ? 449  PHE A CD1   1 
ATOM   3231  C  CD2   . PHE A 1 449  ? -81.503 -18.492 -13.358 1.00 93.53  ? 449  PHE A CD2   1 
ATOM   3232  C  CE1   . PHE A 1 449  ? -80.333 -18.881 -10.885 1.00 94.63  ? 449  PHE A CE1   1 
ATOM   3233  C  CE2   . PHE A 1 449  ? -80.156 -18.215 -13.175 1.00 91.83  ? 449  PHE A CE2   1 
ATOM   3234  C  CZ    . PHE A 1 449  ? -79.570 -18.412 -11.937 1.00 92.14  ? 449  PHE A CZ    1 
ATOM   3235  N  N     . GLY A 1 450  ? -86.284 -20.943 -13.559 1.00 103.31 ? 450  GLY A N     1 
ATOM   3236  C  CA    . GLY A 1 450  ? -87.723 -21.181 -13.550 1.00 106.64 ? 450  GLY A CA    1 
ATOM   3237  C  C     . GLY A 1 450  ? -88.494 -20.082 -12.831 1.00 110.98 ? 450  GLY A C     1 
ATOM   3238  O  O     . GLY A 1 450  ? -88.579 -20.079 -11.599 1.00 112.45 ? 450  GLY A O     1 
ATOM   3239  N  N     . GLU A 1 451  ? -89.046 -19.157 -13.616 1.00 113.50 ? 451  GLU A N     1 
ATOM   3240  C  CA    . GLU A 1 451  ? -89.855 -18.005 -13.151 1.00 116.42 ? 451  GLU A CA    1 
ATOM   3241  C  C     . GLU A 1 451  ? -89.384 -17.279 -11.864 1.00 118.62 ? 451  GLU A C     1 
ATOM   3242  O  O     . GLU A 1 451  ? -89.640 -17.718 -10.742 1.00 120.46 ? 451  GLU A O     1 
ATOM   3243  C  CB    . GLU A 1 451  ? -91.367 -18.360 -13.127 1.00 117.82 ? 451  GLU A CB    1 
ATOM   3244  C  CG    . GLU A 1 451  ? -91.869 -19.272 -12.006 1.00 119.85 ? 451  GLU A CG    1 
ATOM   3245  C  CD    . GLU A 1 451  ? -92.655 -18.542 -10.913 1.00 123.34 ? 451  GLU A CD    1 
ATOM   3246  O  OE1   . GLU A 1 451  ? -92.417 -17.336 -10.670 1.00 124.16 ? 451  GLU A OE1   1 
ATOM   3247  O  OE2   . GLU A 1 451  ? -93.527 -19.178 -10.281 1.00 125.35 ? 451  GLU A OE2   1 
ATOM   3248  N  N     . GLY A 1 452  ? -88.661 -16.176 -12.051 1.00 119.36 ? 452  GLY A N     1 
ATOM   3249  C  CA    . GLY A 1 452  ? -88.460 -15.183 -10.987 1.00 121.59 ? 452  GLY A CA    1 
ATOM   3250  C  C     . GLY A 1 452  ? -87.325 -15.472 -10.020 1.00 121.68 ? 452  GLY A C     1 
ATOM   3251  O  O     . GLY A 1 452  ? -86.157 -15.383 -10.406 1.00 120.27 ? 452  GLY A O     1 
ATOM   3252  N  N     . ASP A 1 453  ? -87.675 -15.819 -8.773  1.00 123.01 ? 453  ASP A N     1 
ATOM   3253  C  CA    . ASP A 1 453  ? -86.705 -15.987 -7.670  1.00 122.46 ? 453  ASP A CA    1 
ATOM   3254  C  C     . ASP A 1 453  ? -85.459 -16.790 -8.068  1.00 120.45 ? 453  ASP A C     1 
ATOM   3255  O  O     . ASP A 1 453  ? -85.545 -17.773 -8.818  1.00 119.63 ? 453  ASP A O     1 
ATOM   3256  C  CB    . ASP A 1 453  ? -87.375 -16.624 -6.438  1.00 124.15 ? 453  ASP A CB    1 
ATOM   3257  C  CG    . ASP A 1 453  ? -88.212 -15.621 -5.620  1.00 127.23 ? 453  ASP A CG    1 
ATOM   3258  O  OD1   . ASP A 1 453  ? -87.834 -14.433 -5.522  1.00 127.13 ? 453  ASP A OD1   1 
ATOM   3259  O  OD2   . ASP A 1 453  ? -89.246 -16.026 -5.044  1.00 128.81 ? 453  ASP A OD2   1 
ATOM   3260  N  N     . GLY A 1 454  ? -84.305 -16.371 -7.547  1.00 118.91 ? 454  GLY A N     1 
ATOM   3261  C  CA    . GLY A 1 454  ? -83.006 -16.868 -8.011  1.00 115.50 ? 454  GLY A CA    1 
ATOM   3262  C  C     . GLY A 1 454  ? -82.528 -18.193 -7.444  1.00 114.53 ? 454  GLY A C     1 
ATOM   3263  O  O     . GLY A 1 454  ? -81.324 -18.379 -7.264  1.00 113.11 ? 454  GLY A O     1 
ATOM   3264  N  N     . ILE A 1 455  ? -83.458 -19.114 -7.179  1.00 114.49 ? 455  ILE A N     1 
ATOM   3265  C  CA    . ILE A 1 455  ? -83.130 -20.480 -6.766  1.00 113.31 ? 455  ILE A CA    1 
ATOM   3266  C  C     . ILE A 1 455  ? -82.760 -21.281 -8.010  1.00 109.73 ? 455  ILE A C     1 
ATOM   3267  O  O     . ILE A 1 455  ? -83.538 -21.330 -8.966  1.00 108.55 ? 455  ILE A O     1 
ATOM   3268  C  CB    . ILE A 1 455  ? -84.327 -21.170 -6.065  1.00 115.34 ? 455  ILE A CB    1 
ATOM   3269  C  CG1   . ILE A 1 455  ? -84.756 -20.383 -4.818  1.00 118.10 ? 455  ILE A CG1   1 
ATOM   3270  C  CG2   . ILE A 1 455  ? -84.004 -22.625 -5.720  1.00 115.05 ? 455  ILE A CG2   1 
ATOM   3271  C  CD1   . ILE A 1 455  ? -83.656 -20.157 -3.801  1.00 118.59 ? 455  ILE A CD1   1 
ATOM   3272  N  N     . ILE A 1 456  ? -81.591 -21.921 -7.987  1.00 106.80 ? 456  ILE A N     1 
ATOM   3273  C  CA    . ILE A 1 456  ? -81.126 -22.679 -9.145  1.00 104.86 ? 456  ILE A CA    1 
ATOM   3274  C  C     . ILE A 1 456  ? -81.832 -24.050 -9.138  1.00 105.21 ? 456  ILE A C     1 
ATOM   3275  O  O     . ILE A 1 456  ? -81.715 -24.811 -8.172  1.00 105.66 ? 456  ILE A O     1 
ATOM   3276  C  CB    . ILE A 1 456  ? -79.563 -22.740 -9.256  1.00 102.79 ? 456  ILE A CB    1 
ATOM   3277  C  CG1   . ILE A 1 456  ? -78.912 -23.755 -8.301  1.00 103.04 ? 456  ILE A CG1   1 
ATOM   3278  C  CG2   . ILE A 1 456  ? -78.931 -21.359 -9.096  1.00 102.25 ? 456  ILE A CG2   1 
ATOM   3279  C  CD1   . ILE A 1 456  ? -78.551 -25.030 -9.023  1.00 102.07 ? 456  ILE A CD1   1 
ATOM   3280  N  N     . ARG A 1 457  ? -82.608 -24.324 -10.193 1.00 104.33 ? 457  ARG A N     1 
ATOM   3281  C  CA    . ARG A 1 457  ? -83.404 -25.558 -10.304 1.00 104.43 ? 457  ARG A CA    1 
ATOM   3282  C  C     . ARG A 1 457  ? -82.732 -26.637 -11.127 1.00 102.25 ? 457  ARG A C     1 
ATOM   3283  O  O     . ARG A 1 457  ? -83.028 -27.808 -10.932 1.00 103.23 ? 457  ARG A O     1 
ATOM   3284  C  CB    . ARG A 1 457  ? -84.787 -25.265 -10.884 1.00 105.39 ? 457  ARG A CB    1 
ATOM   3285  C  CG    . ARG A 1 457  ? -85.591 -24.328 -10.008 1.00 107.88 ? 457  ARG A CG    1 
ATOM   3286  C  CD    . ARG A 1 457  ? -87.080 -24.388 -10.294 1.00 109.81 ? 457  ARG A CD    1 
ATOM   3287  N  NE    . ARG A 1 457  ? -87.766 -23.193 -9.794  1.00 111.96 ? 457  ARG A NE    1 
ATOM   3288  C  CZ    . ARG A 1 457  ? -87.996 -22.903 -8.510  1.00 113.96 ? 457  ARG A CZ    1 
ATOM   3289  N  NH1   . ARG A 1 457  ? -87.598 -23.714 -7.527  1.00 114.78 ? 457  ARG A NH1   1 
ATOM   3290  N  NH2   . ARG A 1 457  ? -88.637 -21.777 -8.199  1.00 115.27 ? 457  ARG A NH2   1 
ATOM   3291  N  N     . GLU A 1 458  ? -81.872 -26.247 -12.070 1.00 100.15 ? 458  GLU A N     1 
ATOM   3292  C  CA    . GLU A 1 458  ? -81.003 -27.193 -12.788 1.00 98.02  ? 458  GLU A CA    1 
ATOM   3293  C  C     . GLU A 1 458  ? -79.633 -26.587 -13.032 1.00 95.88  ? 458  GLU A C     1 
ATOM   3294  O  O     . GLU A 1 458  ? -79.475 -25.367 -13.040 1.00 95.98  ? 458  GLU A O     1 
ATOM   3295  C  CB    . GLU A 1 458  ? -81.598 -27.600 -14.137 1.00 96.82  ? 458  GLU A CB    1 
ATOM   3296  C  CG    . GLU A 1 458  ? -83.034 -28.108 -14.102 1.00 97.82  ? 458  GLU A CG    1 
ATOM   3297  C  CD    . GLU A 1 458  ? -83.575 -28.397 -15.488 1.00 96.67  ? 458  GLU A CD    1 
ATOM   3298  O  OE1   . GLU A 1 458  ? -82.775 -28.771 -16.385 1.00 94.96  ? 458  GLU A OE1   1 
ATOM   3299  O  OE2   . GLU A 1 458  ? -84.801 -28.250 -15.680 1.00 96.84  ? 458  GLU A OE2   1 
ATOM   3300  N  N     . LEU A 1 459  ? -78.658 -27.461 -13.252 1.00 94.69  ? 459  LEU A N     1 
ATOM   3301  C  CA    . LEU A 1 459  ? -77.264 -27.066 -13.430 1.00 93.58  ? 459  LEU A CA    1 
ATOM   3302  C  C     . LEU A 1 459  ? -76.473 -28.201 -14.116 1.00 93.31  ? 459  LEU A C     1 
ATOM   3303  O  O     . LEU A 1 459  ? -76.447 -29.321 -13.613 1.00 94.23  ? 459  LEU A O     1 
ATOM   3304  C  CB    . LEU A 1 459  ? -76.655 -26.729 -12.062 1.00 94.41  ? 459  LEU A CB    1 
ATOM   3305  C  CG    . LEU A 1 459  ? -75.290 -26.039 -12.005 1.00 93.20  ? 459  LEU A CG    1 
ATOM   3306  C  CD1   . LEU A 1 459  ? -75.383 -24.604 -12.474 1.00 92.48  ? 459  LEU A CD1   1 
ATOM   3307  C  CD2   . LEU A 1 459  ? -74.737 -26.071 -10.594 1.00 94.53  ? 459  LEU A CD2   1 
ATOM   3308  N  N     . CYS A 1 460  ? -75.868 -27.920 -15.273 1.00 92.61  ? 460  CYS A N     1 
ATOM   3309  C  CA    . CYS A 1 460  ? -74.977 -28.871 -15.960 1.00 91.68  ? 460  CYS A CA    1 
ATOM   3310  C  C     . CYS A 1 460  ? -73.658 -28.181 -16.251 1.00 88.68  ? 460  CYS A C     1 
ATOM   3311  O  O     . CYS A 1 460  ? -73.647 -27.085 -16.798 1.00 88.71  ? 460  CYS A O     1 
ATOM   3312  C  CB    . CYS A 1 460  ? -75.590 -29.365 -17.273 1.00 92.30  ? 460  CYS A CB    1 
ATOM   3313  S  SG    . CYS A 1 460  ? -77.051 -30.407 -17.076 1.00 97.55  ? 460  CYS A SG    1 
ATOM   3314  N  N     . ILE A 1 461  ? -72.556 -28.824 -15.874 1.00 86.55  ? 461  ILE A N     1 
ATOM   3315  C  CA    . ILE A 1 461  ? -71.216 -28.266 -16.035 1.00 83.99  ? 461  ILE A CA    1 
ATOM   3316  C  C     . ILE A 1 461  ? -70.339 -29.337 -16.672 1.00 81.99  ? 461  ILE A C     1 
ATOM   3317  O  O     . ILE A 1 461  ? -69.976 -30.314 -16.019 1.00 82.08  ? 461  ILE A O     1 
ATOM   3318  C  CB    . ILE A 1 461  ? -70.638 -27.815 -14.673 1.00 84.50  ? 461  ILE A CB    1 
ATOM   3319  C  CG1   . ILE A 1 461  ? -71.405 -26.594 -14.159 1.00 85.46  ? 461  ILE A CG1   1 
ATOM   3320  C  CG2   . ILE A 1 461  ? -69.151 -27.490 -14.778 1.00 83.56  ? 461  ILE A CG2   1 
ATOM   3321  C  CD1   . ILE A 1 461  ? -71.110 -26.226 -12.721 1.00 86.75  ? 461  ILE A CD1   1 
ATOM   3322  N  N     . SER A 1 462  ? -70.012 -29.142 -17.947 1.00 80.05  ? 462  SER A N     1 
ATOM   3323  C  CA    . SER A 1 462  ? -69.198 -30.083 -18.710 1.00 78.86  ? 462  SER A CA    1 
ATOM   3324  C  C     . SER A 1 462  ? -67.865 -29.454 -19.079 1.00 76.97  ? 462  SER A C     1 
ATOM   3325  O  O     . SER A 1 462  ? -67.812 -28.262 -19.377 1.00 76.80  ? 462  SER A O     1 
ATOM   3326  C  CB    . SER A 1 462  ? -69.926 -30.499 -19.982 1.00 78.28  ? 462  SER A CB    1 
ATOM   3327  O  OG    . SER A 1 462  ? -69.108 -31.351 -20.764 1.00 77.53  ? 462  SER A OG    1 
ATOM   3328  N  N     . TYR A 1 463  ? -66.808 -30.270 -19.069 1.00 75.25  ? 463  TYR A N     1 
ATOM   3329  C  CA    . TYR A 1 463  ? -65.452 -29.831 -19.395 1.00 73.65  ? 463  TYR A CA    1 
ATOM   3330  C  C     . TYR A 1 463  ? -64.806 -30.741 -20.434 1.00 72.98  ? 463  TYR A C     1 
ATOM   3331  O  O     . TYR A 1 463  ? -65.140 -31.924 -20.528 1.00 74.17  ? 463  TYR A O     1 
ATOM   3332  C  CB    . TYR A 1 463  ? -64.581 -29.810 -18.137 1.00 73.86  ? 463  TYR A CB    1 
ATOM   3333  C  CG    . TYR A 1 463  ? -64.907 -28.688 -17.174 1.00 74.22  ? 463  TYR A CG    1 
ATOM   3334  C  CD1   . TYR A 1 463  ? -64.606 -27.367 -17.485 1.00 73.13  ? 463  TYR A CD1   1 
ATOM   3335  C  CD2   . TYR A 1 463  ? -65.509 -28.952 -15.950 1.00 75.83  ? 463  TYR A CD2   1 
ATOM   3336  C  CE1   . TYR A 1 463  ? -64.904 -26.339 -16.607 1.00 74.42  ? 463  TYR A CE1   1 
ATOM   3337  C  CE2   . TYR A 1 463  ? -65.814 -27.936 -15.064 1.00 76.84  ? 463  TYR A CE2   1 
ATOM   3338  C  CZ    . TYR A 1 463  ? -65.515 -26.630 -15.390 1.00 76.31  ? 463  TYR A CZ    1 
ATOM   3339  O  OH    . TYR A 1 463  ? -65.816 -25.631 -14.487 1.00 76.45  ? 463  TYR A OH    1 
ATOM   3340  N  N     . GLY A 1 464  ? -63.879 -30.179 -21.207 1.00 71.69  ? 464  GLY A N     1 
ATOM   3341  C  CA    . GLY A 1 464  ? -63.048 -30.949 -22.136 1.00 71.07  ? 464  GLY A CA    1 
ATOM   3342  C  C     . GLY A 1 464  ? -61.579 -30.635 -21.930 1.00 70.32  ? 464  GLY A C     1 
ATOM   3343  O  O     . GLY A 1 464  ? -61.232 -29.654 -21.275 1.00 71.28  ? 464  GLY A O     1 
ATOM   3344  N  N     . GLY A 1 465  ? -60.720 -31.490 -22.475 1.00 68.79  ? 465  GLY A N     1 
ATOM   3345  C  CA    . GLY A 1 465  ? -59.285 -31.412 -22.244 1.00 68.01  ? 465  GLY A CA    1 
ATOM   3346  C  C     . GLY A 1 465  ? -58.831 -31.829 -20.852 1.00 69.26  ? 465  GLY A C     1 
ATOM   3347  O  O     . GLY A 1 465  ? -57.670 -31.618 -20.499 1.00 68.87  ? 465  GLY A O     1 
ATOM   3348  N  N     . VAL A 1 466  ? -59.715 -32.453 -20.074 1.00 71.27  ? 466  VAL A N     1 
ATOM   3349  C  CA    . VAL A 1 466  ? -59.428 -32.778 -18.670 1.00 73.68  ? 466  VAL A CA    1 
ATOM   3350  C  C     . VAL A 1 466  ? -59.568 -34.287 -18.403 1.00 74.39  ? 466  VAL A C     1 
ATOM   3351  O  O     . VAL A 1 466  ? -60.116 -34.719 -17.378 1.00 76.78  ? 466  VAL A O     1 
ATOM   3352  C  CB    . VAL A 1 466  ? -60.300 -31.934 -17.706 1.00 75.45  ? 466  VAL A CB    1 
ATOM   3353  C  CG1   . VAL A 1 466  ? -59.886 -30.474 -17.771 1.00 75.20  ? 466  VAL A CG1   1 
ATOM   3354  C  CG2   . VAL A 1 466  ? -61.787 -32.078 -18.015 1.00 76.44  ? 466  VAL A CG2   1 
ATOM   3355  N  N     . GLY A 1 467  ? -59.037 -35.080 -19.327 1.00 72.84  ? 467  GLY A N     1 
ATOM   3356  C  CA    . GLY A 1 467  ? -59.148 -36.533 -19.282 1.00 73.21  ? 467  GLY A CA    1 
ATOM   3357  C  C     . GLY A 1 467  ? -59.401 -37.085 -20.670 1.00 71.83  ? 467  GLY A C     1 
ATOM   3358  O  O     . GLY A 1 467  ? -59.553 -36.315 -21.621 1.00 70.63  ? 467  GLY A O     1 
ATOM   3359  N  N     . PRO A 1 468  ? -59.456 -38.422 -20.796 1.00 72.05  ? 468  PRO A N     1 
ATOM   3360  C  CA    . PRO A 1 468  ? -59.650 -39.078 -22.088 1.00 71.13  ? 468  PRO A CA    1 
ATOM   3361  C  C     . PRO A 1 468  ? -60.977 -38.785 -22.812 1.00 71.56  ? 468  PRO A C     1 
ATOM   3362  O  O     . PRO A 1 468  ? -61.062 -39.043 -24.018 1.00 71.40  ? 468  PRO A O     1 
ATOM   3363  C  CB    . PRO A 1 468  ? -59.543 -40.568 -21.743 1.00 72.12  ? 468  PRO A CB    1 
ATOM   3364  C  CG    . PRO A 1 468  ? -59.856 -40.656 -20.294 1.00 73.68  ? 468  PRO A CG    1 
ATOM   3365  C  CD    . PRO A 1 468  ? -59.275 -39.406 -19.715 1.00 73.68  ? 468  PRO A CD    1 
ATOM   3366  N  N     . ALA A 1 469  ? -61.991 -38.272 -22.109 1.00 72.69  ? 469  ALA A N     1 
ATOM   3367  C  CA    . ALA A 1 469  ? -63.253 -37.857 -22.745 1.00 73.03  ? 469  ALA A CA    1 
ATOM   3368  C  C     . ALA A 1 469  ? -63.828 -36.587 -22.118 1.00 73.85  ? 469  ALA A C     1 
ATOM   3369  O  O     . ALA A 1 469  ? -63.383 -36.154 -21.063 1.00 74.60  ? 469  ALA A O     1 
ATOM   3370  C  CB    . ALA A 1 469  ? -64.275 -38.984 -22.667 1.00 73.82  ? 469  ALA A CB    1 
ATOM   3371  N  N     . THR A 1 470  ? -64.819 -36.005 -22.790 1.00 74.42  ? 470  THR A N     1 
ATOM   3372  C  CA    . THR A 1 470  ? -65.598 -34.882 -22.263 1.00 76.52  ? 470  THR A CA    1 
ATOM   3373  C  C     . THR A 1 470  ? -66.374 -35.330 -21.023 1.00 79.73  ? 470  THR A C     1 
ATOM   3374  O  O     . THR A 1 470  ? -67.184 -36.251 -21.114 1.00 81.44  ? 470  THR A O     1 
ATOM   3375  C  CB    . THR A 1 470  ? -66.603 -34.368 -23.320 1.00 75.82  ? 470  THR A CB    1 
ATOM   3376  O  OG1   . THR A 1 470  ? -65.904 -34.005 -24.514 1.00 73.82  ? 470  THR A OG1   1 
ATOM   3377  C  CG2   . THR A 1 470  ? -67.380 -33.149 -22.817 1.00 76.94  ? 470  THR A CG2   1 
ATOM   3378  N  N     . ILE A 1 471  ? -66.141 -34.682 -19.879 1.00 82.59  ? 471  ILE A N     1 
ATOM   3379  C  CA    . ILE A 1 471  ? -66.758 -35.110 -18.606 1.00 86.80  ? 471  ILE A CA    1 
ATOM   3380  C  C     . ILE A 1 471  ? -67.644 -34.044 -17.982 1.00 88.06  ? 471  ILE A C     1 
ATOM   3381  O  O     . ILE A 1 471  ? -67.314 -32.863 -18.014 1.00 87.04  ? 471  ILE A O     1 
ATOM   3382  C  CB    . ILE A 1 471  ? -65.718 -35.608 -17.568 1.00 88.06  ? 471  ILE A CB    1 
ATOM   3383  C  CG1   . ILE A 1 471  ? -64.729 -34.502 -17.165 1.00 87.93  ? 471  ILE A CG1   1 
ATOM   3384  C  CG2   . ILE A 1 471  ? -64.983 -36.840 -18.101 1.00 87.90  ? 471  ILE A CG2   1 
ATOM   3385  C  CD1   . ILE A 1 471  ? -63.641 -34.992 -16.234 1.00 88.96  ? 471  ILE A CD1   1 
ATOM   3386  N  N     . CYS A 1 472  ? -68.764 -34.490 -17.416 1.00 91.61  ? 472  CYS A N     1 
ATOM   3387  C  CA    . CYS A 1 472  ? -69.751 -33.623 -16.767 1.00 94.16  ? 472  CYS A CA    1 
ATOM   3388  C  C     . CYS A 1 472  ? -69.656 -33.771 -15.261 1.00 93.24  ? 472  CYS A C     1 
ATOM   3389  O  O     . CYS A 1 472  ? -69.644 -34.886 -14.748 1.00 92.82  ? 472  CYS A O     1 
ATOM   3390  C  CB    . CYS A 1 472  ? -71.160 -33.985 -17.234 1.00 97.08  ? 472  CYS A CB    1 
ATOM   3391  S  SG    . CYS A 1 472  ? -71.305 -33.990 -19.039 1.00 101.98 ? 472  CYS A SG    1 
ATOM   3392  N  N     . ALA A 1 473  ? -69.586 -32.640 -14.563 1.00 92.55  ? 473  ALA A N     1 
ATOM   3393  C  CA    . ALA A 1 473  ? -69.530 -32.620 -13.106 1.00 94.19  ? 473  ALA A CA    1 
ATOM   3394  C  C     . ALA A 1 473  ? -70.948 -32.725 -12.542 1.00 95.69  ? 473  ALA A C     1 
ATOM   3395  O  O     . ALA A 1 473  ? -71.509 -31.743 -12.069 1.00 96.48  ? 473  ALA A O     1 
ATOM   3396  C  CB    . ALA A 1 473  ? -68.838 -31.352 -12.622 1.00 93.93  ? 473  ALA A CB    1 
ATOM   3397  N  N     . LYS A 1 474  ? -71.517 -33.926 -12.597 1.00 96.56  ? 474  LYS A N     1 
ATOM   3398  C  CA    . LYS A 1 474  ? -72.905 -34.162 -12.182 1.00 98.78  ? 474  LYS A CA    1 
ATOM   3399  C  C     . LYS A 1 474  ? -73.104 -34.183 -10.662 1.00 100.32 ? 474  LYS A C     1 
ATOM   3400  O  O     . LYS A 1 474  ? -74.165 -33.782 -10.181 1.00 101.61 ? 474  LYS A O     1 
ATOM   3401  C  CB    . LYS A 1 474  ? -73.436 -35.467 -12.790 1.00 99.91  ? 474  LYS A CB    1 
ATOM   3402  C  CG    . LYS A 1 474  ? -72.952 -36.746 -12.107 1.00 102.00 ? 474  LYS A CG    1 
ATOM   3403  C  CD    . LYS A 1 474  ? -73.309 -37.992 -12.902 1.00 102.79 ? 474  LYS A CD    1 
ATOM   3404  C  CE    . LYS A 1 474  ? -72.377 -38.193 -14.088 1.00 101.25 ? 474  LYS A CE    1 
ATOM   3405  N  NZ    . LYS A 1 474  ? -72.738 -39.403 -14.883 1.00 101.78 ? 474  LYS A NZ    1 
ATOM   3406  N  N     . ASN A 1 475  ? -72.100 -34.660 -9.922  1.00 99.89  ? 475  ASN A N     1 
ATOM   3407  C  CA    . ASN A 1 475  ? -72.197 -34.814 -8.463  1.00 101.49 ? 475  ASN A CA    1 
ATOM   3408  C  C     . ASN A 1 475  ? -72.118 -33.478 -7.741  1.00 101.39 ? 475  ASN A C     1 
ATOM   3409  O  O     . ASN A 1 475  ? -72.877 -33.217 -6.799  1.00 102.64 ? 475  ASN A O     1 
ATOM   3410  C  CB    . ASN A 1 475  ? -71.098 -35.733 -7.937  1.00 101.86 ? 475  ASN A CB    1 
ATOM   3411  C  CG    . ASN A 1 475  ? -71.132 -37.101 -8.578  1.00 101.98 ? 475  ASN A CG    1 
ATOM   3412  O  OD1   . ASN A 1 475  ? -72.202 -37.665 -8.820  1.00 102.49 ? 475  ASN A OD1   1 
ATOM   3413  N  ND2   . ASN A 1 475  ? -69.956 -37.641 -8.867  1.00 101.75 ? 475  ASN A ND2   1 
ATOM   3414  N  N     . SER A 1 476  ? -71.171 -32.657 -8.180  1.00 98.61  ? 476  SER A N     1 
ATOM   3415  C  CA    . SER A 1 476  ? -71.107 -31.258 -7.799  1.00 98.50  ? 476  SER A CA    1 
ATOM   3416  C  C     . SER A 1 476  ? -72.398 -30.532 -8.139  1.00 98.20  ? 476  SER A C     1 
ATOM   3417  O  O     . SER A 1 476  ? -72.923 -29.784 -7.320  1.00 99.27  ? 476  SER A O     1 
ATOM   3418  C  CB    . SER A 1 476  ? -69.952 -30.579 -8.526  1.00 97.90  ? 476  SER A CB    1 
ATOM   3419  O  OG    . SER A 1 476  ? -68.716 -31.065 -8.044  1.00 98.74  ? 476  SER A OG    1 
ATOM   3420  N  N     . CYS A 1 477  ? -72.901 -30.760 -9.349  1.00 97.13  ? 477  CYS A N     1 
ATOM   3421  C  CA    . CYS A 1 477  ? -74.150 -30.137 -9.807  1.00 97.97  ? 477  CYS A CA    1 
ATOM   3422  C  C     . CYS A 1 477  ? -75.381 -30.542 -8.986  1.00 100.80 ? 477  CYS A C     1 
ATOM   3423  O  O     . CYS A 1 477  ? -76.264 -29.712 -8.764  1.00 102.45 ? 477  CYS A O     1 
ATOM   3424  C  CB    . CYS A 1 477  ? -74.395 -30.406 -11.298 1.00 96.30  ? 477  CYS A CB    1 
ATOM   3425  S  SG    . CYS A 1 477  ? -73.545 -29.245 -12.396 1.00 93.96  ? 477  CYS A SG    1 
ATOM   3426  N  N     . GLN A 1 478  ? -75.442 -31.800 -8.547  1.00 101.87 ? 478  GLN A N     1 
ATOM   3427  C  CA    . GLN A 1 478  ? -76.500 -32.235 -7.629  1.00 104.08 ? 478  GLN A CA    1 
ATOM   3428  C  C     . GLN A 1 478  ? -76.435 -31.444 -6.330  1.00 105.39 ? 478  GLN A C     1 
ATOM   3429  O  O     . GLN A 1 478  ? -77.448 -30.916 -5.883  1.00 106.91 ? 478  GLN A O     1 
ATOM   3430  C  CB    . GLN A 1 478  ? -76.428 -33.743 -7.320  1.00 105.48 ? 478  GLN A CB    1 
ATOM   3431  C  CG    . GLN A 1 478  ? -77.306 -34.626 -8.205  1.00 105.59 ? 478  GLN A CG    1 
ATOM   3432  C  CD    . GLN A 1 478  ? -78.803 -34.355 -8.060  1.00 107.19 ? 478  GLN A CD    1 
ATOM   3433  O  OE1   . GLN A 1 478  ? -79.270 -33.819 -7.049  1.00 108.18 ? 478  GLN A OE1   1 
ATOM   3434  N  NE2   . GLN A 1 478  ? -79.562 -34.725 -9.086  1.00 107.01 ? 478  GLN A NE2   1 
ATOM   3435  N  N     . LYS A 1 479  ? -75.241 -31.343 -5.748  1.00 104.99 ? 479  LYS A N     1 
ATOM   3436  C  CA    . LYS A 1 479  ? -75.064 -30.653 -4.461  1.00 106.82 ? 479  LYS A CA    1 
ATOM   3437  C  C     . LYS A 1 479  ? -75.375 -29.146 -4.474  1.00 106.21 ? 479  LYS A C     1 
ATOM   3438  O  O     . LYS A 1 479  ? -75.588 -28.563 -3.411  1.00 107.38 ? 479  LYS A O     1 
ATOM   3439  C  CB    . LYS A 1 479  ? -73.650 -30.885 -3.903  1.00 107.44 ? 479  LYS A CB    1 
ATOM   3440  C  CG    . LYS A 1 479  ? -73.377 -32.318 -3.457  1.00 109.10 ? 479  LYS A CG    1 
ATOM   3441  C  CD    . LYS A 1 479  ? -72.322 -32.386 -2.357  1.00 110.61 ? 479  LYS A CD    1 
ATOM   3442  C  CE    . LYS A 1 479  ? -71.846 -33.810 -2.103  1.00 111.20 ? 479  LYS A CE    1 
ATOM   3443  N  NZ    . LYS A 1 479  ? -71.101 -34.383 -3.263  1.00 109.44 ? 479  LYS A NZ    1 
ATOM   3444  N  N     . LEU A 1 480  ? -75.396 -28.525 -5.656  1.00 104.21 ? 480  LEU A N     1 
ATOM   3445  C  CA    . LEU A 1 480  ? -75.683 -27.089 -5.790  1.00 103.60 ? 480  LEU A CA    1 
ATOM   3446  C  C     . LEU A 1 480  ? -77.155 -26.741 -6.055  1.00 104.60 ? 480  LEU A C     1 
ATOM   3447  O  O     . LEU A 1 480  ? -77.510 -25.562 -5.984  1.00 105.39 ? 480  LEU A O     1 
ATOM   3448  C  CB    . LEU A 1 480  ? -74.805 -26.476 -6.890  1.00 100.96 ? 480  LEU A CB    1 
ATOM   3449  C  CG    . LEU A 1 480  ? -73.295 -26.488 -6.627  1.00 99.87  ? 480  LEU A CG    1 
ATOM   3450  C  CD1   . LEU A 1 480  ? -72.529 -26.165 -7.902  1.00 97.80  ? 480  LEU A CD1   1 
ATOM   3451  C  CD2   . LEU A 1 480  ? -72.910 -25.528 -5.510  1.00 100.83 ? 480  LEU A CD2   1 
ATOM   3452  N  N     . ILE A 1 481  ? -78.004 -27.737 -6.345  1.00 104.99 ? 481  ILE A N     1 
ATOM   3453  C  CA    . ILE A 1 481  ? -79.439 -27.488 -6.616  1.00 105.53 ? 481  ILE A CA    1 
ATOM   3454  C  C     . ILE A 1 481  ? -80.115 -26.987 -5.348  1.00 108.07 ? 481  ILE A C     1 
ATOM   3455  O  O     . ILE A 1 481  ? -79.910 -27.559 -4.280  1.00 109.95 ? 481  ILE A O     1 
ATOM   3456  C  CB    . ILE A 1 481  ? -80.203 -28.741 -7.134  1.00 105.19 ? 481  ILE A CB    1 
ATOM   3457  C  CG1   . ILE A 1 481  ? -79.537 -29.345 -8.385  1.00 102.89 ? 481  ILE A CG1   1 
ATOM   3458  C  CG2   . ILE A 1 481  ? -81.665 -28.403 -7.428  1.00 105.91 ? 481  ILE A CG2   1 
ATOM   3459  C  CD1   . ILE A 1 481  ? -79.275 -28.372 -9.519  1.00 101.07 ? 481  ILE A CD1   1 
ATOM   3460  N  N     . GLY A 1 482  ? -80.903 -25.917 -5.477  1.00 109.01 ? 482  GLY A N     1 
ATOM   3461  C  CA    . GLY A 1 482  ? -81.555 -25.258 -4.338  1.00 111.00 ? 482  GLY A CA    1 
ATOM   3462  C  C     . GLY A 1 482  ? -80.934 -23.925 -3.938  1.00 111.28 ? 482  GLY A C     1 
ATOM   3463  O  O     . GLY A 1 482  ? -81.632 -23.048 -3.424  1.00 111.84 ? 482  GLY A O     1 
ATOM   3464  N  N     . ARG A 1 483  ? -79.630 -23.764 -4.174  1.00 110.68 ? 483  ARG A N     1 
ATOM   3465  C  CA    . ARG A 1 483  ? -78.905 -22.557 -3.755  1.00 110.96 ? 483  ARG A CA    1 
ATOM   3466  C  C     . ARG A 1 483  ? -79.195 -21.326 -4.611  1.00 110.66 ? 483  ARG A C     1 
ATOM   3467  O  O     . ARG A 1 483  ? -79.646 -21.431 -5.756  1.00 108.70 ? 483  ARG A O     1 
ATOM   3468  C  CB    . ARG A 1 483  ? -77.390 -22.803 -3.719  1.00 109.55 ? 483  ARG A CB    1 
ATOM   3469  C  CG    . ARG A 1 483  ? -76.930 -23.654 -2.546  1.00 111.38 ? 483  ARG A CG    1 
ATOM   3470  C  CD    . ARG A 1 483  ? -75.437 -23.492 -2.299  1.00 111.24 ? 483  ARG A CD    1 
ATOM   3471  N  NE    . ARG A 1 483  ? -74.985 -24.166 -1.079  1.00 113.02 ? 483  ARG A NE    1 
ATOM   3472  C  CZ    . ARG A 1 483  ? -74.767 -25.478 -0.948  1.00 112.83 ? 483  ARG A CZ    1 
ATOM   3473  N  NH1   . ARG A 1 483  ? -74.961 -26.318 -1.963  1.00 111.49 ? 483  ARG A NH1   1 
ATOM   3474  N  NH2   . ARG A 1 483  ? -74.343 -25.956 0.219   1.00 114.45 ? 483  ARG A NH2   1 
ATOM   3475  N  N     . HIS A 1 484  ? -78.923 -20.164 -4.013  1.00 113.23 ? 484  HIS A N     1 
ATOM   3476  C  CA    . HIS A 1 484  ? -79.005 -18.864 -4.684  1.00 113.64 ? 484  HIS A CA    1 
ATOM   3477  C  C     . HIS A 1 484  ? -77.758 -18.629 -5.511  1.00 112.25 ? 484  HIS A C     1 
ATOM   3478  O  O     . HIS A 1 484  ? -76.780 -19.370 -5.409  1.00 111.65 ? 484  HIS A O     1 
ATOM   3479  C  CB    . HIS A 1 484  ? -79.168 -17.716 -3.672  1.00 115.36 ? 484  HIS A CB    1 
ATOM   3480  C  CG    . HIS A 1 484  ? -80.592 -17.398 -3.348  1.00 117.69 ? 484  HIS A CG    1 
ATOM   3481  N  ND1   . HIS A 1 484  ? -81.256 -17.953 -2.275  1.00 120.10 ? 484  HIS A ND1   1 
ATOM   3482  C  CD2   . HIS A 1 484  ? -81.480 -16.579 -3.959  1.00 118.33 ? 484  HIS A CD2   1 
ATOM   3483  C  CE1   . HIS A 1 484  ? -82.490 -17.484 -2.234  1.00 121.65 ? 484  HIS A CE1   1 
ATOM   3484  N  NE2   . HIS A 1 484  ? -82.654 -16.653 -3.249  1.00 120.82 ? 484  HIS A NE2   1 
ATOM   3485  N  N     . TRP A 1 485  ? -77.800 -17.581 -6.323  1.00 112.81 ? 485  TRP A N     1 
ATOM   3486  C  CA    . TRP A 1 485  ? -76.681 -17.211 -7.176  1.00 111.45 ? 485  TRP A CA    1 
ATOM   3487  C  C     . TRP A 1 485  ? -75.893 -16.081 -6.514  1.00 113.29 ? 485  TRP A C     1 
ATOM   3488  O  O     . TRP A 1 485  ? -76.234 -14.908 -6.666  1.00 114.28 ? 485  TRP A O     1 
ATOM   3489  C  CB    . TRP A 1 485  ? -77.206 -16.809 -8.564  1.00 110.12 ? 485  TRP A CB    1 
ATOM   3490  C  CG    . TRP A 1 485  ? -76.209 -16.983 -9.661  1.00 107.58 ? 485  TRP A CG    1 
ATOM   3491  C  CD1   . TRP A 1 485  ? -75.515 -16.010 -10.290 1.00 105.83 ? 485  TRP A CD1   1 
ATOM   3492  C  CD2   . TRP A 1 485  ? -75.801 -18.215 -10.250 1.00 105.86 ? 485  TRP A CD2   1 
ATOM   3493  N  NE1   . TRP A 1 485  ? -74.692 -16.551 -11.248 1.00 103.46 ? 485  TRP A NE1   1 
ATOM   3494  C  CE2   . TRP A 1 485  ? -74.844 -17.910 -11.239 1.00 103.73 ? 485  TRP A CE2   1 
ATOM   3495  C  CE3   . TRP A 1 485  ? -76.153 -19.551 -10.038 1.00 106.48 ? 485  TRP A CE3   1 
ATOM   3496  C  CZ2   . TRP A 1 485  ? -74.224 -18.899 -12.018 1.00 102.66 ? 485  TRP A CZ2   1 
ATOM   3497  C  CZ3   . TRP A 1 485  ? -75.546 -20.537 -10.815 1.00 105.21 ? 485  TRP A CZ3   1 
ATOM   3498  C  CH2   . TRP A 1 485  ? -74.589 -20.202 -11.796 1.00 103.30 ? 485  TRP A CH2   1 
ATOM   3499  N  N     . ASN A 1 486  ? -74.869 -16.443 -5.739  1.00 114.84 ? 486  ASN A N     1 
ATOM   3500  C  CA    . ASN A 1 486  ? -73.906 -15.463 -5.219  1.00 116.37 ? 486  ASN A CA    1 
ATOM   3501  C  C     . ASN A 1 486  ? -72.603 -16.110 -4.743  1.00 116.36 ? 486  ASN A C     1 
ATOM   3502  O  O     . ASN A 1 486  ? -72.451 -17.321 -4.815  1.00 115.66 ? 486  ASN A O     1 
ATOM   3503  C  CB    . ASN A 1 486  ? -74.535 -14.601 -4.109  1.00 119.88 ? 486  ASN A CB    1 
ATOM   3504  C  CG    . ASN A 1 486  ? -74.168 -13.120 -4.226  1.00 121.00 ? 486  ASN A CG    1 
ATOM   3505  O  OD1   . ASN A 1 486  ? -73.980 -12.589 -5.325  1.00 120.54 ? 486  ASN A OD1   1 
ATOM   3506  N  ND2   . ASN A 1 486  ? -74.064 -12.451 -3.085  1.00 122.91 ? 486  ASN A ND2   1 
ATOM   3507  N  N     . GLU A 1 487  ? -71.669 -15.295 -4.255  1.00 117.80 ? 487  GLU A N     1 
ATOM   3508  C  CA    . GLU A 1 487  ? -70.291 -15.738 -4.010  1.00 117.79 ? 487  GLU A CA    1 
ATOM   3509  C  C     . GLU A 1 487  ? -70.113 -16.801 -2.928  1.00 119.48 ? 487  GLU A C     1 
ATOM   3510  O  O     . GLU A 1 487  ? -69.098 -17.497 -2.928  1.00 119.13 ? 487  GLU A O     1 
ATOM   3511  C  CB    . GLU A 1 487  ? -69.387 -14.535 -3.728  1.00 117.60 ? 487  GLU A CB    1 
ATOM   3512  C  CG    . GLU A 1 487  ? -69.201 -13.663 -4.959  1.00 116.25 ? 487  GLU A CG    1 
ATOM   3513  C  CD    . GLU A 1 487  ? -68.252 -12.507 -4.739  1.00 116.79 ? 487  GLU A CD    1 
ATOM   3514  O  OE1   . GLU A 1 487  ? -68.222 -11.956 -3.619  1.00 118.95 ? 487  GLU A OE1   1 
ATOM   3515  O  OE2   . GLU A 1 487  ? -67.542 -12.142 -5.699  1.00 115.58 ? 487  GLU A OE2   1 
ATOM   3516  N  N     . GLN A 1 488  ? -71.081 -16.929 -2.019  1.00 122.34 ? 488  GLN A N     1 
ATOM   3517  C  CA    . GLN A 1 488  ? -71.102 -18.047 -1.058  1.00 124.08 ? 488  GLN A CA    1 
ATOM   3518  C  C     . GLN A 1 488  ? -71.024 -19.415 -1.754  1.00 121.54 ? 488  GLN A C     1 
ATOM   3519  O  O     . GLN A 1 488  ? -70.300 -20.308 -1.301  1.00 120.35 ? 488  GLN A O     1 
ATOM   3520  C  CB    . GLN A 1 488  ? -72.330 -17.980 -0.115  1.00 127.74 ? 488  GLN A CB    1 
ATOM   3521  C  CG    . GLN A 1 488  ? -73.704 -18.353 -0.698  1.00 129.19 ? 488  GLN A CG    1 
ATOM   3522  C  CD    . GLN A 1 488  ? -74.357 -17.238 -1.505  1.00 129.48 ? 488  GLN A CD    1 
ATOM   3523  O  OE1   . GLN A 1 488  ? -74.524 -16.128 -1.004  1.00 132.71 ? 488  GLN A OE1   1 
ATOM   3524  N  NE2   . GLN A 1 488  ? -74.762 -17.534 -2.741  1.00 127.39 ? 488  GLN A NE2   1 
ATOM   3525  N  N     . MET A 1 489  ? -71.747 -19.552 -2.866  1.00 119.38 ? 489  MET A N     1 
ATOM   3526  C  CA    . MET A 1 489  ? -71.850 -20.821 -3.583  1.00 118.02 ? 489  MET A CA    1 
ATOM   3527  C  C     . MET A 1 489  ? -70.648 -21.069 -4.511  1.00 116.02 ? 489  MET A C     1 
ATOM   3528  O  O     . MET A 1 489  ? -70.328 -22.223 -4.796  1.00 113.41 ? 489  MET A O     1 
ATOM   3529  C  CB    . MET A 1 489  ? -73.191 -20.917 -4.337  1.00 117.05 ? 489  MET A CB    1 
ATOM   3530  C  CG    . MET A 1 489  ? -73.267 -20.185 -5.669  1.00 115.43 ? 489  MET A CG    1 
ATOM   3531  S  SD    . MET A 1 489  ? -72.938 -21.219 -7.109  1.00 111.78 ? 489  MET A SD    1 
ATOM   3532  C  CE    . MET A 1 489  ? -73.195 -20.038 -8.427  1.00 109.58 ? 489  MET A CE    1 
ATOM   3533  N  N     . LEU A 1 490  ? -69.995 -19.994 -4.970  1.00 115.45 ? 490  LEU A N     1 
ATOM   3534  C  CA    . LEU A 1 490  ? -68.797 -20.105 -5.818  1.00 113.50 ? 490  LEU A CA    1 
ATOM   3535  C  C     . LEU A 1 490  ? -67.646 -20.778 -5.103  1.00 113.78 ? 490  LEU A C     1 
ATOM   3536  O  O     . LEU A 1 490  ? -67.053 -21.715 -5.632  1.00 112.71 ? 490  LEU A O     1 
ATOM   3537  C  CB    . LEU A 1 490  ? -68.307 -18.737 -6.307  1.00 113.49 ? 490  LEU A CB    1 
ATOM   3538  C  CG    . LEU A 1 490  ? -68.807 -18.314 -7.683  1.00 112.27 ? 490  LEU A CG    1 
ATOM   3539  C  CD1   . LEU A 1 490  ? -70.255 -17.856 -7.595  1.00 113.89 ? 490  LEU A CD1   1 
ATOM   3540  C  CD2   . LEU A 1 490  ? -67.921 -17.220 -8.262  1.00 111.01 ? 490  LEU A CD2   1 
ATOM   3541  N  N     . ASP A 1 491  ? -67.322 -20.272 -3.915  1.00 115.29 ? 491  ASP A N     1 
ATOM   3542  C  CA    . ASP A 1 491  ? -66.212 -20.802 -3.121  1.00 116.06 ? 491  ASP A CA    1 
ATOM   3543  C  C     . ASP A 1 491  ? -66.375 -22.300 -2.874  1.00 116.19 ? 491  ASP A C     1 
ATOM   3544  O  O     . ASP A 1 491  ? -65.418 -23.051 -3.046  1.00 116.28 ? 491  ASP A O     1 
ATOM   3545  C  CB    . ASP A 1 491  ? -66.075 -20.059 -1.783  1.00 118.89 ? 491  ASP A CB    1 
ATOM   3546  C  CG    . ASP A 1 491  ? -65.575 -18.620 -1.944  1.00 118.89 ? 491  ASP A CG    1 
ATOM   3547  O  OD1   . ASP A 1 491  ? -65.309 -18.187 -3.092  1.00 116.39 ? 491  ASP A OD1   1 
ATOM   3548  O  OD2   . ASP A 1 491  ? -65.451 -17.925 -0.905  1.00 120.16 ? 491  ASP A OD2   1 
ATOM   3549  N  N     . ILE A 1 492  ? -67.584 -22.727 -2.495  1.00 116.29 ? 492  ILE A N     1 
ATOM   3550  C  CA    . ILE A 1 492  ? -67.876 -24.163 -2.312  1.00 115.21 ? 492  ILE A CA    1 
ATOM   3551  C  C     . ILE A 1 492  ? -67.949 -24.925 -3.651  1.00 111.69 ? 492  ILE A C     1 
ATOM   3552  O  O     . ILE A 1 492  ? -67.404 -26.023 -3.754  1.00 111.37 ? 492  ILE A O     1 
ATOM   3553  C  CB    . ILE A 1 492  ? -69.135 -24.434 -1.435  1.00 116.68 ? 492  ILE A CB    1 
ATOM   3554  C  CG1   . ILE A 1 492  ? -70.427 -23.980 -2.132  1.00 116.22 ? 492  ILE A CG1   1 
ATOM   3555  C  CG2   . ILE A 1 492  ? -68.979 -23.773 -0.065  1.00 118.35 ? 492  ILE A CG2   1 
ATOM   3556  C  CD1   . ILE A 1 492  ? -71.690 -24.252 -1.350  1.00 118.03 ? 492  ILE A CD1   1 
ATOM   3557  N  N     . ALA A 1 493  ? -68.592 -24.344 -4.667  1.00 108.20 ? 493  ALA A N     1 
ATOM   3558  C  CA    . ALA A 1 493  ? -68.666 -24.973 -5.996  1.00 104.61 ? 493  ALA A CA    1 
ATOM   3559  C  C     . ALA A 1 493  ? -67.276 -25.262 -6.549  1.00 101.96 ? 493  ALA A C     1 
ATOM   3560  O  O     . ALA A 1 493  ? -67.029 -26.355 -7.045  1.00 101.23 ? 493  ALA A O     1 
ATOM   3561  C  CB    . ALA A 1 493  ? -69.453 -24.116 -6.977  1.00 103.14 ? 493  ALA A CB    1 
ATOM   3562  N  N     . CYS A 1 494  ? -66.375 -24.288 -6.432  1.00 100.70 ? 494  CYS A N     1 
ATOM   3563  C  CA    . CYS A 1 494  ? -64.989 -24.456 -6.850  1.00 99.30  ? 494  CYS A CA    1 
ATOM   3564  C  C     . CYS A 1 494  ? -64.307 -25.609 -6.119  1.00 100.82 ? 494  CYS A C     1 
ATOM   3565  O  O     . CYS A 1 494  ? -63.670 -26.446 -6.753  1.00 100.51 ? 494  CYS A O     1 
ATOM   3566  C  CB    . CYS A 1 494  ? -64.187 -23.173 -6.631  1.00 99.23  ? 494  CYS A CB    1 
ATOM   3567  S  SG    . CYS A 1 494  ? -64.668 -21.743 -7.629  1.00 97.50  ? 494  CYS A SG    1 
ATOM   3568  N  N     . ARG A 1 495  ? -64.441 -25.657 -4.796  1.00 104.42 ? 495  ARG A N     1 
ATOM   3569  C  CA    . ARG A 1 495  ? -63.886 -26.765 -4.013  1.00 107.08 ? 495  ARG A CA    1 
ATOM   3570  C  C     . ARG A 1 495  ? -64.411 -28.096 -4.537  1.00 105.90 ? 495  ARG A C     1 
ATOM   3571  O  O     . ARG A 1 495  ? -63.628 -28.972 -4.910  1.00 104.62 ? 495  ARG A O     1 
ATOM   3572  C  CB    . ARG A 1 495  ? -64.241 -26.652 -2.522  1.00 111.70 ? 495  ARG A CB    1 
ATOM   3573  C  CG    . ARG A 1 495  ? -63.559 -25.527 -1.759  1.00 114.75 ? 495  ARG A CG    1 
ATOM   3574  C  CD    . ARG A 1 495  ? -62.090 -25.810 -1.482  1.00 116.19 ? 495  ARG A CD    1 
ATOM   3575  N  NE    . ARG A 1 495  ? -61.468 -24.703 -0.748  1.00 118.25 ? 495  ARG A NE    1 
ATOM   3576  C  CZ    . ARG A 1 495  ? -60.158 -24.440 -0.696  1.00 118.85 ? 495  ARG A CZ    1 
ATOM   3577  N  NH1   . ARG A 1 495  ? -59.260 -25.196 -1.337  1.00 118.25 ? 495  ARG A NH1   1 
ATOM   3578  N  NH2   . ARG A 1 495  ? -59.735 -23.393 0.007   1.00 120.46 ? 495  ARG A NH2   1 
ATOM   3579  N  N     . LEU A 1 496  ? -65.736 -28.228 -4.590  1.00 106.00 ? 496  LEU A N     1 
ATOM   3580  C  CA    . LEU A 1 496  ? -66.346 -29.523 -4.886  1.00 106.29 ? 496  LEU A CA    1 
ATOM   3581  C  C     . LEU A 1 496  ? -66.291 -29.955 -6.363  1.00 104.90 ? 496  LEU A C     1 
ATOM   3582  O  O     . LEU A 1 496  ? -66.544 -31.127 -6.643  1.00 106.18 ? 496  LEU A O     1 
ATOM   3583  C  CB    . LEU A 1 496  ? -67.753 -29.688 -4.256  1.00 107.59 ? 496  LEU A CB    1 
ATOM   3584  C  CG    . LEU A 1 496  ? -68.951 -28.746 -4.410  1.00 107.33 ? 496  LEU A CG    1 
ATOM   3585  C  CD1   . LEU A 1 496  ? -69.360 -28.580 -5.852  1.00 105.90 ? 496  LEU A CD1   1 
ATOM   3586  C  CD2   . LEU A 1 496  ? -70.125 -29.294 -3.620  1.00 108.33 ? 496  LEU A CD2   1 
ATOM   3587  N  N     . ILE A 1 497  ? -65.952 -29.055 -7.294  1.00 103.22 ? 497  ILE A N     1 
ATOM   3588  C  CA    . ILE A 1 497  ? -65.572 -29.503 -8.653  1.00 101.65 ? 497  ILE A CA    1 
ATOM   3589  C  C     . ILE A 1 497  ? -64.086 -29.878 -8.732  1.00 100.63 ? 497  ILE A C     1 
ATOM   3590  O  O     . ILE A 1 497  ? -63.729 -30.847 -9.399  1.00 99.10  ? 497  ILE A O     1 
ATOM   3591  C  CB    . ILE A 1 497  ? -65.963 -28.532 -9.807  1.00 99.97  ? 497  ILE A CB    1 
ATOM   3592  C  CG1   . ILE A 1 497  ? -65.203 -27.204 -9.758  1.00 99.72  ? 497  ILE A CG1   1 
ATOM   3593  C  CG2   . ILE A 1 497  ? -67.466 -28.300 -9.829  1.00 100.37 ? 497  ILE A CG2   1 
ATOM   3594  C  CD1   . ILE A 1 497  ? -65.231 -26.482 -11.085 1.00 98.51  ? 497  ILE A CD1   1 
ATOM   3595  N  N     . LEU A 1 498  ? -63.231 -29.130 -8.035  1.00 100.40 ? 498  LEU A N     1 
ATOM   3596  C  CA    . LEU A 1 498  ? -61.781 -29.368 -8.081  1.00 99.44  ? 498  LEU A CA    1 
ATOM   3597  C  C     . LEU A 1 498  ? -61.333 -30.758 -7.610  1.00 100.53 ? 498  LEU A C     1 
ATOM   3598  O  O     . LEU A 1 498  ? -60.247 -31.204 -7.983  1.00 101.73 ? 498  LEU A O     1 
ATOM   3599  C  CB    . LEU A 1 498  ? -61.019 -28.288 -7.303  1.00 99.42  ? 498  LEU A CB    1 
ATOM   3600  C  CG    . LEU A 1 498  ? -60.830 -26.962 -8.042  1.00 98.08  ? 498  LEU A CG    1 
ATOM   3601  C  CD1   . LEU A 1 498  ? -60.397 -25.872 -7.068  1.00 99.38  ? 498  LEU A CD1   1 
ATOM   3602  C  CD2   . LEU A 1 498  ? -59.836 -27.099 -9.190  1.00 95.95  ? 498  LEU A CD2   1 
ATOM   3603  N  N     . ASN A 1 499  ? -62.147 -31.435 -6.803  1.00 101.40 ? 499  ASN A N     1 
ATOM   3604  C  CA    . ASN A 1 499  ? -61.869 -32.838 -6.435  1.00 102.26 ? 499  ASN A CA    1 
ATOM   3605  C  C     . ASN A 1 499  ? -62.689 -33.862 -7.229  1.00 101.15 ? 499  ASN A C     1 
ATOM   3606  O  O     . ASN A 1 499  ? -62.247 -35.002 -7.360  1.00 101.16 ? 499  ASN A O     1 
ATOM   3607  C  CB    . ASN A 1 499  ? -61.993 -33.078 -4.922  1.00 104.41 ? 499  ASN A CB    1 
ATOM   3608  C  CG    . ASN A 1 499  ? -63.156 -32.347 -4.309  1.00 105.99 ? 499  ASN A CG    1 
ATOM   3609  O  OD1   . ASN A 1 499  ? -64.035 -31.872 -5.024  1.00 106.22 ? 499  ASN A OD1   1 
ATOM   3610  N  ND2   . ASN A 1 499  ? -63.162 -32.232 -2.986  1.00 107.87 ? 499  ASN A ND2   1 
ATOM   3611  N  N     . GLU A 1 500  ? -63.852 -33.468 -7.762  1.00 100.11 ? 500  GLU A N     1 
ATOM   3612  C  CA    . GLU A 1 500  ? -64.605 -34.326 -8.695  1.00 99.48  ? 500  GLU A CA    1 
ATOM   3613  C  C     . GLU A 1 500  ? -63.907 -34.441 -10.061 1.00 97.28  ? 500  GLU A C     1 
ATOM   3614  O  O     . GLU A 1 500  ? -63.622 -35.550 -10.529 1.00 95.72  ? 500  GLU A O     1 
ATOM   3615  C  CB    . GLU A 1 500  ? -66.034 -33.820 -8.901  1.00 100.30 ? 500  GLU A CB    1 
ATOM   3616  C  CG    . GLU A 1 500  ? -66.890 -34.797 -9.704  1.00 101.19 ? 500  GLU A CG    1 
ATOM   3617  C  CD    . GLU A 1 500  ? -68.298 -34.308 -9.995  1.00 102.56 ? 500  GLU A CD    1 
ATOM   3618  O  OE1   . GLU A 1 500  ? -68.601 -33.116 -9.775  1.00 102.83 ? 500  GLU A OE1   1 
ATOM   3619  O  OE2   . GLU A 1 500  ? -69.112 -35.135 -10.461 1.00 103.59 ? 500  GLU A OE2   1 
ATOM   3620  N  N     . VAL A 1 501  ? -63.652 -33.285 -10.682 1.00 95.63  ? 501  VAL A N     1 
ATOM   3621  C  CA    . VAL A 1 501  ? -62.974 -33.195 -11.986 1.00 91.81  ? 501  VAL A CA    1 
ATOM   3622  C  C     . VAL A 1 501  ? -61.499 -32.855 -11.742 1.00 90.84  ? 501  VAL A C     1 
ATOM   3623  O  O     . VAL A 1 501  ? -61.022 -31.784 -12.097 1.00 89.95  ? 501  VAL A O     1 
ATOM   3624  C  CB    . VAL A 1 501  ? -63.694 -32.215 -12.976 1.00 90.63  ? 501  VAL A CB    1 
ATOM   3625  C  CG1   . VAL A 1 501  ? -64.034 -30.869 -12.354 1.00 91.48  ? 501  VAL A CG1   1 
ATOM   3626  C  CG2   . VAL A 1 501  ? -62.899 -32.012 -14.263 1.00 89.35  ? 501  VAL A CG2   1 
ATOM   3627  N  N     . SER A 1 502  ? -60.783 -33.795 -11.130 1.00 91.08  ? 502  SER A N     1 
ATOM   3628  C  CA    . SER A 1 502  ? -59.365 -33.626 -10.826 1.00 90.60  ? 502  SER A CA    1 
ATOM   3629  C  C     . SER A 1 502  ? -58.500 -34.256 -11.908 1.00 88.95  ? 502  SER A C     1 
ATOM   3630  O  O     . SER A 1 502  ? -58.949 -35.114 -12.669 1.00 87.04  ? 502  SER A O     1 
ATOM   3631  C  CB    . SER A 1 502  ? -59.022 -34.249 -9.473  1.00 92.98  ? 502  SER A CB    1 
ATOM   3632  O  OG    . SER A 1 502  ? -58.849 -35.653 -9.583  1.00 93.98  ? 502  SER A OG    1 
ATOM   3633  N  N     . LEU A 1 503  ? -57.249 -33.809 -11.950 1.00 88.93  ? 503  LEU A N     1 
ATOM   3634  C  CA    . LEU A 1 503  ? -56.232 -34.330 -12.848 1.00 87.17  ? 503  LEU A CA    1 
ATOM   3635  C  C     . LEU A 1 503  ? -55.068 -34.802 -12.003 1.00 87.13  ? 503  LEU A C     1 
ATOM   3636  O  O     . LEU A 1 503  ? -54.708 -34.155 -11.022 1.00 87.47  ? 503  LEU A O     1 
ATOM   3637  C  CB    . LEU A 1 503  ? -55.729 -33.237 -13.792 1.00 86.54  ? 503  LEU A CB    1 
ATOM   3638  C  CG    . LEU A 1 503  ? -56.717 -32.652 -14.806 1.00 86.43  ? 503  LEU A CG    1 
ATOM   3639  C  CD1   . LEU A 1 503  ? -57.780 -31.774 -14.147 1.00 87.50  ? 503  LEU A CD1   1 
ATOM   3640  C  CD2   . LEU A 1 503  ? -55.961 -31.869 -15.875 1.00 85.43  ? 503  LEU A CD2   1 
ATOM   3641  N  N     . LEU A 1 504  ? -54.478 -35.925 -12.390 1.00 86.41  ? 504  LEU A N     1 
ATOM   3642  C  CA    . LEU A 1 504  ? -53.237 -36.381 -11.786 1.00 86.88  ? 504  LEU A CA    1 
ATOM   3643  C  C     . LEU A 1 504  ? -52.114 -35.515 -12.352 1.00 85.78  ? 504  LEU A C     1 
ATOM   3644  O  O     . LEU A 1 504  ? -52.186 -35.093 -13.502 1.00 84.51  ? 504  LEU A O     1 
ATOM   3645  C  CB    . LEU A 1 504  ? -53.003 -37.860 -12.099 1.00 86.74  ? 504  LEU A CB    1 
ATOM   3646  C  CG    . LEU A 1 504  ? -54.083 -38.819 -11.577 1.00 87.90  ? 504  LEU A CG    1 
ATOM   3647  C  CD1   . LEU A 1 504  ? -53.852 -40.230 -12.103 1.00 87.32  ? 504  LEU A CD1   1 
ATOM   3648  C  CD2   . LEU A 1 504  ? -54.142 -38.804 -10.053 1.00 89.55  ? 504  LEU A CD2   1 
ATOM   3649  N  N     . GLY A 1 505  ? -51.088 -35.251 -11.544 1.00 86.68  ? 505  GLY A N     1 
ATOM   3650  C  CA    . GLY A 1 505  ? -49.918 -34.471 -11.973 1.00 85.95  ? 505  GLY A CA    1 
ATOM   3651  C  C     . GLY A 1 505  ? -49.232 -34.984 -13.229 1.00 84.85  ? 505  GLY A C     1 
ATOM   3652  O  O     . GLY A 1 505  ? -48.614 -34.212 -13.972 1.00 83.03  ? 505  GLY A O     1 
ATOM   3653  N  N     . SER A 1 506  ? -49.349 -36.291 -13.457 1.00 85.21  ? 506  SER A N     1 
ATOM   3654  C  CA    . SER A 1 506  ? -48.838 -36.946 -14.651 1.00 83.99  ? 506  SER A CA    1 
ATOM   3655  C  C     . SER A 1 506  ? -49.856 -37.024 -15.791 1.00 82.63  ? 506  SER A C     1 
ATOM   3656  O  O     . SER A 1 506  ? -49.719 -37.875 -16.661 1.00 82.25  ? 506  SER A O     1 
ATOM   3657  C  CB    . SER A 1 506  ? -48.434 -38.366 -14.269 1.00 85.38  ? 506  SER A CB    1 
ATOM   3658  O  OG    . SER A 1 506  ? -49.578 -39.100 -13.883 1.00 86.70  ? 506  SER A OG    1 
ATOM   3659  N  N     . ALA A 1 507  ? -50.866 -36.155 -15.802 1.00 82.69  ? 507  ALA A N     1 
ATOM   3660  C  CA    . ALA A 1 507  ? -51.926 -36.237 -16.812 1.00 81.65  ? 507  ALA A CA    1 
ATOM   3661  C  C     . ALA A 1 507  ? -51.381 -35.953 -18.217 1.00 79.62  ? 507  ALA A C     1 
ATOM   3662  O  O     . ALA A 1 507  ? -50.541 -35.057 -18.382 1.00 78.98  ? 507  ALA A O     1 
ATOM   3663  C  CB    . ALA A 1 507  ? -53.064 -35.276 -16.487 1.00 82.26  ? 507  ALA A CB    1 
ATOM   3664  N  N     . PRO A 1 508  ? -51.847 -36.720 -19.233 1.00 77.94  ? 508  PRO A N     1 
ATOM   3665  C  CA    . PRO A 1 508  ? -51.419 -36.408 -20.594 1.00 75.35  ? 508  PRO A CA    1 
ATOM   3666  C  C     . PRO A 1 508  ? -51.904 -35.026 -21.008 1.00 74.22  ? 508  PRO A C     1 
ATOM   3667  O  O     . PRO A 1 508  ? -52.953 -34.582 -20.551 1.00 75.22  ? 508  PRO A O     1 
ATOM   3668  C  CB    . PRO A 1 508  ? -52.068 -37.511 -21.440 1.00 74.75  ? 508  PRO A CB    1 
ATOM   3669  C  CG    . PRO A 1 508  ? -53.197 -38.019 -20.625 1.00 76.00  ? 508  PRO A CG    1 
ATOM   3670  C  CD    . PRO A 1 508  ? -52.771 -37.870 -19.200 1.00 77.86  ? 508  PRO A CD    1 
ATOM   3671  N  N     . GLY A 1 509  ? -51.126 -34.358 -21.853 1.00 72.77  ? 509  GLY A N     1 
ATOM   3672  C  CA    . GLY A 1 509  ? -51.336 -32.950 -22.191 1.00 71.43  ? 509  GLY A CA    1 
ATOM   3673  C  C     . GLY A 1 509  ? -50.505 -31.977 -21.371 1.00 71.43  ? 509  GLY A C     1 
ATOM   3674  O  O     . GLY A 1 509  ? -50.238 -30.866 -21.832 1.00 70.35  ? 509  GLY A O     1 
ATOM   3675  N  N     . GLY A 1 510  ? -50.102 -32.379 -20.162 1.00 72.65  ? 510  GLY A N     1 
ATOM   3676  C  CA    . GLY A 1 510  ? -49.345 -31.517 -19.261 1.00 73.23  ? 510  GLY A CA    1 
ATOM   3677  C  C     . GLY A 1 510  ? -50.203 -30.365 -18.784 1.00 74.37  ? 510  GLY A C     1 
ATOM   3678  O  O     . GLY A 1 510  ? -51.434 -30.442 -18.835 1.00 74.70  ? 510  GLY A O     1 
ATOM   3679  N  N     . LYS A 1 511  ? -49.545 -29.301 -18.327 1.00 75.15  ? 511  LYS A N     1 
ATOM   3680  C  CA    . LYS A 1 511  ? -50.199 -28.056 -17.900 1.00 75.87  ? 511  LYS A CA    1 
ATOM   3681  C  C     . LYS A 1 511  ? -51.216 -28.227 -16.765 1.00 77.80  ? 511  LYS A C     1 
ATOM   3682  O  O     . LYS A 1 511  ? -52.197 -27.490 -16.686 1.00 77.56  ? 511  LYS A O     1 
ATOM   3683  C  CB    . LYS A 1 511  ? -50.886 -27.379 -19.094 1.00 74.67  ? 511  LYS A CB    1 
ATOM   3684  C  CG    . LYS A 1 511  ? -49.982 -27.088 -20.272 1.00 72.96  ? 511  LYS A CG    1 
ATOM   3685  C  CD    . LYS A 1 511  ? -50.659 -26.116 -21.220 1.00 72.10  ? 511  LYS A CD    1 
ATOM   3686  C  CE    . LYS A 1 511  ? -49.728 -25.693 -22.335 1.00 71.46  ? 511  LYS A CE    1 
ATOM   3687  N  NZ    . LYS A 1 511  ? -49.353 -26.835 -23.213 1.00 71.14  ? 511  LYS A NZ    1 
ATOM   3688  N  N     . VAL A 1 512  ? -50.978 -29.182 -15.874 1.00 80.29  ? 512  VAL A N     1 
ATOM   3689  C  CA    . VAL A 1 512  ? -52.028 -29.589 -14.923 1.00 82.96  ? 512  VAL A CA    1 
ATOM   3690  C  C     . VAL A 1 512  ? -52.546 -28.445 -14.034 1.00 84.12  ? 512  VAL A C     1 
ATOM   3691  O  O     . VAL A 1 512  ? -53.755 -28.306 -13.841 1.00 83.66  ? 512  VAL A O     1 
ATOM   3692  C  CB    . VAL A 1 512  ? -51.637 -30.846 -14.091 1.00 84.26  ? 512  VAL A CB    1 
ATOM   3693  C  CG1   . VAL A 1 512  ? -51.651 -32.079 -14.986 1.00 83.33  ? 512  VAL A CG1   1 
ATOM   3694  C  CG2   . VAL A 1 512  ? -50.281 -30.697 -13.398 1.00 85.01  ? 512  VAL A CG2   1 
ATOM   3695  N  N     . GLU A 1 513  ? -51.641 -27.597 -13.556 1.00 85.55  ? 513  GLU A N     1 
ATOM   3696  C  CA    . GLU A 1 513  ? -52.011 -26.488 -12.671 1.00 87.93  ? 513  GLU A CA    1 
ATOM   3697  C  C     . GLU A 1 513  ? -52.705 -25.348 -13.430 1.00 85.53  ? 513  GLU A C     1 
ATOM   3698  O  O     . GLU A 1 513  ? -53.498 -24.605 -12.850 1.00 86.77  ? 513  GLU A O     1 
ATOM   3699  C  CB    . GLU A 1 513  ? -50.782 -25.976 -11.914 1.00 90.62  ? 513  GLU A CB    1 
ATOM   3700  C  CG    . GLU A 1 513  ? -50.143 -27.031 -11.011 1.00 93.74  ? 513  GLU A CG    1 
ATOM   3701  C  CD    . GLU A 1 513  ? -48.912 -26.535 -10.264 1.00 96.43  ? 513  GLU A CD    1 
ATOM   3702  O  OE1   . GLU A 1 513  ? -48.138 -25.731 -10.832 1.00 97.95  ? 513  GLU A OE1   1 
ATOM   3703  O  OE2   . GLU A 1 513  ? -48.703 -26.966 -9.107  1.00 98.25  ? 513  GLU A OE2   1 
ATOM   3704  N  N     . PHE A 1 514  ? -52.412 -25.222 -14.722 1.00 82.46  ? 514  PHE A N     1 
ATOM   3705  C  CA    . PHE A 1 514  ? -53.106 -24.270 -15.591 1.00 80.29  ? 514  PHE A CA    1 
ATOM   3706  C  C     . PHE A 1 514  ? -54.526 -24.776 -15.873 1.00 80.97  ? 514  PHE A C     1 
ATOM   3707  O  O     . PHE A 1 514  ? -55.497 -24.020 -15.740 1.00 82.24  ? 514  PHE A O     1 
ATOM   3708  C  CB    . PHE A 1 514  ? -52.299 -24.050 -16.888 1.00 76.73  ? 514  PHE A CB    1 
ATOM   3709  C  CG    . PHE A 1 514  ? -52.886 -23.029 -17.840 1.00 74.50  ? 514  PHE A CG    1 
ATOM   3710  C  CD1   . PHE A 1 514  ? -53.522 -21.871 -17.394 1.00 75.07  ? 514  PHE A CD1   1 
ATOM   3711  C  CD2   . PHE A 1 514  ? -52.759 -23.214 -19.204 1.00 72.79  ? 514  PHE A CD2   1 
ATOM   3712  C  CE1   . PHE A 1 514  ? -54.038 -20.949 -18.297 1.00 73.60  ? 514  PHE A CE1   1 
ATOM   3713  C  CE2   . PHE A 1 514  ? -53.268 -22.291 -20.106 1.00 71.48  ? 514  PHE A CE2   1 
ATOM   3714  C  CZ    . PHE A 1 514  ? -53.907 -21.157 -19.652 1.00 71.80  ? 514  PHE A CZ    1 
ATOM   3715  N  N     . LYS A 1 515  ? -54.639 -26.058 -16.231 1.00 80.19  ? 515  LYS A N     1 
ATOM   3716  C  CA    . LYS A 1 515  ? -55.942 -26.694 -16.467 1.00 79.76  ? 515  LYS A CA    1 
ATOM   3717  C  C     . LYS A 1 515  ? -56.824 -26.636 -15.220 1.00 80.53  ? 515  LYS A C     1 
ATOM   3718  O  O     . LYS A 1 515  ? -58.011 -26.334 -15.319 1.00 81.00  ? 515  LYS A O     1 
ATOM   3719  C  CB    . LYS A 1 515  ? -55.780 -28.155 -16.894 1.00 79.82  ? 515  LYS A CB    1 
ATOM   3720  C  CG    . LYS A 1 515  ? -55.159 -28.372 -18.261 1.00 78.32  ? 515  LYS A CG    1 
ATOM   3721  C  CD    . LYS A 1 515  ? -55.099 -29.856 -18.564 1.00 78.33  ? 515  LYS A CD    1 
ATOM   3722  C  CE    . LYS A 1 515  ? -54.676 -30.132 -19.990 1.00 76.62  ? 515  LYS A CE    1 
ATOM   3723  N  NZ    . LYS A 1 515  ? -54.370 -31.580 -20.148 1.00 76.93  ? 515  LYS A NZ    1 
ATOM   3724  N  N     . ARG A 1 516  ? -56.237 -26.934 -14.059 1.00 80.59  ? 516  ARG A N     1 
ATOM   3725  C  CA    . ARG A 1 516  ? -56.923 -26.780 -12.759 1.00 81.68  ? 516  ARG A CA    1 
ATOM   3726  C  C     . ARG A 1 516  ? -57.530 -25.391 -12.584 1.00 81.78  ? 516  ARG A C     1 
ATOM   3727  O  O     . ARG A 1 516  ? -58.683 -25.254 -12.173 1.00 82.34  ? 516  ARG A O     1 
ATOM   3728  C  CB    . ARG A 1 516  ? -55.967 -27.070 -11.588 1.00 82.14  ? 516  ARG A CB    1 
ATOM   3729  C  CG    . ARG A 1 516  ? -55.913 -28.536 -11.204 1.00 82.12  ? 516  ARG A CG    1 
ATOM   3730  C  CD    . ARG A 1 516  ? -54.672 -28.889 -10.410 1.00 82.50  ? 516  ARG A CD    1 
ATOM   3731  N  NE    . ARG A 1 516  ? -54.562 -30.337 -10.241 1.00 82.83  ? 516  ARG A NE    1 
ATOM   3732  C  CZ    . ARG A 1 516  ? -53.467 -30.992 -9.852  1.00 83.53  ? 516  ARG A CZ    1 
ATOM   3733  N  NH1   . ARG A 1 516  ? -52.336 -30.351 -9.558  1.00 84.06  ? 516  ARG A NH1   1 
ATOM   3734  N  NH2   . ARG A 1 516  ? -53.504 -32.315 -9.749  1.00 83.92  ? 516  ARG A NH2   1 
ATOM   3735  N  N     . THR A 1 517  ? -56.736 -24.376 -12.911 1.00 80.91  ? 517  THR A N     1 
ATOM   3736  C  CA    . THR A 1 517  ? -57.140 -22.988 -12.777 1.00 81.01  ? 517  THR A CA    1 
ATOM   3737  C  C     . THR A 1 517  ? -58.247 -22.605 -13.754 1.00 80.20  ? 517  THR A C     1 
ATOM   3738  O  O     . THR A 1 517  ? -59.240 -21.999 -13.351 1.00 81.74  ? 517  THR A O     1 
ATOM   3739  C  CB    . THR A 1 517  ? -55.923 -22.073 -12.948 1.00 80.45  ? 517  THR A CB    1 
ATOM   3740  O  OG1   . THR A 1 517  ? -54.974 -22.387 -11.922 1.00 81.84  ? 517  THR A OG1   1 
ATOM   3741  C  CG2   . THR A 1 517  ? -56.311 -20.606 -12.852 1.00 80.67  ? 517  THR A CG2   1 
ATOM   3742  N  N     . LEU A 1 518  ? -58.078 -22.965 -15.025 1.00 78.91  ? 518  LEU A N     1 
ATOM   3743  C  CA    . LEU A 1 518  ? -59.094 -22.688 -16.060 1.00 78.30  ? 518  LEU A CA    1 
ATOM   3744  C  C     . LEU A 1 518  ? -60.479 -23.253 -15.712 1.00 79.64  ? 518  LEU A C     1 
ATOM   3745  O  O     . LEU A 1 518  ? -61.495 -22.607 -15.975 1.00 79.62  ? 518  LEU A O     1 
ATOM   3746  C  CB    . LEU A 1 518  ? -58.643 -23.210 -17.436 1.00 75.35  ? 518  LEU A CB    1 
ATOM   3747  C  CG    . LEU A 1 518  ? -57.485 -22.471 -18.126 1.00 74.08  ? 518  LEU A CG    1 
ATOM   3748  C  CD1   . LEU A 1 518  ? -57.068 -23.197 -19.402 1.00 72.49  ? 518  LEU A CD1   1 
ATOM   3749  C  CD2   . LEU A 1 518  ? -57.837 -21.026 -18.442 1.00 73.60  ? 518  LEU A CD2   1 
ATOM   3750  N  N     . ILE A 1 519  ? -60.497 -24.446 -15.112 1.00 81.20  ? 519  ILE A N     1 
ATOM   3751  C  CA    . ILE A 1 519  ? -61.731 -25.112 -14.658 1.00 82.41  ? 519  ILE A CA    1 
ATOM   3752  C  C     . ILE A 1 519  ? -62.547 -24.204 -13.737 1.00 83.85  ? 519  ILE A C     1 
ATOM   3753  O  O     . ILE A 1 519  ? -63.741 -23.995 -13.961 1.00 83.52  ? 519  ILE A O     1 
ATOM   3754  C  CB    . ILE A 1 519  ? -61.403 -26.466 -13.975 1.00 83.29  ? 519  ILE A CB    1 
ATOM   3755  C  CG1   . ILE A 1 519  ? -61.042 -27.506 -15.042 1.00 83.15  ? 519  ILE A CG1   1 
ATOM   3756  C  CG2   . ILE A 1 519  ? -62.560 -26.985 -13.131 1.00 85.01  ? 519  ILE A CG2   1 
ATOM   3757  C  CD1   . ILE A 1 519  ? -60.236 -28.680 -14.525 1.00 84.03  ? 519  ILE A CD1   1 
ATOM   3758  N  N     . ILE A 1 520  ? -61.897 -23.665 -12.714 1.00 84.74  ? 520  ILE A N     1 
ATOM   3759  C  CA    . ILE A 1 520  ? -62.572 -22.754 -11.793 1.00 87.41  ? 520  ILE A CA    1 
ATOM   3760  C  C     . ILE A 1 520  ? -62.683 -21.318 -12.332 1.00 86.47  ? 520  ILE A C     1 
ATOM   3761  O  O     . ILE A 1 520  ? -63.619 -20.601 -11.965 1.00 87.41  ? 520  ILE A O     1 
ATOM   3762  C  CB    . ILE A 1 520  ? -61.964 -22.795 -10.361 1.00 90.29  ? 520  ILE A CB    1 
ATOM   3763  C  CG1   . ILE A 1 520  ? -60.546 -22.199 -10.297 1.00 90.62  ? 520  ILE A CG1   1 
ATOM   3764  C  CG2   . ILE A 1 520  ? -61.976 -24.224 -9.828  1.00 91.05  ? 520  ILE A CG2   1 
ATOM   3765  C  CD1   . ILE A 1 520  ? -59.911 -22.301 -8.924  1.00 92.30  ? 520  ILE A CD1   1 
ATOM   3766  N  N     . SER A 1 521  ? -61.750 -20.895 -13.189 1.00 83.70  ? 521  SER A N     1 
ATOM   3767  C  CA    . SER A 1 521  ? -61.814 -19.555 -13.781 1.00 82.48  ? 521  SER A CA    1 
ATOM   3768  C  C     . SER A 1 521  ? -62.984 -19.410 -14.764 1.00 82.16  ? 521  SER A C     1 
ATOM   3769  O  O     . SER A 1 521  ? -63.603 -18.346 -14.821 1.00 82.64  ? 521  SER A O     1 
ATOM   3770  C  CB    . SER A 1 521  ? -60.492 -19.189 -14.454 1.00 81.13  ? 521  SER A CB    1 
ATOM   3771  O  OG    . SER A 1 521  ? -59.423 -19.221 -13.523 1.00 81.32  ? 521  SER A OG    1 
ATOM   3772  N  N     . PHE A 1 522  ? -63.285 -20.470 -15.526 1.00 81.76  ? 522  PHE A N     1 
ATOM   3773  C  CA    . PHE A 1 522  ? -64.473 -20.494 -16.405 1.00 81.68  ? 522  PHE A CA    1 
ATOM   3774  C  C     . PHE A 1 522  ? -65.764 -20.526 -15.597 1.00 83.39  ? 522  PHE A C     1 
ATOM   3775  O  O     . PHE A 1 522  ? -66.775 -19.967 -16.017 1.00 83.99  ? 522  PHE A O     1 
ATOM   3776  C  CB    . PHE A 1 522  ? -64.474 -21.700 -17.360 1.00 80.80  ? 522  PHE A CB    1 
ATOM   3777  C  CG    . PHE A 1 522  ? -63.380 -21.691 -18.405 1.00 79.81  ? 522  PHE A CG    1 
ATOM   3778  C  CD1   . PHE A 1 522  ? -62.905 -20.502 -18.978 1.00 79.11  ? 522  PHE A CD1   1 
ATOM   3779  C  CD2   . PHE A 1 522  ? -62.850 -22.898 -18.859 1.00 79.27  ? 522  PHE A CD2   1 
ATOM   3780  C  CE1   . PHE A 1 522  ? -61.910 -20.525 -19.944 1.00 77.73  ? 522  PHE A CE1   1 
ATOM   3781  C  CE2   . PHE A 1 522  ? -61.851 -22.920 -19.824 1.00 78.07  ? 522  PHE A CE2   1 
ATOM   3782  C  CZ    . PHE A 1 522  ? -61.383 -21.732 -20.367 1.00 77.10  ? 522  PHE A CZ    1 
ATOM   3783  N  N     . LEU A 1 523  ? -65.722 -21.211 -14.456 1.00 84.60  ? 523  LEU A N     1 
ATOM   3784  C  CA    . LEU A 1 523  ? -66.810 -21.194 -13.470 1.00 86.02  ? 523  LEU A CA    1 
ATOM   3785  C  C     . LEU A 1 523  ? -67.104 -19.772 -12.977 1.00 86.44  ? 523  LEU A C     1 
ATOM   3786  O  O     . LEU A 1 523  ? -68.263 -19.375 -12.880 1.00 87.60  ? 523  LEU A O     1 
ATOM   3787  C  CB    . LEU A 1 523  ? -66.447 -22.085 -12.277 1.00 87.24  ? 523  LEU A CB    1 
ATOM   3788  C  CG    . LEU A 1 523  ? -67.565 -22.675 -11.427 1.00 88.54  ? 523  LEU A CG    1 
ATOM   3789  C  CD1   . LEU A 1 523  ? -68.372 -23.694 -12.216 1.00 88.17  ? 523  LEU A CD1   1 
ATOM   3790  C  CD2   . LEU A 1 523  ? -66.956 -23.316 -10.192 1.00 89.52  ? 523  LEU A CD2   1 
ATOM   3791  N  N     . PHE A 1 524  ? -66.047 -19.019 -12.674 1.00 85.88  ? 524  PHE A N     1 
ATOM   3792  C  CA    . PHE A 1 524  ? -66.166 -17.609 -12.296 1.00 87.03  ? 524  PHE A CA    1 
ATOM   3793  C  C     . PHE A 1 524  ? -66.784 -16.769 -13.407 1.00 85.95  ? 524  PHE A C     1 
ATOM   3794  O  O     . PHE A 1 524  ? -67.689 -15.981 -13.163 1.00 87.67  ? 524  PHE A O     1 
ATOM   3795  C  CB    . PHE A 1 524  ? -64.795 -17.035 -11.921 1.00 87.12  ? 524  PHE A CB    1 
ATOM   3796  C  CG    . PHE A 1 524  ? -64.828 -15.585 -11.503 1.00 88.54  ? 524  PHE A CG    1 
ATOM   3797  C  CD1   . PHE A 1 524  ? -65.544 -15.186 -10.374 1.00 90.59  ? 524  PHE A CD1   1 
ATOM   3798  C  CD2   . PHE A 1 524  ? -64.131 -14.616 -12.227 1.00 87.57  ? 524  PHE A CD2   1 
ATOM   3799  C  CE1   . PHE A 1 524  ? -65.565 -13.851 -9.978  1.00 91.29  ? 524  PHE A CE1   1 
ATOM   3800  C  CE2   . PHE A 1 524  ? -64.155 -13.281 -11.838 1.00 88.46  ? 524  PHE A CE2   1 
ATOM   3801  C  CZ    . PHE A 1 524  ? -64.873 -12.898 -10.712 1.00 90.23  ? 524  PHE A CZ    1 
ATOM   3802  N  N     . LYS A 1 525  ? -66.289 -16.933 -14.623 1.00 84.06  ? 525  LYS A N     1 
ATOM   3803  C  CA    . LYS A 1 525  ? -66.802 -16.170 -15.759 1.00 83.94  ? 525  LYS A CA    1 
ATOM   3804  C  C     . LYS A 1 525  ? -68.287 -16.449 -16.019 1.00 83.26  ? 525  LYS A C     1 
ATOM   3805  O  O     . LYS A 1 525  ? -69.044 -15.535 -16.351 1.00 82.88  ? 525  LYS A O     1 
ATOM   3806  C  CB    . LYS A 1 525  ? -65.965 -16.452 -17.011 1.00 83.60  ? 525  LYS A CB    1 
ATOM   3807  C  CG    . LYS A 1 525  ? -64.558 -15.879 -16.920 1.00 84.59  ? 525  LYS A CG    1 
ATOM   3808  C  CD    . LYS A 1 525  ? -63.621 -16.475 -17.959 1.00 84.54  ? 525  LYS A CD    1 
ATOM   3809  C  CE    . LYS A 1 525  ? -63.804 -15.849 -19.334 1.00 84.32  ? 525  LYS A CE    1 
ATOM   3810  N  NZ    . LYS A 1 525  ? -63.093 -14.548 -19.448 1.00 84.70  ? 525  LYS A NZ    1 
ATOM   3811  N  N     . PHE A 1 526  ? -68.694 -17.707 -15.853 1.00 82.71  ? 526  PHE A N     1 
ATOM   3812  C  CA    . PHE A 1 526  ? -70.105 -18.092 -15.961 1.00 83.23  ? 526  PHE A CA    1 
ATOM   3813  C  C     . PHE A 1 526  ? -70.963 -17.441 -14.866 1.00 84.97  ? 526  PHE A C     1 
ATOM   3814  O  O     . PHE A 1 526  ? -72.054 -16.948 -15.152 1.00 84.75  ? 526  PHE A O     1 
ATOM   3815  C  CB    . PHE A 1 526  ? -70.261 -19.619 -15.918 1.00 82.73  ? 526  PHE A CB    1 
ATOM   3816  C  CG    . PHE A 1 526  ? -71.676 -20.097 -16.155 1.00 83.58  ? 526  PHE A CG    1 
ATOM   3817  C  CD1   . PHE A 1 526  ? -72.365 -19.734 -17.311 1.00 83.15  ? 526  PHE A CD1   1 
ATOM   3818  C  CD2   . PHE A 1 526  ? -72.320 -20.911 -15.226 1.00 84.84  ? 526  PHE A CD2   1 
ATOM   3819  C  CE1   . PHE A 1 526  ? -73.665 -20.167 -17.531 1.00 84.13  ? 526  PHE A CE1   1 
ATOM   3820  C  CE2   . PHE A 1 526  ? -73.619 -21.347 -15.440 1.00 85.82  ? 526  PHE A CE2   1 
ATOM   3821  C  CZ    . PHE A 1 526  ? -74.295 -20.977 -16.593 1.00 85.49  ? 526  PHE A CZ    1 
ATOM   3822  N  N     . TYR A 1 527  ? -70.469 -17.446 -13.629 1.00 85.86  ? 527  TYR A N     1 
ATOM   3823  C  CA    . TYR A 1 527  ? -71.130 -16.732 -12.540 1.00 89.29  ? 527  TYR A CA    1 
ATOM   3824  C  C     . TYR A 1 527  ? -71.429 -15.281 -12.937 1.00 90.11  ? 527  TYR A C     1 
ATOM   3825  O  O     . TYR A 1 527  ? -72.586 -14.849 -12.899 1.00 90.95  ? 527  TYR A O     1 
ATOM   3826  C  CB    . TYR A 1 527  ? -70.296 -16.781 -11.250 1.00 90.59  ? 527  TYR A CB    1 
ATOM   3827  C  CG    . TYR A 1 527  ? -70.753 -15.794 -10.192 1.00 93.21  ? 527  TYR A CG    1 
ATOM   3828  C  CD1   . TYR A 1 527  ? -72.018 -15.905 -9.607  1.00 94.74  ? 527  TYR A CD1   1 
ATOM   3829  C  CD2   . TYR A 1 527  ? -69.928 -14.745 -9.778  1.00 93.47  ? 527  TYR A CD2   1 
ATOM   3830  C  CE1   . TYR A 1 527  ? -72.444 -15.007 -8.639  1.00 96.63  ? 527  TYR A CE1   1 
ATOM   3831  C  CE2   . TYR A 1 527  ? -70.348 -13.841 -8.811  1.00 95.45  ? 527  TYR A CE2   1 
ATOM   3832  C  CZ    . TYR A 1 527  ? -71.605 -13.975 -8.245  1.00 97.18  ? 527  TYR A CZ    1 
ATOM   3833  O  OH    . TYR A 1 527  ? -72.021 -13.078 -7.283  1.00 100.33 ? 527  TYR A OH    1 
ATOM   3834  N  N     . LEU A 1 528  ? -70.380 -14.559 -13.331 1.00 89.60  ? 528  LEU A N     1 
ATOM   3835  C  CA    . LEU A 1 528  ? -70.482 -13.161 -13.775 1.00 90.04  ? 528  LEU A CA    1 
ATOM   3836  C  C     . LEU A 1 528  ? -71.477 -12.963 -14.908 1.00 89.51  ? 528  LEU A C     1 
ATOM   3837  O  O     . LEU A 1 528  ? -72.341 -12.087 -14.842 1.00 89.73  ? 528  LEU A O     1 
ATOM   3838  C  CB    . LEU A 1 528  ? -69.110 -12.648 -14.243 1.00 89.22  ? 528  LEU A CB    1 
ATOM   3839  C  CG    . LEU A 1 528  ? -68.171 -11.995 -13.223 1.00 90.43  ? 528  LEU A CG    1 
ATOM   3840  C  CD1   . LEU A 1 528  ? -68.254 -12.629 -11.843 1.00 92.08  ? 528  LEU A CD1   1 
ATOM   3841  C  CD2   . LEU A 1 528  ? -66.738 -12.024 -13.741 1.00 88.92  ? 528  LEU A CD2   1 
ATOM   3842  N  N     . GLU A 1 529  ? -71.331 -13.781 -15.944 1.00 88.89  ? 529  GLU A N     1 
ATOM   3843  C  CA    . GLU A 1 529  ? -72.096 -13.620 -17.180 1.00 89.32  ? 529  GLU A CA    1 
ATOM   3844  C  C     . GLU A 1 529  ? -73.587 -13.722 -16.912 1.00 91.59  ? 529  GLU A C     1 
ATOM   3845  O  O     . GLU A 1 529  ? -74.365 -12.836 -17.271 1.00 91.70  ? 529  GLU A O     1 
ATOM   3846  C  CB    . GLU A 1 529  ? -71.673 -14.671 -18.214 1.00 87.15  ? 529  GLU A CB    1 
ATOM   3847  C  CG    . GLU A 1 529  ? -72.220 -14.421 -19.614 1.00 86.63  ? 529  GLU A CG    1 
ATOM   3848  C  CD    . GLU A 1 529  ? -71.557 -15.287 -20.684 1.00 85.59  ? 529  GLU A CD    1 
ATOM   3849  O  OE1   . GLU A 1 529  ? -70.310 -15.459 -20.664 1.00 83.72  ? 529  GLU A OE1   1 
ATOM   3850  O  OE2   . GLU A 1 529  ? -72.288 -15.804 -21.562 1.00 85.70  ? 529  GLU A OE2   1 
ATOM   3851  N  N     . VAL A 1 530  ? -73.966 -14.803 -16.250 1.00 93.51  ? 530  VAL A N     1 
ATOM   3852  C  CA    . VAL A 1 530  ? -75.362 -15.086 -15.993 1.00 96.55  ? 530  VAL A CA    1 
ATOM   3853  C  C     . VAL A 1 530  ? -75.919 -14.251 -14.822 1.00 98.06  ? 530  VAL A C     1 
ATOM   3854  O  O     . VAL A 1 530  ? -77.128 -14.003 -14.762 1.00 98.23  ? 530  VAL A O     1 
ATOM   3855  C  CB    . VAL A 1 530  ? -75.582 -16.607 -15.807 1.00 98.58  ? 530  VAL A CB    1 
ATOM   3856  C  CG1   . VAL A 1 530  ? -75.216 -17.061 -14.402 1.00 100.44 ? 530  VAL A CG1   1 
ATOM   3857  C  CG2   . VAL A 1 530  ? -77.012 -16.990 -16.136 1.00 100.11 ? 530  VAL A CG2   1 
ATOM   3858  N  N     . SER A 1 531  ? -75.047 -13.795 -13.916 1.00 97.80  ? 531  SER A N     1 
ATOM   3859  C  CA    . SER A 1 531  ? -75.424 -12.765 -12.942 1.00 99.31  ? 531  SER A CA    1 
ATOM   3860  C  C     . SER A 1 531  ? -75.277 -11.398 -13.587 1.00 100.32 ? 531  SER A C     1 
ATOM   3861  O  O     . SER A 1 531  ? -74.568 -10.536 -13.086 1.00 101.53 ? 531  SER A O     1 
ATOM   3862  C  CB    . SER A 1 531  ? -74.592 -12.858 -11.660 1.00 99.18  ? 531  SER A CB    1 
ATOM   3863  O  OG    . SER A 1 531  ? -73.269 -12.418 -11.844 1.00 97.66  ? 531  SER A OG    1 
ATOM   3864  N  N     . GLN A 1 532  ? -75.966 -11.214 -14.705 1.00 101.60 ? 532  GLN A N     1 
ATOM   3865  C  CA    . GLN A 1 532  ? -75.980 -9.950  -15.431 1.00 103.08 ? 532  GLN A CA    1 
ATOM   3866  C  C     . GLN A 1 532  ? -77.160 -9.895  -16.392 1.00 103.37 ? 532  GLN A C     1 
ATOM   3867  O  O     . GLN A 1 532  ? -77.821 -8.857  -16.496 1.00 104.87 ? 532  GLN A O     1 
ATOM   3868  C  CB    . GLN A 1 532  ? -74.688 -9.727  -16.197 1.00 102.56 ? 532  GLN A CB    1 
ATOM   3869  C  CG    . GLN A 1 532  ? -74.555 -8.295  -16.674 1.00 104.52 ? 532  GLN A CG    1 
ATOM   3870  C  CD    . GLN A 1 532  ? -73.421 -8.120  -17.644 1.00 105.15 ? 532  GLN A CD    1 
ATOM   3871  O  OE1   . GLN A 1 532  ? -73.343 -8.817  -18.657 1.00 105.53 ? 532  GLN A OE1   1 
ATOM   3872  N  NE2   . GLN A 1 532  ? -72.534 -7.178  -17.351 1.00 106.94 ? 532  GLN A NE2   1 
ATOM   3873  N  N     . ILE A 1 533  ? -77.391 -10.990 -17.120 1.00 101.93 ? 533  ILE A N     1 
ATOM   3874  C  CA    . ILE A 1 533  ? -78.684 -11.225 -17.778 1.00 102.80 ? 533  ILE A CA    1 
ATOM   3875  C  C     . ILE A 1 533  ? -79.834 -11.234 -16.749 1.00 103.43 ? 533  ILE A C     1 
ATOM   3876  O  O     . ILE A 1 533  ? -80.935 -10.761 -17.042 1.00 104.04 ? 533  ILE A O     1 
ATOM   3877  C  CB    . ILE A 1 533  ? -78.679 -12.512 -18.660 1.00 103.27 ? 533  ILE A CB    1 
ATOM   3878  C  CG1   . ILE A 1 533  ? -79.978 -12.654 -19.471 1.00 105.08 ? 533  ILE A CG1   1 
ATOM   3879  C  CG2   . ILE A 1 533  ? -78.485 -13.773 -17.831 1.00 103.60 ? 533  ILE A CG2   1 
ATOM   3880  C  CD1   . ILE A 1 533  ? -80.353 -11.443 -20.302 1.00 106.28 ? 533  ILE A CD1   1 
ATOM   3881  N  N     . LEU A 1 534  ? -79.570 -11.766 -15.554 1.00 102.01 ? 534  LEU A N     1 
ATOM   3882  C  CA    . LEU A 1 534  ? -80.491 -11.636 -14.424 1.00 102.45 ? 534  LEU A CA    1 
ATOM   3883  C  C     . LEU A 1 534  ? -80.688 -10.172 -14.013 1.00 103.53 ? 534  LEU A C     1 
ATOM   3884  O  O     . LEU A 1 534  ? -81.827 -9.727  -13.829 1.00 104.48 ? 534  LEU A O     1 
ATOM   3885  C  CB    . LEU A 1 534  ? -80.010 -12.458 -13.215 1.00 102.31 ? 534  LEU A CB    1 
ATOM   3886  C  CG    . LEU A 1 534  ? -80.173 -13.986 -13.261 1.00 101.02 ? 534  LEU A CG    1 
ATOM   3887  C  CD1   . LEU A 1 534  ? -79.543 -14.654 -12.044 1.00 100.91 ? 534  LEU A CD1   1 
ATOM   3888  C  CD2   . LEU A 1 534  ? -81.635 -14.390 -13.378 1.00 102.08 ? 534  LEU A CD2   1 
ATOM   3889  N  N     . LYS A 1 535  ? -79.586 -9.436  -13.861 1.00 102.26 ? 535  LYS A N     1 
ATOM   3890  C  CA    . LYS A 1 535  ? -79.648 -8.003  -13.548 1.00 102.95 ? 535  LYS A CA    1 
ATOM   3891  C  C     . LYS A 1 535  ? -80.403 -7.241  -14.632 1.00 103.11 ? 535  LYS A C     1 
ATOM   3892  O  O     . LYS A 1 535  ? -81.241 -6.396  -14.334 1.00 104.93 ? 535  LYS A O     1 
ATOM   3893  C  CB    . LYS A 1 535  ? -78.237 -7.429  -13.384 1.00 102.17 ? 535  LYS A CB    1 
ATOM   3894  C  CG    . LYS A 1 535  ? -78.156 -5.929  -13.126 1.00 103.32 ? 535  LYS A CG    1 
ATOM   3895  C  CD    . LYS A 1 535  ? -78.884 -5.539  -11.856 1.00 105.98 ? 535  LYS A CD    1 
ATOM   3896  C  CE    . LYS A 1 535  ? -78.672 -4.076  -11.522 1.00 107.08 ? 535  LYS A CE    1 
ATOM   3897  N  NZ    . LYS A 1 535  ? -79.317 -3.704  -10.229 1.00 109.16 ? 535  LYS A NZ    1 
ATOM   3898  N  N     . LYS A 1 536  ? -80.095 -7.556  -15.885 1.00 102.21 ? 536  LYS A N     1 
ATOM   3899  C  CA    . LYS A 1 536  ? -80.763 -6.977  -17.051 1.00 103.66 ? 536  LYS A CA    1 
ATOM   3900  C  C     . LYS A 1 536  ? -82.275 -7.213  -17.006 1.00 104.86 ? 536  LYS A C     1 
ATOM   3901  O  O     . LYS A 1 536  ? -83.063 -6.271  -17.073 1.00 105.81 ? 536  LYS A O     1 
ATOM   3902  C  CB    . LYS A 1 536  ? -80.156 -7.583  -18.331 1.00 103.15 ? 536  LYS A CB    1 
ATOM   3903  C  CG    . LYS A 1 536  ? -80.749 -7.119  -19.656 1.00 104.62 ? 536  LYS A CG    1 
ATOM   3904  C  CD    . LYS A 1 536  ? -80.560 -5.624  -19.889 1.00 106.16 ? 536  LYS A CD    1 
ATOM   3905  C  CE    . LYS A 1 536  ? -81.096 -5.195  -21.251 1.00 106.59 ? 536  LYS A CE    1 
ATOM   3906  N  NZ    . LYS A 1 536  ? -80.440 -5.908  -22.388 1.00 104.48 ? 536  LYS A NZ    1 
ATOM   3907  N  N     . MET A 1 537  ? -82.657 -8.479  -16.871 1.00 105.14 ? 537  MET A N     1 
ATOM   3908  C  CA    . MET A 1 537  ? -84.065 -8.889  -16.861 1.00 106.26 ? 537  MET A CA    1 
ATOM   3909  C  C     . MET A 1 537  ? -84.847 -8.499  -15.611 1.00 108.55 ? 537  MET A C     1 
ATOM   3910  O  O     . MET A 1 537  ? -86.050 -8.289  -15.698 1.00 110.01 ? 537  MET A O     1 
ATOM   3911  C  CB    . MET A 1 537  ? -84.174 -10.405 -17.021 1.00 105.30 ? 537  MET A CB    1 
ATOM   3912  C  CG    . MET A 1 537  ? -83.817 -10.920 -18.396 1.00 102.69 ? 537  MET A CG    1 
ATOM   3913  S  SD    . MET A 1 537  ? -83.677 -12.709 -18.345 1.00 102.05 ? 537  MET A SD    1 
ATOM   3914  C  CE    . MET A 1 537  ? -85.392 -13.195 -18.175 1.00 104.00 ? 537  MET A CE    1 
ATOM   3915  N  N     . ASP A 1 538  ? -84.179 -8.437  -14.458 1.00 109.94 ? 538  ASP A N     1 
ATOM   3916  C  CA    . ASP A 1 538  ? -84.844 -8.181  -13.172 1.00 112.93 ? 538  ASP A CA    1 
ATOM   3917  C  C     . ASP A 1 538  ? -83.990 -7.225  -12.312 1.00 113.81 ? 538  ASP A C     1 
ATOM   3918  O  O     . ASP A 1 538  ? -83.365 -7.656  -11.340 1.00 112.98 ? 538  ASP A O     1 
ATOM   3919  C  CB    . ASP A 1 538  ? -85.100 -9.523  -12.465 1.00 113.91 ? 538  ASP A CB    1 
ATOM   3920  C  CG    . ASP A 1 538  ? -86.090 -9.419  -11.313 1.00 117.42 ? 538  ASP A CG    1 
ATOM   3921  O  OD1   . ASP A 1 538  ? -86.438 -8.299  -10.878 1.00 120.26 ? 538  ASP A OD1   1 
ATOM   3922  O  OD2   . ASP A 1 538  ? -86.531 -10.478 -10.817 1.00 118.92 ? 538  ASP A OD2   1 
ATOM   3923  N  N     . PRO A 1 539  ? -83.972 -5.918  -12.667 1.00 115.52 ? 539  PRO A N     1 
ATOM   3924  C  CA    . PRO A 1 539  ? -83.052 -4.944  -12.049 1.00 115.77 ? 539  PRO A CA    1 
ATOM   3925  C  C     . PRO A 1 539  ? -83.177 -4.761  -10.536 1.00 117.22 ? 539  PRO A C     1 
ATOM   3926  O  O     . PRO A 1 539  ? -82.154 -4.707  -9.849  1.00 116.94 ? 539  PRO A O     1 
ATOM   3927  C  CB    . PRO A 1 539  ? -83.392 -3.629  -12.769 1.00 116.26 ? 539  PRO A CB    1 
ATOM   3928  C  CG    . PRO A 1 539  ? -84.012 -4.046  -14.052 1.00 115.59 ? 539  PRO A CG    1 
ATOM   3929  C  CD    . PRO A 1 539  ? -84.801 -5.271  -13.704 1.00 116.19 ? 539  PRO A CD    1 
ATOM   3930  N  N     . VAL A 1 540  ? -84.404 -4.664  -10.029 1.00 118.76 ? 540  VAL A N     1 
ATOM   3931  C  CA    . VAL A 1 540  ? -84.615 -4.410  -8.593  1.00 120.93 ? 540  VAL A CA    1 
ATOM   3932  C  C     . VAL A 1 540  ? -84.213 -5.582  -7.683  1.00 120.94 ? 540  VAL A C     1 
ATOM   3933  O  O     . VAL A 1 540  ? -83.695 -5.355  -6.588  1.00 121.91 ? 540  VAL A O     1 
ATOM   3934  C  CB    . VAL A 1 540  ? -86.062 -3.949  -8.267  1.00 122.90 ? 540  VAL A CB    1 
ATOM   3935  C  CG1   . VAL A 1 540  ? -86.400 -2.673  -9.025  1.00 123.06 ? 540  VAL A CG1   1 
ATOM   3936  C  CG2   . VAL A 1 540  ? -87.089 -5.047  -8.538  1.00 123.21 ? 540  VAL A CG2   1 
ATOM   3937  N  N     . HIS A 1 541  ? -84.424 -6.818  -8.141  1.00 120.18 ? 541  HIS A N     1 
ATOM   3938  C  CA    . HIS A 1 541  ? -84.170 -8.021  -7.320  1.00 120.63 ? 541  HIS A CA    1 
ATOM   3939  C  C     . HIS A 1 541  ? -82.735 -8.575  -7.355  1.00 119.09 ? 541  HIS A C     1 
ATOM   3940  O  O     . HIS A 1 541  ? -82.414 -9.470  -6.570  1.00 119.12 ? 541  HIS A O     1 
ATOM   3941  C  CB    . HIS A 1 541  ? -85.159 -9.137  -7.693  1.00 120.50 ? 541  HIS A CB    1 
ATOM   3942  C  CG    . HIS A 1 541  ? -86.582 -8.805  -7.376  1.00 122.53 ? 541  HIS A CG    1 
ATOM   3943  N  ND1   . HIS A 1 541  ? -87.509 -8.485  -8.345  1.00 122.78 ? 541  HIS A ND1   1 
ATOM   3944  C  CD2   . HIS A 1 541  ? -87.232 -8.719  -6.192  1.00 124.29 ? 541  HIS A CD2   1 
ATOM   3945  C  CE1   . HIS A 1 541  ? -88.670 -8.223  -7.773  1.00 124.41 ? 541  HIS A CE1   1 
ATOM   3946  N  NE2   . HIS A 1 541  ? -88.529 -8.360  -6.467  1.00 125.94 ? 541  HIS A NE2   1 
ATOM   3947  N  N     . TYR A 1 542  ? -81.886 -8.065  -8.250  1.00 117.97 ? 542  TYR A N     1 
ATOM   3948  C  CA    . TYR A 1 542  ? -80.497 -8.534  -8.361  1.00 116.77 ? 542  TYR A CA    1 
ATOM   3949  C  C     . TYR A 1 542  ? -79.502 -7.379  -8.290  1.00 116.60 ? 542  TYR A C     1 
ATOM   3950  O  O     . TYR A 1 542  ? -79.816 -6.269  -8.727  1.00 116.50 ? 542  TYR A O     1 
ATOM   3951  C  CB    . TYR A 1 542  ? -80.300 -9.322  -9.656  1.00 114.62 ? 542  TYR A CB    1 
ATOM   3952  C  CG    . TYR A 1 542  ? -81.052 -10.627 -9.647  1.00 115.04 ? 542  TYR A CG    1 
ATOM   3953  C  CD1   . TYR A 1 542  ? -82.405 -10.675 -10.000 1.00 116.27 ? 542  TYR A CD1   1 
ATOM   3954  C  CD2   . TYR A 1 542  ? -80.429 -11.815 -9.259  1.00 113.95 ? 542  TYR A CD2   1 
ATOM   3955  C  CE1   . TYR A 1 542  ? -83.111 -11.869 -9.984  1.00 116.15 ? 542  TYR A CE1   1 
ATOM   3956  C  CE2   . TYR A 1 542  ? -81.131 -13.016 -9.237  1.00 114.17 ? 542  TYR A CE2   1 
ATOM   3957  C  CZ    . TYR A 1 542  ? -82.469 -13.035 -9.604  1.00 114.98 ? 542  TYR A CZ    1 
ATOM   3958  O  OH    . TYR A 1 542  ? -83.174 -14.208 -9.587  1.00 115.12 ? 542  TYR A OH    1 
ATOM   3959  N  N     . PRO A 1 543  ? -78.293 -7.640  -7.745  1.00 116.42 ? 543  PRO A N     1 
ATOM   3960  C  CA    . PRO A 1 543  ? -77.283 -6.591  -7.599  1.00 116.31 ? 543  PRO A CA    1 
ATOM   3961  C  C     . PRO A 1 543  ? -76.484 -6.347  -8.882  1.00 114.32 ? 543  PRO A C     1 
ATOM   3962  O  O     . PRO A 1 543  ? -76.329 -7.256  -9.708  1.00 112.38 ? 543  PRO A O     1 
ATOM   3963  C  CB    . PRO A 1 543  ? -76.373 -7.150  -6.506  1.00 116.43 ? 543  PRO A CB    1 
ATOM   3964  C  CG    . PRO A 1 543  ? -76.420 -8.623  -6.718  1.00 115.47 ? 543  PRO A CG    1 
ATOM   3965  C  CD    . PRO A 1 543  ? -77.782 -8.945  -7.277  1.00 115.75 ? 543  PRO A CD    1 
ATOM   3966  N  N     . SER A 1 544  ? -75.980 -5.124  -9.026  1.00 114.35 ? 544  SER A N     1 
ATOM   3967  C  CA    . SER A 1 544  ? -75.147 -4.752  -10.167 1.00 112.59 ? 544  SER A CA    1 
ATOM   3968  C  C     . SER A 1 544  ? -73.716 -5.262  -9.954  1.00 111.65 ? 544  SER A C     1 
ATOM   3969  O  O     . SER A 1 544  ? -73.281 -5.447  -8.814  1.00 112.29 ? 544  SER A O     1 
ATOM   3970  C  CB    . SER A 1 544  ? -75.157 -3.232  -10.357 1.00 112.97 ? 544  SER A CB    1 
ATOM   3971  O  OG    . SER A 1 544  ? -74.895 -2.889  -11.704 1.00 111.34 ? 544  SER A OG    1 
ATOM   3972  N  N     . LEU A 1 545  ? -72.994 -5.485  -11.051 1.00 109.81 ? 545  LEU A N     1 
ATOM   3973  C  CA    . LEU A 1 545  ? -71.610 -5.977  -10.983 1.00 109.63 ? 545  LEU A CA    1 
ATOM   3974  C  C     . LEU A 1 545  ? -70.674 -4.886  -10.450 1.00 111.33 ? 545  LEU A C     1 
ATOM   3975  O  O     . LEU A 1 545  ? -70.913 -3.700  -10.680 1.00 112.81 ? 545  LEU A O     1 
ATOM   3976  C  CB    . LEU A 1 545  ? -71.107 -6.445  -12.357 1.00 107.06 ? 545  LEU A CB    1 
ATOM   3977  C  CG    . LEU A 1 545  ? -71.653 -7.752  -12.936 1.00 105.63 ? 545  LEU A CG    1 
ATOM   3978  C  CD1   . LEU A 1 545  ? -73.106 -7.612  -13.378 1.00 106.27 ? 545  LEU A CD1   1 
ATOM   3979  C  CD2   . LEU A 1 545  ? -70.772 -8.212  -14.091 1.00 102.63 ? 545  LEU A CD2   1 
ATOM   3980  N  N     . ALA A 1 546  ? -69.616 -5.296  -9.746  1.00 112.24 ? 546  ALA A N     1 
ATOM   3981  C  CA    . ALA A 1 546  ? -68.584 -4.371  -9.256  1.00 113.33 ? 546  ALA A CA    1 
ATOM   3982  C  C     . ALA A 1 546  ? -67.927 -3.691  -10.448 1.00 112.44 ? 546  ALA A C     1 
ATOM   3983  O  O     . ALA A 1 546  ? -67.655 -4.350  -11.445 1.00 110.31 ? 546  ALA A O     1 
ATOM   3984  C  CB    . ALA A 1 546  ? -67.540 -5.114  -8.435  1.00 113.23 ? 546  ALA A CB    1 
ATOM   3985  N  N     . ASP A 1 547  ? -67.677 -2.385  -10.342 1.00 114.09 ? 547  ASP A N     1 
ATOM   3986  C  CA    . ASP A 1 547  ? -67.266 -1.565  -11.500 1.00 113.17 ? 547  ASP A CA    1 
ATOM   3987  C  C     . ASP A 1 547  ? -65.970 -2.003  -12.189 1.00 111.22 ? 547  ASP A C     1 
ATOM   3988  O  O     . ASP A 1 547  ? -65.848 -1.877  -13.413 1.00 110.82 ? 547  ASP A O     1 
ATOM   3989  C  CB    . ASP A 1 547  ? -67.170 -0.089  -11.108 1.00 115.28 ? 547  ASP A CB    1 
ATOM   3990  C  CG    . ASP A 1 547  ? -68.530 0.543   -10.909 1.00 117.44 ? 547  ASP A CG    1 
ATOM   3991  O  OD1   . ASP A 1 547  ? -69.340 0.496   -11.861 1.00 117.73 ? 547  ASP A OD1   1 
ATOM   3992  O  OD2   . ASP A 1 547  ? -68.788 1.084   -9.811  1.00 119.13 ? 547  ASP A OD2   1 
ATOM   3993  N  N     . LYS A 1 548  ? -65.025 -2.534  -11.412 1.00 109.87 ? 548  LYS A N     1 
ATOM   3994  C  CA    . LYS A 1 548  ? -63.750 -3.043  -11.953 1.00 106.02 ? 548  LYS A CA    1 
ATOM   3995  C  C     . LYS A 1 548  ? -63.802 -4.508  -12.434 1.00 102.85 ? 548  LYS A C     1 
ATOM   3996  O  O     . LYS A 1 548  ? -62.755 -5.109  -12.668 1.00 101.71 ? 548  LYS A O     1 
ATOM   3997  C  CB    . LYS A 1 548  ? -62.621 -2.843  -10.920 1.00 106.65 ? 548  LYS A CB    1 
ATOM   3998  C  CG    . LYS A 1 548  ? -62.683 -3.754  -9.697  1.00 107.77 ? 548  LYS A CG    1 
ATOM   3999  C  CD    . LYS A 1 548  ? -61.825 -3.236  -8.550  1.00 108.99 ? 548  LYS A CD    1 
ATOM   4000  C  CE    . LYS A 1 548  ? -61.694 -4.279  -7.444  1.00 109.70 ? 548  LYS A CE    1 
ATOM   4001  N  NZ    . LYS A 1 548  ? -62.999 -4.727  -6.882  1.00 110.53 ? 548  LYS A NZ    1 
ATOM   4002  N  N     . TYR A 1 549  ? -65.004 -5.073  -12.579 1.00 102.05 ? 549  TYR A N     1 
ATOM   4003  C  CA    . TYR A 1 549  ? -65.196 -6.476  -12.971 1.00 100.63 ? 549  TYR A CA    1 
ATOM   4004  C  C     . TYR A 1 549  ? -65.763 -6.678  -14.396 1.00 98.79  ? 549  TYR A C     1 
ATOM   4005  O  O     . TYR A 1 549  ? -65.523 -7.727  -14.985 1.00 97.41  ? 549  TYR A O     1 
ATOM   4006  C  CB    . TYR A 1 549  ? -66.108 -7.188  -11.947 1.00 102.35 ? 549  TYR A CB    1 
ATOM   4007  C  CG    . TYR A 1 549  ? -65.424 -7.791  -10.717 1.00 103.03 ? 549  TYR A CG    1 
ATOM   4008  C  CD1   . TYR A 1 549  ? -64.309 -7.186  -10.113 1.00 103.30 ? 549  TYR A CD1   1 
ATOM   4009  C  CD2   . TYR A 1 549  ? -65.920 -8.965  -10.136 1.00 102.89 ? 549  TYR A CD2   1 
ATOM   4010  C  CE1   . TYR A 1 549  ? -63.706 -7.748  -8.991  1.00 103.99 ? 549  TYR A CE1   1 
ATOM   4011  C  CE2   . TYR A 1 549  ? -65.322 -9.528  -9.014  1.00 103.50 ? 549  TYR A CE2   1 
ATOM   4012  C  CZ    . TYR A 1 549  ? -64.219 -8.919  -8.445  1.00 104.19 ? 549  TYR A CZ    1 
ATOM   4013  O  OH    . TYR A 1 549  ? -63.629 -9.483  -7.338  1.00 105.27 ? 549  TYR A OH    1 
ATOM   4014  N  N     . GLU A 1 550  ? -66.496 -5.700  -14.944 1.00 99.01  ? 550  GLU A N     1 
ATOM   4015  C  CA    . GLU A 1 550  ? -67.209 -5.860  -16.237 1.00 97.89  ? 550  GLU A CA    1 
ATOM   4016  C  C     . GLU A 1 550  ? -66.371 -6.359  -17.418 1.00 95.23  ? 550  GLU A C     1 
ATOM   4017  O  O     . GLU A 1 550  ? -66.882 -7.097  -18.263 1.00 94.35  ? 550  GLU A O     1 
ATOM   4018  C  CB    . GLU A 1 550  ? -67.913 -4.561  -16.672 1.00 99.94  ? 550  GLU A CB    1 
ATOM   4019  C  CG    . GLU A 1 550  ? -69.315 -4.357  -16.103 1.00 103.96 ? 550  GLU A CG    1 
ATOM   4020  C  CD    . GLU A 1 550  ? -69.348 -3.673  -14.745 1.00 108.47 ? 550  GLU A CD    1 
ATOM   4021  O  OE1   . GLU A 1 550  ? -68.278 -3.484  -14.128 1.00 111.61 ? 550  GLU A OE1   1 
ATOM   4022  O  OE2   . GLU A 1 550  ? -70.458 -3.314  -14.286 1.00 112.22 ? 550  GLU A OE2   1 
ATOM   4023  N  N     . SER A 1 551  ? -65.103 -5.958  -17.486 1.00 93.80  ? 551  SER A N     1 
ATOM   4024  C  CA    . SER A 1 551  ? -64.243 -6.325  -18.622 1.00 91.02  ? 551  SER A CA    1 
ATOM   4025  C  C     . SER A 1 551  ? -63.942 -7.836  -18.728 1.00 90.43  ? 551  SER A C     1 
ATOM   4026  O  O     . SER A 1 551  ? -63.527 -8.315  -19.789 1.00 87.43  ? 551  SER A O     1 
ATOM   4027  C  CB    . SER A 1 551  ? -62.946 -5.512  -18.624 1.00 89.83  ? 551  SER A CB    1 
ATOM   4028  O  OG    . SER A 1 551  ? -62.192 -5.726  -17.445 1.00 89.94  ? 551  SER A OG    1 
ATOM   4029  N  N     . ALA A 1 552  ? -64.162 -8.579  -17.641 1.00 92.10  ? 552  ALA A N     1 
ATOM   4030  C  CA    . ALA A 1 552  ? -64.077 -10.048 -17.653 1.00 92.12  ? 552  ALA A CA    1 
ATOM   4031  C  C     . ALA A 1 552  ? -65.044 -10.738 -18.625 1.00 92.22  ? 552  ALA A C     1 
ATOM   4032  O  O     . ALA A 1 552  ? -64.758 -11.844 -19.063 1.00 90.68  ? 552  ALA A O     1 
ATOM   4033  C  CB    . ALA A 1 552  ? -64.285 -10.600 -16.247 1.00 92.84  ? 552  ALA A CB    1 
ATOM   4034  N  N     . LEU A 1 553  ? -66.165 -10.094 -18.961 1.00 95.64  ? 553  LEU A N     1 
ATOM   4035  C  CA    . LEU A 1 553  ? -67.210 -10.705 -19.801 1.00 98.28  ? 553  LEU A CA    1 
ATOM   4036  C  C     . LEU A 1 553  ? -66.909 -10.675 -21.310 1.00 99.66  ? 553  LEU A C     1 
ATOM   4037  O  O     . LEU A 1 553  ? -66.862 -11.727 -21.953 1.00 98.25  ? 553  LEU A O     1 
ATOM   4038  C  CB    . LEU A 1 553  ? -68.581 -10.072 -19.517 1.00 100.30 ? 553  LEU A CB    1 
ATOM   4039  C  CG    . LEU A 1 553  ? -69.258 -10.554 -18.228 1.00 102.38 ? 553  LEU A CG    1 
ATOM   4040  C  CD1   . LEU A 1 553  ? -68.501 -10.110 -16.981 1.00 103.17 ? 553  LEU A CD1   1 
ATOM   4041  C  CD2   . LEU A 1 553  ? -70.697 -10.072 -18.179 1.00 103.65 ? 553  LEU A CD2   1 
ATOM   4042  N  N     . GLU A 1 554  ? -66.742 -9.479  -21.875 1.00 104.31 ? 554  GLU A N     1 
ATOM   4043  C  CA    . GLU A 1 554  ? -66.331 -9.339  -23.288 1.00 107.93 ? 554  GLU A CA    1 
ATOM   4044  C  C     . GLU A 1 554  ? -64.875 -9.780  -23.461 1.00 106.97 ? 554  GLU A C     1 
ATOM   4045  O  O     . GLU A 1 554  ? -64.045 -9.519  -22.598 1.00 105.48 ? 554  GLU A O     1 
ATOM   4046  C  CB    . GLU A 1 554  ? -66.567 -7.906  -23.833 1.00 110.87 ? 554  GLU A CB    1 
ATOM   4047  C  CG    . GLU A 1 554  ? -65.535 -6.820  -23.500 1.00 112.13 ? 554  GLU A CG    1 
ATOM   4048  C  CD    . GLU A 1 554  ? -65.613 -6.322  -22.065 1.00 115.80 ? 554  GLU A CD    1 
ATOM   4049  O  OE1   . GLU A 1 554  ? -66.068 -7.089  -21.188 1.00 118.21 ? 554  GLU A OE1   1 
ATOM   4050  O  OE2   . GLU A 1 554  ? -65.218 -5.162  -21.803 1.00 117.86 ? 554  GLU A OE2   1 
ATOM   4051  N  N     . ASP A 1 555  ? -64.584 -10.459 -24.567 1.00 108.98 ? 555  ASP A N     1 
ATOM   4052  C  CA    . ASP A 1 555  ? -63.248 -11.001 -24.816 1.00 111.82 ? 555  ASP A CA    1 
ATOM   4053  C  C     . ASP A 1 555  ? -62.588 -10.246 -25.980 1.00 110.58 ? 555  ASP A C     1 
ATOM   4054  O  O     . ASP A 1 555  ? -63.161 -9.280  -26.503 1.00 109.84 ? 555  ASP A O     1 
ATOM   4055  C  CB    . ASP A 1 555  ? -63.324 -12.526 -25.063 1.00 113.85 ? 555  ASP A CB    1 
ATOM   4056  C  CG    . ASP A 1 555  ? -62.124 -13.309 -24.462 1.00 116.21 ? 555  ASP A CG    1 
ATOM   4057  O  OD1   . ASP A 1 555  ? -61.134 -12.699 -23.981 1.00 116.07 ? 555  ASP A OD1   1 
ATOM   4058  O  OD2   . ASP A 1 555  ? -62.174 -14.561 -24.488 1.00 116.41 ? 555  ASP A OD2   1 
ATOM   4059  N  N     . LEU A 1 556  ? -61.399 -10.706 -26.376 1.00 108.56 ? 556  LEU A N     1 
ATOM   4060  C  CA    . LEU A 1 556  ? -60.455 -9.948  -27.190 1.00 107.43 ? 556  LEU A CA    1 
ATOM   4061  C  C     . LEU A 1 556  ? -60.492 -10.467 -28.634 1.00 108.68 ? 556  LEU A C     1 
ATOM   4062  O  O     . LEU A 1 556  ? -59.978 -11.553 -28.924 1.00 107.25 ? 556  LEU A O     1 
ATOM   4063  C  CB    . LEU A 1 556  ? -59.047 -10.094 -26.587 1.00 105.46 ? 556  LEU A CB    1 
ATOM   4064  C  CG    . LEU A 1 556  ? -58.940 -10.090 -25.053 1.00 104.57 ? 556  LEU A CG    1 
ATOM   4065  C  CD1   . LEU A 1 556  ? -57.532 -10.421 -24.592 1.00 103.77 ? 556  LEU A CD1   1 
ATOM   4066  C  CD2   . LEU A 1 556  ? -59.390 -8.752  -24.499 1.00 105.94 ? 556  LEU A CD2   1 
ATOM   4067  N  N     . HIS A 1 557  ? -61.105 -9.691  -29.531 1.00 112.35 ? 557  HIS A N     1 
ATOM   4068  C  CA    . HIS A 1 557  ? -61.370 -10.141 -30.908 1.00 114.41 ? 557  HIS A CA    1 
ATOM   4069  C  C     . HIS A 1 557  ? -61.221 -9.023  -31.957 1.00 112.58 ? 557  HIS A C     1 
ATOM   4070  O  O     . HIS A 1 557  ? -62.176 -8.643  -32.639 1.00 113.03 ? 557  HIS A O     1 
ATOM   4071  C  CB    . HIS A 1 557  ? -62.755 -10.822 -30.991 1.00 118.81 ? 557  HIS A CB    1 
ATOM   4072  C  CG    . HIS A 1 557  ? -63.887 -9.975  -30.482 1.00 124.06 ? 557  HIS A CG    1 
ATOM   4073  N  ND1   . HIS A 1 557  ? -64.486 -8.993  -31.245 1.00 125.89 ? 557  HIS A ND1   1 
ATOM   4074  C  CD2   . HIS A 1 557  ? -64.529 -9.967  -29.289 1.00 126.68 ? 557  HIS A CD2   1 
ATOM   4075  C  CE1   . HIS A 1 557  ? -65.444 -8.414  -30.543 1.00 128.07 ? 557  HIS A CE1   1 
ATOM   4076  N  NE2   . HIS A 1 557  ? -65.489 -8.985  -29.352 1.00 128.82 ? 557  HIS A NE2   1 
ATOM   4077  N  N     . SER A 1 558  ? -60.004 -8.500  -32.074 1.00 110.76 ? 558  SER A N     1 
ATOM   4078  C  CA    . SER A 1 558  ? -59.603 -7.648  -33.204 1.00 109.85 ? 558  SER A CA    1 
ATOM   4079  C  C     . SER A 1 558  ? -60.438 -6.371  -33.350 1.00 109.26 ? 558  SER A C     1 
ATOM   4080  O  O     . SER A 1 558  ? -59.957 -5.271  -33.079 1.00 108.50 ? 558  SER A O     1 
ATOM   4081  C  CB    . SER A 1 558  ? -59.602 -8.465  -34.513 1.00 108.61 ? 558  SER A CB    1 
ATOM   4082  O  OG    . SER A 1 558  ? -60.903 -8.628  -35.064 1.00 107.44 ? 558  SER A OG    1 
ATOM   4083  N  N     . HIS A 1 560  ? -60.372 -6.627  -36.940 1.00 106.51 ? 560  HIS A N     1 
ATOM   4084  C  CA    . HIS A 1 560  ? -59.805 -5.600  -37.807 1.00 108.16 ? 560  HIS A CA    1 
ATOM   4085  C  C     . HIS A 1 560  ? -58.279 -5.659  -37.848 1.00 105.82 ? 560  HIS A C     1 
ATOM   4086  O  O     . HIS A 1 560  ? -57.631 -6.065  -36.876 1.00 103.60 ? 560  HIS A O     1 
ATOM   4087  C  CB    . HIS A 1 560  ? -60.282 -4.215  -37.371 1.00 110.83 ? 560  HIS A CB    1 
ATOM   4088  C  CG    . HIS A 1 560  ? -61.750 -4.015  -37.557 1.00 114.47 ? 560  HIS A CG    1 
ATOM   4089  N  ND1   . HIS A 1 560  ? -62.692 -4.675  -36.796 1.00 116.66 ? 560  HIS A ND1   1 
ATOM   4090  C  CD2   . HIS A 1 560  ? -62.442 -3.255  -38.437 1.00 116.40 ? 560  HIS A CD2   1 
ATOM   4091  C  CE1   . HIS A 1 560  ? -63.902 -4.317  -37.188 1.00 117.76 ? 560  HIS A CE1   1 
ATOM   4092  N  NE2   . HIS A 1 560  ? -63.778 -3.456  -38.182 1.00 118.84 ? 560  HIS A NE2   1 
ATOM   4093  N  N     . HIS A 1 561  ? -57.727 -5.258  -38.994 1.00 104.55 ? 561  HIS A N     1 
ATOM   4094  C  CA    . HIS A 1 561  ? -56.290 -5.325  -39.270 1.00 102.82 ? 561  HIS A CA    1 
ATOM   4095  C  C     . HIS A 1 561  ? -55.870 -4.114  -40.108 1.00 101.83 ? 561  HIS A C     1 
ATOM   4096  O  O     . HIS A 1 561  ? -56.033 -4.109  -41.327 1.00 102.13 ? 561  HIS A O     1 
ATOM   4097  C  CB    . HIS A 1 561  ? -55.938 -6.639  -39.981 1.00 101.01 ? 561  HIS A CB    1 
ATOM   4098  C  CG    . HIS A 1 561  ? -56.183 -7.857  -39.143 1.00 101.86 ? 561  HIS A CG    1 
ATOM   4099  N  ND1   . HIS A 1 561  ? -55.417 -8.166  -38.038 1.00 102.26 ? 561  HIS A ND1   1 
ATOM   4100  C  CD2   . HIS A 1 561  ? -57.122 -8.829  -39.232 1.00 102.82 ? 561  HIS A CD2   1 
ATOM   4101  C  CE1   . HIS A 1 561  ? -55.868 -9.280  -37.488 1.00 101.93 ? 561  HIS A CE1   1 
ATOM   4102  N  NE2   . HIS A 1 561  ? -56.901 -9.704  -38.194 1.00 103.20 ? 561  HIS A NE2   1 
ATOM   4103  N  N     . CYS A 1 562  ? -55.344 -3.095  -39.425 1.00 101.43 ? 562  CYS A N     1 
ATOM   4104  C  CA    . CYS A 1 562  ? -54.946 -1.809  -40.019 1.00 100.78 ? 562  CYS A CA    1 
ATOM   4105  C  C     . CYS A 1 562  ? -53.414 -1.692  -40.125 1.00 94.83  ? 562  CYS A C     1 
ATOM   4106  O  O     . CYS A 1 562  ? -52.686 -2.252  -39.296 1.00 92.99  ? 562  CYS A O     1 
ATOM   4107  C  CB    . CYS A 1 562  ? -55.513 -0.668  -39.156 1.00 104.40 ? 562  CYS A CB    1 
ATOM   4108  S  SG    . CYS A 1 562  ? -55.079 1.011   -39.668 1.00 109.98 ? 562  CYS A SG    1 
ATOM   4109  N  N     . SER A 1 563  ? -52.931 -0.980  -41.149 1.00 89.30  ? 563  SER A N     1 
ATOM   4110  C  CA    . SER A 1 563  ? -51.493 -0.701  -41.284 1.00 85.89  ? 563  SER A CA    1 
ATOM   4111  C  C     . SER A 1 563  ? -51.152 0.536   -42.129 1.00 84.02  ? 563  SER A C     1 
ATOM   4112  O  O     . SER A 1 563  ? -51.929 0.937   -42.991 1.00 84.03  ? 563  SER A O     1 
ATOM   4113  C  CB    . SER A 1 563  ? -50.740 -1.930  -41.827 1.00 83.69  ? 563  SER A CB    1 
ATOM   4114  O  OG    . SER A 1 563  ? -51.089 -2.215  -43.165 1.00 82.30  ? 563  SER A OG    1 
ATOM   4115  N  N     . THR A 1 564  ? -49.990 1.134   -41.849 1.00 82.30  ? 564  THR A N     1 
ATOM   4116  C  CA    . THR A 1 564  ? -49.412 2.216   -42.663 1.00 82.12  ? 564  THR A CA    1 
ATOM   4117  C  C     . THR A 1 564  ? -47.909 1.990   -42.859 1.00 80.93  ? 564  THR A C     1 
ATOM   4118  O  O     . THR A 1 564  ? -47.259 1.350   -42.028 1.00 79.11  ? 564  THR A O     1 
ATOM   4119  C  CB    . THR A 1 564  ? -49.612 3.599   -42.014 1.00 83.09  ? 564  THR A CB    1 
ATOM   4120  O  OG1   . THR A 1 564  ? -49.013 3.607   -40.713 1.00 82.76  ? 564  THR A OG1   1 
ATOM   4121  C  CG2   . THR A 1 564  ? -51.089 3.940   -41.899 1.00 83.82  ? 564  THR A CG2   1 
ATOM   4122  N  N     . LEU A 1 565  ? -47.369 2.526   -43.953 1.00 81.47  ? 565  LEU A N     1 
ATOM   4123  C  CA    . LEU A 1 565  ? -45.971 2.289   -44.338 1.00 82.17  ? 565  LEU A CA    1 
ATOM   4124  C  C     . LEU A 1 565  ? -45.326 3.558   -44.902 1.00 82.62  ? 565  LEU A C     1 
ATOM   4125  O  O     . LEU A 1 565  ? -45.663 3.992   -46.001 1.00 81.27  ? 565  LEU A O     1 
ATOM   4126  C  CB    . LEU A 1 565  ? -45.877 1.151   -45.376 1.00 81.33  ? 565  LEU A CB    1 
ATOM   4127  C  CG    . LEU A 1 565  ? -46.685 -0.135  -45.135 1.00 81.24  ? 565  LEU A CG    1 
ATOM   4128  C  CD1   . LEU A 1 565  ? -46.737 -0.980  -46.398 1.00 81.10  ? 565  LEU A CD1   1 
ATOM   4129  C  CD2   . LEU A 1 565  ? -46.143 -0.952  -43.967 1.00 81.44  ? 565  LEU A CD2   1 
ATOM   4130  N  N     . LYS A 1 566  ? -44.400 4.149   -44.152 1.00 84.64  ? 566  LYS A N     1 
ATOM   4131  C  CA    . LYS A 1 566  ? -43.649 5.308   -44.641 1.00 87.82  ? 566  LYS A CA    1 
ATOM   4132  C  C     . LYS A 1 566  ? -42.287 4.891   -45.202 1.00 87.35  ? 566  LYS A C     1 
ATOM   4133  O  O     . LYS A 1 566  ? -41.589 4.055   -44.620 1.00 84.52  ? 566  LYS A O     1 
ATOM   4134  C  CB    . LYS A 1 566  ? -43.472 6.360   -43.544 1.00 90.08  ? 566  LYS A CB    1 
ATOM   4135  C  CG    . LYS A 1 566  ? -44.731 7.153   -43.242 1.00 92.55  ? 566  LYS A CG    1 
ATOM   4136  C  CD    . LYS A 1 566  ? -44.427 8.339   -42.333 1.00 95.59  ? 566  LYS A CD    1 
ATOM   4137  C  CE    . LYS A 1 566  ? -45.681 9.127   -41.966 1.00 97.04  ? 566  LYS A CE    1 
ATOM   4138  N  NZ    . LYS A 1 566  ? -46.655 8.322   -41.173 1.00 96.10  ? 566  LYS A NZ    1 
ATOM   4139  N  N     . TYR A 1 567  ? -41.938 5.481   -46.345 1.00 88.96  ? 567  TYR A N     1 
ATOM   4140  C  CA    . TYR A 1 567  ? -40.620 5.333   -46.961 1.00 89.76  ? 567  TYR A CA    1 
ATOM   4141  C  C     . TYR A 1 567  ? -40.395 6.460   -47.995 1.00 92.39  ? 567  TYR A C     1 
ATOM   4142  O  O     . TYR A 1 567  ? -41.290 7.274   -48.226 1.00 91.91  ? 567  TYR A O     1 
ATOM   4143  C  CB    . TYR A 1 567  ? -40.471 3.937   -47.588 1.00 88.12  ? 567  TYR A CB    1 
ATOM   4144  C  CG    . TYR A 1 567  ? -41.372 3.687   -48.772 1.00 87.78  ? 567  TYR A CG    1 
ATOM   4145  C  CD1   . TYR A 1 567  ? -42.714 3.350   -48.593 1.00 88.18  ? 567  TYR A CD1   1 
ATOM   4146  C  CD2   . TYR A 1 567  ? -40.884 3.787   -50.078 1.00 87.39  ? 567  TYR A CD2   1 
ATOM   4147  C  CE1   . TYR A 1 567  ? -43.546 3.124   -49.683 1.00 87.85  ? 567  TYR A CE1   1 
ATOM   4148  C  CE2   . TYR A 1 567  ? -41.705 3.564   -51.174 1.00 87.49  ? 567  TYR A CE2   1 
ATOM   4149  C  CZ    . TYR A 1 567  ? -43.036 3.234   -50.971 1.00 88.08  ? 567  TYR A CZ    1 
ATOM   4150  O  OH    . TYR A 1 567  ? -43.852 3.009   -52.053 1.00 89.25  ? 567  TYR A OH    1 
ATOM   4151  N  N     . GLN A 1 568  ? -39.211 6.496   -48.610 1.00 96.14  ? 568  GLN A N     1 
ATOM   4152  C  CA    . GLN A 1 568  ? -38.806 7.595   -49.503 1.00 100.28 ? 568  GLN A CA    1 
ATOM   4153  C  C     . GLN A 1 568  ? -38.907 7.264   -50.999 1.00 100.36 ? 568  GLN A C     1 
ATOM   4154  O  O     . GLN A 1 568  ? -39.001 6.102   -51.378 1.00 100.51 ? 568  GLN A O     1 
ATOM   4155  C  CB    . GLN A 1 568  ? -37.374 8.011   -49.166 1.00 103.05 ? 568  GLN A CB    1 
ATOM   4156  C  CG    . GLN A 1 568  ? -37.049 9.441   -49.563 1.00 107.37 ? 568  GLN A CG    1 
ATOM   4157  C  CD    . GLN A 1 568  ? -35.879 10.002  -48.798 1.00 109.70 ? 568  GLN A CD    1 
ATOM   4158  O  OE1   . GLN A 1 568  ? -34.782 9.448   -48.837 1.00 110.35 ? 568  GLN A OE1   1 
ATOM   4159  N  NE2   . GLN A 1 568  ? -36.104 11.112  -48.100 1.00 111.50 ? 568  GLN A NE2   1 
ATOM   4160  N  N     . ASN A 1 569  ? -38.896 8.302   -51.836 1.00 103.07 ? 569  ASN A N     1 
ATOM   4161  C  CA    . ASN A 1 569  ? -38.946 8.157   -53.296 1.00 103.17 ? 569  ASN A CA    1 
ATOM   4162  C  C     . ASN A 1 569  ? -38.278 9.336   -54.013 1.00 105.73 ? 569  ASN A C     1 
ATOM   4163  O  O     . ASN A 1 569  ? -37.238 9.184   -54.656 1.00 105.76 ? 569  ASN A O     1 
ATOM   4164  C  CB    . ASN A 1 569  ? -40.402 8.008   -53.759 1.00 103.60 ? 569  ASN A CB    1 
ATOM   4165  C  CG    . ASN A 1 569  ? -41.359 8.957   -53.032 1.00 106.91 ? 569  ASN A CG    1 
ATOM   4166  O  OD1   . ASN A 1 569  ? -40.962 10.018  -52.542 1.00 106.37 ? 569  ASN A OD1   1 
ATOM   4167  N  ND2   . ASN A 1 569  ? -42.629 8.569   -52.955 1.00 107.98 ? 569  ASN A ND2   1 
ATOM   4168  N  N     . PRO A 1 572  ? -36.279 11.882  -58.051 1.00 121.98 ? 572  PRO A N     1 
ATOM   4169  C  CA    . PRO A 1 572  ? -36.196 13.081  -58.885 1.00 124.40 ? 572  PRO A CA    1 
ATOM   4170  C  C     . PRO A 1 572  ? -34.937 13.117  -59.770 1.00 124.23 ? 572  PRO A C     1 
ATOM   4171  O  O     . PRO A 1 572  ? -35.059 13.037  -60.995 1.00 124.37 ? 572  PRO A O     1 
ATOM   4172  C  CB    . PRO A 1 572  ? -36.223 14.235  -57.865 1.00 125.09 ? 572  PRO A CB    1 
ATOM   4173  C  CG    . PRO A 1 572  ? -35.872 13.629  -56.541 1.00 124.42 ? 572  PRO A CG    1 
ATOM   4174  C  CD    . PRO A 1 572  ? -35.829 12.128  -56.672 1.00 122.60 ? 572  PRO A CD    1 
ATOM   4175  N  N     . LYS A 1 573  ? -33.753 13.222  -59.162 1.00 122.28 ? 573  LYS A N     1 
ATOM   4176  C  CA    . LYS A 1 573  ? -32.483 13.246  -59.912 1.00 121.03 ? 573  LYS A CA    1 
ATOM   4177  C  C     . LYS A 1 573  ? -32.157 11.917  -60.627 1.00 119.18 ? 573  LYS A C     1 
ATOM   4178  O  O     . LYS A 1 573  ? -31.459 11.920  -61.645 1.00 121.10 ? 573  LYS A O     1 
ATOM   4179  C  CB    . LYS A 1 573  ? -31.314 13.641  -58.994 1.00 120.90 ? 573  LYS A CB    1 
ATOM   4180  C  CG    . LYS A 1 573  ? -31.211 15.132  -58.691 1.00 122.58 ? 573  LYS A CG    1 
ATOM   4181  C  CD    . LYS A 1 573  ? -30.655 15.927  -59.869 1.00 123.71 ? 573  LYS A CD    1 
ATOM   4182  C  CE    . LYS A 1 573  ? -30.022 17.238  -59.425 1.00 125.22 ? 573  LYS A CE    1 
ATOM   4183  N  NZ    . LYS A 1 573  ? -30.972 18.114  -58.686 1.00 126.08 ? 573  LYS A NZ    1 
ATOM   4184  N  N     . GLN A 1 574  ? -32.655 10.799  -60.091 1.00 114.86 ? 574  GLN A N     1 
ATOM   4185  C  CA    . GLN A 1 574  ? -32.438 9.463   -60.668 1.00 109.76 ? 574  GLN A CA    1 
ATOM   4186  C  C     . GLN A 1 574  ? -33.258 9.253   -61.944 1.00 107.48 ? 574  GLN A C     1 
ATOM   4187  O  O     . GLN A 1 574  ? -34.395 9.718   -62.032 1.00 105.58 ? 574  GLN A O     1 
ATOM   4188  C  CB    . GLN A 1 574  ? -32.813 8.395   -59.633 1.00 107.84 ? 574  GLN A CB    1 
ATOM   4189  C  CG    . GLN A 1 574  ? -32.556 6.955   -60.052 1.00 106.14 ? 574  GLN A CG    1 
ATOM   4190  C  CD    . GLN A 1 574  ? -32.960 5.966   -58.975 1.00 103.67 ? 574  GLN A CD    1 
ATOM   4191  O  OE1   . GLN A 1 574  ? -32.531 6.072   -57.831 1.00 104.32 ? 574  GLN A OE1   1 
ATOM   4192  N  NE2   . GLN A 1 574  ? -33.788 4.999   -59.339 1.00 101.93 ? 574  GLN A NE2   1 
ATOM   4193  N  N     . HIS A 1 575  ? -32.686 8.534   -62.914 1.00 106.36 ? 575  HIS A N     1 
ATOM   4194  C  CA    . HIS A 1 575  ? -33.373 8.235   -64.180 1.00 107.09 ? 575  HIS A CA    1 
ATOM   4195  C  C     . HIS A 1 575  ? -34.656 7.415   -63.945 1.00 105.11 ? 575  HIS A C     1 
ATOM   4196  O  O     . HIS A 1 575  ? -34.691 6.576   -63.036 1.00 104.88 ? 575  HIS A O     1 
ATOM   4197  C  CB    . HIS A 1 575  ? -32.468 7.442   -65.135 1.00 108.23 ? 575  HIS A CB    1 
ATOM   4198  C  CG    . HIS A 1 575  ? -31.306 8.218   -65.676 1.00 111.78 ? 575  HIS A CG    1 
ATOM   4199  N  ND1   . HIS A 1 575  ? -30.055 7.658   -65.844 1.00 111.38 ? 575  HIS A ND1   1 
ATOM   4200  C  CD2   . HIS A 1 575  ? -31.204 9.500   -66.100 1.00 114.12 ? 575  HIS A CD2   1 
ATOM   4201  C  CE1   . HIS A 1 575  ? -29.233 8.563   -66.344 1.00 112.41 ? 575  HIS A CE1   1 
ATOM   4202  N  NE2   . HIS A 1 575  ? -29.905 9.689   -66.510 1.00 115.26 ? 575  HIS A NE2   1 
ATOM   4203  N  N     . PRO A 1 576  ? -35.707 7.643   -64.767 1.00 102.96 ? 576  PRO A N     1 
ATOM   4204  C  CA    . PRO A 1 576  ? -36.930 6.822   -64.642 1.00 99.26  ? 576  PRO A CA    1 
ATOM   4205  C  C     . PRO A 1 576  ? -36.766 5.343   -65.058 1.00 93.38  ? 576  PRO A C     1 
ATOM   4206  O  O     . PRO A 1 576  ? -37.554 4.510   -64.622 1.00 89.74  ? 576  PRO A O     1 
ATOM   4207  C  CB    . PRO A 1 576  ? -37.949 7.550   -65.535 1.00 101.08 ? 576  PRO A CB    1 
ATOM   4208  C  CG    . PRO A 1 576  ? -37.139 8.367   -66.486 1.00 102.85 ? 576  PRO A CG    1 
ATOM   4209  C  CD    . PRO A 1 576  ? -35.833 8.678   -65.815 1.00 103.44 ? 576  PRO A CD    1 
ATOM   4210  N  N     . GLU A 1 577  ? -35.750 5.030   -65.865 1.00 91.18  ? 577  GLU A N     1 
ATOM   4211  C  CA    . GLU A 1 577  ? -35.430 3.638   -66.245 1.00 89.23  ? 577  GLU A CA    1 
ATOM   4212  C  C     . GLU A 1 577  ? -34.528 2.888   -65.239 1.00 83.78  ? 577  GLU A C     1 
ATOM   4213  O  O     . GLU A 1 577  ? -34.304 1.689   -65.399 1.00 83.22  ? 577  GLU A O     1 
ATOM   4214  C  CB    . GLU A 1 577  ? -34.764 3.589   -67.626 1.00 91.70  ? 577  GLU A CB    1 
ATOM   4215  C  CG    . GLU A 1 577  ? -35.570 4.237   -68.748 1.00 95.75  ? 577  GLU A CG    1 
ATOM   4216  C  CD    . GLU A 1 577  ? -35.253 5.711   -68.974 1.00 99.96  ? 577  GLU A CD    1 
ATOM   4217  O  OE1   . GLU A 1 577  ? -34.613 6.350   -68.101 1.00 102.38 ? 577  GLU A OE1   1 
ATOM   4218  O  OE2   . GLU A 1 577  ? -35.660 6.237   -70.035 1.00 102.58 ? 577  GLU A OE2   1 
ATOM   4219  N  N     . ASP A 1 578  ? -34.002 3.592   -64.235 1.00 78.70  ? 578  ASP A N     1 
ATOM   4220  C  CA    . ASP A 1 578  ? -33.173 3.004   -63.185 1.00 73.21  ? 578  ASP A CA    1 
ATOM   4221  C  C     . ASP A 1 578  ? -34.098 2.428   -62.112 1.00 70.33  ? 578  ASP A C     1 
ATOM   4222  O  O     . ASP A 1 578  ? -34.814 3.187   -61.467 1.00 71.72  ? 578  ASP A O     1 
ATOM   4223  C  CB    . ASP A 1 578  ? -32.278 4.098   -62.591 1.00 73.34  ? 578  ASP A CB    1 
ATOM   4224  C  CG    . ASP A 1 578  ? -31.282 3.576   -61.565 1.00 71.67  ? 578  ASP A CG    1 
ATOM   4225  O  OD1   . ASP A 1 578  ? -31.412 2.438   -61.081 1.00 69.33  ? 578  ASP A OD1   1 
ATOM   4226  O  OD2   . ASP A 1 578  ? -30.345 4.330   -61.232 1.00 72.69  ? 578  ASP A OD2   1 
ATOM   4227  N  N     . PRO A 1 579  ? -34.086 1.094   -61.901 1.00 66.65  ? 579  PRO A N     1 
ATOM   4228  C  CA    . PRO A 1 579  ? -35.031 0.503   -60.941 1.00 64.61  ? 579  PRO A CA    1 
ATOM   4229  C  C     . PRO A 1 579  ? -34.585 0.474   -59.473 1.00 62.35  ? 579  PRO A C     1 
ATOM   4230  O  O     . PRO A 1 579  ? -35.354 0.026   -58.623 1.00 60.77  ? 579  PRO A O     1 
ATOM   4231  C  CB    . PRO A 1 579  ? -35.199 -0.928  -61.469 1.00 64.30  ? 579  PRO A CB    1 
ATOM   4232  C  CG    . PRO A 1 579  ? -33.881 -1.252  -62.077 1.00 64.78  ? 579  PRO A CG    1 
ATOM   4233  C  CD    . PRO A 1 579  ? -33.275 0.051   -62.560 1.00 66.30  ? 579  PRO A CD    1 
ATOM   4234  N  N     . ILE A 1 580  ? -33.386 0.963   -59.167 1.00 62.27  ? 580  ILE A N     1 
ATOM   4235  C  CA    . ILE A 1 580  ? -32.863 0.899   -57.804 1.00 62.41  ? 580  ILE A CA    1 
ATOM   4236  C  C     . ILE A 1 580  ? -33.646 1.864   -56.922 1.00 63.49  ? 580  ILE A C     1 
ATOM   4237  O  O     . ILE A 1 580  ? -33.764 3.047   -57.243 1.00 64.35  ? 580  ILE A O     1 
ATOM   4238  C  CB    . ILE A 1 580  ? -31.356 1.238   -57.737 1.00 63.12  ? 580  ILE A CB    1 
ATOM   4239  C  CG1   . ILE A 1 580  ? -30.514 0.237   -58.562 1.00 62.43  ? 580  ILE A CG1   1 
ATOM   4240  C  CG2   . ILE A 1 580  ? -30.873 1.262   -56.289 1.00 63.45  ? 580  ILE A CG2   1 
ATOM   4241  C  CD1   . ILE A 1 580  ? -30.452 -1.184  -58.021 1.00 61.19  ? 580  ILE A CD1   1 
ATOM   4242  N  N     . GLY A 1 581  ? -34.182 1.335   -55.821 1.00 63.66  ? 581  GLY A N     1 
ATOM   4243  C  CA    . GLY A 1 581  ? -35.051 2.083   -54.911 1.00 63.76  ? 581  GLY A CA    1 
ATOM   4244  C  C     . GLY A 1 581  ? -36.541 1.916   -55.160 1.00 63.87  ? 581  GLY A C     1 
ATOM   4245  O  O     . GLY A 1 581  ? -37.339 2.292   -54.306 1.00 63.70  ? 581  GLY A O     1 
ATOM   4246  N  N     . HIS A 1 582  ? -36.925 1.364   -56.316 1.00 64.09  ? 582  HIS A N     1 
ATOM   4247  C  CA    . HIS A 1 582  ? -38.340 1.173   -56.659 1.00 64.16  ? 582  HIS A CA    1 
ATOM   4248  C  C     . HIS A 1 582  ? -38.856 -0.134  -56.059 1.00 62.62  ? 582  HIS A C     1 
ATOM   4249  O  O     . HIS A 1 582  ? -38.121 -1.121  -56.020 1.00 61.88  ? 582  HIS A O     1 
ATOM   4250  C  CB    . HIS A 1 582  ? -38.547 1.173   -58.180 1.00 64.70  ? 582  HIS A CB    1 
ATOM   4251  C  CG    . HIS A 1 582  ? -38.372 2.519   -58.814 1.00 65.99  ? 582  HIS A CG    1 
ATOM   4252  N  ND1   . HIS A 1 582  ? -37.179 2.941   -59.357 1.00 65.69  ? 582  HIS A ND1   1 
ATOM   4253  C  CD2   . HIS A 1 582  ? -39.243 3.541   -58.986 1.00 67.85  ? 582  HIS A CD2   1 
ATOM   4254  C  CE1   . HIS A 1 582  ? -37.322 4.162   -59.840 1.00 67.30  ? 582  HIS A CE1   1 
ATOM   4255  N  NE2   . HIS A 1 582  ? -38.564 4.550   -59.625 1.00 68.43  ? 582  HIS A NE2   1 
ATOM   4256  N  N     . PRO A 1 583  ? -40.121 -0.155  -55.595 1.00 62.85  ? 583  PRO A N     1 
ATOM   4257  C  CA    . PRO A 1 583  ? -40.673 -1.351  -54.953 1.00 62.69  ? 583  PRO A CA    1 
ATOM   4258  C  C     . PRO A 1 583  ? -41.084 -2.411  -55.982 1.00 62.28  ? 583  PRO A C     1 
ATOM   4259  O  O     . PRO A 1 583  ? -42.274 -2.671  -56.180 1.00 64.49  ? 583  PRO A O     1 
ATOM   4260  C  CB    . PRO A 1 583  ? -41.880 -0.792  -54.185 1.00 63.03  ? 583  PRO A CB    1 
ATOM   4261  C  CG    . PRO A 1 583  ? -42.344 0.335   -55.024 1.00 63.10  ? 583  PRO A CG    1 
ATOM   4262  C  CD    . PRO A 1 583  ? -41.104 0.942   -55.616 1.00 63.56  ? 583  PRO A CD    1 
ATOM   4263  N  N     . ILE A 1 584  ? -40.091 -3.017  -56.627 1.00 61.32  ? 584  ILE A N     1 
ATOM   4264  C  CA    . ILE A 1 584  ? -40.324 -3.984  -57.702 1.00 59.51  ? 584  ILE A CA    1 
ATOM   4265  C  C     . ILE A 1 584  ? -40.816 -5.295  -57.101 1.00 59.14  ? 584  ILE A C     1 
ATOM   4266  O  O     . ILE A 1 584  ? -40.258 -5.786  -56.120 1.00 58.51  ? 584  ILE A O     1 
ATOM   4267  C  CB    . ILE A 1 584  ? -39.042 -4.255  -58.525 1.00 58.62  ? 584  ILE A CB    1 
ATOM   4268  C  CG1   . ILE A 1 584  ? -38.501 -2.955  -59.147 1.00 59.55  ? 584  ILE A CG1   1 
ATOM   4269  C  CG2   . ILE A 1 584  ? -39.281 -5.323  -59.586 1.00 57.18  ? 584  ILE A CG2   1 
ATOM   4270  C  CD1   . ILE A 1 584  ? -39.491 -2.199  -60.004 1.00 59.81  ? 584  ILE A CD1   1 
ATOM   4271  N  N     . MET A 1 585  ? -41.873 -5.846  -57.690 1.00 59.52  ? 585  MET A N     1 
ATOM   4272  C  CA    . MET A 1 585  ? -42.431 -7.125  -57.261 1.00 57.83  ? 585  MET A CA    1 
ATOM   4273  C  C     . MET A 1 585  ? -41.400 -8.249  -57.442 1.00 55.97  ? 585  MET A C     1 
ATOM   4274  O  O     . MET A 1 585  ? -40.620 -8.235  -58.391 1.00 54.97  ? 585  MET A O     1 
ATOM   4275  C  CB    . MET A 1 585  ? -43.698 -7.425  -58.071 1.00 58.87  ? 585  MET A CB    1 
ATOM   4276  C  CG    . MET A 1 585  ? -44.343 -8.782  -57.803 1.00 59.74  ? 585  MET A CG    1 
ATOM   4277  S  SD    . MET A 1 585  ? -45.714 -9.197  -58.896 1.00 62.83  ? 585  MET A SD    1 
ATOM   4278  C  CE    . MET A 1 585  ? -45.126 -8.662  -60.510 1.00 60.69  ? 585  MET A CE    1 
ATOM   4279  N  N     . HIS A 1 586  ? -41.415 -9.204  -56.512 1.00 55.25  ? 586  HIS A N     1 
ATOM   4280  C  CA    . HIS A 1 586  ? -40.627 -10.435 -56.590 1.00 54.76  ? 586  HIS A CA    1 
ATOM   4281  C  C     . HIS A 1 586  ? -40.802 -11.024 -57.998 1.00 54.49  ? 586  HIS A C     1 
ATOM   4282  O  O     . HIS A 1 586  ? -41.929 -11.097 -58.493 1.00 55.71  ? 586  HIS A O     1 
ATOM   4283  C  CB    . HIS A 1 586  ? -41.127 -11.414 -55.505 1.00 55.22  ? 586  HIS A CB    1 
ATOM   4284  C  CG    . HIS A 1 586  ? -40.193 -12.552 -55.194 1.00 55.88  ? 586  HIS A CG    1 
ATOM   4285  N  ND1   . HIS A 1 586  ? -39.929 -13.574 -56.084 1.00 55.18  ? 586  HIS A ND1   1 
ATOM   4286  C  CD2   . HIS A 1 586  ? -39.511 -12.860 -54.063 1.00 55.49  ? 586  HIS A CD2   1 
ATOM   4287  C  CE1   . HIS A 1 586  ? -39.102 -14.443 -55.531 1.00 54.04  ? 586  HIS A CE1   1 
ATOM   4288  N  NE2   . HIS A 1 586  ? -38.830 -14.032 -54.305 1.00 54.68  ? 586  HIS A NE2   1 
ATOM   4289  N  N     . LEU A 1 587  ? -39.711 -11.426 -58.648 1.00 53.32  ? 587  LEU A N     1 
ATOM   4290  C  CA    . LEU A 1 587  ? -39.766 -11.910 -60.043 1.00 53.58  ? 587  LEU A CA    1 
ATOM   4291  C  C     . LEU A 1 587  ? -40.663 -13.122 -60.241 1.00 52.59  ? 587  LEU A C     1 
ATOM   4292  O  O     . LEU A 1 587  ? -41.298 -13.242 -61.271 1.00 54.29  ? 587  LEU A O     1 
ATOM   4293  C  CB    . LEU A 1 587  ? -38.372 -12.288 -60.554 1.00 54.38  ? 587  LEU A CB    1 
ATOM   4294  C  CG    . LEU A 1 587  ? -37.310 -11.193 -60.703 1.00 55.22  ? 587  LEU A CG    1 
ATOM   4295  C  CD1   . LEU A 1 587  ? -35.963 -11.812 -61.069 1.00 54.43  ? 587  LEU A CD1   1 
ATOM   4296  C  CD2   . LEU A 1 587  ? -37.744 -10.131 -61.711 1.00 55.50  ? 587  LEU A CD2   1 
ATOM   4297  N  N     . SER A 1 588  ? -40.635 -14.046 -59.286 1.00 52.19  ? 588  SER A N     1 
ATOM   4298  C  CA    . SER A 1 588  ? -41.576 -15.174 -59.199 1.00 52.62  ? 588  SER A CA    1 
ATOM   4299  C  C     . SER A 1 588  ? -42.961 -14.920 -58.590 1.00 51.65  ? 588  SER A C     1 
ATOM   4300  O  O     . SER A 1 588  ? -43.762 -15.862 -58.501 1.00 52.23  ? 588  SER A O     1 
ATOM   4301  C  CB    . SER A 1 588  ? -40.939 -16.306 -58.389 1.00 53.44  ? 588  SER A CB    1 
ATOM   4302  O  OG    . SER A 1 588  ? -39.691 -16.652 -58.937 1.00 56.70  ? 588  SER A OG    1 
ATOM   4303  N  N     . GLY A 1 589  ? -43.254 -13.690 -58.172 1.00 50.51  ? 589  GLY A N     1 
ATOM   4304  C  CA    . GLY A 1 589  ? -44.511 -13.368 -57.494 1.00 49.56  ? 589  GLY A CA    1 
ATOM   4305  C  C     . GLY A 1 589  ? -45.763 -13.921 -58.156 1.00 48.53  ? 589  GLY A C     1 
ATOM   4306  O  O     . GLY A 1 589  ? -46.572 -14.563 -57.501 1.00 47.63  ? 589  GLY A O     1 
ATOM   4307  N  N     . VAL A 1 590  ? -45.907 -13.692 -59.460 1.00 48.61  ? 590  VAL A N     1 
ATOM   4308  C  CA    . VAL A 1 590  ? -47.044 -14.219 -60.217 1.00 49.25  ? 590  VAL A CA    1 
ATOM   4309  C  C     . VAL A 1 590  ? -46.969 -15.745 -60.352 1.00 49.27  ? 590  VAL A C     1 
ATOM   4310  O  O     . VAL A 1 590  ? -47.974 -16.435 -60.161 1.00 49.87  ? 590  VAL A O     1 
ATOM   4311  C  CB    . VAL A 1 590  ? -47.183 -13.533 -61.595 1.00 50.32  ? 590  VAL A CB    1 
ATOM   4312  C  CG1   . VAL A 1 590  ? -48.275 -14.191 -62.441 1.00 51.16  ? 590  VAL A CG1   1 
ATOM   4313  C  CG2   . VAL A 1 590  ? -47.499 -12.054 -61.408 1.00 51.25  ? 590  VAL A CG2   1 
ATOM   4314  N  N     . LYS A 1 591  ? -45.787 -16.271 -60.655 1.00 49.18  ? 591  LYS A N     1 
ATOM   4315  C  CA    . LYS A 1 591  ? -45.586 -17.717 -60.668 1.00 49.64  ? 591  LYS A CA    1 
ATOM   4316  C  C     . LYS A 1 591  ? -45.916 -18.376 -59.333 1.00 49.20  ? 591  LYS A C     1 
ATOM   4317  O  O     . LYS A 1 591  ? -46.366 -19.523 -59.322 1.00 49.09  ? 591  LYS A O     1 
ATOM   4318  C  CB    . LYS A 1 591  ? -44.157 -18.080 -61.059 1.00 50.52  ? 591  LYS A CB    1 
ATOM   4319  C  CG    . LYS A 1 591  ? -43.831 -17.809 -62.519 1.00 51.43  ? 591  LYS A CG    1 
ATOM   4320  C  CD    . LYS A 1 591  ? -42.479 -18.397 -62.889 1.00 51.77  ? 591  LYS A CD    1 
ATOM   4321  C  CE    . LYS A 1 591  ? -41.312 -17.583 -62.364 1.00 51.53  ? 591  LYS A CE    1 
ATOM   4322  N  NZ    . LYS A 1 591  ? -41.214 -16.300 -63.106 1.00 53.36  ? 591  LYS A NZ    1 
ATOM   4323  N  N     . HIS A 1 592  ? -45.682 -17.675 -58.221 1.00 48.34  ? 592  HIS A N     1 
ATOM   4324  C  CA    . HIS A 1 592  ? -46.140 -18.161 -56.921 1.00 48.01  ? 592  HIS A CA    1 
ATOM   4325  C  C     . HIS A 1 592  ? -47.658 -18.224 -56.924 1.00 48.70  ? 592  HIS A C     1 
ATOM   4326  O  O     . HIS A 1 592  ? -48.246 -19.247 -56.614 1.00 48.84  ? 592  HIS A O     1 
ATOM   4327  C  CB    . HIS A 1 592  ? -45.682 -17.267 -55.779 1.00 48.05  ? 592  HIS A CB    1 
ATOM   4328  C  CG    . HIS A 1 592  ? -44.205 -17.224 -55.603 1.00 48.96  ? 592  HIS A CG    1 
ATOM   4329  N  ND1   . HIS A 1 592  ? -43.555 -16.138 -55.060 1.00 50.58  ? 592  HIS A ND1   1 
ATOM   4330  C  CD2   . HIS A 1 592  ? -43.245 -18.134 -55.888 1.00 49.13  ? 592  HIS A CD2   1 
ATOM   4331  C  CE1   . HIS A 1 592  ? -42.257 -16.379 -55.019 1.00 50.21  ? 592  HIS A CE1   1 
ATOM   4332  N  NE2   . HIS A 1 592  ? -42.044 -17.583 -55.520 1.00 50.25  ? 592  HIS A NE2   1 
ATOM   4333  N  N     . ALA A 1 593  ? -48.282 -17.124 -57.309 1.00 50.16  ? 593  ALA A N     1 
ATOM   4334  C  CA    . ALA A 1 593  ? -49.730 -17.029 -57.330 1.00 51.67  ? 593  ALA A CA    1 
ATOM   4335  C  C     . ALA A 1 593  ? -50.409 -18.049 -58.248 1.00 51.84  ? 593  ALA A C     1 
ATOM   4336  O  O     . ALA A 1 593  ? -51.481 -18.534 -57.911 1.00 53.94  ? 593  ALA A O     1 
ATOM   4337  C  CB    . ALA A 1 593  ? -50.162 -15.611 -57.686 1.00 52.63  ? 593  ALA A CB    1 
ATOM   4338  N  N     . THR A 1 594  ? -49.798 -18.384 -59.382 1.00 51.89  ? 594  THR A N     1 
ATOM   4339  C  CA    . THR A 1 594  ? -50.395 -19.339 -60.338 1.00 51.94  ? 594  THR A CA    1 
ATOM   4340  C  C     . THR A 1 594  ? -49.983 -20.799 -60.144 1.00 51.58  ? 594  THR A C     1 
ATOM   4341  O  O     . THR A 1 594  ? -50.511 -21.688 -60.818 1.00 52.16  ? 594  THR A O     1 
ATOM   4342  C  CB    . THR A 1 594  ? -50.049 -18.962 -61.784 1.00 50.93  ? 594  THR A CB    1 
ATOM   4343  O  OG1   . THR A 1 594  ? -48.636 -19.031 -61.955 1.00 49.45  ? 594  THR A OG1   1 
ATOM   4344  C  CG2   . THR A 1 594  ? -50.543 -17.564 -62.107 1.00 51.71  ? 594  THR A CG2   1 
ATOM   4345  N  N     . GLY A 1 595  ? -49.043 -21.048 -59.241 1.00 52.62  ? 595  GLY A N     1 
ATOM   4346  C  CA    . GLY A 1 595  ? -48.520 -22.396 -59.016 1.00 53.62  ? 595  GLY A CA    1 
ATOM   4347  C  C     . GLY A 1 595  ? -47.576 -22.888 -60.107 1.00 54.28  ? 595  GLY A C     1 
ATOM   4348  O  O     . GLY A 1 595  ? -47.330 -24.085 -60.208 1.00 54.84  ? 595  GLY A O     1 
ATOM   4349  N  N     . GLU A 1 596  ? -47.048 -21.973 -60.920 1.00 55.48  ? 596  GLU A N     1 
ATOM   4350  C  CA    . GLU A 1 596  ? -46.122 -22.324 -61.993 1.00 56.13  ? 596  GLU A CA    1 
ATOM   4351  C  C     . GLU A 1 596  ? -44.666 -22.318 -61.511 1.00 56.05  ? 596  GLU A C     1 
ATOM   4352  O  O     . GLU A 1 596  ? -43.789 -22.796 -62.223 1.00 57.80  ? 596  GLU A O     1 
ATOM   4353  C  CB    . GLU A 1 596  ? -46.303 -21.389 -63.194 1.00 57.51  ? 596  GLU A CB    1 
ATOM   4354  C  CG    . GLU A 1 596  ? -47.631 -21.578 -63.920 1.00 58.84  ? 596  GLU A CG    1 
ATOM   4355  C  CD    . GLU A 1 596  ? -47.959 -20.442 -64.883 1.00 60.51  ? 596  GLU A CD    1 
ATOM   4356  O  OE1   . GLU A 1 596  ? -47.349 -20.371 -65.959 1.00 65.05  ? 596  GLU A OE1   1 
ATOM   4357  O  OE2   . GLU A 1 596  ? -48.838 -19.620 -64.584 1.00 61.00  ? 596  GLU A OE2   1 
ATOM   4358  N  N     . ALA A 1 597  ? -44.415 -21.790 -60.314 1.00 55.14  ? 597  ALA A N     1 
ATOM   4359  C  CA    . ALA A 1 597  ? -43.102 -21.869 -59.686 1.00 54.37  ? 597  ALA A CA    1 
ATOM   4360  C  C     . ALA A 1 597  ? -42.782 -23.315 -59.300 1.00 53.79  ? 597  ALA A C     1 
ATOM   4361  O  O     . ALA A 1 597  ? -43.538 -23.944 -58.556 1.00 54.18  ? 597  ALA A O     1 
ATOM   4362  C  CB    . ALA A 1 597  ? -43.050 -20.969 -58.456 1.00 53.98  ? 597  ALA A CB    1 
ATOM   4363  N  N     . ILE A 1 598  ? -41.670 -23.836 -59.820 1.00 52.82  ? 598  ILE A N     1 
ATOM   4364  C  CA    . ILE A 1 598  ? -41.225 -25.204 -59.525 1.00 51.98  ? 598  ILE A CA    1 
ATOM   4365  C  C     . ILE A 1 598  ? -40.341 -25.178 -58.285 1.00 50.06  ? 598  ILE A C     1 
ATOM   4366  O  O     . ILE A 1 598  ? -39.318 -24.523 -58.269 1.00 50.39  ? 598  ILE A O     1 
ATOM   4367  C  CB    . ILE A 1 598  ? -40.448 -25.830 -60.728 1.00 52.30  ? 598  ILE A CB    1 
ATOM   4368  C  CG1   . ILE A 1 598  ? -41.307 -25.864 -62.008 1.00 52.47  ? 598  ILE A CG1   1 
ATOM   4369  C  CG2   . ILE A 1 598  ? -39.955 -27.238 -60.413 1.00 52.38  ? 598  ILE A CG2   1 
ATOM   4370  C  CD1   . ILE A 1 598  ? -42.660 -26.557 -61.865 1.00 53.54  ? 598  ILE A CD1   1 
ATOM   4371  N  N     . TYR A 1 599  ? -40.775 -25.864 -57.238 1.00 50.30  ? 599  TYR A N     1 
ATOM   4372  C  CA    . TYR A 1 599  ? -39.938 -26.177 -56.082 1.00 49.55  ? 599  TYR A CA    1 
ATOM   4373  C  C     . TYR A 1 599  ? -39.452 -27.611 -56.253 1.00 50.07  ? 599  TYR A C     1 
ATOM   4374  O  O     . TYR A 1 599  ? -39.984 -28.374 -57.056 1.00 50.18  ? 599  TYR A O     1 
ATOM   4375  C  CB    . TYR A 1 599  ? -40.719 -26.018 -54.767 1.00 49.06  ? 599  TYR A CB    1 
ATOM   4376  C  CG    . TYR A 1 599  ? -41.261 -24.629 -54.552 1.00 48.39  ? 599  TYR A CG    1 
ATOM   4377  C  CD1   . TYR A 1 599  ? -42.444 -24.227 -55.162 1.00 49.14  ? 599  TYR A CD1   1 
ATOM   4378  C  CD2   . TYR A 1 599  ? -40.592 -23.702 -53.765 1.00 48.91  ? 599  TYR A CD2   1 
ATOM   4379  C  CE1   . TYR A 1 599  ? -42.950 -22.950 -54.996 1.00 48.97  ? 599  TYR A CE1   1 
ATOM   4380  C  CE2   . TYR A 1 599  ? -41.097 -22.415 -53.587 1.00 49.63  ? 599  TYR A CE2   1 
ATOM   4381  C  CZ    . TYR A 1 599  ? -42.286 -22.054 -54.209 1.00 49.05  ? 599  TYR A CZ    1 
ATOM   4382  O  OH    . TYR A 1 599  ? -42.815 -20.802 -54.081 1.00 49.63  ? 599  TYR A OH    1 
ATOM   4383  N  N     . CYS A 1 600  ? -38.446 -27.979 -55.478 1.00 51.58  ? 600  CYS A N     1 
ATOM   4384  C  CA    . CYS A 1 600  ? -37.751 -29.245 -55.663 1.00 51.64  ? 600  CYS A CA    1 
ATOM   4385  C  C     . CYS A 1 600  ? -38.639 -30.485 -55.883 1.00 50.85  ? 600  CYS A C     1 
ATOM   4386  O  O     . CYS A 1 600  ? -38.387 -31.241 -56.803 1.00 50.38  ? 600  CYS A O     1 
ATOM   4387  C  CB    . CYS A 1 600  ? -36.801 -29.493 -54.508 1.00 53.17  ? 600  CYS A CB    1 
ATOM   4388  S  SG    . CYS A 1 600  ? -35.654 -30.816 -54.900 1.00 59.03  ? 600  CYS A SG    1 
ATOM   4389  N  N     . ASP A 1 601  ? -39.669 -30.691 -55.064 1.00 50.80  ? 601  ASP A N     1 
ATOM   4390  C  CA    . ASP A 1 601  ? -40.583 -31.838 -55.240 1.00 50.85  ? 601  ASP A CA    1 
ATOM   4391  C  C     . ASP A 1 601  ? -41.562 -31.684 -56.418 1.00 50.32  ? 601  ASP A C     1 
ATOM   4392  O  O     . ASP A 1 601  ? -42.196 -32.664 -56.826 1.00 52.67  ? 601  ASP A O     1 
ATOM   4393  C  CB    . ASP A 1 601  ? -41.350 -32.128 -53.943 1.00 53.04  ? 601  ASP A CB    1 
ATOM   4394  C  CG    . ASP A 1 601  ? -42.233 -33.387 -54.027 1.00 55.38  ? 601  ASP A CG    1 
ATOM   4395  O  OD1   . ASP A 1 601  ? -41.762 -34.475 -54.456 1.00 55.14  ? 601  ASP A OD1   1 
ATOM   4396  O  OD2   . ASP A 1 601  ? -43.418 -33.275 -53.659 1.00 57.21  ? 601  ASP A OD2   1 
ATOM   4397  N  N     . ASP A 1 602  ? -41.683 -30.478 -56.971 1.00 49.12  ? 602  ASP A N     1 
ATOM   4398  C  CA    . ASP A 1 602  ? -42.534 -30.245 -58.134 1.00 49.40  ? 602  ASP A CA    1 
ATOM   4399  C  C     . ASP A 1 602  ? -41.889 -30.726 -59.420 1.00 48.98  ? 602  ASP A C     1 
ATOM   4400  O  O     . ASP A 1 602  ? -42.557 -30.815 -60.456 1.00 50.94  ? 602  ASP A O     1 
ATOM   4401  C  CB    . ASP A 1 602  ? -42.883 -28.759 -58.315 1.00 50.47  ? 602  ASP A CB    1 
ATOM   4402  C  CG    . ASP A 1 602  ? -43.535 -28.140 -57.100 1.00 51.29  ? 602  ASP A CG    1 
ATOM   4403  O  OD1   . ASP A 1 602  ? -44.131 -28.858 -56.271 1.00 52.66  ? 602  ASP A OD1   1 
ATOM   4404  O  OD2   . ASP A 1 602  ? -43.439 -26.905 -56.985 1.00 49.85  ? 602  ASP A OD2   1 
ATOM   4405  N  N     . MET A 1 603  ? -40.597 -31.007 -59.383 1.00 48.76  ? 603  MET A N     1 
ATOM   4406  C  CA    . MET A 1 603  ? -39.914 -31.515 -60.558 1.00 48.71  ? 603  MET A CA    1 
ATOM   4407  C  C     . MET A 1 603  ? -40.565 -32.833 -60.969 1.00 48.41  ? 603  MET A C     1 
ATOM   4408  O  O     . MET A 1 603  ? -40.900 -33.650 -60.106 1.00 50.43  ? 603  MET A O     1 
ATOM   4409  C  CB    . MET A 1 603  ? -38.446 -31.734 -60.263 1.00 49.95  ? 603  MET A CB    1 
ATOM   4410  C  CG    . MET A 1 603  ? -37.703 -30.452 -59.933 1.00 51.61  ? 603  MET A CG    1 
ATOM   4411  S  SD    . MET A 1 603  ? -35.924 -30.688 -59.917 1.00 54.86  ? 603  MET A SD    1 
ATOM   4412  C  CE    . MET A 1 603  ? -35.727 -31.744 -58.496 1.00 54.86  ? 603  MET A CE    1 
ATOM   4413  N  N     . PRO A 1 604  ? -40.776 -33.039 -62.277 1.00 46.97  ? 604  PRO A N     1 
ATOM   4414  C  CA    . PRO A 1 604  ? -41.397 -34.286 -62.712 1.00 47.77  ? 604  PRO A CA    1 
ATOM   4415  C  C     . PRO A 1 604  ? -40.651 -35.561 -62.293 1.00 47.59  ? 604  PRO A C     1 
ATOM   4416  O  O     . PRO A 1 604  ? -39.448 -35.531 -62.056 1.00 46.71  ? 604  PRO A O     1 
ATOM   4417  C  CB    . PRO A 1 604  ? -41.395 -34.170 -64.241 1.00 48.23  ? 604  PRO A CB    1 
ATOM   4418  C  CG    . PRO A 1 604  ? -41.294 -32.717 -64.524 1.00 47.41  ? 604  PRO A CG    1 
ATOM   4419  C  CD    . PRO A 1 604  ? -40.512 -32.126 -63.404 1.00 46.69  ? 604  PRO A CD    1 
ATOM   4420  N  N     . LEU A 1 605  ? -41.396 -36.658 -62.200 1.00 49.28  ? 605  LEU A N     1 
ATOM   4421  C  CA    . LEU A 1 605  ? -40.851 -37.998 -61.976 1.00 50.46  ? 605  LEU A CA    1 
ATOM   4422  C  C     . LEU A 1 605  ? -39.813 -38.299 -63.036 1.00 49.30  ? 605  LEU A C     1 
ATOM   4423  O  O     . LEU A 1 605  ? -40.118 -38.226 -64.229 1.00 48.34  ? 605  LEU A O     1 
ATOM   4424  C  CB    . LEU A 1 605  ? -41.977 -39.040 -62.071 1.00 53.44  ? 605  LEU A CB    1 
ATOM   4425  C  CG    . LEU A 1 605  ? -41.670 -40.501 -61.721 1.00 55.88  ? 605  LEU A CG    1 
ATOM   4426  C  CD1   . LEU A 1 605  ? -41.688 -40.712 -60.215 1.00 56.17  ? 605  LEU A CD1   1 
ATOM   4427  C  CD2   . LEU A 1 605  ? -42.654 -41.448 -62.397 1.00 57.53  ? 605  LEU A CD2   1 
ATOM   4428  N  N     . VAL A 1 606  ? -38.589 -38.612 -62.613 1.00 48.71  ? 606  VAL A N     1 
ATOM   4429  C  CA    . VAL A 1 606  ? -37.546 -38.979 -63.573 1.00 48.74  ? 606  VAL A CA    1 
ATOM   4430  C  C     . VAL A 1 606  ? -37.621 -40.496 -63.703 1.00 48.23  ? 606  VAL A C     1 
ATOM   4431  O  O     . VAL A 1 606  ? -37.872 -41.193 -62.722 1.00 47.59  ? 606  VAL A O     1 
ATOM   4432  C  CB    . VAL A 1 606  ? -36.110 -38.447 -63.247 1.00 48.53  ? 606  VAL A CB    1 
ATOM   4433  C  CG1   . VAL A 1 606  ? -36.126 -37.363 -62.198 1.00 48.15  ? 606  VAL A CG1   1 
ATOM   4434  C  CG2   . VAL A 1 606  ? -35.141 -39.536 -62.832 1.00 48.55  ? 606  VAL A CG2   1 
ATOM   4435  N  N     . ASP A 1 607  ? -37.408 -40.982 -64.924 1.00 48.11  ? 607  ASP A N     1 
ATOM   4436  C  CA    . ASP A 1 607  ? -37.576 -42.403 -65.278 1.00 47.93  ? 607  ASP A CA    1 
ATOM   4437  C  C     . ASP A 1 607  ? -36.964 -43.354 -64.226 1.00 47.07  ? 607  ASP A C     1 
ATOM   4438  O  O     . ASP A 1 607  ? -35.780 -43.242 -63.891 1.00 45.00  ? 607  ASP A O     1 
ATOM   4439  C  CB    . ASP A 1 607  ? -36.961 -42.650 -66.665 1.00 48.63  ? 607  ASP A CB    1 
ATOM   4440  C  CG    . ASP A 1 607  ? -37.319 -44.006 -67.245 1.00 50.72  ? 607  ASP A CG    1 
ATOM   4441  O  OD1   . ASP A 1 607  ? -38.445 -44.489 -66.978 1.00 50.54  ? 607  ASP A OD1   1 
ATOM   4442  O  OD2   . ASP A 1 607  ? -36.474 -44.579 -67.989 1.00 51.06  ? 607  ASP A OD2   1 
ATOM   4443  N  N     . GLN A 1 608  ? -37.805 -44.235 -63.683 1.00 47.70  ? 608  GLN A N     1 
ATOM   4444  C  CA    . GLN A 1 608  ? -37.416 -45.255 -62.694 1.00 49.01  ? 608  GLN A CA    1 
ATOM   4445  C  C     . GLN A 1 608  ? -36.842 -44.751 -61.364 1.00 48.36  ? 608  GLN A C     1 
ATOM   4446  O  O     . GLN A 1 608  ? -36.087 -45.478 -60.718 1.00 47.80  ? 608  GLN A O     1 
ATOM   4447  C  CB    . GLN A 1 608  ? -36.401 -46.236 -63.288 1.00 50.51  ? 608  GLN A CB    1 
ATOM   4448  C  CG    . GLN A 1 608  ? -36.747 -46.771 -64.650 1.00 51.83  ? 608  GLN A CG    1 
ATOM   4449  C  CD    . GLN A 1 608  ? -35.878 -47.947 -64.982 1.00 53.74  ? 608  GLN A CD    1 
ATOM   4450  O  OE1   . GLN A 1 608  ? -34.691 -47.794 -65.259 1.00 55.68  ? 608  GLN A OE1   1 
ATOM   4451  N  NE2   . GLN A 1 608  ? -36.450 -49.131 -64.918 1.00 54.86  ? 608  GLN A NE2   1 
ATOM   4452  N  N     . GLU A 1 609  ? -37.184 -43.534 -60.947 1.00 48.34  ? 609  GLU A N     1 
ATOM   4453  C  CA    . GLU A 1 609  ? -36.690 -43.033 -59.669 1.00 48.77  ? 609  GLU A CA    1 
ATOM   4454  C  C     . GLU A 1 609  ? -37.283 -43.809 -58.511 1.00 47.77  ? 609  GLU A C     1 
ATOM   4455  O  O     . GLU A 1 609  ? -38.398 -44.315 -58.591 1.00 49.14  ? 609  GLU A O     1 
ATOM   4456  C  CB    . GLU A 1 609  ? -36.914 -41.526 -59.475 1.00 50.15  ? 609  GLU A CB    1 
ATOM   4457  C  CG    . GLU A 1 609  ? -38.359 -41.089 -59.347 1.00 53.77  ? 609  GLU A CG    1 
ATOM   4458  C  CD    . GLU A 1 609  ? -38.495 -39.656 -58.850 1.00 56.34  ? 609  GLU A CD    1 
ATOM   4459  O  OE1   . GLU A 1 609  ? -38.216 -38.705 -59.616 1.00 58.45  ? 609  GLU A OE1   1 
ATOM   4460  O  OE2   . GLU A 1 609  ? -38.906 -39.479 -57.681 1.00 59.80  ? 609  GLU A OE2   1 
ATOM   4461  N  N     . LEU A 1 610  ? -36.497 -43.899 -57.448 1.00 46.35  ? 610  LEU A N     1 
ATOM   4462  C  CA    . LEU A 1 610  ? -36.860 -44.554 -56.216 1.00 45.18  ? 610  LEU A CA    1 
ATOM   4463  C  C     . LEU A 1 610  ? -37.110 -43.477 -55.182 1.00 44.23  ? 610  LEU A C     1 
ATOM   4464  O  O     . LEU A 1 610  ? -36.759 -42.323 -55.372 1.00 42.52  ? 610  LEU A O     1 
ATOM   4465  C  CB    . LEU A 1 610  ? -35.696 -45.439 -55.756 1.00 46.12  ? 610  LEU A CB    1 
ATOM   4466  C  CG    . LEU A 1 610  ? -35.272 -46.535 -56.747 1.00 46.26  ? 610  LEU A CG    1 
ATOM   4467  C  CD1   . LEU A 1 610  ? -33.972 -47.158 -56.293 1.00 47.02  ? 610  LEU A CD1   1 
ATOM   4468  C  CD2   . LEU A 1 610  ? -36.344 -47.612 -56.901 1.00 46.39  ? 610  LEU A CD2   1 
ATOM   4469  N  N     . PHE A 1 611  ? -37.721 -43.874 -54.079 1.00 45.25  ? 611  PHE A N     1 
ATOM   4470  C  CA    . PHE A 1 611  ? -37.939 -43.001 -52.946 1.00 44.68  ? 611  PHE A CA    1 
ATOM   4471  C  C     . PHE A 1 611  ? -37.165 -43.507 -51.732 1.00 45.55  ? 611  PHE A C     1 
ATOM   4472  O  O     . PHE A 1 611  ? -37.112 -44.714 -51.468 1.00 45.34  ? 611  PHE A O     1 
ATOM   4473  C  CB    . PHE A 1 611  ? -39.424 -42.943 -52.621 1.00 45.15  ? 611  PHE A CB    1 
ATOM   4474  C  CG    . PHE A 1 611  ? -39.796 -41.781 -51.757 1.00 44.92  ? 611  PHE A CG    1 
ATOM   4475  C  CD1   . PHE A 1 611  ? -39.997 -40.526 -52.321 1.00 43.63  ? 611  PHE A CD1   1 
ATOM   4476  C  CD2   . PHE A 1 611  ? -39.913 -41.929 -50.383 1.00 45.63  ? 611  PHE A CD2   1 
ATOM   4477  C  CE1   . PHE A 1 611  ? -40.320 -39.445 -51.529 1.00 43.87  ? 611  PHE A CE1   1 
ATOM   4478  C  CE2   . PHE A 1 611  ? -40.245 -40.842 -49.583 1.00 45.61  ? 611  PHE A CE2   1 
ATOM   4479  C  CZ    . PHE A 1 611  ? -40.451 -39.605 -50.161 1.00 44.42  ? 611  PHE A CZ    1 
ATOM   4480  N  N     . LEU A 1 612  ? -36.584 -42.570 -50.994 1.00 46.24  ? 612  LEU A N     1 
ATOM   4481  C  CA    . LEU A 1 612  ? -35.880 -42.870 -49.766 1.00 48.18  ? 612  LEU A CA    1 
ATOM   4482  C  C     . LEU A 1 612  ? -36.597 -42.256 -48.573 1.00 48.50  ? 612  LEU A C     1 
ATOM   4483  O  O     . LEU A 1 612  ? -36.975 -41.087 -48.605 1.00 47.63  ? 612  LEU A O     1 
ATOM   4484  C  CB    . LEU A 1 612  ? -34.470 -42.307 -49.831 1.00 49.30  ? 612  LEU A CB    1 
ATOM   4485  C  CG    . LEU A 1 612  ? -33.554 -42.798 -48.712 1.00 51.44  ? 612  LEU A CG    1 
ATOM   4486  C  CD1   . LEU A 1 612  ? -33.019 -44.187 -49.025 1.00 52.49  ? 612  LEU A CD1   1 
ATOM   4487  C  CD2   . LEU A 1 612  ? -32.411 -41.822 -48.524 1.00 52.88  ? 612  LEU A CD2   1 
ATOM   4488  N  N     . THR A 1 613  ? -36.742 -43.052 -47.519 1.00 50.30  ? 613  THR A N     1 
ATOM   4489  C  CA    . THR A 1 613  ? -37.273 -42.610 -46.224 1.00 52.20  ? 613  THR A CA    1 
ATOM   4490  C  C     . THR A 1 613  ? -36.463 -43.224 -45.070 1.00 52.95  ? 613  THR A C     1 
ATOM   4491  O  O     . THR A 1 613  ? -35.913 -44.321 -45.199 1.00 54.47  ? 613  THR A O     1 
ATOM   4492  C  CB    . THR A 1 613  ? -38.784 -42.945 -46.064 1.00 53.43  ? 613  THR A CB    1 
ATOM   4493  O  OG1   . THR A 1 613  ? -39.255 -42.438 -44.807 1.00 56.20  ? 613  THR A OG1   1 
ATOM   4494  C  CG2   . THR A 1 613  ? -39.056 -44.439 -46.117 1.00 53.76  ? 613  THR A CG2   1 
ATOM   4495  N  N     . PHE A 1 614  ? -36.413 -42.516 -43.944 1.00 53.12  ? 614  PHE A N     1 
ATOM   4496  C  CA    . PHE A 1 614  ? -35.542 -42.869 -42.822 1.00 53.87  ? 614  PHE A CA    1 
ATOM   4497  C  C     . PHE A 1 614  ? -36.294 -43.499 -41.665 1.00 54.56  ? 614  PHE A C     1 
ATOM   4498  O  O     . PHE A 1 614  ? -37.411 -43.120 -41.392 1.00 54.99  ? 614  PHE A O     1 
ATOM   4499  C  CB    . PHE A 1 614  ? -34.813 -41.621 -42.320 1.00 54.10  ? 614  PHE A CB    1 
ATOM   4500  C  CG    . PHE A 1 614  ? -33.848 -41.054 -43.314 1.00 54.31  ? 614  PHE A CG    1 
ATOM   4501  C  CD1   . PHE A 1 614  ? -32.561 -41.580 -43.432 1.00 55.77  ? 614  PHE A CD1   1 
ATOM   4502  C  CD2   . PHE A 1 614  ? -34.219 -40.013 -44.147 1.00 53.69  ? 614  PHE A CD2   1 
ATOM   4503  C  CE1   . PHE A 1 614  ? -31.663 -41.071 -44.363 1.00 55.43  ? 614  PHE A CE1   1 
ATOM   4504  C  CE2   . PHE A 1 614  ? -33.326 -39.501 -45.081 1.00 54.30  ? 614  PHE A CE2   1 
ATOM   4505  C  CZ    . PHE A 1 614  ? -32.049 -40.030 -45.193 1.00 54.56  ? 614  PHE A CZ    1 
ATOM   4506  N  N     . VAL A 1 615  ? -35.677 -44.481 -41.014 1.00 56.28  ? 615  VAL A N     1 
ATOM   4507  C  CA    . VAL A 1 615  ? -36.087 -44.923 -39.688 1.00 58.08  ? 615  VAL A CA    1 
ATOM   4508  C  C     . VAL A 1 615  ? -35.263 -44.084 -38.708 1.00 59.08  ? 615  VAL A C     1 
ATOM   4509  O  O     . VAL A 1 615  ? -34.034 -44.056 -38.804 1.00 60.29  ? 615  VAL A O     1 
ATOM   4510  C  CB    . VAL A 1 615  ? -35.811 -46.432 -39.466 1.00 59.56  ? 615  VAL A CB    1 
ATOM   4511  C  CG1   . VAL A 1 615  ? -36.155 -46.845 -38.035 1.00 61.03  ? 615  VAL A CG1   1 
ATOM   4512  C  CG2   . VAL A 1 615  ? -36.575 -47.282 -40.476 1.00 58.69  ? 615  VAL A CG2   1 
ATOM   4513  N  N     . THR A 1 616  ? -35.929 -43.403 -37.778 1.00 59.65  ? 616  THR A N     1 
ATOM   4514  C  CA    . THR A 1 616  ? -35.247 -42.540 -36.805 1.00 59.97  ? 616  THR A CA    1 
ATOM   4515  C  C     . THR A 1 616  ? -35.305 -43.115 -35.393 1.00 60.82  ? 616  THR A C     1 
ATOM   4516  O  O     . THR A 1 616  ? -36.169 -43.925 -35.080 1.00 62.89  ? 616  THR A O     1 
ATOM   4517  C  CB    . THR A 1 616  ? -35.852 -41.132 -36.771 1.00 59.54  ? 616  THR A CB    1 
ATOM   4518  O  OG1   . THR A 1 616  ? -37.189 -41.196 -36.265 1.00 60.33  ? 616  THR A OG1   1 
ATOM   4519  C  CG2   . THR A 1 616  ? -35.839 -40.496 -38.154 1.00 58.07  ? 616  THR A CG2   1 
ATOM   4520  N  N     . SER A 1 617  ? -34.376 -42.689 -34.547 1.00 60.80  ? 617  SER A N     1 
ATOM   4521  C  CA    . SER A 1 617  ? -34.313 -43.162 -33.169 1.00 61.89  ? 617  SER A CA    1 
ATOM   4522  C  C     . SER A 1 617  ? -35.574 -42.767 -32.412 1.00 62.96  ? 617  SER A C     1 
ATOM   4523  O  O     . SER A 1 617  ? -36.083 -41.652 -32.589 1.00 61.73  ? 617  SER A O     1 
ATOM   4524  C  CB    . SER A 1 617  ? -33.102 -42.570 -32.451 1.00 61.82  ? 617  SER A CB    1 
ATOM   4525  O  OG    . SER A 1 617  ? -33.150 -42.866 -31.074 1.00 62.21  ? 617  SER A OG    1 
ATOM   4526  N  N     . SER A 1 618  ? -36.068 -43.691 -31.587 1.00 64.32  ? 618  SER A N     1 
ATOM   4527  C  CA    . SER A 1 618  ? -37.183 -43.427 -30.675 1.00 65.28  ? 618  SER A CA    1 
ATOM   4528  C  C     . SER A 1 618  ? -36.727 -43.287 -29.212 1.00 67.23  ? 618  SER A C     1 
ATOM   4529  O  O     . SER A 1 618  ? -37.558 -43.043 -28.332 1.00 67.98  ? 618  SER A O     1 
ATOM   4530  C  CB    . SER A 1 618  ? -38.222 -44.539 -30.796 1.00 65.35  ? 618  SER A CB    1 
ATOM   4531  O  OG    . SER A 1 618  ? -37.657 -45.788 -30.439 1.00 66.82  ? 618  SER A OG    1 
ATOM   4532  N  N     . ARG A 1 619  ? -35.421 -43.438 -28.960 1.00 67.96  ? 619  ARG A N     1 
ATOM   4533  C  CA    . ARG A 1 619  ? -34.843 -43.267 -27.630 1.00 69.68  ? 619  ARG A CA    1 
ATOM   4534  C  C     . ARG A 1 619  ? -33.881 -42.090 -27.619 1.00 68.54  ? 619  ARG A C     1 
ATOM   4535  O  O     . ARG A 1 619  ? -33.256 -41.800 -28.633 1.00 68.70  ? 619  ARG A O     1 
ATOM   4536  C  CB    . ARG A 1 619  ? -34.107 -44.536 -27.215 1.00 72.57  ? 619  ARG A CB    1 
ATOM   4537  C  CG    . ARG A 1 619  ? -34.983 -45.780 -27.157 1.00 74.83  ? 619  ARG A CG    1 
ATOM   4538  C  CD    . ARG A 1 619  ? -36.161 -45.642 -26.190 1.00 76.85  ? 619  ARG A CD    1 
ATOM   4539  N  NE    . ARG A 1 619  ? -36.850 -46.920 -25.990 1.00 79.14  ? 619  ARG A NE    1 
ATOM   4540  C  CZ    . ARG A 1 619  ? -36.393 -47.939 -25.256 1.00 82.52  ? 619  ARG A CZ    1 
ATOM   4541  N  NH1   . ARG A 1 619  ? -35.226 -47.867 -24.609 1.00 84.04  ? 619  ARG A NH1   1 
ATOM   4542  N  NH2   . ARG A 1 619  ? -37.112 -49.058 -25.165 1.00 84.47  ? 619  ARG A NH2   1 
ATOM   4543  N  N     . ALA A 1 620  ? -33.765 -41.421 -26.470 1.00 68.60  ? 620  ALA A N     1 
ATOM   4544  C  CA    . ALA A 1 620  ? -32.908 -40.231 -26.317 1.00 67.33  ? 620  ALA A CA    1 
ATOM   4545  C  C     . ALA A 1 620  ? -31.428 -40.547 -26.031 1.00 67.52  ? 620  ALA A C     1 
ATOM   4546  O  O     . ALA A 1 620  ? -30.546 -39.824 -26.475 1.00 66.34  ? 620  ALA A O     1 
ATOM   4547  C  CB    . ALA A 1 620  ? -33.466 -39.327 -25.233 1.00 68.24  ? 620  ALA A CB    1 
ATOM   4548  N  N     . HIS A 1 621  ? -31.159 -41.603 -25.271 1.00 68.71  ? 621  HIS A N     1 
ATOM   4549  C  CA    . HIS A 1 621  ? -29.785 -42.042 -25.032 1.00 70.15  ? 621  HIS A CA    1 
ATOM   4550  C  C     . HIS A 1 621  ? -29.774 -43.528 -24.685 1.00 72.27  ? 621  HIS A C     1 
ATOM   4551  O  O     . HIS A 1 621  ? -30.033 -43.910 -23.542 1.00 74.49  ? 621  HIS A O     1 
ATOM   4552  C  CB    . HIS A 1 621  ? -29.120 -41.192 -23.937 1.00 71.06  ? 621  HIS A CB    1 
ATOM   4553  C  CG    . HIS A 1 621  ? -27.672 -41.508 -23.708 1.00 71.70  ? 621  HIS A CG    1 
ATOM   4554  N  ND1   . HIS A 1 621  ? -26.792 -41.788 -24.732 1.00 71.00  ? 621  HIS A ND1   1 
ATOM   4555  C  CD2   . HIS A 1 621  ? -26.947 -41.566 -22.567 1.00 73.22  ? 621  HIS A CD2   1 
ATOM   4556  C  CE1   . HIS A 1 621  ? -25.593 -42.023 -24.231 1.00 72.13  ? 621  HIS A CE1   1 
ATOM   4557  N  NE2   . HIS A 1 621  ? -25.661 -41.893 -22.920 1.00 73.57  ? 621  HIS A NE2   1 
ATOM   4558  N  N     . ALA A 1 622  ? -29.473 -44.356 -25.685 1.00 72.20  ? 622  ALA A N     1 
ATOM   4559  C  CA    . ALA A 1 622  ? -29.611 -45.798 -25.562 1.00 73.53  ? 622  ALA A CA    1 
ATOM   4560  C  C     . ALA A 1 622  ? -28.640 -46.563 -26.445 1.00 74.38  ? 622  ALA A C     1 
ATOM   4561  O  O     . ALA A 1 622  ? -28.175 -46.065 -27.471 1.00 71.65  ? 622  ALA A O     1 
ATOM   4562  C  CB    . ALA A 1 622  ? -31.036 -46.194 -25.906 1.00 73.05  ? 622  ALA A CB    1 
ATOM   4563  N  N     . LYS A 1 623  ? -28.349 -47.787 -26.021 1.00 78.42  ? 623  LYS A N     1 
ATOM   4564  C  CA    . LYS A 1 623  ? -27.598 -48.753 -26.821 1.00 81.42  ? 623  LYS A CA    1 
ATOM   4565  C  C     . LYS A 1 623  ? -28.536 -49.341 -27.877 1.00 80.01  ? 623  LYS A C     1 
ATOM   4566  O  O     . LYS A 1 623  ? -29.706 -49.590 -27.600 1.00 79.68  ? 623  LYS A O     1 
ATOM   4567  C  CB    . LYS A 1 623  ? -27.038 -49.857 -25.909 1.00 86.11  ? 623  LYS A CB    1 
ATOM   4568  C  CG    . LYS A 1 623  ? -26.286 -50.993 -26.593 1.00 89.37  ? 623  LYS A CG    1 
ATOM   4569  C  CD    . LYS A 1 623  ? -24.904 -50.574 -27.072 1.00 90.92  ? 623  LYS A CD    1 
ATOM   4570  C  CE    . LYS A 1 623  ? -24.279 -51.666 -27.936 1.00 92.07  ? 623  LYS A CE    1 
ATOM   4571  N  NZ    . LYS A 1 623  ? -22.911 -51.304 -28.401 1.00 92.39  ? 623  LYS A NZ    1 
ATOM   4572  N  N     . ILE A 1 624  ? -28.024 -49.524 -29.093 1.00 79.43  ? 624  ILE A N     1 
ATOM   4573  C  CA    . ILE A 1 624  ? -28.744 -50.224 -30.155 1.00 78.06  ? 624  ILE A CA    1 
ATOM   4574  C  C     . ILE A 1 624  ? -28.302 -51.671 -30.043 1.00 79.62  ? 624  ILE A C     1 
ATOM   4575  O  O     . ILE A 1 624  ? -27.200 -52.014 -30.477 1.00 80.38  ? 624  ILE A O     1 
ATOM   4576  C  CB    . ILE A 1 624  ? -28.401 -49.667 -31.558 1.00 76.39  ? 624  ILE A CB    1 
ATOM   4577  C  CG1   . ILE A 1 624  ? -28.849 -48.212 -31.680 1.00 75.13  ? 624  ILE A CG1   1 
ATOM   4578  C  CG2   . ILE A 1 624  ? -29.063 -50.503 -32.652 1.00 76.16  ? 624  ILE A CG2   1 
ATOM   4579  C  CD1   . ILE A 1 624  ? -28.328 -47.508 -32.915 1.00 74.15  ? 624  ILE A CD1   1 
ATOM   4580  N  N     . VAL A 1 625  ? -29.137 -52.516 -29.441 1.00 80.21  ? 625  VAL A N     1 
ATOM   4581  C  CA    . VAL A 1 625  ? -28.750 -53.912 -29.234 1.00 82.14  ? 625  VAL A CA    1 
ATOM   4582  C  C     . VAL A 1 625  ? -28.854 -54.675 -30.561 1.00 81.53  ? 625  VAL A C     1 
ATOM   4583  O  O     . VAL A 1 625  ? -27.982 -55.486 -30.864 1.00 83.03  ? 625  VAL A O     1 
ATOM   4584  C  CB    . VAL A 1 625  ? -29.501 -54.627 -28.055 1.00 83.81  ? 625  VAL A CB    1 
ATOM   4585  C  CG1   . VAL A 1 625  ? -29.636 -53.707 -26.843 1.00 84.22  ? 625  VAL A CG1   1 
ATOM   4586  C  CG2   . VAL A 1 625  ? -30.861 -55.176 -28.460 1.00 83.04  ? 625  VAL A CG2   1 
ATOM   4587  N  N     . SER A 1 626  ? -29.894 -54.399 -31.354 1.00 80.42  ? 626  SER A N     1 
ATOM   4588  C  CA    . SER A 1 626  ? -30.080 -55.072 -32.646 1.00 79.75  ? 626  SER A CA    1 
ATOM   4589  C  C     . SER A 1 626  ? -31.071 -54.367 -33.570 1.00 77.96  ? 626  SER A C     1 
ATOM   4590  O  O     . SER A 1 626  ? -31.921 -53.593 -33.120 1.00 78.14  ? 626  SER A O     1 
ATOM   4591  C  CB    . SER A 1 626  ? -30.562 -56.511 -32.437 1.00 81.35  ? 626  SER A CB    1 
ATOM   4592  O  OG    . SER A 1 626  ? -31.895 -56.533 -31.950 1.00 82.02  ? 626  SER A OG    1 
ATOM   4593  N  N     . ILE A 1 627  ? -30.944 -54.671 -34.862 1.00 76.72  ? 627  ILE A N     1 
ATOM   4594  C  CA    . ILE A 1 627  ? -31.875 -54.225 -35.897 1.00 75.06  ? 627  ILE A CA    1 
ATOM   4595  C  C     . ILE A 1 627  ? -32.300 -55.454 -36.699 1.00 75.41  ? 627  ILE A C     1 
ATOM   4596  O  O     . ILE A 1 627  ? -31.453 -56.164 -37.229 1.00 76.34  ? 627  ILE A O     1 
ATOM   4597  C  CB    . ILE A 1 627  ? -31.235 -53.187 -36.848 1.00 73.00  ? 627  ILE A CB    1 
ATOM   4598  C  CG1   . ILE A 1 627  ? -30.629 -52.024 -36.051 1.00 72.57  ? 627  ILE A CG1   1 
ATOM   4599  C  CG2   . ILE A 1 627  ? -32.259 -52.645 -37.846 1.00 71.81  ? 627  ILE A CG2   1 
ATOM   4600  C  CD1   . ILE A 1 627  ? -30.098 -50.895 -36.910 1.00 70.50  ? 627  ILE A CD1   1 
ATOM   4601  N  N     . ASP A 1 628  ? -33.609 -55.695 -36.771 1.00 75.64  ? 628  ASP A N     1 
ATOM   4602  C  CA    . ASP A 1 628  ? -34.182 -56.752 -37.605 1.00 75.59  ? 628  ASP A CA    1 
ATOM   4603  C  C     . ASP A 1 628  ? -34.824 -56.126 -38.851 1.00 72.70  ? 628  ASP A C     1 
ATOM   4604  O  O     . ASP A 1 628  ? -35.776 -55.341 -38.749 1.00 71.65  ? 628  ASP A O     1 
ATOM   4605  C  CB    . ASP A 1 628  ? -35.220 -57.549 -36.804 1.00 77.86  ? 628  ASP A CB    1 
ATOM   4606  C  CG    . ASP A 1 628  ? -35.634 -58.855 -37.484 1.00 79.30  ? 628  ASP A CG    1 
ATOM   4607  O  OD1   . ASP A 1 628  ? -34.983 -59.283 -38.462 1.00 80.05  ? 628  ASP A OD1   1 
ATOM   4608  O  OD2   . ASP A 1 628  ? -36.625 -59.462 -37.026 1.00 80.24  ? 628  ASP A OD2   1 
ATOM   4609  N  N     . LEU A 1 629  ? -34.286 -56.468 -40.017 1.00 70.17  ? 629  LEU A N     1 
ATOM   4610  C  CA    . LEU A 1 629  ? -34.759 -55.936 -41.287 1.00 68.80  ? 629  LEU A CA    1 
ATOM   4611  C  C     . LEU A 1 629  ? -35.490 -56.976 -42.134 1.00 69.79  ? 629  LEU A C     1 
ATOM   4612  O  O     . LEU A 1 629  ? -35.952 -56.662 -43.231 1.00 69.99  ? 629  LEU A O     1 
ATOM   4613  C  CB    . LEU A 1 629  ? -33.568 -55.392 -42.079 1.00 67.55  ? 629  LEU A CB    1 
ATOM   4614  C  CG    . LEU A 1 629  ? -32.786 -54.238 -41.456 1.00 66.74  ? 629  LEU A CG    1 
ATOM   4615  C  CD1   . LEU A 1 629  ? -31.512 -53.977 -42.246 1.00 65.98  ? 629  LEU A CD1   1 
ATOM   4616  C  CD2   . LEU A 1 629  ? -33.639 -52.982 -41.373 1.00 65.65  ? 629  LEU A CD2   1 
ATOM   4617  N  N     . SER A 1 630  ? -35.615 -58.199 -41.625 1.00 71.90  ? 630  SER A N     1 
ATOM   4618  C  CA    . SER A 1 630  ? -36.072 -59.342 -42.418 1.00 71.93  ? 630  SER A CA    1 
ATOM   4619  C  C     . SER A 1 630  ? -37.503 -59.186 -42.930 1.00 71.32  ? 630  SER A C     1 
ATOM   4620  O  O     . SER A 1 630  ? -37.776 -59.516 -44.082 1.00 69.79  ? 630  SER A O     1 
ATOM   4621  C  CB    . SER A 1 630  ? -35.940 -60.625 -41.599 1.00 73.41  ? 630  SER A CB    1 
ATOM   4622  O  OG    . SER A 1 630  ? -36.479 -60.439 -40.300 1.00 74.00  ? 630  SER A OG    1 
ATOM   4623  N  N     . GLU A 1 631  ? -38.400 -58.682 -42.085 1.00 72.59  ? 631  GLU A N     1 
ATOM   4624  C  CA    . GLU A 1 631  ? -39.778 -58.406 -42.502 1.00 75.02  ? 631  GLU A CA    1 
ATOM   4625  C  C     . GLU A 1 631  ? -39.831 -57.217 -43.459 1.00 73.50  ? 631  GLU A C     1 
ATOM   4626  O  O     . GLU A 1 631  ? -40.477 -57.291 -44.506 1.00 74.73  ? 631  GLU A O     1 
ATOM   4627  C  CB    . GLU A 1 631  ? -40.703 -58.155 -41.303 1.00 77.91  ? 631  GLU A CB    1 
ATOM   4628  C  CG    . GLU A 1 631  ? -42.186 -58.278 -41.655 1.00 80.82  ? 631  GLU A CG    1 
ATOM   4629  C  CD    . GLU A 1 631  ? -43.131 -58.083 -40.471 1.00 84.71  ? 631  GLU A CD    1 
ATOM   4630  O  OE1   . GLU A 1 631  ? -42.671 -57.784 -39.345 1.00 87.53  ? 631  GLU A OE1   1 
ATOM   4631  O  OE2   . GLU A 1 631  ? -44.358 -58.218 -40.671 1.00 86.91  ? 631  GLU A OE2   1 
ATOM   4632  N  N     . ALA A 1 632  ? -39.151 -56.132 -43.097 1.00 71.55  ? 632  ALA A N     1 
ATOM   4633  C  CA    . ALA A 1 632  ? -39.075 -54.946 -43.950 1.00 69.60  ? 632  ALA A CA    1 
ATOM   4634  C  C     . ALA A 1 632  ? -38.506 -55.253 -45.334 1.00 67.81  ? 632  ALA A C     1 
ATOM   4635  O  O     . ALA A 1 632  ? -39.041 -54.788 -46.336 1.00 68.17  ? 632  ALA A O     1 
ATOM   4636  C  CB    . ALA A 1 632  ? -38.251 -53.858 -43.281 1.00 69.64  ? 632  ALA A CB    1 
ATOM   4637  N  N     . LEU A 1 633  ? -37.441 -56.045 -45.386 1.00 66.61  ? 633  LEU A N     1 
ATOM   4638  C  CA    . LEU A 1 633  ? -36.779 -56.374 -46.659 1.00 66.62  ? 633  LEU A CA    1 
ATOM   4639  C  C     . LEU A 1 633  ? -37.612 -57.216 -47.620 1.00 67.18  ? 633  LEU A C     1 
ATOM   4640  O  O     . LEU A 1 633  ? -37.379 -57.184 -48.828 1.00 67.00  ? 633  LEU A O     1 
ATOM   4641  C  CB    . LEU A 1 633  ? -35.447 -57.092 -46.413 1.00 67.03  ? 633  LEU A CB    1 
ATOM   4642  C  CG    . LEU A 1 633  ? -34.253 -56.191 -46.104 1.00 65.73  ? 633  LEU A CG    1 
ATOM   4643  C  CD1   . LEU A 1 633  ? -33.133 -57.014 -45.483 1.00 66.69  ? 633  LEU A CD1   1 
ATOM   4644  C  CD2   . LEU A 1 633  ? -33.780 -55.469 -47.359 1.00 64.44  ? 633  LEU A CD2   1 
ATOM   4645  N  N     . SER A 1 634  ? -38.566 -57.969 -47.085 1.00 68.85  ? 634  SER A N     1 
ATOM   4646  C  CA    . SER A 1 634  ? -39.400 -58.860 -47.884 1.00 70.61  ? 634  SER A CA    1 
ATOM   4647  C  C     . SER A 1 634  ? -40.629 -58.174 -48.480 1.00 70.00  ? 634  SER A C     1 
ATOM   4648  O  O     . SER A 1 634  ? -41.328 -58.774 -49.297 1.00 70.07  ? 634  SER A O     1 
ATOM   4649  C  CB    . SER A 1 634  ? -39.859 -60.027 -47.011 1.00 73.12  ? 634  SER A CB    1 
ATOM   4650  O  OG    . SER A 1 634  ? -40.571 -59.540 -45.878 1.00 74.85  ? 634  SER A OG    1 
ATOM   4651  N  N     . MET A 1 635  ? -40.891 -56.930 -48.080 1.00 69.17  ? 635  MET A N     1 
ATOM   4652  C  CA    . MET A 1 635  ? -42.155 -56.270 -48.407 1.00 68.82  ? 635  MET A CA    1 
ATOM   4653  C  C     . MET A 1 635  ? -42.187 -55.667 -49.807 1.00 65.10  ? 635  MET A C     1 
ATOM   4654  O  O     . MET A 1 635  ? -41.135 -55.440 -50.391 1.00 62.70  ? 635  MET A O     1 
ATOM   4655  C  CB    . MET A 1 635  ? -42.484 -55.213 -47.352 1.00 71.22  ? 635  MET A CB    1 
ATOM   4656  C  CG    . MET A 1 635  ? -43.123 -55.842 -46.132 1.00 74.40  ? 635  MET A CG    1 
ATOM   4657  S  SD    . MET A 1 635  ? -43.407 -54.651 -44.834 1.00 78.61  ? 635  MET A SD    1 
ATOM   4658  C  CE    . MET A 1 635  ? -44.660 -53.616 -45.605 1.00 76.46  ? 635  MET A CE    1 
ATOM   4659  N  N     . PRO A 1 636  ? -43.407 -55.412 -50.349 1.00 63.36  ? 636  PRO A N     1 
ATOM   4660  C  CA    . PRO A 1 636  ? -43.549 -54.948 -51.740 1.00 60.86  ? 636  PRO A CA    1 
ATOM   4661  C  C     . PRO A 1 636  ? -42.796 -53.663 -52.057 1.00 57.58  ? 636  PRO A C     1 
ATOM   4662  O  O     . PRO A 1 636  ? -42.931 -52.682 -51.338 1.00 56.86  ? 636  PRO A O     1 
ATOM   4663  C  CB    . PRO A 1 636  ? -45.062 -54.722 -51.888 1.00 60.79  ? 636  PRO A CB    1 
ATOM   4664  C  CG    . PRO A 1 636  ? -45.684 -55.601 -50.867 1.00 62.20  ? 636  PRO A CG    1 
ATOM   4665  C  CD    . PRO A 1 636  ? -44.731 -55.595 -49.712 1.00 62.97  ? 636  PRO A CD    1 
ATOM   4666  N  N     . GLY A 1 637  ? -42.004 -53.693 -53.122 1.00 55.77  ? 637  GLY A N     1 
ATOM   4667  C  CA    . GLY A 1 637  ? -41.318 -52.508 -53.630 1.00 54.24  ? 637  GLY A CA    1 
ATOM   4668  C  C     . GLY A 1 637  ? -39.951 -52.228 -53.035 1.00 53.29  ? 637  GLY A C     1 
ATOM   4669  O  O     . GLY A 1 637  ? -39.204 -51.421 -53.572 1.00 52.25  ? 637  GLY A O     1 
ATOM   4670  N  N     . VAL A 1 638  ? -39.608 -52.890 -51.936 1.00 54.11  ? 638  VAL A N     1 
ATOM   4671  C  CA    . VAL A 1 638  ? -38.396 -52.556 -51.209 1.00 54.24  ? 638  VAL A CA    1 
ATOM   4672  C  C     . VAL A 1 638  ? -37.212 -53.008 -52.039 1.00 54.41  ? 638  VAL A C     1 
ATOM   4673  O  O     . VAL A 1 638  ? -37.183 -54.125 -52.541 1.00 55.87  ? 638  VAL A O     1 
ATOM   4674  C  CB    . VAL A 1 638  ? -38.358 -53.188 -49.804 1.00 55.35  ? 638  VAL A CB    1 
ATOM   4675  C  CG1   . VAL A 1 638  ? -37.039 -52.882 -49.105 1.00 56.28  ? 638  VAL A CG1   1 
ATOM   4676  C  CG2   . VAL A 1 638  ? -39.515 -52.666 -48.972 1.00 55.21  ? 638  VAL A CG2   1 
ATOM   4677  N  N     . VAL A 1 639  ? -36.269 -52.095 -52.207 1.00 54.24  ? 639  VAL A N     1 
ATOM   4678  C  CA    . VAL A 1 639  ? -35.061 -52.313 -52.985 1.00 54.63  ? 639  VAL A CA    1 
ATOM   4679  C  C     . VAL A 1 639  ? -33.860 -52.522 -52.067 1.00 56.35  ? 639  VAL A C     1 
ATOM   4680  O  O     . VAL A 1 639  ? -33.018 -53.378 -52.348 1.00 58.15  ? 639  VAL A O     1 
ATOM   4681  C  CB    . VAL A 1 639  ? -34.822 -51.114 -53.930 1.00 53.38  ? 639  VAL A CB    1 
ATOM   4682  C  CG1   . VAL A 1 639  ? -33.482 -51.206 -54.650 1.00 52.91  ? 639  VAL A CG1   1 
ATOM   4683  C  CG2   . VAL A 1 639  ? -35.974 -51.019 -54.924 1.00 53.24  ? 639  VAL A CG2   1 
ATOM   4684  N  N     . ASP A 1 640  ? -33.763 -51.741 -50.991 1.00 56.61  ? 640  ASP A N     1 
ATOM   4685  C  CA    . ASP A 1 640  ? -32.594 -51.787 -50.124 1.00 58.56  ? 640  ASP A CA    1 
ATOM   4686  C  C     . ASP A 1 640  ? -32.906 -51.150 -48.789 1.00 58.58  ? 640  ASP A C     1 
ATOM   4687  O  O     . ASP A 1 640  ? -33.722 -50.232 -48.717 1.00 57.95  ? 640  ASP A O     1 
ATOM   4688  C  CB    . ASP A 1 640  ? -31.434 -51.033 -50.794 1.00 59.45  ? 640  ASP A CB    1 
ATOM   4689  C  CG    . ASP A 1 640  ? -30.056 -51.391 -50.228 1.00 61.68  ? 640  ASP A CG    1 
ATOM   4690  O  OD1   . ASP A 1 640  ? -29.915 -52.366 -49.463 1.00 64.47  ? 640  ASP A OD1   1 
ATOM   4691  O  OD2   . ASP A 1 640  ? -29.083 -50.683 -50.582 1.00 63.02  ? 640  ASP A OD2   1 
ATOM   4692  N  N     . ILE A 1 641  ? -32.272 -51.648 -47.731 1.00 59.64  ? 641  ILE A N     1 
ATOM   4693  C  CA    . ILE A 1 641  ? -32.274 -50.956 -46.449 1.00 60.32  ? 641  ILE A CA    1 
ATOM   4694  C  C     . ILE A 1 641  ? -30.839 -50.831 -45.916 1.00 62.56  ? 641  ILE A C     1 
ATOM   4695  O  O     . ILE A 1 641  ? -30.185 -51.833 -45.640 1.00 64.25  ? 641  ILE A O     1 
ATOM   4696  C  CB    . ILE A 1 641  ? -33.209 -51.615 -45.419 1.00 59.76  ? 641  ILE A CB    1 
ATOM   4697  C  CG1   . ILE A 1 641  ? -34.628 -51.744 -45.999 1.00 59.16  ? 641  ILE A CG1   1 
ATOM   4698  C  CG2   . ILE A 1 641  ? -33.221 -50.792 -44.131 1.00 59.94  ? 641  ILE A CG2   1 
ATOM   4699  C  CD1   . ILE A 1 641  ? -35.644 -52.411 -45.090 1.00 59.56  ? 641  ILE A CD1   1 
ATOM   4700  N  N     . MET A 1 642  ? -30.366 -49.591 -45.783 1.00 64.08  ? 642  MET A N     1 
ATOM   4701  C  CA    . MET A 1 642  ? -29.007 -49.302 -45.334 1.00 66.18  ? 642  MET A CA    1 
ATOM   4702  C  C     . MET A 1 642  ? -28.971 -48.895 -43.861 1.00 66.17  ? 642  MET A C     1 
ATOM   4703  O  O     . MET A 1 642  ? -29.690 -47.993 -43.441 1.00 66.49  ? 642  MET A O     1 
ATOM   4704  C  CB    . MET A 1 642  ? -28.413 -48.180 -46.175 1.00 68.71  ? 642  MET A CB    1 
ATOM   4705  C  CG    . MET A 1 642  ? -28.026 -48.587 -47.585 1.00 72.16  ? 642  MET A CG    1 
ATOM   4706  S  SD    . MET A 1 642  ? -28.014 -47.175 -48.720 1.00 77.09  ? 642  MET A SD    1 
ATOM   4707  C  CE    . MET A 1 642  ? -29.772 -47.019 -49.064 1.00 77.35  ? 642  MET A CE    1 
ATOM   4708  N  N     . THR A 1 643  ? -28.151 -49.598 -43.088 1.00 67.07  ? 643  THR A N     1 
ATOM   4709  C  CA    . THR A 1 643  ? -27.708 -49.184 -41.755 1.00 67.48  ? 643  THR A CA    1 
ATOM   4710  C  C     . THR A 1 643  ? -26.302 -48.608 -41.870 1.00 67.46  ? 643  THR A C     1 
ATOM   4711  O  O     . THR A 1 643  ? -25.756 -48.530 -42.962 1.00 67.09  ? 643  THR A O     1 
ATOM   4712  C  CB    . THR A 1 643  ? -27.669 -50.385 -40.795 1.00 69.54  ? 643  THR A CB    1 
ATOM   4713  O  OG1   . THR A 1 643  ? -26.674 -51.321 -41.236 1.00 70.11  ? 643  THR A OG1   1 
ATOM   4714  C  CG2   . THR A 1 643  ? -29.037 -51.070 -40.730 1.00 69.78  ? 643  THR A CG2   1 
ATOM   4715  N  N     . ALA A 1 644  ? -25.709 -48.220 -40.745 1.00 69.15  ? 644  ALA A N     1 
ATOM   4716  C  CA    . ALA A 1 644  ? -24.341 -47.665 -40.725 1.00 69.79  ? 644  ALA A CA    1 
ATOM   4717  C  C     . ALA A 1 644  ? -23.254 -48.617 -41.241 1.00 70.89  ? 644  ALA A C     1 
ATOM   4718  O  O     . ALA A 1 644  ? -22.230 -48.170 -41.748 1.00 69.75  ? 644  ALA A O     1 
ATOM   4719  C  CB    . ALA A 1 644  ? -23.988 -47.185 -39.324 1.00 70.83  ? 644  ALA A CB    1 
ATOM   4720  N  N     . GLU A 1 645  ? -23.482 -49.919 -41.105 1.00 73.71  ? 645  GLU A N     1 
ATOM   4721  C  CA    . GLU A 1 645  ? -22.582 -50.936 -41.654 1.00 76.38  ? 645  GLU A CA    1 
ATOM   4722  C  C     . GLU A 1 645  ? -22.438 -50.862 -43.186 1.00 75.90  ? 645  GLU A C     1 
ATOM   4723  O  O     . GLU A 1 645  ? -21.355 -51.112 -43.730 1.00 74.51  ? 645  GLU A O     1 
ATOM   4724  C  CB    . GLU A 1 645  ? -23.080 -52.326 -41.258 1.00 79.21  ? 645  GLU A CB    1 
ATOM   4725  C  CG    . GLU A 1 645  ? -22.066 -53.442 -41.477 1.00 82.69  ? 645  GLU A CG    1 
ATOM   4726  C  CD    . GLU A 1 645  ? -22.670 -54.822 -41.326 1.00 85.76  ? 645  GLU A CD    1 
ATOM   4727  O  OE1   . GLU A 1 645  ? -23.910 -54.952 -41.434 1.00 89.12  ? 645  GLU A OE1   1 
ATOM   4728  O  OE2   . GLU A 1 645  ? -21.902 -55.784 -41.110 1.00 87.63  ? 645  GLU A OE2   1 
ATOM   4729  N  N     . HIS A 1 646  ? -23.526 -50.495 -43.862 1.00 76.27  ? 646  HIS A N     1 
ATOM   4730  C  CA    . HIS A 1 646  ? -23.602 -50.489 -45.326 1.00 75.93  ? 646  HIS A CA    1 
ATOM   4731  C  C     . HIS A 1 646  ? -23.006 -49.217 -45.917 1.00 75.26  ? 646  HIS A C     1 
ATOM   4732  O  O     . HIS A 1 646  ? -22.816 -49.136 -47.123 1.00 74.09  ? 646  HIS A O     1 
ATOM   4733  C  CB    . HIS A 1 646  ? -25.055 -50.620 -45.783 1.00 76.32  ? 646  HIS A CB    1 
ATOM   4734  C  CG    . HIS A 1 646  ? -25.725 -51.874 -45.321 1.00 78.52  ? 646  HIS A CG    1 
ATOM   4735  N  ND1   . HIS A 1 646  ? -26.079 -52.095 -44.008 1.00 80.09  ? 646  HIS A ND1   1 
ATOM   4736  C  CD2   . HIS A 1 646  ? -26.108 -52.977 -46.002 1.00 80.45  ? 646  HIS A CD2   1 
ATOM   4737  C  CE1   . HIS A 1 646  ? -26.647 -53.279 -43.897 1.00 81.17  ? 646  HIS A CE1   1 
ATOM   4738  N  NE2   . HIS A 1 646  ? -26.674 -53.837 -45.093 1.00 82.07  ? 646  HIS A NE2   1 
ATOM   4739  N  N     . LEU A 1 647  ? -22.752 -48.219 -45.072 1.00 77.00  ? 647  LEU A N     1 
ATOM   4740  C  CA    . LEU A 1 647  ? -21.989 -47.031 -45.458 1.00 78.36  ? 647  LEU A CA    1 
ATOM   4741  C  C     . LEU A 1 647  ? -20.499 -47.112 -45.081 1.00 80.31  ? 647  LEU A C     1 
ATOM   4742  O  O     . LEU A 1 647  ? -19.699 -46.337 -45.602 1.00 80.44  ? 647  LEU A O     1 
ATOM   4743  C  CB    . LEU A 1 647  ? -22.631 -45.772 -44.867 1.00 78.76  ? 647  LEU A CB    1 
ATOM   4744  C  CG    . LEU A 1 647  ? -23.787 -45.221 -45.705 1.00 78.55  ? 647  LEU A CG    1 
ATOM   4745  C  CD1   . LEU A 1 647  ? -24.907 -46.240 -45.861 1.00 79.41  ? 647  LEU A CD1   1 
ATOM   4746  C  CD2   . LEU A 1 647  ? -24.313 -43.939 -45.089 1.00 79.26  ? 647  LEU A CD2   1 
ATOM   4747  N  N     . SER A 1 648  ? -20.140 -48.038 -44.185 1.00 83.19  ? 648  SER A N     1 
ATOM   4748  C  CA    . SER A 1 648  ? -18.743 -48.306 -43.776 1.00 85.17  ? 648  SER A CA    1 
ATOM   4749  C  C     . SER A 1 648  ? -17.915 -47.024 -43.555 1.00 85.37  ? 648  SER A C     1 
ATOM   4750  O  O     . SER A 1 648  ? -18.306 -46.190 -42.736 1.00 86.60  ? 648  SER A O     1 
ATOM   4751  C  CB    . SER A 1 648  ? -18.066 -49.316 -44.731 1.00 86.23  ? 648  SER A CB    1 
ATOM   4752  O  OG    . SER A 1 648  ? -17.884 -48.789 -46.036 1.00 84.61  ? 648  SER A OG    1 
ATOM   4753  N  N     . ASP A 1 649  ? -16.825 -46.829 -44.302 1.00 86.01  ? 649  ASP A N     1 
ATOM   4754  C  CA    . ASP A 1 649  ? -15.908 -45.696 -44.064 1.00 85.33  ? 649  ASP A CA    1 
ATOM   4755  C  C     . ASP A 1 649  ? -16.379 -44.333 -44.593 1.00 81.72  ? 649  ASP A C     1 
ATOM   4756  O  O     . ASP A 1 649  ? -15.648 -43.356 -44.460 1.00 80.79  ? 649  ASP A O     1 
ATOM   4757  C  CB    . ASP A 1 649  ? -14.515 -46.005 -44.636 1.00 87.27  ? 649  ASP A CB    1 
ATOM   4758  C  CG    . ASP A 1 649  ? -14.449 -45.866 -46.151 1.00 87.54  ? 649  ASP A CG    1 
ATOM   4759  O  OD1   . ASP A 1 649  ? -15.469 -46.122 -46.838 1.00 88.46  ? 649  ASP A OD1   1 
ATOM   4760  O  OD2   . ASP A 1 649  ? -13.362 -45.515 -46.655 1.00 88.60  ? 649  ASP A OD2   1 
ATOM   4761  N  N     . VAL A 1 650  ? -17.562 -44.277 -45.211 1.00 78.81  ? 650  VAL A N     1 
ATOM   4762  C  CA    . VAL A 1 650  ? -18.156 -43.014 -45.651 1.00 76.52  ? 650  VAL A CA    1 
ATOM   4763  C  C     . VAL A 1 650  ? -19.462 -42.725 -44.893 1.00 77.41  ? 650  VAL A C     1 
ATOM   4764  O  O     . VAL A 1 650  ? -20.436 -42.211 -45.468 1.00 75.21  ? 650  VAL A O     1 
ATOM   4765  C  CB    . VAL A 1 650  ? -18.355 -42.972 -47.183 1.00 74.69  ? 650  VAL A CB    1 
ATOM   4766  C  CG1   . VAL A 1 650  ? -17.005 -42.950 -47.881 1.00 75.71  ? 650  VAL A CG1   1 
ATOM   4767  C  CG2   . VAL A 1 650  ? -19.198 -44.136 -47.683 1.00 73.98  ? 650  VAL A CG2   1 
ATOM   4768  N  N     . ASN A 1 651  ? -19.459 -43.032 -43.590 1.00 78.72  ? 651  ASN A N     1 
ATOM   4769  C  CA    . ASN A 1 651  ? -20.574 -42.700 -42.703 1.00 78.41  ? 651  ASN A CA    1 
ATOM   4770  C  C     . ASN A 1 651  ? -20.315 -41.467 -41.826 1.00 79.12  ? 651  ASN A C     1 
ATOM   4771  O  O     . ASN A 1 651  ? -20.924 -41.331 -40.773 1.00 78.19  ? 651  ASN A O     1 
ATOM   4772  C  CB    . ASN A 1 651  ? -20.927 -43.903 -41.824 1.00 78.77  ? 651  ASN A CB    1 
ATOM   4773  C  CG    . ASN A 1 651  ? -22.292 -43.763 -41.170 1.00 78.05  ? 651  ASN A CG    1 
ATOM   4774  O  OD1   . ASN A 1 651  ? -23.279 -43.452 -41.834 1.00 77.05  ? 651  ASN A OD1   1 
ATOM   4775  N  ND2   . ASN A 1 651  ? -22.349 -43.970 -39.863 1.00 79.02  ? 651  ASN A ND2   1 
ATOM   4776  N  N     . SER A 1 652  ? -19.426 -40.572 -42.261 1.00 80.99  ? 652  SER A N     1 
ATOM   4777  C  CA    . SER A 1 652  ? -19.180 -39.306 -41.562 1.00 82.77  ? 652  SER A CA    1 
ATOM   4778  C  C     . SER A 1 652  ? -18.570 -38.264 -42.498 1.00 82.29  ? 652  SER A C     1 
ATOM   4779  O  O     . SER A 1 652  ? -18.236 -38.574 -43.640 1.00 81.74  ? 652  SER A O     1 
ATOM   4780  C  CB    . SER A 1 652  ? -18.275 -39.533 -40.350 1.00 84.63  ? 652  SER A CB    1 
ATOM   4781  O  OG    . SER A 1 652  ? -17.022 -40.048 -40.751 1.00 86.95  ? 652  SER A OG    1 
ATOM   4782  N  N     . PHE A 1 653  ? -18.448 -37.030 -42.010 1.00 83.71  ? 653  PHE A N     1 
ATOM   4783  C  CA    . PHE A 1 653  ? -17.883 -35.924 -42.789 1.00 83.98  ? 653  PHE A CA    1 
ATOM   4784  C  C     . PHE A 1 653  ? -17.294 -34.842 -41.875 1.00 89.95  ? 653  PHE A C     1 
ATOM   4785  O  O     . PHE A 1 653  ? -17.962 -34.406 -40.935 1.00 92.15  ? 653  PHE A O     1 
ATOM   4786  C  CB    . PHE A 1 653  ? -18.958 -35.308 -43.690 1.00 79.28  ? 653  PHE A CB    1 
ATOM   4787  C  CG    . PHE A 1 653  ? -18.433 -34.249 -44.626 1.00 76.15  ? 653  PHE A CG    1 
ATOM   4788  C  CD1   . PHE A 1 653  ? -17.611 -34.596 -45.699 1.00 74.18  ? 653  PHE A CD1   1 
ATOM   4789  C  CD2   . PHE A 1 653  ? -18.762 -32.908 -44.445 1.00 74.06  ? 653  PHE A CD2   1 
ATOM   4790  C  CE1   . PHE A 1 653  ? -17.121 -33.629 -46.564 1.00 72.53  ? 653  PHE A CE1   1 
ATOM   4791  C  CE2   . PHE A 1 653  ? -18.276 -31.937 -45.313 1.00 73.04  ? 653  PHE A CE2   1 
ATOM   4792  C  CZ    . PHE A 1 653  ? -17.454 -32.299 -46.371 1.00 72.21  ? 653  PHE A CZ    1 
ATOM   4793  N  N     . CYS A 1 654  ? -16.054 -34.425 -42.167 1.00 94.98  ? 654  CYS A N     1 
ATOM   4794  C  CA    . CYS A 1 654  ? -15.345 -33.337 -41.458 1.00 97.95  ? 654  CYS A CA    1 
ATOM   4795  C  C     . CYS A 1 654  ? -15.374 -33.472 -39.931 1.00 99.79  ? 654  CYS A C     1 
ATOM   4796  O  O     . CYS A 1 654  ? -14.334 -33.585 -39.286 1.00 102.79 ? 654  CYS A O     1 
ATOM   4797  C  CB    . CYS A 1 654  ? -15.879 -31.958 -41.890 1.00 97.46  ? 654  CYS A CB    1 
ATOM   4798  S  SG    . CYS A 1 654  ? -17.245 -31.288 -40.902 1.00 100.26 ? 654  CYS A SG    1 
ATOM   4799  N  N     . LYS A 1 661  ? -21.275 -38.184 -37.750 1.00 78.71  ? 661  LYS A N     1 
ATOM   4800  C  CA    . LYS A 1 661  ? -21.689 -39.361 -38.518 1.00 79.42  ? 661  LYS A CA    1 
ATOM   4801  C  C     . LYS A 1 661  ? -23.157 -39.322 -38.978 1.00 77.76  ? 661  LYS A C     1 
ATOM   4802  O  O     . LYS A 1 661  ? -24.025 -38.792 -38.290 1.00 78.50  ? 661  LYS A O     1 
ATOM   4803  C  CB    . LYS A 1 661  ? -21.380 -40.674 -37.767 1.00 82.27  ? 661  LYS A CB    1 
ATOM   4804  C  CG    . LYS A 1 661  ? -21.529 -40.660 -36.246 1.00 84.77  ? 661  LYS A CG    1 
ATOM   4805  C  CD    . LYS A 1 661  ? -20.926 -41.918 -35.615 1.00 86.78  ? 661  LYS A CD    1 
ATOM   4806  C  CE    . LYS A 1 661  ? -20.355 -41.665 -34.222 1.00 89.46  ? 661  LYS A CE    1 
ATOM   4807  N  NZ    . LYS A 1 661  ? -21.393 -41.342 -33.199 1.00 90.18  ? 661  LYS A NZ    1 
ATOM   4808  N  N     . PHE A 1 662  ? -23.421 -39.909 -40.144 1.00 75.70  ? 662  PHE A N     1 
ATOM   4809  C  CA    . PHE A 1 662  ? -24.723 -39.791 -40.800 1.00 72.86  ? 662  PHE A CA    1 
ATOM   4810  C  C     . PHE A 1 662  ? -25.744 -40.692 -40.123 1.00 72.19  ? 662  PHE A C     1 
ATOM   4811  O  O     . PHE A 1 662  ? -26.789 -40.219 -39.667 1.00 72.50  ? 662  PHE A O     1 
ATOM   4812  C  CB    . PHE A 1 662  ? -24.652 -40.152 -42.300 1.00 72.47  ? 662  PHE A CB    1 
ATOM   4813  C  CG    . PHE A 1 662  ? -23.575 -39.426 -43.081 1.00 73.16  ? 662  PHE A CG    1 
ATOM   4814  C  CD1   . PHE A 1 662  ? -23.114 -38.153 -42.710 1.00 73.55  ? 662  PHE A CD1   1 
ATOM   4815  C  CD2   . PHE A 1 662  ? -23.043 -40.012 -44.227 1.00 72.66  ? 662  PHE A CD2   1 
ATOM   4816  C  CE1   . PHE A 1 662  ? -22.131 -37.507 -43.451 1.00 72.62  ? 662  PHE A CE1   1 
ATOM   4817  C  CE2   . PHE A 1 662  ? -22.065 -39.364 -44.969 1.00 73.07  ? 662  PHE A CE2   1 
ATOM   4818  C  CZ    . PHE A 1 662  ? -21.610 -38.109 -44.581 1.00 72.76  ? 662  PHE A CZ    1 
ATOM   4819  N  N     . LEU A 1 663  ? -25.431 -41.985 -40.074 1.00 70.56  ? 663  LEU A N     1 
ATOM   4820  C  CA    . LEU A 1 663  ? -26.303 -43.000 -39.493 1.00 70.22  ? 663  LEU A CA    1 
ATOM   4821  C  C     . LEU A 1 663  ? -25.730 -43.507 -38.176 1.00 70.18  ? 663  LEU A C     1 
ATOM   4822  O  O     . LEU A 1 663  ? -24.527 -43.752 -38.067 1.00 71.30  ? 663  LEU A O     1 
ATOM   4823  C  CB    . LEU A 1 663  ? -26.474 -44.172 -40.460 1.00 70.15  ? 663  LEU A CB    1 
ATOM   4824  C  CG    . LEU A 1 663  ? -27.159 -43.902 -41.802 1.00 69.38  ? 663  LEU A CG    1 
ATOM   4825  C  CD1   . LEU A 1 663  ? -27.090 -45.153 -42.662 1.00 70.07  ? 663  LEU A CD1   1 
ATOM   4826  C  CD2   . LEU A 1 663  ? -28.608 -43.478 -41.624 1.00 69.14  ? 663  LEU A CD2   1 
ATOM   4827  N  N     . ALA A 1 664  ? -26.604 -43.682 -37.187 1.00 68.65  ? 664  ALA A N     1 
ATOM   4828  C  CA    . ALA A 1 664  ? -26.199 -44.168 -35.880 1.00 68.90  ? 664  ALA A CA    1 
ATOM   4829  C  C     . ALA A 1 664  ? -25.557 -45.524 -36.037 1.00 69.99  ? 664  ALA A C     1 
ATOM   4830  O  O     . ALA A 1 664  ? -26.007 -46.345 -36.831 1.00 70.51  ? 664  ALA A O     1 
ATOM   4831  C  CB    . ALA A 1 664  ? -27.385 -44.254 -34.938 1.00 68.91  ? 664  ALA A CB    1 
ATOM   4832  N  N     . THR A 1 665  ? -24.483 -45.741 -35.293 1.00 72.15  ? 665  THR A N     1 
ATOM   4833  C  CA    . THR A 1 665  ? -23.743 -46.983 -35.361 1.00 72.87  ? 665  THR A CA    1 
ATOM   4834  C  C     . THR A 1 665  ? -24.321 -47.921 -34.305 1.00 74.69  ? 665  THR A C     1 
ATOM   4835  O  O     . THR A 1 665  ? -25.204 -48.709 -34.626 1.00 75.35  ? 665  THR A O     1 
ATOM   4836  C  CB    . THR A 1 665  ? -22.232 -46.739 -35.200 1.00 73.09  ? 665  THR A CB    1 
ATOM   4837  O  OG1   . THR A 1 665  ? -21.948 -46.242 -33.888 1.00 74.41  ? 665  THR A OG1   1 
ATOM   4838  C  CG2   . THR A 1 665  ? -21.736 -45.734 -36.229 1.00 71.47  ? 665  THR A CG2   1 
ATOM   4839  N  N     . ASP A 1 666  ? -23.866 -47.802 -33.057 1.00 76.64  ? 666  ASP A N     1 
ATOM   4840  C  CA    . ASP A 1 666  ? -24.297 -48.692 -31.965 1.00 78.93  ? 666  ASP A CA    1 
ATOM   4841  C  C     . ASP A 1 666  ? -24.971 -48.008 -30.767 1.00 79.39  ? 666  ASP A C     1 
ATOM   4842  O  O     . ASP A 1 666  ? -25.465 -48.700 -29.872 1.00 81.53  ? 666  ASP A O     1 
ATOM   4843  C  CB    . ASP A 1 666  ? -23.115 -49.537 -31.474 1.00 81.41  ? 666  ASP A CB    1 
ATOM   4844  C  CG    . ASP A 1 666  ? -22.070 -48.724 -30.712 1.00 83.08  ? 666  ASP A CG    1 
ATOM   4845  O  OD1   . ASP A 1 666  ? -22.034 -47.475 -30.839 1.00 81.66  ? 666  ASP A OD1   1 
ATOM   4846  O  OD2   . ASP A 1 666  ? -21.275 -49.355 -29.982 1.00 85.78  ? 666  ASP A OD2   1 
ATOM   4847  N  N     . LYS A 1 667  ? -24.967 -46.674 -30.731 1.00 77.76  ? 667  LYS A N     1 
ATOM   4848  C  CA    . LYS A 1 667  ? -25.727 -45.912 -29.741 1.00 77.18  ? 667  LYS A CA    1 
ATOM   4849  C  C     . LYS A 1 667  ? -26.497 -44.790 -30.424 1.00 73.29  ? 667  LYS A C     1 
ATOM   4850  O  O     . LYS A 1 667  ? -26.111 -44.332 -31.496 1.00 71.92  ? 667  LYS A O     1 
ATOM   4851  C  CB    . LYS A 1 667  ? -24.794 -45.331 -28.686 1.00 79.55  ? 667  LYS A CB    1 
ATOM   4852  C  CG    . LYS A 1 667  ? -24.093 -46.391 -27.854 1.00 83.18  ? 667  LYS A CG    1 
ATOM   4853  C  CD    . LYS A 1 667  ? -23.503 -45.815 -26.574 1.00 86.08  ? 667  LYS A CD    1 
ATOM   4854  C  CE    . LYS A 1 667  ? -22.182 -45.101 -26.816 1.00 87.12  ? 667  LYS A CE    1 
ATOM   4855  N  NZ    . LYS A 1 667  ? -21.027 -46.038 -26.710 1.00 88.99  ? 667  LYS A NZ    1 
ATOM   4856  N  N     . VAL A 1 668  ? -27.596 -44.373 -29.807 1.00 71.07  ? 668  VAL A N     1 
ATOM   4857  C  CA    . VAL A 1 668  ? -28.327 -43.178 -30.239 1.00 69.16  ? 668  VAL A CA    1 
ATOM   4858  C  C     . VAL A 1 668  ? -28.168 -42.116 -29.151 1.00 69.21  ? 668  VAL A C     1 
ATOM   4859  O  O     . VAL A 1 668  ? -28.132 -42.442 -27.968 1.00 70.24  ? 668  VAL A O     1 
ATOM   4860  C  CB    . VAL A 1 668  ? -29.820 -43.463 -30.558 1.00 68.18  ? 668  VAL A CB    1 
ATOM   4861  C  CG1   . VAL A 1 668  ? -29.940 -44.567 -31.597 1.00 67.87  ? 668  VAL A CG1   1 
ATOM   4862  C  CG2   . VAL A 1 668  ? -30.624 -43.816 -29.313 1.00 69.46  ? 668  VAL A CG2   1 
ATOM   4863  N  N     . PHE A 1 669  ? -28.035 -40.857 -29.555 1.00 67.64  ? 669  PHE A N     1 
ATOM   4864  C  CA    . PHE A 1 669  ? -27.817 -39.755 -28.605 1.00 68.42  ? 669  PHE A CA    1 
ATOM   4865  C  C     . PHE A 1 669  ? -28.940 -38.722 -28.561 1.00 67.88  ? 669  PHE A C     1 
ATOM   4866  O  O     . PHE A 1 669  ? -28.820 -37.738 -27.847 1.00 69.02  ? 669  PHE A O     1 
ATOM   4867  C  CB    . PHE A 1 669  ? -26.467 -39.096 -28.886 1.00 67.90  ? 669  PHE A CB    1 
ATOM   4868  C  CG    . PHE A 1 669  ? -25.322 -40.045 -28.748 1.00 68.75  ? 669  PHE A CG    1 
ATOM   4869  C  CD1   . PHE A 1 669  ? -24.701 -40.227 -27.516 1.00 70.13  ? 669  PHE A CD1   1 
ATOM   4870  C  CD2   . PHE A 1 669  ? -24.899 -40.807 -29.836 1.00 67.80  ? 669  PHE A CD2   1 
ATOM   4871  C  CE1   . PHE A 1 669  ? -23.652 -41.124 -27.378 1.00 71.54  ? 669  PHE A CE1   1 
ATOM   4872  C  CE2   . PHE A 1 669  ? -23.852 -41.710 -29.704 1.00 69.20  ? 669  PHE A CE2   1 
ATOM   4873  C  CZ    . PHE A 1 669  ? -23.228 -41.870 -28.472 1.00 70.94  ? 669  PHE A CZ    1 
ATOM   4874  N  N     . CYS A 1 670  ? -30.034 -38.972 -29.283 1.00 66.87  ? 670  CYS A N     1 
ATOM   4875  C  CA    . CYS A 1 670  ? -31.281 -38.204 -29.160 1.00 66.43  ? 670  CYS A CA    1 
ATOM   4876  C  C     . CYS A 1 670  ? -32.379 -38.941 -29.915 1.00 65.02  ? 670  CYS A C     1 
ATOM   4877  O  O     . CYS A 1 670  ? -32.075 -39.836 -30.708 1.00 64.43  ? 670  CYS A O     1 
ATOM   4878  C  CB    . CYS A 1 670  ? -31.128 -36.805 -29.754 1.00 65.94  ? 670  CYS A CB    1 
ATOM   4879  S  SG    . CYS A 1 670  ? -30.682 -36.798 -31.503 1.00 65.32  ? 670  CYS A SG    1 
ATOM   4880  N  N     . VAL A 1 671  ? -33.642 -38.574 -29.689 1.00 64.29  ? 671  VAL A N     1 
ATOM   4881  C  CA    . VAL A 1 671  ? -34.719 -39.085 -30.544 1.00 63.82  ? 671  VAL A CA    1 
ATOM   4882  C  C     . VAL A 1 671  ? -34.621 -38.342 -31.859 1.00 62.24  ? 671  VAL A C     1 
ATOM   4883  O  O     . VAL A 1 671  ? -34.182 -37.196 -31.888 1.00 62.25  ? 671  VAL A O     1 
ATOM   4884  C  CB    . VAL A 1 671  ? -36.149 -38.935 -29.966 1.00 64.26  ? 671  VAL A CB    1 
ATOM   4885  C  CG1   . VAL A 1 671  ? -36.256 -39.572 -28.589 1.00 65.56  ? 671  VAL A CG1   1 
ATOM   4886  C  CG2   . VAL A 1 671  ? -36.610 -37.478 -29.961 1.00 64.99  ? 671  VAL A CG2   1 
ATOM   4887  N  N     . GLY A 1 672  ? -35.011 -39.005 -32.943 1.00 61.62  ? 672  GLY A N     1 
ATOM   4888  C  CA    . GLY A 1 672  ? -34.976 -38.397 -34.266 1.00 60.38  ? 672  GLY A CA    1 
ATOM   4889  C  C     . GLY A 1 672  ? -33.678 -38.571 -35.012 1.00 59.78  ? 672  GLY A C     1 
ATOM   4890  O  O     . GLY A 1 672  ? -33.603 -38.222 -36.182 1.00 59.05  ? 672  GLY A O     1 
ATOM   4891  N  N     . GLN A 1 673  ? -32.657 -39.109 -34.353 1.00 61.29  ? 673  GLN A N     1 
ATOM   4892  C  CA    . GLN A 1 673  ? -31.384 -39.388 -35.006 1.00 61.99  ? 673  GLN A CA    1 
ATOM   4893  C  C     . GLN A 1 673  ? -31.606 -40.462 -36.070 1.00 61.38  ? 673  GLN A C     1 
ATOM   4894  O  O     . GLN A 1 673  ? -32.425 -41.366 -35.870 1.00 61.96  ? 673  GLN A O     1 
ATOM   4895  C  CB    . GLN A 1 673  ? -30.357 -39.860 -33.971 1.00 64.11  ? 673  GLN A CB    1 
ATOM   4896  C  CG    . GLN A 1 673  ? -28.923 -39.898 -34.480 1.00 65.04  ? 673  GLN A CG    1 
ATOM   4897  C  CD    . GLN A 1 673  ? -27.951 -40.494 -33.477 1.00 65.72  ? 673  GLN A CD    1 
ATOM   4898  O  OE1   . GLN A 1 673  ? -28.182 -40.464 -32.273 1.00 66.69  ? 673  GLN A OE1   1 
ATOM   4899  N  NE2   . GLN A 1 673  ? -26.855 -41.041 -33.978 1.00 65.65  ? 673  GLN A NE2   1 
ATOM   4900  N  N     . LEU A 1 674  ? -30.889 -40.364 -37.190 1.00 60.06  ? 674  LEU A N     1 
ATOM   4901  C  CA    . LEU A 1 674  ? -31.050 -41.323 -38.293 1.00 59.05  ? 674  LEU A CA    1 
ATOM   4902  C  C     . LEU A 1 674  ? -30.466 -42.670 -37.883 1.00 60.57  ? 674  LEU A C     1 
ATOM   4903  O  O     . LEU A 1 674  ? -29.420 -42.719 -37.234 1.00 60.48  ? 674  LEU A O     1 
ATOM   4904  C  CB    . LEU A 1 674  ? -30.390 -40.820 -39.584 1.00 57.45  ? 674  LEU A CB    1 
ATOM   4905  C  CG    . LEU A 1 674  ? -30.750 -39.408 -40.075 1.00 56.07  ? 674  LEU A CG    1 
ATOM   4906  C  CD1   . LEU A 1 674  ? -30.167 -39.160 -41.456 1.00 55.48  ? 674  LEU A CD1   1 
ATOM   4907  C  CD2   . LEU A 1 674  ? -32.248 -39.159 -40.093 1.00 55.37  ? 674  LEU A CD2   1 
ATOM   4908  N  N     . VAL A 1 675  ? -31.167 -43.749 -38.237 1.00 61.61  ? 675  VAL A N     1 
ATOM   4909  C  CA    . VAL A 1 675  ? -30.756 -45.121 -37.905 1.00 63.07  ? 675  VAL A CA    1 
ATOM   4910  C  C     . VAL A 1 675  ? -30.665 -45.984 -39.171 1.00 64.17  ? 675  VAL A C     1 
ATOM   4911  O  O     . VAL A 1 675  ? -29.608 -46.548 -39.456 1.00 66.92  ? 675  VAL A O     1 
ATOM   4912  C  CB    . VAL A 1 675  ? -31.716 -45.758 -36.876 1.00 63.59  ? 675  VAL A CB    1 
ATOM   4913  C  CG1   . VAL A 1 675  ? -31.308 -47.195 -36.555 1.00 65.07  ? 675  VAL A CG1   1 
ATOM   4914  C  CG2   . VAL A 1 675  ? -31.757 -44.919 -35.605 1.00 63.85  ? 675  VAL A CG2   1 
ATOM   4915  N  N     . CYS A 1 676  ? -31.772 -46.099 -39.907 1.00 64.84  ? 676  CYS A N     1 
ATOM   4916  C  CA    . CYS A 1 676  ? -31.810 -46.798 -41.200 1.00 64.84  ? 676  CYS A CA    1 
ATOM   4917  C  C     . CYS A 1 676  ? -32.317 -45.891 -42.320 1.00 62.33  ? 676  CYS A C     1 
ATOM   4918  O  O     . CYS A 1 676  ? -32.880 -44.822 -42.076 1.00 59.83  ? 676  CYS A O     1 
ATOM   4919  C  CB    . CYS A 1 676  ? -32.723 -48.027 -41.151 1.00 67.44  ? 676  CYS A CB    1 
ATOM   4920  S  SG    . CYS A 1 676  ? -32.478 -49.147 -39.760 1.00 74.05  ? 676  CYS A SG    1 
ATOM   4921  N  N     . ALA A 1 677  ? -32.119 -46.360 -43.548 1.00 60.75  ? 677  ALA A N     1 
ATOM   4922  C  CA    . ALA A 1 677  ? -32.584 -45.690 -44.749 1.00 58.93  ? 677  ALA A CA    1 
ATOM   4923  C  C     . ALA A 1 677  ? -33.287 -46.735 -45.608 1.00 57.86  ? 677  ALA A C     1 
ATOM   4924  O  O     . ALA A 1 677  ? -32.676 -47.733 -45.984 1.00 57.31  ? 677  ALA A O     1 
ATOM   4925  C  CB    . ALA A 1 677  ? -31.402 -45.082 -45.489 1.00 58.50  ? 677  ALA A CB    1 
ATOM   4926  N  N     . VAL A 1 678  ? -34.565 -46.513 -45.905 1.00 56.42  ? 678  VAL A N     1 
ATOM   4927  C  CA    . VAL A 1 678  ? -35.354 -47.479 -46.656 1.00 56.74  ? 678  VAL A CA    1 
ATOM   4928  C  C     . VAL A 1 678  ? -35.567 -46.963 -48.068 1.00 55.57  ? 678  VAL A C     1 
ATOM   4929  O  O     . VAL A 1 678  ? -36.166 -45.907 -48.250 1.00 55.20  ? 678  VAL A O     1 
ATOM   4930  C  CB    . VAL A 1 678  ? -36.712 -47.768 -45.984 1.00 57.30  ? 678  VAL A CB    1 
ATOM   4931  C  CG1   . VAL A 1 678  ? -37.454 -48.887 -46.720 1.00 57.36  ? 678  VAL A CG1   1 
ATOM   4932  C  CG2   . VAL A 1 678  ? -36.505 -48.156 -44.526 1.00 58.47  ? 678  VAL A CG2   1 
ATOM   4933  N  N     . LEU A 1 679  ? -35.092 -47.735 -49.049 1.00 54.71  ? 679  LEU A N     1 
ATOM   4934  C  CA    . LEU A 1 679  ? -35.177 -47.388 -50.461 1.00 54.30  ? 679  LEU A CA    1 
ATOM   4935  C  C     . LEU A 1 679  ? -36.234 -48.240 -51.180 1.00 54.44  ? 679  LEU A C     1 
ATOM   4936  O  O     . LEU A 1 679  ? -36.146 -49.457 -51.185 1.00 55.27  ? 679  LEU A O     1 
ATOM   4937  C  CB    . LEU A 1 679  ? -33.805 -47.607 -51.097 1.00 55.04  ? 679  LEU A CB    1 
ATOM   4938  C  CG    . LEU A 1 679  ? -33.565 -47.043 -52.495 1.00 54.61  ? 679  LEU A CG    1 
ATOM   4939  C  CD1   . LEU A 1 679  ? -33.727 -45.535 -52.513 1.00 53.74  ? 679  LEU A CD1   1 
ATOM   4940  C  CD2   . LEU A 1 679  ? -32.178 -47.445 -52.982 1.00 55.79  ? 679  LEU A CD2   1 
ATOM   4941  N  N     . ALA A 1 680  ? -37.224 -47.608 -51.803 1.00 54.01  ? 680  ALA A N     1 
ATOM   4942  C  CA    . ALA A 1 680  ? -38.316 -48.360 -52.409 1.00 54.76  ? 680  ALA A CA    1 
ATOM   4943  C  C     . ALA A 1 680  ? -38.786 -47.775 -53.723 1.00 54.51  ? 680  ALA A C     1 
ATOM   4944  O  O     . ALA A 1 680  ? -38.466 -46.647 -54.065 1.00 52.99  ? 680  ALA A O     1 
ATOM   4945  C  CB    . ALA A 1 680  ? -39.473 -48.457 -51.433 1.00 55.42  ? 680  ALA A CB    1 
ATOM   4946  N  N     . ASP A 1 681  ? -39.559 -48.569 -54.452 1.00 56.37  ? 681  ASP A N     1 
ATOM   4947  C  CA    . ASP A 1 681  ? -40.132 -48.148 -55.729 1.00 57.68  ? 681  ASP A CA    1 
ATOM   4948  C  C     . ASP A 1 681  ? -41.115 -46.994 -55.581 1.00 56.13  ? 681  ASP A C     1 
ATOM   4949  O  O     . ASP A 1 681  ? -41.358 -46.269 -56.538 1.00 56.43  ? 681  ASP A O     1 
ATOM   4950  C  CB    . ASP A 1 681  ? -40.853 -49.312 -56.419 1.00 60.76  ? 681  ASP A CB    1 
ATOM   4951  C  CG    . ASP A 1 681  ? -39.904 -50.365 -56.981 1.00 64.53  ? 681  ASP A CG    1 
ATOM   4952  O  OD1   . ASP A 1 681  ? -38.704 -50.073 -57.222 1.00 65.28  ? 681  ASP A OD1   1 
ATOM   4953  O  OD2   . ASP A 1 681  ? -40.389 -51.505 -57.198 1.00 69.22  ? 681  ASP A OD2   1 
ATOM   4954  N  N     . SER A 1 682  ? -41.704 -46.835 -54.403 1.00 55.63  ? 682  SER A N     1 
ATOM   4955  C  CA    . SER A 1 682  ? -42.587 -45.706 -54.154 1.00 54.55  ? 682  SER A CA    1 
ATOM   4956  C  C     . SER A 1 682  ? -42.486 -45.265 -52.714 1.00 54.81  ? 682  SER A C     1 
ATOM   4957  O  O     . SER A 1 682  ? -42.024 -46.019 -51.849 1.00 53.91  ? 682  SER A O     1 
ATOM   4958  C  CB    . SER A 1 682  ? -44.036 -46.066 -54.486 1.00 54.06  ? 682  SER A CB    1 
ATOM   4959  O  OG    . SER A 1 682  ? -44.601 -46.901 -53.489 1.00 53.82  ? 682  SER A OG    1 
ATOM   4960  N  N     . GLU A 1 683  ? -42.931 -44.033 -52.488 1.00 55.19  ? 683  GLU A N     1 
ATOM   4961  C  CA    . GLU A 1 683  ? -42.993 -43.418 -51.170 1.00 56.35  ? 683  GLU A CA    1 
ATOM   4962  C  C     . GLU A 1 683  ? -43.886 -44.193 -50.197 1.00 56.63  ? 683  GLU A C     1 
ATOM   4963  O  O     . GLU A 1 683  ? -43.530 -44.361 -49.024 1.00 56.59  ? 683  GLU A O     1 
ATOM   4964  C  CB    . GLU A 1 683  ? -43.505 -41.997 -51.337 1.00 58.76  ? 683  GLU A CB    1 
ATOM   4965  C  CG    . GLU A 1 683  ? -43.713 -41.205 -50.062 1.00 62.99  ? 683  GLU A CG    1 
ATOM   4966  C  CD    . GLU A 1 683  ? -44.070 -39.763 -50.360 1.00 67.48  ? 683  GLU A CD    1 
ATOM   4967  O  OE1   . GLU A 1 683  ? -44.547 -39.474 -51.487 1.00 70.57  ? 683  GLU A OE1   1 
ATOM   4968  O  OE2   . GLU A 1 683  ? -43.876 -38.909 -49.470 1.00 72.27  ? 683  GLU A OE2   1 
ATOM   4969  N  N     . VAL A 1 684  ? -45.040 -44.654 -50.685 1.00 55.68  ? 684  VAL A N     1 
ATOM   4970  C  CA    . VAL A 1 684  ? -45.992 -45.415 -49.865 1.00 55.71  ? 684  VAL A CA    1 
ATOM   4971  C  C     . VAL A 1 684  ? -45.345 -46.696 -49.376 1.00 55.17  ? 684  VAL A C     1 
ATOM   4972  O  O     . VAL A 1 684  ? -45.401 -47.014 -48.186 1.00 56.00  ? 684  VAL A O     1 
ATOM   4973  C  CB    . VAL A 1 684  ? -47.301 -45.730 -50.647 1.00 57.03  ? 684  VAL A CB    1 
ATOM   4974  C  CG1   . VAL A 1 684  ? -48.130 -46.822 -49.978 1.00 58.33  ? 684  VAL A CG1   1 
ATOM   4975  C  CG2   . VAL A 1 684  ? -48.140 -44.470 -50.777 1.00 57.12  ? 684  VAL A CG2   1 
ATOM   4976  N  N     . GLN A 1 685  ? -44.735 -47.418 -50.308 1.00 54.18  ? 685  GLN A N     1 
ATOM   4977  C  CA    . GLN A 1 685  ? -44.072 -48.680 -50.010 1.00 54.10  ? 685  GLN A CA    1 
ATOM   4978  C  C     . GLN A 1 685  ? -42.881 -48.492 -49.098 1.00 54.36  ? 685  GLN A C     1 
ATOM   4979  O  O     . GLN A 1 685  ? -42.648 -49.316 -48.210 1.00 57.71  ? 685  GLN A O     1 
ATOM   4980  C  CB    . GLN A 1 685  ? -43.642 -49.374 -51.294 1.00 53.75  ? 685  GLN A CB    1 
ATOM   4981  C  CG    . GLN A 1 685  ? -44.834 -49.859 -52.101 1.00 53.75  ? 685  GLN A CG    1 
ATOM   4982  C  CD    . GLN A 1 685  ? -44.476 -50.344 -53.481 1.00 54.04  ? 685  GLN A CD    1 
ATOM   4983  O  OE1   . GLN A 1 685  ? -44.924 -51.413 -53.902 1.00 56.00  ? 685  GLN A OE1   1 
ATOM   4984  N  NE2   . GLN A 1 685  ? -43.696 -49.558 -54.213 1.00 52.74  ? 685  GLN A NE2   1 
ATOM   4985  N  N     . ALA A 1 686  ? -42.145 -47.404 -49.299 1.00 53.08  ? 686  ALA A N     1 
ATOM   4986  C  CA    . ALA A 1 686  ? -41.024 -47.077 -48.429 1.00 53.26  ? 686  ALA A CA    1 
ATOM   4987  C  C     . ALA A 1 686  ? -41.448 -46.908 -46.959 1.00 54.38  ? 686  ALA A C     1 
ATOM   4988  O  O     . ALA A 1 686  ? -40.796 -47.426 -46.053 1.00 54.24  ? 686  ALA A O     1 
ATOM   4989  C  CB    . ALA A 1 686  ? -40.314 -45.831 -48.928 1.00 52.49  ? 686  ALA A CB    1 
ATOM   4990  N  N     . LYS A 1 687  ? -42.542 -46.195 -46.727 1.00 55.46  ? 687  LYS A N     1 
ATOM   4991  C  CA    . LYS A 1 687  ? -42.971 -45.894 -45.362 1.00 57.28  ? 687  LYS A CA    1 
ATOM   4992  C  C     . LYS A 1 687  ? -43.636 -47.072 -44.690 1.00 57.65  ? 687  LYS A C     1 
ATOM   4993  O  O     . LYS A 1 687  ? -43.441 -47.290 -43.501 1.00 57.94  ? 687  LYS A O     1 
ATOM   4994  C  CB    . LYS A 1 687  ? -43.870 -44.667 -45.347 1.00 59.46  ? 687  LYS A CB    1 
ATOM   4995  C  CG    . LYS A 1 687  ? -43.064 -43.401 -45.574 1.00 61.00  ? 687  LYS A CG    1 
ATOM   4996  C  CD    . LYS A 1 687  ? -43.914 -42.246 -46.038 1.00 62.81  ? 687  LYS A CD    1 
ATOM   4997  C  CE    . LYS A 1 687  ? -43.021 -41.111 -46.513 1.00 65.24  ? 687  LYS A CE    1 
ATOM   4998  N  NZ    . LYS A 1 687  ? -43.812 -39.974 -47.065 1.00 65.93  ? 687  LYS A NZ    1 
ATOM   4999  N  N     . ARG A 1 688  ? -44.407 -47.833 -45.459 1.00 58.19  ? 688  ARG A N     1 
ATOM   5000  C  CA    . ARG A 1 688  ? -44.917 -49.119 -45.006 1.00 59.02  ? 688  ARG A CA    1 
ATOM   5001  C  C     . ARG A 1 688  ? -43.797 -50.025 -44.528 1.00 59.93  ? 688  ARG A C     1 
ATOM   5002  O  O     . ARG A 1 688  ? -43.865 -50.564 -43.427 1.00 62.31  ? 688  ARG A O     1 
ATOM   5003  C  CB    . ARG A 1 688  ? -45.697 -49.831 -46.110 1.00 59.96  ? 688  ARG A CB    1 
ATOM   5004  C  CG    . ARG A 1 688  ? -47.174 -49.514 -46.103 1.00 60.77  ? 688  ARG A CG    1 
ATOM   5005  C  CD    . ARG A 1 688  ? -47.901 -50.172 -47.259 1.00 62.10  ? 688  ARG A CD    1 
ATOM   5006  N  NE    . ARG A 1 688  ? -49.063 -49.371 -47.628 1.00 63.78  ? 688  ARG A NE    1 
ATOM   5007  C  CZ    . ARG A 1 688  ? -49.706 -49.427 -48.795 1.00 65.72  ? 688  ARG A CZ    1 
ATOM   5008  N  NH1   . ARG A 1 688  ? -49.329 -50.256 -49.766 1.00 66.28  ? 688  ARG A NH1   1 
ATOM   5009  N  NH2   . ARG A 1 688  ? -50.751 -48.628 -48.997 1.00 66.96  ? 688  ARG A NH2   1 
ATOM   5010  N  N     . ALA A 1 689  ? -42.772 -50.193 -45.353 1.00 59.30  ? 689  ALA A N     1 
ATOM   5011  C  CA    . ALA A 1 689  ? -41.686 -51.112 -45.019 1.00 60.61  ? 689  ALA A CA    1 
ATOM   5012  C  C     . ALA A 1 689  ? -40.860 -50.618 -43.834 1.00 61.73  ? 689  ALA A C     1 
ATOM   5013  O  O     . ALA A 1 689  ? -40.409 -51.423 -43.017 1.00 61.58  ? 689  ALA A O     1 
ATOM   5014  C  CB    . ALA A 1 689  ? -40.801 -51.342 -46.224 1.00 60.20  ? 689  ALA A CB    1 
ATOM   5015  N  N     . ALA A 1 690  ? -40.692 -49.296 -43.742 1.00 62.24  ? 690  ALA A N     1 
ATOM   5016  C  CA    . ALA A 1 690  ? -39.935 -48.661 -42.664 1.00 63.54  ? 690  ALA A CA    1 
ATOM   5017  C  C     . ALA A 1 690  ? -40.548 -48.920 -41.294 1.00 66.21  ? 690  ALA A C     1 
ATOM   5018  O  O     . ALA A 1 690  ? -39.824 -49.125 -40.311 1.00 66.01  ? 690  ALA A O     1 
ATOM   5019  C  CB    . ALA A 1 690  ? -39.825 -47.166 -42.912 1.00 62.51  ? 690  ALA A CB    1 
ATOM   5020  N  N     . LYS A 1 691  ? -41.879 -48.938 -41.239 1.00 68.86  ? 691  LYS A N     1 
ATOM   5021  C  CA    . LYS A 1 691  ? -42.598 -49.184 -39.986 1.00 71.37  ? 691  LYS A CA    1 
ATOM   5022  C  C     . LYS A 1 691  ? -42.559 -50.631 -39.510 1.00 72.17  ? 691  LYS A C     1 
ATOM   5023  O  O     . LYS A 1 691  ? -43.023 -50.906 -38.405 1.00 74.25  ? 691  LYS A O     1 
ATOM   5024  C  CB    . LYS A 1 691  ? -44.042 -48.670 -40.074 1.00 73.39  ? 691  LYS A CB    1 
ATOM   5025  C  CG    . LYS A 1 691  ? -44.114 -47.145 -40.077 1.00 75.85  ? 691  LYS A CG    1 
ATOM   5026  C  CD    . LYS A 1 691  ? -45.526 -46.611 -39.889 1.00 78.57  ? 691  LYS A CD    1 
ATOM   5027  C  CE    . LYS A 1 691  ? -46.398 -46.893 -41.103 1.00 80.39  ? 691  LYS A CE    1 
ATOM   5028  N  NZ    . LYS A 1 691  ? -47.753 -46.290 -40.954 1.00 81.99  ? 691  LYS A NZ    1 
ATOM   5029  N  N     . ARG A 1 692  ? -42.013 -51.541 -40.325 1.00 71.97  ? 692  ARG A N     1 
ATOM   5030  C  CA    . ARG A 1 692  ? -41.781 -52.935 -39.940 1.00 73.39  ? 692  ARG A CA    1 
ATOM   5031  C  C     . ARG A 1 692  ? -40.322 -53.263 -39.603 1.00 72.58  ? 692  ARG A C     1 
ATOM   5032  O  O     . ARG A 1 692  ? -39.995 -54.428 -39.403 1.00 73.84  ? 692  ARG A O     1 
ATOM   5033  C  CB    . ARG A 1 692  ? -42.280 -53.867 -41.051 1.00 75.81  ? 692  ARG A CB    1 
ATOM   5034  C  CG    . ARG A 1 692  ? -43.781 -53.824 -41.247 1.00 78.81  ? 692  ARG A CG    1 
ATOM   5035  C  CD    . ARG A 1 692  ? -44.506 -54.633 -40.186 1.00 84.14  ? 692  ARG A CD    1 
ATOM   5036  N  NE    . ARG A 1 692  ? -45.930 -54.303 -40.121 1.00 89.12  ? 692  ARG A NE    1 
ATOM   5037  C  CZ    . ARG A 1 692  ? -46.858 -54.667 -41.017 1.00 91.76  ? 692  ARG A CZ    1 
ATOM   5038  N  NH1   . ARG A 1 692  ? -46.543 -55.385 -42.104 1.00 91.57  ? 692  ARG A NH1   1 
ATOM   5039  N  NH2   . ARG A 1 692  ? -48.130 -54.302 -40.826 1.00 92.84  ? 692  ARG A NH2   1 
ATOM   5040  N  N     . VAL A 1 693  ? -39.452 -52.258 -39.535 1.00 72.10  ? 693  VAL A N     1 
ATOM   5041  C  CA    . VAL A 1 693  ? -38.070 -52.451 -39.080 1.00 73.40  ? 693  VAL A CA    1 
ATOM   5042  C  C     . VAL A 1 693  ? -38.065 -52.499 -37.558 1.00 75.61  ? 693  VAL A C     1 
ATOM   5043  O  O     . VAL A 1 693  ? -38.529 -51.567 -36.917 1.00 76.30  ? 693  VAL A O     1 
ATOM   5044  C  CB    . VAL A 1 693  ? -37.152 -51.302 -39.543 1.00 72.60  ? 693  VAL A CB    1 
ATOM   5045  C  CG1   . VAL A 1 693  ? -35.756 -51.428 -38.935 1.00 73.24  ? 693  VAL A CG1   1 
ATOM   5046  C  CG2   . VAL A 1 693  ? -37.078 -51.263 -41.062 1.00 71.65  ? 693  VAL A CG2   1 
ATOM   5047  N  N     . LYS A 1 694  ? -37.530 -53.571 -36.983 1.00 79.21  ? 694  LYS A N     1 
ATOM   5048  C  CA    . LYS A 1 694  ? -37.568 -53.770 -35.531 1.00 82.45  ? 694  LYS A CA    1 
ATOM   5049  C  C     . LYS A 1 694  ? -36.209 -53.455 -34.932 1.00 81.36  ? 694  LYS A C     1 
ATOM   5050  O  O     . LYS A 1 694  ? -35.219 -54.114 -35.259 1.00 80.40  ? 694  LYS A O     1 
ATOM   5051  C  CB    . LYS A 1 694  ? -37.995 -55.205 -35.181 1.00 86.56  ? 694  LYS A CB    1 
ATOM   5052  C  CG    . LYS A 1 694  ? -39.499 -55.450 -35.268 1.00 89.32  ? 694  LYS A CG    1 
ATOM   5053  C  CD    . LYS A 1 694  ? -40.240 -54.897 -34.047 1.00 92.53  ? 694  LYS A CD    1 
ATOM   5054  C  CE    . LYS A 1 694  ? -41.727 -54.694 -34.318 1.00 93.88  ? 694  LYS A CE    1 
ATOM   5055  N  NZ    . LYS A 1 694  ? -42.398 -55.958 -34.748 1.00 95.82  ? 694  LYS A NZ    1 
ATOM   5056  N  N     . ILE A 1 695  ? -36.173 -52.444 -34.064 1.00 79.91  ? 695  ILE A N     1 
ATOM   5057  C  CA    . ILE A 1 695  ? -34.951 -52.031 -33.382 1.00 79.56  ? 695  ILE A CA    1 
ATOM   5058  C  C     . ILE A 1 695  ? -35.151 -52.225 -31.890 1.00 79.61  ? 695  ILE A C     1 
ATOM   5059  O  O     . ILE A 1 695  ? -36.086 -51.670 -31.318 1.00 80.37  ? 695  ILE A O     1 
ATOM   5060  C  CB    . ILE A 1 695  ? -34.619 -50.546 -33.640 1.00 78.70  ? 695  ILE A CB    1 
ATOM   5061  C  CG1   . ILE A 1 695  ? -34.535 -50.263 -35.145 1.00 77.40  ? 695  ILE A CG1   1 
ATOM   5062  C  CG2   . ILE A 1 695  ? -33.309 -50.175 -32.942 1.00 79.71  ? 695  ILE A CG2   1 
ATOM   5063  C  CD1   . ILE A 1 695  ? -34.613 -48.797 -35.499 1.00 76.60  ? 695  ILE A CD1   1 
ATOM   5064  N  N     . VAL A 1 696  ? -34.278 -53.002 -31.262 1.00 79.08  ? 696  VAL A N     1 
ATOM   5065  C  CA    . VAL A 1 696  ? -34.335 -53.196 -29.820 1.00 80.06  ? 696  VAL A CA    1 
ATOM   5066  C  C     . VAL A 1 696  ? -33.260 -52.315 -29.169 1.00 79.31  ? 696  VAL A C     1 
ATOM   5067  O  O     . VAL A 1 696  ? -32.116 -52.264 -29.638 1.00 78.85  ? 696  VAL A O     1 
ATOM   5068  C  CB    . VAL A 1 696  ? -34.198 -54.690 -29.451 1.00 82.04  ? 696  VAL A CB    1 
ATOM   5069  C  CG1   . VAL A 1 696  ? -34.275 -54.897 -27.942 1.00 83.73  ? 696  VAL A CG1   1 
ATOM   5070  C  CG2   . VAL A 1 696  ? -35.294 -55.496 -30.135 1.00 81.92  ? 696  VAL A CG2   1 
ATOM   5071  N  N     . TYR A 1 697  ? -33.654 -51.611 -28.107 1.00 78.12  ? 697  TYR A N     1 
ATOM   5072  C  CA    . TYR A 1 697  ? -32.798 -50.651 -27.416 1.00 78.07  ? 697  TYR A CA    1 
ATOM   5073  C  C     . TYR A 1 697  ? -32.492 -51.074 -25.981 1.00 79.71  ? 697  TYR A C     1 
ATOM   5074  O  O     . TYR A 1 697  ? -33.183 -51.916 -25.419 1.00 82.03  ? 697  TYR A O     1 
ATOM   5075  C  CB    . TYR A 1 697  ? -33.491 -49.296 -27.344 1.00 76.92  ? 697  TYR A CB    1 
ATOM   5076  C  CG    . TYR A 1 697  ? -33.749 -48.619 -28.662 1.00 74.93  ? 697  TYR A CG    1 
ATOM   5077  C  CD1   . TYR A 1 697  ? -32.753 -47.878 -29.295 1.00 74.24  ? 697  TYR A CD1   1 
ATOM   5078  C  CD2   . TYR A 1 697  ? -35.008 -48.669 -29.253 1.00 74.12  ? 697  TYR A CD2   1 
ATOM   5079  C  CE1   . TYR A 1 697  ? -33.001 -47.225 -30.500 1.00 72.75  ? 697  TYR A CE1   1 
ATOM   5080  C  CE2   . TYR A 1 697  ? -35.268 -48.025 -30.456 1.00 72.28  ? 697  TYR A CE2   1 
ATOM   5081  C  CZ    . TYR A 1 697  ? -34.265 -47.305 -31.080 1.00 71.60  ? 697  TYR A CZ    1 
ATOM   5082  O  OH    . TYR A 1 697  ? -34.533 -46.678 -32.276 1.00 69.67  ? 697  TYR A OH    1 
ATOM   5083  N  N     . GLN A 1 698  ? -31.462 -50.459 -25.399 1.00 80.24  ? 698  GLN A N     1 
ATOM   5084  C  CA    . GLN A 1 698  ? -31.188 -50.505 -23.955 1.00 82.03  ? 698  GLN A CA    1 
ATOM   5085  C  C     . GLN A 1 698  ? -30.803 -49.102 -23.484 1.00 81.59  ? 698  GLN A C     1 
ATOM   5086  O  O     . GLN A 1 698  ? -29.751 -48.599 -23.869 1.00 80.70  ? 698  GLN A O     1 
ATOM   5087  C  CB    . GLN A 1 698  ? -30.055 -51.483 -23.656 1.00 84.31  ? 698  GLN A CB    1 
ATOM   5088  C  CG    . GLN A 1 698  ? -29.835 -51.752 -22.177 1.00 87.32  ? 698  GLN A CG    1 
ATOM   5089  C  CD    . GLN A 1 698  ? -28.711 -52.739 -21.936 1.00 90.04  ? 698  GLN A CD    1 
ATOM   5090  O  OE1   . GLN A 1 698  ? -27.663 -52.677 -22.581 1.00 90.95  ? 698  GLN A OE1   1 
ATOM   5091  N  NE2   . GLN A 1 698  ? -28.920 -53.656 -21.000 1.00 92.10  ? 698  GLN A NE2   1 
ATOM   5092  N  N     . ASP A 1 699  ? -31.651 -48.476 -22.666 1.00 82.45  ? 699  ASP A N     1 
ATOM   5093  C  CA    . ASP A 1 699  ? -31.425 -47.092 -22.213 1.00 83.06  ? 699  ASP A CA    1 
ATOM   5094  C  C     . ASP A 1 699  ? -30.108 -46.941 -21.452 1.00 84.75  ? 699  ASP A C     1 
ATOM   5095  O  O     . ASP A 1 699  ? -29.678 -47.866 -20.763 1.00 86.35  ? 699  ASP A O     1 
ATOM   5096  C  CB    . ASP A 1 699  ? -32.576 -46.595 -21.315 1.00 84.63  ? 699  ASP A CB    1 
ATOM   5097  C  CG    . ASP A 1 699  ? -33.836 -46.220 -22.098 1.00 84.12  ? 699  ASP A CG    1 
ATOM   5098  O  OD1   . ASP A 1 699  ? -33.738 -45.569 -23.161 1.00 84.07  ? 699  ASP A OD1   1 
ATOM   5099  O  OD2   . ASP A 1 699  ? -34.943 -46.556 -21.632 1.00 86.01  ? 699  ASP A OD2   1 
ATOM   5100  N  N     . LEU A 1 700  ? -29.487 -45.768 -21.594 1.00 84.78  ? 700  LEU A N     1 
ATOM   5101  C  CA    . LEU A 1 700  ? -28.216 -45.433 -20.947 1.00 86.45  ? 700  LEU A CA    1 
ATOM   5102  C  C     . LEU A 1 700  ? -28.371 -44.214 -20.043 1.00 88.87  ? 700  LEU A C     1 
ATOM   5103  O  O     . LEU A 1 700  ? -29.190 -43.331 -20.322 1.00 88.12  ? 700  LEU A O     1 
ATOM   5104  C  CB    . LEU A 1 700  ? -27.156 -45.126 -22.000 1.00 84.61  ? 700  LEU A CB    1 
ATOM   5105  C  CG    . LEU A 1 700  ? -26.748 -46.279 -22.913 1.00 84.29  ? 700  LEU A CG    1 
ATOM   5106  C  CD1   . LEU A 1 700  ? -25.884 -45.756 -24.050 1.00 83.14  ? 700  LEU A CD1   1 
ATOM   5107  C  CD2   . LEU A 1 700  ? -26.025 -47.373 -22.142 1.00 86.01  ? 700  LEU A CD2   1 
ATOM   5108  N  N     . GLU A 1 701  ? -27.569 -44.171 -18.974 1.00 92.50  ? 701  GLU A N     1 
ATOM   5109  C  CA    . GLU A 1 701  ? -27.514 -43.023 -18.061 1.00 94.54  ? 701  GLU A CA    1 
ATOM   5110  C  C     . GLU A 1 701  ? -26.178 -42.294 -18.232 1.00 93.94  ? 701  GLU A C     1 
ATOM   5111  O  O     . GLU A 1 701  ? -25.174 -42.947 -18.517 1.00 94.14  ? 701  GLU A O     1 
ATOM   5112  C  CB    . GLU A 1 701  ? -27.677 -43.479 -16.606 1.00 98.35  ? 701  GLU A CB    1 
ATOM   5113  C  CG    . GLU A 1 701  ? -28.821 -44.455 -16.358 1.00 100.85 ? 701  GLU A CG    1 
ATOM   5114  C  CD    . GLU A 1 701  ? -30.128 -44.040 -17.022 1.00 101.23 ? 701  GLU A CD    1 
ATOM   5115  O  OE1   . GLU A 1 701  ? -30.494 -42.846 -16.937 1.00 101.85 ? 701  GLU A OE1   1 
ATOM   5116  O  OE2   . GLU A 1 701  ? -30.787 -44.908 -17.639 1.00 102.54 ? 701  GLU A OE2   1 
ATOM   5117  N  N     . PRO A 1 702  ? -26.134 -40.967 -18.060 1.00 93.01  ? 702  PRO A N     1 
ATOM   5118  C  CA    . PRO A 1 702  ? -27.274 -40.122 -17.685 1.00 92.13  ? 702  PRO A CA    1 
ATOM   5119  C  C     . PRO A 1 702  ? -28.076 -39.633 -18.893 1.00 89.40  ? 702  PRO A C     1 
ATOM   5120  O  O     . PRO A 1 702  ? -27.510 -39.397 -19.964 1.00 88.89  ? 702  PRO A O     1 
ATOM   5121  C  CB    . PRO A 1 702  ? -26.597 -38.936 -17.008 1.00 92.91  ? 702  PRO A CB    1 
ATOM   5122  C  CG    . PRO A 1 702  ? -25.289 -38.802 -17.727 1.00 92.80  ? 702  PRO A CG    1 
ATOM   5123  C  CD    . PRO A 1 702  ? -24.897 -40.175 -18.206 1.00 93.01  ? 702  PRO A CD    1 
ATOM   5124  N  N     . LEU A 1 703  ? -29.382 -39.481 -18.711 1.00 88.07  ? 703  LEU A N     1 
ATOM   5125  C  CA    . LEU A 1 703  ? -30.241 -38.873 -19.725 1.00 86.13  ? 703  LEU A CA    1 
ATOM   5126  C  C     . LEU A 1 703  ? -30.298 -37.360 -19.480 1.00 85.73  ? 703  LEU A C     1 
ATOM   5127  O  O     . LEU A 1 703  ? -31.046 -36.888 -18.625 1.00 85.96  ? 703  LEU A O     1 
ATOM   5128  C  CB    . LEU A 1 703  ? -31.638 -39.503 -19.693 1.00 86.11  ? 703  LEU A CB    1 
ATOM   5129  C  CG    . LEU A 1 703  ? -32.739 -38.953 -20.611 1.00 85.53  ? 703  LEU A CG    1 
ATOM   5130  C  CD1   . LEU A 1 703  ? -32.303 -38.809 -22.062 1.00 84.35  ? 703  LEU A CD1   1 
ATOM   5131  C  CD2   . LEU A 1 703  ? -33.971 -39.842 -20.524 1.00 86.28  ? 703  LEU A CD2   1 
ATOM   5132  N  N     . ILE A 1 704  ? -29.493 -36.614 -20.235 1.00 84.62  ? 704  ILE A N     1 
ATOM   5133  C  CA    . ILE A 1 704  ? -29.329 -35.171 -20.056 1.00 83.82  ? 704  ILE A CA    1 
ATOM   5134  C  C     . ILE A 1 704  ? -30.309 -34.424 -20.955 1.00 80.92  ? 704  ILE A C     1 
ATOM   5135  O  O     . ILE A 1 704  ? -30.240 -34.569 -22.165 1.00 80.65  ? 704  ILE A O     1 
ATOM   5136  C  CB    . ILE A 1 704  ? -27.895 -34.742 -20.437 1.00 85.24  ? 704  ILE A CB    1 
ATOM   5137  C  CG1   . ILE A 1 704  ? -26.849 -35.514 -19.614 1.00 88.18  ? 704  ILE A CG1   1 
ATOM   5138  C  CG2   . ILE A 1 704  ? -27.708 -33.241 -20.245 1.00 85.56  ? 704  ILE A CG2   1 
ATOM   5139  C  CD1   . ILE A 1 704  ? -25.500 -35.619 -20.303 1.00 88.90  ? 704  ILE A CD1   1 
ATOM   5140  N  N     . LEU A 1 705  ? -31.206 -33.625 -20.376 1.00 79.94  ? 705  LEU A N     1 
ATOM   5141  C  CA    . LEU A 1 705  ? -32.199 -32.861 -21.161 1.00 77.96  ? 705  LEU A CA    1 
ATOM   5142  C  C     . LEU A 1 705  ? -32.119 -31.345 -20.979 1.00 77.08  ? 705  LEU A C     1 
ATOM   5143  O  O     . LEU A 1 705  ? -32.284 -30.602 -21.945 1.00 75.10  ? 705  LEU A O     1 
ATOM   5144  C  CB    . LEU A 1 705  ? -33.628 -33.334 -20.842 1.00 78.34  ? 705  LEU A CB    1 
ATOM   5145  C  CG    . LEU A 1 705  ? -33.972 -34.803 -21.120 1.00 78.47  ? 705  LEU A CG    1 
ATOM   5146  C  CD1   . LEU A 1 705  ? -35.372 -35.132 -20.618 1.00 78.36  ? 705  LEU A CD1   1 
ATOM   5147  C  CD2   . LEU A 1 705  ? -33.824 -35.127 -22.600 1.00 76.93  ? 705  LEU A CD2   1 
ATOM   5148  N  N     . THR A 1 706  ? -31.915 -30.884 -19.749 1.00 78.52  ? 706  THR A N     1 
ATOM   5149  C  CA    . THR A 1 706  ? -31.818 -29.450 -19.471 1.00 79.66  ? 706  THR A CA    1 
ATOM   5150  C  C     . THR A 1 706  ? -30.376 -28.950 -19.566 1.00 80.70  ? 706  THR A C     1 
ATOM   5151  O  O     . THR A 1 706  ? -29.426 -29.737 -19.669 1.00 80.44  ? 706  THR A O     1 
ATOM   5152  C  CB    . THR A 1 706  ? -32.392 -29.089 -18.076 1.00 81.37  ? 706  THR A CB    1 
ATOM   5153  O  OG1   . THR A 1 706  ? -31.616 -29.715 -17.042 1.00 82.74  ? 706  THR A OG1   1 
ATOM   5154  C  CG2   . THR A 1 706  ? -33.852 -29.514 -17.964 1.00 80.84  ? 706  THR A CG2   1 
ATOM   5155  N  N     . ILE A 1 707  ? -30.238 -27.626 -19.518 1.00 81.40  ? 707  ILE A N     1 
ATOM   5156  C  CA    . ILE A 1 707  ? -28.934 -26.960 -19.514 1.00 82.34  ? 707  ILE A CA    1 
ATOM   5157  C  C     . ILE A 1 707  ? -28.224 -27.169 -18.162 1.00 84.44  ? 707  ILE A C     1 
ATOM   5158  O  O     . ILE A 1 707  ? -27.002 -27.284 -18.122 1.00 84.69  ? 707  ILE A O     1 
ATOM   5159  C  CB    . ILE A 1 707  ? -29.056 -25.449 -19.852 1.00 81.47  ? 707  ILE A CB    1 
ATOM   5160  C  CG1   . ILE A 1 707  ? -29.855 -25.238 -21.152 1.00 79.42  ? 707  ILE A CG1   1 
ATOM   5161  C  CG2   . ILE A 1 707  ? -27.680 -24.809 -20.017 1.00 82.11  ? 707  ILE A CG2   1 
ATOM   5162  C  CD1   . ILE A 1 707  ? -29.941 -23.800 -21.624 1.00 78.59  ? 707  ILE A CD1   1 
ATOM   5163  N  N     . GLU A 1 708  ? -28.986 -27.248 -17.071 1.00 86.67  ? 708  GLU A N     1 
ATOM   5164  C  CA    . GLU A 1 708  ? -28.410 -27.384 -15.721 1.00 89.96  ? 708  GLU A CA    1 
ATOM   5165  C  C     . GLU A 1 708  ? -27.864 -28.783 -15.470 1.00 90.65  ? 708  GLU A C     1 
ATOM   5166  O  O     . GLU A 1 708  ? -26.820 -28.936 -14.833 1.00 92.25  ? 708  GLU A O     1 
ATOM   5167  C  CB    . GLU A 1 708  ? -29.433 -27.040 -14.635 1.00 92.11  ? 708  GLU A CB    1 
ATOM   5168  C  CG    . GLU A 1 708  ? -29.865 -25.580 -14.619 1.00 92.51  ? 708  GLU A CG    1 
ATOM   5169  C  CD    . GLU A 1 708  ? -31.076 -25.296 -15.502 1.00 91.97  ? 708  GLU A CD    1 
ATOM   5170  O  OE1   . GLU A 1 708  ? -31.122 -25.773 -16.665 1.00 89.81  ? 708  GLU A OE1   1 
ATOM   5171  O  OE2   . GLU A 1 708  ? -31.987 -24.582 -15.024 1.00 93.19  ? 708  GLU A OE2   1 
ATOM   5172  N  N     . GLU A 1 709  ? -28.586 -29.793 -15.960 1.00 89.75  ? 709  GLU A N     1 
ATOM   5173  C  CA    . GLU A 1 709  ? -28.113 -31.181 -15.958 1.00 89.08  ? 709  GLU A CA    1 
ATOM   5174  C  C     . GLU A 1 709  ? -26.831 -31.339 -16.767 1.00 87.19  ? 709  GLU A C     1 
ATOM   5175  O  O     . GLU A 1 709  ? -25.937 -32.087 -16.378 1.00 89.80  ? 709  GLU A O     1 
ATOM   5176  C  CB    . GLU A 1 709  ? -29.183 -32.117 -16.523 1.00 88.78  ? 709  GLU A CB    1 
ATOM   5177  C  CG    . GLU A 1 709  ? -30.368 -32.337 -15.600 1.00 90.23  ? 709  GLU A CG    1 
ATOM   5178  C  CD    . GLU A 1 709  ? -31.456 -33.192 -16.231 1.00 90.00  ? 709  GLU A CD    1 
ATOM   5179  O  OE1   . GLU A 1 709  ? -31.914 -32.872 -17.350 1.00 89.16  ? 709  GLU A OE1   1 
ATOM   5180  O  OE2   . GLU A 1 709  ? -31.866 -34.188 -15.599 1.00 91.78  ? 709  GLU A OE2   1 
ATOM   5181  N  N     . SER A 1 710  ? -26.743 -30.618 -17.882 1.00 83.79  ? 710  SER A N     1 
ATOM   5182  C  CA    . SER A 1 710  ? -25.562 -30.656 -18.747 1.00 82.21  ? 710  SER A CA    1 
ATOM   5183  C  C     . SER A 1 710  ? -24.263 -30.110 -18.124 1.00 83.07  ? 710  SER A C     1 
ATOM   5184  O  O     . SER A 1 710  ? -23.189 -30.352 -18.663 1.00 82.50  ? 710  SER A O     1 
ATOM   5185  C  CB    . SER A 1 710  ? -25.856 -29.934 -20.067 1.00 79.20  ? 710  SER A CB    1 
ATOM   5186  O  OG    . SER A 1 710  ? -24.729 -29.954 -20.917 1.00 77.82  ? 710  SER A OG    1 
ATOM   5187  N  N     . ILE A 1 711  ? -24.344 -29.413 -16.991 1.00 85.13  ? 711  ILE A N     1 
ATOM   5188  C  CA    . ILE A 1 711  ? -23.130 -28.947 -16.291 1.00 87.91  ? 711  ILE A CA    1 
ATOM   5189  C  C     . ILE A 1 711  ? -22.556 -30.040 -15.348 1.00 90.39  ? 711  ILE A C     1 
ATOM   5190  O  O     . ILE A 1 711  ? -21.815 -29.729 -14.415 1.00 92.31  ? 711  ILE A O     1 
ATOM   5191  C  CB    . ILE A 1 711  ? -23.339 -27.602 -15.521 1.00 88.11  ? 711  ILE A CB    1 
ATOM   5192  C  CG1   . ILE A 1 711  ? -24.361 -26.665 -16.197 1.00 86.58  ? 711  ILE A CG1   1 
ATOM   5193  C  CG2   . ILE A 1 711  ? -22.020 -26.842 -15.396 1.00 89.46  ? 711  ILE A CG2   1 
ATOM   5194  C  CD1   . ILE A 1 711  ? -24.043 -26.270 -17.627 1.00 84.40  ? 711  ILE A CD1   1 
ATOM   5195  N  N     . GLN A 1 712  ? -22.917 -31.311 -15.574 1.00 90.52  ? 712  GLN A N     1 
ATOM   5196  C  CA    . GLN A 1 712  ? -22.256 -32.450 -14.930 1.00 91.47  ? 712  GLN A CA    1 
ATOM   5197  C  C     . GLN A 1 712  ? -22.502 -33.740 -15.712 1.00 88.00  ? 712  GLN A C     1 
ATOM   5198  O  O     . GLN A 1 712  ? -21.649 -34.168 -16.477 1.00 84.69  ? 712  GLN A O     1 
ATOM   5199  C  CB    . GLN A 1 712  ? -22.722 -32.608 -13.475 1.00 94.21  ? 712  GLN A CB    1 
ATOM   5200  C  CG    . GLN A 1 712  ? -24.233 -32.717 -13.295 1.00 94.28  ? 712  GLN A CG    1 
ATOM   5201  C  CD    . GLN A 1 712  ? -24.874 -31.445 -12.772 1.00 94.27  ? 712  GLN A CD    1 
ATOM   5202  O  OE1   . GLN A 1 712  ? -25.317 -31.394 -11.623 1.00 96.78  ? 712  GLN A OE1   1 
ATOM   5203  N  NE2   . GLN A 1 712  ? -24.930 -30.418 -13.605 1.00 91.76  ? 712  GLN A NE2   1 
ATOM   5204  N  N     . SER A 1 716  ? -15.985 -32.521 -18.258 1.00 109.11 ? 716  SER A N     1 
ATOM   5205  C  CA    . SER A 1 716  ? -14.633 -32.671 -18.800 1.00 108.81 ? 716  SER A CA    1 
ATOM   5206  C  C     . SER A 1 716  ? -13.986 -31.309 -19.139 1.00 107.71 ? 716  SER A C     1 
ATOM   5207  O  O     . SER A 1 716  ? -13.293 -30.742 -18.286 1.00 109.69 ? 716  SER A O     1 
ATOM   5208  C  CB    . SER A 1 716  ? -14.639 -33.614 -20.012 1.00 106.74 ? 716  SER A CB    1 
ATOM   5209  O  OG    . SER A 1 716  ? -15.576 -33.184 -20.983 1.00 104.20 ? 716  SER A OG    1 
ATOM   5210  N  N     . PHE A 1 717  ? -14.209 -30.789 -20.355 1.00 102.99 ? 717  PHE A N     1 
ATOM   5211  C  CA    . PHE A 1 717  ? -13.615 -29.509 -20.784 1.00 100.51 ? 717  PHE A CA    1 
ATOM   5212  C  C     . PHE A 1 717  ? -14.401 -28.831 -21.902 1.00 97.39  ? 717  PHE A C     1 
ATOM   5213  O  O     . PHE A 1 717  ? -14.560 -29.394 -22.982 1.00 94.30  ? 717  PHE A O     1 
ATOM   5214  C  CB    . PHE A 1 717  ? -12.162 -29.698 -21.244 1.00 100.52 ? 717  PHE A CB    1 
ATOM   5215  C  CG    . PHE A 1 717  ? -11.546 -28.455 -21.850 1.00 99.19  ? 717  PHE A CG    1 
ATOM   5216  C  CD1   . PHE A 1 717  ? -11.116 -27.405 -21.038 1.00 100.06 ? 717  PHE A CD1   1 
ATOM   5217  C  CD2   . PHE A 1 717  ? -11.403 -28.328 -23.233 1.00 96.17  ? 717  PHE A CD2   1 
ATOM   5218  C  CE1   . PHE A 1 717  ? -10.558 -26.256 -21.593 1.00 98.66  ? 717  PHE A CE1   1 
ATOM   5219  C  CE2   . PHE A 1 717  ? -10.842 -27.182 -23.789 1.00 95.14  ? 717  PHE A CE2   1 
ATOM   5220  C  CZ    . PHE A 1 717  ? -10.420 -26.146 -22.969 1.00 96.10  ? 717  PHE A CZ    1 
ATOM   5221  N  N     . LYS A 1 718  ? -14.852 -27.608 -21.627 1.00 97.96  ? 718  LYS A N     1 
ATOM   5222  C  CA    . LYS A 1 718  ? -15.496 -26.734 -22.607 1.00 97.18  ? 718  LYS A CA    1 
ATOM   5223  C  C     . LYS A 1 718  ? -14.543 -25.588 -22.955 1.00 95.62  ? 718  LYS A C     1 
ATOM   5224  O  O     . LYS A 1 718  ? -13.903 -25.043 -22.058 1.00 96.78  ? 718  LYS A O     1 
ATOM   5225  C  CB    . LYS A 1 718  ? -16.762 -26.113 -22.006 1.00 98.96  ? 718  LYS A CB    1 
ATOM   5226  C  CG    . LYS A 1 718  ? -17.877 -27.088 -21.674 1.00 100.36 ? 718  LYS A CG    1 
ATOM   5227  C  CD    . LYS A 1 718  ? -18.794 -27.306 -22.868 1.00 100.53 ? 718  LYS A CD    1 
ATOM   5228  C  CE    . LYS A 1 718  ? -19.919 -28.277 -22.532 1.00 102.35 ? 718  LYS A CE    1 
ATOM   5229  N  NZ    . LYS A 1 718  ? -20.815 -27.762 -21.454 1.00 103.56 ? 718  LYS A NZ    1 
ATOM   5230  N  N     . PRO A 1 719  ? -14.439 -25.214 -24.246 1.00 92.81  ? 719  PRO A N     1 
ATOM   5231  C  CA    . PRO A 1 719  ? -13.767 -23.937 -24.538 1.00 92.59  ? 719  PRO A CA    1 
ATOM   5232  C  C     . PRO A 1 719  ? -14.617 -22.748 -24.084 1.00 91.90  ? 719  PRO A C     1 
ATOM   5233  O  O     . PRO A 1 719  ? -15.813 -22.714 -24.363 1.00 92.94  ? 719  PRO A O     1 
ATOM   5234  C  CB    . PRO A 1 719  ? -13.610 -23.950 -26.068 1.00 90.59  ? 719  PRO A CB    1 
ATOM   5235  C  CG    . PRO A 1 719  ? -14.601 -24.941 -26.557 1.00 89.05  ? 719  PRO A CG    1 
ATOM   5236  C  CD    . PRO A 1 719  ? -14.745 -25.968 -25.473 1.00 90.23  ? 719  PRO A CD    1 
ATOM   5237  N  N     . GLU A 1 720  ? -14.010 -21.802 -23.377 1.00 92.12  ? 720  GLU A N     1 
ATOM   5238  C  CA    . GLU A 1 720  ? -14.709 -20.598 -22.941 1.00 91.59  ? 720  GLU A CA    1 
ATOM   5239  C  C     . GLU A 1 720  ? -14.665 -19.557 -24.047 1.00 89.19  ? 720  GLU A C     1 
ATOM   5240  O  O     . GLU A 1 720  ? -13.752 -19.558 -24.864 1.00 88.62  ? 720  GLU A O     1 
ATOM   5241  C  CB    . GLU A 1 720  ? -14.056 -20.024 -21.680 1.00 94.77  ? 720  GLU A CB    1 
ATOM   5242  C  CG    . GLU A 1 720  ? -14.842 -18.890 -21.036 1.00 95.97  ? 720  GLU A CG    1 
ATOM   5243  C  CD    . GLU A 1 720  ? -14.273 -18.470 -19.699 1.00 98.75  ? 720  GLU A CD    1 
ATOM   5244  O  OE1   . GLU A 1 720  ? -14.694 -19.042 -18.672 1.00 100.09 ? 720  GLU A OE1   1 
ATOM   5245  O  OE2   . GLU A 1 720  ? -13.405 -17.573 -19.675 1.00 99.98  ? 720  GLU A OE2   1 
ATOM   5246  N  N     . ARG A 1 721  ? -15.668 -18.684 -24.073 1.00 87.65  ? 721  ARG A N     1 
ATOM   5247  C  CA    . ARG A 1 721  ? -15.621 -17.446 -24.851 1.00 86.70  ? 721  ARG A CA    1 
ATOM   5248  C  C     . ARG A 1 721  ? -15.904 -16.284 -23.910 1.00 86.75  ? 721  ARG A C     1 
ATOM   5249  O  O     . ARG A 1 721  ? -16.796 -16.385 -23.064 1.00 86.75  ? 721  ARG A O     1 
ATOM   5250  C  CB    . ARG A 1 721  ? -16.648 -17.467 -25.977 1.00 84.96  ? 721  ARG A CB    1 
ATOM   5251  C  CG    . ARG A 1 721  ? -16.233 -18.299 -27.172 1.00 84.97  ? 721  ARG A CG    1 
ATOM   5252  C  CD    . ARG A 1 721  ? -15.225 -17.577 -28.048 1.00 85.37  ? 721  ARG A CD    1 
ATOM   5253  N  NE    . ARG A 1 721  ? -14.746 -18.449 -29.119 1.00 85.51  ? 721  ARG A NE    1 
ATOM   5254  C  CZ    . ARG A 1 721  ? -13.851 -19.430 -28.969 1.00 86.93  ? 721  ARG A CZ    1 
ATOM   5255  N  NH1   . ARG A 1 721  ? -13.289 -19.690 -27.788 1.00 88.19  ? 721  ARG A NH1   1 
ATOM   5256  N  NH2   . ARG A 1 721  ? -13.502 -20.162 -30.022 1.00 86.83  ? 721  ARG A NH2   1 
ATOM   5257  N  N     . LYS A 1 722  ? -15.157 -15.188 -24.065 1.00 85.69  ? 722  LYS A N     1 
ATOM   5258  C  CA    . LYS A 1 722  ? -15.241 -14.068 -23.133 1.00 85.78  ? 722  LYS A CA    1 
ATOM   5259  C  C     . LYS A 1 722  ? -14.965 -12.697 -23.759 1.00 84.01  ? 722  LYS A C     1 
ATOM   5260  O  O     . LYS A 1 722  ? -14.112 -12.550 -24.634 1.00 82.34  ? 722  LYS A O     1 
ATOM   5261  C  CB    . LYS A 1 722  ? -14.292 -14.302 -21.956 1.00 88.27  ? 722  LYS A CB    1 
ATOM   5262  C  CG    . LYS A 1 722  ? -14.469 -13.318 -20.811 1.00 90.61  ? 722  LYS A CG    1 
ATOM   5263  C  CD    . LYS A 1 722  ? -13.605 -13.675 -19.613 1.00 93.33  ? 722  LYS A CD    1 
ATOM   5264  C  CE    . LYS A 1 722  ? -12.139 -13.403 -19.901 1.00 94.82  ? 722  LYS A CE    1 
ATOM   5265  N  NZ    . LYS A 1 722  ? -11.337 -13.408 -18.652 1.00 98.25  ? 722  LYS A NZ    1 
ATOM   5266  N  N     . LEU A 1 723  ? -15.721 -11.706 -23.292 1.00 83.10  ? 723  LEU A N     1 
ATOM   5267  C  CA    . LEU A 1 723  ? -15.473 -10.302 -23.568 1.00 82.90  ? 723  LEU A CA    1 
ATOM   5268  C  C     . LEU A 1 723  ? -15.335 -9.619  -22.233 1.00 84.68  ? 723  LEU A C     1 
ATOM   5269  O  O     . LEU A 1 723  ? -16.085 -9.930  -21.303 1.00 84.58  ? 723  LEU A O     1 
ATOM   5270  C  CB    . LEU A 1 723  ? -16.649 -9.673  -24.301 1.00 81.81  ? 723  LEU A CB    1 
ATOM   5271  C  CG    . LEU A 1 723  ? -16.793 -9.924  -25.799 1.00 79.95  ? 723  LEU A CG    1 
ATOM   5272  C  CD1   . LEU A 1 723  ? -18.208 -9.588  -26.223 1.00 78.89  ? 723  LEU A CD1   1 
ATOM   5273  C  CD2   . LEU A 1 723  ? -15.791 -9.096  -26.589 1.00 80.34  ? 723  LEU A CD2   1 
ATOM   5274  N  N     . GLU A 1 724  ? -14.380 -8.699  -22.141 1.00 86.17  ? 724  GLU A N     1 
ATOM   5275  C  CA    . GLU A 1 724  ? -14.237 -7.836  -20.974 1.00 88.12  ? 724  GLU A CA    1 
ATOM   5276  C  C     . GLU A 1 724  ? -14.066 -6.397  -21.428 1.00 87.27  ? 724  GLU A C     1 
ATOM   5277  O  O     . GLU A 1 724  ? -13.232 -6.108  -22.281 1.00 87.00  ? 724  GLU A O     1 
ATOM   5278  C  CB    . GLU A 1 724  ? -13.049 -8.263  -20.117 1.00 91.41  ? 724  GLU A CB    1 
ATOM   5279  C  CG    . GLU A 1 724  ? -13.212 -9.654  -19.523 1.00 93.09  ? 724  GLU A CG    1 
ATOM   5280  C  CD    . GLU A 1 724  ? -12.354 -9.899  -18.291 1.00 97.63  ? 724  GLU A CD    1 
ATOM   5281  O  OE1   . GLU A 1 724  ? -11.313 -9.217  -18.112 1.00 100.60 ? 724  GLU A OE1   1 
ATOM   5282  O  OE2   . GLU A 1 724  ? -12.729 -10.790 -17.493 1.00 99.40  ? 724  GLU A OE2   1 
ATOM   5283  N  N     . TYR A 1 725  ? -14.887 -5.510  -20.874 1.00 86.95  ? 725  TYR A N     1 
ATOM   5284  C  CA    . TYR A 1 725  ? -14.749 -4.073  -21.063 1.00 86.79  ? 725  TYR A CA    1 
ATOM   5285  C  C     . TYR A 1 725  ? -14.588 -3.453  -19.684 1.00 88.27  ? 725  TYR A C     1 
ATOM   5286  O  O     . TYR A 1 725  ? -15.190 -3.930  -18.724 1.00 88.22  ? 725  TYR A O     1 
ATOM   5287  C  CB    . TYR A 1 725  ? -15.976 -3.520  -21.780 1.00 85.24  ? 725  TYR A CB    1 
ATOM   5288  C  CG    . TYR A 1 725  ? -15.753 -2.180  -22.443 1.00 85.73  ? 725  TYR A CG    1 
ATOM   5289  C  CD1   . TYR A 1 725  ? -14.901 -2.053  -23.540 1.00 85.25  ? 725  TYR A CD1   1 
ATOM   5290  C  CD2   . TYR A 1 725  ? -16.402 -1.036  -21.985 1.00 86.71  ? 725  TYR A CD2   1 
ATOM   5291  C  CE1   . TYR A 1 725  ? -14.698 -0.824  -24.153 1.00 85.24  ? 725  TYR A CE1   1 
ATOM   5292  C  CE2   . TYR A 1 725  ? -16.209 0.192   -22.594 1.00 86.62  ? 725  TYR A CE2   1 
ATOM   5293  C  CZ    . TYR A 1 725  ? -15.359 0.289   -23.674 1.00 86.04  ? 725  TYR A CZ    1 
ATOM   5294  O  OH    . TYR A 1 725  ? -15.171 1.501   -24.273 1.00 86.99  ? 725  TYR A OH    1 
ATOM   5295  N  N     . GLY A 1 726  ? -13.752 -2.419  -19.582 1.00 89.62  ? 726  GLY A N     1 
ATOM   5296  C  CA    . GLY A 1 726  ? -13.484 -1.760  -18.309 1.00 91.82  ? 726  GLY A CA    1 
ATOM   5297  C  C     . GLY A 1 726  ? -12.976 -2.721  -17.247 1.00 93.70  ? 726  GLY A C     1 
ATOM   5298  O  O     . GLY A 1 726  ? -12.233 -3.652  -17.554 1.00 93.66  ? 726  GLY A O     1 
ATOM   5299  N  N     . ASN A 1 727  ? -13.397 -2.495  -16.004 1.00 95.87  ? 727  ASN A N     1 
ATOM   5300  C  CA    . ASN A 1 727  ? -12.979 -3.290  -14.847 1.00 98.24  ? 727  ASN A CA    1 
ATOM   5301  C  C     . ASN A 1 727  ? -14.192 -3.495  -13.941 1.00 99.56  ? 727  ASN A C     1 
ATOM   5302  O  O     . ASN A 1 727  ? -14.509 -2.644  -13.107 1.00 101.85 ? 727  ASN A O     1 
ATOM   5303  C  CB    . ASN A 1 727  ? -11.834 -2.566  -14.116 1.00 100.73 ? 727  ASN A CB    1 
ATOM   5304  C  CG    . ASN A 1 727  ? -11.310 -3.325  -12.897 1.00 102.62 ? 727  ASN A CG    1 
ATOM   5305  O  OD1   . ASN A 1 727  ? -11.760 -4.421  -12.572 1.00 101.86 ? 727  ASN A OD1   1 
ATOM   5306  N  ND2   . ASN A 1 727  ? -10.340 -2.726  -12.215 1.00 105.40 ? 727  ASN A ND2   1 
ATOM   5307  N  N     . VAL A 1 728  ? -14.861 -4.634  -14.110 1.00 99.16  ? 728  VAL A N     1 
ATOM   5308  C  CA    . VAL A 1 728  ? -16.156 -4.883  -13.470 1.00 99.84  ? 728  VAL A CA    1 
ATOM   5309  C  C     . VAL A 1 728  ? -16.055 -5.142  -11.964 1.00 102.70 ? 728  VAL A C     1 
ATOM   5310  O  O     . VAL A 1 728  ? -16.996 -4.853  -11.233 1.00 103.51 ? 728  VAL A O     1 
ATOM   5311  C  CB    . VAL A 1 728  ? -16.925 -6.033  -14.180 1.00 98.24  ? 728  VAL A CB    1 
ATOM   5312  C  CG1   . VAL A 1 728  ? -16.431 -7.408  -13.739 1.00 98.56  ? 728  VAL A CG1   1 
ATOM   5313  C  CG2   . VAL A 1 728  ? -18.427 -5.899  -13.959 1.00 97.87  ? 728  VAL A CG2   1 
ATOM   5314  N  N     . ASP A 1 729  ? -14.919 -5.669  -11.507 1.00 105.64 ? 729  ASP A N     1 
ATOM   5315  C  CA    . ASP A 1 729  ? -14.707 -5.954  -10.073 1.00 108.54 ? 729  ASP A CA    1 
ATOM   5316  C  C     . ASP A 1 729  ? -14.589 -4.679  -9.229  1.00 109.79 ? 729  ASP A C     1 
ATOM   5317  O  O     . ASP A 1 729  ? -15.111 -4.625  -8.112  1.00 111.22 ? 729  ASP A O     1 
ATOM   5318  C  CB    . ASP A 1 729  ? -13.472 -6.852  -9.859  1.00 110.38 ? 729  ASP A CB    1 
ATOM   5319  C  CG    . ASP A 1 729  ? -13.589 -8.213  -10.568 1.00 109.46 ? 729  ASP A CG    1 
ATOM   5320  O  OD1   . ASP A 1 729  ? -14.715 -8.743  -10.712 1.00 107.63 ? 729  ASP A OD1   1 
ATOM   5321  O  OD2   . ASP A 1 729  ? -12.541 -8.753  -10.984 1.00 110.32 ? 729  ASP A OD2   1 
ATOM   5322  N  N     . GLU A 1 730  ? -13.911 -3.662  -9.758  1.00 109.60 ? 730  GLU A N     1 
ATOM   5323  C  CA    . GLU A 1 730  ? -13.873 -2.343  -9.109  1.00 111.01 ? 730  GLU A CA    1 
ATOM   5324  C  C     . GLU A 1 730  ? -15.233 -1.637  -9.157  1.00 109.19 ? 730  GLU A C     1 
ATOM   5325  O  O     . GLU A 1 730  ? -15.654 -1.037  -8.173  1.00 110.04 ? 730  GLU A O     1 
ATOM   5326  C  CB    . GLU A 1 730  ? -12.789 -1.453  -9.731  1.00 112.11 ? 730  GLU A CB    1 
ATOM   5327  C  CG    . GLU A 1 730  ? -11.373 -1.870  -9.368  1.00 114.47 ? 730  GLU A CG    1 
ATOM   5328  C  CD    . GLU A 1 730  ? -11.056 -1.659  -7.894  1.00 118.53 ? 730  GLU A CD    1 
ATOM   5329  O  OE1   . GLU A 1 730  ? -10.874 -0.496  -7.470  1.00 120.55 ? 730  GLU A OE1   1 
ATOM   5330  O  OE2   . GLU A 1 730  ? -10.987 -2.660  -7.150  1.00 120.25 ? 730  GLU A OE2   1 
ATOM   5331  N  N     . ALA A 1 731  ? -15.920 -1.735  -10.295 1.00 106.53 ? 731  ALA A N     1 
ATOM   5332  C  CA    . ALA A 1 731  ? -17.226 -1.085  -10.495 1.00 104.87 ? 731  ALA A CA    1 
ATOM   5333  C  C     . ALA A 1 731  ? -18.316 -1.533  -9.516  1.00 104.81 ? 731  ALA A C     1 
ATOM   5334  O  O     . ALA A 1 731  ? -19.155 -0.720  -9.124  1.00 104.84 ? 731  ALA A O     1 
ATOM   5335  C  CB    . ALA A 1 731  ? -17.703 -1.292  -11.924 1.00 102.17 ? 731  ALA A CB    1 
ATOM   5336  N  N     . PHE A 1 732  ? -18.305 -2.812  -9.131  1.00 104.36 ? 732  PHE A N     1 
ATOM   5337  C  CA    . PHE A 1 732  ? -19.260 -3.340  -8.133  1.00 104.55 ? 732  PHE A CA    1 
ATOM   5338  C  C     . PHE A 1 732  ? -19.119 -2.711  -6.730  1.00 107.35 ? 732  PHE A C     1 
ATOM   5339  O  O     . PHE A 1 732  ? -20.081 -2.723  -5.958  1.00 107.65 ? 732  PHE A O     1 
ATOM   5340  C  CB    . PHE A 1 732  ? -19.173 -4.878  -8.018  1.00 103.38 ? 732  PHE A CB    1 
ATOM   5341  C  CG    . PHE A 1 732  ? -19.948 -5.628  -9.077  1.00 100.73 ? 732  PHE A CG    1 
ATOM   5342  C  CD1   . PHE A 1 732  ? -21.329 -5.463  -9.206  1.00 99.62  ? 732  PHE A CD1   1 
ATOM   5343  C  CD2   . PHE A 1 732  ? -19.309 -6.539  -9.924  1.00 99.07  ? 732  PHE A CD2   1 
ATOM   5344  C  CE1   . PHE A 1 732  ? -22.047 -6.167  -10.174 1.00 96.89  ? 732  PHE A CE1   1 
ATOM   5345  C  CE2   . PHE A 1 732  ? -20.025 -7.241  -10.887 1.00 96.08  ? 732  PHE A CE2   1 
ATOM   5346  C  CZ    . PHE A 1 732  ? -21.392 -7.054  -11.014 1.00 94.94  ? 732  PHE A CZ    1 
ATOM   5347  N  N     . LYS A 1 733  ? -17.941 -2.174  -6.398  1.00 109.05 ? 733  LYS A N     1 
ATOM   5348  C  CA    . LYS A 1 733  ? -17.726 -1.511  -5.101  1.00 111.88 ? 733  LYS A CA    1 
ATOM   5349  C  C     . LYS A 1 733  ? -18.451 -0.167  -4.969  1.00 112.01 ? 733  LYS A C     1 
ATOM   5350  O  O     . LYS A 1 733  ? -18.873 0.192   -3.870  1.00 113.82 ? 733  LYS A O     1 
ATOM   5351  C  CB    . LYS A 1 733  ? -16.237 -1.270  -4.846  1.00 114.16 ? 733  LYS A CB    1 
ATOM   5352  C  CG    . LYS A 1 733  ? -15.386 -2.522  -4.778  1.00 114.76 ? 733  LYS A CG    1 
ATOM   5353  C  CD    . LYS A 1 733  ? -13.916 -2.152  -4.680  1.00 117.12 ? 733  LYS A CD    1 
ATOM   5354  C  CE    . LYS A 1 733  ? -13.029 -3.376  -4.822  1.00 117.53 ? 733  LYS A CE    1 
ATOM   5355  N  NZ    . LYS A 1 733  ? -13.298 -4.396  -3.770  1.00 118.68 ? 733  LYS A NZ    1 
ATOM   5356  N  N     . VAL A 1 734  ? -18.578 0.566   -6.082  1.00 110.20 ? 734  VAL A N     1 
ATOM   5357  C  CA    . VAL A 1 734  ? -19.105 1.949   -6.090  1.00 109.90 ? 734  VAL A CA    1 
ATOM   5358  C  C     . VAL A 1 734  ? -20.552 2.098   -6.621  1.00 107.71 ? 734  VAL A C     1 
ATOM   5359  O  O     . VAL A 1 734  ? -20.970 3.208   -6.961  1.00 108.03 ? 734  VAL A O     1 
ATOM   5360  C  CB    . VAL A 1 734  ? -18.141 2.907   -6.856  1.00 109.75 ? 734  VAL A CB    1 
ATOM   5361  C  CG1   . VAL A 1 734  ? -16.701 2.676   -6.417  1.00 111.45 ? 734  VAL A CG1   1 
ATOM   5362  C  CG2   . VAL A 1 734  ? -18.256 2.765   -8.373  1.00 107.21 ? 734  VAL A CG2   1 
ATOM   5363  N  N     . VAL A 1 735  ? -21.316 1.003   -6.667  1.00 105.67 ? 735  VAL A N     1 
ATOM   5364  C  CA    . VAL A 1 735  ? -22.718 1.051   -7.125  1.00 103.60 ? 735  VAL A CA    1 
ATOM   5365  C  C     . VAL A 1 735  ? -23.688 1.187   -5.953  1.00 104.61 ? 735  VAL A C     1 
ATOM   5366  O  O     . VAL A 1 735  ? -23.354 0.827   -4.826  1.00 105.76 ? 735  VAL A O     1 
ATOM   5367  C  CB    . VAL A 1 735  ? -23.127 -0.144  -8.039  1.00 100.54 ? 735  VAL A CB    1 
ATOM   5368  C  CG1   . VAL A 1 735  ? -22.487 -0.010  -9.413  1.00 98.66  ? 735  VAL A CG1   1 
ATOM   5369  C  CG2   . VAL A 1 735  ? -22.800 -1.494  -7.411  1.00 100.81 ? 735  VAL A CG2   1 
ATOM   5370  N  N     . ASP A 1 736  ? -24.886 1.700   -6.233  1.00 104.01 ? 736  ASP A N     1 
ATOM   5371  C  CA    . ASP A 1 736  ? -25.916 1.883   -5.207  1.00 105.61 ? 736  ASP A CA    1 
ATOM   5372  C  C     . ASP A 1 736  ? -26.539 0.545   -4.814  1.00 105.22 ? 736  ASP A C     1 
ATOM   5373  O  O     . ASP A 1 736  ? -26.739 0.287   -3.633  1.00 107.24 ? 736  ASP A O     1 
ATOM   5374  C  CB    . ASP A 1 736  ? -27.026 2.839   -5.678  1.00 105.20 ? 736  ASP A CB    1 
ATOM   5375  C  CG    . ASP A 1 736  ? -26.551 4.283   -5.847  1.00 106.49 ? 736  ASP A CG    1 
ATOM   5376  O  OD1   . ASP A 1 736  ? -25.594 4.707   -5.169  1.00 108.34 ? 736  ASP A OD1   1 
ATOM   5377  O  OD2   . ASP A 1 736  ? -27.163 5.009   -6.660  1.00 106.10 ? 736  ASP A OD2   1 
ATOM   5378  N  N     . GLN A 1 737  ? -26.853 -0.289  -5.804  1.00 103.30 ? 737  GLN A N     1 
ATOM   5379  C  CA    . GLN A 1 737  ? -27.443 -1.608  -5.568  1.00 103.04 ? 737  GLN A CA    1 
ATOM   5380  C  C     . GLN A 1 737  ? -26.831 -2.679  -6.463  1.00 101.78 ? 737  GLN A C     1 
ATOM   5381  O  O     . GLN A 1 737  ? -26.242 -2.380  -7.507  1.00 100.41 ? 737  GLN A O     1 
ATOM   5382  C  CB    . GLN A 1 737  ? -28.934 -1.595  -5.884  1.00 102.17 ? 737  GLN A CB    1 
ATOM   5383  C  CG    . GLN A 1 737  ? -29.790 -0.566  -5.173  1.00 103.51 ? 737  GLN A CG    1 
ATOM   5384  C  CD    . GLN A 1 737  ? -31.203 -0.573  -5.755  1.00 102.48 ? 737  GLN A CD    1 
ATOM   5385  O  OE1   . GLN A 1 737  ? -31.968 -1.551  -5.560  1.00 101.51 ? 737  GLN A OE1   1 
ATOM   5386  N  NE2   . GLN A 1 737  ? -31.546 0.500   -6.459  1.00 102.27 ? 737  GLN A NE2   1 
ATOM   5387  N  N     . ILE A 1 738  ? -27.028 -3.931  -6.050  1.00 102.09 ? 738  ILE A N     1 
ATOM   5388  C  CA    . ILE A 1 738  ? -26.662 -5.112  -6.835  1.00 100.33 ? 738  ILE A CA    1 
ATOM   5389  C  C     . ILE A 1 738  ? -27.896 -6.019  -6.952  1.00 99.33  ? 738  ILE A C     1 
ATOM   5390  O  O     . ILE A 1 738  ? -28.754 -6.060  -6.061  1.00 99.45  ? 738  ILE A O     1 
ATOM   5391  C  CB    . ILE A 1 738  ? -25.454 -5.869  -6.223  1.00 101.60 ? 738  ILE A CB    1 
ATOM   5392  C  CG1   . ILE A 1 738  ? -24.251 -4.918  -6.066  1.00 102.90 ? 738  ILE A CG1   1 
ATOM   5393  C  CG2   . ILE A 1 738  ? -25.066 -7.072  -7.084  1.00 99.69  ? 738  ILE A CG2   1 
ATOM   5394  C  CD1   . ILE A 1 738  ? -23.033 -5.537  -5.410  1.00 104.27 ? 738  ILE A CD1   1 
ATOM   5395  N  N     . LEU A 1 739  ? -27.972 -6.728  -8.075  1.00 98.36  ? 739  LEU A N     1 
ATOM   5396  C  CA    . LEU A 1 739  ? -29.143 -7.502  -8.460  1.00 96.63  ? 739  LEU A CA    1 
ATOM   5397  C  C     . LEU A 1 739  ? -28.674 -8.716  -9.232  1.00 94.61  ? 739  LEU A C     1 
ATOM   5398  O  O     . LEU A 1 739  ? -27.896 -8.584  -10.169 1.00 93.28  ? 739  LEU A O     1 
ATOM   5399  C  CB    . LEU A 1 739  ? -30.026 -6.615  -9.331  1.00 95.75  ? 739  LEU A CB    1 
ATOM   5400  C  CG    . LEU A 1 739  ? -31.327 -7.064  -9.993  1.00 94.65  ? 739  LEU A CG    1 
ATOM   5401  C  CD1   . LEU A 1 739  ? -32.037 -5.821  -10.525 1.00 94.77  ? 739  LEU A CD1   1 
ATOM   5402  C  CD2   . LEU A 1 739  ? -31.112 -8.071  -11.118 1.00 92.93  ? 739  LEU A CD2   1 
ATOM   5403  N  N     . GLU A 1 740  ? -29.129 -9.890  -8.809  1.00 94.87  ? 740  GLU A N     1 
ATOM   5404  C  CA    . GLU A 1 740  ? -28.903 -11.141 -9.524  1.00 93.92  ? 740  GLU A CA    1 
ATOM   5405  C  C     . GLU A 1 740  ? -30.219 -11.622 -10.112 1.00 91.98  ? 740  GLU A C     1 
ATOM   5406  O  O     . GLU A 1 740  ? -31.294 -11.367 -9.568  1.00 92.22  ? 740  GLU A O     1 
ATOM   5407  C  CB    . GLU A 1 740  ? -28.372 -12.224 -8.584  1.00 96.24  ? 740  GLU A CB    1 
ATOM   5408  C  CG    . GLU A 1 740  ? -26.946 -12.025 -8.101  1.00 98.69  ? 740  GLU A CG    1 
ATOM   5409  C  CD    . GLU A 1 740  ? -26.626 -12.891 -6.892  1.00 101.14 ? 740  GLU A CD    1 
ATOM   5410  O  OE1   . GLU A 1 740  ? -26.964 -12.483 -5.757  1.00 102.26 ? 740  GLU A OE1   1 
ATOM   5411  O  OE2   . GLU A 1 740  ? -26.041 -13.981 -7.080  1.00 101.67 ? 740  GLU A OE2   1 
ATOM   5412  N  N     . GLY A 1 741  ? -30.132 -12.339 -11.217 1.00 90.52  ? 741  GLY A N     1 
ATOM   5413  C  CA    . GLY A 1 741  ? -31.321 -12.901 -11.831 1.00 89.35  ? 741  GLY A CA    1 
ATOM   5414  C  C     . GLY A 1 741  ? -30.965 -13.821 -12.962 1.00 87.43  ? 741  GLY A C     1 
ATOM   5415  O  O     . GLY A 1 741  ? -29.799 -13.937 -13.329 1.00 88.52  ? 741  GLY A O     1 
ATOM   5416  N  N     . GLU A 1 742  ? -31.975 -14.483 -13.507 1.00 86.01  ? 742  GLU A N     1 
ATOM   5417  C  CA    . GLU A 1 742  ? -31.778 -15.340 -14.658 1.00 84.52  ? 742  GLU A CA    1 
ATOM   5418  C  C     . GLU A 1 742  ? -33.057 -15.520 -15.446 1.00 82.09  ? 742  GLU A C     1 
ATOM   5419  O  O     . GLU A 1 742  ? -34.146 -15.352 -14.907 1.00 82.53  ? 742  GLU A O     1 
ATOM   5420  C  CB    . GLU A 1 742  ? -31.224 -16.699 -14.226 1.00 86.15  ? 742  GLU A CB    1 
ATOM   5421  C  CG    . GLU A 1 742  ? -32.079 -17.450 -13.219 1.00 88.16  ? 742  GLU A CG    1 
ATOM   5422  C  CD    . GLU A 1 742  ? -31.659 -18.901 -13.086 1.00 89.24  ? 742  GLU A CD    1 
ATOM   5423  O  OE1   . GLU A 1 742  ? -30.552 -19.150 -12.565 1.00 91.16  ? 742  GLU A OE1   1 
ATOM   5424  O  OE2   . GLU A 1 742  ? -32.433 -19.792 -13.501 1.00 88.94  ? 742  GLU A OE2   1 
ATOM   5425  N  N     . ILE A 1 743  ? -32.907 -15.870 -16.721 1.00 79.98  ? 743  ILE A N     1 
ATOM   5426  C  CA    . ILE A 1 743  ? -34.046 -16.139 -17.607 1.00 78.49  ? 743  ILE A CA    1 
ATOM   5427  C  C     . ILE A 1 743  ? -33.739 -17.317 -18.546 1.00 76.62  ? 743  ILE A C     1 
ATOM   5428  O  O     . ILE A 1 743  ? -32.720 -17.327 -19.234 1.00 76.27  ? 743  ILE A O     1 
ATOM   5429  C  CB    . ILE A 1 743  ? -34.478 -14.869 -18.396 1.00 77.48  ? 743  ILE A CB    1 
ATOM   5430  C  CG1   . ILE A 1 743  ? -35.733 -15.139 -19.227 1.00 75.86  ? 743  ILE A CG1   1 
ATOM   5431  C  CG2   . ILE A 1 743  ? -33.359 -14.333 -19.288 1.00 77.10  ? 743  ILE A CG2   1 
ATOM   5432  C  CD1   . ILE A 1 743  ? -36.329 -13.894 -19.844 1.00 75.71  ? 743  ILE A CD1   1 
ATOM   5433  N  N     . HIS A 1 744  ? -34.615 -18.317 -18.533 1.00 75.90  ? 744  HIS A N     1 
ATOM   5434  C  CA    . HIS A 1 744  ? -34.587 -19.386 -19.521 1.00 75.32  ? 744  HIS A CA    1 
ATOM   5435  C  C     . HIS A 1 744  ? -35.334 -18.941 -20.765 1.00 73.87  ? 744  HIS A C     1 
ATOM   5436  O  O     . HIS A 1 744  ? -36.336 -18.236 -20.670 1.00 74.36  ? 744  HIS A O     1 
ATOM   5437  C  CB    . HIS A 1 744  ? -35.232 -20.648 -18.970 1.00 75.87  ? 744  HIS A CB    1 
ATOM   5438  C  CG    . HIS A 1 744  ? -34.463 -21.261 -17.851 1.00 78.64  ? 744  HIS A CG    1 
ATOM   5439  N  ND1   . HIS A 1 744  ? -34.645 -20.890 -16.535 1.00 80.74  ? 744  HIS A ND1   1 
ATOM   5440  C  CD2   . HIS A 1 744  ? -33.491 -22.203 -17.849 1.00 79.41  ? 744  HIS A CD2   1 
ATOM   5441  C  CE1   . HIS A 1 744  ? -33.824 -21.585 -15.769 1.00 82.12  ? 744  HIS A CE1   1 
ATOM   5442  N  NE2   . HIS A 1 744  ? -33.113 -22.388 -16.541 1.00 81.69  ? 744  HIS A NE2   1 
ATOM   5443  N  N     . MET A 1 745  ? -34.843 -19.357 -21.928 1.00 72.46  ? 745  MET A N     1 
ATOM   5444  C  CA    . MET A 1 745  ? -35.493 -19.051 -23.192 1.00 70.72  ? 745  MET A CA    1 
ATOM   5445  C  C     . MET A 1 745  ? -35.589 -20.308 -24.043 1.00 68.75  ? 745  MET A C     1 
ATOM   5446  O  O     . MET A 1 745  ? -34.599 -21.010 -24.232 1.00 68.94  ? 745  MET A O     1 
ATOM   5447  C  CB    . MET A 1 745  ? -34.713 -17.979 -23.930 1.00 70.93  ? 745  MET A CB    1 
ATOM   5448  C  CG    . MET A 1 745  ? -35.324 -17.621 -25.263 1.00 70.15  ? 745  MET A CG    1 
ATOM   5449  S  SD    . MET A 1 745  ? -34.448 -16.260 -26.017 1.00 71.43  ? 745  MET A SD    1 
ATOM   5450  C  CE    . MET A 1 745  ? -35.271 -16.204 -27.613 1.00 68.46  ? 745  MET A CE    1 
ATOM   5451  N  N     . GLY A 1 746  ? -36.782 -20.566 -24.569 1.00 66.78  ? 746  GLY A N     1 
ATOM   5452  C  CA    . GLY A 1 746  ? -37.038 -21.752 -25.367 1.00 64.89  ? 746  GLY A CA    1 
ATOM   5453  C  C     . GLY A 1 746  ? -36.523 -21.666 -26.789 1.00 62.95  ? 746  GLY A C     1 
ATOM   5454  O  O     . GLY A 1 746  ? -36.166 -20.593 -27.286 1.00 63.45  ? 746  GLY A O     1 
ATOM   5455  N  N     . GLY A 1 747  ? -36.500 -22.820 -27.443 1.00 61.37  ? 747  GLY A N     1 
ATOM   5456  C  CA    . GLY A 1 747  ? -36.038 -22.935 -28.809 1.00 60.25  ? 747  GLY A CA    1 
ATOM   5457  C  C     . GLY A 1 747  ? -37.096 -22.469 -29.777 1.00 59.71  ? 747  GLY A C     1 
ATOM   5458  O  O     . GLY A 1 747  ? -37.982 -21.703 -29.413 1.00 60.84  ? 747  GLY A O     1 
ATOM   5459  N  N     . GLN A 1 748  ? -36.993 -22.925 -31.019 1.00 58.91  ? 748  GLN A N     1 
ATOM   5460  C  CA    . GLN A 1 748  ? -37.911 -22.520 -32.073 1.00 57.61  ? 748  GLN A CA    1 
ATOM   5461  C  C     . GLN A 1 748  ? -37.721 -23.426 -33.284 1.00 58.49  ? 748  GLN A C     1 
ATOM   5462  O  O     . GLN A 1 748  ? -36.596 -23.605 -33.738 1.00 58.66  ? 748  GLN A O     1 
ATOM   5463  C  CB    . GLN A 1 748  ? -37.650 -21.068 -32.481 1.00 55.71  ? 748  GLN A CB    1 
ATOM   5464  C  CG    . GLN A 1 748  ? -38.800 -20.451 -33.263 1.00 54.74  ? 748  GLN A CG    1 
ATOM   5465  C  CD    . GLN A 1 748  ? -38.538 -19.027 -33.701 1.00 53.65  ? 748  GLN A CD    1 
ATOM   5466  O  OE1   . GLN A 1 748  ? -37.408 -18.579 -33.732 1.00 55.10  ? 748  GLN A OE1   1 
ATOM   5467  N  NE2   . GLN A 1 748  ? -39.587 -18.314 -34.053 1.00 53.60  ? 748  GLN A NE2   1 
ATOM   5468  N  N     . GLU A 1 749  ? -38.802 -24.010 -33.795 1.00 60.20  ? 749  GLU A N     1 
ATOM   5469  C  CA    . GLU A 1 749  ? -38.741 -24.751 -35.058 1.00 60.96  ? 749  GLU A CA    1 
ATOM   5470  C  C     . GLU A 1 749  ? -38.743 -23.765 -36.229 1.00 58.40  ? 749  GLU A C     1 
ATOM   5471  O  O     . GLU A 1 749  ? -39.450 -22.767 -36.211 1.00 58.40  ? 749  GLU A O     1 
ATOM   5472  C  CB    . GLU A 1 749  ? -39.884 -25.775 -35.192 1.00 63.87  ? 749  GLU A CB    1 
ATOM   5473  C  CG    . GLU A 1 749  ? -39.654 -27.087 -34.436 1.00 68.47  ? 749  GLU A CG    1 
ATOM   5474  C  CD    . GLU A 1 749  ? -38.502 -27.967 -34.972 1.00 72.66  ? 749  GLU A CD    1 
ATOM   5475  O  OE1   . GLU A 1 749  ? -38.039 -27.808 -36.138 1.00 74.41  ? 749  GLU A OE1   1 
ATOM   5476  O  OE2   . GLU A 1 749  ? -38.052 -28.852 -34.206 1.00 76.39  ? 749  GLU A OE2   1 
ATOM   5477  N  N     . HIS A 1 750  ? -37.923 -24.058 -37.233 1.00 56.60  ? 750  HIS A N     1 
ATOM   5478  C  CA    . HIS A 1 750  ? -37.807 -23.239 -38.432 1.00 54.53  ? 750  HIS A CA    1 
ATOM   5479  C  C     . HIS A 1 750  ? -39.151 -23.052 -39.085 1.00 53.96  ? 750  HIS A C     1 
ATOM   5480  O  O     . HIS A 1 750  ? -39.528 -21.940 -39.437 1.00 53.75  ? 750  HIS A O     1 
ATOM   5481  C  CB    . HIS A 1 750  ? -36.852 -23.890 -39.422 1.00 53.99  ? 750  HIS A CB    1 
ATOM   5482  C  CG    . HIS A 1 750  ? -35.451 -23.981 -38.922 1.00 54.49  ? 750  HIS A CG    1 
ATOM   5483  N  ND1   . HIS A 1 750  ? -34.605 -22.895 -38.889 1.00 54.91  ? 750  HIS A ND1   1 
ATOM   5484  C  CD2   . HIS A 1 750  ? -34.751 -25.022 -38.414 1.00 55.56  ? 750  HIS A CD2   1 
ATOM   5485  C  CE1   . HIS A 1 750  ? -33.443 -23.260 -38.383 1.00 55.90  ? 750  HIS A CE1   1 
ATOM   5486  N  NE2   . HIS A 1 750  ? -33.505 -24.545 -38.083 1.00 56.72  ? 750  HIS A NE2   1 
ATOM   5487  N  N     . PHE A 1 751  ? -39.861 -24.162 -39.247 1.00 54.30  ? 751  PHE A N     1 
ATOM   5488  C  CA    . PHE A 1 751  ? -41.171 -24.190 -39.887 1.00 54.92  ? 751  PHE A CA    1 
ATOM   5489  C  C     . PHE A 1 751  ? -41.232 -23.432 -41.223 1.00 53.75  ? 751  PHE A C     1 
ATOM   5490  O  O     . PHE A 1 751  ? -42.162 -22.677 -41.497 1.00 54.70  ? 751  PHE A O     1 
ATOM   5491  C  CB    . PHE A 1 751  ? -42.268 -23.729 -38.913 1.00 55.84  ? 751  PHE A CB    1 
ATOM   5492  C  CG    . PHE A 1 751  ? -43.493 -24.591 -38.957 1.00 56.34  ? 751  PHE A CG    1 
ATOM   5493  C  CD1   . PHE A 1 751  ? -44.317 -24.590 -40.074 1.00 56.42  ? 751  PHE A CD1   1 
ATOM   5494  C  CD2   . PHE A 1 751  ? -43.797 -25.441 -37.900 1.00 57.56  ? 751  PHE A CD2   1 
ATOM   5495  C  CE1   . PHE A 1 751  ? -45.438 -25.404 -40.132 1.00 57.68  ? 751  PHE A CE1   1 
ATOM   5496  C  CE2   . PHE A 1 751  ? -44.919 -26.252 -37.945 1.00 58.60  ? 751  PHE A CE2   1 
ATOM   5497  C  CZ    . PHE A 1 751  ? -45.744 -26.233 -39.060 1.00 58.73  ? 751  PHE A CZ    1 
ATOM   5498  N  N     . TYR A 1 752  ? -40.199 -23.627 -42.033 1.00 53.06  ? 752  TYR A N     1 
ATOM   5499  C  CA    . TYR A 1 752  ? -40.274 -23.387 -43.471 1.00 52.12  ? 752  TYR A CA    1 
ATOM   5500  C  C     . TYR A 1 752  ? -41.465 -24.211 -44.028 1.00 52.10  ? 752  TYR A C     1 
ATOM   5501  O  O     . TYR A 1 752  ? -41.712 -25.330 -43.586 1.00 50.32  ? 752  TYR A O     1 
ATOM   5502  C  CB    . TYR A 1 752  ? -38.931 -23.737 -44.161 1.00 50.39  ? 752  TYR A CB    1 
ATOM   5503  C  CG    . TYR A 1 752  ? -38.203 -24.932 -43.570 1.00 50.04  ? 752  TYR A CG    1 
ATOM   5504  C  CD1   . TYR A 1 752  ? -38.780 -26.207 -43.590 1.00 50.54  ? 752  TYR A CD1   1 
ATOM   5505  C  CD2   . TYR A 1 752  ? -36.960 -24.793 -42.966 1.00 49.00  ? 752  TYR A CD2   1 
ATOM   5506  C  CE1   . TYR A 1 752  ? -38.142 -27.302 -43.040 1.00 50.44  ? 752  TYR A CE1   1 
ATOM   5507  C  CE2   . TYR A 1 752  ? -36.311 -25.884 -42.416 1.00 49.42  ? 752  TYR A CE2   1 
ATOM   5508  C  CZ    . TYR A 1 752  ? -36.914 -27.135 -42.456 1.00 50.68  ? 752  TYR A CZ    1 
ATOM   5509  O  OH    . TYR A 1 752  ? -36.315 -28.244 -41.925 1.00 52.58  ? 752  TYR A OH    1 
ATOM   5510  N  N     . MET A 1 753  ? -42.238 -23.631 -44.942 1.00 53.28  ? 753  MET A N     1 
ATOM   5511  C  CA    . MET A 1 753  ? -43.445 -24.307 -45.422 1.00 54.28  ? 753  MET A CA    1 
ATOM   5512  C  C     . MET A 1 753  ? -43.117 -25.493 -46.362 1.00 51.86  ? 753  MET A C     1 
ATOM   5513  O  O     . MET A 1 753  ? -43.847 -26.486 -46.379 1.00 50.68  ? 753  MET A O     1 
ATOM   5514  C  CB    . MET A 1 753  ? -44.430 -23.308 -46.072 1.00 56.61  ? 753  MET A CB    1 
ATOM   5515  C  CG    . MET A 1 753  ? -45.247 -22.449 -45.103 1.00 58.97  ? 753  MET A CG    1 
ATOM   5516  S  SD    . MET A 1 753  ? -46.235 -23.290 -43.827 1.00 61.97  ? 753  MET A SD    1 
ATOM   5517  C  CE    . MET A 1 753  ? -46.924 -24.674 -44.734 1.00 61.79  ? 753  MET A CE    1 
ATOM   5518  N  N     . GLU A 1 754  ? -42.032 -25.382 -47.129 1.00 49.85  ? 754  GLU A N     1 
ATOM   5519  C  CA    . GLU A 1 754  ? -41.488 -26.505 -47.911 1.00 49.04  ? 754  GLU A CA    1 
ATOM   5520  C  C     . GLU A 1 754  ? -40.632 -27.387 -47.008 1.00 47.16  ? 754  GLU A C     1 
ATOM   5521  O  O     . GLU A 1 754  ? -39.595 -26.942 -46.549 1.00 45.72  ? 754  GLU A O     1 
ATOM   5522  C  CB    . GLU A 1 754  ? -40.626 -25.970 -49.063 1.00 49.49  ? 754  GLU A CB    1 
ATOM   5523  C  CG    . GLU A 1 754  ? -39.980 -27.025 -49.965 1.00 49.72  ? 754  GLU A CG    1 
ATOM   5524  C  CD    . GLU A 1 754  ? -38.896 -26.472 -50.886 1.00 49.59  ? 754  GLU A CD    1 
ATOM   5525  O  OE1   . GLU A 1 754  ? -38.265 -25.457 -50.523 1.00 49.27  ? 754  GLU A OE1   1 
ATOM   5526  O  OE2   . GLU A 1 754  ? -38.657 -27.052 -51.974 1.00 49.71  ? 754  GLU A OE2   1 
ATOM   5527  N  N     . THR A 1 755  ? -41.042 -28.631 -46.764 1.00 46.90  ? 755  THR A N     1 
ATOM   5528  C  CA    . THR A 1 755  ? -40.210 -29.549 -45.968 1.00 48.28  ? 755  THR A CA    1 
ATOM   5529  C  C     . THR A 1 755  ? -38.939 -29.911 -46.726 1.00 48.04  ? 755  THR A C     1 
ATOM   5530  O  O     . THR A 1 755  ? -38.795 -29.590 -47.896 1.00 48.12  ? 755  THR A O     1 
ATOM   5531  C  CB    . THR A 1 755  ? -40.935 -30.848 -45.591 1.00 48.81  ? 755  THR A CB    1 
ATOM   5532  O  OG1   . THR A 1 755  ? -41.265 -31.584 -46.771 1.00 47.12  ? 755  THR A OG1   1 
ATOM   5533  C  CG2   . THR A 1 755  ? -42.192 -30.542 -44.795 1.00 50.72  ? 755  THR A CG2   1 
ATOM   5534  N  N     . GLN A 1 756  ? -38.019 -30.575 -46.046 1.00 48.66  ? 756  GLN A N     1 
ATOM   5535  C  CA    . GLN A 1 756  ? -36.750 -30.984 -46.650 1.00 49.00  ? 756  GLN A CA    1 
ATOM   5536  C  C     . GLN A 1 756  ? -37.056 -31.824 -47.890 1.00 48.80  ? 756  GLN A C     1 
ATOM   5537  O  O     . GLN A 1 756  ? -37.885 -32.725 -47.838 1.00 47.88  ? 756  GLN A O     1 
ATOM   5538  C  CB    . GLN A 1 756  ? -35.920 -31.801 -45.659 1.00 49.48  ? 756  GLN A CB    1 
ATOM   5539  C  CG    . GLN A 1 756  ? -35.453 -31.042 -44.418 1.00 50.70  ? 756  GLN A CG    1 
ATOM   5540  C  CD    . GLN A 1 756  ? -34.265 -30.126 -44.657 1.00 51.12  ? 756  GLN A CD    1 
ATOM   5541  O  OE1   . GLN A 1 756  ? -33.565 -30.221 -45.673 1.00 53.47  ? 756  GLN A OE1   1 
ATOM   5542  N  NE2   . GLN A 1 756  ? -34.026 -29.237 -43.710 1.00 50.69  ? 756  GLN A NE2   1 
ATOM   5543  N  N     . SER A 1 757  ? -36.414 -31.487 -49.005 1.00 49.72  ? 757  SER A N     1 
ATOM   5544  C  CA    . SER A 1 757  ? -36.712 -32.077 -50.312 1.00 49.84  ? 757  SER A CA    1 
ATOM   5545  C  C     . SER A 1 757  ? -35.443 -32.132 -51.163 1.00 50.07  ? 757  SER A C     1 
ATOM   5546  O  O     . SER A 1 757  ? -34.697 -31.155 -51.232 1.00 49.04  ? 757  SER A O     1 
ATOM   5547  C  CB    . SER A 1 757  ? -37.779 -31.245 -51.055 1.00 49.64  ? 757  SER A CB    1 
ATOM   5548  O  OG    . SER A 1 757  ? -38.929 -30.981 -50.255 1.00 49.59  ? 757  SER A OG    1 
ATOM   5549  N  N     . MET A 1 758  ? -35.200 -33.276 -51.803 1.00 51.80  ? 758  MET A N     1 
ATOM   5550  C  CA    . MET A 1 758  ? -34.150 -33.382 -52.807 1.00 51.42  ? 758  MET A CA    1 
ATOM   5551  C  C     . MET A 1 758  ? -34.383 -34.513 -53.789 1.00 51.08  ? 758  MET A C     1 
ATOM   5552  O  O     . MET A 1 758  ? -35.121 -35.472 -53.517 1.00 50.25  ? 758  MET A O     1 
ATOM   5553  C  CB    . MET A 1 758  ? -32.782 -33.541 -52.161 1.00 54.27  ? 758  MET A CB    1 
ATOM   5554  C  CG    . MET A 1 758  ? -32.604 -34.810 -51.357 1.00 57.31  ? 758  MET A CG    1 
ATOM   5555  S  SD    . MET A 1 758  ? -31.403 -34.578 -50.035 1.00 62.14  ? 758  MET A SD    1 
ATOM   5556  C  CE    . MET A 1 758  ? -32.388 -33.694 -48.824 1.00 63.80  ? 758  MET A CE    1 
ATOM   5557  N  N     . LEU A 1 759  ? -33.744 -34.360 -54.943 1.00 49.90  ? 759  LEU A N     1 
ATOM   5558  C  CA    . LEU A 1 759  ? -33.685 -35.374 -55.973 1.00 49.26  ? 759  LEU A CA    1 
ATOM   5559  C  C     . LEU A 1 759  ? -32.231 -35.503 -56.400 1.00 48.23  ? 759  LEU A C     1 
ATOM   5560  O  O     . LEU A 1 759  ? -31.586 -34.517 -56.768 1.00 47.93  ? 759  LEU A O     1 
ATOM   5561  C  CB    . LEU A 1 759  ? -34.533 -34.943 -57.150 1.00 49.52  ? 759  LEU A CB    1 
ATOM   5562  C  CG    . LEU A 1 759  ? -34.690 -35.892 -58.328 1.00 50.19  ? 759  LEU A CG    1 
ATOM   5563  C  CD1   . LEU A 1 759  ? -35.362 -37.175 -57.882 1.00 51.65  ? 759  LEU A CD1   1 
ATOM   5564  C  CD2   . LEU A 1 759  ? -35.523 -35.206 -59.393 1.00 50.01  ? 759  LEU A CD2   1 
ATOM   5565  N  N     . VAL A 1 760  ? -31.716 -36.720 -56.325 1.00 47.89  ? 760  VAL A N     1 
ATOM   5566  C  CA    . VAL A 1 760  ? -30.359 -37.017 -56.740 1.00 48.39  ? 760  VAL A CA    1 
ATOM   5567  C  C     . VAL A 1 760  ? -30.458 -37.865 -57.997 1.00 47.74  ? 760  VAL A C     1 
ATOM   5568  O  O     . VAL A 1 760  ? -31.136 -38.886 -57.997 1.00 46.99  ? 760  VAL A O     1 
ATOM   5569  C  CB    . VAL A 1 760  ? -29.601 -37.731 -55.613 1.00 49.28  ? 760  VAL A CB    1 
ATOM   5570  C  CG1   . VAL A 1 760  ? -28.247 -38.183 -56.081 1.00 49.79  ? 760  VAL A CG1   1 
ATOM   5571  C  CG2   . VAL A 1 760  ? -29.439 -36.794 -54.432 1.00 50.62  ? 760  VAL A CG2   1 
ATOM   5572  N  N     . VAL A 1 761  ? -29.801 -37.416 -59.066 1.00 48.24  ? 761  VAL A N     1 
ATOM   5573  C  CA    . VAL A 1 761  ? -29.877 -38.063 -60.379 1.00 48.87  ? 761  VAL A CA    1 
ATOM   5574  C  C     . VAL A 1 761  ? -28.469 -38.406 -60.892 1.00 49.19  ? 761  VAL A C     1 
ATOM   5575  O  O     . VAL A 1 761  ? -27.712 -37.498 -61.235 1.00 48.92  ? 761  VAL A O     1 
ATOM   5576  C  CB    . VAL A 1 761  ? -30.598 -37.154 -61.405 1.00 48.09  ? 761  VAL A CB    1 
ATOM   5577  C  CG1   . VAL A 1 761  ? -30.731 -37.864 -62.744 1.00 47.86  ? 761  VAL A CG1   1 
ATOM   5578  C  CG2   . VAL A 1 761  ? -31.959 -36.733 -60.878 1.00 47.27  ? 761  VAL A CG2   1 
ATOM   5579  N  N     . PRO A 1 762  ? -28.104 -39.710 -60.924 1.00 50.38  ? 762  PRO A N     1 
ATOM   5580  C  CA    . PRO A 1 762  ? -26.834 -40.101 -61.570 1.00 51.06  ? 762  PRO A CA    1 
ATOM   5581  C  C     . PRO A 1 762  ? -26.946 -40.019 -63.078 1.00 52.23  ? 762  PRO A C     1 
ATOM   5582  O  O     . PRO A 1 762  ? -27.951 -40.458 -63.632 1.00 53.51  ? 762  PRO A O     1 
ATOM   5583  C  CB    . PRO A 1 762  ? -26.626 -41.558 -61.136 1.00 50.78  ? 762  PRO A CB    1 
ATOM   5584  C  CG    . PRO A 1 762  ? -27.944 -42.035 -60.663 1.00 50.71  ? 762  PRO A CG    1 
ATOM   5585  C  CD    . PRO A 1 762  ? -28.745 -40.842 -60.231 1.00 49.79  ? 762  PRO A CD    1 
ATOM   5586  N  N     . LYS A 1 763  ? -25.926 -39.460 -63.727 1.00 54.10  ? 763  LYS A N     1 
ATOM   5587  C  CA    . LYS A 1 763  ? -25.916 -39.288 -65.181 1.00 56.00  ? 763  LYS A CA    1 
ATOM   5588  C  C     . LYS A 1 763  ? -25.698 -40.602 -65.918 1.00 55.95  ? 763  LYS A C     1 
ATOM   5589  O  O     . LYS A 1 763  ? -26.241 -40.797 -66.999 1.00 56.75  ? 763  LYS A O     1 
ATOM   5590  C  CB    . LYS A 1 763  ? -24.830 -38.295 -65.601 1.00 58.30  ? 763  LYS A CB    1 
ATOM   5591  C  CG    . LYS A 1 763  ? -25.008 -37.738 -67.007 1.00 61.28  ? 763  LYS A CG    1 
ATOM   5592  C  CD    . LYS A 1 763  ? -26.032 -36.613 -67.039 1.00 64.32  ? 763  LYS A CD    1 
ATOM   5593  C  CE    . LYS A 1 763  ? -26.540 -36.327 -68.448 1.00 68.01  ? 763  LYS A CE    1 
ATOM   5594  N  NZ    . LYS A 1 763  ? -27.429 -37.399 -69.005 1.00 70.30  ? 763  LYS A NZ    1 
ATOM   5595  N  N     . GLY A 1 764  ? -24.883 -41.480 -65.341 1.00 56.36  ? 764  GLY A N     1 
ATOM   5596  C  CA    . GLY A 1 764  ? -24.516 -42.757 -65.959 1.00 57.53  ? 764  GLY A CA    1 
ATOM   5597  C  C     . GLY A 1 764  ? -23.185 -42.752 -66.684 1.00 57.34  ? 764  GLY A C     1 
ATOM   5598  O  O     . GLY A 1 764  ? -22.872 -43.702 -67.379 1.00 59.39  ? 764  GLY A O     1 
ATOM   5599  N  N     . GLU A 1 765  ? -22.418 -41.679 -66.528 1.00 58.47  ? 765  GLU A N     1 
ATOM   5600  C  CA    . GLU A 1 765  ? -21.087 -41.537 -67.104 1.00 59.82  ? 765  GLU A CA    1 
ATOM   5601  C  C     . GLU A 1 765  ? -20.167 -40.972 -66.038 1.00 60.30  ? 765  GLU A C     1 
ATOM   5602  O  O     . GLU A 1 765  ? -20.547 -40.000 -65.369 1.00 60.50  ? 765  GLU A O     1 
ATOM   5603  C  CB    . GLU A 1 765  ? -21.099 -40.527 -68.249 1.00 60.92  ? 765  GLU A CB    1 
ATOM   5604  C  CG    . GLU A 1 765  ? -21.917 -40.916 -69.469 1.00 62.48  ? 765  GLU A CG    1 
ATOM   5605  C  CD    . GLU A 1 765  ? -21.653 -40.021 -70.686 1.00 63.51  ? 765  GLU A CD    1 
ATOM   5606  O  OE1   . GLU A 1 765  ? -20.793 -39.114 -70.609 1.00 63.94  ? 765  GLU A OE1   1 
ATOM   5607  O  OE2   . GLU A 1 765  ? -22.306 -40.228 -71.737 1.00 63.78  ? 765  GLU A OE2   1 
ATOM   5608  N  N     . ASP A 1 766  ? -18.976 -41.562 -65.886 1.00 59.07  ? 766  ASP A N     1 
ATOM   5609  C  CA    . ASP A 1 766  ? -17.912 -41.037 -65.011 1.00 59.71  ? 766  ASP A CA    1 
ATOM   5610  C  C     . ASP A 1 766  ? -18.330 -40.796 -63.552 1.00 58.14  ? 766  ASP A C     1 
ATOM   5611  O  O     . ASP A 1 766  ? -17.750 -39.958 -62.864 1.00 57.13  ? 766  ASP A O     1 
ATOM   5612  C  CB    . ASP A 1 766  ? -17.355 -39.727 -65.578 1.00 61.69  ? 766  ASP A CB    1 
ATOM   5613  C  CG    . ASP A 1 766  ? -16.910 -39.850 -67.012 1.00 64.12  ? 766  ASP A CG    1 
ATOM   5614  O  OD1   . ASP A 1 766  ? -16.078 -40.737 -67.291 1.00 65.43  ? 766  ASP A OD1   1 
ATOM   5615  O  OD2   . ASP A 1 766  ? -17.376 -39.042 -67.855 1.00 66.49  ? 766  ASP A OD2   1 
ATOM   5616  N  N     . GLN A 1 767  ? -19.326 -41.538 -63.087 1.00 58.11  ? 767  GLN A N     1 
ATOM   5617  C  CA    . GLN A 1 767  ? -19.965 -41.304 -61.789 1.00 58.34  ? 767  GLN A CA    1 
ATOM   5618  C  C     . GLN A 1 767  ? -20.442 -39.859 -61.558 1.00 55.81  ? 767  GLN A C     1 
ATOM   5619  O  O     . GLN A 1 767  ? -20.395 -39.360 -60.439 1.00 55.97  ? 767  GLN A O     1 
ATOM   5620  C  CB    . GLN A 1 767  ? -19.040 -41.781 -60.660 1.00 60.23  ? 767  GLN A CB    1 
ATOM   5621  C  CG    . GLN A 1 767  ? -18.761 -43.273 -60.700 1.00 62.05  ? 767  GLN A CG    1 
ATOM   5622  C  CD    . GLN A 1 767  ? -17.512 -43.643 -59.926 1.00 64.56  ? 767  GLN A CD    1 
ATOM   5623  O  OE1   . GLN A 1 767  ? -16.388 -43.328 -60.338 1.00 64.91  ? 767  GLN A OE1   1 
ATOM   5624  N  NE2   . GLN A 1 767  ? -17.699 -44.312 -58.796 1.00 65.26  ? 767  GLN A NE2   1 
ATOM   5625  N  N     . GLU A 1 768  ? -20.909 -39.198 -62.614 1.00 54.61  ? 768  GLU A N     1 
ATOM   5626  C  CA    . GLU A 1 768  ? -21.464 -37.857 -62.486 1.00 54.59  ? 768  GLU A CA    1 
ATOM   5627  C  C     . GLU A 1 768  ? -22.811 -37.897 -61.769 1.00 53.87  ? 768  GLU A C     1 
ATOM   5628  O  O     . GLU A 1 768  ? -23.686 -38.660 -62.149 1.00 51.07  ? 768  GLU A O     1 
ATOM   5629  C  CB    . GLU A 1 768  ? -21.680 -37.208 -63.843 1.00 55.44  ? 768  GLU A CB    1 
ATOM   5630  C  CG    . GLU A 1 768  ? -20.417 -36.740 -64.540 1.00 57.92  ? 768  GLU A CG    1 
ATOM   5631  C  CD    . GLU A 1 768  ? -20.719 -36.091 -65.889 1.00 59.87  ? 768  GLU A CD    1 
ATOM   5632  O  OE1   . GLU A 1 768  ? -21.800 -35.464 -66.043 1.00 59.37  ? 768  GLU A OE1   1 
ATOM   5633  O  OE2   . GLU A 1 768  ? -19.873 -36.216 -66.805 1.00 60.62  ? 768  GLU A OE2   1 
ATOM   5634  N  N     . MET A 1 769  ? -22.950 -37.076 -60.732 1.00 55.62  ? 769  MET A N     1 
ATOM   5635  C  CA    . MET A 1 769  ? -24.217 -36.861 -60.051 1.00 58.11  ? 769  MET A CA    1 
ATOM   5636  C  C     . MET A 1 769  ? -24.677 -35.433 -60.279 1.00 54.54  ? 769  MET A C     1 
ATOM   5637  O  O     . MET A 1 769  ? -23.875 -34.501 -60.265 1.00 53.05  ? 769  MET A O     1 
ATOM   5638  C  CB    . MET A 1 769  ? -24.066 -37.065 -58.549 1.00 63.60  ? 769  MET A CB    1 
ATOM   5639  C  CG    . MET A 1 769  ? -23.511 -38.414 -58.135 1.00 69.02  ? 769  MET A CG    1 
ATOM   5640  S  SD    . MET A 1 769  ? -24.528 -39.831 -58.610 1.00 77.32  ? 769  MET A SD    1 
ATOM   5641  C  CE    . MET A 1 769  ? -26.052 -39.421 -57.796 1.00 73.17  ? 769  MET A CE    1 
ATOM   5642  N  N     . ASP A 1 770  ? -25.976 -35.281 -60.493 1.00 52.92  ? 770  ASP A N     1 
ATOM   5643  C  CA    . ASP A 1 770  ? -26.649 -33.993 -60.379 1.00 51.05  ? 770  ASP A CA    1 
ATOM   5644  C  C     . ASP A 1 770  ? -27.539 -34.055 -59.154 1.00 49.79  ? 770  ASP A C     1 
ATOM   5645  O  O     . ASP A 1 770  ? -28.278 -35.026 -58.958 1.00 49.00  ? 770  ASP A O     1 
ATOM   5646  C  CB    . ASP A 1 770  ? -27.457 -33.684 -61.636 1.00 50.83  ? 770  ASP A CB    1 
ATOM   5647  C  CG    . ASP A 1 770  ? -26.579 -33.255 -62.793 1.00 50.65  ? 770  ASP A CG    1 
ATOM   5648  O  OD1   . ASP A 1 770  ? -25.797 -32.296 -62.623 1.00 50.91  ? 770  ASP A OD1   1 
ATOM   5649  O  OD2   . ASP A 1 770  ? -26.657 -33.877 -63.868 1.00 51.11  ? 770  ASP A OD2   1 
ATOM   5650  N  N     . VAL A 1 771  ? -27.435 -33.029 -58.317 1.00 49.34  ? 771  VAL A N     1 
ATOM   5651  C  CA    . VAL A 1 771  ? -28.176 -32.965 -57.061 1.00 49.28  ? 771  VAL A CA    1 
ATOM   5652  C  C     . VAL A 1 771  ? -29.089 -31.733 -57.070 1.00 47.50  ? 771  VAL A C     1 
ATOM   5653  O  O     . VAL A 1 771  ? -28.609 -30.603 -57.070 1.00 46.38  ? 771  VAL A O     1 
ATOM   5654  C  CB    . VAL A 1 771  ? -27.211 -32.947 -55.860 1.00 49.90  ? 771  VAL A CB    1 
ATOM   5655  C  CG1   . VAL A 1 771  ? -27.977 -33.004 -54.550 1.00 51.14  ? 771  VAL A CG1   1 
ATOM   5656  C  CG2   . VAL A 1 771  ? -26.252 -34.125 -55.941 1.00 50.42  ? 771  VAL A CG2   1 
ATOM   5657  N  N     . TYR A 1 772  ? -30.400 -31.975 -57.122 1.00 46.18  ? 772  TYR A N     1 
ATOM   5658  C  CA    . TYR A 1 772  ? -31.415 -30.919 -57.024 1.00 46.39  ? 772  TYR A CA    1 
ATOM   5659  C  C     . TYR A 1 772  ? -31.928 -30.960 -55.605 1.00 46.35  ? 772  TYR A C     1 
ATOM   5660  O  O     . TYR A 1 772  ? -32.537 -31.949 -55.199 1.00 47.08  ? 772  TYR A O     1 
ATOM   5661  C  CB    . TYR A 1 772  ? -32.565 -31.140 -58.034 1.00 45.74  ? 772  TYR A CB    1 
ATOM   5662  C  CG    . TYR A 1 772  ? -32.038 -31.319 -59.420 1.00 44.85  ? 772  TYR A CG    1 
ATOM   5663  C  CD1   . TYR A 1 772  ? -31.678 -30.215 -60.198 1.00 43.80  ? 772  TYR A CD1   1 
ATOM   5664  C  CD2   . TYR A 1 772  ? -31.793 -32.604 -59.924 1.00 44.53  ? 772  TYR A CD2   1 
ATOM   5665  C  CE1   . TYR A 1 772  ? -31.129 -30.391 -61.462 1.00 43.89  ? 772  TYR A CE1   1 
ATOM   5666  C  CE2   . TYR A 1 772  ? -31.244 -32.792 -61.175 1.00 43.64  ? 772  TYR A CE2   1 
ATOM   5667  C  CZ    . TYR A 1 772  ? -30.908 -31.695 -61.938 1.00 43.82  ? 772  TYR A CZ    1 
ATOM   5668  O  OH    . TYR A 1 772  ? -30.361 -31.913 -63.172 1.00 43.99  ? 772  TYR A OH    1 
ATOM   5669  N  N     . VAL A 1 773  ? -31.664 -29.906 -54.843 1.00 46.18  ? 773  VAL A N     1 
ATOM   5670  C  CA    . VAL A 1 773  ? -31.979 -29.913 -53.419 1.00 46.17  ? 773  VAL A CA    1 
ATOM   5671  C  C     . VAL A 1 773  ? -32.376 -28.530 -52.930 1.00 46.33  ? 773  VAL A C     1 
ATOM   5672  O  O     . VAL A 1 773  ? -31.815 -27.528 -53.361 1.00 46.18  ? 773  VAL A O     1 
ATOM   5673  C  CB    . VAL A 1 773  ? -30.806 -30.491 -52.594 1.00 46.24  ? 773  VAL A CB    1 
ATOM   5674  C  CG1   . VAL A 1 773  ? -29.495 -29.811 -52.936 1.00 46.36  ? 773  VAL A CG1   1 
ATOM   5675  C  CG2   . VAL A 1 773  ? -31.085 -30.395 -51.100 1.00 47.30  ? 773  VAL A CG2   1 
ATOM   5676  N  N     . SER A 1 774  ? -33.366 -28.498 -52.041 1.00 46.66  ? 774  SER A N     1 
ATOM   5677  C  CA    . SER A 1 774  ? -33.761 -27.281 -51.344 1.00 46.72  ? 774  SER A CA    1 
ATOM   5678  C  C     . SER A 1 774  ? -32.751 -27.040 -50.215 1.00 46.86  ? 774  SER A C     1 
ATOM   5679  O  O     . SER A 1 774  ? -32.861 -27.645 -49.145 1.00 47.27  ? 774  SER A O     1 
ATOM   5680  C  CB    . SER A 1 774  ? -35.192 -27.432 -50.806 1.00 46.90  ? 774  SER A CB    1 
ATOM   5681  O  OG    . SER A 1 774  ? -35.615 -26.263 -50.142 1.00 47.24  ? 774  SER A OG    1 
ATOM   5682  N  N     . THR A 1 775  ? -31.759 -26.186 -50.489 1.00 46.92  ? 775  THR A N     1 
ATOM   5683  C  CA    . THR A 1 775  ? -30.650 -25.873 -49.560 1.00 48.13  ? 775  THR A CA    1 
ATOM   5684  C  C     . THR A 1 775  ? -30.205 -24.409 -49.658 1.00 48.43  ? 775  THR A C     1 
ATOM   5685  O  O     . THR A 1 775  ? -30.454 -23.734 -50.652 1.00 47.72  ? 775  THR A O     1 
ATOM   5686  C  CB    . THR A 1 775  ? -29.386 -26.738 -49.821 1.00 49.08  ? 775  THR A CB    1 
ATOM   5687  O  OG1   . THR A 1 775  ? -28.353 -26.430 -48.859 1.00 49.00  ? 775  THR A OG1   1 
ATOM   5688  C  CG2   . THR A 1 775  ? -28.823 -26.490 -51.231 1.00 49.25  ? 775  THR A CG2   1 
ATOM   5689  N  N     . GLN A 1 776  ? -29.508 -23.960 -48.620 1.00 49.74  ? 776  GLN A N     1 
ATOM   5690  C  CA    . GLN A 1 776  ? -28.882 -22.645 -48.580 1.00 51.10  ? 776  GLN A CA    1 
ATOM   5691  C  C     . GLN A 1 776  ? -27.398 -22.662 -48.927 1.00 50.87  ? 776  GLN A C     1 
ATOM   5692  O  O     . GLN A 1 776  ? -26.772 -21.606 -48.921 1.00 50.71  ? 776  GLN A O     1 
ATOM   5693  C  CB    . GLN A 1 776  ? -29.001 -22.070 -47.178 1.00 52.78  ? 776  GLN A CB    1 
ATOM   5694  C  CG    . GLN A 1 776  ? -30.415 -21.918 -46.694 1.00 53.77  ? 776  GLN A CG    1 
ATOM   5695  C  CD    . GLN A 1 776  ? -30.449 -21.543 -45.243 1.00 56.01  ? 776  GLN A CD    1 
ATOM   5696  O  OE1   . GLN A 1 776  ? -30.892 -22.329 -44.412 1.00 59.09  ? 776  GLN A OE1   1 
ATOM   5697  N  NE2   . GLN A 1 776  ? -29.960 -20.346 -44.921 1.00 56.69  ? 776  GLN A NE2   1 
ATOM   5698  N  N     . PHE A 1 777  ? -26.831 -23.836 -49.206 1.00 50.29  ? 777  PHE A N     1 
ATOM   5699  C  CA    . PHE A 1 777  ? -25.384 -23.968 -49.330 1.00 50.97  ? 777  PHE A CA    1 
ATOM   5700  C  C     . PHE A 1 777  ? -24.977 -25.070 -50.330 1.00 51.88  ? 777  PHE A C     1 
ATOM   5701  O  O     . PHE A 1 777  ? -24.520 -26.142 -49.921 1.00 52.89  ? 777  PHE A O     1 
ATOM   5702  C  CB    . PHE A 1 777  ? -24.824 -24.239 -47.923 1.00 50.90  ? 777  PHE A CB    1 
ATOM   5703  C  CG    . PHE A 1 777  ? -23.361 -23.904 -47.732 1.00 51.18  ? 777  PHE A CG    1 
ATOM   5704  C  CD1   . PHE A 1 777  ? -22.580 -23.287 -48.719 1.00 50.60  ? 777  PHE A CD1   1 
ATOM   5705  C  CD2   . PHE A 1 777  ? -22.764 -24.188 -46.497 1.00 51.12  ? 777  PHE A CD2   1 
ATOM   5706  C  CE1   . PHE A 1 777  ? -21.244 -23.002 -48.475 1.00 51.22  ? 777  PHE A CE1   1 
ATOM   5707  C  CE2   . PHE A 1 777  ? -21.436 -23.896 -46.258 1.00 50.79  ? 777  PHE A CE2   1 
ATOM   5708  C  CZ    . PHE A 1 777  ? -20.675 -23.307 -47.247 1.00 51.05  ? 777  PHE A CZ    1 
ATOM   5709  N  N     . PRO A 1 778  ? -25.140 -24.810 -51.649 1.00 51.35  ? 778  PRO A N     1 
ATOM   5710  C  CA    . PRO A 1 778  ? -24.814 -25.822 -52.662 1.00 51.19  ? 778  PRO A CA    1 
ATOM   5711  C  C     . PRO A 1 778  ? -23.382 -26.349 -52.589 1.00 52.86  ? 778  PRO A C     1 
ATOM   5712  O  O     . PRO A 1 778  ? -23.182 -27.557 -52.660 1.00 55.07  ? 778  PRO A O     1 
ATOM   5713  C  CB    . PRO A 1 778  ? -25.053 -25.095 -53.986 1.00 50.57  ? 778  PRO A CB    1 
ATOM   5714  C  CG    . PRO A 1 778  ? -26.077 -24.080 -53.660 1.00 50.66  ? 778  PRO A CG    1 
ATOM   5715  C  CD    . PRO A 1 778  ? -25.755 -23.619 -52.265 1.00 51.08  ? 778  PRO A CD    1 
ATOM   5716  N  N     . LYS A 1 779  ? -22.406 -25.462 -52.434 1.00 53.68  ? 779  LYS A N     1 
ATOM   5717  C  CA    . LYS A 1 779  ? -21.008 -25.870 -52.329 1.00 54.56  ? 779  LYS A CA    1 
ATOM   5718  C  C     . LYS A 1 779  ? -20.803 -26.909 -51.217 1.00 54.48  ? 779  LYS A C     1 
ATOM   5719  O  O     . LYS A 1 779  ? -20.024 -27.846 -51.384 1.00 53.79  ? 779  LYS A O     1 
ATOM   5720  C  CB    . LYS A 1 779  ? -20.129 -24.646 -52.101 1.00 56.72  ? 779  LYS A CB    1 
ATOM   5721  C  CG    . LYS A 1 779  ? -18.659 -24.917 -51.828 1.00 59.02  ? 779  LYS A CG    1 
ATOM   5722  C  CD    . LYS A 1 779  ? -18.246 -24.172 -50.565 1.00 63.36  ? 779  LYS A CD    1 
ATOM   5723  C  CE    . LYS A 1 779  ? -16.774 -24.341 -50.230 1.00 65.86  ? 779  LYS A CE    1 
ATOM   5724  N  NZ    . LYS A 1 779  ? -16.426 -25.786 -50.082 1.00 66.79  ? 779  LYS A NZ    1 
ATOM   5725  N  N     . TYR A 1 780  ? -21.500 -26.756 -50.096 1.00 53.92  ? 780  TYR A N     1 
ATOM   5726  C  CA    . TYR A 1 780  ? -21.420 -27.754 -49.030 1.00 54.23  ? 780  TYR A CA    1 
ATOM   5727  C  C     . TYR A 1 780  ? -22.078 -29.079 -49.419 1.00 54.15  ? 780  TYR A C     1 
ATOM   5728  O  O     . TYR A 1 780  ? -21.556 -30.139 -49.047 1.00 56.02  ? 780  TYR A O     1 
ATOM   5729  C  CB    . TYR A 1 780  ? -21.996 -27.226 -47.729 1.00 54.42  ? 780  TYR A CB    1 
ATOM   5730  C  CG    . TYR A 1 780  ? -22.368 -28.301 -46.747 1.00 55.37  ? 780  TYR A CG    1 
ATOM   5731  C  CD1   . TYR A 1 780  ? -21.395 -29.042 -46.080 1.00 56.74  ? 780  TYR A CD1   1 
ATOM   5732  C  CD2   . TYR A 1 780  ? -23.704 -28.580 -46.484 1.00 55.62  ? 780  TYR A CD2   1 
ATOM   5733  C  CE1   . TYR A 1 780  ? -21.750 -30.027 -45.174 1.00 57.75  ? 780  TYR A CE1   1 
ATOM   5734  C  CE2   . TYR A 1 780  ? -24.070 -29.557 -45.585 1.00 55.98  ? 780  TYR A CE2   1 
ATOM   5735  C  CZ    . TYR A 1 780  ? -23.101 -30.277 -44.935 1.00 57.50  ? 780  TYR A CZ    1 
ATOM   5736  O  OH    . TYR A 1 780  ? -23.519 -31.238 -44.049 1.00 60.40  ? 780  TYR A OH    1 
ATOM   5737  N  N     . ILE A 1 781  ? -23.194 -29.023 -50.162 1.00 52.59  ? 781  ILE A N     1 
ATOM   5738  C  CA    . ILE A 1 781  ? -23.852 -30.239 -50.695 1.00 51.31  ? 781  ILE A CA    1 
ATOM   5739  C  C     . ILE A 1 781  ? -22.895 -30.983 -51.621 1.00 51.66  ? 781  ILE A C     1 
ATOM   5740  O  O     . ILE A 1 781  ? -22.726 -32.191 -51.503 1.00 51.35  ? 781  ILE A O     1 
ATOM   5741  C  CB    . ILE A 1 781  ? -25.164 -29.949 -51.482 1.00 50.06  ? 781  ILE A CB    1 
ATOM   5742  C  CG1   . ILE A 1 781  ? -26.212 -29.241 -50.610 1.00 49.41  ? 781  ILE A CG1   1 
ATOM   5743  C  CG2   . ILE A 1 781  ? -25.759 -31.239 -52.080 1.00 49.84  ? 781  ILE A CG2   1 
ATOM   5744  C  CD1   . ILE A 1 781  ? -26.724 -30.033 -49.427 1.00 50.04  ? 781  ILE A CD1   1 
ATOM   5745  N  N     . GLN A 1 782  ? -22.286 -30.246 -52.541 1.00 52.36  ? 782  GLN A N     1 
ATOM   5746  C  CA    . GLN A 1 782  ? -21.279 -30.788 -53.453 1.00 54.05  ? 782  GLN A CA    1 
ATOM   5747  C  C     . GLN A 1 782  ? -20.147 -31.491 -52.695 1.00 56.50  ? 782  GLN A C     1 
ATOM   5748  O  O     . GLN A 1 782  ? -19.735 -32.586 -53.083 1.00 58.12  ? 782  GLN A O     1 
ATOM   5749  C  CB    . GLN A 1 782  ? -20.726 -29.661 -54.327 1.00 54.42  ? 782  GLN A CB    1 
ATOM   5750  C  CG    . GLN A 1 782  ? -19.733 -30.055 -55.400 1.00 54.74  ? 782  GLN A CG    1 
ATOM   5751  C  CD    . GLN A 1 782  ? -19.298 -28.861 -56.234 1.00 55.67  ? 782  GLN A CD    1 
ATOM   5752  O  OE1   . GLN A 1 782  ? -19.218 -27.729 -55.738 1.00 57.85  ? 782  GLN A OE1   1 
ATOM   5753  N  NE2   . GLN A 1 782  ? -19.001 -29.104 -57.503 1.00 55.80  ? 782  GLN A NE2   1 
ATOM   5754  N  N     . ASP A 1 783  ? -19.679 -30.887 -51.605 1.00 57.25  ? 783  ASP A N     1 
ATOM   5755  C  CA    . ASP A 1 783  ? -18.591 -31.467 -50.822 1.00 59.82  ? 783  ASP A CA    1 
ATOM   5756  C  C     . ASP A 1 783  ? -18.966 -32.772 -50.137 1.00 58.24  ? 783  ASP A C     1 
ATOM   5757  O  O     . ASP A 1 783  ? -18.234 -33.762 -50.236 1.00 57.48  ? 783  ASP A O     1 
ATOM   5758  C  CB    . ASP A 1 783  ? -18.100 -30.490 -49.755 1.00 63.33  ? 783  ASP A CB    1 
ATOM   5759  C  CG    . ASP A 1 783  ? -17.443 -29.258 -50.347 1.00 67.42  ? 783  ASP A CG    1 
ATOM   5760  O  OD1   . ASP A 1 783  ? -17.212 -29.215 -51.587 1.00 70.91  ? 783  ASP A OD1   1 
ATOM   5761  O  OD2   . ASP A 1 783  ? -17.174 -28.319 -49.560 1.00 70.57  ? 783  ASP A OD2   1 
ATOM   5762  N  N     . ILE A 1 784  ? -20.084 -32.764 -49.423 1.00 56.31  ? 784  ILE A N     1 
ATOM   5763  C  CA    . ILE A 1 784  ? -20.472 -33.938 -48.636 1.00 55.65  ? 784  ILE A CA    1 
ATOM   5764  C  C     . ILE A 1 784  ? -20.905 -35.103 -49.539 1.00 54.63  ? 784  ILE A C     1 
ATOM   5765  O  O     . ILE A 1 784  ? -20.637 -36.256 -49.215 1.00 55.44  ? 784  ILE A O     1 
ATOM   5766  C  CB    . ILE A 1 784  ? -21.510 -33.589 -47.535 1.00 54.95  ? 784  ILE A CB    1 
ATOM   5767  C  CG1   . ILE A 1 784  ? -21.593 -34.712 -46.499 1.00 55.59  ? 784  ILE A CG1   1 
ATOM   5768  C  CG2   . ILE A 1 784  ? -22.882 -33.288 -48.121 1.00 54.26  ? 784  ILE A CG2   1 
ATOM   5769  C  CD1   . ILE A 1 784  ? -22.583 -34.432 -45.393 1.00 55.92  ? 784  ILE A CD1   1 
ATOM   5770  N  N     . VAL A 1 785  ? -21.525 -34.808 -50.682 1.00 53.46  ? 785  VAL A N     1 
ATOM   5771  C  CA    . VAL A 1 785  ? -21.899 -35.856 -51.649 1.00 52.86  ? 785  VAL A CA    1 
ATOM   5772  C  C     . VAL A 1 785  ? -20.651 -36.456 -52.324 1.00 53.86  ? 785  VAL A C     1 
ATOM   5773  O  O     . VAL A 1 785  ? -20.536 -37.680 -52.423 1.00 53.80  ? 785  VAL A O     1 
ATOM   5774  C  CB    . VAL A 1 785  ? -22.932 -35.344 -52.684 1.00 51.04  ? 785  VAL A CB    1 
ATOM   5775  C  CG1   . VAL A 1 785  ? -23.185 -36.361 -53.791 1.00 50.86  ? 785  VAL A CG1   1 
ATOM   5776  C  CG2   . VAL A 1 785  ? -24.248 -35.032 -51.988 1.00 50.61  ? 785  VAL A CG2   1 
ATOM   5777  N  N     . ALA A 1 786  ? -19.727 -35.597 -52.768 1.00 53.85  ? 786  ALA A N     1 
ATOM   5778  C  CA    . ALA A 1 786  ? -18.473 -36.040 -53.396 1.00 53.73  ? 786  ALA A CA    1 
ATOM   5779  C  C     . ALA A 1 786  ? -17.617 -36.881 -52.450 1.00 55.10  ? 786  ALA A C     1 
ATOM   5780  O  O     . ALA A 1 786  ? -17.158 -37.970 -52.814 1.00 57.04  ? 786  ALA A O     1 
ATOM   5781  C  CB    . ALA A 1 786  ? -17.684 -34.848 -53.896 1.00 53.37  ? 786  ALA A CB    1 
ATOM   5782  N  N     . SER A 1 787  ? -17.415 -36.372 -51.241 1.00 54.97  ? 787  SER A N     1 
ATOM   5783  C  CA    . SER A 1 787  ? -16.760 -37.112 -50.166 1.00 55.76  ? 787  SER A CA    1 
ATOM   5784  C  C     . SER A 1 787  ? -17.392 -38.500 -49.931 1.00 56.62  ? 787  SER A C     1 
ATOM   5785  O  O     . SER A 1 787  ? -16.691 -39.514 -49.874 1.00 57.52  ? 787  SER A O     1 
ATOM   5786  C  CB    . SER A 1 787  ? -16.834 -36.285 -48.887 1.00 56.36  ? 787  SER A CB    1 
ATOM   5787  O  OG    . SER A 1 787  ? -16.278 -36.971 -47.792 1.00 59.16  ? 787  SER A OG    1 
ATOM   5788  N  N     . THR A 1 788  ? -18.719 -38.536 -49.822 1.00 56.75  ? 788  THR A N     1 
ATOM   5789  C  CA    . THR A 1 788  ? -19.462 -39.783 -49.603 1.00 56.17  ? 788  THR A CA    1 
ATOM   5790  C  C     . THR A 1 788  ? -19.259 -40.787 -50.734 1.00 56.29  ? 788  THR A C     1 
ATOM   5791  O  O     . THR A 1 788  ? -19.158 -41.987 -50.478 1.00 57.58  ? 788  THR A O     1 
ATOM   5792  C  CB    . THR A 1 788  ? -20.966 -39.502 -49.419 1.00 55.48  ? 788  THR A CB    1 
ATOM   5793  O  OG1   . THR A 1 788  ? -21.153 -38.695 -48.249 1.00 55.66  ? 788  THR A OG1   1 
ATOM   5794  C  CG2   . THR A 1 788  ? -21.777 -40.802 -49.263 1.00 55.90  ? 788  THR A CG2   1 
ATOM   5795  N  N     . LEU A 1 789  ? -19.186 -40.291 -51.971 1.00 55.04  ? 789  LEU A N     1 
ATOM   5796  C  CA    . LEU A 1 789  ? -18.940 -41.133 -53.144 1.00 54.28  ? 789  LEU A CA    1 
ATOM   5797  C  C     . LEU A 1 789  ? -17.453 -41.334 -53.478 1.00 54.32  ? 789  LEU A C     1 
ATOM   5798  O  O     . LEU A 1 789  ? -17.134 -42.049 -54.425 1.00 52.89  ? 789  LEU A O     1 
ATOM   5799  C  CB    . LEU A 1 789  ? -19.695 -40.574 -54.359 1.00 53.29  ? 789  LEU A CB    1 
ATOM   5800  C  CG    . LEU A 1 789  ? -21.221 -40.499 -54.207 1.00 52.90  ? 789  LEU A CG    1 
ATOM   5801  C  CD1   . LEU A 1 789  ? -21.859 -39.934 -55.466 1.00 52.14  ? 789  LEU A CD1   1 
ATOM   5802  C  CD2   . LEU A 1 789  ? -21.834 -41.845 -53.860 1.00 53.05  ? 789  LEU A CD2   1 
ATOM   5803  N  N     . LYS A 1 790  ? -16.560 -40.736 -52.688 1.00 55.48  ? 790  LYS A N     1 
ATOM   5804  C  CA    . LYS A 1 790  ? -15.120 -40.721 -52.952 1.00 56.60  ? 790  LYS A CA    1 
ATOM   5805  C  C     . LYS A 1 790  ? -14.800 -40.192 -54.350 1.00 54.55  ? 790  LYS A C     1 
ATOM   5806  O  O     . LYS A 1 790  ? -13.951 -40.745 -55.050 1.00 54.52  ? 790  LYS A O     1 
ATOM   5807  C  CB    . LYS A 1 790  ? -14.512 -42.114 -52.746 1.00 59.50  ? 790  LYS A CB    1 
ATOM   5808  C  CG    . LYS A 1 790  ? -14.667 -42.682 -51.344 1.00 61.95  ? 790  LYS A CG    1 
ATOM   5809  C  CD    . LYS A 1 790  ? -14.488 -44.191 -51.389 1.00 65.30  ? 790  LYS A CD    1 
ATOM   5810  C  CE    . LYS A 1 790  ? -14.513 -44.820 -50.008 1.00 68.15  ? 790  LYS A CE    1 
ATOM   5811  N  NZ    . LYS A 1 790  ? -13.424 -44.291 -49.143 1.00 70.03  ? 790  LYS A NZ    1 
ATOM   5812  N  N     . LEU A 1 791  ? -15.491 -39.124 -54.747 1.00 52.42  ? 791  LEU A N     1 
ATOM   5813  C  CA    . LEU A 1 791  ? -15.351 -38.545 -56.087 1.00 51.94  ? 791  LEU A CA    1 
ATOM   5814  C  C     . LEU A 1 791  ? -14.758 -37.155 -56.012 1.00 51.25  ? 791  LEU A C     1 
ATOM   5815  O  O     . LEU A 1 791  ? -14.918 -36.478 -55.004 1.00 52.71  ? 791  LEU A O     1 
ATOM   5816  C  CB    . LEU A 1 791  ? -16.714 -38.425 -56.760 1.00 51.26  ? 791  LEU A CB    1 
ATOM   5817  C  CG    . LEU A 1 791  ? -17.426 -39.721 -57.121 1.00 50.81  ? 791  LEU A CG    1 
ATOM   5818  C  CD1   . LEU A 1 791  ? -18.833 -39.392 -57.594 1.00 49.94  ? 791  LEU A CD1   1 
ATOM   5819  C  CD2   . LEU A 1 791  ? -16.649 -40.483 -58.183 1.00 50.87  ? 791  LEU A CD2   1 
ATOM   5820  N  N     . PRO A 1 792  ? -14.088 -36.708 -57.085 1.00 50.42  ? 792  PRO A N     1 
ATOM   5821  C  CA    . PRO A 1 792  ? -13.734 -35.288 -57.131 1.00 50.59  ? 792  PRO A CA    1 
ATOM   5822  C  C     . PRO A 1 792  ? -14.973 -34.392 -57.207 1.00 50.17  ? 792  PRO A C     1 
ATOM   5823  O  O     . PRO A 1 792  ? -16.049 -34.840 -57.619 1.00 49.62  ? 792  PRO A O     1 
ATOM   5824  C  CB    . PRO A 1 792  ? -12.910 -35.164 -58.416 1.00 50.42  ? 792  PRO A CB    1 
ATOM   5825  C  CG    . PRO A 1 792  ? -12.472 -36.549 -58.743 1.00 50.24  ? 792  PRO A CG    1 
ATOM   5826  C  CD    . PRO A 1 792  ? -13.538 -37.451 -58.228 1.00 50.17  ? 792  PRO A CD    1 
ATOM   5827  N  N     . ALA A 1 793  ? -14.809 -33.136 -56.818 1.00 50.21  ? 793  ALA A N     1 
ATOM   5828  C  CA    . ALA A 1 793  ? -15.909 -32.190 -56.829 1.00 49.20  ? 793  ALA A CA    1 
ATOM   5829  C  C     . ALA A 1 793  ? -16.405 -31.901 -58.247 1.00 49.35  ? 793  ALA A C     1 
ATOM   5830  O  O     . ALA A 1 793  ? -17.575 -31.565 -58.415 1.00 50.07  ? 793  ALA A O     1 
ATOM   5831  C  CB    . ALA A 1 793  ? -15.507 -30.909 -56.128 1.00 48.98  ? 793  ALA A CB    1 
ATOM   5832  N  N     . ASN A 1 794  ? -15.542 -32.046 -59.261 1.00 49.95  ? 794  ASN A N     1 
ATOM   5833  C  CA    . ASN A 1 794  ? -15.946 -31.833 -60.667 1.00 49.83  ? 794  ASN A CA    1 
ATOM   5834  C  C     . ASN A 1 794  ? -16.943 -32.873 -61.227 1.00 50.16  ? 794  ASN A C     1 
ATOM   5835  O  O     . ASN A 1 794  ? -17.569 -32.654 -62.274 1.00 49.89  ? 794  ASN A O     1 
ATOM   5836  C  CB    . ASN A 1 794  ? -14.724 -31.646 -61.593 1.00 50.12  ? 794  ASN A CB    1 
ATOM   5837  C  CG    . ASN A 1 794  ? -13.867 -32.908 -61.750 1.00 51.02  ? 794  ASN A CG    1 
ATOM   5838  O  OD1   . ASN A 1 794  ? -14.252 -34.005 -61.348 1.00 50.57  ? 794  ASN A OD1   1 
ATOM   5839  N  ND2   . ASN A 1 794  ? -12.690 -32.744 -62.357 1.00 50.95  ? 794  ASN A ND2   1 
ATOM   5840  N  N     . LYS A 1 795  ? -17.086 -33.994 -60.521 1.00 51.62  ? 795  LYS A N     1 
ATOM   5841  C  CA    . LYS A 1 795  ? -18.098 -35.001 -60.841 1.00 51.52  ? 795  LYS A CA    1 
ATOM   5842  C  C     . LYS A 1 795  ? -19.478 -34.704 -60.251 1.00 50.09  ? 795  LYS A C     1 
ATOM   5843  O  O     . LYS A 1 795  ? -20.466 -35.179 -60.787 1.00 50.14  ? 795  LYS A O     1 
ATOM   5844  C  CB    . LYS A 1 795  ? -17.632 -36.401 -60.409 1.00 53.22  ? 795  LYS A CB    1 
ATOM   5845  C  CG    . LYS A 1 795  ? -16.987 -37.209 -61.522 1.00 54.44  ? 795  LYS A CG    1 
ATOM   5846  C  CD    . LYS A 1 795  ? -15.750 -36.522 -62.045 1.00 55.96  ? 795  LYS A CD    1 
ATOM   5847  C  CE    . LYS A 1 795  ? -14.967 -37.370 -63.029 1.00 56.73  ? 795  LYS A CE    1 
ATOM   5848  N  NZ    . LYS A 1 795  ? -13.549 -36.889 -63.011 1.00 58.09  ? 795  LYS A NZ    1 
ATOM   5849  N  N     . VAL A 1 796  ? -19.557 -33.940 -59.163 1.00 50.29  ? 796  VAL A N     1 
ATOM   5850  C  CA    . VAL A 1 796  ? -20.858 -33.650 -58.509 1.00 49.84  ? 796  VAL A CA    1 
ATOM   5851  C  C     . VAL A 1 796  ? -21.251 -32.180 -58.642 1.00 48.16  ? 796  VAL A C     1 
ATOM   5852  O  O     . VAL A 1 796  ? -20.515 -31.316 -58.223 1.00 47.62  ? 796  VAL A O     1 
ATOM   5853  C  CB    . VAL A 1 796  ? -20.848 -34.042 -57.017 1.00 50.42  ? 796  VAL A CB    1 
ATOM   5854  C  CG1   . VAL A 1 796  ? -22.234 -33.863 -56.409 1.00 50.66  ? 796  VAL A CG1   1 
ATOM   5855  C  CG2   . VAL A 1 796  ? -20.384 -35.484 -56.848 1.00 50.96  ? 796  VAL A CG2   1 
ATOM   5856  N  N     . MET A 1 797  ? -22.412 -31.914 -59.235 1.00 48.21  ? 797  MET A N     1 
ATOM   5857  C  CA    . MET A 1 797  ? -22.951 -30.558 -59.343 1.00 48.37  ? 797  MET A CA    1 
ATOM   5858  C  C     . MET A 1 797  ? -24.271 -30.432 -58.577 1.00 48.93  ? 797  MET A C     1 
ATOM   5859  O  O     . MET A 1 797  ? -25.139 -31.298 -58.672 1.00 48.55  ? 797  MET A O     1 
ATOM   5860  C  CB    . MET A 1 797  ? -23.149 -30.169 -60.809 1.00 48.42  ? 797  MET A CB    1 
ATOM   5861  C  CG    . MET A 1 797  ? -21.848 -30.095 -61.611 1.00 49.52  ? 797  MET A CG    1 
ATOM   5862  S  SD    . MET A 1 797  ? -20.682 -28.836 -61.035 1.00 49.63  ? 797  MET A SD    1 
ATOM   5863  C  CE    . MET A 1 797  ? -19.150 -29.771 -60.963 1.00 51.59  ? 797  MET A CE    1 
ATOM   5864  N  N     . CYS A 1 798  ? -24.401 -29.347 -57.814 1.00 49.88  ? 798  CYS A N     1 
ATOM   5865  C  CA    . CYS A 1 798  ? -25.612 -29.044 -57.073 1.00 50.68  ? 798  CYS A CA    1 
ATOM   5866  C  C     . CYS A 1 798  ? -26.337 -27.869 -57.730 1.00 49.50  ? 798  CYS A C     1 
ATOM   5867  O  O     . CYS A 1 798  ? -25.719 -26.843 -57.993 1.00 47.69  ? 798  CYS A O     1 
ATOM   5868  C  CB    . CYS A 1 798  ? -25.261 -28.711 -55.627 1.00 52.82  ? 798  CYS A CB    1 
ATOM   5869  S  SG    . CYS A 1 798  ? -26.705 -28.364 -54.591 1.00 56.28  ? 798  CYS A SG    1 
ATOM   5870  N  N     . HIS A 1 799  ? -27.640 -28.037 -57.987 1.00 49.35  ? 799  HIS A N     1 
ATOM   5871  C  CA    . HIS A 1 799  ? -28.479 -27.036 -58.676 1.00 48.54  ? 799  HIS A CA    1 
ATOM   5872  C  C     . HIS A 1 799  ? -29.659 -26.644 -57.798 1.00 47.13  ? 799  HIS A C     1 
ATOM   5873  O  O     . HIS A 1 799  ? -30.343 -27.519 -57.275 1.00 47.16  ? 799  HIS A O     1 
ATOM   5874  C  CB    . HIS A 1 799  ? -29.034 -27.598 -59.991 1.00 48.76  ? 799  HIS A CB    1 
ATOM   5875  C  CG    . HIS A 1 799  ? -28.023 -28.317 -60.826 1.00 50.03  ? 799  HIS A CG    1 
ATOM   5876  N  ND1   . HIS A 1 799  ? -27.148 -27.660 -61.665 1.00 51.17  ? 799  HIS A ND1   1 
ATOM   5877  C  CD2   . HIS A 1 799  ? -27.742 -29.636 -60.947 1.00 50.29  ? 799  HIS A CD2   1 
ATOM   5878  C  CE1   . HIS A 1 799  ? -26.367 -28.543 -62.260 1.00 50.86  ? 799  HIS A CE1   1 
ATOM   5879  N  NE2   . HIS A 1 799  ? -26.712 -29.749 -61.847 1.00 50.70  ? 799  HIS A NE2   1 
ATOM   5880  N  N     . VAL A 1 800  ? -29.904 -25.343 -57.649 1.00 46.91  ? 800  VAL A N     1 
ATOM   5881  C  CA    . VAL A 1 800  ? -31.035 -24.832 -56.844 1.00 47.13  ? 800  VAL A CA    1 
ATOM   5882  C  C     . VAL A 1 800  ? -31.728 -23.689 -57.566 1.00 46.45  ? 800  VAL A C     1 
ATOM   5883  O  O     . VAL A 1 800  ? -31.121 -22.647 -57.762 1.00 46.05  ? 800  VAL A O     1 
ATOM   5884  C  CB    . VAL A 1 800  ? -30.576 -24.267 -55.484 1.00 47.54  ? 800  VAL A CB    1 
ATOM   5885  C  CG1   . VAL A 1 800  ? -31.779 -23.762 -54.683 1.00 48.02  ? 800  VAL A CG1   1 
ATOM   5886  C  CG2   . VAL A 1 800  ? -29.766 -25.292 -54.711 1.00 47.24  ? 800  VAL A CG2   1 
ATOM   5887  N  N     . ARG A 1 801  ? -32.994 -23.874 -57.944 1.00 47.23  ? 801  ARG A N     1 
ATOM   5888  C  CA    . ARG A 1 801  ? -33.782 -22.777 -58.527 1.00 48.31  ? 801  ARG A CA    1 
ATOM   5889  C  C     . ARG A 1 801  ? -34.351 -21.881 -57.429 1.00 47.45  ? 801  ARG A C     1 
ATOM   5890  O  O     . ARG A 1 801  ? -34.136 -20.682 -57.437 1.00 48.99  ? 801  ARG A O     1 
ATOM   5891  C  CB    . ARG A 1 801  ? -34.894 -23.299 -59.423 1.00 49.58  ? 801  ARG A CB    1 
ATOM   5892  C  CG    . ARG A 1 801  ? -35.650 -22.188 -60.129 1.00 52.16  ? 801  ARG A CG    1 
ATOM   5893  C  CD    . ARG A 1 801  ? -36.537 -22.719 -61.238 1.00 54.80  ? 801  ARG A CD    1 
ATOM   5894  N  NE    . ARG A 1 801  ? -35.787 -23.059 -62.450 1.00 57.02  ? 801  ARG A NE    1 
ATOM   5895  C  CZ    . ARG A 1 801  ? -35.724 -22.331 -63.573 1.00 58.35  ? 801  ARG A CZ    1 
ATOM   5896  N  NH1   . ARG A 1 801  ? -36.366 -21.168 -63.702 1.00 58.77  ? 801  ARG A NH1   1 
ATOM   5897  N  NH2   . ARG A 1 801  ? -34.995 -22.783 -64.594 1.00 60.17  ? 801  ARG A NH2   1 
ATOM   5898  N  N     . ARG A 1 802  ? -35.060 -22.475 -56.484 1.00 47.07  ? 802  ARG A N     1 
ATOM   5899  C  CA    . ARG A 1 802  ? -35.619 -21.740 -55.362 1.00 47.81  ? 802  ARG A CA    1 
ATOM   5900  C  C     . ARG A 1 802  ? -35.820 -22.657 -54.174 1.00 47.48  ? 802  ARG A C     1 
ATOM   5901  O  O     . ARG A 1 802  ? -35.896 -23.873 -54.318 1.00 46.21  ? 802  ARG A O     1 
ATOM   5902  C  CB    . ARG A 1 802  ? -36.960 -21.100 -55.740 1.00 48.47  ? 802  ARG A CB    1 
ATOM   5903  C  CG    . ARG A 1 802  ? -38.068 -22.099 -56.066 1.00 49.17  ? 802  ARG A CG    1 
ATOM   5904  C  CD    . ARG A 1 802  ? -39.414 -21.431 -56.337 1.00 50.21  ? 802  ARG A CD    1 
ATOM   5905  N  NE    . ARG A 1 802  ? -39.390 -20.446 -57.422 1.00 50.30  ? 802  ARG A NE    1 
ATOM   5906  C  CZ    . ARG A 1 802  ? -39.272 -20.723 -58.722 1.00 50.50  ? 802  ARG A CZ    1 
ATOM   5907  N  NH1   . ARG A 1 802  ? -39.142 -21.981 -59.150 1.00 50.13  ? 802  ARG A NH1   1 
ATOM   5908  N  NH2   . ARG A 1 802  ? -39.271 -19.723 -59.611 1.00 49.51  ? 802  ARG A NH2   1 
ATOM   5909  N  N     . VAL A 1 803  ? -35.919 -22.036 -53.007 1.00 48.03  ? 803  VAL A N     1 
ATOM   5910  C  CA    . VAL A 1 803  ? -36.196 -22.712 -51.758 1.00 47.36  ? 803  VAL A CA    1 
ATOM   5911  C  C     . VAL A 1 803  ? -37.482 -22.094 -51.194 1.00 47.31  ? 803  VAL A C     1 
ATOM   5912  O  O     . VAL A 1 803  ? -37.677 -20.871 -51.248 1.00 47.72  ? 803  VAL A O     1 
ATOM   5913  C  CB    . VAL A 1 803  ? -35.005 -22.550 -50.796 1.00 47.12  ? 803  VAL A CB    1 
ATOM   5914  C  CG1   . VAL A 1 803  ? -35.352 -23.018 -49.392 1.00 47.86  ? 803  VAL A CG1   1 
ATOM   5915  C  CG2   . VAL A 1 803  ? -33.811 -23.311 -51.331 1.00 46.76  ? 803  VAL A CG2   1 
ATOM   5916  N  N     . GLY A 1 804  ? -38.356 -22.950 -50.673 1.00 46.17  ? 804  GLY A N     1 
ATOM   5917  C  CA    . GLY A 1 804  ? -39.616 -22.531 -50.064 1.00 46.75  ? 804  GLY A CA    1 
ATOM   5918  C  C     . GLY A 1 804  ? -39.423 -22.197 -48.598 1.00 46.90  ? 804  GLY A C     1 
ATOM   5919  O  O     . GLY A 1 804  ? -39.987 -22.862 -47.726 1.00 46.59  ? 804  GLY A O     1 
ATOM   5920  N  N     . GLY A 1 805  ? -38.603 -21.178 -48.333 1.00 47.07  ? 805  GLY A N     1 
ATOM   5921  C  CA    . GLY A 1 805  ? -38.211 -20.809 -46.978 1.00 47.84  ? 805  GLY A CA    1 
ATOM   5922  C  C     . GLY A 1 805  ? -37.130 -21.705 -46.408 1.00 48.30  ? 805  GLY A C     1 
ATOM   5923  O  O     . GLY A 1 805  ? -37.088 -22.900 -46.705 1.00 50.52  ? 805  GLY A O     1 
ATOM   5924  N  N     . ALA A 1 806  ? -36.262 -21.131 -45.578 1.00 49.06  ? 806  ALA A N     1 
ATOM   5925  C  CA    . ALA A 1 806  ? -35.145 -21.865 -44.957 1.00 49.94  ? 806  ALA A CA    1 
ATOM   5926  C  C     . ALA A 1 806  ? -34.811 -21.355 -43.548 1.00 51.78  ? 806  ALA A C     1 
ATOM   5927  O  O     . ALA A 1 806  ? -34.731 -22.140 -42.600 1.00 52.82  ? 806  ALA A O     1 
ATOM   5928  C  CB    . ALA A 1 806  ? -33.911 -21.797 -45.848 1.00 49.73  ? 806  ALA A CB    1 
ATOM   5929  N  N     . PHE A 1 807  ? -34.566 -20.053 -43.422 1.00 52.94  ? 807  PHE A N     1 
ATOM   5930  C  CA    . PHE A 1 807  ? -34.280 -19.427 -42.128 1.00 54.50  ? 807  PHE A CA    1 
ATOM   5931  C  C     . PHE A 1 807  ? -33.143 -20.119 -41.370 1.00 55.35  ? 807  PHE A C     1 
ATOM   5932  O  O     . PHE A 1 807  ? -33.204 -20.248 -40.144 1.00 56.63  ? 807  PHE A O     1 
ATOM   5933  C  CB    . PHE A 1 807  ? -35.556 -19.389 -41.269 1.00 55.27  ? 807  PHE A CB    1 
ATOM   5934  C  CG    . PHE A 1 807  ? -36.779 -18.984 -42.034 1.00 54.09  ? 807  PHE A CG    1 
ATOM   5935  C  CD1   . PHE A 1 807  ? -36.952 -17.671 -42.431 1.00 53.90  ? 807  PHE A CD1   1 
ATOM   5936  C  CD2   . PHE A 1 807  ? -37.735 -19.920 -42.384 1.00 53.05  ? 807  PHE A CD2   1 
ATOM   5937  C  CE1   . PHE A 1 807  ? -38.066 -17.293 -43.153 1.00 54.53  ? 807  PHE A CE1   1 
ATOM   5938  C  CE2   . PHE A 1 807  ? -38.849 -19.554 -43.118 1.00 53.06  ? 807  PHE A CE2   1 
ATOM   5939  C  CZ    . PHE A 1 807  ? -39.016 -18.238 -43.510 1.00 53.51  ? 807  PHE A CZ    1 
ATOM   5940  N  N     . GLY A 1 808  ? -32.130 -20.582 -42.105 1.00 54.71  ? 808  GLY A N     1 
ATOM   5941  C  CA    . GLY A 1 808  ? -31.000 -21.305 -41.519 1.00 55.12  ? 808  GLY A CA    1 
ATOM   5942  C  C     . GLY A 1 808  ? -31.133 -22.814 -41.388 1.00 55.10  ? 808  GLY A C     1 
ATOM   5943  O  O     . GLY A 1 808  ? -30.125 -23.507 -41.257 1.00 56.23  ? 808  GLY A O     1 
ATOM   5944  N  N     . GLY A 1 809  ? -32.349 -23.352 -41.453 1.00 55.12  ? 809  GLY A N     1 
ATOM   5945  C  CA    . GLY A 1 809  ? -32.556 -24.800 -41.248 1.00 54.95  ? 809  GLY A CA    1 
ATOM   5946  C  C     . GLY A 1 809  ? -32.447 -25.723 -42.459 1.00 53.14  ? 809  GLY A C     1 
ATOM   5947  O  O     . GLY A 1 809  ? -33.012 -26.817 -42.437 1.00 51.98  ? 809  GLY A O     1 
ATOM   5948  N  N     . LYS A 1 810  ? -31.741 -25.295 -43.505 1.00 52.70  ? 810  LYS A N     1 
ATOM   5949  C  CA    . LYS A 1 810  ? -31.537 -26.104 -44.702 1.00 52.35  ? 810  LYS A CA    1 
ATOM   5950  C  C     . LYS A 1 810  ? -30.051 -26.172 -45.088 1.00 53.46  ? 810  LYS A C     1 
ATOM   5951  O  O     . LYS A 1 810  ? -29.678 -25.888 -46.220 1.00 54.10  ? 810  LYS A O     1 
ATOM   5952  C  CB    . LYS A 1 810  ? -32.430 -25.590 -45.840 1.00 50.99  ? 810  LYS A CB    1 
ATOM   5953  C  CG    . LYS A 1 810  ? -33.812 -26.212 -45.801 1.00 50.64  ? 810  LYS A CG    1 
ATOM   5954  C  CD    . LYS A 1 810  ? -34.794 -25.586 -46.766 1.00 50.37  ? 810  LYS A CD    1 
ATOM   5955  C  CE    . LYS A 1 810  ? -36.148 -26.277 -46.635 1.00 50.58  ? 810  LYS A CE    1 
ATOM   5956  N  NZ    . LYS A 1 810  ? -37.242 -25.563 -47.349 1.00 50.42  ? 810  LYS A NZ    1 
ATOM   5957  N  N     . VAL A 1 811  ? -29.212 -26.571 -44.130 1.00 54.68  ? 811  VAL A N     1 
ATOM   5958  C  CA    . VAL A 1 811  ? -27.766 -26.662 -44.337 1.00 55.41  ? 811  VAL A CA    1 
ATOM   5959  C  C     . VAL A 1 811  ? -27.234 -28.037 -43.899 1.00 57.18  ? 811  VAL A C     1 
ATOM   5960  O  O     . VAL A 1 811  ? -27.316 -28.975 -44.682 1.00 56.91  ? 811  VAL A O     1 
ATOM   5961  C  CB    . VAL A 1 811  ? -27.020 -25.486 -43.659 1.00 56.15  ? 811  VAL A CB    1 
ATOM   5962  C  CG1   . VAL A 1 811  ? -25.525 -25.557 -43.957 1.00 56.06  ? 811  VAL A CG1   1 
ATOM   5963  C  CG2   . VAL A 1 811  ? -27.601 -24.153 -44.120 1.00 55.98  ? 811  VAL A CG2   1 
ATOM   5964  N  N     . LEU A 1 812  ? -26.724 -28.176 -42.668 1.00 60.20  ? 812  LEU A N     1 
ATOM   5965  C  CA    . LEU A 1 812  ? -25.986 -29.391 -42.253 1.00 63.19  ? 812  LEU A CA    1 
ATOM   5966  C  C     . LEU A 1 812  ? -26.815 -30.658 -42.458 1.00 61.86  ? 812  LEU A C     1 
ATOM   5967  O  O     . LEU A 1 812  ? -26.358 -31.619 -43.081 1.00 61.75  ? 812  LEU A O     1 
ATOM   5968  C  CB    . LEU A 1 812  ? -25.510 -29.296 -40.780 1.00 65.97  ? 812  LEU A CB    1 
ATOM   5969  C  CG    . LEU A 1 812  ? -25.046 -30.584 -40.049 1.00 68.72  ? 812  LEU A CG    1 
ATOM   5970  C  CD1   . LEU A 1 812  ? -23.699 -31.092 -40.557 1.00 69.98  ? 812  LEU A CD1   1 
ATOM   5971  C  CD2   . LEU A 1 812  ? -24.988 -30.370 -38.541 1.00 70.63  ? 812  LEU A CD2   1 
ATOM   5972  N  N     . LYS A 1 813  ? -28.035 -30.632 -41.934 1.00 61.27  ? 813  LYS A N     1 
ATOM   5973  C  CA    . LYS A 1 813  ? -28.900 -31.800 -41.927 1.00 61.23  ? 813  LYS A CA    1 
ATOM   5974  C  C     . LYS A 1 813  ? -29.380 -32.158 -43.332 1.00 58.03  ? 813  LYS A C     1 
ATOM   5975  O  O     . LYS A 1 813  ? -29.522 -33.337 -43.657 1.00 58.20  ? 813  LYS A O     1 
ATOM   5976  C  CB    . LYS A 1 813  ? -30.088 -31.584 -40.992 1.00 63.72  ? 813  LYS A CB    1 
ATOM   5977  C  CG    . LYS A 1 813  ? -30.373 -32.795 -40.120 1.00 68.43  ? 813  LYS A CG    1 
ATOM   5978  C  CD    . LYS A 1 813  ? -29.425 -32.840 -38.932 1.00 71.29  ? 813  LYS A CD    1 
ATOM   5979  C  CE    . LYS A 1 813  ? -29.511 -34.162 -38.192 1.00 73.79  ? 813  LYS A CE    1 
ATOM   5980  N  NZ    . LYS A 1 813  ? -29.149 -33.965 -36.759 1.00 76.37  ? 813  LYS A NZ    1 
ATOM   5981  N  N     . THR A 1 814  ? -29.631 -31.132 -44.145 1.00 54.35  ? 814  THR A N     1 
ATOM   5982  C  CA    . THR A 1 814  ? -29.917 -31.284 -45.571 1.00 51.85  ? 814  THR A CA    1 
ATOM   5983  C  C     . THR A 1 814  ? -28.823 -32.079 -46.269 1.00 50.90  ? 814  THR A C     1 
ATOM   5984  O  O     . THR A 1 814  ? -29.113 -33.036 -46.987 1.00 49.26  ? 814  THR A O     1 
ATOM   5985  C  CB    . THR A 1 814  ? -30.041 -29.898 -46.266 1.00 51.05  ? 814  THR A CB    1 
ATOM   5986  O  OG1   . THR A 1 814  ? -31.072 -29.130 -45.631 1.00 50.15  ? 814  THR A OG1   1 
ATOM   5987  C  CG2   . THR A 1 814  ? -30.360 -30.032 -47.755 1.00 49.71  ? 814  THR A CG2   1 
ATOM   5988  N  N     . GLY A 1 815  ? -27.574 -31.664 -46.051 1.00 51.35  ? 815  GLY A N     1 
ATOM   5989  C  CA    . GLY A 1 815  ? -26.397 -32.307 -46.639 1.00 51.15  ? 815  GLY A CA    1 
ATOM   5990  C  C     . GLY A 1 815  ? -26.215 -33.770 -46.274 1.00 51.28  ? 815  GLY A C     1 
ATOM   5991  O  O     . GLY A 1 815  ? -25.836 -34.574 -47.126 1.00 50.61  ? 815  GLY A O     1 
ATOM   5992  N  N     . ILE A 1 816  ? -26.476 -34.108 -45.014 1.00 51.96  ? 816  ILE A N     1 
ATOM   5993  C  CA    . ILE A 1 816  ? -26.450 -35.503 -44.554 1.00 54.12  ? 816  ILE A CA    1 
ATOM   5994  C  C     . ILE A 1 816  ? -27.437 -36.360 -45.323 1.00 53.57  ? 816  ILE A C     1 
ATOM   5995  O  O     . ILE A 1 816  ? -27.104 -37.450 -45.775 1.00 56.33  ? 816  ILE A O     1 
ATOM   5996  C  CB    . ILE A 1 816  ? -26.766 -35.624 -43.048 1.00 55.76  ? 816  ILE A CB    1 
ATOM   5997  C  CG1   . ILE A 1 816  ? -25.576 -35.109 -42.227 1.00 56.55  ? 816  ILE A CG1   1 
ATOM   5998  C  CG2   . ILE A 1 816  ? -27.075 -37.074 -42.651 1.00 56.24  ? 816  ILE A CG2   1 
ATOM   5999  C  CD1   . ILE A 1 816  ? -25.936 -34.764 -40.800 1.00 57.15  ? 816  ILE A CD1   1 
ATOM   6000  N  N     . ILE A 1 817  ? -28.651 -35.860 -45.459 1.00 53.12  ? 817  ILE A N     1 
ATOM   6001  C  CA    . ILE A 1 817  ? -29.698 -36.576 -46.159 1.00 52.30  ? 817  ILE A CA    1 
ATOM   6002  C  C     . ILE A 1 817  ? -29.343 -36.708 -47.639 1.00 52.02  ? 817  ILE A C     1 
ATOM   6003  O  O     . ILE A 1 817  ? -29.540 -37.773 -48.223 1.00 52.68  ? 817  ILE A O     1 
ATOM   6004  C  CB    . ILE A 1 817  ? -31.064 -35.891 -45.978 1.00 52.11  ? 817  ILE A CB    1 
ATOM   6005  C  CG1   . ILE A 1 817  ? -31.466 -35.885 -44.494 1.00 52.34  ? 817  ILE A CG1   1 
ATOM   6006  C  CG2   . ILE A 1 817  ? -32.132 -36.610 -46.801 1.00 52.35  ? 817  ILE A CG2   1 
ATOM   6007  C  CD1   . ILE A 1 817  ? -32.560 -34.891 -44.162 1.00 52.62  ? 817  ILE A CD1   1 
ATOM   6008  N  N     . ALA A 1 818  ? -28.818 -35.635 -48.238 1.00 52.57  ? 818  ALA A N     1 
ATOM   6009  C  CA    . ALA A 1 818  ? -28.316 -35.672 -49.628 1.00 51.40  ? 818  ALA A CA    1 
ATOM   6010  C  C     . ALA A 1 818  ? -27.195 -36.683 -49.824 1.00 51.37  ? 818  ALA A C     1 
ATOM   6011  O  O     . ALA A 1 818  ? -27.181 -37.389 -50.824 1.00 50.67  ? 818  ALA A O     1 
ATOM   6012  C  CB    . ALA A 1 818  ? -27.868 -34.292 -50.081 1.00 50.72  ? 818  ALA A CB    1 
ATOM   6013  N  N     . ALA A 1 819  ? -26.278 -36.754 -48.861 1.00 51.96  ? 819  ALA A N     1 
ATOM   6014  C  CA    . ALA A 1 819  ? -25.150 -37.697 -48.912 1.00 53.65  ? 819  ALA A CA    1 
ATOM   6015  C  C     . ALA A 1 819  ? -25.619 -39.143 -48.882 1.00 54.06  ? 819  ALA A C     1 
ATOM   6016  O  O     . ALA A 1 819  ? -25.188 -39.966 -49.695 1.00 54.84  ? 819  ALA A O     1 
ATOM   6017  C  CB    . ALA A 1 819  ? -24.190 -37.445 -47.758 1.00 54.31  ? 819  ALA A CB    1 
ATOM   6018  N  N     . VAL A 1 820  ? -26.501 -39.434 -47.932 1.00 54.00  ? 820  VAL A N     1 
ATOM   6019  C  CA    . VAL A 1 820  ? -27.112 -40.749 -47.812 1.00 54.34  ? 820  VAL A CA    1 
ATOM   6020  C  C     . VAL A 1 820  ? -27.930 -41.061 -49.071 1.00 52.91  ? 820  VAL A C     1 
ATOM   6021  O  O     . VAL A 1 820  ? -27.824 -42.158 -49.614 1.00 54.78  ? 820  VAL A O     1 
ATOM   6022  C  CB    . VAL A 1 820  ? -27.995 -40.872 -46.543 1.00 55.33  ? 820  VAL A CB    1 
ATOM   6023  C  CG1   . VAL A 1 820  ? -28.720 -42.222 -46.512 1.00 56.20  ? 820  VAL A CG1   1 
ATOM   6024  C  CG2   . VAL A 1 820  ? -27.161 -40.696 -45.272 1.00 56.01  ? 820  VAL A CG2   1 
ATOM   6025  N  N     . THR A 1 821  ? -28.716 -40.098 -49.538 1.00 50.63  ? 821  THR A N     1 
ATOM   6026  C  CA    . THR A 1 821  ? -29.524 -40.274 -50.742 1.00 50.30  ? 821  THR A CA    1 
ATOM   6027  C  C     . THR A 1 821  ? -28.667 -40.576 -51.973 1.00 49.81  ? 821  THR A C     1 
ATOM   6028  O  O     . THR A 1 821  ? -29.014 -41.447 -52.765 1.00 50.00  ? 821  THR A O     1 
ATOM   6029  C  CB    . THR A 1 821  ? -30.420 -39.029 -51.005 1.00 49.92  ? 821  THR A CB    1 
ATOM   6030  O  OG1   . THR A 1 821  ? -31.351 -38.877 -49.929 1.00 49.39  ? 821  THR A OG1   1 
ATOM   6031  C  CG2   . THR A 1 821  ? -31.212 -39.166 -52.304 1.00 49.63  ? 821  THR A CG2   1 
ATOM   6032  N  N     . ALA A 1 822  ? -27.563 -39.842 -52.122 1.00 50.32  ? 822  ALA A N     1 
ATOM   6033  C  CA    . ALA A 1 822  ? -26.644 -39.985 -53.262 1.00 49.15  ? 822  ALA A CA    1 
ATOM   6034  C  C     . ALA A 1 822  ? -25.896 -41.294 -53.230 1.00 50.16  ? 822  ALA A C     1 
ATOM   6035  O  O     . ALA A 1 822  ? -25.601 -41.852 -54.280 1.00 51.22  ? 822  ALA A O     1 
ATOM   6036  C  CB    . ALA A 1 822  ? -25.652 -38.832 -53.302 1.00 48.56  ? 822  ALA A CB    1 
ATOM   6037  N  N     . PHE A 1 823  ? -25.572 -41.769 -52.030 1.00 51.59  ? 823  PHE A N     1 
ATOM   6038  C  CA    . PHE A 1 823  ? -24.991 -43.105 -51.856 1.00 53.52  ? 823  PHE A CA    1 
ATOM   6039  C  C     . PHE A 1 823  ? -25.901 -44.221 -52.401 1.00 53.00  ? 823  PHE A C     1 
ATOM   6040  O  O     . PHE A 1 823  ? -25.440 -45.106 -53.103 1.00 52.99  ? 823  PHE A O     1 
ATOM   6041  C  CB    . PHE A 1 823  ? -24.681 -43.368 -50.384 1.00 54.41  ? 823  PHE A CB    1 
ATOM   6042  C  CG    . PHE A 1 823  ? -23.910 -44.626 -50.157 1.00 56.51  ? 823  PHE A CG    1 
ATOM   6043  C  CD1   . PHE A 1 823  ? -22.524 -44.641 -50.306 1.00 58.02  ? 823  PHE A CD1   1 
ATOM   6044  C  CD2   . PHE A 1 823  ? -24.565 -45.808 -49.812 1.00 57.68  ? 823  PHE A CD2   1 
ATOM   6045  C  CE1   . PHE A 1 823  ? -21.796 -45.814 -50.105 1.00 59.37  ? 823  PHE A CE1   1 
ATOM   6046  C  CE2   . PHE A 1 823  ? -23.848 -46.983 -49.606 1.00 59.42  ? 823  PHE A CE2   1 
ATOM   6047  C  CZ    . PHE A 1 823  ? -22.459 -46.984 -49.749 1.00 60.17  ? 823  PHE A CZ    1 
ATOM   6048  N  N     . ALA A 1 824  ? -27.186 -44.165 -52.060 1.00 52.61  ? 824  ALA A N     1 
ATOM   6049  C  CA    . ALA A 1 824  ? -28.190 -45.086 -52.593 1.00 51.85  ? 824  ALA A CA    1 
ATOM   6050  C  C     . ALA A 1 824  ? -28.319 -44.956 -54.114 1.00 51.68  ? 824  ALA A C     1 
ATOM   6051  O  O     . ALA A 1 824  ? -28.368 -45.958 -54.823 1.00 53.20  ? 824  ALA A O     1 
ATOM   6052  C  CB    . ALA A 1 824  ? -29.537 -44.841 -51.931 1.00 50.61  ? 824  ALA A CB    1 
ATOM   6053  N  N     . ALA A 1 825  ? -28.362 -43.726 -54.610 1.00 50.23  ? 825  ALA A N     1 
ATOM   6054  C  CA    . ALA A 1 825  ? -28.571 -43.484 -56.034 1.00 49.88  ? 825  ALA A CA    1 
ATOM   6055  C  C     . ALA A 1 825  ? -27.469 -44.132 -56.840 1.00 51.65  ? 825  ALA A C     1 
ATOM   6056  O  O     . ALA A 1 825  ? -27.718 -44.917 -57.764 1.00 52.99  ? 825  ALA A O     1 
ATOM   6057  C  CB    . ALA A 1 825  ? -28.630 -41.989 -56.318 1.00 48.56  ? 825  ALA A CB    1 
ATOM   6058  N  N     . ASN A 1 826  ? -26.246 -43.802 -56.454 1.00 51.88  ? 826  ASN A N     1 
ATOM   6059  C  CA    . ASN A 1 826  ? -25.063 -44.364 -57.050 1.00 51.94  ? 826  ASN A CA    1 
ATOM   6060  C  C     . ASN A 1 826  ? -25.005 -45.886 -56.952 1.00 53.17  ? 826  ASN A C     1 
ATOM   6061  O  O     . ASN A 1 826  ? -24.653 -46.547 -57.914 1.00 54.98  ? 826  ASN A O     1 
ATOM   6062  C  CB    . ASN A 1 826  ? -23.833 -43.748 -56.392 1.00 52.02  ? 826  ASN A CB    1 
ATOM   6063  C  CG    . ASN A 1 826  ? -22.557 -44.375 -56.873 1.00 52.41  ? 826  ASN A CG    1 
ATOM   6064  O  OD1   . ASN A 1 826  ? -22.118 -44.138 -57.993 1.00 51.64  ? 826  ASN A OD1   1 
ATOM   6065  N  ND2   . ASN A 1 826  ? -21.968 -45.207 -56.034 1.00 53.84  ? 826  ASN A ND2   1 
ATOM   6066  N  N     . LYS A 1 827  ? -25.348 -46.433 -55.792 1.00 54.23  ? 827  LYS A N     1 
ATOM   6067  C  CA    . LYS A 1 827  ? -25.303 -47.879 -55.574 1.00 55.34  ? 827  LYS A CA    1 
ATOM   6068  C  C     . LYS A 1 827  ? -26.207 -48.644 -56.526 1.00 54.83  ? 827  LYS A C     1 
ATOM   6069  O  O     . LYS A 1 827  ? -25.840 -49.713 -56.994 1.00 56.21  ? 827  LYS A O     1 
ATOM   6070  C  CB    . LYS A 1 827  ? -25.695 -48.219 -54.139 1.00 56.70  ? 827  LYS A CB    1 
ATOM   6071  C  CG    . LYS A 1 827  ? -25.491 -49.678 -53.754 1.00 58.43  ? 827  LYS A CG    1 
ATOM   6072  C  CD    . LYS A 1 827  ? -25.864 -49.883 -52.298 1.00 60.21  ? 827  LYS A CD    1 
ATOM   6073  C  CE    . LYS A 1 827  ? -25.963 -51.356 -51.930 1.00 62.24  ? 827  LYS A CE    1 
ATOM   6074  N  NZ    . LYS A 1 827  ? -26.482 -51.548 -50.541 1.00 63.48  ? 827  LYS A NZ    1 
ATOM   6075  N  N     . HIS A 1 828  ? -27.383 -48.092 -56.800 1.00 53.73  ? 828  HIS A N     1 
ATOM   6076  C  CA    . HIS A 1 828  ? -28.403 -48.764 -57.609 1.00 52.77  ? 828  HIS A CA    1 
ATOM   6077  C  C     . HIS A 1 828  ? -28.573 -48.183 -59.009 1.00 50.73  ? 828  HIS A C     1 
ATOM   6078  O  O     . HIS A 1 828  ? -29.405 -48.656 -59.765 1.00 50.77  ? 828  HIS A O     1 
ATOM   6079  C  CB    . HIS A 1 828  ? -29.729 -48.736 -56.857 1.00 52.59  ? 828  HIS A CB    1 
ATOM   6080  C  CG    . HIS A 1 828  ? -29.676 -49.463 -55.555 1.00 53.93  ? 828  HIS A CG    1 
ATOM   6081  N  ND1   . HIS A 1 828  ? -29.783 -50.832 -55.467 1.00 54.74  ? 828  HIS A ND1   1 
ATOM   6082  C  CD2   . HIS A 1 828  ? -29.495 -49.017 -54.292 1.00 54.85  ? 828  HIS A CD2   1 
ATOM   6083  C  CE1   . HIS A 1 828  ? -29.689 -51.198 -54.202 1.00 55.61  ? 828  HIS A CE1   1 
ATOM   6084  N  NE2   . HIS A 1 828  ? -29.504 -50.116 -53.469 1.00 55.83  ? 828  HIS A NE2   1 
ATOM   6085  N  N     . GLY A 1 829  ? -27.775 -47.185 -59.367 1.00 49.47  ? 829  GLY A N     1 
ATOM   6086  C  CA    . GLY A 1 829  ? -27.857 -46.587 -60.694 1.00 49.73  ? 829  GLY A CA    1 
ATOM   6087  C  C     . GLY A 1 829  ? -29.236 -46.028 -60.969 1.00 49.47  ? 829  GLY A C     1 
ATOM   6088  O  O     . GLY A 1 829  ? -29.809 -46.273 -62.017 1.00 50.00  ? 829  GLY A O     1 
ATOM   6089  N  N     . ARG A 1 830  ? -29.780 -45.296 -60.007 1.00 49.29  ? 830  ARG A N     1 
ATOM   6090  C  CA    . ARG A 1 830  ? -31.147 -44.809 -60.097 1.00 48.77  ? 830  ARG A CA    1 
ATOM   6091  C  C     . ARG A 1 830  ? -31.231 -43.423 -59.526 1.00 47.98  ? 830  ARG A C     1 
ATOM   6092  O  O     . ARG A 1 830  ? -30.519 -43.092 -58.583 1.00 48.09  ? 830  ARG A O     1 
ATOM   6093  C  CB    . ARG A 1 830  ? -32.084 -45.711 -59.293 1.00 49.64  ? 830  ARG A CB    1 
ATOM   6094  C  CG    . ARG A 1 830  ? -32.331 -47.082 -59.882 1.00 49.82  ? 830  ARG A CG    1 
ATOM   6095  C  CD    . ARG A 1 830  ? -33.069 -46.990 -61.193 1.00 49.55  ? 830  ARG A CD    1 
ATOM   6096  N  NE    . ARG A 1 830  ? -33.604 -48.289 -61.554 1.00 50.93  ? 830  ARG A NE    1 
ATOM   6097  C  CZ    . ARG A 1 830  ? -34.686 -48.862 -61.026 1.00 51.90  ? 830  ARG A CZ    1 
ATOM   6098  N  NH1   . ARG A 1 830  ? -35.413 -48.261 -60.085 1.00 52.16  ? 830  ARG A NH1   1 
ATOM   6099  N  NH2   . ARG A 1 830  ? -35.056 -50.059 -61.460 1.00 53.09  ? 830  ARG A NH2   1 
ATOM   6100  N  N     . ALA A 1 831  ? -32.120 -42.611 -60.076 1.00 47.24  ? 831  ALA A N     1 
ATOM   6101  C  CA    . ALA A 1 831  ? -32.454 -41.373 -59.413 1.00 46.95  ? 831  ALA A CA    1 
ATOM   6102  C  C     . ALA A 1 831  ? -33.176 -41.734 -58.103 1.00 46.51  ? 831  ALA A C     1 
ATOM   6103  O  O     . ALA A 1 831  ? -33.944 -42.688 -58.060 1.00 45.26  ? 831  ALA A O     1 
ATOM   6104  C  CB    . ALA A 1 831  ? -33.312 -40.505 -60.303 1.00 46.69  ? 831  ALA A CB    1 
ATOM   6105  N  N     . VAL A 1 832  ? -32.864 -41.019 -57.028 1.00 46.56  ? 832  VAL A N     1 
ATOM   6106  C  CA    . VAL A 1 832  ? -33.519 -41.231 -55.737 1.00 46.34  ? 832  VAL A CA    1 
ATOM   6107  C  C     . VAL A 1 832  ? -34.024 -39.881 -55.237 1.00 46.38  ? 832  VAL A C     1 
ATOM   6108  O  O     . VAL A 1 832  ? -33.308 -38.886 -55.306 1.00 45.63  ? 832  VAL A O     1 
ATOM   6109  C  CB    . VAL A 1 832  ? -32.577 -41.889 -54.702 1.00 46.44  ? 832  VAL A CB    1 
ATOM   6110  C  CG1   . VAL A 1 832  ? -33.314 -42.145 -53.393 1.00 46.71  ? 832  VAL A CG1   1 
ATOM   6111  C  CG2   . VAL A 1 832  ? -32.020 -43.195 -55.239 1.00 46.54  ? 832  VAL A CG2   1 
ATOM   6112  N  N     . ARG A 1 833  ? -35.273 -39.866 -54.771 1.00 47.60  ? 833  ARG A N     1 
ATOM   6113  C  CA    . ARG A 1 833  ? -35.928 -38.679 -54.245 1.00 48.07  ? 833  ARG A CA    1 
ATOM   6114  C  C     . ARG A 1 833  ? -36.176 -38.904 -52.762 1.00 48.82  ? 833  ARG A C     1 
ATOM   6115  O  O     . ARG A 1 833  ? -36.611 -39.967 -52.351 1.00 48.38  ? 833  ARG A O     1 
ATOM   6116  C  CB    . ARG A 1 833  ? -37.256 -38.420 -54.965 1.00 48.65  ? 833  ARG A CB    1 
ATOM   6117  C  CG    . ARG A 1 833  ? -37.921 -37.077 -54.632 1.00 49.25  ? 833  ARG A CG    1 
ATOM   6118  C  CD    . ARG A 1 833  ? -39.314 -36.941 -55.235 1.00 48.97  ? 833  ARG A CD    1 
ATOM   6119  N  NE    . ARG A 1 833  ? -39.276 -36.911 -56.703 1.00 49.14  ? 833  ARG A NE    1 
ATOM   6120  C  CZ    . ARG A 1 833  ? -39.681 -35.919 -57.507 1.00 49.59  ? 833  ARG A CZ    1 
ATOM   6121  N  NH1   . ARG A 1 833  ? -40.214 -34.796 -57.045 1.00 50.78  ? 833  ARG A NH1   1 
ATOM   6122  N  NH2   . ARG A 1 833  ? -39.561 -36.060 -58.821 1.00 50.48  ? 833  ARG A NH2   1 
ATOM   6123  N  N     . CYS A 1 834  ? -35.885 -37.887 -51.964 1.00 50.75  ? 834  CYS A N     1 
ATOM   6124  C  CA    . CYS A 1 834  ? -36.149 -37.906 -50.535 1.00 52.12  ? 834  CYS A CA    1 
ATOM   6125  C  C     . CYS A 1 834  ? -36.895 -36.614 -50.184 1.00 51.79  ? 834  CYS A C     1 
ATOM   6126  O  O     . CYS A 1 834  ? -36.373 -35.516 -50.378 1.00 51.93  ? 834  CYS A O     1 
ATOM   6127  C  CB    . CYS A 1 834  ? -34.833 -38.006 -49.765 1.00 53.08  ? 834  CYS A CB    1 
ATOM   6128  S  SG    . CYS A 1 834  ? -35.047 -38.233 -47.994 1.00 55.99  ? 834  CYS A SG    1 
ATOM   6129  N  N     . VAL A 1 835  ? -38.136 -36.762 -49.722 1.00 51.59  ? 835  VAL A N     1 
ATOM   6130  C  CA    . VAL A 1 835  ? -38.942 -35.643 -49.228 1.00 50.56  ? 835  VAL A CA    1 
ATOM   6131  C  C     . VAL A 1 835  ? -39.473 -36.035 -47.869 1.00 50.07  ? 835  VAL A C     1 
ATOM   6132  O  O     . VAL A 1 835  ? -40.078 -37.088 -47.731 1.00 50.22  ? 835  VAL A O     1 
ATOM   6133  C  CB    . VAL A 1 835  ? -40.131 -35.332 -50.150 1.00 50.34  ? 835  VAL A CB    1 
ATOM   6134  C  CG1   . VAL A 1 835  ? -40.997 -34.211 -49.570 1.00 50.06  ? 835  VAL A CG1   1 
ATOM   6135  C  CG2   . VAL A 1 835  ? -39.625 -34.977 -51.538 1.00 50.69  ? 835  VAL A CG2   1 
ATOM   6136  N  N     . LEU A 1 836  ? -39.257 -35.175 -46.882 1.00 50.32  ? 836  LEU A N     1 
ATOM   6137  C  CA    . LEU A 1 836  ? -39.662 -35.437 -45.509 1.00 51.83  ? 836  LEU A CA    1 
ATOM   6138  C  C     . LEU A 1 836  ? -41.080 -34.935 -45.219 1.00 52.84  ? 836  LEU A C     1 
ATOM   6139  O  O     . LEU A 1 836  ? -41.487 -33.881 -45.702 1.00 53.15  ? 836  LEU A O     1 
ATOM   6140  C  CB    . LEU A 1 836  ? -38.677 -34.775 -44.540 1.00 52.40  ? 836  LEU A CB    1 
ATOM   6141  C  CG    . LEU A 1 836  ? -37.236 -35.297 -44.478 1.00 52.46  ? 836  LEU A CG    1 
ATOM   6142  C  CD1   . LEU A 1 836  ? -36.494 -34.644 -43.324 1.00 53.02  ? 836  LEU A CD1   1 
ATOM   6143  C  CD2   . LEU A 1 836  ? -37.186 -36.805 -44.315 1.00 53.31  ? 836  LEU A CD2   1 
ATOM   6144  N  N     . GLU A 1 837  ? -41.828 -35.705 -44.431 1.00 54.70  ? 837  GLU A N     1 
ATOM   6145  C  CA    . GLU A 1 837  ? -43.098 -35.238 -43.871 1.00 55.92  ? 837  GLU A CA    1 
ATOM   6146  C  C     . GLU A 1 837  ? -42.828 -34.353 -42.670 1.00 54.75  ? 837  GLU A C     1 
ATOM   6147  O  O     . GLU A 1 837  ? -41.776 -34.465 -42.030 1.00 53.85  ? 837  GLU A O     1 
ATOM   6148  C  CB    . GLU A 1 837  ? -43.979 -36.407 -43.471 1.00 58.35  ? 837  GLU A CB    1 
ATOM   6149  C  CG    . GLU A 1 837  ? -44.420 -37.210 -44.668 1.00 60.42  ? 837  GLU A CG    1 
ATOM   6150  C  CD    . GLU A 1 837  ? -45.508 -38.205 -44.343 1.00 64.16  ? 837  GLU A CD    1 
ATOM   6151  O  OE1   . GLU A 1 837  ? -46.575 -37.786 -43.838 1.00 68.37  ? 837  GLU A OE1   1 
ATOM   6152  O  OE2   . GLU A 1 837  ? -45.306 -39.404 -44.627 1.00 65.91  ? 837  GLU A OE2   1 
ATOM   6153  N  N     . ARG A 1 838  ? -43.790 -33.488 -42.369 1.00 53.52  ? 838  ARG A N     1 
ATOM   6154  C  CA    . ARG A 1 838  ? -43.611 -32.439 -41.364 1.00 54.30  ? 838  ARG A CA    1 
ATOM   6155  C  C     . ARG A 1 838  ? -43.174 -32.966 -40.007 1.00 54.24  ? 838  ARG A C     1 
ATOM   6156  O  O     . ARG A 1 838  ? -42.294 -32.388 -39.387 1.00 52.96  ? 838  ARG A O     1 
ATOM   6157  C  CB    . ARG A 1 838  ? -44.907 -31.634 -41.207 1.00 55.44  ? 838  ARG A CB    1 
ATOM   6158  C  CG    . ARG A 1 838  ? -44.869 -30.506 -40.186 1.00 55.56  ? 838  ARG A CG    1 
ATOM   6159  C  CD    . ARG A 1 838  ? -43.813 -29.473 -40.527 1.00 55.06  ? 838  ARG A CD    1 
ATOM   6160  N  NE    . ARG A 1 838  ? -44.053 -28.828 -41.817 1.00 54.52  ? 838  ARG A NE    1 
ATOM   6161  C  CZ    . ARG A 1 838  ? -43.286 -27.867 -42.335 1.00 54.24  ? 838  ARG A CZ    1 
ATOM   6162  N  NH1   . ARG A 1 838  ? -42.210 -27.425 -41.687 1.00 54.46  ? 838  ARG A NH1   1 
ATOM   6163  N  NH2   . ARG A 1 838  ? -43.594 -27.337 -43.515 1.00 53.52  ? 838  ARG A NH2   1 
ATOM   6164  N  N     . GLY A 1 839  ? -43.802 -34.051 -39.551 1.00 56.09  ? 839  GLY A N     1 
ATOM   6165  C  CA    . GLY A 1 839  ? -43.465 -34.688 -38.269 1.00 58.10  ? 839  GLY A CA    1 
ATOM   6166  C  C     . GLY A 1 839  ? -42.021 -35.164 -38.175 1.00 60.02  ? 839  GLY A C     1 
ATOM   6167  O  O     . GLY A 1 839  ? -41.332 -34.862 -37.204 1.00 60.46  ? 839  GLY A O     1 
ATOM   6168  N  N     . GLU A 1 840  ? -41.576 -35.905 -39.192 1.00 61.91  ? 840  GLU A N     1 
ATOM   6169  C  CA    . GLU A 1 840  ? -40.172 -36.345 -39.319 1.00 63.62  ? 840  GLU A CA    1 
ATOM   6170  C  C     . GLU A 1 840  ? -39.216 -35.156 -39.422 1.00 62.46  ? 840  GLU A C     1 
ATOM   6171  O  O     . GLU A 1 840  ? -38.108 -35.200 -38.900 1.00 60.73  ? 840  GLU A O     1 
ATOM   6172  C  CB    . GLU A 1 840  ? -39.940 -37.158 -40.601 1.00 65.09  ? 840  GLU A CB    1 
ATOM   6173  C  CG    . GLU A 1 840  ? -40.784 -38.394 -40.844 1.00 67.83  ? 840  GLU A CG    1 
ATOM   6174  C  CD    . GLU A 1 840  ? -40.593 -38.912 -42.270 1.00 69.67  ? 840  GLU A CD    1 
ATOM   6175  O  OE1   . GLU A 1 840  ? -41.136 -38.298 -43.220 1.00 67.37  ? 840  GLU A OE1   1 
ATOM   6176  O  OE2   . GLU A 1 840  ? -39.873 -39.925 -42.445 1.00 73.61  ? 840  GLU A OE2   1 
ATOM   6177  N  N     . ASP A 1 841  ? -39.642 -34.132 -40.160 1.00 61.55  ? 841  ASP A N     1 
ATOM   6178  C  CA    . ASP A 1 841  ? -38.820 -32.962 -40.446 1.00 62.40  ? 841  ASP A CA    1 
ATOM   6179  C  C     . ASP A 1 841  ? -38.468 -32.240 -39.156 1.00 65.11  ? 841  ASP A C     1 
ATOM   6180  O  O     . ASP A 1 841  ? -37.296 -32.005 -38.895 1.00 66.06  ? 841  ASP A O     1 
ATOM   6181  C  CB    . ASP A 1 841  ? -39.556 -32.022 -41.406 1.00 61.78  ? 841  ASP A CB    1 
ATOM   6182  C  CG    . ASP A 1 841  ? -38.638 -31.042 -42.109 1.00 61.69  ? 841  ASP A CG    1 
ATOM   6183  O  OD1   . ASP A 1 841  ? -37.937 -30.261 -41.443 1.00 63.40  ? 841  ASP A OD1   1 
ATOM   6184  O  OD2   . ASP A 1 841  ? -38.653 -31.022 -43.352 1.00 62.37  ? 841  ASP A OD2   1 
ATOM   6185  N  N     . MET A 1 842  ? -39.482 -31.926 -38.351 1.00 67.96  ? 842  MET A N     1 
ATOM   6186  C  CA    . MET A 1 842  ? -39.295 -31.265 -37.051 1.00 71.57  ? 842  MET A CA    1 
ATOM   6187  C  C     . MET A 1 842  ? -38.405 -32.052 -36.092 1.00 71.44  ? 842  MET A C     1 
ATOM   6188  O  O     . MET A 1 842  ? -37.662 -31.464 -35.312 1.00 75.52  ? 842  MET A O     1 
ATOM   6189  C  CB    . MET A 1 842  ? -40.649 -30.999 -36.374 1.00 75.06  ? 842  MET A CB    1 
ATOM   6190  C  CG    . MET A 1 842  ? -41.463 -29.894 -37.034 1.00 77.02  ? 842  MET A CG    1 
ATOM   6191  S  SD    . MET A 1 842  ? -42.942 -29.425 -36.108 1.00 81.98  ? 842  MET A SD    1 
ATOM   6192  C  CE    . MET A 1 842  ? -43.888 -30.953 -36.176 1.00 79.97  ? 842  MET A CE    1 
ATOM   6193  N  N     . LEU A 1 843  ? -38.481 -33.373 -36.170 1.00 70.11  ? 843  LEU A N     1 
ATOM   6194  C  CA    . LEU A 1 843  ? -37.714 -34.288 -35.314 1.00 71.71  ? 843  LEU A CA    1 
ATOM   6195  C  C     . LEU A 1 843  ? -36.244 -34.426 -35.741 1.00 70.36  ? 843  LEU A C     1 
ATOM   6196  O  O     . LEU A 1 843  ? -35.338 -34.398 -34.907 1.00 72.66  ? 843  LEU A O     1 
ATOM   6197  C  CB    . LEU A 1 843  ? -38.396 -35.666 -35.340 1.00 73.52  ? 843  LEU A CB    1 
ATOM   6198  C  CG    . LEU A 1 843  ? -38.222 -36.641 -34.181 1.00 77.10  ? 843  LEU A CG    1 
ATOM   6199  C  CD1   . LEU A 1 843  ? -38.524 -35.979 -32.841 1.00 79.28  ? 843  LEU A CD1   1 
ATOM   6200  C  CD2   . LEU A 1 843  ? -39.115 -37.860 -34.402 1.00 77.45  ? 843  LEU A CD2   1 
ATOM   6201  N  N     . ILE A 1 844  ? -36.025 -34.583 -37.044 1.00 68.83  ? 844  ILE A N     1 
ATOM   6202  C  CA    . ILE A 1 844  ? -34.687 -34.782 -37.628 1.00 68.02  ? 844  ILE A CA    1 
ATOM   6203  C  C     . ILE A 1 844  ? -33.877 -33.480 -37.672 1.00 68.93  ? 844  ILE A C     1 
ATOM   6204  O  O     . ILE A 1 844  ? -32.708 -33.463 -37.298 1.00 65.62  ? 844  ILE A O     1 
ATOM   6205  C  CB    . ILE A 1 844  ? -34.801 -35.380 -39.054 1.00 65.57  ? 844  ILE A CB    1 
ATOM   6206  C  CG1   . ILE A 1 844  ? -35.342 -36.815 -38.968 1.00 65.92  ? 844  ILE A CG1   1 
ATOM   6207  C  CG2   . ILE A 1 844  ? -33.463 -35.339 -39.789 1.00 64.79  ? 844  ILE A CG2   1 
ATOM   6208  C  CD1   . ILE A 1 844  ? -35.839 -37.398 -40.278 1.00 64.62  ? 844  ILE A CD1   1 
ATOM   6209  N  N     . THR A 1 845  ? -34.499 -32.413 -38.177 1.00 72.01  ? 845  THR A N     1 
ATOM   6210  C  CA    . THR A 1 845  ? -33.899 -31.082 -38.174 1.00 73.98  ? 845  THR A CA    1 
ATOM   6211  C  C     . THR A 1 845  ? -33.912 -30.581 -36.729 1.00 75.40  ? 845  THR A C     1 
ATOM   6212  O  O     . THR A 1 845  ? -34.725 -31.027 -35.904 1.00 77.78  ? 845  THR A O     1 
ATOM   6213  C  CB    . THR A 1 845  ? -34.626 -30.094 -39.145 1.00 76.15  ? 845  THR A CB    1 
ATOM   6214  O  OG1   . THR A 1 845  ? -33.713 -29.077 -39.576 1.00 79.96  ? 845  THR A OG1   1 
ATOM   6215  C  CG2   . THR A 1 845  ? -35.866 -29.383 -38.511 1.00 77.72  ? 845  THR A CG2   1 
ATOM   6216  N  N     . GLY A 1 846  ? -33.012 -29.662 -36.415 1.00 74.46  ? 846  GLY A N     1 
ATOM   6217  C  CA    . GLY A 1 846  ? -33.012 -29.047 -35.096 1.00 74.63  ? 846  GLY A CA    1 
ATOM   6218  C  C     . GLY A 1 846  ? -33.981 -27.883 -35.034 1.00 72.69  ? 846  GLY A C     1 
ATOM   6219  O  O     . GLY A 1 846  ? -35.050 -27.891 -35.656 1.00 73.95  ? 846  GLY A O     1 
ATOM   6220  N  N     . GLY A 1 847  ? -33.596 -26.881 -34.258 1.00 70.22  ? 847  GLY A N     1 
ATOM   6221  C  CA    . GLY A 1 847  ? -34.260 -25.593 -34.254 1.00 68.11  ? 847  GLY A CA    1 
ATOM   6222  C  C     . GLY A 1 847  ? -33.310 -24.548 -33.724 1.00 66.95  ? 847  GLY A C     1 
ATOM   6223  O  O     . GLY A 1 847  ? -32.095 -24.730 -33.746 1.00 67.24  ? 847  GLY A O     1 
ATOM   6224  N  N     . ARG A 1 848  ? -33.868 -23.457 -33.227 1.00 66.24  ? 848  ARG A N     1 
ATOM   6225  C  CA    . ARG A 1 848  ? -33.076 -22.431 -32.567 1.00 66.49  ? 848  ARG A CA    1 
ATOM   6226  C  C     . ARG A 1 848  ? -32.544 -22.978 -31.243 1.00 67.81  ? 848  ARG A C     1 
ATOM   6227  O  O     . ARG A 1 848  ? -33.186 -23.828 -30.621 1.00 68.21  ? 848  ARG A O     1 
ATOM   6228  C  CB    . ARG A 1 848  ? -33.920 -21.187 -32.313 1.00 66.26  ? 848  ARG A CB    1 
ATOM   6229  C  CG    . ARG A 1 848  ? -33.090 -19.960 -32.012 1.00 67.22  ? 848  ARG A CG    1 
ATOM   6230  C  CD    . ARG A 1 848  ? -33.960 -18.804 -31.577 1.00 67.54  ? 848  ARG A CD    1 
ATOM   6231  N  NE    . ARG A 1 848  ? -34.721 -18.220 -32.679 1.00 65.70  ? 848  ARG A NE    1 
ATOM   6232  C  CZ    . ARG A 1 848  ? -34.218 -17.440 -33.638 1.00 64.78  ? 848  ARG A CZ    1 
ATOM   6233  N  NH1   . ARG A 1 848  ? -32.912 -17.149 -33.700 1.00 65.42  ? 848  ARG A NH1   1 
ATOM   6234  N  NH2   . ARG A 1 848  ? -35.036 -16.945 -34.561 1.00 63.67  ? 848  ARG A NH2   1 
ATOM   6235  N  N     . HIS A 1 849  ? -31.381 -22.484 -30.823 1.00 67.75  ? 849  HIS A N     1 
ATOM   6236  C  CA    . HIS A 1 849  ? -30.799 -22.858 -29.532 1.00 68.15  ? 849  HIS A CA    1 
ATOM   6237  C  C     . HIS A 1 849  ? -31.608 -22.257 -28.381 1.00 67.37  ? 849  HIS A C     1 
ATOM   6238  O  O     . HIS A 1 849  ? -31.805 -21.036 -28.337 1.00 66.04  ? 849  HIS A O     1 
ATOM   6239  C  CB    . HIS A 1 849  ? -29.356 -22.357 -29.414 1.00 70.14  ? 849  HIS A CB    1 
ATOM   6240  C  CG    . HIS A 1 849  ? -28.428 -22.916 -30.446 1.00 70.39  ? 849  HIS A CG    1 
ATOM   6241  N  ND1   . HIS A 1 849  ? -27.576 -23.970 -30.188 1.00 72.36  ? 849  HIS A ND1   1 
ATOM   6242  C  CD2   . HIS A 1 849  ? -28.212 -22.564 -31.735 1.00 69.79  ? 849  HIS A CD2   1 
ATOM   6243  C  CE1   . HIS A 1 849  ? -26.882 -24.249 -31.277 1.00 71.12  ? 849  HIS A CE1   1 
ATOM   6244  N  NE2   . HIS A 1 849  ? -27.247 -23.409 -32.229 1.00 70.25  ? 849  HIS A NE2   1 
ATOM   6245  N  N     . PRO A 1 850  ? -32.103 -23.107 -27.462 1.00 67.47  ? 850  PRO A N     1 
ATOM   6246  C  CA    . PRO A 1 850  ? -32.583 -22.575 -26.194 1.00 69.09  ? 850  PRO A CA    1 
ATOM   6247  C  C     . PRO A 1 850  ? -31.415 -22.007 -25.385 1.00 71.56  ? 850  PRO A C     1 
ATOM   6248  O  O     . PRO A 1 850  ? -30.291 -22.519 -25.488 1.00 73.08  ? 850  PRO A O     1 
ATOM   6249  C  CB    . PRO A 1 850  ? -33.194 -23.800 -25.502 1.00 68.86  ? 850  PRO A CB    1 
ATOM   6250  C  CG    . PRO A 1 850  ? -33.526 -24.734 -26.600 1.00 67.23  ? 850  PRO A CG    1 
ATOM   6251  C  CD    . PRO A 1 850  ? -32.432 -24.535 -27.597 1.00 67.11  ? 850  PRO A CD    1 
ATOM   6252  N  N     . TYR A 1 851  ? -31.687 -20.960 -24.603 1.00 71.93  ? 851  TYR A N     1 
ATOM   6253  C  CA    . TYR A 1 851  ? -30.655 -20.210 -23.882 1.00 71.99  ? 851  TYR A CA    1 
ATOM   6254  C  C     . TYR A 1 851  ? -30.991 -20.121 -22.405 1.00 73.03  ? 851  TYR A C     1 
ATOM   6255  O  O     . TYR A 1 851  ? -32.166 -20.095 -22.019 1.00 72.06  ? 851  TYR A O     1 
ATOM   6256  C  CB    . TYR A 1 851  ? -30.520 -18.788 -24.452 1.00 71.45  ? 851  TYR A CB    1 
ATOM   6257  C  CG    . TYR A 1 851  ? -29.260 -18.509 -25.255 1.00 71.25  ? 851  TYR A CG    1 
ATOM   6258  C  CD1   . TYR A 1 851  ? -28.982 -19.205 -26.440 1.00 70.27  ? 851  TYR A CD1   1 
ATOM   6259  C  CD2   . TYR A 1 851  ? -28.366 -17.508 -24.859 1.00 71.92  ? 851  TYR A CD2   1 
ATOM   6260  C  CE1   . TYR A 1 851  ? -27.833 -18.927 -27.187 1.00 70.02  ? 851  TYR A CE1   1 
ATOM   6261  C  CE2   . TYR A 1 851  ? -27.219 -17.226 -25.597 1.00 71.69  ? 851  TYR A CE2   1 
ATOM   6262  C  CZ    . TYR A 1 851  ? -26.949 -17.930 -26.759 1.00 70.51  ? 851  TYR A CZ    1 
ATOM   6263  O  OH    . TYR A 1 851  ? -25.802 -17.644 -27.479 1.00 69.27  ? 851  TYR A OH    1 
ATOM   6264  N  N     . LEU A 1 852  ? -29.942 -20.068 -21.592 1.00 74.20  ? 852  LEU A N     1 
ATOM   6265  C  CA    . LEU A 1 852  ? -30.046 -19.680 -20.193 1.00 76.72  ? 852  LEU A CA    1 
ATOM   6266  C  C     . LEU A 1 852  ? -29.135 -18.473 -19.961 1.00 77.89  ? 852  LEU A C     1 
ATOM   6267  O  O     . LEU A 1 852  ? -27.944 -18.518 -20.276 1.00 79.09  ? 852  LEU A O     1 
ATOM   6268  C  CB    . LEU A 1 852  ? -29.654 -20.842 -19.283 1.00 77.93  ? 852  LEU A CB    1 
ATOM   6269  C  CG    . LEU A 1 852  ? -29.435 -20.543 -17.801 1.00 79.51  ? 852  LEU A CG    1 
ATOM   6270  C  CD1   . LEU A 1 852  ? -30.656 -19.864 -17.193 1.00 79.81  ? 852  LEU A CD1   1 
ATOM   6271  C  CD2   . LEU A 1 852  ? -29.104 -21.837 -17.082 1.00 80.59  ? 852  LEU A CD2   1 
ATOM   6272  N  N     . GLY A 1 853  ? -29.705 -17.398 -19.422 1.00 78.19  ? 853  GLY A N     1 
ATOM   6273  C  CA    . GLY A 1 853  ? -28.952 -16.185 -19.117 1.00 79.78  ? 853  GLY A CA    1 
ATOM   6274  C  C     . GLY A 1 853  ? -28.914 -15.979 -17.621 1.00 81.12  ? 853  GLY A C     1 
ATOM   6275  O  O     . GLY A 1 853  ? -29.955 -16.013 -16.991 1.00 82.06  ? 853  GLY A O     1 
ATOM   6276  N  N     . LYS A 1 854  ? -27.725 -15.804 -17.052 1.00 82.33  ? 854  LYS A N     1 
ATOM   6277  C  CA    . LYS A 1 854  ? -27.574 -15.395 -15.654 1.00 84.62  ? 854  LYS A CA    1 
ATOM   6278  C  C     . LYS A 1 854  ? -26.813 -14.087 -15.633 1.00 85.88  ? 854  LYS A C     1 
ATOM   6279  O  O     . LYS A 1 854  ? -25.832 -13.935 -16.362 1.00 86.06  ? 854  LYS A O     1 
ATOM   6280  C  CB    . LYS A 1 854  ? -26.798 -16.430 -14.853 1.00 86.07  ? 854  LYS A CB    1 
ATOM   6281  C  CG    . LYS A 1 854  ? -27.456 -17.787 -14.797 1.00 86.24  ? 854  LYS A CG    1 
ATOM   6282  C  CD    . LYS A 1 854  ? -26.695 -18.723 -13.874 1.00 88.36  ? 854  LYS A CD    1 
ATOM   6283  C  CE    . LYS A 1 854  ? -27.097 -20.170 -14.117 1.00 88.44  ? 854  LYS A CE    1 
ATOM   6284  N  NZ    . LYS A 1 854  ? -26.435 -21.105 -13.166 1.00 90.40  ? 854  LYS A NZ    1 
ATOM   6285  N  N     . TYR A 1 855  ? -27.255 -13.152 -14.797 1.00 87.39  ? 855  TYR A N     1 
ATOM   6286  C  CA    . TYR A 1 855  ? -26.610 -11.850 -14.709 1.00 88.70  ? 855  TYR A CA    1 
ATOM   6287  C  C     . TYR A 1 855  ? -26.505 -11.334 -13.288 1.00 91.57  ? 855  TYR A C     1 
ATOM   6288  O  O     . TYR A 1 855  ? -27.361 -11.624 -12.455 1.00 92.02  ? 855  TYR A O     1 
ATOM   6289  C  CB    . TYR A 1 855  ? -27.332 -10.818 -15.581 1.00 87.69  ? 855  TYR A CB    1 
ATOM   6290  C  CG    . TYR A 1 855  ? -28.837 -10.788 -15.452 1.00 86.99  ? 855  TYR A CG    1 
ATOM   6291  C  CD1   . TYR A 1 855  ? -29.458 -10.173 -14.365 1.00 88.21  ? 855  TYR A CD1   1 
ATOM   6292  C  CD2   . TYR A 1 855  ? -29.646 -11.346 -16.443 1.00 85.79  ? 855  TYR A CD2   1 
ATOM   6293  C  CE1   . TYR A 1 855  ? -30.841 -10.133 -14.257 1.00 87.90  ? 855  TYR A CE1   1 
ATOM   6294  C  CE2   . TYR A 1 855  ? -31.028 -11.312 -16.347 1.00 85.46  ? 855  TYR A CE2   1 
ATOM   6295  C  CZ    . TYR A 1 855  ? -31.619 -10.707 -15.253 1.00 86.82  ? 855  TYR A CZ    1 
ATOM   6296  O  OH    . TYR A 1 855  ? -32.986 -10.678 -15.173 1.00 86.48  ? 855  TYR A OH    1 
ATOM   6297  N  N     . LYS A 1 856  ? -25.424 -10.590 -13.037 1.00 93.59  ? 856  LYS A N     1 
ATOM   6298  C  CA    . LYS A 1 856  ? -25.253 -9.755  -11.848 1.00 96.12  ? 856  LYS A CA    1 
ATOM   6299  C  C     . LYS A 1 856  ? -25.078 -8.315  -12.357 1.00 94.45  ? 856  LYS A C     1 
ATOM   6300  O  O     . LYS A 1 856  ? -24.136 -8.035  -13.103 1.00 92.85  ? 856  LYS A O     1 
ATOM   6301  C  CB    . LYS A 1 856  ? -24.036 -10.188 -11.002 1.00 99.37  ? 856  LYS A CB    1 
ATOM   6302  C  CG    . LYS A 1 856  ? -24.062 -11.644 -10.507 1.00 100.86 ? 856  LYS A CG    1 
ATOM   6303  C  CD    . LYS A 1 856  ? -22.958 -12.557 -11.079 1.00 101.00 ? 856  LYS A CD    1 
ATOM   6304  C  CE    . LYS A 1 856  ? -23.320 -13.264 -12.394 1.00 98.41  ? 856  LYS A CE    1 
ATOM   6305  N  NZ    . LYS A 1 856  ? -24.360 -14.323 -12.264 1.00 97.07  ? 856  LYS A NZ    1 
ATOM   6306  N  N     . ALA A 1 857  ? -26.000 -7.425  -11.978 1.00 93.49  ? 857  ALA A N     1 
ATOM   6307  C  CA    . ALA A 1 857  ? -26.011 -6.039  -12.450 1.00 92.01  ? 857  ALA A CA    1 
ATOM   6308  C  C     . ALA A 1 857  ? -25.829 -5.077  -11.281 1.00 94.00  ? 857  ALA A C     1 
ATOM   6309  O  O     . ALA A 1 857  ? -26.630 -5.082  -10.349 1.00 94.43  ? 857  ALA A O     1 
ATOM   6310  C  CB    . ALA A 1 857  ? -27.312 -5.744  -13.167 1.00 89.84  ? 857  ALA A CB    1 
ATOM   6311  N  N     . GLY A 1 858  ? -24.764 -4.277  -11.331 1.00 94.15  ? 858  GLY A N     1 
ATOM   6312  C  CA    . GLY A 1 858  ? -24.551 -3.176  -10.396 1.00 96.66  ? 858  GLY A CA    1 
ATOM   6313  C  C     . GLY A 1 858  ? -25.007 -1.870  -11.021 1.00 96.11  ? 858  GLY A C     1 
ATOM   6314  O  O     . GLY A 1 858  ? -24.526 -1.499  -12.092 1.00 95.05  ? 858  GLY A O     1 
ATOM   6315  N  N     . PHE A 1 859  ? -25.918 -1.164  -10.355 1.00 97.07  ? 859  PHE A N     1 
ATOM   6316  C  CA    . PHE A 1 859  ? -26.548 0.018   -10.947 1.00 97.16  ? 859  PHE A CA    1 
ATOM   6317  C  C     . PHE A 1 859  ? -26.751 1.167   -9.962  1.00 99.18  ? 859  PHE A C     1 
ATOM   6318  O  O     . PHE A 1 859  ? -26.725 0.981   -8.746  1.00 100.40 ? 859  PHE A O     1 
ATOM   6319  C  CB    . PHE A 1 859  ? -27.884 -0.358  -11.614 1.00 95.28  ? 859  PHE A CB    1 
ATOM   6320  C  CG    . PHE A 1 859  ? -28.876 -1.001  -10.679 1.00 95.97  ? 859  PHE A CG    1 
ATOM   6321  C  CD1   . PHE A 1 859  ? -28.759 -2.342  -10.342 1.00 95.81  ? 859  PHE A CD1   1 
ATOM   6322  C  CD2   . PHE A 1 859  ? -29.933 -0.271  -10.138 1.00 96.78  ? 859  PHE A CD2   1 
ATOM   6323  C  CE1   . PHE A 1 859  ? -29.663 -2.938  -9.473  1.00 96.52  ? 859  PHE A CE1   1 
ATOM   6324  C  CE2   . PHE A 1 859  ? -30.845 -0.867  -9.271  1.00 97.33  ? 859  PHE A CE2   1 
ATOM   6325  C  CZ    . PHE A 1 859  ? -30.711 -2.202  -8.939  1.00 96.85  ? 859  PHE A CZ    1 
ATOM   6326  N  N     . MET A 1 860  ? -26.950 2.354   -10.531 1.00 99.69  ? 860  MET A N     1 
ATOM   6327  C  CA    . MET A 1 860  ? -27.222 3.583   -9.786  1.00 101.88 ? 860  MET A CA    1 
ATOM   6328  C  C     . MET A 1 860  ? -28.726 3.695   -9.578  1.00 101.04 ? 860  MET A C     1 
ATOM   6329  O  O     . MET A 1 860  ? -29.505 3.082   -10.312 1.00 98.83  ? 860  MET A O     1 
ATOM   6330  C  CB    . MET A 1 860  ? -26.757 4.803   -10.588 1.00 102.67 ? 860  MET A CB    1 
ATOM   6331  C  CG    . MET A 1 860  ? -25.311 4.779   -11.059 1.00 103.24 ? 860  MET A CG    1 
ATOM   6332  S  SD    . MET A 1 860  ? -24.157 5.199   -9.747  1.00 107.47 ? 860  MET A SD    1 
ATOM   6333  C  CE    . MET A 1 860  ? -23.878 3.624   -8.975  1.00 106.59 ? 860  MET A CE    1 
ATOM   6334  N  N     . ASN A 1 861  ? -29.140 4.513   -8.616  1.00 102.08 ? 861  ASN A N     1 
ATOM   6335  C  CA    . ASN A 1 861  ? -30.571 4.718   -8.364  1.00 101.77 ? 861  ASN A CA    1 
ATOM   6336  C  C     . ASN A 1 861  ? -31.332 5.436   -9.494  1.00 100.53 ? 861  ASN A C     1 
ATOM   6337  O  O     . ASN A 1 861  ? -32.569 5.314   -9.578  1.00 99.80  ? 861  ASN A O     1 
ATOM   6338  C  CB    . ASN A 1 861  ? -30.792 5.405   -7.007  1.00 103.69 ? 861  ASN A CB    1 
ATOM   6339  C  CG    . ASN A 1 861  ? -30.543 4.465   -5.831  1.00 104.41 ? 861  ASN A CG    1 
ATOM   6340  O  OD1   . ASN A 1 861  ? -30.123 3.320   -6.003  1.00 104.00 ? 861  ASN A OD1   1 
ATOM   6341  N  ND2   . ASN A 1 861  ? -30.814 4.942   -4.635  1.00 105.98 ? 861  ASN A ND2   1 
ATOM   6342  N  N     . ASP A 1 862  ? -30.600 6.145   -10.366 1.00 100.31 ? 862  ASP A N     1 
ATOM   6343  C  CA    . ASP A 1 862  ? -31.165 6.670   -11.627 1.00 99.17  ? 862  ASP A CA    1 
ATOM   6344  C  C     . ASP A 1 862  ? -31.300 5.615   -12.750 1.00 97.25  ? 862  ASP A C     1 
ATOM   6345  O  O     . ASP A 1 862  ? -31.665 5.957   -13.877 1.00 95.39  ? 862  ASP A O     1 
ATOM   6346  C  CB    . ASP A 1 862  ? -30.369 7.897   -12.129 1.00 100.29 ? 862  ASP A CB    1 
ATOM   6347  C  CG    . ASP A 1 862  ? -28.930 7.564   -12.582 1.00 100.55 ? 862  ASP A CG    1 
ATOM   6348  O  OD1   . ASP A 1 862  ? -28.655 6.445   -13.060 1.00 98.93  ? 862  ASP A OD1   1 
ATOM   6349  O  OD2   . ASP A 1 862  ? -28.058 8.450   -12.467 1.00 102.82 ? 862  ASP A OD2   1 
ATOM   6350  N  N     . GLY A 1 863  ? -30.980 4.353   -12.455 1.00 97.07  ? 863  GLY A N     1 
ATOM   6351  C  CA    . GLY A 1 863  ? -31.120 3.264   -13.411 1.00 95.22  ? 863  GLY A CA    1 
ATOM   6352  C  C     . GLY A 1 863  ? -29.920 3.013   -14.311 1.00 94.88  ? 863  GLY A C     1 
ATOM   6353  O  O     . GLY A 1 863  ? -29.978 2.115   -15.154 1.00 94.28  ? 863  GLY A O     1 
ATOM   6354  N  N     . ARG A 1 864  ? -28.837 3.779   -14.154 1.00 96.19  ? 864  ARG A N     1 
ATOM   6355  C  CA    . ARG A 1 864  ? -27.635 3.593   -14.981 1.00 95.93  ? 864  ARG A CA    1 
ATOM   6356  C  C     . ARG A 1 864  ? -26.843 2.388   -14.482 1.00 95.78  ? 864  ARG A C     1 
ATOM   6357  O  O     . ARG A 1 864  ? -26.650 2.223   -13.277 1.00 96.88  ? 864  ARG A O     1 
ATOM   6358  C  CB    . ARG A 1 864  ? -26.751 4.842   -14.972 1.00 98.14  ? 864  ARG A CB    1 
ATOM   6359  C  CG    . ARG A 1 864  ? -25.589 4.809   -15.958 1.00 97.91  ? 864  ARG A CG    1 
ATOM   6360  C  CD    . ARG A 1 864  ? -24.933 6.181   -16.089 1.00 100.02 ? 864  ARG A CD    1 
ATOM   6361  N  NE    . ARG A 1 864  ? -24.483 6.707   -14.787 1.00 102.70 ? 864  ARG A NE    1 
ATOM   6362  C  CZ    . ARG A 1 864  ? -24.908 7.825   -14.180 1.00 103.54 ? 864  ARG A CZ    1 
ATOM   6363  N  NH1   . ARG A 1 864  ? -25.819 8.643   -14.723 1.00 103.23 ? 864  ARG A NH1   1 
ATOM   6364  N  NH2   . ARG A 1 864  ? -24.390 8.141   -12.998 1.00 105.56 ? 864  ARG A NH2   1 
ATOM   6365  N  N     . ILE A 1 865  ? -26.381 1.566   -15.424 1.00 93.80  ? 865  ILE A N     1 
ATOM   6366  C  CA    . ILE A 1 865  ? -25.777 0.276   -15.127 1.00 93.30  ? 865  ILE A CA    1 
ATOM   6367  C  C     . ILE A 1 865  ? -24.279 0.384   -15.378 1.00 93.74  ? 865  ILE A C     1 
ATOM   6368  O  O     . ILE A 1 865  ? -23.815 0.262   -16.510 1.00 93.30  ? 865  ILE A O     1 
ATOM   6369  C  CB    . ILE A 1 865  ? -26.432 -0.844  -15.970 1.00 91.23  ? 865  ILE A CB    1 
ATOM   6370  C  CG1   . ILE A 1 865  ? -27.913 -0.992  -15.570 1.00 90.86  ? 865  ILE A CG1   1 
ATOM   6371  C  CG2   . ILE A 1 865  ? -25.692 -2.170  -15.793 1.00 91.05  ? 865  ILE A CG2   1 
ATOM   6372  C  CD1   . ILE A 1 865  ? -28.725 -1.917  -16.451 1.00 88.71  ? 865  ILE A CD1   1 
ATOM   6373  N  N     . LEU A 1 866  ? -23.534 0.620   -14.303 1.00 95.37  ? 866  LEU A N     1 
ATOM   6374  C  CA    . LEU A 1 866  ? -22.087 0.779   -14.373 1.00 96.19  ? 866  LEU A CA    1 
ATOM   6375  C  C     . LEU A 1 866  ? -21.335 -0.545  -14.345 1.00 95.16  ? 866  LEU A C     1 
ATOM   6376  O  O     . LEU A 1 866  ? -20.244 -0.622  -14.894 1.00 95.13  ? 866  LEU A O     1 
ATOM   6377  C  CB    . LEU A 1 866  ? -21.598 1.676   -13.234 1.00 99.74  ? 866  LEU A CB    1 
ATOM   6378  C  CG    . LEU A 1 866  ? -22.149 3.107   -13.240 1.00 100.89 ? 866  LEU A CG    1 
ATOM   6379  C  CD1   . LEU A 1 866  ? -21.667 3.850   -12.004 1.00 103.81 ? 866  LEU A CD1   1 
ATOM   6380  C  CD2   . LEU A 1 866  ? -21.759 3.854   -14.515 1.00 100.24 ? 866  LEU A CD2   1 
ATOM   6381  N  N     . ALA A 1 867  ? -21.905 -1.567  -13.704 1.00 94.94  ? 867  ALA A N     1 
ATOM   6382  C  CA    . ALA A 1 867  ? -21.328 -2.923  -13.674 1.00 94.58  ? 867  ALA A CA    1 
ATOM   6383  C  C     . ALA A 1 867  ? -22.307 -3.969  -14.212 1.00 92.24  ? 867  ALA A C     1 
ATOM   6384  O  O     . ALA A 1 867  ? -23.498 -3.914  -13.913 1.00 92.15  ? 867  ALA A O     1 
ATOM   6385  C  CB    . ALA A 1 867  ? -20.930 -3.277  -12.253 1.00 96.67  ? 867  ALA A CB    1 
ATOM   6386  N  N     . LEU A 1 868  ? -21.809 -4.929  -14.988 1.00 90.94  ? 868  LEU A N     1 
ATOM   6387  C  CA    . LEU A 1 868  ? -22.653 -6.009  -15.514 1.00 89.39  ? 868  LEU A CA    1 
ATOM   6388  C  C     . LEU A 1 868  ? -21.853 -7.289  -15.763 1.00 89.47  ? 868  LEU A C     1 
ATOM   6389  O  O     . LEU A 1 868  ? -21.104 -7.377  -16.730 1.00 88.98  ? 868  LEU A O     1 
ATOM   6390  C  CB    . LEU A 1 868  ? -23.360 -5.562  -16.810 1.00 87.27  ? 868  LEU A CB    1 
ATOM   6391  C  CG    . LEU A 1 868  ? -24.329 -6.543  -17.509 1.00 84.51  ? 868  LEU A CG    1 
ATOM   6392  C  CD1   . LEU A 1 868  ? -25.480 -6.958  -16.604 1.00 84.50  ? 868  LEU A CD1   1 
ATOM   6393  C  CD2   . LEU A 1 868  ? -24.883 -5.947  -18.791 1.00 82.64  ? 868  LEU A CD2   1 
ATOM   6394  N  N     . ASP A 1 869  ? -22.018 -8.271  -14.881 1.00 90.77  ? 869  ASP A N     1 
ATOM   6395  C  CA    . ASP A 1 869  ? -21.479 -9.616  -15.090 1.00 91.59  ? 869  ASP A CA    1 
ATOM   6396  C  C     . ASP A 1 869  ? -22.581 -10.478 -15.714 1.00 89.30  ? 869  ASP A C     1 
ATOM   6397  O  O     . ASP A 1 869  ? -23.716 -10.471 -15.240 1.00 88.84  ? 869  ASP A O     1 
ATOM   6398  C  CB    . ASP A 1 869  ? -20.996 -10.209 -13.760 1.00 94.64  ? 869  ASP A CB    1 
ATOM   6399  C  CG    . ASP A 1 869  ? -20.297 -11.553 -13.928 1.00 95.76  ? 869  ASP A CG    1 
ATOM   6400  O  OD1   . ASP A 1 869  ? -20.933 -12.506 -14.450 1.00 96.07  ? 869  ASP A OD1   1 
ATOM   6401  O  OD2   . ASP A 1 869  ? -19.117 -11.659 -13.524 1.00 96.84  ? 869  ASP A OD2   1 
ATOM   6402  N  N     . MET A 1 870  ? -22.224 -11.236 -16.752 1.00 87.99  ? 870  MET A N     1 
ATOM   6403  C  CA    . MET A 1 870  ? -23.195 -11.896 -17.636 1.00 85.89  ? 870  MET A CA    1 
ATOM   6404  C  C     . MET A 1 870  ? -22.731 -13.301 -18.030 1.00 84.25  ? 870  MET A C     1 
ATOM   6405  O  O     . MET A 1 870  ? -21.569 -13.503 -18.372 1.00 84.69  ? 870  MET A O     1 
ATOM   6406  C  CB    . MET A 1 870  ? -23.383 -11.033 -18.888 1.00 85.38  ? 870  MET A CB    1 
ATOM   6407  C  CG    . MET A 1 870  ? -24.396 -11.539 -19.901 1.00 85.22  ? 870  MET A CG    1 
ATOM   6408  S  SD    . MET A 1 870  ? -26.075 -11.596 -19.254 1.00 86.31  ? 870  MET A SD    1 
ATOM   6409  C  CE    . MET A 1 870  ? -26.470 -9.850  -19.248 1.00 87.09  ? 870  MET A CE    1 
ATOM   6410  N  N     . GLU A 1 871  ? -23.647 -14.262 -17.975 1.00 82.85  ? 871  GLU A N     1 
ATOM   6411  C  CA    . GLU A 1 871  ? -23.380 -15.633 -18.400 1.00 82.16  ? 871  GLU A CA    1 
ATOM   6412  C  C     . GLU A 1 871  ? -24.437 -16.096 -19.391 1.00 79.98  ? 871  GLU A C     1 
ATOM   6413  O  O     . GLU A 1 871  ? -25.627 -15.968 -19.118 1.00 80.32  ? 871  GLU A O     1 
ATOM   6414  C  CB    . GLU A 1 871  ? -23.399 -16.557 -17.202 1.00 83.76  ? 871  GLU A CB    1 
ATOM   6415  C  CG    . GLU A 1 871  ? -22.165 -16.458 -16.337 1.00 86.32  ? 871  GLU A CG    1 
ATOM   6416  C  CD    . GLU A 1 871  ? -22.189 -17.443 -15.186 1.00 88.54  ? 871  GLU A CD    1 
ATOM   6417  O  OE1   . GLU A 1 871  ? -23.289 -17.889 -14.792 1.00 88.81  ? 871  GLU A OE1   1 
ATOM   6418  O  OE2   . GLU A 1 871  ? -21.104 -17.770 -14.665 1.00 91.54  ? 871  GLU A OE2   1 
ATOM   6419  N  N     . HIS A 1 872  ? -24.001 -16.627 -20.532 1.00 78.06  ? 872  HIS A N     1 
ATOM   6420  C  CA    . HIS A 1 872  ? -24.892 -17.235 -21.513 1.00 75.75  ? 872  HIS A CA    1 
ATOM   6421  C  C     . HIS A 1 872  ? -24.647 -18.735 -21.556 1.00 75.14  ? 872  HIS A C     1 
ATOM   6422  O  O     . HIS A 1 872  ? -23.513 -19.177 -21.426 1.00 75.31  ? 872  HIS A O     1 
ATOM   6423  C  CB    . HIS A 1 872  ? -24.648 -16.647 -22.902 1.00 74.86  ? 872  HIS A CB    1 
ATOM   6424  C  CG    . HIS A 1 872  ? -25.017 -15.199 -23.032 1.00 75.44  ? 872  HIS A CG    1 
ATOM   6425  N  ND1   . HIS A 1 872  ? -24.674 -14.447 -24.134 1.00 74.91  ? 872  HIS A ND1   1 
ATOM   6426  C  CD2   . HIS A 1 872  ? -25.686 -14.363 -22.202 1.00 76.63  ? 872  HIS A CD2   1 
ATOM   6427  C  CE1   . HIS A 1 872  ? -25.120 -13.213 -23.981 1.00 75.36  ? 872  HIS A CE1   1 
ATOM   6428  N  NE2   . HIS A 1 872  ? -25.738 -13.135 -22.817 1.00 76.36  ? 872  HIS A NE2   1 
ATOM   6429  N  N     . TYR A 1 873  ? -25.718 -19.510 -21.727 1.00 74.95  ? 873  TYR A N     1 
ATOM   6430  C  CA    . TYR A 1 873  ? -25.631 -20.960 -21.953 1.00 74.77  ? 873  TYR A CA    1 
ATOM   6431  C  C     . TYR A 1 873  ? -26.578 -21.364 -23.067 1.00 72.76  ? 873  TYR A C     1 
ATOM   6432  O  O     . TYR A 1 873  ? -27.783 -21.259 -22.901 1.00 73.41  ? 873  TYR A O     1 
ATOM   6433  C  CB    . TYR A 1 873  ? -26.006 -21.747 -20.693 1.00 76.43  ? 873  TYR A CB    1 
ATOM   6434  C  CG    . TYR A 1 873  ? -25.142 -21.462 -19.492 1.00 78.97  ? 873  TYR A CG    1 
ATOM   6435  C  CD1   . TYR A 1 873  ? -25.420 -20.382 -18.652 1.00 80.13  ? 873  TYR A CD1   1 
ATOM   6436  C  CD2   . TYR A 1 873  ? -24.050 -22.275 -19.186 1.00 79.94  ? 873  TYR A CD2   1 
ATOM   6437  C  CE1   . TYR A 1 873  ? -24.624 -20.112 -17.549 1.00 82.45  ? 873  TYR A CE1   1 
ATOM   6438  C  CE2   . TYR A 1 873  ? -23.253 -22.020 -18.082 1.00 81.82  ? 873  TYR A CE2   1 
ATOM   6439  C  CZ    . TYR A 1 873  ? -23.539 -20.934 -17.268 1.00 83.26  ? 873  TYR A CZ    1 
ATOM   6440  O  OH    . TYR A 1 873  ? -22.747 -20.666 -16.174 1.00 84.74  ? 873  TYR A OH    1 
ATOM   6441  N  N     . SER A 1 874  ? -26.049 -21.817 -24.199 1.00 72.18  ? 874  SER A N     1 
ATOM   6442  C  CA    . SER A 1 874  ? -26.892 -22.397 -25.246 1.00 71.43  ? 874  SER A CA    1 
ATOM   6443  C  C     . SER A 1 874  ? -27.039 -23.896 -25.013 1.00 71.00  ? 874  SER A C     1 
ATOM   6444  O  O     . SER A 1 874  ? -26.116 -24.542 -24.510 1.00 71.82  ? 874  SER A O     1 
ATOM   6445  C  CB    . SER A 1 874  ? -26.328 -22.132 -26.647 1.00 71.09  ? 874  SER A CB    1 
ATOM   6446  O  OG    . SER A 1 874  ? -25.210 -22.949 -26.942 1.00 71.66  ? 874  SER A OG    1 
ATOM   6447  N  N     . ASN A 1 875  ? -28.208 -24.431 -25.362 1.00 69.58  ? 875  ASN A N     1 
ATOM   6448  C  CA    . ASN A 1 875  ? -28.431 -25.871 -25.418 1.00 69.31  ? 875  ASN A CA    1 
ATOM   6449  C  C     . ASN A 1 875  ? -28.157 -26.328 -26.852 1.00 67.64  ? 875  ASN A C     1 
ATOM   6450  O  O     . ASN A 1 875  ? -28.888 -25.972 -27.773 1.00 65.88  ? 875  ASN A O     1 
ATOM   6451  C  CB    . ASN A 1 875  ? -29.862 -26.207 -24.984 1.00 69.48  ? 875  ASN A CB    1 
ATOM   6452  C  CG    . ASN A 1 875  ? -30.094 -27.706 -24.797 1.00 71.06  ? 875  ASN A CG    1 
ATOM   6453  O  OD1   . ASN A 1 875  ? -29.384 -28.546 -25.358 1.00 71.13  ? 875  ASN A OD1   1 
ATOM   6454  N  ND2   . ASN A 1 875  ? -31.111 -28.048 -24.015 1.00 71.94  ? 875  ASN A ND2   1 
ATOM   6455  N  N     . ALA A 1 876  ? -27.101 -27.113 -27.036 1.00 68.66  ? 876  ALA A N     1 
ATOM   6456  C  CA    . ALA A 1 876  ? -26.640 -27.498 -28.373 1.00 68.62  ? 876  ALA A CA    1 
ATOM   6457  C  C     . ALA A 1 876  ? -27.344 -28.724 -28.961 1.00 68.31  ? 876  ALA A C     1 
ATOM   6458  O  O     . ALA A 1 876  ? -27.311 -28.930 -30.168 1.00 67.65  ? 876  ALA A O     1 
ATOM   6459  C  CB    . ALA A 1 876  ? -25.143 -27.734 -28.345 1.00 69.58  ? 876  ALA A CB    1 
ATOM   6460  N  N     . GLY A 1 877  ? -27.973 -29.534 -28.117 1.00 70.35  ? 877  GLY A N     1 
ATOM   6461  C  CA    . GLY A 1 877  ? -28.485 -30.835 -28.530 1.00 71.29  ? 877  GLY A CA    1 
ATOM   6462  C  C     . GLY A 1 877  ? -27.344 -31.835 -28.580 1.00 73.54  ? 877  GLY A C     1 
ATOM   6463  O  O     . GLY A 1 877  ? -26.258 -31.556 -28.072 1.00 73.68  ? 877  GLY A O     1 
ATOM   6464  N  N     . ALA A 1 878  ? -27.599 -32.992 -29.193 1.00 75.09  ? 878  ALA A N     1 
ATOM   6465  C  CA    . ALA A 1 878  ? -26.654 -34.121 -29.246 1.00 77.06  ? 878  ALA A CA    1 
ATOM   6466  C  C     . ALA A 1 878  ? -25.244 -33.768 -29.722 1.00 79.05  ? 878  ALA A C     1 
ATOM   6467  O  O     . ALA A 1 878  ? -24.259 -34.297 -29.197 1.00 79.79  ? 878  ALA A O     1 
ATOM   6468  C  CB    . ALA A 1 878  ? -27.225 -35.224 -30.123 1.00 77.00  ? 878  ALA A CB    1 
ATOM   6469  N  N     . SER A 1 879  ? -25.161 -32.884 -30.712 1.00 80.31  ? 879  SER A N     1 
ATOM   6470  C  CA    . SER A 1 879  ? -23.898 -32.493 -31.328 1.00 84.26  ? 879  SER A CA    1 
ATOM   6471  C  C     . SER A 1 879  ? -23.667 -30.983 -31.187 1.00 88.18  ? 879  SER A C     1 
ATOM   6472  O  O     . SER A 1 879  ? -24.615 -30.210 -31.019 1.00 89.00  ? 879  SER A O     1 
ATOM   6473  C  CB    . SER A 1 879  ? -23.915 -32.918 -32.811 1.00 83.84  ? 879  SER A CB    1 
ATOM   6474  O  OG    . SER A 1 879  ? -22.934 -32.254 -33.602 1.00 84.31  ? 879  SER A OG    1 
ATOM   6475  N  N     . LEU A 1 880  ? -22.396 -30.584 -31.230 1.00 92.60  ? 880  LEU A N     1 
ATOM   6476  C  CA    . LEU A 1 880  ? -22.010 -29.186 -31.445 1.00 95.14  ? 880  LEU A CA    1 
ATOM   6477  C  C     . LEU A 1 880  ? -21.947 -28.953 -32.955 1.00 95.01  ? 880  LEU A C     1 
ATOM   6478  O  O     . LEU A 1 880  ? -22.089 -27.828 -33.434 1.00 96.03  ? 880  LEU A O     1 
ATOM   6479  C  CB    . LEU A 1 880  ? -20.665 -28.877 -30.764 1.00 98.02  ? 880  LEU A CB    1 
ATOM   6480  C  CG    . LEU A 1 880  ? -19.816 -27.684 -31.248 1.00 99.92  ? 880  LEU A CG    1 
ATOM   6481  C  CD1   . LEU A 1 880  ? -18.989 -27.107 -30.098 1.00 101.01 ? 880  LEU A CD1   1 
ATOM   6482  C  CD2   . LEU A 1 880  ? -18.921 -28.049 -32.443 1.00 99.58  ? 880  LEU A CD2   1 
ATOM   6483  N  N     . SER A 1 883  ? -22.700 -23.907 -33.203 1.00 92.35  ? 883  SER A N     1 
ATOM   6484  C  CA    . SER A 1 883  ? -23.193 -23.856 -31.825 1.00 93.94  ? 883  SER A CA    1 
ATOM   6485  C  C     . SER A 1 883  ? -22.288 -23.013 -30.931 1.00 94.44  ? 883  SER A C     1 
ATOM   6486  O  O     . SER A 1 883  ? -22.783 -22.217 -30.127 1.00 97.06  ? 883  SER A O     1 
ATOM   6487  C  CB    . SER A 1 883  ? -23.339 -25.262 -31.237 1.00 95.47  ? 883  SER A CB    1 
ATOM   6488  O  OG    . SER A 1 883  ? -24.054 -25.214 -30.011 1.00 97.01  ? 883  SER A OG    1 
ATOM   6489  N  N     . LEU A 1 884  ? -20.973 -23.202 -31.055 1.00 92.21  ? 884  LEU A N     1 
ATOM   6490  C  CA    . LEU A 1 884  ? -20.013 -22.269 -30.464 1.00 91.26  ? 884  LEU A CA    1 
ATOM   6491  C  C     . LEU A 1 884  ? -20.026 -20.915 -31.200 1.00 88.21  ? 884  LEU A C     1 
ATOM   6492  O  O     . LEU A 1 884  ? -19.819 -19.872 -30.580 1.00 88.67  ? 884  LEU A O     1 
ATOM   6493  C  CB    . LEU A 1 884  ? -18.601 -22.853 -30.462 1.00 92.97  ? 884  LEU A CB    1 
ATOM   6494  C  CG    . LEU A 1 884  ? -17.575 -22.080 -29.612 1.00 96.09  ? 884  LEU A CG    1 
ATOM   6495  C  CD1   . LEU A 1 884  ? -17.845 -22.218 -28.114 1.00 96.78  ? 884  LEU A CD1   1 
ATOM   6496  C  CD2   . LEU A 1 884  ? -16.162 -22.535 -29.948 1.00 98.01  ? 884  LEU A CD2   1 
ATOM   6497  N  N     . PHE A 1 885  ? -20.269 -20.935 -32.511 1.00 83.89  ? 885  PHE A N     1 
ATOM   6498  C  CA    . PHE A 1 885  ? -20.415 -19.702 -33.295 1.00 81.90  ? 885  PHE A CA    1 
ATOM   6499  C  C     . PHE A 1 885  ? -21.600 -18.866 -32.805 1.00 79.42  ? 885  PHE A C     1 
ATOM   6500  O  O     . PHE A 1 885  ? -21.535 -17.636 -32.794 1.00 78.39  ? 885  PHE A O     1 
ATOM   6501  C  CB    . PHE A 1 885  ? -20.600 -20.005 -34.787 1.00 81.61  ? 885  PHE A CB    1 
ATOM   6502  C  CG    . PHE A 1 885  ? -19.477 -20.802 -35.395 1.00 84.21  ? 885  PHE A CG    1 
ATOM   6503  C  CD1   . PHE A 1 885  ? -18.160 -20.326 -35.359 1.00 86.66  ? 885  PHE A CD1   1 
ATOM   6504  C  CD2   . PHE A 1 885  ? -19.725 -22.034 -36.013 1.00 83.61  ? 885  PHE A CD2   1 
ATOM   6505  C  CE1   . PHE A 1 885  ? -17.119 -21.064 -35.921 1.00 85.92  ? 885  PHE A CE1   1 
ATOM   6506  C  CE2   . PHE A 1 885  ? -18.687 -22.770 -36.578 1.00 83.26  ? 885  PHE A CE2   1 
ATOM   6507  C  CZ    . PHE A 1 885  ? -17.384 -22.285 -36.530 1.00 84.64  ? 885  PHE A CZ    1 
ATOM   6508  N  N     . VAL A 1 886  ? -22.674 -19.546 -32.400 1.00 76.96  ? 886  VAL A N     1 
ATOM   6509  C  CA    . VAL A 1 886  ? -23.884 -18.892 -31.885 1.00 74.59  ? 886  VAL A CA    1 
ATOM   6510  C  C     . VAL A 1 886  ? -23.609 -18.195 -30.553 1.00 74.91  ? 886  VAL A C     1 
ATOM   6511  O  O     . VAL A 1 886  ? -24.176 -17.142 -30.284 1.00 75.08  ? 886  VAL A O     1 
ATOM   6512  C  CB    . VAL A 1 886  ? -25.056 -19.894 -31.750 1.00 73.23  ? 886  VAL A CB    1 
ATOM   6513  C  CG1   . VAL A 1 886  ? -26.262 -19.265 -31.064 1.00 72.90  ? 886  VAL A CG1   1 
ATOM   6514  C  CG2   . VAL A 1 886  ? -25.462 -20.410 -33.124 1.00 72.42  ? 886  VAL A CG2   1 
ATOM   6515  N  N     . ILE A 1 887  ? -22.752 -18.792 -29.728 1.00 74.94  ? 887  ILE A N     1 
ATOM   6516  C  CA    . ILE A 1 887  ? -22.303 -18.171 -28.484 1.00 75.40  ? 887  ILE A CA    1 
ATOM   6517  C  C     . ILE A 1 887  ? -21.469 -16.926 -28.780 1.00 76.20  ? 887  ILE A C     1 
ATOM   6518  O  O     . ILE A 1 887  ? -21.678 -15.895 -28.147 1.00 77.29  ? 887  ILE A O     1 
ATOM   6519  C  CB    . ILE A 1 887  ? -21.516 -19.174 -27.599 1.00 75.82  ? 887  ILE A CB    1 
ATOM   6520  C  CG1   . ILE A 1 887  ? -22.464 -20.233 -27.026 1.00 74.74  ? 887  ILE A CG1   1 
ATOM   6521  C  CG2   . ILE A 1 887  ? -20.753 -18.476 -26.469 1.00 77.81  ? 887  ILE A CG2   1 
ATOM   6522  C  CD1   . ILE A 1 887  ? -23.519 -19.702 -26.075 1.00 74.92  ? 887  ILE A CD1   1 
ATOM   6523  N  N     . GLU A 1 888  ? -20.547 -17.027 -29.737 1.00 76.38  ? 888  GLU A N     1 
ATOM   6524  C  CA    . GLU A 1 888  ? -19.689 -15.903 -30.135 1.00 77.76  ? 888  GLU A CA    1 
ATOM   6525  C  C     . GLU A 1 888  ? -20.491 -14.697 -30.604 1.00 78.18  ? 888  GLU A C     1 
ATOM   6526  O  O     . GLU A 1 888  ? -20.242 -13.572 -30.153 1.00 80.89  ? 888  GLU A O     1 
ATOM   6527  C  CB    . GLU A 1 888  ? -18.734 -16.310 -31.251 1.00 77.98  ? 888  GLU A CB    1 
ATOM   6528  C  CG    . GLU A 1 888  ? -17.631 -17.243 -30.803 1.00 80.21  ? 888  GLU A CG    1 
ATOM   6529  C  CD    . GLU A 1 888  ? -16.869 -17.881 -31.956 1.00 81.12  ? 888  GLU A CD    1 
ATOM   6530  O  OE1   . GLU A 1 888  ? -17.208 -17.656 -33.141 1.00 80.32  ? 888  GLU A OE1   1 
ATOM   6531  O  OE2   . GLU A 1 888  ? -15.907 -18.623 -31.663 1.00 83.63  ? 888  GLU A OE2   1 
ATOM   6532  N  N     . MET A 1 889  ? -21.450 -14.925 -31.499 1.00 75.76  ? 889  MET A N     1 
ATOM   6533  C  CA    . MET A 1 889  ? -22.305 -13.835 -31.980 1.00 76.09  ? 889  MET A CA    1 
ATOM   6534  C  C     . MET A 1 889  ? -23.212 -13.307 -30.873 1.00 75.22  ? 889  MET A C     1 
ATOM   6535  O  O     . MET A 1 889  ? -23.478 -12.114 -30.812 1.00 74.50  ? 889  MET A O     1 
ATOM   6536  C  CB    . MET A 1 889  ? -23.135 -14.266 -33.192 1.00 76.20  ? 889  MET A CB    1 
ATOM   6537  C  CG    . MET A 1 889  ? -22.291 -14.583 -34.416 1.00 77.85  ? 889  MET A CG    1 
ATOM   6538  S  SD    . MET A 1 889  ? -21.340 -13.176 -35.036 1.00 81.10  ? 889  MET A SD    1 
ATOM   6539  C  CE    . MET A 1 889  ? -22.324 -12.735 -36.476 1.00 80.33  ? 889  MET A CE    1 
ATOM   6540  N  N     . GLY A 1 890  ? -23.674 -14.200 -29.999 1.00 74.78  ? 890  GLY A N     1 
ATOM   6541  C  CA    . GLY A 1 890  ? -24.420 -13.815 -28.813 1.00 74.50  ? 890  GLY A CA    1 
ATOM   6542  C  C     . GLY A 1 890  ? -23.659 -12.766 -28.032 1.00 75.89  ? 890  GLY A C     1 
ATOM   6543  O  O     . GLY A 1 890  ? -24.170 -11.671 -27.806 1.00 75.35  ? 890  GLY A O     1 
ATOM   6544  N  N     . LEU A 1 891  ? -22.417 -13.086 -27.672 1.00 75.98  ? 891  LEU A N     1 
ATOM   6545  C  CA    . LEU A 1 891  ? -21.610 -12.206 -26.830 1.00 77.87  ? 891  LEU A CA    1 
ATOM   6546  C  C     . LEU A 1 891  ? -21.254 -10.883 -27.512 1.00 77.59  ? 891  LEU A C     1 
ATOM   6547  O  O     . LEU A 1 891  ? -21.228 -9.847  -26.859 1.00 77.64  ? 891  LEU A O     1 
ATOM   6548  C  CB    . LEU A 1 891  ? -20.327 -12.907 -26.364 1.00 79.18  ? 891  LEU A CB    1 
ATOM   6549  C  CG    . LEU A 1 891  ? -20.421 -14.207 -25.556 1.00 79.52  ? 891  LEU A CG    1 
ATOM   6550  C  CD1   . LEU A 1 891  ? -19.018 -14.712 -25.262 1.00 80.53  ? 891  LEU A CD1   1 
ATOM   6551  C  CD2   . LEU A 1 891  ? -21.213 -14.082 -24.261 1.00 80.57  ? 891  LEU A CD2   1 
ATOM   6552  N  N     . LEU A 1 892  ? -20.988 -10.921 -28.814 1.00 76.98  ? 892  LEU A N     1 
ATOM   6553  C  CA    . LEU A 1 892  ? -20.634 -9.711  -29.556 1.00 76.99  ? 892  LEU A CA    1 
ATOM   6554  C  C     . LEU A 1 892  ? -21.822 -8.780  -29.740 1.00 76.99  ? 892  LEU A C     1 
ATOM   6555  O  O     . LEU A 1 892  ? -21.657 -7.567  -29.760 1.00 78.93  ? 892  LEU A O     1 
ATOM   6556  C  CB    . LEU A 1 892  ? -20.036 -10.065 -30.919 1.00 75.88  ? 892  LEU A CB    1 
ATOM   6557  C  CG    . LEU A 1 892  ? -18.641 -10.692 -30.897 1.00 76.11  ? 892  LEU A CG    1 
ATOM   6558  C  CD1   . LEU A 1 892  ? -18.290 -11.212 -32.278 1.00 75.24  ? 892  LEU A CD1   1 
ATOM   6559  C  CD2   . LEU A 1 892  ? -17.593 -9.701  -30.425 1.00 77.46  ? 892  LEU A CD2   1 
ATOM   6560  N  N     . LYS A 1 893  ? -23.015 -9.344  -29.857 1.00 76.79  ? 893  LYS A N     1 
ATOM   6561  C  CA    . LYS A 1 893  ? -24.225 -8.552  -30.076 1.00 77.16  ? 893  LYS A CA    1 
ATOM   6562  C  C     . LYS A 1 893  ? -25.057 -8.323  -28.803 1.00 76.88  ? 893  LYS A C     1 
ATOM   6563  O  O     . LYS A 1 893  ? -26.111 -7.696  -28.858 1.00 74.76  ? 893  LYS A O     1 
ATOM   6564  C  CB    . LYS A 1 893  ? -25.072 -9.228  -31.146 1.00 76.69  ? 893  LYS A CB    1 
ATOM   6565  C  CG    . LYS A 1 893  ? -24.311 -9.595  -32.407 1.00 77.48  ? 893  LYS A CG    1 
ATOM   6566  C  CD    . LYS A 1 893  ? -25.258 -10.129 -33.462 1.00 78.52  ? 893  LYS A CD    1 
ATOM   6567  C  CE    . LYS A 1 893  ? -24.577 -10.282 -34.810 1.00 79.33  ? 893  LYS A CE    1 
ATOM   6568  N  NZ    . LYS A 1 893  ? -25.597 -10.374 -35.896 1.00 79.24  ? 893  LYS A NZ    1 
ATOM   6569  N  N     . MET A 1 894  ? -24.555 -8.820  -27.673 1.00 78.61  ? 894  MET A N     1 
ATOM   6570  C  CA    . MET A 1 894  ? -25.207 -8.761  -26.355 1.00 80.54  ? 894  MET A CA    1 
ATOM   6571  C  C     . MET A 1 894  ? -25.561 -7.335  -25.907 1.00 80.35  ? 894  MET A C     1 
ATOM   6572  O  O     . MET A 1 894  ? -26.652 -7.094  -25.399 1.00 81.00  ? 894  MET A O     1 
ATOM   6573  C  CB    . MET A 1 894  ? -24.260 -9.397  -25.321 1.00 83.92  ? 894  MET A CB    1 
ATOM   6574  C  CG    . MET A 1 894  ? -24.772 -9.471  -23.899 1.00 87.36  ? 894  MET A CG    1 
ATOM   6575  S  SD    . MET A 1 894  ? -23.602 -8.782  -22.715 1.00 92.88  ? 894  MET A SD    1 
ATOM   6576  C  CE    . MET A 1 894  ? -23.580 -7.058  -23.179 1.00 92.75  ? 894  MET A CE    1 
ATOM   6577  N  N     . ASP A 1 895  ? -24.625 -6.407  -26.078 1.00 79.25  ? 895  ASP A N     1 
ATOM   6578  C  CA    . ASP A 1 895  ? -24.832 -5.006  -25.701 1.00 79.66  ? 895  ASP A CA    1 
ATOM   6579  C  C     . ASP A 1 895  ? -26.097 -4.375  -26.298 1.00 78.46  ? 895  ASP A C     1 
ATOM   6580  O  O     . ASP A 1 895  ? -26.760 -3.566  -25.639 1.00 80.04  ? 895  ASP A O     1 
ATOM   6581  C  CB    . ASP A 1 895  ? -23.599 -4.151  -26.043 1.00 80.15  ? 895  ASP A CB    1 
ATOM   6582  C  CG    . ASP A 1 895  ? -23.257 -4.171  -27.517 1.00 79.07  ? 895  ASP A CG    1 
ATOM   6583  O  OD1   . ASP A 1 895  ? -22.985 -5.271  -28.046 1.00 78.82  ? 895  ASP A OD1   1 
ATOM   6584  O  OD2   . ASP A 1 895  ? -23.255 -3.093  -28.144 1.00 78.88  ? 895  ASP A OD2   1 
ATOM   6585  N  N     . ASN A 1 896  ? -26.427 -4.761  -27.529 1.00 76.37  ? 896  ASN A N     1 
ATOM   6586  C  CA    . ASN A 1 896  ? -27.540 -4.187  -28.285 1.00 74.80  ? 896  ASN A CA    1 
ATOM   6587  C  C     . ASN A 1 896  ? -27.389 -2.651  -28.351 1.00 75.33  ? 896  ASN A C     1 
ATOM   6588  O  O     . ASN A 1 896  ? -26.425 -2.182  -28.948 1.00 75.77  ? 896  ASN A O     1 
ATOM   6589  C  CB    . ASN A 1 896  ? -28.895 -4.691  -27.749 1.00 73.81  ? 896  ASN A CB    1 
ATOM   6590  C  CG    . ASN A 1 896  ? -30.086 -4.200  -28.569 1.00 73.34  ? 896  ASN A CG    1 
ATOM   6591  O  OD1   . ASN A 1 896  ? -29.975 -3.899  -29.759 1.00 72.19  ? 896  ASN A OD1   1 
ATOM   6592  N  ND2   . ASN A 1 896  ? -31.236 -4.110  -27.921 1.00 74.61  ? 896  ASN A ND2   1 
ATOM   6593  N  N     . ALA A 1 897  ? -28.263 -1.882  -27.700 1.00 75.16  ? 897  ALA A N     1 
ATOM   6594  C  CA    . ALA A 1 897  ? -28.289 -0.431  -27.860 1.00 75.28  ? 897  ALA A CA    1 
ATOM   6595  C  C     . ALA A 1 897  ? -27.575 0.315   -26.731 1.00 76.68  ? 897  ALA A C     1 
ATOM   6596  O  O     . ALA A 1 897  ? -27.449 1.532   -26.801 1.00 77.23  ? 897  ALA A O     1 
ATOM   6597  C  CB    . ALA A 1 897  ? -29.731 0.037   -27.961 1.00 74.89  ? 897  ALA A CB    1 
ATOM   6598  N  N     . TYR A 1 898  ? -27.081 -0.409  -25.724 1.00 77.34  ? 898  TYR A N     1 
ATOM   6599  C  CA    . TYR A 1 898  ? -26.658 0.191   -24.456 1.00 79.05  ? 898  TYR A CA    1 
ATOM   6600  C  C     . TYR A 1 898  ? -25.145 0.172   -24.253 1.00 80.92  ? 898  TYR A C     1 
ATOM   6601  O  O     . TYR A 1 898  ? -24.462 -0.757  -24.694 1.00 80.47  ? 898  TYR A O     1 
ATOM   6602  C  CB    . TYR A 1 898  ? -27.340 -0.525  -23.300 1.00 79.00  ? 898  TYR A CB    1 
ATOM   6603  C  CG    . TYR A 1 898  ? -28.776 -0.843  -23.614 1.00 77.91  ? 898  TYR A CG    1 
ATOM   6604  C  CD1   . TYR A 1 898  ? -29.739 0.165   -23.637 1.00 78.39  ? 898  TYR A CD1   1 
ATOM   6605  C  CD2   . TYR A 1 898  ? -29.171 -2.142  -23.935 1.00 75.97  ? 898  TYR A CD2   1 
ATOM   6606  C  CE1   . TYR A 1 898  ? -31.062 -0.118  -23.942 1.00 77.17  ? 898  TYR A CE1   1 
ATOM   6607  C  CE2   . TYR A 1 898  ? -30.487 -2.430  -24.241 1.00 75.11  ? 898  TYR A CE2   1 
ATOM   6608  C  CZ    . TYR A 1 898  ? -31.427 -1.416  -24.241 1.00 75.40  ? 898  TYR A CZ    1 
ATOM   6609  O  OH    . TYR A 1 898  ? -32.730 -1.692  -24.543 1.00 74.63  ? 898  TYR A OH    1 
ATOM   6610  N  N     . LYS A 1 899  ? -24.641 1.209   -23.581 1.00 83.01  ? 899  LYS A N     1 
ATOM   6611  C  CA    . LYS A 1 899  ? -23.225 1.338   -23.262 1.00 83.94  ? 899  LYS A CA    1 
ATOM   6612  C  C     . LYS A 1 899  ? -23.001 0.911   -21.826 1.00 84.57  ? 899  LYS A C     1 
ATOM   6613  O  O     . LYS A 1 899  ? -23.237 1.687   -20.910 1.00 87.13  ? 899  LYS A O     1 
ATOM   6614  C  CB    . LYS A 1 899  ? -22.755 2.784   -23.459 1.00 85.16  ? 899  LYS A CB    1 
ATOM   6615  C  CG    . LYS A 1 899  ? -21.305 3.048   -23.079 1.00 87.20  ? 899  LYS A CG    1 
ATOM   6616  C  CD    . LYS A 1 899  ? -20.331 2.244   -23.925 1.00 87.05  ? 899  LYS A CD    1 
ATOM   6617  C  CE    . LYS A 1 899  ? -18.919 2.344   -23.379 1.00 89.53  ? 899  LYS A CE    1 
ATOM   6618  N  NZ    . LYS A 1 899  ? -18.448 3.752   -23.268 1.00 91.73  ? 899  LYS A NZ    1 
ATOM   6619  N  N     . PHE A 1 900  ? -22.550 -0.325  -21.643 1.00 83.72  ? 900  PHE A N     1 
ATOM   6620  C  CA    . PHE A 1 900  ? -22.172 -0.840  -20.331 1.00 85.23  ? 900  PHE A CA    1 
ATOM   6621  C  C     . PHE A 1 900  ? -20.693 -0.528  -20.076 1.00 86.59  ? 900  PHE A C     1 
ATOM   6622  O  O     . PHE A 1 900  ? -19.832 -1.183  -20.651 1.00 85.49  ? 900  PHE A O     1 
ATOM   6623  C  CB    . PHE A 1 900  ? -22.440 -2.346  -20.265 1.00 84.29  ? 900  PHE A CB    1 
ATOM   6624  C  CG    . PHE A 1 900  ? -23.881 -2.707  -20.486 1.00 82.84  ? 900  PHE A CG    1 
ATOM   6625  C  CD1   . PHE A 1 900  ? -24.834 -2.422  -19.520 1.00 83.68  ? 900  PHE A CD1   1 
ATOM   6626  C  CD2   . PHE A 1 900  ? -24.294 -3.325  -21.665 1.00 81.61  ? 900  PHE A CD2   1 
ATOM   6627  C  CE1   . PHE A 1 900  ? -26.171 -2.745  -19.721 1.00 82.71  ? 900  PHE A CE1   1 
ATOM   6628  C  CE2   . PHE A 1 900  ? -25.630 -3.654  -21.869 1.00 79.89  ? 900  PHE A CE2   1 
ATOM   6629  C  CZ    . PHE A 1 900  ? -26.568 -3.363  -20.894 1.00 80.34  ? 900  PHE A CZ    1 
ATOM   6630  N  N     . PRO A 1 901  ? -20.386 0.477   -19.223 1.00 89.43  ? 901  PRO A N     1 
ATOM   6631  C  CA    . PRO A 1 901  ? -18.975 0.890   -19.079 1.00 90.99  ? 901  PRO A CA    1 
ATOM   6632  C  C     . PRO A 1 901  ? -18.036 -0.203  -18.548 1.00 91.68  ? 901  PRO A C     1 
ATOM   6633  O  O     . PRO A 1 901  ? -16.879 -0.254  -18.950 1.00 91.73  ? 901  PRO A O     1 
ATOM   6634  C  CB    . PRO A 1 901  ? -19.042 2.066   -18.088 1.00 92.89  ? 901  PRO A CB    1 
ATOM   6635  C  CG    . PRO A 1 901  ? -20.473 2.472   -18.041 1.00 92.28  ? 901  PRO A CG    1 
ATOM   6636  C  CD    . PRO A 1 901  ? -21.252 1.222   -18.291 1.00 90.34  ? 901  PRO A CD    1 
ATOM   6637  N  N     . ASN A 1 902  ? -18.535 -1.041  -17.638 1.00 92.52  ? 902  ASN A N     1 
ATOM   6638  C  CA    . ASN A 1 902  ? -17.802 -2.203  -17.138 1.00 92.98  ? 902  ASN A CA    1 
ATOM   6639  C  C     . ASN A 1 902  ? -18.652 -3.449  -17.294 1.00 91.79  ? 902  ASN A C     1 
ATOM   6640  O  O     . ASN A 1 902  ? -19.768 -3.524  -16.770 1.00 91.02  ? 902  ASN A O     1 
ATOM   6641  C  CB    . ASN A 1 902  ? -17.412 -2.018  -15.679 1.00 95.38  ? 902  ASN A CB    1 
ATOM   6642  C  CG    . ASN A 1 902  ? -16.738 -0.695  -15.432 1.00 96.96  ? 902  ASN A CG    1 
ATOM   6643  O  OD1   . ASN A 1 902  ? -15.602 -0.488  -15.845 1.00 97.92  ? 902  ASN A OD1   1 
ATOM   6644  N  ND2   . ASN A 1 902  ? -17.440 0.215   -14.777 1.00 97.93  ? 902  ASN A ND2   1 
ATOM   6645  N  N     . LEU A 1 903  ? -18.095 -4.426  -18.004 1.00 92.00  ? 903  LEU A N     1 
ATOM   6646  C  CA    . LEU A 1 903  ? -18.842 -5.567  -18.513 1.00 91.13  ? 903  LEU A CA    1 
ATOM   6647  C  C     . LEU A 1 903  ? -17.944 -6.794  -18.580 1.00 90.96  ? 903  LEU A C     1 
ATOM   6648  O  O     . LEU A 1 903  ? -16.876 -6.734  -19.177 1.00 90.55  ? 903  LEU A O     1 
ATOM   6649  C  CB    . LEU A 1 903  ? -19.363 -5.233  -19.915 1.00 89.81  ? 903  LEU A CB    1 
ATOM   6650  C  CG    . LEU A 1 903  ? -19.964 -6.349  -20.775 1.00 88.47  ? 903  LEU A CG    1 
ATOM   6651  C  CD1   . LEU A 1 903  ? -21.152 -6.981  -20.066 1.00 89.07  ? 903  LEU A CD1   1 
ATOM   6652  C  CD2   . LEU A 1 903  ? -20.363 -5.820  -22.146 1.00 86.85  ? 903  LEU A CD2   1 
ATOM   6653  N  N     . ARG A 1 904  ? -18.372 -7.884  -17.950 1.00 91.86  ? 904  ARG A N     1 
ATOM   6654  C  CA    . ARG A 1 904  ? -17.786 -9.206  -18.168 1.00 92.65  ? 904  ARG A CA    1 
ATOM   6655  C  C     . ARG A 1 904  ? -18.871 -10.068 -18.783 1.00 91.61  ? 904  ARG A C     1 
ATOM   6656  O  O     . ARG A 1 904  ? -19.977 -10.151 -18.250 1.00 91.31  ? 904  ARG A O     1 
ATOM   6657  C  CB    . ARG A 1 904  ? -17.295 -9.836  -16.865 1.00 94.64  ? 904  ARG A CB    1 
ATOM   6658  C  CG    . ARG A 1 904  ? -16.610 -11.185 -17.056 1.00 94.92  ? 904  ARG A CG    1 
ATOM   6659  C  CD    . ARG A 1 904  ? -15.667 -11.507 -15.909 1.00 98.07  ? 904  ARG A CD    1 
ATOM   6660  N  NE    . ARG A 1 904  ? -16.381 -11.604 -14.631 1.00 100.08 ? 904  ARG A NE    1 
ATOM   6661  C  CZ    . ARG A 1 904  ? -15.883 -11.299 -13.425 1.00 103.55 ? 904  ARG A CZ    1 
ATOM   6662  N  NH1   . ARG A 1 904  ? -14.633 -10.847 -13.265 1.00 105.15 ? 904  ARG A NH1   1 
ATOM   6663  N  NH2   . ARG A 1 904  ? -16.658 -11.433 -12.349 1.00 104.59 ? 904  ARG A NH2   1 
ATOM   6664  N  N     . CYS A 1 905  ? -18.546 -10.707 -19.900 1.00 91.71  ? 905  CYS A N     1 
ATOM   6665  C  CA    . CYS A 1 905  ? -19.510 -11.472 -20.679 1.00 91.00  ? 905  CYS A CA    1 
ATOM   6666  C  C     . CYS A 1 905  ? -18.890 -12.823 -21.013 1.00 88.26  ? 905  CYS A C     1 
ATOM   6667  O  O     . CYS A 1 905  ? -17.799 -12.867 -21.562 1.00 87.91  ? 905  CYS A O     1 
ATOM   6668  C  CB    . CYS A 1 905  ? -19.855 -10.698 -21.952 1.00 91.44  ? 905  CYS A CB    1 
ATOM   6669  S  SG    . CYS A 1 905  ? -21.421 -11.175 -22.700 1.00 95.35  ? 905  CYS A SG    1 
ATOM   6670  N  N     . ARG A 1 906  ? -19.576 -13.909 -20.661 1.00 86.34  ? 906  ARG A N     1 
ATOM   6671  C  CA    . ARG A 1 906  ? -19.067 -15.262 -20.868 1.00 85.65  ? 906  ARG A CA    1 
ATOM   6672  C  C     . ARG A 1 906  ? -20.161 -16.202 -21.352 1.00 83.12  ? 906  ARG A C     1 
ATOM   6673  O  O     . ARG A 1 906  ? -21.303 -16.076 -20.922 1.00 82.73  ? 906  ARG A O     1 
ATOM   6674  C  CB    . ARG A 1 906  ? -18.469 -15.798 -19.573 1.00 88.07  ? 906  ARG A CB    1 
ATOM   6675  C  CG    . ARG A 1 906  ? -17.161 -15.134 -19.194 1.00 90.92  ? 906  ARG A CG    1 
ATOM   6676  C  CD    . ARG A 1 906  ? -16.441 -15.897 -18.097 1.00 93.91  ? 906  ARG A CD    1 
ATOM   6677  N  NE    . ARG A 1 906  ? -17.283 -16.107 -16.920 1.00 95.53  ? 906  ARG A NE    1 
ATOM   6678  C  CZ    . ARG A 1 906  ? -16.990 -16.919 -15.901 1.00 97.67  ? 906  ARG A CZ    1 
ATOM   6679  N  NH1   . ARG A 1 906  ? -15.855 -17.624 -15.876 1.00 98.55  ? 906  ARG A NH1   1 
ATOM   6680  N  NH2   . ARG A 1 906  ? -17.846 -17.028 -14.887 1.00 98.52  ? 906  ARG A NH2   1 
ATOM   6681  N  N     . GLY A 1 907  ? -19.797 -17.146 -22.229 1.00 81.05  ? 907  GLY A N     1 
ATOM   6682  C  CA    . GLY A 1 907  ? -20.747 -18.114 -22.804 1.00 78.83  ? 907  GLY A CA    1 
ATOM   6683  C  C     . GLY A 1 907  ? -20.218 -19.537 -22.899 1.00 78.22  ? 907  GLY A C     1 
ATOM   6684  O  O     . GLY A 1 907  ? -19.012 -19.751 -22.961 1.00 79.49  ? 907  GLY A O     1 
ATOM   6685  N  N     . TRP A 1 908  ? -21.135 -20.506 -22.905 1.00 77.37  ? 908  TRP A N     1 
ATOM   6686  C  CA    . TRP A 1 908  ? -20.811 -21.939 -23.029 1.00 77.11  ? 908  TRP A CA    1 
ATOM   6687  C  C     . TRP A 1 908  ? -21.944 -22.679 -23.733 1.00 74.03  ? 908  TRP A C     1 
ATOM   6688  O  O     . TRP A 1 908  ? -23.092 -22.534 -23.338 1.00 72.40  ? 908  TRP A O     1 
ATOM   6689  C  CB    . TRP A 1 908  ? -20.650 -22.593 -21.652 1.00 79.78  ? 908  TRP A CB    1 
ATOM   6690  C  CG    . TRP A 1 908  ? -19.533 -22.080 -20.808 1.00 82.82  ? 908  TRP A CG    1 
ATOM   6691  C  CD1   . TRP A 1 908  ? -18.227 -22.484 -20.835 1.00 84.44  ? 908  TRP A CD1   1 
ATOM   6692  C  CD2   . TRP A 1 908  ? -19.625 -21.093 -19.781 1.00 84.52  ? 908  TRP A CD2   1 
ATOM   6693  N  NE1   . TRP A 1 908  ? -17.499 -21.795 -19.897 1.00 86.37  ? 908  TRP A NE1   1 
ATOM   6694  C  CE2   . TRP A 1 908  ? -18.333 -20.935 -19.234 1.00 86.50  ? 908  TRP A CE2   1 
ATOM   6695  C  CE3   . TRP A 1 908  ? -20.674 -20.319 -19.273 1.00 84.55  ? 908  TRP A CE3   1 
ATOM   6696  C  CZ2   . TRP A 1 908  ? -18.062 -20.035 -18.204 1.00 88.38  ? 908  TRP A CZ2   1 
ATOM   6697  C  CZ3   . TRP A 1 908  ? -20.407 -19.427 -18.248 1.00 86.45  ? 908  TRP A CZ3   1 
ATOM   6698  C  CH2   . TRP A 1 908  ? -19.110 -19.292 -17.723 1.00 88.49  ? 908  TRP A CH2   1 
ATOM   6699  N  N     . ALA A 1 909  ? -21.622 -23.487 -24.745 1.00 72.94  ? 909  ALA A N     1 
ATOM   6700  C  CA    . ALA A 1 909  ? -22.605 -24.363 -25.396 1.00 71.19  ? 909  ALA A CA    1 
ATOM   6701  C  C     . ALA A 1 909  ? -22.677 -25.684 -24.642 1.00 72.31  ? 909  ALA A C     1 
ATOM   6702  O  O     . ALA A 1 909  ? -21.655 -26.191 -24.211 1.00 74.35  ? 909  ALA A O     1 
ATOM   6703  C  CB    . ALA A 1 909  ? -22.231 -24.592 -26.844 1.00 69.73  ? 909  ALA A CB    1 
ATOM   6704  N  N     . CYS A 1 910  ? -23.878 -26.238 -24.489 1.00 72.98  ? 910  CYS A N     1 
ATOM   6705  C  CA    . CYS A 1 910  ? -24.117 -27.394 -23.606 1.00 74.78  ? 910  CYS A CA    1 
ATOM   6706  C  C     . CYS A 1 910  ? -24.792 -28.548 -24.337 1.00 73.51  ? 910  CYS A C     1 
ATOM   6707  O  O     . CYS A 1 910  ? -25.949 -28.430 -24.736 1.00 72.01  ? 910  CYS A O     1 
ATOM   6708  C  CB    . CYS A 1 910  ? -24.999 -26.962 -22.437 1.00 76.55  ? 910  CYS A CB    1 
ATOM   6709  S  SG    . CYS A 1 910  ? -24.226 -25.735 -21.359 1.00 81.19  ? 910  CYS A SG    1 
ATOM   6710  N  N     . ARG A 1 911  ? -24.080 -29.663 -24.499 1.00 74.80  ? 911  ARG A N     1 
ATOM   6711  C  CA    . ARG A 1 911  ? -24.631 -30.815 -25.198 1.00 75.88  ? 911  ARG A CA    1 
ATOM   6712  C  C     . ARG A 1 911  ? -25.659 -31.526 -24.310 1.00 75.49  ? 911  ARG A C     1 
ATOM   6713  O  O     . ARG A 1 911  ? -25.450 -31.700 -23.115 1.00 76.03  ? 911  ARG A O     1 
ATOM   6714  C  CB    . ARG A 1 911  ? -23.533 -31.761 -25.739 1.00 78.92  ? 911  ARG A CB    1 
ATOM   6715  C  CG    . ARG A 1 911  ? -22.975 -32.806 -24.784 1.00 85.05  ? 911  ARG A CG    1 
ATOM   6716  C  CD    . ARG A 1 911  ? -22.214 -33.907 -25.524 1.00 89.34  ? 911  ARG A CD    1 
ATOM   6717  N  NE    . ARG A 1 911  ? -23.075 -34.787 -26.338 1.00 92.82  ? 911  ARG A NE    1 
ATOM   6718  C  CZ    . ARG A 1 911  ? -23.901 -35.743 -25.876 1.00 95.69  ? 911  ARG A CZ    1 
ATOM   6719  N  NH1   . ARG A 1 911  ? -24.041 -35.982 -24.567 1.00 97.89  ? 911  ARG A NH1   1 
ATOM   6720  N  NH2   . ARG A 1 911  ? -24.617 -36.468 -26.742 1.00 95.32  ? 911  ARG A NH2   1 
ATOM   6721  N  N     . THR A 1 912  ? -26.783 -31.893 -24.917 1.00 74.20  ? 912  THR A N     1 
ATOM   6722  C  CA    . THR A 1 912  ? -27.869 -32.607 -24.255 1.00 74.59  ? 912  THR A CA    1 
ATOM   6723  C  C     . THR A 1 912  ? -28.333 -33.743 -25.171 1.00 72.79  ? 912  THR A C     1 
ATOM   6724  O  O     . THR A 1 912  ? -27.854 -33.867 -26.296 1.00 72.60  ? 912  THR A O     1 
ATOM   6725  C  CB    . THR A 1 912  ? -29.050 -31.657 -23.944 1.00 74.99  ? 912  THR A CB    1 
ATOM   6726  O  OG1   . THR A 1 912  ? -29.617 -31.147 -25.166 1.00 74.11  ? 912  THR A OG1   1 
ATOM   6727  C  CG2   . THR A 1 912  ? -28.594 -30.490 -23.058 1.00 75.62  ? 912  THR A CG2   1 
ATOM   6728  N  N     . ASN A 1 913  ? -29.273 -34.556 -24.696 1.00 71.98  ? 913  ASN A N     1 
ATOM   6729  C  CA    . ASN A 1 913  ? -29.807 -35.671 -25.476 1.00 71.30  ? 913  ASN A CA    1 
ATOM   6730  C  C     . ASN A 1 913  ? -31.093 -35.297 -26.227 1.00 70.97  ? 913  ASN A C     1 
ATOM   6731  O  O     . ASN A 1 913  ? -32.118 -35.976 -26.140 1.00 71.42  ? 913  ASN A O     1 
ATOM   6732  C  CB    . ASN A 1 913  ? -29.994 -36.897 -24.577 1.00 71.86  ? 913  ASN A CB    1 
ATOM   6733  C  CG    . ASN A 1 913  ? -28.679 -37.465 -24.105 1.00 72.69  ? 913  ASN A CG    1 
ATOM   6734  O  OD1   . ASN A 1 913  ? -28.417 -37.560 -22.906 1.00 75.25  ? 913  ASN A OD1   1 
ATOM   6735  N  ND2   . ASN A 1 913  ? -27.834 -37.840 -25.050 1.00 72.11  ? 913  ASN A ND2   1 
ATOM   6736  N  N     . LEU A 1 914  ? -31.008 -34.211 -26.987 1.00 71.34  ? 914  LEU A N     1 
ATOM   6737  C  CA    . LEU A 1 914  ? -32.110 -33.715 -27.795 1.00 70.80  ? 914  LEU A CA    1 
ATOM   6738  C  C     . LEU A 1 914  ? -31.578 -33.525 -29.194 1.00 69.31  ? 914  LEU A C     1 
ATOM   6739  O  O     . LEU A 1 914  ? -30.363 -33.520 -29.378 1.00 70.17  ? 914  LEU A O     1 
ATOM   6740  C  CB    . LEU A 1 914  ? -32.600 -32.378 -27.245 1.00 71.99  ? 914  LEU A CB    1 
ATOM   6741  C  CG    . LEU A 1 914  ? -33.283 -32.429 -25.875 1.00 73.80  ? 914  LEU A CG    1 
ATOM   6742  C  CD1   . LEU A 1 914  ? -33.489 -31.028 -25.318 1.00 73.38  ? 914  LEU A CD1   1 
ATOM   6743  C  CD2   . LEU A 1 914  ? -34.604 -33.179 -25.966 1.00 74.25  ? 914  LEU A CD2   1 
ATOM   6744  N  N     . PRO A 1 915  ? -32.472 -33.379 -30.191 1.00 67.89  ? 915  PRO A N     1 
ATOM   6745  C  CA    . PRO A 1 915  ? -31.998 -33.117 -31.547 1.00 66.49  ? 915  PRO A CA    1 
ATOM   6746  C  C     . PRO A 1 915  ? -31.014 -31.958 -31.598 1.00 66.17  ? 915  PRO A C     1 
ATOM   6747  O  O     . PRO A 1 915  ? -31.189 -30.962 -30.890 1.00 66.86  ? 915  PRO A O     1 
ATOM   6748  C  CB    . PRO A 1 915  ? -33.281 -32.768 -32.306 1.00 65.60  ? 915  PRO A CB    1 
ATOM   6749  C  CG    . PRO A 1 915  ? -34.336 -33.545 -31.605 1.00 66.60  ? 915  PRO A CG    1 
ATOM   6750  C  CD    . PRO A 1 915  ? -33.935 -33.562 -30.152 1.00 67.81  ? 915  PRO A CD    1 
ATOM   6751  N  N     . SER A 1 916  ? -29.989 -32.112 -32.426 1.00 65.67  ? 916  SER A N     1 
ATOM   6752  C  CA    . SER A 1 916  ? -28.918 -31.132 -32.556 1.00 65.21  ? 916  SER A CA    1 
ATOM   6753  C  C     . SER A 1 916  ? -29.410 -29.811 -33.159 1.00 64.55  ? 916  SER A C     1 
ATOM   6754  O  O     . SER A 1 916  ? -29.840 -29.772 -34.309 1.00 64.51  ? 916  SER A O     1 
ATOM   6755  C  CB    . SER A 1 916  ? -27.805 -31.709 -33.419 1.00 64.46  ? 916  SER A CB    1 
ATOM   6756  O  OG    . SER A 1 916  ? -26.686 -30.866 -33.377 1.00 66.50  ? 916  SER A OG    1 
ATOM   6757  N  N     . ASN A 1 917  ? -29.338 -28.733 -32.382 1.00 64.71  ? 917  ASN A N     1 
ATOM   6758  C  CA    . ASN A 1 917  ? -29.844 -27.438 -32.821 1.00 64.54  ? 917  ASN A CA    1 
ATOM   6759  C  C     . ASN A 1 917  ? -28.928 -26.773 -33.826 1.00 65.80  ? 917  ASN A C     1 
ATOM   6760  O  O     . ASN A 1 917  ? -27.737 -27.049 -33.862 1.00 67.07  ? 917  ASN A O     1 
ATOM   6761  C  CB    . ASN A 1 917  ? -30.103 -26.510 -31.633 1.00 64.24  ? 917  ASN A CB    1 
ATOM   6762  C  CG    . ASN A 1 917  ? -31.243 -26.996 -30.750 1.00 63.48  ? 917  ASN A CG    1 
ATOM   6763  O  OD1   . ASN A 1 917  ? -32.208 -27.589 -31.227 1.00 62.35  ? 917  ASN A OD1   1 
ATOM   6764  N  ND2   . ASN A 1 917  ? -31.133 -26.750 -29.453 1.00 64.19  ? 917  ASN A ND2   1 
ATOM   6765  N  N     . THR A 1 918  ? -29.518 -25.903 -34.642 1.00 68.25  ? 918  THR A N     1 
ATOM   6766  C  CA    . THR A 1 918  ? -28.848 -25.261 -35.777 1.00 69.98  ? 918  THR A CA    1 
ATOM   6767  C  C     . THR A 1 918  ? -28.983 -23.739 -35.675 1.00 69.60  ? 918  THR A C     1 
ATOM   6768  O  O     . THR A 1 918  ? -29.674 -23.220 -34.794 1.00 69.60  ? 918  THR A O     1 
ATOM   6769  C  CB    . THR A 1 918  ? -29.461 -25.714 -37.133 1.00 69.92  ? 918  THR A CB    1 
ATOM   6770  O  OG1   . THR A 1 918  ? -30.725 -25.069 -37.334 1.00 72.40  ? 918  THR A OG1   1 
ATOM   6771  C  CG2   . THR A 1 918  ? -29.661 -27.229 -37.191 1.00 69.96  ? 918  THR A CG2   1 
ATOM   6772  N  N     . ALA A 1 919  ? -28.328 -23.037 -36.596 1.00 69.86  ? 919  ALA A N     1 
ATOM   6773  C  CA    . ALA A 1 919  ? -28.459 -21.587 -36.703 1.00 70.12  ? 919  ALA A CA    1 
ATOM   6774  C  C     . ALA A 1 919  ? -29.815 -21.248 -37.271 1.00 68.77  ? 919  ALA A C     1 
ATOM   6775  O  O     . ALA A 1 919  ? -30.433 -22.055 -37.962 1.00 70.46  ? 919  ALA A O     1 
ATOM   6776  C  CB    . ALA A 1 919  ? -27.370 -21.000 -37.581 1.00 71.71  ? 919  ALA A CB    1 
ATOM   6777  N  N     . PHE A 1 920  ? -30.249 -20.033 -36.981 1.00 67.76  ? 920  PHE A N     1 
ATOM   6778  C  CA    . PHE A 1 920  ? -31.609 -19.586 -37.225 1.00 67.05  ? 920  PHE A CA    1 
ATOM   6779  C  C     . PHE A 1 920  ? -31.511 -18.087 -37.490 1.00 69.33  ? 920  PHE A C     1 
ATOM   6780  O  O     . PHE A 1 920  ? -30.579 -17.433 -37.016 1.00 72.86  ? 920  PHE A O     1 
ATOM   6781  C  CB    . PHE A 1 920  ? -32.463 -19.875 -35.979 1.00 65.82  ? 920  PHE A CB    1 
ATOM   6782  C  CG    . PHE A 1 920  ? -33.938 -20.048 -36.245 1.00 64.50  ? 920  PHE A CG    1 
ATOM   6783  C  CD1   . PHE A 1 920  ? -34.710 -19.011 -36.759 1.00 64.25  ? 920  PHE A CD1   1 
ATOM   6784  C  CD2   . PHE A 1 920  ? -34.572 -21.241 -35.938 1.00 64.48  ? 920  PHE A CD2   1 
ATOM   6785  C  CE1   . PHE A 1 920  ? -36.073 -19.161 -36.980 1.00 64.04  ? 920  PHE A CE1   1 
ATOM   6786  C  CE2   . PHE A 1 920  ? -35.934 -21.402 -36.158 1.00 64.26  ? 920  PHE A CE2   1 
ATOM   6787  C  CZ    . PHE A 1 920  ? -36.690 -20.356 -36.676 1.00 63.93  ? 920  PHE A CZ    1 
ATOM   6788  N  N     . ARG A 1 921  ? -32.437 -17.567 -38.288 1.00 70.17  ? 921  ARG A N     1 
ATOM   6789  C  CA    . ARG A 1 921  ? -32.666 -16.112 -38.446 1.00 71.38  ? 921  ARG A CA    1 
ATOM   6790  C  C     . ARG A 1 921  ? -32.455 -15.285 -37.156 1.00 72.21  ? 921  ARG A C     1 
ATOM   6791  O  O     . ARG A 1 921  ? -33.333 -15.207 -36.292 1.00 70.56  ? 921  ARG A O     1 
ATOM   6792  C  CB    . ARG A 1 921  ? -34.080 -15.875 -39.001 1.00 70.54  ? 921  ARG A CB    1 
ATOM   6793  C  CG    . ARG A 1 921  ? -34.250 -14.575 -39.754 1.00 69.79  ? 921  ARG A CG    1 
ATOM   6794  C  CD    . ARG A 1 921  ? -35.641 -14.515 -40.348 1.00 68.84  ? 921  ARG A CD    1 
ATOM   6795  N  NE    . ARG A 1 921  ? -35.845 -13.342 -41.184 1.00 68.36  ? 921  ARG A NE    1 
ATOM   6796  C  CZ    . ARG A 1 921  ? -36.976 -13.049 -41.826 1.00 68.69  ? 921  ARG A CZ    1 
ATOM   6797  N  NH1   . ARG A 1 921  ? -38.039 -13.854 -41.762 1.00 68.60  ? 921  ARG A NH1   1 
ATOM   6798  N  NH2   . ARG A 1 921  ? -37.039 -11.939 -42.556 1.00 68.73  ? 921  ARG A NH2   1 
ATOM   6799  N  N     . GLY A 1 922  ? -31.265 -14.698 -37.047 1.00 74.00  ? 922  GLY A N     1 
ATOM   6800  C  CA    . GLY A 1 922  ? -30.859 -13.897 -35.892 1.00 76.87  ? 922  GLY A CA    1 
ATOM   6801  C  C     . GLY A 1 922  ? -29.468 -14.276 -35.405 1.00 78.67  ? 922  GLY A C     1 
ATOM   6802  O  O     . GLY A 1 922  ? -28.664 -13.398 -35.077 1.00 80.03  ? 922  GLY A O     1 
ATOM   6803  N  N     . PHE A 1 923  ? -29.208 -15.585 -35.331 1.00 79.16  ? 923  PHE A N     1 
ATOM   6804  C  CA    . PHE A 1 923  ? -27.885 -16.133 -35.012 1.00 81.28  ? 923  PHE A CA    1 
ATOM   6805  C  C     . PHE A 1 923  ? -27.422 -15.722 -33.604 1.00 79.75  ? 923  PHE A C     1 
ATOM   6806  O  O     . PHE A 1 923  ? -26.374 -15.079 -33.438 1.00 81.73  ? 923  PHE A O     1 
ATOM   6807  C  CB    . PHE A 1 923  ? -26.859 -15.712 -36.089 1.00 84.90  ? 923  PHE A CB    1 
ATOM   6808  C  CG    . PHE A 1 923  ? -25.799 -16.749 -36.382 1.00 89.73  ? 923  PHE A CG    1 
ATOM   6809  C  CD1   . PHE A 1 923  ? -25.194 -17.495 -35.363 1.00 92.65  ? 923  PHE A CD1   1 
ATOM   6810  C  CD2   . PHE A 1 923  ? -25.384 -16.965 -37.695 1.00 93.40  ? 923  PHE A CD2   1 
ATOM   6811  C  CE1   . PHE A 1 923  ? -24.220 -18.440 -35.651 1.00 94.04  ? 923  PHE A CE1   1 
ATOM   6812  C  CE2   . PHE A 1 923  ? -24.408 -17.909 -37.986 1.00 95.36  ? 923  PHE A CE2   1 
ATOM   6813  C  CZ    . PHE A 1 923  ? -23.824 -18.646 -36.961 1.00 95.28  ? 923  PHE A CZ    1 
ATOM   6814  N  N     . GLY A 1 924  ? -28.212 -16.086 -32.594 1.00 75.63  ? 924  GLY A N     1 
ATOM   6815  C  CA    . GLY A 1 924  ? -27.859 -15.823 -31.199 1.00 73.73  ? 924  GLY A CA    1 
ATOM   6816  C  C     . GLY A 1 924  ? -28.299 -14.473 -30.659 1.00 72.38  ? 924  GLY A C     1 
ATOM   6817  O  O     . GLY A 1 924  ? -28.316 -14.277 -29.439 1.00 73.50  ? 924  GLY A O     1 
ATOM   6818  N  N     . PHE A 1 925  ? -28.647 -13.537 -31.545 1.00 68.90  ? 925  PHE A N     1 
ATOM   6819  C  CA    . PHE A 1 925  ? -29.038 -12.193 -31.130 1.00 67.43  ? 925  PHE A CA    1 
ATOM   6820  C  C     . PHE A 1 925  ? -30.398 -12.156 -30.420 1.00 66.68  ? 925  PHE A C     1 
ATOM   6821  O  O     . PHE A 1 925  ? -30.496 -11.572 -29.348 1.00 67.81  ? 925  PHE A O     1 
ATOM   6822  C  CB    . PHE A 1 925  ? -29.003 -11.216 -32.310 1.00 66.49  ? 925  PHE A CB    1 
ATOM   6823  C  CG    . PHE A 1 925  ? -29.360 -9.807  -31.934 1.00 67.19  ? 925  PHE A CG    1 
ATOM   6824  C  CD1   . PHE A 1 925  ? -28.530 -9.065  -31.109 1.00 68.77  ? 925  PHE A CD1   1 
ATOM   6825  C  CD2   . PHE A 1 925  ? -30.537 -9.227  -32.378 1.00 67.21  ? 925  PHE A CD2   1 
ATOM   6826  C  CE1   . PHE A 1 925  ? -28.853 -7.762  -30.744 1.00 69.59  ? 925  PHE A CE1   1 
ATOM   6827  C  CE2   . PHE A 1 925  ? -30.866 -7.926  -32.019 1.00 67.97  ? 925  PHE A CE2   1 
ATOM   6828  C  CZ    . PHE A 1 925  ? -30.024 -7.191  -31.200 1.00 68.88  ? 925  PHE A CZ    1 
ATOM   6829  N  N     . PRO A 1 926  ? -31.442 -12.793 -30.993 1.00 65.23  ? 926  PRO A N     1 
ATOM   6830  C  CA    . PRO A 1 926  ? -32.741 -12.803 -30.313 1.00 64.85  ? 926  PRO A CA    1 
ATOM   6831  C  C     . PRO A 1 926  ? -32.683 -13.372 -28.898 1.00 65.50  ? 926  PRO A C     1 
ATOM   6832  O  O     . PRO A 1 926  ? -33.460 -12.954 -28.053 1.00 65.73  ? 926  PRO A O     1 
ATOM   6833  C  CB    . PRO A 1 926  ? -33.602 -13.704 -31.207 1.00 64.02  ? 926  PRO A CB    1 
ATOM   6834  C  CG    . PRO A 1 926  ? -32.930 -13.682 -32.528 1.00 63.33  ? 926  PRO A CG    1 
ATOM   6835  C  CD    . PRO A 1 926  ? -31.476 -13.634 -32.202 1.00 64.04  ? 926  PRO A CD    1 
ATOM   6836  N  N     . GLN A 1 927  ? -31.767 -14.311 -28.661 1.00 66.04  ? 927  GLN A N     1 
ATOM   6837  C  CA    . GLN A 1 927  ? -31.517 -14.860 -27.329 1.00 67.37  ? 927  GLN A CA    1 
ATOM   6838  C  C     . GLN A 1 927  ? -30.715 -13.911 -26.463 1.00 68.69  ? 927  GLN A C     1 
ATOM   6839  O  O     . GLN A 1 927  ? -31.115 -13.608 -25.343 1.00 70.04  ? 927  GLN A O     1 
ATOM   6840  C  CB    . GLN A 1 927  ? -30.759 -16.189 -27.404 1.00 67.91  ? 927  GLN A CB    1 
ATOM   6841  C  CG    . GLN A 1 927  ? -31.462 -17.310 -28.160 1.00 66.95  ? 927  GLN A CG    1 
ATOM   6842  C  CD    . GLN A 1 927  ? -30.939 -17.503 -29.571 1.00 66.08  ? 927  GLN A CD    1 
ATOM   6843  O  OE1   . GLN A 1 927  ? -30.761 -16.542 -30.309 1.00 66.83  ? 927  GLN A OE1   1 
ATOM   6844  N  NE2   . GLN A 1 927  ? -30.704 -18.749 -29.955 1.00 66.13  ? 927  GLN A NE2   1 
ATOM   6845  N  N     . ALA A 1 928  ? -29.578 -13.459 -26.989 1.00 68.89  ? 928  ALA A N     1 
ATOM   6846  C  CA    . ALA A 1 928  ? -28.640 -12.615 -26.240 1.00 70.09  ? 928  ALA A CA    1 
ATOM   6847  C  C     . ALA A 1 928  ? -29.230 -11.261 -25.851 1.00 70.22  ? 928  ALA A C     1 
ATOM   6848  O  O     . ALA A 1 928  ? -29.058 -10.809 -24.718 1.00 72.62  ? 928  ALA A O     1 
ATOM   6849  C  CB    . ALA A 1 928  ? -27.355 -12.418 -27.034 1.00 70.10  ? 928  ALA A CB    1 
ATOM   6850  N  N     . ALA A 1 929  ? -29.920 -10.622 -26.790 1.00 69.36  ? 929  ALA A N     1 
ATOM   6851  C  CA    . ALA A 1 929  ? -30.550 -9.324  -26.539 1.00 70.26  ? 929  ALA A CA    1 
ATOM   6852  C  C     . ALA A 1 929  ? -31.736 -9.420  -25.567 1.00 71.35  ? 929  ALA A C     1 
ATOM   6853  O  O     . ALA A 1 929  ? -31.954 -8.497  -24.786 1.00 71.92  ? 929  ALA A O     1 
ATOM   6854  C  CB    . ALA A 1 929  ? -30.969 -8.672  -27.846 1.00 68.84  ? 929  ALA A CB    1 
ATOM   6855  N  N     . LEU A 1 930  ? -32.481 -10.530 -25.599 1.00 71.52  ? 930  LEU A N     1 
ATOM   6856  C  CA    . LEU A 1 930  ? -33.531 -10.778 -24.597 1.00 73.13  ? 930  LEU A CA    1 
ATOM   6857  C  C     . LEU A 1 930  ? -32.979 -10.888 -23.179 1.00 74.97  ? 930  LEU A C     1 
ATOM   6858  O  O     . LEU A 1 930  ? -33.659 -10.477 -22.231 1.00 76.11  ? 930  LEU A O     1 
ATOM   6859  C  CB    . LEU A 1 930  ? -34.331 -12.047 -24.899 1.00 72.79  ? 930  LEU A CB    1 
ATOM   6860  C  CG    . LEU A 1 930  ? -35.513 -12.314 -23.950 1.00 74.04  ? 930  LEU A CG    1 
ATOM   6861  C  CD1   . LEU A 1 930  ? -36.607 -11.269 -24.148 1.00 74.97  ? 930  LEU A CD1   1 
ATOM   6862  C  CD2   . LEU A 1 930  ? -36.049 -13.721 -24.125 1.00 73.55  ? 930  LEU A CD2   1 
ATOM   6863  N  N     . ILE A 1 931  ? -31.778 -11.458 -23.031 1.00 75.07  ? 931  ILE A N     1 
ATOM   6864  C  CA    . ILE A 1 931  ? -31.133 -11.548 -21.715 1.00 76.38  ? 931  ILE A CA    1 
ATOM   6865  C  C     . ILE A 1 931  ? -30.921 -10.137 -21.183 1.00 76.96  ? 931  ILE A C     1 
ATOM   6866  O  O     . ILE A 1 931  ? -31.276 -9.852  -20.041 1.00 77.51  ? 931  ILE A O     1 
ATOM   6867  C  CB    . ILE A 1 931  ? -29.767 -12.301 -21.713 1.00 76.85  ? 931  ILE A CB    1 
ATOM   6868  C  CG1   . ILE A 1 931  ? -29.857 -13.700 -22.354 1.00 76.56  ? 931  ILE A CG1   1 
ATOM   6869  C  CG2   . ILE A 1 931  ? -29.245 -12.461 -20.291 1.00 78.26  ? 931  ILE A CG2   1 
ATOM   6870  C  CD1   . ILE A 1 931  ? -31.022 -14.559 -21.903 1.00 76.30  ? 931  ILE A CD1   1 
ATOM   6871  N  N     . THR A 1 932  ? -30.366 -9.258  -22.015 1.00 76.63  ? 932  THR A N     1 
ATOM   6872  C  CA    . THR A 1 932  ? -30.060 -7.897  -21.579 1.00 78.72  ? 932  THR A CA    1 
ATOM   6873  C  C     . THR A 1 932  ? -31.299 -7.038  -21.333 1.00 78.19  ? 932  THR A C     1 
ATOM   6874  O  O     . THR A 1 932  ? -31.282 -6.211  -20.431 1.00 80.33  ? 932  THR A O     1 
ATOM   6875  C  CB    . THR A 1 932  ? -29.106 -7.180  -22.547 1.00 79.15  ? 932  THR A CB    1 
ATOM   6876  O  OG1   . THR A 1 932  ? -29.650 -7.224  -23.867 1.00 79.61  ? 932  THR A OG1   1 
ATOM   6877  C  CG2   . THR A 1 932  ? -27.750 -7.857  -22.545 1.00 79.47  ? 932  THR A CG2   1 
ATOM   6878  N  N     . GLU A 1 933  ? -32.367 -7.230  -22.102 1.00 76.37  ? 933  GLU A N     1 
ATOM   6879  C  CA    . GLU A 1 933  ? -33.625 -6.508  -21.839 1.00 76.76  ? 933  GLU A CA    1 
ATOM   6880  C  C     . GLU A 1 933  ? -34.305 -6.959  -20.546 1.00 77.06  ? 933  GLU A C     1 
ATOM   6881  O  O     . GLU A 1 933  ? -34.892 -6.145  -19.838 1.00 78.52  ? 933  GLU A O     1 
ATOM   6882  C  CB    . GLU A 1 933  ? -34.617 -6.648  -22.999 1.00 75.71  ? 933  GLU A CB    1 
ATOM   6883  C  CG    . GLU A 1 933  ? -34.172 -6.068  -24.337 1.00 75.09  ? 933  GLU A CG    1 
ATOM   6884  C  CD    . GLU A 1 933  ? -33.843 -4.578  -24.312 1.00 76.24  ? 933  GLU A CD    1 
ATOM   6885  O  OE1   . GLU A 1 933  ? -34.275 -3.853  -23.384 1.00 76.36  ? 933  GLU A OE1   1 
ATOM   6886  O  OE2   . GLU A 1 933  ? -33.148 -4.128  -25.251 1.00 75.80  ? 933  GLU A OE2   1 
ATOM   6887  N  N     . SER A 1 934  ? -34.243 -8.254  -20.257 1.00 76.89  ? 934  SER A N     1 
ATOM   6888  C  CA    . SER A 1 934  ? -34.733 -8.794  -18.988 1.00 78.34  ? 934  SER A CA    1 
ATOM   6889  C  C     . SER A 1 934  ? -33.983 -8.158  -17.820 1.00 79.62  ? 934  SER A C     1 
ATOM   6890  O  O     . SER A 1 934  ? -34.589 -7.746  -16.833 1.00 80.14  ? 934  SER A O     1 
ATOM   6891  C  CB    . SER A 1 934  ? -34.584 -10.323 -18.954 1.00 78.26  ? 934  SER A CB    1 
ATOM   6892  O  OG    . SER A 1 934  ? -34.726 -10.838 -17.637 1.00 80.73  ? 934  SER A OG    1 
ATOM   6893  N  N     . CYS A 1 935  ? -32.664 -8.076  -17.959 1.00 80.62  ? 935  CYS A N     1 
ATOM   6894  C  CA    . CYS A 1 935  ? -31.806 -7.422  -16.969 1.00 82.74  ? 935  CYS A CA    1 
ATOM   6895  C  C     . CYS A 1 935  ? -32.151 -5.944  -16.773 1.00 83.37  ? 935  CYS A C     1 
ATOM   6896  O  O     . CYS A 1 935  ? -32.115 -5.450  -15.648 1.00 85.59  ? 935  CYS A O     1 
ATOM   6897  C  CB    . CYS A 1 935  ? -30.339 -7.563  -17.365 1.00 82.63  ? 935  CYS A CB    1 
ATOM   6898  S  SG    . CYS A 1 935  ? -29.203 -6.945  -16.118 1.00 86.43  ? 935  CYS A SG    1 
ATOM   6899  N  N     . ILE A 1 936  ? -32.486 -5.252  -17.861 1.00 81.97  ? 936  ILE A N     1 
ATOM   6900  C  CA    . ILE A 1 936  ? -32.944 -3.863  -17.791 1.00 82.54  ? 936  ILE A CA    1 
ATOM   6901  C  C     . ILE A 1 936  ? -34.278 -3.746  -17.052 1.00 83.77  ? 936  ILE A C     1 
ATOM   6902  O  O     . ILE A 1 936  ? -34.367 -2.987  -16.090 1.00 86.25  ? 936  ILE A O     1 
ATOM   6903  C  CB    . ILE A 1 936  ? -33.024 -3.203  -19.189 1.00 80.86  ? 936  ILE A CB    1 
ATOM   6904  C  CG1   . ILE A 1 936  ? -31.612 -2.898  -19.687 1.00 80.74  ? 936  ILE A CG1   1 
ATOM   6905  C  CG2   . ILE A 1 936  ? -33.829 -1.906  -19.158 1.00 81.55  ? 936  ILE A CG2   1 
ATOM   6906  C  CD1   . ILE A 1 936  ? -31.532 -2.535  -21.148 1.00 78.99  ? 936  ILE A CD1   1 
ATOM   6907  N  N     . THR A 1 937  ? -35.303 -4.487  -17.470 1.00 83.25  ? 937  THR A N     1 
ATOM   6908  C  CA    . THR A 1 937  ? -36.637 -4.319  -16.858 1.00 85.21  ? 937  THR A CA    1 
ATOM   6909  C  C     . THR A 1 937  ? -36.674 -4.696  -15.364 1.00 88.06  ? 937  THR A C     1 
ATOM   6910  O  O     . THR A 1 937  ? -37.509 -4.169  -14.615 1.00 90.23  ? 937  THR A O     1 
ATOM   6911  C  CB    . THR A 1 937  ? -37.758 -5.063  -17.615 1.00 83.21  ? 937  THR A CB    1 
ATOM   6912  O  OG1   . THR A 1 937  ? -37.491 -6.463  -17.608 1.00 83.77  ? 937  THR A OG1   1 
ATOM   6913  C  CG2   . THR A 1 937  ? -37.896 -4.554  -19.069 1.00 81.52  ? 937  THR A CG2   1 
ATOM   6914  N  N     . GLU A 1 938  ? -35.766 -5.581  -14.941 1.00 89.20  ? 938  GLU A N     1 
ATOM   6915  C  CA    . GLU A 1 938  ? -35.539 -5.865  -13.510 1.00 91.61  ? 938  GLU A CA    1 
ATOM   6916  C  C     . GLU A 1 938  ? -34.903 -4.703  -12.730 1.00 91.84  ? 938  GLU A C     1 
ATOM   6917  O  O     . GLU A 1 938  ? -35.306 -4.415  -11.601 1.00 92.23  ? 938  GLU A O     1 
ATOM   6918  C  CB    . GLU A 1 938  ? -34.666 -7.111  -13.330 1.00 92.89  ? 938  GLU A CB    1 
ATOM   6919  C  CG    . GLU A 1 938  ? -35.418 -8.424  -13.487 1.00 93.30  ? 938  GLU A CG    1 
ATOM   6920  C  CD    . GLU A 1 938  ? -34.788 -9.568  -12.706 1.00 95.27  ? 938  GLU A CD    1 
ATOM   6921  O  OE1   . GLU A 1 938  ? -34.407 -9.371  -11.522 1.00 97.97  ? 938  GLU A OE1   1 
ATOM   6922  O  OE2   . GLU A 1 938  ? -34.691 -10.675 -13.275 1.00 94.26  ? 938  GLU A OE2   1 
ATOM   6923  N  N     . VAL A 1 939  ? -33.889 -4.078  -13.323 1.00 90.24  ? 939  VAL A N     1 
ATOM   6924  C  CA    . VAL A 1 939  ? -33.248 -2.885  -12.755 1.00 91.48  ? 939  VAL A CA    1 
ATOM   6925  C  C     . VAL A 1 939  ? -34.248 -1.725  -12.709 1.00 91.31  ? 939  VAL A C     1 
ATOM   6926  O  O     . VAL A 1 939  ? -34.316 -0.993  -11.720 1.00 92.39  ? 939  VAL A O     1 
ATOM   6927  C  CB    . VAL A 1 939  ? -31.987 -2.492  -13.567 1.00 91.31  ? 939  VAL A CB    1 
ATOM   6928  C  CG1   . VAL A 1 939  ? -31.483 -1.103  -13.200 1.00 93.31  ? 939  VAL A CG1   1 
ATOM   6929  C  CG2   . VAL A 1 939  ? -30.882 -3.522  -13.365 1.00 91.41  ? 939  VAL A CG2   1 
ATOM   6930  N  N     . ALA A 1 940  ? -35.013 -1.572  -13.789 1.00 89.68  ? 940  ALA A N     1 
ATOM   6931  C  CA    . ALA A 1 940  ? -36.117 -0.604  -13.854 1.00 89.51  ? 940  ALA A CA    1 
ATOM   6932  C  C     . ALA A 1 940  ? -37.092 -0.786  -12.695 1.00 90.06  ? 940  ALA A C     1 
ATOM   6933  O  O     . ALA A 1 940  ? -37.461 0.185   -12.040 1.00 91.72  ? 940  ALA A O     1 
ATOM   6934  C  CB    . ALA A 1 940  ? -36.851 -0.726  -15.180 1.00 87.33  ? 940  ALA A CB    1 
ATOM   6935  N  N     . ALA A 1 941  ? -37.486 -2.033  -12.443 1.00 89.15  ? 941  ALA A N     1 
ATOM   6936  C  CA    . ALA A 1 941  ? -38.349 -2.366  -11.305 1.00 90.07  ? 941  ALA A CA    1 
ATOM   6937  C  C     . ALA A 1 941  ? -37.751 -1.908  -9.971  1.00 91.33  ? 941  ALA A C     1 
ATOM   6938  O  O     . ALA A 1 941  ? -38.443 -1.284  -9.179  1.00 91.91  ? 941  ALA A O     1 
ATOM   6939  C  CB    . ALA A 1 941  ? -38.646 -3.861  -11.266 1.00 89.16  ? 941  ALA A CB    1 
ATOM   6940  N  N     . LYS A 1 942  ? -36.466 -2.192  -9.754  1.00 91.61  ? 942  LYS A N     1 
ATOM   6941  C  CA    . LYS A 1 942  ? -35.783 -1.841  -8.499  1.00 94.47  ? 942  LYS A CA    1 
ATOM   6942  C  C     . LYS A 1 942  ? -35.500 -0.343  -8.316  1.00 96.24  ? 942  LYS A C     1 
ATOM   6943  O  O     . LYS A 1 942  ? -35.178 0.080   -7.209  1.00 98.43  ? 942  LYS A O     1 
ATOM   6944  C  CB    . LYS A 1 942  ? -34.476 -2.636  -8.344  1.00 94.72  ? 942  LYS A CB    1 
ATOM   6945  C  CG    . LYS A 1 942  ? -34.682 -4.108  -8.023  1.00 94.88  ? 942  LYS A CG    1 
ATOM   6946  C  CD    . LYS A 1 942  ? -35.035 -4.327  -6.553  1.00 97.52  ? 942  LYS A CD    1 
ATOM   6947  C  CE    . LYS A 1 942  ? -35.591 -5.723  -6.294  1.00 97.46  ? 942  LYS A CE    1 
ATOM   6948  N  NZ    . LYS A 1 942  ? -34.535 -6.776  -6.300  1.00 97.56  ? 942  LYS A NZ    1 
ATOM   6949  N  N     . CYS A 1 943  ? -35.607 0.445   -9.388  1.00 95.71  ? 943  CYS A N     1 
ATOM   6950  C  CA    . CYS A 1 943  ? -35.470 1.900   -9.318  1.00 97.12  ? 943  CYS A CA    1 
ATOM   6951  C  C     . CYS A 1 943  ? -36.798 2.653   -9.348  1.00 97.27  ? 943  CYS A C     1 
ATOM   6952  O  O     . CYS A 1 943  ? -36.808 3.878   -9.202  1.00 98.99  ? 943  CYS A O     1 
ATOM   6953  C  CB    . CYS A 1 943  ? -34.610 2.377   -10.489 1.00 96.77  ? 943  CYS A CB    1 
ATOM   6954  S  SG    . CYS A 1 943  ? -32.983 1.532   -10.568 1.00 98.50  ? 943  CYS A SG    1 
ATOM   6955  N  N     . GLY A 1 944  ? -37.909 1.941   -9.537  1.00 96.24  ? 944  GLY A N     1 
ATOM   6956  C  CA    . GLY A 1 944  ? -39.225 2.570   -9.670  1.00 96.80  ? 944  GLY A CA    1 
ATOM   6957  C  C     . GLY A 1 944  ? -39.369 3.440   -10.908 1.00 96.43  ? 944  GLY A C     1 
ATOM   6958  O  O     . GLY A 1 944  ? -40.160 4.383   -10.920 1.00 97.44  ? 944  GLY A O     1 
ATOM   6959  N  N     . LEU A 1 945  ? -38.602 3.116   -11.946 1.00 95.19  ? 945  LEU A N     1 
ATOM   6960  C  CA    . LEU A 1 945  ? -38.592 3.858   -13.195 1.00 94.23  ? 945  LEU A CA    1 
ATOM   6961  C  C     . LEU A 1 945  ? -39.128 2.922   -14.256 1.00 92.32  ? 945  LEU A C     1 
ATOM   6962  O  O     . LEU A 1 945  ? -38.966 1.704   -14.142 1.00 91.59  ? 945  LEU A O     1 
ATOM   6963  C  CB    . LEU A 1 945  ? -37.162 4.271   -13.540 1.00 94.23  ? 945  LEU A CB    1 
ATOM   6964  C  CG    . LEU A 1 945  ? -36.527 5.271   -12.570 1.00 96.39  ? 945  LEU A CG    1 
ATOM   6965  C  CD1   . LEU A 1 945  ? -35.009 5.262   -12.693 1.00 96.57  ? 945  LEU A CD1   1 
ATOM   6966  C  CD2   . LEU A 1 945  ? -37.087 6.668   -12.800 1.00 96.81  ? 945  LEU A CD2   1 
ATOM   6967  N  N     . SER A 1 946  ? -39.766 3.476   -15.286 1.00 91.79  ? 946  SER A N     1 
ATOM   6968  C  CA    . SER A 1 946  ? -40.229 2.659   -16.408 1.00 90.06  ? 946  SER A CA    1 
ATOM   6969  C  C     . SER A 1 946  ? -38.989 2.080   -17.086 1.00 88.93  ? 946  SER A C     1 
ATOM   6970  O  O     . SER A 1 946  ? -37.935 2.726   -17.106 1.00 90.05  ? 946  SER A O     1 
ATOM   6971  C  CB    . SER A 1 946  ? -41.080 3.461   -17.413 1.00 89.91  ? 946  SER A CB    1 
ATOM   6972  O  OG    . SER A 1 946  ? -40.294 4.207   -18.336 1.00 89.61  ? 946  SER A OG    1 
ATOM   6973  N  N     . PRO A 1 947  ? -39.092 0.859   -17.634 1.00 86.14  ? 947  PRO A N     1 
ATOM   6974  C  CA    . PRO A 1 947  ? -37.944 0.358   -18.383 1.00 84.71  ? 947  PRO A CA    1 
ATOM   6975  C  C     . PRO A 1 947  ? -37.456 1.305   -19.486 1.00 83.89  ? 947  PRO A C     1 
ATOM   6976  O  O     . PRO A 1 947  ? -36.271 1.319   -19.783 1.00 84.17  ? 947  PRO A O     1 
ATOM   6977  C  CB    . PRO A 1 947  ? -38.464 -0.957  -18.958 1.00 83.32  ? 947  PRO A CB    1 
ATOM   6978  C  CG    . PRO A 1 947  ? -39.460 -1.416  -17.946 1.00 83.65  ? 947  PRO A CG    1 
ATOM   6979  C  CD    . PRO A 1 947  ? -40.140 -0.165  -17.486 1.00 84.78  ? 947  PRO A CD    1 
ATOM   6980  N  N     . GLU A 1 948  ? -38.350 2.118   -20.038 1.00 83.57  ? 948  GLU A N     1 
ATOM   6981  C  CA    . GLU A 1 948  ? -38.019 2.984   -21.160 1.00 83.60  ? 948  GLU A CA    1 
ATOM   6982  C  C     . GLU A 1 948  ? -37.179 4.194   -20.724 1.00 85.94  ? 948  GLU A C     1 
ATOM   6983  O  O     . GLU A 1 948  ? -36.438 4.751   -21.537 1.00 86.62  ? 948  GLU A O     1 
ATOM   6984  C  CB    . GLU A 1 948  ? -39.292 3.406   -21.908 1.00 83.26  ? 948  GLU A CB    1 
ATOM   6985  C  CG    . GLU A 1 948  ? -39.943 2.280   -22.727 1.00 81.99  ? 948  GLU A CG    1 
ATOM   6986  C  CD    . GLU A 1 948  ? -40.557 1.149   -21.892 1.00 82.13  ? 948  GLU A CD    1 
ATOM   6987  O  OE1   . GLU A 1 948  ? -40.707 1.308   -20.659 1.00 84.66  ? 948  GLU A OE1   1 
ATOM   6988  O  OE2   . GLU A 1 948  ? -40.893 0.091   -22.463 1.00 79.66  ? 948  GLU A OE2   1 
ATOM   6989  N  N     . LYS A 1 949  ? -37.288 4.594   -19.455 1.00 87.37  ? 949  LYS A N     1 
ATOM   6990  C  CA    . LYS A 1 949  ? -36.358 5.571   -18.858 1.00 89.38  ? 949  LYS A CA    1 
ATOM   6991  C  C     . LYS A 1 949  ? -34.960 4.979   -18.658 1.00 88.06  ? 949  LYS A C     1 
ATOM   6992  O  O     . LYS A 1 949  ? -33.958 5.659   -18.859 1.00 87.95  ? 949  LYS A O     1 
ATOM   6993  C  CB    . LYS A 1 949  ? -36.866 6.065   -17.498 1.00 92.44  ? 949  LYS A CB    1 
ATOM   6994  C  CG    . LYS A 1 949  ? -38.149 6.871   -17.539 1.00 94.55  ? 949  LYS A CG    1 
ATOM   6995  C  CD    . LYS A 1 949  ? -38.559 7.288   -16.133 1.00 98.36  ? 949  LYS A CD    1 
ATOM   6996  C  CE    . LYS A 1 949  ? -39.838 8.116   -16.121 1.00 99.95  ? 949  LYS A CE    1 
ATOM   6997  N  NZ    . LYS A 1 949  ? -41.002 7.348   -16.650 1.00 98.89  ? 949  LYS A NZ    1 
ATOM   6998  N  N     . VAL A 1 950  ? -34.903 3.723   -18.225 1.00 87.19  ? 950  VAL A N     1 
ATOM   6999  C  CA    . VAL A 1 950  ? -33.631 3.021   -18.005 1.00 87.18  ? 950  VAL A CA    1 
ATOM   7000  C  C     . VAL A 1 950  ? -32.922 2.725   -19.340 1.00 85.15  ? 950  VAL A C     1 
ATOM   7001  O  O     . VAL A 1 950  ? -31.703 2.830   -19.432 1.00 84.94  ? 950  VAL A O     1 
ATOM   7002  C  CB    . VAL A 1 950  ? -33.839 1.722   -17.180 1.00 86.94  ? 950  VAL A CB    1 
ATOM   7003  C  CG1   . VAL A 1 950  ? -32.550 0.909   -17.086 1.00 86.98  ? 950  VAL A CG1   1 
ATOM   7004  C  CG2   . VAL A 1 950  ? -34.362 2.061   -15.788 1.00 88.15  ? 950  VAL A CG2   1 
ATOM   7005  N  N     . ARG A 1 951  ? -33.687 2.363   -20.365 1.00 83.13  ? 951  ARG A N     1 
ATOM   7006  C  CA    . ARG A 1 951  ? -33.125 2.166   -21.690 1.00 82.06  ? 951  ARG A CA    1 
ATOM   7007  C  C     . ARG A 1 951  ? -32.521 3.445   -22.233 1.00 84.20  ? 951  ARG A C     1 
ATOM   7008  O  O     . ARG A 1 951  ? -31.375 3.444   -22.676 1.00 85.56  ? 951  ARG A O     1 
ATOM   7009  C  CB    . ARG A 1 951  ? -34.176 1.631   -22.660 1.00 80.13  ? 951  ARG A CB    1 
ATOM   7010  C  CG    . ARG A 1 951  ? -34.512 0.178   -22.396 1.00 78.93  ? 951  ARG A CG    1 
ATOM   7011  C  CD    . ARG A 1 951  ? -35.646 -0.330  -23.262 1.00 77.07  ? 951  ARG A CD    1 
ATOM   7012  N  NE    . ARG A 1 951  ? -35.885 -1.739  -22.953 1.00 76.46  ? 951  ARG A NE    1 
ATOM   7013  C  CZ    . ARG A 1 951  ? -37.019 -2.279  -22.498 1.00 77.04  ? 951  ARG A CZ    1 
ATOM   7014  N  NH1   . ARG A 1 951  ? -38.129 -1.562  -22.301 1.00 78.00  ? 951  ARG A NH1   1 
ATOM   7015  N  NH2   . ARG A 1 951  ? -37.048 -3.585  -22.252 1.00 76.97  ? 951  ARG A NH2   1 
ATOM   7016  N  N     . ILE A 1 952  ? -33.282 4.535   -22.178 1.00 86.50  ? 952  ILE A N     1 
ATOM   7017  C  CA    . ILE A 1 952  ? -32.875 5.794   -22.814 1.00 88.04  ? 952  ILE A CA    1 
ATOM   7018  C  C     . ILE A 1 952  ? -31.610 6.416   -22.181 1.00 89.40  ? 952  ILE A C     1 
ATOM   7019  O  O     . ILE A 1 952  ? -30.809 7.024   -22.900 1.00 89.21  ? 952  ILE A O     1 
ATOM   7020  C  CB    . ILE A 1 952  ? -34.064 6.800   -22.913 1.00 89.69  ? 952  ILE A CB    1 
ATOM   7021  C  CG1   . ILE A 1 952  ? -33.780 7.901   -23.948 1.00 90.55  ? 952  ILE A CG1   1 
ATOM   7022  C  CG2   . ILE A 1 952  ? -34.399 7.419   -21.565 1.00 91.80  ? 952  ILE A CG2   1 
ATOM   7023  C  CD1   . ILE A 1 952  ? -34.978 8.778   -24.265 1.00 90.56  ? 952  ILE A CD1   1 
ATOM   7024  N  N     . ILE A 1 953  ? -31.410 6.238   -20.871 1.00 90.38  ? 953  ILE A N     1 
ATOM   7025  C  CA    . ILE A 1 953  ? -30.186 6.736   -20.196 1.00 92.40  ? 953  ILE A CA    1 
ATOM   7026  C  C     . ILE A 1 953  ? -28.988 5.760   -20.179 1.00 90.73  ? 953  ILE A C     1 
ATOM   7027  O  O     . ILE A 1 953  ? -27.880 6.163   -19.809 1.00 92.19  ? 953  ILE A O     1 
ATOM   7028  C  CB    . ILE A 1 953  ? -30.461 7.270   -18.759 1.00 95.92  ? 953  ILE A CB    1 
ATOM   7029  C  CG1   . ILE A 1 953  ? -30.794 6.134   -17.769 1.00 96.45  ? 953  ILE A CG1   1 
ATOM   7030  C  CG2   . ILE A 1 953  ? -31.542 8.353   -18.779 1.00 96.79  ? 953  ILE A CG2   1 
ATOM   7031  C  CD1   . ILE A 1 953  ? -29.654 5.779   -16.831 1.00 97.84  ? 953  ILE A CD1   1 
ATOM   7032  N  N     . ASN A 1 954  ? -29.204 4.497   -20.555 1.00 87.45  ? 954  ASN A N     1 
ATOM   7033  C  CA    . ASN A 1 954  ? -28.101 3.547   -20.780 1.00 85.64  ? 954  ASN A CA    1 
ATOM   7034  C  C     . ASN A 1 954  ? -27.688 3.398   -22.250 1.00 84.08  ? 954  ASN A C     1 
ATOM   7035  O  O     . ASN A 1 954  ? -26.736 2.680   -22.539 1.00 83.02  ? 954  ASN A O     1 
ATOM   7036  C  CB    . ASN A 1 954  ? -28.424 2.167   -20.180 1.00 84.26  ? 954  ASN A CB    1 
ATOM   7037  C  CG    . ASN A 1 954  ? -28.050 2.065   -18.712 1.00 85.73  ? 954  ASN A CG    1 
ATOM   7038  O  OD1   . ASN A 1 954  ? -26.982 2.517   -18.293 1.00 87.05  ? 954  ASN A OD1   1 
ATOM   7039  N  ND2   . ASN A 1 954  ? -28.919 1.450   -17.925 1.00 85.64  ? 954  ASN A ND2   1 
ATOM   7040  N  N     . MET A 1 955  ? -28.370 4.091   -23.163 1.00 83.83  ? 955  MET A N     1 
ATOM   7041  C  CA    . MET A 1 955  ? -28.044 4.016   -24.595 1.00 82.96  ? 955  MET A CA    1 
ATOM   7042  C  C     . MET A 1 955  ? -26.664 4.574   -24.944 1.00 82.46  ? 955  MET A C     1 
ATOM   7043  O  O     . MET A 1 955  ? -26.134 5.420   -24.241 1.00 84.20  ? 955  MET A O     1 
ATOM   7044  C  CB    . MET A 1 955  ? -29.112 4.718   -25.455 1.00 83.48  ? 955  MET A CB    1 
ATOM   7045  C  CG    . MET A 1 955  ? -30.204 3.779   -25.934 1.00 83.69  ? 955  MET A CG    1 
ATOM   7046  S  SD    . MET A 1 955  ? -31.509 4.515   -26.941 1.00 86.11  ? 955  MET A SD    1 
ATOM   7047  C  CE    . MET A 1 955  ? -30.571 5.479   -28.128 1.00 84.40  ? 955  MET A CE    1 
ATOM   7048  N  N     . TYR A 1 956  ? -26.100 4.076   -26.040 1.00 81.06  ? 956  TYR A N     1 
ATOM   7049  C  CA    . TYR A 1 956  ? -24.907 4.652   -26.645 1.00 81.82  ? 956  TYR A CA    1 
ATOM   7050  C  C     . TYR A 1 956  ? -25.175 6.096   -27.040 1.00 82.90  ? 956  TYR A C     1 
ATOM   7051  O  O     . TYR A 1 956  ? -26.278 6.435   -27.461 1.00 81.06  ? 956  TYR A O     1 
ATOM   7052  C  CB    . TYR A 1 956  ? -24.502 3.877   -27.911 1.00 80.62  ? 956  TYR A CB    1 
ATOM   7053  C  CG    . TYR A 1 956  ? -23.870 2.520   -27.671 1.00 79.61  ? 956  TYR A CG    1 
ATOM   7054  C  CD1   . TYR A 1 956  ? -22.621 2.413   -27.078 1.00 80.66  ? 956  TYR A CD1   1 
ATOM   7055  C  CD2   . TYR A 1 956  ? -24.504 1.349   -28.072 1.00 78.47  ? 956  TYR A CD2   1 
ATOM   7056  C  CE1   . TYR A 1 956  ? -22.029 1.185   -26.857 1.00 80.39  ? 956  TYR A CE1   1 
ATOM   7057  C  CE2   . TYR A 1 956  ? -23.918 0.111   -27.861 1.00 78.24  ? 956  TYR A CE2   1 
ATOM   7058  C  CZ    . TYR A 1 956  ? -22.678 0.038   -27.252 1.00 79.41  ? 956  TYR A CZ    1 
ATOM   7059  O  OH    . TYR A 1 956  ? -22.081 -1.179  -27.040 1.00 79.19  ? 956  TYR A OH    1 
ATOM   7060  N  N     . LYS A 1 957  ? -24.160 6.943   -26.910 1.00 86.27  ? 957  LYS A N     1 
ATOM   7061  C  CA    . LYS A 1 957  ? -24.237 8.313   -27.426 1.00 88.46  ? 957  LYS A CA    1 
ATOM   7062  C  C     . LYS A 1 957  ? -24.005 8.270   -28.927 1.00 87.17  ? 957  LYS A C     1 
ATOM   7063  O  O     . LYS A 1 957  ? -23.761 7.195   -29.483 1.00 86.27  ? 957  LYS A O     1 
ATOM   7064  C  CB    . LYS A 1 957  ? -23.216 9.230   -26.735 1.00 91.12  ? 957  LYS A CB    1 
ATOM   7065  C  CG    . LYS A 1 957  ? -23.399 9.366   -25.229 1.00 92.74  ? 957  LYS A CG    1 
ATOM   7066  C  CD    . LYS A 1 957  ? -24.799 9.825   -24.847 1.00 92.83  ? 957  LYS A CD    1 
ATOM   7067  C  CE    . LYS A 1 957  ? -24.853 10.258  -23.389 1.00 94.69  ? 957  LYS A CE    1 
ATOM   7068  N  NZ    . LYS A 1 957  ? -26.241 10.571  -22.958 1.00 94.38  ? 957  LYS A NZ    1 
ATOM   7069  N  N     . GLU A 1 958  ? -24.107 9.427   -29.579 1.00 88.13  ? 958  GLU A N     1 
ATOM   7070  C  CA    . GLU A 1 958  ? -23.932 9.513   -31.030 1.00 88.25  ? 958  GLU A CA    1 
ATOM   7071  C  C     . GLU A 1 958  ? -22.637 8.817   -31.454 1.00 87.11  ? 958  GLU A C     1 
ATOM   7072  O  O     . GLU A 1 958  ? -22.669 7.927   -32.300 1.00 85.37  ? 958  GLU A O     1 
ATOM   7073  C  CB    . GLU A 1 958  ? -23.954 10.973  -31.506 1.00 90.77  ? 958  GLU A CB    1 
ATOM   7074  C  CG    . GLU A 1 958  ? -23.915 11.129  -33.024 1.00 90.66  ? 958  GLU A CG    1 
ATOM   7075  C  CD    . GLU A 1 958  ? -24.227 12.542  -33.496 1.00 92.85  ? 958  GLU A CD    1 
ATOM   7076  O  OE1   . GLU A 1 958  ? -23.888 13.525  -32.791 1.00 93.60  ? 958  GLU A OE1   1 
ATOM   7077  O  OE2   . GLU A 1 958  ? -24.810 12.665  -34.594 1.00 93.29  ? 958  GLU A OE2   1 
ATOM   7078  N  N     . ILE A 1 959  ? -21.525 9.215   -30.834 1.00 87.94  ? 959  ILE A N     1 
ATOM   7079  C  CA    . ILE A 1 959  ? -20.224 8.557   -30.992 1.00 87.49  ? 959  ILE A CA    1 
ATOM   7080  C  C     . ILE A 1 959  ? -19.940 7.769   -29.717 1.00 86.94  ? 959  ILE A C     1 
ATOM   7081  O  O     . ILE A 1 959  ? -20.126 8.285   -28.616 1.00 88.62  ? 959  ILE A O     1 
ATOM   7082  C  CB    . ILE A 1 959  ? -19.073 9.574   -31.235 1.00 89.13  ? 959  ILE A CB    1 
ATOM   7083  C  CG1   . ILE A 1 959  ? -19.403 10.524  -32.398 1.00 89.33  ? 959  ILE A CG1   1 
ATOM   7084  C  CG2   . ILE A 1 959  ? -17.755 8.851   -31.506 1.00 88.68  ? 959  ILE A CG2   1 
ATOM   7085  C  CD1   . ILE A 1 959  ? -19.631 9.841   -33.737 1.00 87.61  ? 959  ILE A CD1   1 
ATOM   7086  N  N     . ASP A 1 960  ? -19.492 6.526   -29.870 1.00 84.94  ? 960  ASP A N     1 
ATOM   7087  C  CA    . ASP A 1 960  ? -19.250 5.634   -28.734 1.00 85.28  ? 960  ASP A CA    1 
ATOM   7088  C  C     . ASP A 1 960  ? -18.489 4.371   -29.193 1.00 83.75  ? 960  ASP A C     1 
ATOM   7089  O  O     . ASP A 1 960  ? -18.235 4.193   -30.385 1.00 83.03  ? 960  ASP A O     1 
ATOM   7090  C  CB    . ASP A 1 960  ? -20.590 5.249   -28.062 1.00 85.43  ? 960  ASP A CB    1 
ATOM   7091  C  CG    . ASP A 1 960  ? -20.518 5.257   -26.531 1.00 87.92  ? 960  ASP A CG    1 
ATOM   7092  O  OD1   . ASP A 1 960  ? -19.469 4.853   -25.973 1.00 88.70  ? 960  ASP A OD1   1 
ATOM   7093  O  OD2   . ASP A 1 960  ? -21.525 5.647   -25.888 1.00 88.56  ? 960  ASP A OD2   1 
ATOM   7094  N  N     . GLN A 1 961  ? -18.152 3.501   -28.243 1.00 82.92  ? 961  GLN A N     1 
ATOM   7095  C  CA    . GLN A 1 961  ? -17.344 2.317   -28.497 1.00 81.57  ? 961  GLN A CA    1 
ATOM   7096  C  C     . GLN A 1 961  ? -18.037 1.062   -27.971 1.00 80.36  ? 961  GLN A C     1 
ATOM   7097  O  O     . GLN A 1 961  ? -18.618 1.089   -26.878 1.00 81.11  ? 961  GLN A O     1 
ATOM   7098  C  CB    . GLN A 1 961  ? -16.007 2.492   -27.794 1.00 83.40  ? 961  GLN A CB    1 
ATOM   7099  C  CG    . GLN A 1 961  ? -14.980 1.424   -28.113 1.00 83.51  ? 961  GLN A CG    1 
ATOM   7100  C  CD    . GLN A 1 961  ? -13.641 1.681   -27.446 1.00 85.61  ? 961  GLN A CD    1 
ATOM   7101  O  OE1   . GLN A 1 961  ? -13.568 2.120   -26.302 1.00 86.95  ? 961  GLN A OE1   1 
ATOM   7102  N  NE2   . GLN A 1 961  ? -12.571 1.398   -28.165 1.00 86.33  ? 961  GLN A NE2   1 
ATOM   7103  N  N     . THR A 1 962  ? -17.942 -0.034  -28.731 1.00 77.80  ? 962  THR A N     1 
ATOM   7104  C  CA    . THR A 1 962  ? -18.509 -1.331  -28.330 1.00 77.10  ? 962  THR A CA    1 
ATOM   7105  C  C     . THR A 1 962  ? -17.627 -2.024  -27.291 1.00 78.28  ? 962  THR A C     1 
ATOM   7106  O  O     . THR A 1 962  ? -16.467 -1.648  -27.138 1.00 79.05  ? 962  THR A O     1 
ATOM   7107  C  CB    . THR A 1 962  ? -18.634 -2.288  -29.531 1.00 75.64  ? 962  THR A CB    1 
ATOM   7108  O  OG1   . THR A 1 962  ? -17.338 -2.517  -30.090 1.00 76.81  ? 962  THR A OG1   1 
ATOM   7109  C  CG2   . THR A 1 962  ? -19.558 -1.722  -30.602 1.00 74.79  ? 962  THR A CG2   1 
ATOM   7110  N  N     . PRO A 1 963  ? -18.153 -3.067  -26.599 1.00 79.19  ? 963  PRO A N     1 
ATOM   7111  C  CA    . PRO A 1 963  ? -17.325 -3.865  -25.668 1.00 80.83  ? 963  PRO A CA    1 
ATOM   7112  C  C     . PRO A 1 963  ? -16.082 -4.528  -26.289 1.00 80.93  ? 963  PRO A C     1 
ATOM   7113  O  O     . PRO A 1 963  ? -15.110 -4.785  -25.581 1.00 82.90  ? 963  PRO A O     1 
ATOM   7114  C  CB    . PRO A 1 963  ? -18.297 -4.946  -25.176 1.00 80.20  ? 963  PRO A CB    1 
ATOM   7115  C  CG    . PRO A 1 963  ? -19.642 -4.329  -25.311 1.00 79.05  ? 963  PRO A CG    1 
ATOM   7116  C  CD    . PRO A 1 963  ? -19.558 -3.524  -26.574 1.00 78.22  ? 963  PRO A CD    1 
ATOM   7117  N  N     . TYR A 1 964  ? -16.124 -4.765  -27.600 1.00 79.47  ? 964  TYR A N     1 
ATOM   7118  C  CA    . TYR A 1 964  ? -15.002 -5.321  -28.380 1.00 78.62  ? 964  TYR A CA    1 
ATOM   7119  C  C     . TYR A 1 964  ? -14.220 -4.211  -29.120 1.00 79.72  ? 964  TYR A C     1 
ATOM   7120  O  O     . TYR A 1 964  ? -13.560 -4.469  -30.127 1.00 78.73  ? 964  TYR A O     1 
ATOM   7121  C  CB    . TYR A 1 964  ? -15.510 -6.412  -29.356 1.00 75.80  ? 964  TYR A CB    1 
ATOM   7122  C  CG    . TYR A 1 964  ? -16.728 -5.993  -30.142 1.00 73.52  ? 964  TYR A CG    1 
ATOM   7123  C  CD1   . TYR A 1 964  ? -18.007 -6.176  -29.622 1.00 73.09  ? 964  TYR A CD1   1 
ATOM   7124  C  CD2   . TYR A 1 964  ? -16.609 -5.376  -31.380 1.00 72.33  ? 964  TYR A CD2   1 
ATOM   7125  C  CE1   . TYR A 1 964  ? -19.128 -5.767  -30.316 1.00 71.46  ? 964  TYR A CE1   1 
ATOM   7126  C  CE2   . TYR A 1 964  ? -17.733 -4.969  -32.083 1.00 71.10  ? 964  TYR A CE2   1 
ATOM   7127  C  CZ    . TYR A 1 964  ? -18.986 -5.166  -31.541 1.00 70.66  ? 964  TYR A CZ    1 
ATOM   7128  O  OH    . TYR A 1 964  ? -20.106 -4.768  -32.215 1.00 69.98  ? 964  TYR A OH    1 
ATOM   7129  N  N     . LYS A 1 965  ? -14.310 -2.979  -28.612 1.00 82.07  ? 965  LYS A N     1 
ATOM   7130  C  CA    . LYS A 1 965  ? -13.508 -1.839  -29.068 1.00 84.81  ? 965  LYS A CA    1 
ATOM   7131  C  C     . LYS A 1 965  ? -13.677 -1.444  -30.544 1.00 83.93  ? 965  LYS A C     1 
ATOM   7132  O  O     . LYS A 1 965  ? -12.755 -0.906  -31.157 1.00 85.02  ? 965  LYS A O     1 
ATOM   7133  C  CB    . LYS A 1 965  ? -12.021 -2.042  -28.717 1.00 87.36  ? 965  LYS A CB    1 
ATOM   7134  C  CG    . LYS A 1 965  ? -11.708 -1.982  -27.228 1.00 90.73  ? 965  LYS A CG    1 
ATOM   7135  C  CD    . LYS A 1 965  ? -12.037 -3.282  -26.509 1.00 91.77  ? 965  LYS A CD    1 
ATOM   7136  C  CE    . LYS A 1 965  ? -11.527 -3.278  -25.076 1.00 94.57  ? 965  LYS A CE    1 
ATOM   7137  N  NZ    . LYS A 1 965  ? -11.965 -4.523  -24.381 1.00 94.91  ? 965  LYS A NZ    1 
ATOM   7138  N  N     . GLN A 1 966  ? -14.856 -1.689  -31.107 1.00 82.92  ? 966  GLN A N     1 
ATOM   7139  C  CA    . GLN A 1 966  ? -15.195 -1.138  -32.415 1.00 82.95  ? 966  GLN A CA    1 
ATOM   7140  C  C     . GLN A 1 966  ? -15.920 0.193   -32.201 1.00 85.43  ? 966  GLN A C     1 
ATOM   7141  O  O     . GLN A 1 966  ? -16.836 0.279   -31.377 1.00 86.22  ? 966  GLN A O     1 
ATOM   7142  C  CB    . GLN A 1 966  ? -16.053 -2.111  -33.222 1.00 80.69  ? 966  GLN A CB    1 
ATOM   7143  C  CG    . GLN A 1 966  ? -16.542 -1.538  -34.546 1.00 80.01  ? 966  GLN A CG    1 
ATOM   7144  C  CD    . GLN A 1 966  ? -16.920 -2.589  -35.571 1.00 78.31  ? 966  GLN A CD    1 
ATOM   7145  O  OE1   . GLN A 1 966  ? -17.329 -3.693  -35.228 1.00 77.77  ? 966  GLN A OE1   1 
ATOM   7146  N  NE2   . GLN A 1 966  ? -16.805 -2.236  -36.843 1.00 78.01  ? 966  GLN A NE2   1 
ATOM   7147  N  N     . GLU A 1 967  ? -15.490 1.229   -32.926 1.00 87.61  ? 967  GLU A N     1 
ATOM   7148  C  CA    . GLU A 1 967  ? -16.162 2.531   -32.911 1.00 89.20  ? 967  GLU A CA    1 
ATOM   7149  C  C     . GLU A 1 967  ? -17.496 2.412   -33.617 1.00 86.67  ? 967  GLU A C     1 
ATOM   7150  O  O     . GLU A 1 967  ? -17.624 1.642   -34.562 1.00 86.21  ? 967  GLU A O     1 
ATOM   7151  C  CB    . GLU A 1 967  ? -15.332 3.593   -33.638 1.00 92.03  ? 967  GLU A CB    1 
ATOM   7152  C  CG    . GLU A 1 967  ? -14.028 3.950   -32.957 1.00 96.09  ? 967  GLU A CG    1 
ATOM   7153  C  CD    . GLU A 1 967  ? -14.247 4.696   -31.656 1.00 100.94 ? 967  GLU A CD    1 
ATOM   7154  O  OE1   . GLU A 1 967  ? -14.646 5.888   -31.701 1.00 103.84 ? 967  GLU A OE1   1 
ATOM   7155  O  OE2   . GLU A 1 967  ? -14.019 4.086   -30.587 1.00 104.20 ? 967  GLU A OE2   1 
ATOM   7156  N  N     . ILE A 1 968  ? -18.484 3.176   -33.159 1.00 86.35  ? 968  ILE A N     1 
ATOM   7157  C  CA    . ILE A 1 968  ? -19.789 3.240   -33.817 1.00 83.98  ? 968  ILE A CA    1 
ATOM   7158  C  C     . ILE A 1 968  ? -20.323 4.660   -33.821 1.00 84.05  ? 968  ILE A C     1 
ATOM   7159  O  O     . ILE A 1 968  ? -20.101 5.419   -32.883 1.00 84.59  ? 968  ILE A O     1 
ATOM   7160  C  CB    . ILE A 1 968  ? -20.835 2.307   -33.160 1.00 83.29  ? 968  ILE A CB    1 
ATOM   7161  C  CG1   . ILE A 1 968  ? -20.896 2.508   -31.637 1.00 84.79  ? 968  ILE A CG1   1 
ATOM   7162  C  CG2   . ILE A 1 968  ? -20.528 0.852   -33.486 1.00 82.22  ? 968  ILE A CG2   1 
ATOM   7163  C  CD1   . ILE A 1 968  ? -22.049 1.781   -30.984 1.00 84.72  ? 968  ILE A CD1   1 
ATOM   7164  N  N     . ASN A 1 969  ? -21.004 5.005   -34.905 1.00 83.42  ? 969  ASN A N     1 
ATOM   7165  C  CA    . ASN A 1 969  ? -21.832 6.187   -34.963 1.00 84.70  ? 969  ASN A CA    1 
ATOM   7166  C  C     . ASN A 1 969  ? -23.271 5.723   -34.734 1.00 84.37  ? 969  ASN A C     1 
ATOM   7167  O  O     . ASN A 1 969  ? -23.894 5.140   -35.628 1.00 83.50  ? 969  ASN A O     1 
ATOM   7168  C  CB    . ASN A 1 969  ? -21.669 6.886   -36.316 1.00 84.52  ? 969  ASN A CB    1 
ATOM   7169  C  CG    . ASN A 1 969  ? -22.420 8.203   -36.405 1.00 85.43  ? 969  ASN A CG    1 
ATOM   7170  O  OD1   . ASN A 1 969  ? -22.834 8.603   -37.488 1.00 85.30  ? 969  ASN A OD1   1 
ATOM   7171  N  ND2   . ASN A 1 969  ? -22.578 8.896   -35.283 1.00 87.54  ? 969  ASN A ND2   1 
ATOM   7172  N  N     . ALA A 1 970  ? -23.777 5.954   -33.524 1.00 85.14  ? 970  ALA A N     1 
ATOM   7173  C  CA    . ALA A 1 970  ? -25.135 5.562   -33.149 1.00 84.33  ? 970  ALA A CA    1 
ATOM   7174  C  C     . ALA A 1 970  ? -26.134 6.721   -33.241 1.00 84.50  ? 970  ALA A C     1 
ATOM   7175  O  O     . ALA A 1 970  ? -27.051 6.799   -32.428 1.00 84.33  ? 970  ALA A O     1 
ATOM   7176  C  CB    . ALA A 1 970  ? -25.130 4.971   -31.744 1.00 85.04  ? 970  ALA A CB    1 
ATOM   7177  N  N     . LYS A 1 971  ? -25.974 7.597   -34.237 1.00 84.69  ? 971  LYS A N     1 
ATOM   7178  C  CA    . LYS A 1 971  ? -26.906 8.709   -34.460 1.00 85.72  ? 971  LYS A CA    1 
ATOM   7179  C  C     . LYS A 1 971  ? -28.290 8.165   -34.802 1.00 82.65  ? 971  LYS A C     1 
ATOM   7180  O  O     . LYS A 1 971  ? -29.297 8.576   -34.215 1.00 82.31  ? 971  LYS A O     1 
ATOM   7181  C  CB    . LYS A 1 971  ? -26.417 9.619   -35.595 1.00 87.53  ? 971  LYS A CB    1 
ATOM   7182  C  CG    . LYS A 1 971  ? -27.255 10.884  -35.800 1.00 90.36  ? 971  LYS A CG    1 
ATOM   7183  C  CD    . LYS A 1 971  ? -26.708 11.772  -36.917 1.00 92.78  ? 971  LYS A CD    1 
ATOM   7184  C  CE    . LYS A 1 971  ? -26.978 11.224  -38.320 1.00 92.73  ? 971  LYS A CE    1 
ATOM   7185  N  NZ    . LYS A 1 971  ? -28.341 11.537  -38.836 1.00 93.02  ? 971  LYS A NZ    1 
ATOM   7186  N  N     . ASN A 1 972  ? -28.316 7.231   -35.747 1.00 78.90  ? 972  ASN A N     1 
ATOM   7187  C  CA    . ASN A 1 972  ? -29.560 6.629   -36.217 1.00 77.21  ? 972  ASN A CA    1 
ATOM   7188  C  C     . ASN A 1 972  ? -30.257 5.746   -35.182 1.00 76.93  ? 972  ASN A C     1 
ATOM   7189  O  O     . ASN A 1 972  ? -31.465 5.500   -35.295 1.00 75.92  ? 972  ASN A O     1 
ATOM   7190  C  CB    . ASN A 1 972  ? -29.313 5.830   -37.494 1.00 75.25  ? 972  ASN A CB    1 
ATOM   7191  C  CG    . ASN A 1 972  ? -28.863 6.700   -38.642 1.00 74.80  ? 972  ASN A CG    1 
ATOM   7192  O  OD1   . ASN A 1 972  ? -28.750 7.917   -38.515 1.00 76.00  ? 972  ASN A OD1   1 
ATOM   7193  N  ND2   . ASN A 1 972  ? -28.606 6.078   -39.772 1.00 73.76  ? 972  ASN A ND2   1 
ATOM   7194  N  N     . LEU A 1 973  ? -29.504 5.267   -34.193 1.00 76.76  ? 973  LEU A N     1 
ATOM   7195  C  CA    . LEU A 1 973  ? -30.097 4.628   -33.025 1.00 76.39  ? 973  LEU A CA    1 
ATOM   7196  C  C     . LEU A 1 973  ? -30.951 5.637   -32.251 1.00 78.37  ? 973  LEU A C     1 
ATOM   7197  O  O     . LEU A 1 973  ? -32.085 5.320   -31.879 1.00 77.83  ? 973  LEU A O     1 
ATOM   7198  C  CB    . LEU A 1 973  ? -29.015 4.039   -32.118 1.00 76.53  ? 973  LEU A CB    1 
ATOM   7199  C  CG    . LEU A 1 973  ? -29.475 3.220   -30.904 1.00 76.50  ? 973  LEU A CG    1 
ATOM   7200  C  CD1   . LEU A 1 973  ? -30.265 1.984   -31.331 1.00 75.00  ? 973  LEU A CD1   1 
ATOM   7201  C  CD2   . LEU A 1 973  ? -28.297 2.835   -30.012 1.00 77.11  ? 973  LEU A CD2   1 
ATOM   7202  N  N     . ILE A 1 974  ? -30.417 6.845   -32.037 1.00 80.33  ? 974  ILE A N     1 
ATOM   7203  C  CA    . ILE A 1 974  ? -31.156 7.904   -31.329 1.00 82.39  ? 974  ILE A CA    1 
ATOM   7204  C  C     . ILE A 1 974  ? -32.424 8.261   -32.122 1.00 82.72  ? 974  ILE A C     1 
ATOM   7205  O  O     . ILE A 1 974  ? -33.522 8.258   -31.570 1.00 81.60  ? 974  ILE A O     1 
ATOM   7206  C  CB    . ILE A 1 974  ? -30.344 9.218   -31.093 1.00 84.36  ? 974  ILE A CB    1 
ATOM   7207  C  CG1   . ILE A 1 974  ? -28.905 8.981   -30.587 1.00 84.82  ? 974  ILE A CG1   1 
ATOM   7208  C  CG2   . ILE A 1 974  ? -31.084 10.124  -30.110 1.00 85.78  ? 974  ILE A CG2   1 
ATOM   7209  C  CD1   . ILE A 1 974  ? -28.776 8.065   -29.393 1.00 84.93  ? 974  ILE A CD1   1 
ATOM   7210  N  N     . GLN A 1 975  ? -32.261 8.542   -33.416 1.00 83.81  ? 975  GLN A N     1 
ATOM   7211  C  CA    . GLN A 1 975  ? -33.381 8.926   -34.292 1.00 85.01  ? 975  GLN A CA    1 
ATOM   7212  C  C     . GLN A 1 975  ? -34.481 7.869   -34.329 1.00 83.40  ? 975  GLN A C     1 
ATOM   7213  O  O     . GLN A 1 975  ? -35.667 8.202   -34.242 1.00 84.07  ? 975  GLN A O     1 
ATOM   7214  C  CB    . GLN A 1 975  ? -32.912 9.144   -35.726 1.00 86.64  ? 975  GLN A CB    1 
ATOM   7215  C  CG    . GLN A 1 975  ? -31.970 10.305  -35.958 1.00 90.94  ? 975  GLN A CG    1 
ATOM   7216  C  CD    . GLN A 1 975  ? -31.616 10.427  -37.429 1.00 93.93  ? 975  GLN A CD    1 
ATOM   7217  O  OE1   . GLN A 1 975  ? -30.493 10.126  -37.849 1.00 94.84  ? 975  GLN A OE1   1 
ATOM   7218  N  NE2   . GLN A 1 975  ? -32.592 10.835  -38.229 1.00 95.98  ? 975  GLN A NE2   1 
ATOM   7219  N  N     . CYS A 1 976  ? -34.080 6.606   -34.488 1.00 81.21  ? 976  CYS A N     1 
ATOM   7220  C  CA    . CYS A 1 976  ? -35.023 5.481   -34.470 1.00 79.64  ? 976  CYS A CA    1 
ATOM   7221  C  C     . CYS A 1 976  ? -35.857 5.460   -33.192 1.00 79.25  ? 976  CYS A C     1 
ATOM   7222  O  O     . CYS A 1 976  ? -37.048 5.181   -33.245 1.00 79.05  ? 976  CYS A O     1 
ATOM   7223  C  CB    . CYS A 1 976  ? -34.306 4.136   -34.643 1.00 79.06  ? 976  CYS A CB    1 
ATOM   7224  S  SG    . CYS A 1 976  ? -33.997 3.675   -36.363 1.00 79.01  ? 976  CYS A SG    1 
ATOM   7225  N  N     . TRP A 1 977  ? -35.224 5.762   -32.060 1.00 79.17  ? 977  TRP A N     1 
ATOM   7226  C  CA    . TRP A 1 977  ? -35.915 5.854   -30.778 1.00 78.77  ? 977  TRP A CA    1 
ATOM   7227  C  C     . TRP A 1 977  ? -36.781 7.106   -30.694 1.00 81.02  ? 977  TRP A C     1 
ATOM   7228  O  O     . TRP A 1 977  ? -37.906 7.017   -30.212 1.00 81.77  ? 977  TRP A O     1 
ATOM   7229  C  CB    . TRP A 1 977  ? -34.914 5.819   -29.622 1.00 78.56  ? 977  TRP A CB    1 
ATOM   7230  C  CG    . TRP A 1 977  ? -35.533 5.770   -28.253 1.00 78.47  ? 977  TRP A CG    1 
ATOM   7231  C  CD1   . TRP A 1 977  ? -35.820 6.833   -27.448 1.00 79.08  ? 977  TRP A CD1   1 
ATOM   7232  C  CD2   . TRP A 1 977  ? -35.924 4.600   -27.524 1.00 77.43  ? 977  TRP A CD2   1 
ATOM   7233  N  NE1   . TRP A 1 977  ? -36.367 6.402   -26.267 1.00 79.12  ? 977  TRP A NE1   1 
ATOM   7234  C  CE2   . TRP A 1 977  ? -36.447 5.036   -26.284 1.00 78.25  ? 977  TRP A CE2   1 
ATOM   7235  C  CE3   . TRP A 1 977  ? -35.893 3.228   -27.799 1.00 75.50  ? 977  TRP A CE3   1 
ATOM   7236  C  CZ2   . TRP A 1 977  ? -36.931 4.146   -25.313 1.00 78.21  ? 977  TRP A CZ2   1 
ATOM   7237  C  CZ3   . TRP A 1 977  ? -36.378 2.339   -26.833 1.00 75.58  ? 977  TRP A CZ3   1 
ATOM   7238  C  CH2   . TRP A 1 977  ? -36.887 2.806   -25.604 1.00 76.64  ? 977  TRP A CH2   1 
ATOM   7239  N  N     . ARG A 1 978  ? -36.272 8.256   -31.151 1.00 83.13  ? 978  ARG A N     1 
ATOM   7240  C  CA    . ARG A 1 978  ? -37.058 9.503   -31.154 1.00 85.53  ? 978  ARG A CA    1 
ATOM   7241  C  C     . ARG A 1 978  ? -38.327 9.335   -31.980 1.00 84.87  ? 978  ARG A C     1 
ATOM   7242  O  O     . ARG A 1 978  ? -39.437 9.551   -31.489 1.00 85.27  ? 978  ARG A O     1 
ATOM   7243  C  CB    . ARG A 1 978  ? -36.281 10.696  -31.734 1.00 87.54  ? 978  ARG A CB    1 
ATOM   7244  C  CG    . ARG A 1 978  ? -35.036 11.154  -30.995 1.00 89.84  ? 978  ARG A CG    1 
ATOM   7245  C  CD    . ARG A 1 978  ? -35.247 11.379  -29.515 1.00 92.47  ? 978  ARG A CD    1 
ATOM   7246  N  NE    . ARG A 1 978  ? -34.026 11.886  -28.890 1.00 95.92  ? 978  ARG A NE    1 
ATOM   7247  C  CZ    . ARG A 1 978  ? -33.873 12.106  -27.583 1.00 99.47  ? 978  ARG A CZ    1 
ATOM   7248  N  NH1   . ARG A 1 978  ? -34.868 11.872  -26.722 1.00 100.55 ? 978  ARG A NH1   1 
ATOM   7249  N  NH2   . ARG A 1 978  ? -32.713 12.571  -27.130 1.00 101.33 ? 978  ARG A NH2   1 
ATOM   7250  N  N     . GLU A 1 979  ? -38.148 8.938   -33.236 1.00 84.01  ? 979  GLU A N     1 
ATOM   7251  C  CA    . GLU A 1 979  ? -39.261 8.813   -34.170 1.00 83.72  ? 979  GLU A CA    1 
ATOM   7252  C  C     . GLU A 1 979  ? -40.292 7.784   -33.705 1.00 81.93  ? 979  GLU A C     1 
ATOM   7253  O  O     . GLU A 1 979  ? -41.488 8.012   -33.855 1.00 81.95  ? 979  GLU A O     1 
ATOM   7254  C  CB    . GLU A 1 979  ? -38.754 8.462   -35.567 1.00 83.44  ? 979  GLU A CB    1 
ATOM   7255  C  CG    . GLU A 1 979  ? -39.832 8.521   -36.635 1.00 84.25  ? 979  GLU A CG    1 
ATOM   7256  C  CD    . GLU A 1 979  ? -39.261 8.512   -38.041 1.00 85.47  ? 979  GLU A CD    1 
ATOM   7257  O  OE1   . GLU A 1 979  ? -38.424 9.391   -38.343 1.00 87.78  ? 979  GLU A OE1   1 
ATOM   7258  O  OE2   . GLU A 1 979  ? -39.655 7.636   -38.851 1.00 85.12  ? 979  GLU A OE2   1 
ATOM   7259  N  N     . CYS A 1 980  ? -39.837 6.670   -33.134 1.00 80.08  ? 980  CYS A N     1 
ATOM   7260  C  CA    . CYS A 1 980  ? -40.757 5.650   -32.627 1.00 78.73  ? 980  CYS A CA    1 
ATOM   7261  C  C     . CYS A 1 980  ? -41.558 6.151   -31.430 1.00 78.67  ? 980  CYS A C     1 
ATOM   7262  O  O     . CYS A 1 980  ? -42.733 5.832   -31.323 1.00 77.82  ? 980  CYS A O     1 
ATOM   7263  C  CB    . CYS A 1 980  ? -40.036 4.343   -32.278 1.00 77.77  ? 980  CYS A CB    1 
ATOM   7264  S  SG    . CYS A 1 980  ? -41.159 2.935   -32.083 1.00 76.40  ? 980  CYS A SG    1 
ATOM   7265  N  N     . MET A 1 981  ? -40.939 6.933   -30.547 1.00 79.96  ? 981  MET A N     1 
ATOM   7266  C  CA    . MET A 1 981  ? -41.678 7.592   -29.452 1.00 82.08  ? 981  MET A CA    1 
ATOM   7267  C  C     . MET A 1 981  ? -42.738 8.571   -29.983 1.00 83.10  ? 981  MET A C     1 
ATOM   7268  O  O     . MET A 1 981  ? -43.841 8.638   -29.436 1.00 82.52  ? 981  MET A O     1 
ATOM   7269  C  CB    . MET A 1 981  ? -40.733 8.320   -28.484 1.00 83.74  ? 981  MET A CB    1 
ATOM   7270  C  CG    . MET A 1 981  ? -39.969 7.412   -27.528 1.00 84.01  ? 981  MET A CG    1 
ATOM   7271  S  SD    . MET A 1 981  ? -40.821 7.028   -25.980 1.00 86.09  ? 981  MET A SD    1 
ATOM   7272  C  CE    . MET A 1 981  ? -40.833 8.637   -25.178 1.00 87.74  ? 981  MET A CE    1 
ATOM   7273  N  N     . ALA A 1 982  ? -42.397 9.305   -31.047 1.00 84.23  ? 982  ALA A N     1 
ATOM   7274  C  CA    . ALA A 1 982  ? -43.305 10.273  -31.684 1.00 85.32  ? 982  ALA A CA    1 
ATOM   7275  C  C     . ALA A 1 982  ? -44.414 9.581   -32.475 1.00 85.32  ? 982  ALA A C     1 
ATOM   7276  O  O     . ALA A 1 982  ? -45.598 9.794   -32.211 1.00 86.41  ? 982  ALA A O     1 
ATOM   7277  C  CB    . ALA A 1 982  ? -42.527 11.219  -32.593 1.00 85.02  ? 982  ALA A CB    1 
ATOM   7278  N  N     . MET A 1 983  ? -44.021 8.756   -33.441 1.00 85.13  ? 983  MET A N     1 
ATOM   7279  C  CA    . MET A 1 983  ? -44.955 7.985   -34.264 1.00 85.50  ? 983  MET A CA    1 
ATOM   7280  C  C     . MET A 1 983  ? -45.982 7.232   -33.431 1.00 84.11  ? 983  MET A C     1 
ATOM   7281  O  O     . MET A 1 983  ? -47.178 7.299   -33.710 1.00 84.36  ? 983  MET A O     1 
ATOM   7282  C  CB    . MET A 1 983  ? -44.196 6.972   -35.119 1.00 87.34  ? 983  MET A CB    1 
ATOM   7283  C  CG    . MET A 1 983  ? -45.068 6.207   -36.100 1.00 89.32  ? 983  MET A CG    1 
ATOM   7284  S  SD    . MET A 1 983  ? -44.058 5.327   -37.299 1.00 93.47  ? 983  MET A SD    1 
ATOM   7285  C  CE    . MET A 1 983  ? -43.790 3.767   -36.453 1.00 91.75  ? 983  MET A CE    1 
ATOM   7286  N  N     . SER A 1 984  ? -45.508 6.519   -32.412 1.00 82.51  ? 984  SER A N     1 
ATOM   7287  C  CA    . SER A 1 984  ? -46.385 5.690   -31.579 1.00 81.76  ? 984  SER A CA    1 
ATOM   7288  C  C     . SER A 1 984  ? -47.284 6.480   -30.628 1.00 83.08  ? 984  SER A C     1 
ATOM   7289  O  O     . SER A 1 984  ? -48.283 5.942   -30.168 1.00 83.21  ? 984  SER A O     1 
ATOM   7290  C  CB    . SER A 1 984  ? -45.577 4.664   -30.768 1.00 80.81  ? 984  SER A CB    1 
ATOM   7291  O  OG    . SER A 1 984  ? -45.033 5.232   -29.588 1.00 81.44  ? 984  SER A OG    1 
ATOM   7292  N  N     . SER A 1 985  ? -46.930 7.734   -30.340 1.00 83.99  ? 985  SER A N     1 
ATOM   7293  C  CA    . SER A 1 985  ? -47.579 8.532   -29.303 1.00 85.81  ? 985  SER A CA    1 
ATOM   7294  C  C     . SER A 1 985  ? -47.490 7.793   -27.972 1.00 86.12  ? 985  SER A C     1 
ATOM   7295  O  O     . SER A 1 985  ? -48.496 7.542   -27.302 1.00 87.54  ? 985  SER A O     1 
ATOM   7296  C  CB    . SER A 1 985  ? -49.021 8.886   -29.678 1.00 86.58  ? 985  SER A CB    1 
ATOM   7297  O  OG    . SER A 1 985  ? -49.058 9.575   -30.916 1.00 86.79  ? 985  SER A OG    1 
ATOM   7298  N  N     . TYR A 1 986  ? -46.253 7.454   -27.616 1.00 85.56  ? 986  TYR A N     1 
ATOM   7299  C  CA    . TYR A 1 986  ? -45.949 6.619   -26.455 1.00 85.57  ? 986  TYR A CA    1 
ATOM   7300  C  C     . TYR A 1 986  ? -46.450 7.217   -25.134 1.00 86.42  ? 986  TYR A C     1 
ATOM   7301  O  O     . TYR A 1 986  ? -47.126 6.537   -24.359 1.00 85.36  ? 986  TYR A O     1 
ATOM   7302  C  CB    . TYR A 1 986  ? -44.433 6.357   -26.379 1.00 85.09  ? 986  TYR A CB    1 
ATOM   7303  C  CG    . TYR A 1 986  ? -44.043 5.435   -25.254 1.00 85.80  ? 986  TYR A CG    1 
ATOM   7304  C  CD1   . TYR A 1 986  ? -44.096 4.043   -25.410 1.00 85.36  ? 986  TYR A CD1   1 
ATOM   7305  C  CD2   . TYR A 1 986  ? -43.643 5.947   -24.025 1.00 87.29  ? 986  TYR A CD2   1 
ATOM   7306  C  CE1   . TYR A 1 986  ? -43.747 3.195   -24.366 1.00 85.57  ? 986  TYR A CE1   1 
ATOM   7307  C  CE2   . TYR A 1 986  ? -43.299 5.114   -22.980 1.00 87.73  ? 986  TYR A CE2   1 
ATOM   7308  C  CZ    . TYR A 1 986  ? -43.351 3.747   -23.153 1.00 87.34  ? 986  TYR A CZ    1 
ATOM   7309  O  OH    . TYR A 1 986  ? -43.006 2.947   -22.098 1.00 89.53  ? 986  TYR A OH    1 
ATOM   7310  N  N     . SER A 1 987  ? -46.115 8.485   -24.899 1.00 87.50  ? 987  SER A N     1 
ATOM   7311  C  CA    . SER A 1 987  ? -46.426 9.161   -23.638 1.00 88.94  ? 987  SER A CA    1 
ATOM   7312  C  C     . SER A 1 987  ? -47.923 9.231   -23.350 1.00 89.58  ? 987  SER A C     1 
ATOM   7313  O  O     . SER A 1 987  ? -48.346 8.974   -22.224 1.00 90.82  ? 987  SER A O     1 
ATOM   7314  C  CB    . SER A 1 987  ? -45.837 10.569  -23.633 1.00 89.99  ? 987  SER A CB    1 
ATOM   7315  O  OG    . SER A 1 987  ? -44.448 10.523  -23.892 1.00 89.84  ? 987  SER A OG    1 
ATOM   7316  N  N     . LEU A 1 988  ? -48.716 9.569   -24.367 1.00 89.58  ? 988  LEU A N     1 
ATOM   7317  C  CA    . LEU A 1 988  ? -50.181 9.627   -24.230 1.00 90.23  ? 988  LEU A CA    1 
ATOM   7318  C  C     . LEU A 1 988  ? -50.793 8.240   -23.993 1.00 89.26  ? 988  LEU A C     1 
ATOM   7319  O  O     . LEU A 1 988  ? -51.655 8.071   -23.125 1.00 91.19  ? 988  LEU A O     1 
ATOM   7320  C  CB    . LEU A 1 988  ? -50.827 10.278  -25.465 1.00 90.42  ? 988  LEU A CB    1 
ATOM   7321  C  CG    . LEU A 1 988  ? -50.587 11.780  -25.679 1.00 91.95  ? 988  LEU A CG    1 
ATOM   7322  C  CD1   . LEU A 1 988  ? -51.158 12.223  -27.020 1.00 91.45  ? 988  LEU A CD1   1 
ATOM   7323  C  CD2   . LEU A 1 988  ? -51.169 12.613  -24.541 1.00 93.65  ? 988  LEU A CD2   1 
ATOM   7324  N  N     . ARG A 1 989  ? -50.341 7.255   -24.760 1.00 85.91  ? 989  ARG A N     1 
ATOM   7325  C  CA    . ARG A 1 989  ? -50.795 5.882   -24.581 1.00 84.46  ? 989  ARG A CA    1 
ATOM   7326  C  C     . ARG A 1 989  ? -50.325 5.243   -23.277 1.00 83.89  ? 989  ARG A C     1 
ATOM   7327  O  O     . ARG A 1 989  ? -50.952 4.300   -22.802 1.00 83.06  ? 989  ARG A O     1 
ATOM   7328  C  CB    . ARG A 1 989  ? -50.348 5.018   -25.754 1.00 83.55  ? 989  ARG A CB    1 
ATOM   7329  C  CG    . ARG A 1 989  ? -51.026 5.393   -27.058 1.00 83.85  ? 989  ARG A CG    1 
ATOM   7330  C  CD    . ARG A 1 989  ? -50.297 4.792   -28.231 1.00 82.70  ? 989  ARG A CD    1 
ATOM   7331  N  NE    . ARG A 1 989  ? -50.430 3.342   -28.274 1.00 81.53  ? 989  ARG A NE    1 
ATOM   7332  C  CZ    . ARG A 1 989  ? -49.593 2.514   -28.900 1.00 81.46  ? 989  ARG A CZ    1 
ATOM   7333  N  NH1   . ARG A 1 989  ? -48.529 2.960   -29.564 1.00 81.62  ? 989  ARG A NH1   1 
ATOM   7334  N  NH2   . ARG A 1 989  ? -49.830 1.209   -28.868 1.00 81.22  ? 989  ARG A NH2   1 
ATOM   7335  N  N     . LYS A 1 990  ? -49.224 5.729   -22.709 1.00 84.35  ? 990  LYS A N     1 
ATOM   7336  C  CA    . LYS A 1 990  ? -48.747 5.223   -21.419 1.00 85.20  ? 990  LYS A CA    1 
ATOM   7337  C  C     . LYS A 1 990  ? -49.777 5.492   -20.309 1.00 86.23  ? 990  LYS A C     1 
ATOM   7338  O  O     . LYS A 1 990  ? -50.127 4.582   -19.553 1.00 86.12  ? 990  LYS A O     1 
ATOM   7339  C  CB    . LYS A 1 990  ? -47.370 5.816   -21.064 1.00 86.59  ? 990  LYS A CB    1 
ATOM   7340  C  CG    . LYS A 1 990  ? -46.690 5.185   -19.850 1.00 88.04  ? 990  LYS A CG    1 
ATOM   7341  C  CD    . LYS A 1 990  ? -46.225 3.756   -20.114 1.00 88.11  ? 990  LYS A CD    1 
ATOM   7342  C  CE    . LYS A 1 990  ? -46.509 2.816   -18.947 1.00 89.62  ? 990  LYS A CE    1 
ATOM   7343  N  NZ    . LYS A 1 990  ? -46.351 1.390   -19.366 1.00 88.71  ? 990  LYS A NZ    1 
ATOM   7344  N  N     . VAL A 1 991  ? -50.274 6.727   -20.232 1.00 86.82  ? 991  VAL A N     1 
ATOM   7345  C  CA    . VAL A 1 991  ? -51.303 7.077   -19.243 1.00 88.05  ? 991  VAL A CA    1 
ATOM   7346  C  C     . VAL A 1 991  ? -52.650 6.413   -19.537 1.00 86.46  ? 991  VAL A C     1 
ATOM   7347  O  O     . VAL A 1 991  ? -53.401 6.113   -18.614 1.00 86.75  ? 991  VAL A O     1 
ATOM   7348  C  CB    . VAL A 1 991  ? -51.467 8.613   -19.045 1.00 90.16  ? 991  VAL A CB    1 
ATOM   7349  C  CG1   . VAL A 1 991  ? -50.166 9.211   -18.535 1.00 90.86  ? 991  VAL A CG1   1 
ATOM   7350  C  CG2   . VAL A 1 991  ? -51.926 9.332   -20.313 1.00 89.85  ? 991  VAL A CG2   1 
ATOM   7351  N  N     . ALA A 1 992  ? -52.942 6.179   -20.815 1.00 84.62  ? 992  ALA A N     1 
ATOM   7352  C  CA    . ALA A 1 992  ? -54.129 5.421   -21.218 1.00 83.39  ? 992  ALA A CA    1 
ATOM   7353  C  C     . ALA A 1 992  ? -54.114 3.991   -20.659 1.00 83.19  ? 992  ALA A C     1 
ATOM   7354  O  O     . ALA A 1 992  ? -55.151 3.491   -20.206 1.00 83.87  ? 992  ALA A O     1 
ATOM   7355  C  CB    . ALA A 1 992  ? -54.254 5.397   -22.734 1.00 81.16  ? 992  ALA A CB    1 
ATOM   7356  N  N     . VAL A 1 993  ? -52.940 3.355   -20.679 1.00 82.25  ? 993  VAL A N     1 
ATOM   7357  C  CA    . VAL A 1 993  ? -52.763 1.997   -20.148 1.00 82.33  ? 993  VAL A CA    1 
ATOM   7358  C  C     . VAL A 1 993  ? -52.784 1.969   -18.611 1.00 84.42  ? 993  VAL A C     1 
ATOM   7359  O  O     . VAL A 1 993  ? -53.347 1.049   -18.018 1.00 84.32  ? 993  VAL A O     1 
ATOM   7360  C  CB    . VAL A 1 993  ? -51.463 1.345   -20.686 1.00 81.02  ? 993  VAL A CB    1 
ATOM   7361  C  CG1   . VAL A 1 993  ? -51.185 0.000   -20.015 1.00 80.60  ? 993  VAL A CG1   1 
ATOM   7362  C  CG2   . VAL A 1 993  ? -51.545 1.164   -22.198 1.00 79.40  ? 993  VAL A CG2   1 
ATOM   7363  N  N     . GLU A 1 994  ? -52.162 2.959   -17.975 1.00 86.76  ? 994  GLU A N     1 
ATOM   7364  C  CA    . GLU A 1 994  ? -52.217 3.101   -16.513 1.00 89.11  ? 994  GLU A CA    1 
ATOM   7365  C  C     . GLU A 1 994  ? -53.650 3.362   -16.038 1.00 90.50  ? 994  GLU A C     1 
ATOM   7366  O  O     . GLU A 1 994  ? -54.078 2.823   -15.014 1.00 90.44  ? 994  GLU A O     1 
ATOM   7367  C  CB    . GLU A 1 994  ? -51.301 4.235   -16.039 1.00 91.03  ? 994  GLU A CB    1 
ATOM   7368  C  CG    . GLU A 1 994  ? -49.810 3.978   -16.239 1.00 91.39  ? 994  GLU A CG    1 
ATOM   7369  C  CD    . GLU A 1 994  ? -48.954 5.210   -15.947 1.00 93.51  ? 994  GLU A CD    1 
ATOM   7370  O  OE1   . GLU A 1 994  ? -48.991 5.711   -14.802 1.00 94.90  ? 994  GLU A OE1   1 
ATOM   7371  O  OE2   . GLU A 1 994  ? -48.233 5.681   -16.855 1.00 93.52  ? 994  GLU A OE2   1 
ATOM   7372  N  N     . LYS A 1 995  ? -54.367 4.198   -16.795 1.00 91.56  ? 995  LYS A N     1 
ATOM   7373  C  CA    . LYS A 1 995  ? -55.782 4.528   -16.558 1.00 92.80  ? 995  LYS A CA    1 
ATOM   7374  C  C     . LYS A 1 995  ? -56.671 3.297   -16.648 1.00 92.05  ? 995  LYS A C     1 
ATOM   7375  O  O     . LYS A 1 995  ? -57.522 3.066   -15.779 1.00 91.88  ? 995  LYS A O     1 
ATOM   7376  C  CB    . LYS A 1 995  ? -56.247 5.548   -17.602 1.00 93.35  ? 995  LYS A CB    1 
ATOM   7377  C  CG    . LYS A 1 995  ? -57.684 6.027   -17.480 1.00 95.12  ? 995  LYS A CG    1 
ATOM   7378  C  CD    . LYS A 1 995  ? -58.119 6.761   -18.742 1.00 95.26  ? 995  LYS A CD    1 
ATOM   7379  C  CE    . LYS A 1 995  ? -59.177 7.811   -18.444 1.00 97.35  ? 995  LYS A CE    1 
ATOM   7380  N  NZ    . LYS A 1 995  ? -60.312 7.263   -17.646 1.00 98.43  ? 995  LYS A NZ    1 
ATOM   7381  N  N     . PHE A 1 996  ? -56.478 2.539   -17.730 1.00 90.08  ? 996  PHE A N     1 
ATOM   7382  C  CA    . PHE A 1 996  ? -57.184 1.283   -17.960 1.00 88.69  ? 996  PHE A CA    1 
ATOM   7383  C  C     . PHE A 1 996  ? -56.971 0.342   -16.777 1.00 89.35  ? 996  PHE A C     1 
ATOM   7384  O  O     . PHE A 1 996  ? -57.938 -0.111  -16.159 1.00 90.37  ? 996  PHE A O     1 
ATOM   7385  C  CB    . PHE A 1 996  ? -56.704 0.638   -19.269 1.00 86.61  ? 996  PHE A CB    1 
ATOM   7386  C  CG    . PHE A 1 996  ? -57.469 -0.599  -19.666 1.00 85.04  ? 996  PHE A CG    1 
ATOM   7387  C  CD1   . PHE A 1 996  ? -58.644 -0.498  -20.396 1.00 84.21  ? 996  PHE A CD1   1 
ATOM   7388  C  CD2   . PHE A 1 996  ? -57.001 -1.866  -19.319 1.00 84.02  ? 996  PHE A CD2   1 
ATOM   7389  C  CE1   . PHE A 1 996  ? -59.348 -1.632  -20.757 1.00 82.94  ? 996  PHE A CE1   1 
ATOM   7390  C  CE2   . PHE A 1 996  ? -57.698 -3.005  -19.681 1.00 82.52  ? 996  PHE A CE2   1 
ATOM   7391  C  CZ    . PHE A 1 996  ? -58.875 -2.885  -20.398 1.00 82.56  ? 996  PHE A CZ    1 
ATOM   7392  N  N     . ASN A 1 997  ? -55.710 0.099   -16.431 1.00 89.19  ? 997  ASN A N     1 
ATOM   7393  C  CA    . ASN A 1 997  ? -55.366 -0.868  -15.377 1.00 89.52  ? 997  ASN A CA    1 
ATOM   7394  C  C     . ASN A 1 997  ? -55.867 -0.506  -13.986 1.00 91.15  ? 997  ASN A C     1 
ATOM   7395  O  O     . ASN A 1 997  ? -56.078 -1.391  -13.164 1.00 92.97  ? 997  ASN A O     1 
ATOM   7396  C  CB    . ASN A 1 997  ? -53.854 -1.122  -15.341 1.00 88.47  ? 997  ASN A CB    1 
ATOM   7397  C  CG    . ASN A 1 997  ? -53.354 -1.851  -16.579 1.00 85.89  ? 997  ASN A CG    1 
ATOM   7398  O  OD1   . ASN A 1 997  ? -54.135 -2.401  -17.352 1.00 83.64  ? 997  ASN A OD1   1 
ATOM   7399  N  ND2   . ASN A 1 997  ? -52.045 -1.855  -16.771 1.00 85.91  ? 997  ASN A ND2   1 
ATOM   7400  N  N     . ALA A 1 998  ? -56.057 0.785   -13.734 1.00 92.33  ? 998  ALA A N     1 
ATOM   7401  C  CA    . ALA A 1 998  ? -56.701 1.258   -12.509 1.00 93.36  ? 998  ALA A CA    1 
ATOM   7402  C  C     . ALA A 1 998  ? -58.221 0.983   -12.484 1.00 93.86  ? 998  ALA A C     1 
ATOM   7403  O  O     . ALA A 1 998  ? -58.822 0.948   -11.407 1.00 96.51  ? 998  ALA A O     1 
ATOM   7404  C  CB    . ALA A 1 998  ? -56.431 2.741   -12.327 1.00 93.73  ? 998  ALA A CB    1 
ATOM   7405  N  N     . GLU A 1 999  ? -58.833 0.805   -13.658 1.00 91.82  ? 999  GLU A N     1 
ATOM   7406  C  CA    . GLU A 1 999  ? -60.279 0.590   -13.796 1.00 91.34  ? 999  GLU A CA    1 
ATOM   7407  C  C     . GLU A 1 999  ? -60.670 -0.853  -14.138 1.00 89.77  ? 999  GLU A C     1 
ATOM   7408  O  O     . GLU A 1 999  ? -61.853 -1.152  -14.259 1.00 90.23  ? 999  GLU A O     1 
ATOM   7409  C  CB    . GLU A 1 999  ? -60.819 1.499   -14.899 1.00 91.18  ? 999  GLU A CB    1 
ATOM   7410  C  CG    . GLU A 1 999  ? -60.598 2.988   -14.661 1.00 92.82  ? 999  GLU A CG    1 
ATOM   7411  C  CD    . GLU A 1 999  ? -60.802 3.835   -15.909 1.00 92.27  ? 999  GLU A CD    1 
ATOM   7412  O  OE1   . GLU A 1 999  ? -60.535 3.346   -17.029 1.00 90.86  ? 999  GLU A OE1   1 
ATOM   7413  O  OE2   . GLU A 1 999  ? -61.219 5.005   -15.766 1.00 92.90  ? 999  GLU A OE2   1 
ATOM   7414  N  N     . ASN A 1 1000 ? -59.695 -1.741  -14.308 1.00 88.05  ? 1000 ASN A N     1 
ATOM   7415  C  CA    . ASN A 1 1000 ? -59.965 -3.108  -14.729 1.00 86.25  ? 1000 ASN A CA    1 
ATOM   7416  C  C     . ASN A 1 1000 ? -59.122 -4.090  -13.942 1.00 85.59  ? 1000 ASN A C     1 
ATOM   7417  O  O     . ASN A 1 1000 ? -57.900 -4.009  -13.960 1.00 83.91  ? 1000 ASN A O     1 
ATOM   7418  C  CB    . ASN A 1 1000 ? -59.683 -3.252  -16.218 1.00 85.03  ? 1000 ASN A CB    1 
ATOM   7419  C  CG    . ASN A 1 1000 ? -60.669 -2.479  -17.074 1.00 85.73  ? 1000 ASN A CG    1 
ATOM   7420  O  OD1   . ASN A 1 1000 ? -61.814 -2.889  -17.224 1.00 86.19  ? 1000 ASN A OD1   1 
ATOM   7421  N  ND2   . ASN A 1 1000 ? -60.233 -1.358  -17.638 1.00 86.20  ? 1000 ASN A ND2   1 
ATOM   7422  N  N     . TYR A 1 1001 ? -59.792 -5.018  -13.264 1.00 86.52  ? 1001 TYR A N     1 
ATOM   7423  C  CA    . TYR A 1 1001 ? -59.149 -5.979  -12.371 1.00 87.42  ? 1001 TYR A CA    1 
ATOM   7424  C  C     . TYR A 1 1001 ? -58.771 -7.285  -13.072 1.00 85.76  ? 1001 TYR A C     1 
ATOM   7425  O  O     . TYR A 1 1001 ? -57.710 -7.845  -12.797 1.00 86.38  ? 1001 TYR A O     1 
ATOM   7426  C  CB    . TYR A 1 1001 ? -60.076 -6.265  -11.190 1.00 89.27  ? 1001 TYR A CB    1 
ATOM   7427  C  CG    . TYR A 1 1001 ? -59.406 -6.918  -10.005 1.00 90.65  ? 1001 TYR A CG    1 
ATOM   7428  C  CD1   . TYR A 1 1001 ? -59.310 -8.301  -9.914  1.00 90.63  ? 1001 TYR A CD1   1 
ATOM   7429  C  CD2   . TYR A 1 1001 ? -58.883 -6.155  -8.962  1.00 92.72  ? 1001 TYR A CD2   1 
ATOM   7430  C  CE1   . TYR A 1 1001 ? -58.706 -8.912  -8.826  1.00 91.75  ? 1001 TYR A CE1   1 
ATOM   7431  C  CE2   . TYR A 1 1001 ? -58.277 -6.756  -7.865  1.00 93.93  ? 1001 TYR A CE2   1 
ATOM   7432  C  CZ    . TYR A 1 1001 ? -58.192 -8.135  -7.807  1.00 93.39  ? 1001 TYR A CZ    1 
ATOM   7433  O  OH    . TYR A 1 1001 ? -57.603 -8.748  -6.736  1.00 94.95  ? 1001 TYR A OH    1 
ATOM   7434  N  N     . TRP A 1 1002 ? -59.634 -7.758  -13.971 1.00 84.63  ? 1002 TRP A N     1 
ATOM   7435  C  CA    . TRP A 1 1002 ? -59.436 -9.035  -14.676 1.00 83.03  ? 1002 TRP A CA    1 
ATOM   7436  C  C     . TRP A 1 1002 ? -58.873 -8.941  -16.107 1.00 82.35  ? 1002 TRP A C     1 
ATOM   7437  O  O     . TRP A 1 1002 ? -58.590 -9.981  -16.729 1.00 82.08  ? 1002 TRP A O     1 
ATOM   7438  C  CB    . TRP A 1 1002 ? -60.756 -9.789  -14.710 1.00 82.55  ? 1002 TRP A CB    1 
ATOM   7439  C  CG    . TRP A 1 1002 ? -61.328 -10.010 -13.349 1.00 84.04  ? 1002 TRP A CG    1 
ATOM   7440  C  CD1   . TRP A 1 1002 ? -62.483 -9.483  -12.849 1.00 84.87  ? 1002 TRP A CD1   1 
ATOM   7441  C  CD2   . TRP A 1 1002 ? -60.764 -10.810 -12.301 1.00 84.28  ? 1002 TRP A CD2   1 
ATOM   7442  N  NE1   . TRP A 1 1002 ? -62.679 -9.914  -11.564 1.00 86.11  ? 1002 TRP A NE1   1 
ATOM   7443  C  CE2   . TRP A 1 1002 ? -61.642 -10.730 -11.200 1.00 85.77  ? 1002 TRP A CE2   1 
ATOM   7444  C  CE3   . TRP A 1 1002 ? -59.606 -11.593 -12.189 1.00 83.65  ? 1002 TRP A CE3   1 
ATOM   7445  C  CZ2   . TRP A 1 1002 ? -61.400 -11.404 -9.993  1.00 86.89  ? 1002 TRP A CZ2   1 
ATOM   7446  C  CZ3   . TRP A 1 1002 ? -59.364 -12.266 -10.985 1.00 84.74  ? 1002 TRP A CZ3   1 
ATOM   7447  C  CH2   . TRP A 1 1002 ? -60.262 -12.165 -9.906  1.00 86.16  ? 1002 TRP A CH2   1 
ATOM   7448  N  N     . LYS A 1 1003 ? -58.738 -7.717  -16.628 1.00 82.74  ? 1003 LYS A N     1 
ATOM   7449  C  CA    . LYS A 1 1003 ? -58.119 -7.445  -17.934 1.00 81.02  ? 1003 LYS A CA    1 
ATOM   7450  C  C     . LYS A 1 1003 ? -57.131 -6.296  -17.773 1.00 81.20  ? 1003 LYS A C     1 
ATOM   7451  O  O     . LYS A 1 1003 ? -57.507 -5.232  -17.291 1.00 82.73  ? 1003 LYS A O     1 
ATOM   7452  C  CB    . LYS A 1 1003 ? -59.179 -7.020  -18.947 1.00 81.05  ? 1003 LYS A CB    1 
ATOM   7453  C  CG    . LYS A 1 1003 ? -60.149 -8.111  -19.351 1.00 81.08  ? 1003 LYS A CG    1 
ATOM   7454  C  CD    . LYS A 1 1003 ? -59.589 -8.916  -20.501 1.00 80.41  ? 1003 LYS A CD    1 
ATOM   7455  C  CE    . LYS A 1 1003 ? -60.376 -10.187 -20.736 1.00 80.66  ? 1003 LYS A CE    1 
ATOM   7456  N  NZ    . LYS A 1 1003 ? -61.732 -9.913  -21.277 1.00 81.92  ? 1003 LYS A NZ    1 
ATOM   7457  N  N     . LYS A 1 1004 ? -55.879 -6.505  -18.171 1.00 79.46  ? 1004 LYS A N     1 
ATOM   7458  C  CA    . LYS A 1 1004 ? -54.847 -5.465  -18.086 1.00 78.47  ? 1004 LYS A CA    1 
ATOM   7459  C  C     . LYS A 1 1004 ? -54.251 -5.185  -19.448 1.00 76.51  ? 1004 LYS A C     1 
ATOM   7460  O  O     . LYS A 1 1004 ? -54.184 -6.076  -20.297 1.00 75.13  ? 1004 LYS A O     1 
ATOM   7461  C  CB    . LYS A 1 1004 ? -53.720 -5.900  -17.148 1.00 78.45  ? 1004 LYS A CB    1 
ATOM   7462  C  CG    . LYS A 1 1004 ? -54.159 -6.210  -15.730 1.00 80.38  ? 1004 LYS A CG    1 
ATOM   7463  C  CD    . LYS A 1 1004 ? -54.717 -4.986  -15.027 1.00 82.31  ? 1004 LYS A CD    1 
ATOM   7464  C  CE    . LYS A 1 1004 ? -55.040 -5.276  -13.574 1.00 84.34  ? 1004 LYS A CE    1 
ATOM   7465  N  NZ    . LYS A 1 1004 ? -55.589 -4.085  -12.871 1.00 85.97  ? 1004 LYS A NZ    1 
ATOM   7466  N  N     . LYS A 1 1005 ? -53.817 -3.946  -19.650 1.00 76.42  ? 1005 LYS A N     1 
ATOM   7467  C  CA    . LYS A 1 1005 ? -53.007 -3.598  -20.805 1.00 75.25  ? 1005 LYS A CA    1 
ATOM   7468  C  C     . LYS A 1 1005 ? -51.568 -3.388  -20.388 1.00 75.15  ? 1005 LYS A C     1 
ATOM   7469  O  O     . LYS A 1 1005 ? -51.276 -3.161  -19.216 1.00 77.10  ? 1005 LYS A O     1 
ATOM   7470  C  CB    . LYS A 1 1005 ? -53.549 -2.355  -21.500 1.00 76.03  ? 1005 LYS A CB    1 
ATOM   7471  C  CG    . LYS A 1 1005 ? -54.869 -2.619  -22.183 1.00 76.43  ? 1005 LYS A CG    1 
ATOM   7472  C  CD    . LYS A 1 1005 ? -55.283 -1.509  -23.129 1.00 77.31  ? 1005 LYS A CD    1 
ATOM   7473  C  CE    . LYS A 1 1005 ? -56.746 -1.675  -23.523 1.00 77.85  ? 1005 LYS A CE    1 
ATOM   7474  N  NZ    . LYS A 1 1005 ? -57.105 -0.888  -24.731 1.00 78.04  ? 1005 LYS A NZ    1 
ATOM   7475  N  N     . GLY A 1 1006 ? -50.677 -3.488  -21.362 1.00 73.34  ? 1006 GLY A N     1 
ATOM   7476  C  CA    . GLY A 1 1006 ? -49.267 -3.193  -21.171 1.00 73.91  ? 1006 GLY A CA    1 
ATOM   7477  C  C     . GLY A 1 1006 ? -48.663 -2.603  -22.437 1.00 73.59  ? 1006 GLY A C     1 
ATOM   7478  O  O     . GLY A 1 1006 ? -49.164 -2.827  -23.540 1.00 72.83  ? 1006 GLY A O     1 
ATOM   7479  N  N     . LEU A 1 1007 ? -47.594 -1.833  -22.265 1.00 74.01  ? 1007 LEU A N     1 
ATOM   7480  C  CA    . LEU A 1 1007 ? -46.913 -1.166  -23.360 1.00 72.94  ? 1007 LEU A CA    1 
ATOM   7481  C  C     . LEU A 1 1007 ? -45.423 -1.242  -23.099 1.00 72.89  ? 1007 LEU A C     1 
ATOM   7482  O  O     . LEU A 1 1007 ? -44.982 -1.157  -21.954 1.00 74.07  ? 1007 LEU A O     1 
ATOM   7483  C  CB    . LEU A 1 1007 ? -47.357 0.290   -23.441 1.00 74.67  ? 1007 LEU A CB    1 
ATOM   7484  C  CG    . LEU A 1 1007 ? -46.921 1.103   -24.661 1.00 74.88  ? 1007 LEU A CG    1 
ATOM   7485  C  CD1   . LEU A 1 1007 ? -47.755 0.732   -25.867 1.00 74.46  ? 1007 LEU A CD1   1 
ATOM   7486  C  CD2   . LEU A 1 1007 ? -47.060 2.589   -24.400 1.00 77.02  ? 1007 LEU A CD2   1 
ATOM   7487  N  N     . ALA A 1 1008 ? -44.649 -1.414  -24.163 1.00 72.17  ? 1008 ALA A N     1 
ATOM   7488  C  CA    . ALA A 1 1008 ? -43.198 -1.504  -24.052 1.00 72.26  ? 1008 ALA A CA    1 
ATOM   7489  C  C     . ALA A 1 1008 ? -42.541 -0.943  -25.292 1.00 72.05  ? 1008 ALA A C     1 
ATOM   7490  O  O     . ALA A 1 1008 ? -43.158 -0.884  -26.350 1.00 71.36  ? 1008 ALA A O     1 
ATOM   7491  C  CB    . ALA A 1 1008 ? -42.771 -2.945  -23.839 1.00 71.07  ? 1008 ALA A CB    1 
ATOM   7492  N  N     . MET A 1 1009 ? -41.291 -0.515  -25.149 1.00 73.51  ? 1009 MET A N     1 
ATOM   7493  C  CA    . MET A 1 1009 ? -40.484 -0.107  -26.291 1.00 73.90  ? 1009 MET A CA    1 
ATOM   7494  C  C     . MET A 1 1009 ? -39.039 -0.583  -26.123 1.00 73.13  ? 1009 MET A C     1 
ATOM   7495  O  O     . MET A 1 1009 ? -38.413 -0.367  -25.078 1.00 73.57  ? 1009 MET A O     1 
ATOM   7496  C  CB    . MET A 1 1009 ? -40.541 1.408   -26.503 1.00 76.19  ? 1009 MET A CB    1 
ATOM   7497  C  CG    . MET A 1 1009 ? -40.111 1.827   -27.904 1.00 76.27  ? 1009 MET A CG    1 
ATOM   7498  S  SD    . MET A 1 1009 ? -39.992 3.611   -28.095 1.00 79.92  ? 1009 MET A SD    1 
ATOM   7499  C  CE    . MET A 1 1009 ? -41.722 4.051   -28.198 1.00 80.52  ? 1009 MET A CE    1 
ATOM   7500  N  N     . VAL A 1 1010 ? -38.533 -1.232  -27.168 1.00 71.74  ? 1010 VAL A N     1 
ATOM   7501  C  CA    . VAL A 1 1010 ? -37.180 -1.780  -27.188 1.00 71.62  ? 1010 VAL A CA    1 
ATOM   7502  C  C     . VAL A 1 1010 ? -36.459 -1.200  -28.408 1.00 71.09  ? 1010 VAL A C     1 
ATOM   7503  O  O     . VAL A 1 1010 ? -37.092 -1.001  -29.448 1.00 70.34  ? 1010 VAL A O     1 
ATOM   7504  C  CB    . VAL A 1 1010 ? -37.182 -3.331  -27.218 1.00 70.46  ? 1010 VAL A CB    1 
ATOM   7505  C  CG1   . VAL A 1 1010 ? -38.052 -3.891  -26.103 1.00 71.05  ? 1010 VAL A CG1   1 
ATOM   7506  C  CG2   . VAL A 1 1010 ? -37.674 -3.880  -28.549 1.00 69.91  ? 1010 VAL A CG2   1 
ATOM   7507  N  N     . PRO A 1 1011 ? -35.150 -0.898  -28.279 1.00 72.00  ? 1011 PRO A N     1 
ATOM   7508  C  CA    . PRO A 1 1011 ? -34.313 -0.475  -29.402 1.00 71.92  ? 1011 PRO A CA    1 
ATOM   7509  C  C     . PRO A 1 1011 ? -33.527 -1.638  -30.031 1.00 70.60  ? 1011 PRO A C     1 
ATOM   7510  O  O     . PRO A 1 1011 ? -33.401 -2.697  -29.426 1.00 69.04  ? 1011 PRO A O     1 
ATOM   7511  C  CB    . PRO A 1 1011 ? -33.346 0.496   -28.737 1.00 73.15  ? 1011 PRO A CB    1 
ATOM   7512  C  CG    . PRO A 1 1011 ? -33.111 -0.133  -27.402 1.00 73.75  ? 1011 PRO A CG    1 
ATOM   7513  C  CD    . PRO A 1 1011 ? -34.396 -0.815  -27.016 1.00 73.24  ? 1011 PRO A CD    1 
ATOM   7514  N  N     . LEU A 1 1012 ? -32.979 -1.401  -31.219 1.00 70.74  ? 1012 LEU A N     1 
ATOM   7515  C  CA    . LEU A 1 1012 ? -32.247 -2.405  -31.979 1.00 70.40  ? 1012 LEU A CA    1 
ATOM   7516  C  C     . LEU A 1 1012 ? -30.930 -1.848  -32.489 1.00 71.67  ? 1012 LEU A C     1 
ATOM   7517  O  O     . LEU A 1 1012 ? -30.920 -0.845  -33.197 1.00 72.66  ? 1012 LEU A O     1 
ATOM   7518  C  CB    . LEU A 1 1012 ? -33.083 -2.827  -33.181 1.00 69.45  ? 1012 LEU A CB    1 
ATOM   7519  C  CG    . LEU A 1 1012 ? -32.445 -3.793  -34.184 1.00 68.30  ? 1012 LEU A CG    1 
ATOM   7520  C  CD1   . LEU A 1 1012 ? -32.365 -5.183  -33.576 1.00 67.76  ? 1012 LEU A CD1   1 
ATOM   7521  C  CD2   . LEU A 1 1012 ? -33.228 -3.798  -35.489 1.00 67.31  ? 1012 LEU A CD2   1 
ATOM   7522  N  N     . LYS A 1 1013 ? -29.828 -2.494  -32.111 1.00 72.54  ? 1013 LYS A N     1 
ATOM   7523  C  CA    . LYS A 1 1013 ? -28.590 -2.447  -32.885 1.00 73.01  ? 1013 LYS A CA    1 
ATOM   7524  C  C     . LYS A 1 1013 ? -28.317 -3.881  -33.320 1.00 71.66  ? 1013 LYS A C     1 
ATOM   7525  O  O     . LYS A 1 1013 ? -28.031 -4.743  -32.477 1.00 71.89  ? 1013 LYS A O     1 
ATOM   7526  C  CB    . LYS A 1 1013 ? -27.405 -1.918  -32.073 1.00 75.43  ? 1013 LYS A CB    1 
ATOM   7527  C  CG    . LYS A 1 1013 ? -26.093 -1.953  -32.860 1.00 76.37  ? 1013 LYS A CG    1 
ATOM   7528  C  CD    . LYS A 1 1013 ? -24.968 -1.083  -32.286 1.00 78.16  ? 1013 LYS A CD    1 
ATOM   7529  C  CE    . LYS A 1 1013 ? -24.250 -1.656  -31.069 1.00 78.94  ? 1013 LYS A CE    1 
ATOM   7530  N  NZ    . LYS A 1 1013 ? -24.196 -3.138  -30.937 1.00 77.74  ? 1013 LYS A NZ    1 
ATOM   7531  N  N     . PHE A 1 1014 ? -28.439 -4.136  -34.622 1.00 69.49  ? 1014 PHE A N     1 
ATOM   7532  C  CA    . PHE A 1 1014 ? -28.118 -5.437  -35.190 1.00 67.80  ? 1014 PHE A CA    1 
ATOM   7533  C  C     . PHE A 1 1014 ? -26.875 -5.304  -36.072 1.00 66.45  ? 1014 PHE A C     1 
ATOM   7534  O  O     . PHE A 1 1014 ? -26.970 -4.792  -37.188 1.00 64.72  ? 1014 PHE A O     1 
ATOM   7535  C  CB    . PHE A 1 1014 ? -29.289 -6.001  -35.992 1.00 67.31  ? 1014 PHE A CB    1 
ATOM   7536  C  CG    . PHE A 1 1014 ? -29.027 -7.373  -36.509 1.00 66.93  ? 1014 PHE A CG    1 
ATOM   7537  C  CD1   . PHE A 1 1014 ? -29.150 -8.464  -35.671 1.00 67.76  ? 1014 PHE A CD1   1 
ATOM   7538  C  CD2   . PHE A 1 1014 ? -28.594 -7.571  -37.809 1.00 66.86  ? 1014 PHE A CD2   1 
ATOM   7539  C  CE1   . PHE A 1 1014 ? -28.876 -9.740  -36.126 1.00 67.35  ? 1014 PHE A CE1   1 
ATOM   7540  C  CE2   . PHE A 1 1014 ? -28.318 -8.843  -38.278 1.00 66.10  ? 1014 PHE A CE2   1 
ATOM   7541  C  CZ    . PHE A 1 1014 ? -28.455 -9.930  -37.433 1.00 66.66  ? 1014 PHE A CZ    1 
ATOM   7542  N  N     . PRO A 1 1015 ? -25.702 -5.748  -35.568 1.00 66.62  ? 1015 PRO A N     1 
ATOM   7543  C  CA    . PRO A 1 1015 ? -24.485 -5.683  -36.372 1.00 65.72  ? 1015 PRO A CA    1 
ATOM   7544  C  C     . PRO A 1 1015 ? -24.467 -6.767  -37.423 1.00 63.73  ? 1015 PRO A C     1 
ATOM   7545  O  O     . PRO A 1 1015 ? -25.039 -7.839  -37.213 1.00 62.44  ? 1015 PRO A O     1 
ATOM   7546  C  CB    . PRO A 1 1015 ? -23.362 -5.925  -35.369 1.00 67.27  ? 1015 PRO A CB    1 
ATOM   7547  C  CG    . PRO A 1 1015 ? -23.982 -6.438  -34.138 1.00 68.06  ? 1015 PRO A CG    1 
ATOM   7548  C  CD    . PRO A 1 1015 ? -25.468 -6.393  -34.263 1.00 67.57  ? 1015 PRO A CD    1 
ATOM   7549  N  N     . VAL A 1 1016 ? -23.793 -6.477  -38.533 1.00 62.70  ? 1016 VAL A N     1 
ATOM   7550  C  CA    . VAL A 1 1016 ? -23.758 -7.349  -39.697 1.00 60.53  ? 1016 VAL A CA    1 
ATOM   7551  C  C     . VAL A 1 1016 ? -22.311 -7.535  -40.155 1.00 61.44  ? 1016 VAL A C     1 
ATOM   7552  O  O     . VAL A 1 1016 ? -21.534 -6.588  -40.238 1.00 61.10  ? 1016 VAL A O     1 
ATOM   7553  C  CB    . VAL A 1 1016 ? -24.617 -6.770  -40.839 1.00 59.28  ? 1016 VAL A CB    1 
ATOM   7554  C  CG1   . VAL A 1 1016 ? -24.506 -7.617  -42.098 1.00 57.38  ? 1016 VAL A CG1   1 
ATOM   7555  C  CG2   . VAL A 1 1016 ? -26.069 -6.650  -40.393 1.00 58.95  ? 1016 VAL A CG2   1 
ATOM   7556  N  N     . GLY A 1 1017 ? -21.973 -8.776  -40.468 1.00 62.58  ? 1017 GLY A N     1 
ATOM   7557  C  CA    . GLY A 1 1017 ? -20.611 -9.152  -40.805 1.00 64.56  ? 1017 GLY A CA    1 
ATOM   7558  C  C     . GLY A 1 1017 ? -20.343 -10.588 -40.408 1.00 65.71  ? 1017 GLY A C     1 
ATOM   7559  O  O     . GLY A 1 1017 ? -20.991 -11.133 -39.506 1.00 67.68  ? 1017 GLY A O     1 
ATOM   7560  N  N     . LEU A 1 1018 ? -19.374 -11.187 -41.088 1.00 66.04  ? 1018 LEU A N     1 
ATOM   7561  C  CA    . LEU A 1 1018 ? -19.017 -12.579 -40.913 1.00 66.06  ? 1018 LEU A CA    1 
ATOM   7562  C  C     . LEU A 1 1018 ? -17.647 -12.615 -40.235 1.00 69.17  ? 1018 LEU A C     1 
ATOM   7563  O  O     . LEU A 1 1018 ? -17.066 -11.565 -39.948 1.00 72.19  ? 1018 LEU A O     1 
ATOM   7564  C  CB    . LEU A 1 1018 ? -19.003 -13.246 -42.289 1.00 65.37  ? 1018 LEU A CB    1 
ATOM   7565  C  CG    . LEU A 1 1018 ? -20.221 -12.922 -43.188 1.00 63.62  ? 1018 LEU A CG    1 
ATOM   7566  C  CD1   . LEU A 1 1018 ? -19.908 -13.090 -44.667 1.00 63.14  ? 1018 LEU A CD1   1 
ATOM   7567  C  CD2   . LEU A 1 1018 ? -21.434 -13.760 -42.800 1.00 62.65  ? 1018 LEU A CD2   1 
ATOM   7568  N  N     . GLY A 1 1019 ? -17.128 -13.805 -39.961 1.00 70.01  ? 1019 GLY A N     1 
ATOM   7569  C  CA    . GLY A 1 1019 ? -15.848 -13.930 -39.253 1.00 72.87  ? 1019 GLY A CA    1 
ATOM   7570  C  C     . GLY A 1 1019 ? -14.631 -13.397 -40.004 1.00 74.44  ? 1019 GLY A C     1 
ATOM   7571  O  O     . GLY A 1 1019 ? -13.727 -12.786 -39.413 1.00 75.21  ? 1019 GLY A O     1 
ATOM   7572  N  N     . SER A 1 1020 ? -14.621 -13.624 -41.315 1.00 73.85  ? 1020 SER A N     1 
ATOM   7573  C  CA    . SER A 1 1020 ? -13.456 -13.354 -42.146 1.00 73.28  ? 1020 SER A CA    1 
ATOM   7574  C  C     . SER A 1 1020 ? -13.838 -12.660 -43.452 1.00 71.15  ? 1020 SER A C     1 
ATOM   7575  O  O     . SER A 1 1020 ? -15.006 -12.631 -43.854 1.00 68.10  ? 1020 SER A O     1 
ATOM   7576  C  CB    . SER A 1 1020 ? -12.742 -14.679 -42.444 1.00 72.61  ? 1020 SER A CB    1 
ATOM   7577  O  OG    . SER A 1 1020 ? -13.679 -15.681 -42.824 1.00 70.16  ? 1020 SER A OG    1 
ATOM   7578  N  N     . ARG A 1 1021 ? -12.823 -12.108 -44.105 1.00 70.71  ? 1021 ARG A N     1 
ATOM   7579  C  CA    . ARG A 1 1021 ? -12.966 -11.570 -45.447 1.00 70.05  ? 1021 ARG A CA    1 
ATOM   7580  C  C     . ARG A 1 1021 ? -13.378 -12.667 -46.439 1.00 67.17  ? 1021 ARG A C     1 
ATOM   7581  O  O     . ARG A 1 1021 ? -14.237 -12.449 -47.289 1.00 65.86  ? 1021 ARG A O     1 
ATOM   7582  C  CB    . ARG A 1 1021 ? -11.656 -10.923 -45.893 1.00 72.07  ? 1021 ARG A CB    1 
ATOM   7583  C  CG    . ARG A 1 1021 ? -11.795 -10.030 -47.103 1.00 74.01  ? 1021 ARG A CG    1 
ATOM   7584  C  CD    . ARG A 1 1021 ? -10.441 -9.636  -47.652 1.00 77.60  ? 1021 ARG A CD    1 
ATOM   7585  N  NE    . ARG A 1 1021 ? -10.578 -8.601  -48.676 1.00 81.32  ? 1021 ARG A NE    1 
ATOM   7586  C  CZ    . ARG A 1 1021 ? -9.599  -8.175  -49.478 1.00 84.21  ? 1021 ARG A CZ    1 
ATOM   7587  N  NH1   . ARG A 1 1021 ? -8.370  -8.689  -49.391 1.00 84.60  ? 1021 ARG A NH1   1 
ATOM   7588  N  NH2   . ARG A 1 1021 ? -9.852  -7.223  -50.382 1.00 84.48  ? 1021 ARG A NH2   1 
ATOM   7589  N  N     . ALA A 1 1022 ? -12.762 -13.839 -46.317 1.00 65.86  ? 1022 ALA A N     1 
ATOM   7590  C  CA    . ALA A 1 1022 ? -13.032 -14.968 -47.207 1.00 63.52  ? 1022 ALA A CA    1 
ATOM   7591  C  C     . ALA A 1 1022 ? -14.478 -15.473 -47.131 1.00 61.38  ? 1022 ALA A C     1 
ATOM   7592  O  O     . ALA A 1 1022 ? -15.028 -15.909 -48.144 1.00 59.29  ? 1022 ALA A O     1 
ATOM   7593  C  CB    . ALA A 1 1022 ? -12.062 -16.104 -46.924 1.00 63.91  ? 1022 ALA A CB    1 
ATOM   7594  N  N     . ALA A 1 1023 ? -15.085 -15.406 -45.945 1.00 60.32  ? 1023 ALA A N     1 
ATOM   7595  C  CA    . ALA A 1 1023 ? -16.493 -15.789 -45.773 1.00 59.01  ? 1023 ALA A CA    1 
ATOM   7596  C  C     . ALA A 1 1023 ? -17.463 -14.869 -46.511 1.00 58.21  ? 1023 ALA A C     1 
ATOM   7597  O  O     . ALA A 1 1023 ? -18.572 -15.289 -46.845 1.00 57.39  ? 1023 ALA A O     1 
ATOM   7598  C  CB    . ALA A 1 1023 ? -16.862 -15.852 -44.299 1.00 59.52  ? 1023 ALA A CB    1 
ATOM   7599  N  N     . GLY A 1 1024 ? -17.049 -13.626 -46.751 1.00 58.55  ? 1024 GLY A N     1 
ATOM   7600  C  CA    . GLY A 1 1024 ? -17.857 -12.652 -47.468 1.00 59.00  ? 1024 GLY A CA    1 
ATOM   7601  C  C     . GLY A 1 1024 ? -17.616 -12.544 -48.964 1.00 58.89  ? 1024 GLY A C     1 
ATOM   7602  O  O     . GLY A 1 1024 ? -18.229 -11.688 -49.611 1.00 59.62  ? 1024 GLY A O     1 
ATOM   7603  N  N     . GLN A 1 1025 ? -16.741 -13.385 -49.525 1.00 58.37  ? 1025 GLN A N     1 
ATOM   7604  C  CA    . GLN A 1 1025 ? -16.478 -13.363 -50.973 1.00 57.51  ? 1025 GLN A CA    1 
ATOM   7605  C  C     . GLN A 1 1025 ? -17.673 -13.902 -51.764 1.00 55.90  ? 1025 GLN A C     1 
ATOM   7606  O  O     . GLN A 1 1025 ? -18.445 -14.724 -51.273 1.00 56.00  ? 1025 GLN A O     1 
ATOM   7607  C  CB    . GLN A 1 1025 ? -15.176 -14.105 -51.340 1.00 58.28  ? 1025 GLN A CB    1 
ATOM   7608  C  CG    . GLN A 1 1025 ? -15.267 -15.622 -51.497 1.00 57.66  ? 1025 GLN A CG    1 
ATOM   7609  C  CD    . GLN A 1 1025 ? -13.895 -16.268 -51.600 1.00 58.15  ? 1025 GLN A CD    1 
ATOM   7610  O  OE1   . GLN A 1 1025 ? -13.468 -16.687 -52.672 1.00 57.88  ? 1025 GLN A OE1   1 
ATOM   7611  N  NE2   . GLN A 1 1025 ? -13.192 -16.329 -50.486 1.00 59.37  ? 1025 GLN A NE2   1 
ATOM   7612  N  N     . ALA A 1 1026 ? -17.817 -13.429 -52.990 1.00 54.57  ? 1026 ALA A N     1 
ATOM   7613  C  CA    . ALA A 1 1026 ? -18.983 -13.747 -53.786 1.00 52.93  ? 1026 ALA A CA    1 
ATOM   7614  C  C     . ALA A 1 1026 ? -18.652 -13.578 -55.247 1.00 53.21  ? 1026 ALA A C     1 
ATOM   7615  O  O     . ALA A 1 1026 ? -17.809 -12.747 -55.606 1.00 52.72  ? 1026 ALA A O     1 
ATOM   7616  C  CB    . ALA A 1 1026 ? -20.143 -12.845 -53.397 1.00 52.31  ? 1026 ALA A CB    1 
ATOM   7617  N  N     . ALA A 1 1027 ? -19.341 -14.362 -56.075 1.00 53.54  ? 1027 ALA A N     1 
ATOM   7618  C  CA    . ALA A 1 1027 ? -19.075 -14.434 -57.503 1.00 54.57  ? 1027 ALA A CA    1 
ATOM   7619  C  C     . ALA A 1 1027 ? -20.354 -14.528 -58.337 1.00 54.97  ? 1027 ALA A C     1 
ATOM   7620  O  O     . ALA A 1 1027 ? -21.401 -14.990 -57.866 1.00 55.18  ? 1027 ALA A O     1 
ATOM   7621  C  CB    . ALA A 1 1027 ? -18.170 -15.615 -57.799 1.00 54.57  ? 1027 ALA A CB    1 
ATOM   7622  N  N     . ALA A 1 1028 ? -20.236 -14.080 -59.586 1.00 55.85  ? 1028 ALA A N     1 
ATOM   7623  C  CA    . ALA A 1 1028 ? -21.323 -14.089 -60.553 1.00 55.26  ? 1028 ALA A CA    1 
ATOM   7624  C  C     . ALA A 1 1028 ? -20.791 -14.381 -61.958 1.00 55.44  ? 1028 ALA A C     1 
ATOM   7625  O  O     . ALA A 1 1028 ? -19.587 -14.347 -62.199 1.00 56.96  ? 1028 ALA A O     1 
ATOM   7626  C  CB    . ALA A 1 1028 ? -22.047 -12.749 -60.523 1.00 56.03  ? 1028 ALA A CB    1 
ATOM   7627  N  N     . LEU A 1 1029 ? -21.698 -14.690 -62.874 1.00 55.17  ? 1029 LEU A N     1 
ATOM   7628  C  CA    . LEU A 1 1029 ? -21.356 -14.934 -64.267 1.00 54.91  ? 1029 LEU A CA    1 
ATOM   7629  C  C     . LEU A 1 1029 ? -22.413 -14.253 -65.125 1.00 55.34  ? 1029 LEU A C     1 
ATOM   7630  O  O     . LEU A 1 1029 ? -23.600 -14.521 -64.943 1.00 55.48  ? 1029 LEU A O     1 
ATOM   7631  C  CB    . LEU A 1 1029 ? -21.348 -16.436 -64.535 1.00 53.74  ? 1029 LEU A CB    1 
ATOM   7632  C  CG    . LEU A 1 1029 ? -20.914 -16.918 -65.922 1.00 54.21  ? 1029 LEU A CG    1 
ATOM   7633  C  CD1   . LEU A 1 1029 ? -19.449 -16.613 -66.176 1.00 54.58  ? 1029 LEU A CD1   1 
ATOM   7634  C  CD2   . LEU A 1 1029 ? -21.177 -18.408 -66.080 1.00 53.91  ? 1029 LEU A CD2   1 
ATOM   7635  N  N     . VAL A 1 1030 ? -21.985 -13.374 -66.037 1.00 55.47  ? 1030 VAL A N     1 
ATOM   7636  C  CA    . VAL A 1 1030 ? -22.903 -12.631 -66.907 1.00 55.44  ? 1030 VAL A CA    1 
ATOM   7637  C  C     . VAL A 1 1030 ? -22.571 -12.861 -68.396 1.00 55.89  ? 1030 VAL A C     1 
ATOM   7638  O  O     . VAL A 1 1030 ? -21.440 -12.612 -68.836 1.00 56.43  ? 1030 VAL A O     1 
ATOM   7639  C  CB    . VAL A 1 1030 ? -22.883 -11.119 -66.585 1.00 56.47  ? 1030 VAL A CB    1 
ATOM   7640  C  CG1   . VAL A 1 1030 ? -23.881 -10.364 -67.459 1.00 56.74  ? 1030 VAL A CG1   1 
ATOM   7641  C  CG2   . VAL A 1 1030 ? -23.176 -10.878 -65.104 1.00 56.21  ? 1030 VAL A CG2   1 
ATOM   7642  N  N     . HIS A 1 1031 ? -23.571 -13.347 -69.147 1.00 54.70  ? 1031 HIS A N     1 
ATOM   7643  C  CA    . HIS A 1 1031 ? -23.526 -13.443 -70.613 1.00 53.66  ? 1031 HIS A CA    1 
ATOM   7644  C  C     . HIS A 1 1031 ? -24.424 -12.405 -71.262 1.00 53.33  ? 1031 HIS A C     1 
ATOM   7645  O  O     . HIS A 1 1031 ? -25.509 -12.128 -70.761 1.00 52.49  ? 1031 HIS A O     1 
ATOM   7646  C  CB    . HIS A 1 1031 ? -24.029 -14.800 -71.097 1.00 52.63  ? 1031 HIS A CB    1 
ATOM   7647  C  CG    . HIS A 1 1031 ? -23.371 -15.962 -70.436 1.00 51.71  ? 1031 HIS A CG    1 
ATOM   7648  N  ND1   . HIS A 1 1031 ? -22.027 -15.990 -70.144 1.00 51.32  ? 1031 HIS A ND1   1 
ATOM   7649  C  CD2   . HIS A 1 1031 ? -23.874 -17.145 -70.016 1.00 50.81  ? 1031 HIS A CD2   1 
ATOM   7650  C  CE1   . HIS A 1 1031 ? -21.730 -17.139 -69.567 1.00 51.07  ? 1031 HIS A CE1   1 
ATOM   7651  N  NE2   . HIS A 1 1031 ? -22.832 -17.858 -69.479 1.00 50.43  ? 1031 HIS A NE2   1 
ATOM   7652  N  N     . ILE A 1 1032 ? -23.974 -11.858 -72.388 1.00 53.57  ? 1032 ILE A N     1 
ATOM   7653  C  CA    . ILE A 1 1032 ? -24.828 -11.082 -73.281 1.00 53.57  ? 1032 ILE A CA    1 
ATOM   7654  C  C     . ILE A 1 1032 ? -24.899 -11.853 -74.591 1.00 52.98  ? 1032 ILE A C     1 
ATOM   7655  O  O     . ILE A 1 1032 ? -23.881 -12.057 -75.253 1.00 52.92  ? 1032 ILE A O     1 
ATOM   7656  C  CB    . ILE A 1 1032 ? -24.287 -9.659  -73.548 1.00 54.37  ? 1032 ILE A CB    1 
ATOM   7657  C  CG1   . ILE A 1 1032 ? -24.143 -8.881  -72.236 1.00 54.46  ? 1032 ILE A CG1   1 
ATOM   7658  C  CG2   . ILE A 1 1032 ? -25.200 -8.921  -74.520 1.00 55.49  ? 1032 ILE A CG2   1 
ATOM   7659  C  CD1   . ILE A 1 1032 ? -23.459 -7.541  -72.374 1.00 55.17  ? 1032 ILE A CD1   1 
ATOM   7660  N  N     . TYR A 1 1033 ? -26.100 -12.294 -74.948 1.00 51.76  ? 1033 TYR A N     1 
ATOM   7661  C  CA    . TYR A 1 1033 ? -26.326 -12.941 -76.233 1.00 51.88  ? 1033 TYR A CA    1 
ATOM   7662  C  C     . TYR A 1 1033 ? -26.455 -11.898 -77.350 1.00 52.53  ? 1033 TYR A C     1 
ATOM   7663  O  O     . TYR A 1 1033 ? -26.648 -10.712 -77.074 1.00 53.13  ? 1033 TYR A O     1 
ATOM   7664  C  CB    . TYR A 1 1033 ? -27.534 -13.873 -76.152 1.00 51.02  ? 1033 TYR A CB    1 
ATOM   7665  C  CG    . TYR A 1 1033 ? -27.306 -15.006 -75.174 1.00 50.74  ? 1033 TYR A CG    1 
ATOM   7666  C  CD1   . TYR A 1 1033 ? -26.582 -16.137 -75.540 1.00 50.79  ? 1033 TYR A CD1   1 
ATOM   7667  C  CD2   . TYR A 1 1033 ? -27.786 -14.935 -73.872 1.00 50.83  ? 1033 TYR A CD2   1 
ATOM   7668  C  CE1   . TYR A 1 1033 ? -26.366 -17.171 -74.642 1.00 50.63  ? 1033 TYR A CE1   1 
ATOM   7669  C  CE2   . TYR A 1 1033 ? -27.573 -15.962 -72.965 1.00 50.17  ? 1033 TYR A CE2   1 
ATOM   7670  C  CZ    . TYR A 1 1033 ? -26.862 -17.080 -73.345 1.00 50.09  ? 1033 TYR A CZ    1 
ATOM   7671  O  OH    . TYR A 1 1033 ? -26.654 -18.104 -72.427 1.00 49.47  ? 1033 TYR A OH    1 
ATOM   7672  N  N     . LEU A 1 1034 ? -26.333 -12.349 -78.598 1.00 52.90  ? 1034 LEU A N     1 
ATOM   7673  C  CA    . LEU A 1 1034 ? -26.268 -11.456 -79.772 1.00 54.24  ? 1034 LEU A CA    1 
ATOM   7674  C  C     . LEU A 1 1034 ? -27.580 -10.725 -80.107 1.00 55.33  ? 1034 LEU A C     1 
ATOM   7675  O  O     . LEU A 1 1034 ? -27.564 -9.749  -80.865 1.00 58.27  ? 1034 LEU A O     1 
ATOM   7676  C  CB    . LEU A 1 1034 ? -25.734 -12.205 -81.004 1.00 54.37  ? 1034 LEU A CB    1 
ATOM   7677  C  CG    . LEU A 1 1034 ? -24.207 -12.216 -81.234 1.00 55.40  ? 1034 LEU A CG    1 
ATOM   7678  C  CD1   . LEU A 1 1034 ? -23.380 -12.269 -79.947 1.00 54.47  ? 1034 LEU A CD1   1 
ATOM   7679  C  CD2   . LEU A 1 1034 ? -23.818 -13.367 -82.159 1.00 55.12  ? 1034 LEU A CD2   1 
ATOM   7680  N  N     . ASP A 1 1035 ? -28.701 -11.191 -79.558 1.00 54.07  ? 1035 ASP A N     1 
ATOM   7681  C  CA    . ASP A 1 1035 ? -29.944 -10.411 -79.568 1.00 54.39  ? 1035 ASP A CA    1 
ATOM   7682  C  C     . ASP A 1 1035 ? -30.008 -9.314  -78.464 1.00 54.43  ? 1035 ASP A C     1 
ATOM   7683  O  O     . ASP A 1 1035 ? -31.025 -8.624  -78.340 1.00 54.41  ? 1035 ASP A O     1 
ATOM   7684  C  CB    . ASP A 1 1035 ? -31.167 -11.342 -79.491 1.00 53.76  ? 1035 ASP A CB    1 
ATOM   7685  C  CG    . ASP A 1 1035 ? -31.381 -11.962 -78.109 1.00 52.66  ? 1035 ASP A CG    1 
ATOM   7686  O  OD1   . ASP A 1 1035 ? -30.476 -11.936 -77.248 1.00 51.28  ? 1035 ASP A OD1   1 
ATOM   7687  O  OD2   . ASP A 1 1035 ? -32.485 -12.502 -77.889 1.00 54.17  ? 1035 ASP A OD2   1 
ATOM   7688  N  N     . GLY A 1 1036 ? -28.947 -9.182  -77.660 1.00 53.15  ? 1036 GLY A N     1 
ATOM   7689  C  CA    . GLY A 1 1036 ? -28.867 -8.163  -76.634 1.00 53.04  ? 1036 GLY A CA    1 
ATOM   7690  C  C     . GLY A 1 1036 ? -29.392 -8.577  -75.278 1.00 52.94  ? 1036 GLY A C     1 
ATOM   7691  O  O     . GLY A 1 1036 ? -29.148 -7.858  -74.305 1.00 53.59  ? 1036 GLY A O     1 
ATOM   7692  N  N     . SER A 1 1037 ? -30.106 -9.712  -75.193 1.00 52.01  ? 1037 SER A N     1 
ATOM   7693  C  CA    . SER A 1 1037 ? -30.630 -10.217 -73.911 1.00 51.14  ? 1037 SER A CA    1 
ATOM   7694  C  C     . SER A 1 1037 ? -29.507 -10.765 -73.039 1.00 51.18  ? 1037 SER A C     1 
ATOM   7695  O  O     . SER A 1 1037 ? -28.467 -11.213 -73.538 1.00 50.40  ? 1037 SER A O     1 
ATOM   7696  C  CB    . SER A 1 1037 ? -31.704 -11.306 -74.109 1.00 50.75  ? 1037 SER A CB    1 
ATOM   7697  O  OG    . SER A 1 1037 ? -31.169 -12.502 -74.666 1.00 50.73  ? 1037 SER A OG    1 
ATOM   7698  N  N     . VAL A 1 1038 ? -29.751 -10.750 -71.734 1.00 50.60  ? 1038 VAL A N     1 
ATOM   7699  C  CA    . VAL A 1 1038 ? -28.736 -11.055 -70.751 1.00 50.24  ? 1038 VAL A CA    1 
ATOM   7700  C  C     . VAL A 1 1038 ? -29.151 -12.203 -69.843 1.00 49.38  ? 1038 VAL A C     1 
ATOM   7701  O  O     . VAL A 1 1038 ? -30.291 -12.254 -69.362 1.00 48.23  ? 1038 VAL A O     1 
ATOM   7702  C  CB    . VAL A 1 1038 ? -28.448 -9.806  -69.907 1.00 50.73  ? 1038 VAL A CB    1 
ATOM   7703  C  CG1   . VAL A 1 1038 ? -27.473 -10.112 -68.765 1.00 50.66  ? 1038 VAL A CG1   1 
ATOM   7704  C  CG2   . VAL A 1 1038 ? -27.926 -8.702  -70.815 1.00 51.88  ? 1038 VAL A CG2   1 
ATOM   7705  N  N     . LEU A 1 1039 ? -28.209 -13.116 -69.610 1.00 48.91  ? 1039 LEU A N     1 
ATOM   7706  C  CA    . LEU A 1 1039 ? -28.365 -14.140 -68.599 1.00 47.96  ? 1039 LEU A CA    1 
ATOM   7707  C  C     . LEU A 1 1039 ? -27.338 -13.924 -67.504 1.00 47.80  ? 1039 LEU A C     1 
ATOM   7708  O  O     . LEU A 1 1039 ? -26.142 -13.825 -67.780 1.00 47.79  ? 1039 LEU A O     1 
ATOM   7709  C  CB    . LEU A 1 1039 ? -28.215 -15.527 -69.190 1.00 47.32  ? 1039 LEU A CB    1 
ATOM   7710  C  CG    . LEU A 1 1039 ? -28.702 -16.618 -68.240 1.00 47.09  ? 1039 LEU A CG    1 
ATOM   7711  C  CD1   . LEU A 1 1039 ? -30.225 -16.732 -68.299 1.00 47.15  ? 1039 LEU A CD1   1 
ATOM   7712  C  CD2   . LEU A 1 1039 ? -28.041 -17.947 -68.576 1.00 46.90  ? 1039 LEU A CD2   1 
ATOM   7713  N  N     . VAL A 1 1040 ? -27.826 -13.863 -66.266 1.00 47.18  ? 1040 VAL A N     1 
ATOM   7714  C  CA    . VAL A 1 1040 ? -26.983 -13.687 -65.096 1.00 48.01  ? 1040 VAL A CA    1 
ATOM   7715  C  C     . VAL A 1 1040 ? -27.216 -14.825 -64.107 1.00 48.03  ? 1040 VAL A C     1 
ATOM   7716  O  O     . VAL A 1 1040 ? -28.322 -15.346 -63.997 1.00 48.77  ? 1040 VAL A O     1 
ATOM   7717  C  CB    . VAL A 1 1040 ? -27.219 -12.320 -64.422 1.00 48.95  ? 1040 VAL A CB    1 
ATOM   7718  C  CG1   . VAL A 1 1040 ? -28.698 -12.074 -64.119 1.00 49.92  ? 1040 VAL A CG1   1 
ATOM   7719  C  CG2   . VAL A 1 1040 ? -26.380 -12.187 -63.160 1.00 49.12  ? 1040 VAL A CG2   1 
ATOM   7720  N  N     . THR A 1 1041 ? -26.150 -15.228 -63.426 1.00 48.38  ? 1041 THR A N     1 
ATOM   7721  C  CA    . THR A 1 1041 ? -26.246 -16.114 -62.284 1.00 48.57  ? 1041 THR A CA    1 
ATOM   7722  C  C     . THR A 1 1041 ? -25.168 -15.752 -61.278 1.00 47.82  ? 1041 THR A C     1 
ATOM   7723  O  O     . THR A 1 1041 ? -24.209 -15.063 -61.613 1.00 47.27  ? 1041 THR A O     1 
ATOM   7724  C  CB    . THR A 1 1041 ? -26.147 -17.608 -62.695 1.00 50.15  ? 1041 THR A CB    1 
ATOM   7725  O  OG1   . THR A 1 1041 ? -26.496 -18.437 -61.574 1.00 53.06  ? 1041 THR A OG1   1 
ATOM   7726  C  CG2   . THR A 1 1041 ? -24.755 -17.987 -63.199 1.00 49.46  ? 1041 THR A CG2   1 
ATOM   7727  N  N     . HIS A 1 1042 ? -25.352 -16.224 -60.049 1.00 47.72  ? 1042 HIS A N     1 
ATOM   7728  C  CA    . HIS A 1 1042 ? -24.457 -15.933 -58.927 1.00 48.85  ? 1042 HIS A CA    1 
ATOM   7729  C  C     . HIS A 1 1042 ? -24.664 -16.994 -57.860 1.00 48.20  ? 1042 HIS A C     1 
ATOM   7730  O  O     . HIS A 1 1042 ? -25.587 -17.806 -57.959 1.00 47.43  ? 1042 HIS A O     1 
ATOM   7731  C  CB    . HIS A 1 1042 ? -24.759 -14.553 -58.348 1.00 50.46  ? 1042 HIS A CB    1 
ATOM   7732  C  CG    . HIS A 1 1042 ? -26.201 -14.370 -58.015 1.00 51.24  ? 1042 HIS A CG    1 
ATOM   7733  N  ND1   . HIS A 1 1042 ? -26.721 -14.630 -56.768 1.00 51.19  ? 1042 HIS A ND1   1 
ATOM   7734  C  CD2   . HIS A 1 1042 ? -27.250 -14.040 -58.799 1.00 51.92  ? 1042 HIS A CD2   1 
ATOM   7735  C  CE1   . HIS A 1 1042 ? -28.023 -14.429 -56.786 1.00 52.27  ? 1042 HIS A CE1   1 
ATOM   7736  N  NE2   . HIS A 1 1042 ? -28.370 -14.079 -58.012 1.00 52.70  ? 1042 HIS A NE2   1 
ATOM   7737  N  N     . GLY A 1 1043 ? -23.815 -16.961 -56.837 1.00 48.76  ? 1043 GLY A N     1 
ATOM   7738  C  CA    . GLY A 1 1043 ? -23.804 -17.978 -55.787 1.00 48.59  ? 1043 GLY A CA    1 
ATOM   7739  C  C     . GLY A 1 1043 ? -24.904 -17.939 -54.747 1.00 47.64  ? 1043 GLY A C     1 
ATOM   7740  O  O     . GLY A 1 1043 ? -25.081 -18.884 -54.004 1.00 48.64  ? 1043 GLY A O     1 
ATOM   7741  N  N     . GLY A 1 1044 ? -25.588 -16.818 -54.642 1.00 48.32  ? 1044 GLY A N     1 
ATOM   7742  C  CA    . GLY A 1 1044 ? -26.757 -16.684 -53.780 1.00 49.16  ? 1044 GLY A CA    1 
ATOM   7743  C  C     . GLY A 1 1044 ? -27.979 -17.524 -54.138 1.00 48.80  ? 1044 GLY A C     1 
ATOM   7744  O  O     . GLY A 1 1044 ? -28.264 -17.760 -55.318 1.00 47.67  ? 1044 GLY A O     1 
ATOM   7745  N  N     . ILE A 1 1045 ? -28.699 -17.939 -53.092 1.00 49.72  ? 1045 ILE A N     1 
ATOM   7746  C  CA    . ILE A 1 1045 ? -29.918 -18.743 -53.180 1.00 49.66  ? 1045 ILE A CA    1 
ATOM   7747  C  C     . ILE A 1 1045 ? -31.150 -17.902 -52.844 1.00 49.38  ? 1045 ILE A C     1 
ATOM   7748  O  O     . ILE A 1 1045 ? -31.176 -17.225 -51.825 1.00 49.14  ? 1045 ILE A O     1 
ATOM   7749  C  CB    . ILE A 1 1045 ? -29.881 -19.908 -52.165 1.00 50.25  ? 1045 ILE A CB    1 
ATOM   7750  C  CG1   . ILE A 1 1045 ? -28.652 -20.796 -52.377 1.00 50.42  ? 1045 ILE A CG1   1 
ATOM   7751  C  CG2   . ILE A 1 1045 ? -31.153 -20.749 -52.254 1.00 50.71  ? 1045 ILE A CG2   1 
ATOM   7752  C  CD1   . ILE A 1 1045 ? -28.690 -21.636 -53.640 1.00 50.23  ? 1045 ILE A CD1   1 
ATOM   7753  N  N     . GLU A 1 1046 ? -32.167 -17.981 -53.696 1.00 49.81  ? 1046 GLU A N     1 
ATOM   7754  C  CA    . GLU A 1 1046 ? -33.479 -17.384 -53.442 1.00 50.28  ? 1046 GLU A CA    1 
ATOM   7755  C  C     . GLU A 1 1046 ? -34.293 -18.285 -52.510 1.00 50.96  ? 1046 GLU A C     1 
ATOM   7756  O  O     . GLU A 1 1046 ? -34.753 -19.352 -52.923 1.00 49.94  ? 1046 GLU A O     1 
ATOM   7757  C  CB    . GLU A 1 1046 ? -34.229 -17.180 -54.771 1.00 50.45  ? 1046 GLU A CB    1 
ATOM   7758  C  CG    . GLU A 1 1046 ? -35.656 -16.638 -54.681 1.00 51.29  ? 1046 GLU A CG    1 
ATOM   7759  C  CD    . GLU A 1 1046 ? -35.752 -15.211 -54.145 1.00 52.26  ? 1046 GLU A CD    1 
ATOM   7760  O  OE1   . GLU A 1 1046 ? -35.319 -14.246 -54.821 1.00 52.46  ? 1046 GLU A OE1   1 
ATOM   7761  O  OE2   . GLU A 1 1046 ? -36.310 -15.044 -53.044 1.00 52.63  ? 1046 GLU A OE2   1 
ATOM   7762  N  N     . MET A 1 1047 ? -34.470 -17.838 -51.264 1.00 52.91  ? 1047 MET A N     1 
ATOM   7763  C  CA    . MET A 1 1047 ? -35.330 -18.501 -50.279 1.00 54.12  ? 1047 MET A CA    1 
ATOM   7764  C  C     . MET A 1 1047 ? -36.634 -17.738 -50.021 1.00 52.47  ? 1047 MET A C     1 
ATOM   7765  O  O     . MET A 1 1047 ? -37.342 -18.047 -49.061 1.00 52.14  ? 1047 MET A O     1 
ATOM   7766  C  CB    . MET A 1 1047 ? -34.615 -18.620 -48.936 1.00 58.82  ? 1047 MET A CB    1 
ATOM   7767  C  CG    . MET A 1 1047 ? -33.146 -19.009 -48.982 1.00 63.03  ? 1047 MET A CG    1 
ATOM   7768  S  SD    . MET A 1 1047 ? -32.359 -18.707 -47.392 1.00 67.89  ? 1047 MET A SD    1 
ATOM   7769  C  CE    . MET A 1 1047 ? -32.234 -16.930 -47.424 1.00 70.21  ? 1047 MET A CE    1 
ATOM   7770  N  N     . GLY A 1 1048 ? -36.949 -16.749 -50.856 1.00 50.14  ? 1048 GLY A N     1 
ATOM   7771  C  CA    . GLY A 1 1048 ? -38.116 -15.897 -50.651 1.00 49.67  ? 1048 GLY A CA    1 
ATOM   7772  C  C     . GLY A 1 1048 ? -37.794 -14.477 -50.238 1.00 49.96  ? 1048 GLY A C     1 
ATOM   7773  O  O     . GLY A 1 1048 ? -38.690 -13.635 -50.176 1.00 50.20  ? 1048 GLY A O     1 
ATOM   7774  N  N     . GLN A 1 1049 ? -36.513 -14.214 -49.968 1.00 49.48  ? 1049 GLN A N     1 
ATOM   7775  C  CA    . GLN A 1 1049 ? -36.029 -12.878 -49.622 1.00 49.36  ? 1049 GLN A CA    1 
ATOM   7776  C  C     . GLN A 1 1049 ? -35.869 -11.933 -50.824 1.00 49.77  ? 1049 GLN A C     1 
ATOM   7777  O  O     . GLN A 1 1049 ? -35.516 -10.779 -50.648 1.00 51.94  ? 1049 GLN A O     1 
ATOM   7778  C  CB    . GLN A 1 1049 ? -34.711 -12.979 -48.833 1.00 49.33  ? 1049 GLN A CB    1 
ATOM   7779  C  CG    . GLN A 1 1049 ? -33.420 -13.126 -49.647 1.00 49.37  ? 1049 GLN A CG    1 
ATOM   7780  C  CD    . GLN A 1 1049 ? -33.146 -14.539 -50.138 1.00 48.77  ? 1049 GLN A CD    1 
ATOM   7781  O  OE1   . GLN A 1 1049 ? -34.006 -15.200 -50.730 1.00 47.04  ? 1049 GLN A OE1   1 
ATOM   7782  N  NE2   . GLN A 1 1049 ? -31.931 -15.003 -49.910 1.00 49.70  ? 1049 GLN A NE2   1 
ATOM   7783  N  N     . GLY A 1 1050 ? -36.091 -12.414 -52.039 1.00 50.40  ? 1050 GLY A N     1 
ATOM   7784  C  CA    . GLY A 1 1050 ? -35.979 -11.568 -53.232 1.00 52.49  ? 1050 GLY A CA    1 
ATOM   7785  C  C     . GLY A 1 1050 ? -34.564 -11.199 -53.682 1.00 53.11  ? 1050 GLY A C     1 
ATOM   7786  O  O     . GLY A 1 1050 ? -34.352 -10.122 -54.263 1.00 53.97  ? 1050 GLY A O     1 
ATOM   7787  N  N     . VAL A 1 1051 ? -33.598 -12.085 -53.437 1.00 52.18  ? 1051 VAL A N     1 
ATOM   7788  C  CA    . VAL A 1 1051 ? -32.223 -11.821 -53.854 1.00 51.86  ? 1051 VAL A CA    1 
ATOM   7789  C  C     . VAL A 1 1051 ? -32.116 -11.729 -55.375 1.00 51.52  ? 1051 VAL A C     1 
ATOM   7790  O  O     . VAL A 1 1051 ? -31.485 -10.827 -55.882 1.00 53.30  ? 1051 VAL A O     1 
ATOM   7791  C  CB    . VAL A 1 1051 ? -31.203 -12.822 -53.266 1.00 50.82  ? 1051 VAL A CB    1 
ATOM   7792  C  CG1   . VAL A 1 1051 ? -31.403 -14.235 -53.805 1.00 50.52  ? 1051 VAL A CG1   1 
ATOM   7793  C  CG2   . VAL A 1 1051 ? -29.792 -12.337 -53.547 1.00 51.37  ? 1051 VAL A CG2   1 
ATOM   7794  N  N     . HIS A 1 1052 ? -32.772 -12.626 -56.095 1.00 51.46  ? 1052 HIS A N     1 
ATOM   7795  C  CA    . HIS A 1 1052 ? -32.728 -12.604 -57.561 1.00 52.16  ? 1052 HIS A CA    1 
ATOM   7796  C  C     . HIS A 1 1052 ? -33.379 -11.342 -58.153 1.00 51.78  ? 1052 HIS A C     1 
ATOM   7797  O  O     . HIS A 1 1052 ? -32.869 -10.786 -59.110 1.00 51.64  ? 1052 HIS A O     1 
ATOM   7798  C  CB    . HIS A 1 1052 ? -33.339 -13.888 -58.163 1.00 51.99  ? 1052 HIS A CB    1 
ATOM   7799  C  CG    . HIS A 1 1052 ? -32.560 -15.131 -57.862 1.00 52.51  ? 1052 HIS A CG    1 
ATOM   7800  N  ND1   . HIS A 1 1052 ? -33.086 -16.399 -58.008 1.00 53.40  ? 1052 HIS A ND1   1 
ATOM   7801  C  CD2   . HIS A 1 1052 ? -31.298 -15.301 -57.403 1.00 52.47  ? 1052 HIS A CD2   1 
ATOM   7802  C  CE1   . HIS A 1 1052 ? -32.175 -17.296 -57.662 1.00 52.83  ? 1052 HIS A CE1   1 
ATOM   7803  N  NE2   . HIS A 1 1052 ? -31.083 -16.654 -57.290 1.00 53.18  ? 1052 HIS A NE2   1 
ATOM   7804  N  N     . THR A 1 1053 ? -34.483 -10.884 -57.574 1.00 52.54  ? 1053 THR A N     1 
ATOM   7805  C  CA    . THR A 1 1053 ? -35.093 -9.613  -57.986 1.00 53.16  ? 1053 THR A CA    1 
ATOM   7806  C  C     . THR A 1 1053 ? -34.116 -8.442  -57.841 1.00 53.42  ? 1053 THR A C     1 
ATOM   7807  O  O     . THR A 1 1053 ? -34.007 -7.612  -58.740 1.00 55.17  ? 1053 THR A O     1 
ATOM   7808  C  CB    . THR A 1 1053 ? -36.380 -9.315  -57.191 1.00 53.69  ? 1053 THR A CB    1 
ATOM   7809  O  OG1   . THR A 1 1053 ? -37.236 -10.458 -57.228 1.00 54.24  ? 1053 THR A OG1   1 
ATOM   7810  C  CG2   . THR A 1 1053 ? -37.131 -8.128  -57.773 1.00 54.39  ? 1053 THR A CG2   1 
ATOM   7811  N  N     . LYS A 1 1054 ? -33.396 -8.393  -56.727 1.00 52.71  ? 1054 LYS A N     1 
ATOM   7812  C  CA    . LYS A 1 1054 ? -32.395 -7.344  -56.503 1.00 53.49  ? 1054 LYS A CA    1 
ATOM   7813  C  C     . LYS A 1 1054 ? -31.195 -7.373  -57.462 1.00 53.99  ? 1054 LYS A C     1 
ATOM   7814  O  O     . LYS A 1 1054 ? -30.680 -6.322  -57.829 1.00 55.21  ? 1054 LYS A O     1 
ATOM   7815  C  CB    . LYS A 1 1054 ? -31.903 -7.402  -55.065 1.00 53.89  ? 1054 LYS A CB    1 
ATOM   7816  C  CG    . LYS A 1 1054 ? -32.968 -6.995  -54.074 1.00 54.25  ? 1054 LYS A CG    1 
ATOM   7817  C  CD    . LYS A 1 1054 ? -32.484 -7.135  -52.652 1.00 54.94  ? 1054 LYS A CD    1 
ATOM   7818  C  CE    . LYS A 1 1054 ? -33.407 -6.384  -51.718 1.00 57.03  ? 1054 LYS A CE    1 
ATOM   7819  N  NZ    . LYS A 1 1054 ? -32.910 -6.449  -50.319 1.00 59.04  ? 1054 LYS A NZ    1 
ATOM   7820  N  N     . MET A 1 1055 ? -30.762 -8.567  -57.868 1.00 53.20  ? 1055 MET A N     1 
ATOM   7821  C  CA    . MET A 1 1055 ? -29.638 -8.706  -58.798 1.00 53.88  ? 1055 MET A CA    1 
ATOM   7822  C  C     . MET A 1 1055 ? -29.989 -8.222  -60.203 1.00 53.46  ? 1055 MET A C     1 
ATOM   7823  O  O     . MET A 1 1055 ? -29.153 -7.648  -60.891 1.00 54.22  ? 1055 MET A O     1 
ATOM   7824  C  CB    . MET A 1 1055 ? -29.142 -10.160 -58.859 1.00 54.19  ? 1055 MET A CB    1 
ATOM   7825  C  CG    . MET A 1 1055 ? -28.646 -10.768 -57.545 1.00 54.09  ? 1055 MET A CG    1 
ATOM   7826  S  SD    . MET A 1 1055 ? -27.379 -9.862  -56.630 1.00 55.68  ? 1055 MET A SD    1 
ATOM   7827  C  CE    . MET A 1 1055 ? -28.348 -8.644  -55.730 1.00 56.40  ? 1055 MET A CE    1 
ATOM   7828  N  N     . ILE A 1 1056 ? -31.228 -8.444  -60.618 1.00 53.78  ? 1056 ILE A N     1 
ATOM   7829  C  CA    . ILE A 1 1056 ? -31.708 -7.956  -61.911 1.00 54.49  ? 1056 ILE A CA    1 
ATOM   7830  C  C     . ILE A 1 1056 ? -31.863 -6.429  -61.862 1.00 54.21  ? 1056 ILE A C     1 
ATOM   7831  O  O     . ILE A 1 1056 ? -31.669 -5.758  -62.873 1.00 54.64  ? 1056 ILE A O     1 
ATOM   7832  C  CB    . ILE A 1 1056 ? -33.065 -8.584  -62.318 1.00 54.75  ? 1056 ILE A CB    1 
ATOM   7833  C  CG1   . ILE A 1 1056 ? -33.032 -10.116 -62.291 1.00 54.72  ? 1056 ILE A CG1   1 
ATOM   7834  C  CG2   . ILE A 1 1056 ? -33.495 -8.101  -63.698 1.00 55.42  ? 1056 ILE A CG2   1 
ATOM   7835  C  CD1   . ILE A 1 1056 ? -32.182 -10.764 -63.344 1.00 56.24  ? 1056 ILE A CD1   1 
ATOM   7836  N  N     . GLN A 1 1057 ? -32.237 -5.891  -60.698 1.00 53.78  ? 1057 GLN A N     1 
ATOM   7837  C  CA    . GLN A 1 1057 ? -32.257 -4.437  -60.484 1.00 54.17  ? 1057 GLN A CA    1 
ATOM   7838  C  C     . GLN A 1 1057 ? -30.858 -3.860  -60.608 1.00 54.86  ? 1057 GLN A C     1 
ATOM   7839  O  O     . GLN A 1 1057 ? -30.690 -2.798  -61.198 1.00 57.19  ? 1057 GLN A O     1 
ATOM   7840  C  CB    . GLN A 1 1057 ? -32.840 -4.059  -59.119 1.00 53.27  ? 1057 GLN A CB    1 
ATOM   7841  C  CG    . GLN A 1 1057 ? -34.338 -4.215  -59.028 1.00 52.25  ? 1057 GLN A CG    1 
ATOM   7842  C  CD    . GLN A 1 1057 ? -34.852 -3.887  -57.650 1.00 52.30  ? 1057 GLN A CD    1 
ATOM   7843  O  OE1   . GLN A 1 1057 ? -34.859 -4.727  -56.761 1.00 51.89  ? 1057 GLN A OE1   1 
ATOM   7844  N  NE2   . GLN A 1 1057 ? -35.286 -2.663  -57.465 1.00 53.60  ? 1057 GLN A NE2   1 
ATOM   7845  N  N     . VAL A 1 1058 ? -29.867 -4.561  -60.054 1.00 54.19  ? 1058 VAL A N     1 
ATOM   7846  C  CA    . VAL A 1 1058 ? -28.462 -4.174  -60.217 1.00 54.63  ? 1058 VAL A CA    1 
ATOM   7847  C  C     . VAL A 1 1058 ? -28.066 -4.234  -61.697 1.00 54.92  ? 1058 VAL A C     1 
ATOM   7848  O  O     . VAL A 1 1058 ? -27.532 -3.264  -62.235 1.00 57.32  ? 1058 VAL A O     1 
ATOM   7849  C  CB    . VAL A 1 1058 ? -27.497 -5.052  -59.375 1.00 53.51  ? 1058 VAL A CB    1 
ATOM   7850  C  CG1   . VAL A 1 1058 ? -26.033 -4.713  -59.684 1.00 53.86  ? 1058 VAL A CG1   1 
ATOM   7851  C  CG2   . VAL A 1 1058 ? -27.778 -4.898  -57.884 1.00 53.20  ? 1058 VAL A CG2   1 
ATOM   7852  N  N     . VAL A 1 1059 ? -28.341 -5.358  -62.353 1.00 53.99  ? 1059 VAL A N     1 
ATOM   7853  C  CA    . VAL A 1 1059 ? -27.979 -5.520  -63.768 1.00 53.91  ? 1059 VAL A CA    1 
ATOM   7854  C  C     . VAL A 1 1059 ? -28.641 -4.428  -64.604 1.00 54.58  ? 1059 VAL A C     1 
ATOM   7855  O  O     . VAL A 1 1059 ? -27.995 -3.829  -65.453 1.00 55.17  ? 1059 VAL A O     1 
ATOM   7856  C  CB    . VAL A 1 1059 ? -28.351 -6.917  -64.323 1.00 53.04  ? 1059 VAL A CB    1 
ATOM   7857  C  CG1   . VAL A 1 1059 ? -28.084 -7.001  -65.826 1.00 53.36  ? 1059 VAL A CG1   1 
ATOM   7858  C  CG2   . VAL A 1 1059 ? -27.574 -8.014  -63.598 1.00 52.50  ? 1059 VAL A CG2   1 
ATOM   7859  N  N     . SER A 1 1060 ? -29.915 -4.162  -64.337 1.00 54.89  ? 1060 SER A N     1 
ATOM   7860  C  CA    . SER A 1 1060 ? -30.666 -3.146  -65.063 1.00 56.62  ? 1060 SER A CA    1 
ATOM   7861  C  C     . SER A 1 1060 ? -30.047 -1.749  -64.966 1.00 58.33  ? 1060 SER A C     1 
ATOM   7862  O  O     . SER A 1 1060 ? -29.999 -1.025  -65.959 1.00 59.25  ? 1060 SER A O     1 
ATOM   7863  C  CB    . SER A 1 1060 ? -32.105 -3.111  -64.566 1.00 56.97  ? 1060 SER A CB    1 
ATOM   7864  O  OG    . SER A 1 1060 ? -32.792 -2.005  -65.101 1.00 58.96  ? 1060 SER A OG    1 
ATOM   7865  N  N     . ARG A 1 1061 ? -29.589 -1.376  -63.773 1.00 59.20  ? 1061 ARG A N     1 
ATOM   7866  C  CA    . ARG A 1 1061 ? -28.885 -0.108  -63.578 1.00 60.43  ? 1061 ARG A CA    1 
ATOM   7867  C  C     . ARG A 1 1061 ? -27.522 -0.110  -64.268 1.00 61.01  ? 1061 ARG A C     1 
ATOM   7868  O  O     . ARG A 1 1061 ? -27.185 0.839   -64.969 1.00 61.70  ? 1061 ARG A O     1 
ATOM   7869  C  CB    . ARG A 1 1061 ? -28.694 0.210   -62.086 1.00 61.29  ? 1061 ARG A CB    1 
ATOM   7870  C  CG    . ARG A 1 1061 ? -27.637 1.284   -61.818 1.00 62.77  ? 1061 ARG A CG    1 
ATOM   7871  C  CD    . ARG A 1 1061 ? -27.525 1.659   -60.359 1.00 63.35  ? 1061 ARG A CD    1 
ATOM   7872  N  NE    . ARG A 1 1061 ? -28.460 2.707   -59.976 1.00 65.72  ? 1061 ARG A NE    1 
ATOM   7873  C  CZ    . ARG A 1 1061 ? -28.529 3.244   -58.757 1.00 67.86  ? 1061 ARG A CZ    1 
ATOM   7874  N  NH1   . ARG A 1 1061 ? -27.708 2.857   -57.790 1.00 68.10  ? 1061 ARG A NH1   1 
ATOM   7875  N  NH2   . ARG A 1 1061 ? -29.426 4.187   -58.502 1.00 70.08  ? 1061 ARG A NH2   1 
ATOM   7876  N  N     . GLU A 1 1062 ? -26.736 -1.161  -64.054 1.00 60.33  ? 1062 GLU A N     1 
ATOM   7877  C  CA    . GLU A 1 1062 ? -25.335 -1.145  -64.465 1.00 61.29  ? 1062 GLU A CA    1 
ATOM   7878  C  C     . GLU A 1 1062 ? -25.134 -1.207  -65.981 1.00 62.20  ? 1062 GLU A C     1 
ATOM   7879  O  O     . GLU A 1 1062 ? -24.280 -0.505  -66.524 1.00 63.72  ? 1062 GLU A O     1 
ATOM   7880  C  CB    . GLU A 1 1062 ? -24.549 -2.253  -63.753 1.00 60.73  ? 1062 GLU A CB    1 
ATOM   7881  C  CG    . GLU A 1 1062 ? -24.366 -2.026  -62.258 1.00 60.60  ? 1062 GLU A CG    1 
ATOM   7882  C  CD    . GLU A 1 1062 ? -23.674 -0.716  -61.936 1.00 62.57  ? 1062 GLU A CD    1 
ATOM   7883  O  OE1   . GLU A 1 1062 ? -22.711 -0.348  -62.653 1.00 64.16  ? 1062 GLU A OE1   1 
ATOM   7884  O  OE2   . GLU A 1 1062 ? -24.096 -0.044  -60.967 1.00 63.99  ? 1062 GLU A OE2   1 
ATOM   7885  N  N     . LEU A 1 1063 ? -25.914 -2.042  -66.657 1.00 62.51  ? 1063 LEU A N     1 
ATOM   7886  C  CA    . LEU A 1 1063 ? -25.894 -2.112  -68.120 1.00 63.52  ? 1063 LEU A CA    1 
ATOM   7887  C  C     . LEU A 1 1063 ? -26.913 -1.180  -68.790 1.00 64.46  ? 1063 LEU A C     1 
ATOM   7888  O  O     . LEU A 1 1063 ? -26.976 -1.138  -70.009 1.00 65.08  ? 1063 LEU A O     1 
ATOM   7889  C  CB    . LEU A 1 1063 ? -26.124 -3.551  -68.584 1.00 62.57  ? 1063 LEU A CB    1 
ATOM   7890  C  CG    . LEU A 1 1063 ? -25.116 -4.582  -68.079 1.00 62.21  ? 1063 LEU A CG    1 
ATOM   7891  C  CD1   . LEU A 1 1063 ? -25.511 -5.974  -68.552 1.00 61.38  ? 1063 LEU A CD1   1 
ATOM   7892  C  CD2   . LEU A 1 1063 ? -23.707 -4.237  -68.538 1.00 63.20  ? 1063 LEU A CD2   1 
ATOM   7893  N  N     . ARG A 1 1064 ? -27.708 -0.449  -68.011 1.00 65.79  ? 1064 ARG A N     1 
ATOM   7894  C  CA    . ARG A 1 1064 ? -28.609 0.575   -68.550 1.00 68.53  ? 1064 ARG A CA    1 
ATOM   7895  C  C     . ARG A 1 1064 ? -29.590 -0.064  -69.542 1.00 65.32  ? 1064 ARG A C     1 
ATOM   7896  O  O     . ARG A 1 1064 ? -29.653 0.304   -70.715 1.00 66.86  ? 1064 ARG A O     1 
ATOM   7897  C  CB    . ARG A 1 1064 ? -27.803 1.740   -69.178 1.00 74.32  ? 1064 ARG A CB    1 
ATOM   7898  C  CG    . ARG A 1 1064 ? -26.659 2.234   -68.290 1.00 78.95  ? 1064 ARG A CG    1 
ATOM   7899  C  CD    . ARG A 1 1064 ? -26.047 3.560   -68.730 1.00 84.54  ? 1064 ARG A CD    1 
ATOM   7900  N  NE    . ARG A 1 1064 ? -25.026 3.408   -69.779 1.00 87.95  ? 1064 ARG A NE    1 
ATOM   7901  C  CZ    . ARG A 1 1064 ? -25.223 3.543   -71.099 1.00 91.30  ? 1064 ARG A CZ    1 
ATOM   7902  N  NH1   . ARG A 1 1064 ? -26.423 3.839   -71.617 1.00 92.54  ? 1064 ARG A NH1   1 
ATOM   7903  N  NH2   . ARG A 1 1064 ? -24.195 3.379   -71.929 1.00 92.66  ? 1064 ARG A NH2   1 
ATOM   7904  N  N     . MET A 1 1065 ? -30.324 -1.054  -69.045 1.00 61.18  ? 1065 MET A N     1 
ATOM   7905  C  CA    . MET A 1 1065 ? -31.297 -1.816  -69.827 1.00 58.10  ? 1065 MET A CA    1 
ATOM   7906  C  C     . MET A 1 1065 ? -32.474 -2.171  -68.933 1.00 55.91  ? 1065 MET A C     1 
ATOM   7907  O  O     . MET A 1 1065 ? -32.308 -2.255  -67.714 1.00 53.88  ? 1065 MET A O     1 
ATOM   7908  C  CB    . MET A 1 1065 ? -30.663 -3.096  -70.381 1.00 56.95  ? 1065 MET A CB    1 
ATOM   7909  C  CG    . MET A 1 1065 ? -30.067 -4.041  -69.341 1.00 56.03  ? 1065 MET A CG    1 
ATOM   7910  S  SD    . MET A 1 1065 ? -29.484 -5.612  -70.037 1.00 55.61  ? 1065 MET A SD    1 
ATOM   7911  C  CE    . MET A 1 1065 ? -28.265 -5.035  -71.210 1.00 56.41  ? 1065 MET A CE    1 
ATOM   7912  N  N     . PRO A 1 1066 ? -33.662 -2.391  -69.527 1.00 55.52  ? 1066 PRO A N     1 
ATOM   7913  C  CA    . PRO A 1 1066 ? -34.822 -2.776  -68.709 1.00 55.55  ? 1066 PRO A CA    1 
ATOM   7914  C  C     . PRO A 1 1066 ? -34.691 -4.181  -68.109 1.00 55.19  ? 1066 PRO A C     1 
ATOM   7915  O  O     . PRO A 1 1066 ? -34.020 -5.056  -68.685 1.00 54.96  ? 1066 PRO A O     1 
ATOM   7916  C  CB    . PRO A 1 1066 ? -36.001 -2.708  -69.690 1.00 55.44  ? 1066 PRO A CB    1 
ATOM   7917  C  CG    . PRO A 1 1066 ? -35.407 -2.783  -71.048 1.00 55.52  ? 1066 PRO A CG    1 
ATOM   7918  C  CD    . PRO A 1 1066 ? -33.979 -2.347  -70.967 1.00 55.86  ? 1066 PRO A CD    1 
ATOM   7919  N  N     . MET A 1 1067 ? -35.348 -4.394  -66.973 1.00 55.43  ? 1067 MET A N     1 
ATOM   7920  C  CA    . MET A 1 1067 ? -35.281 -5.684  -66.268 1.00 54.17  ? 1067 MET A CA    1 
ATOM   7921  C  C     . MET A 1 1067 ? -35.852 -6.837  -67.096 1.00 52.58  ? 1067 MET A C     1 
ATOM   7922  O  O     . MET A 1 1067 ? -35.402 -7.984  -66.974 1.00 50.92  ? 1067 MET A O     1 
ATOM   7923  C  CB    . MET A 1 1067 ? -35.982 -5.580  -64.920 1.00 54.91  ? 1067 MET A CB    1 
ATOM   7924  C  CG    . MET A 1 1067 ? -35.249 -4.647  -63.963 1.00 56.87  ? 1067 MET A CG    1 
ATOM   7925  S  SD    . MET A 1 1067 ? -36.082 -4.476  -62.385 1.00 59.44  ? 1067 MET A SD    1 
ATOM   7926  C  CE    . MET A 1 1067 ? -35.739 -6.081  -61.658 1.00 58.72  ? 1067 MET A CE    1 
ATOM   7927  N  N     . SER A 1 1068 ? -36.805 -6.508  -67.969 1.00 51.94  ? 1068 SER A N     1 
ATOM   7928  C  CA    . SER A 1 1068 ? -37.367 -7.444  -68.939 1.00 51.46  ? 1068 SER A CA    1 
ATOM   7929  C  C     . SER A 1 1068 ? -36.344 -8.042  -69.914 1.00 51.46  ? 1068 SER A C     1 
ATOM   7930  O  O     . SER A 1 1068 ? -36.612 -9.075  -70.534 1.00 50.49  ? 1068 SER A O     1 
ATOM   7931  C  CB    . SER A 1 1068 ? -38.443 -6.742  -69.754 1.00 52.10  ? 1068 SER A CB    1 
ATOM   7932  O  OG    . SER A 1 1068 ? -37.880 -5.648  -70.460 1.00 53.57  ? 1068 SER A OG    1 
ATOM   7933  N  N     . ASN A 1 1069 ? -35.208 -7.371  -70.086 1.00 51.99  ? 1069 ASN A N     1 
ATOM   7934  C  CA    . ASN A 1 1069 ? -34.138 -7.853  -70.950 1.00 52.20  ? 1069 ASN A CA    1 
ATOM   7935  C  C     . ASN A 1 1069 ? -33.140 -8.803  -70.270 1.00 51.14  ? 1069 ASN A C     1 
ATOM   7936  O  O     . ASN A 1 1069 ? -32.319 -9.412  -70.949 1.00 50.69  ? 1069 ASN A O     1 
ATOM   7937  C  CB    . ASN A 1 1069 ? -33.392 -6.658  -71.531 1.00 53.29  ? 1069 ASN A CB    1 
ATOM   7938  C  CG    . ASN A 1 1069 ? -32.522 -7.036  -72.695 1.00 53.34  ? 1069 ASN A CG    1 
ATOM   7939  O  OD1   . ASN A 1 1069 ? -33.003 -7.602  -73.661 1.00 54.39  ? 1069 ASN A OD1   1 
ATOM   7940  N  ND2   . ASN A 1 1069 ? -31.236 -6.737  -72.607 1.00 54.02  ? 1069 ASN A ND2   1 
ATOM   7941  N  N     . VAL A 1 1070 ? -33.211 -8.912  -68.942 1.00 51.24  ? 1070 VAL A N     1 
ATOM   7942  C  CA    . VAL A 1 1070 ? -32.309 -9.756  -68.146 1.00 50.63  ? 1070 VAL A CA    1 
ATOM   7943  C  C     . VAL A 1 1070 ? -33.083 -10.977 -67.667 1.00 49.81  ? 1070 VAL A C     1 
ATOM   7944  O  O     . VAL A 1 1070 ? -34.259 -10.878 -67.380 1.00 49.57  ? 1070 VAL A O     1 
ATOM   7945  C  CB    . VAL A 1 1070 ? -31.768 -8.997  -66.914 1.00 50.50  ? 1070 VAL A CB    1 
ATOM   7946  C  CG1   . VAL A 1 1070 ? -30.660 -9.781  -66.227 1.00 50.13  ? 1070 VAL A CG1   1 
ATOM   7947  C  CG2   . VAL A 1 1070 ? -31.252 -7.623  -67.307 1.00 51.58  ? 1070 VAL A CG2   1 
ATOM   7948  N  N     . HIS A 1 1071 ? -32.421 -12.127 -67.589 1.00 50.56  ? 1071 HIS A N     1 
ATOM   7949  C  CA    . HIS A 1 1071 ? -33.037 -13.344 -67.054 1.00 50.17  ? 1071 HIS A CA    1 
ATOM   7950  C  C     . HIS A 1 1071 ? -32.051 -14.111 -66.205 1.00 48.74  ? 1071 HIS A C     1 
ATOM   7951  O  O     . HIS A 1 1071 ? -30.857 -14.040 -66.410 1.00 48.75  ? 1071 HIS A O     1 
ATOM   7952  C  CB    . HIS A 1 1071 ? -33.566 -14.238 -68.182 1.00 51.53  ? 1071 HIS A CB    1 
ATOM   7953  C  CG    . HIS A 1 1071 ? -34.375 -15.398 -67.695 1.00 52.16  ? 1071 HIS A CG    1 
ATOM   7954  N  ND1   . HIS A 1 1071 ? -35.547 -15.241 -66.991 1.00 53.89  ? 1071 HIS A ND1   1 
ATOM   7955  C  CD2   . HIS A 1 1071 ? -34.164 -16.729 -67.777 1.00 52.91  ? 1071 HIS A CD2   1 
ATOM   7956  C  CE1   . HIS A 1 1071 ? -36.029 -16.425 -66.668 1.00 52.87  ? 1071 HIS A CE1   1 
ATOM   7957  N  NE2   . HIS A 1 1071 ? -35.209 -17.345 -67.136 1.00 52.84  ? 1071 HIS A NE2   1 
ATOM   7958  N  N     . LEU A 1 1072 ? -32.581 -14.829 -65.230 1.00 48.98  ? 1072 LEU A N     1 
ATOM   7959  C  CA    . LEU A 1 1072 ? -31.807 -15.667 -64.338 1.00 49.14  ? 1072 LEU A CA    1 
ATOM   7960  C  C     . LEU A 1 1072 ? -32.602 -16.962 -64.215 1.00 51.03  ? 1072 LEU A C     1 
ATOM   7961  O  O     . LEU A 1 1072 ? -33.826 -16.917 -64.136 1.00 53.62  ? 1072 LEU A O     1 
ATOM   7962  C  CB    . LEU A 1 1072 ? -31.657 -14.970 -62.992 1.00 48.26  ? 1072 LEU A CB    1 
ATOM   7963  C  CG    . LEU A 1 1072 ? -30.815 -15.676 -61.935 1.00 48.31  ? 1072 LEU A CG    1 
ATOM   7964  C  CD1   . LEU A 1 1072 ? -29.975 -14.685 -61.147 1.00 49.19  ? 1072 LEU A CD1   1 
ATOM   7965  C  CD2   . LEU A 1 1072 ? -31.650 -16.542 -60.996 1.00 48.36  ? 1072 LEU A CD2   1 
ATOM   7966  N  N     . ARG A 1 1073 ? -31.912 -18.100 -64.244 1.00 52.12  ? 1073 ARG A N     1 
ATOM   7967  C  CA    . ARG A 1 1073 ? -32.536 -19.424 -64.185 1.00 51.76  ? 1073 ARG A CA    1 
ATOM   7968  C  C     . ARG A 1 1073 ? -32.461 -20.009 -62.788 1.00 50.27  ? 1073 ARG A C     1 
ATOM   7969  O  O     . ARG A 1 1073 ? -33.434 -20.553 -62.288 1.00 48.99  ? 1073 ARG A O     1 
ATOM   7970  C  CB    . ARG A 1 1073 ? -31.839 -20.383 -65.149 1.00 54.21  ? 1073 ARG A CB    1 
ATOM   7971  C  CG    . ARG A 1 1073 ? -32.107 -20.103 -66.613 1.00 57.94  ? 1073 ARG A CG    1 
ATOM   7972  C  CD    . ARG A 1 1073 ? -31.377 -21.098 -67.488 1.00 61.37  ? 1073 ARG A CD    1 
ATOM   7973  N  NE    . ARG A 1 1073 ? -32.057 -22.399 -67.564 1.00 64.67  ? 1073 ARG A NE    1 
ATOM   7974  C  CZ    . ARG A 1 1073 ? -32.900 -22.787 -68.529 1.00 69.38  ? 1073 ARG A CZ    1 
ATOM   7975  N  NH1   . ARG A 1 1073 ? -33.230 -21.977 -69.559 1.00 75.36  ? 1073 ARG A NH1   1 
ATOM   7976  N  NH2   . ARG A 1 1073 ? -33.444 -24.000 -68.462 1.00 67.81  ? 1073 ARG A NH2   1 
ATOM   7977  N  N     . GLY A 1 1074 ? -31.283 -19.938 -62.180 1.00 49.24  ? 1074 GLY A N     1 
ATOM   7978  C  CA    . GLY A 1 1074 ? -31.083 -20.455 -60.837 1.00 47.73  ? 1074 GLY A CA    1 
ATOM   7979  C  C     . GLY A 1 1074 ? -29.653 -20.318 -60.352 1.00 47.44  ? 1074 GLY A C     1 
ATOM   7980  O  O     . GLY A 1 1074 ? -28.925 -19.391 -60.746 1.00 49.76  ? 1074 GLY A O     1 
ATOM   7981  N  N     . THR A 1 1075 ? -29.268 -21.230 -59.468 1.00 46.25  ? 1075 THR A N     1 
ATOM   7982  C  CA    . THR A 1 1075 ? -27.940 -21.257 -58.859 1.00 46.71  ? 1075 THR A CA    1 
ATOM   7983  C  C     . THR A 1 1075 ? -27.364 -22.650 -59.072 1.00 46.43  ? 1075 THR A C     1 
ATOM   7984  O  O     . THR A 1 1075 ? -28.083 -23.649 -58.966 1.00 46.47  ? 1075 THR A O     1 
ATOM   7985  C  CB    . THR A 1 1075 ? -28.017 -20.929 -57.353 1.00 46.92  ? 1075 THR A CB    1 
ATOM   7986  O  OG1   . THR A 1 1075 ? -28.733 -19.699 -57.162 1.00 48.68  ? 1075 THR A OG1   1 
ATOM   7987  C  CG2   . THR A 1 1075 ? -26.633 -20.796 -56.744 1.00 47.56  ? 1075 THR A CG2   1 
ATOM   7988  N  N     . SER A 1 1076 ? -26.078 -22.713 -59.398 1.00 47.35  ? 1076 SER A N     1 
ATOM   7989  C  CA    . SER A 1 1076 ? -25.419 -23.982 -59.704 1.00 47.12  ? 1076 SER A CA    1 
ATOM   7990  C  C     . SER A 1 1076 ? -23.915 -23.913 -59.485 1.00 46.89  ? 1076 SER A C     1 
ATOM   7991  O  O     . SER A 1 1076 ? -23.250 -22.981 -59.939 1.00 47.82  ? 1076 SER A O     1 
ATOM   7992  C  CB    . SER A 1 1076 ? -25.704 -24.387 -61.155 1.00 47.41  ? 1076 SER A CB    1 
ATOM   7993  O  OG    . SER A 1 1076 ? -25.084 -25.619 -61.494 1.00 47.58  ? 1076 SER A OG    1 
ATOM   7994  N  N     . THR A 1 1077 ? -23.382 -24.938 -58.831 1.00 46.72  ? 1077 THR A N     1 
ATOM   7995  C  CA    . THR A 1 1077 ? -21.935 -25.119 -58.700 1.00 47.29  ? 1077 THR A CA    1 
ATOM   7996  C  C     . THR A 1 1077 ? -21.220 -25.265 -60.052 1.00 47.83  ? 1077 THR A C     1 
ATOM   7997  O  O     . THR A 1 1077 ? -20.013 -25.022 -60.158 1.00 47.76  ? 1077 THR A O     1 
ATOM   7998  C  CB    . THR A 1 1077 ? -21.636 -26.356 -57.854 1.00 47.90  ? 1077 THR A CB    1 
ATOM   7999  O  OG1   . THR A 1 1077 ? -22.352 -27.475 -58.383 1.00 46.68  ? 1077 THR A OG1   1 
ATOM   8000  C  CG2   . THR A 1 1077 ? -22.065 -26.123 -56.398 1.00 48.60  ? 1077 THR A CG2   1 
ATOM   8001  N  N     . GLU A 1 1078 ? -21.975 -25.663 -61.077 1.00 48.25  ? 1078 GLU A N     1 
ATOM   8002  C  CA    . GLU A 1 1078 ? -21.472 -25.731 -62.452 1.00 49.04  ? 1078 GLU A CA    1 
ATOM   8003  C  C     . GLU A 1 1078 ? -21.195 -24.363 -63.074 1.00 47.61  ? 1078 GLU A C     1 
ATOM   8004  O  O     . GLU A 1 1078 ? -20.298 -24.244 -63.871 1.00 48.27  ? 1078 GLU A O     1 
ATOM   8005  C  CB    . GLU A 1 1078 ? -22.443 -26.534 -63.332 1.00 49.34  ? 1078 GLU A CB    1 
ATOM   8006  C  CG    . GLU A 1 1078 ? -21.835 -27.063 -64.633 1.00 50.74  ? 1078 GLU A CG    1 
ATOM   8007  C  CD    . GLU A 1 1078 ? -22.626 -28.214 -65.268 1.00 51.18  ? 1078 GLU A CD    1 
ATOM   8008  O  OE1   . GLU A 1 1078 ? -23.527 -28.769 -64.603 1.00 53.30  ? 1078 GLU A OE1   1 
ATOM   8009  O  OE2   . GLU A 1 1078 ? -22.353 -28.576 -66.438 1.00 50.33  ? 1078 GLU A OE2   1 
ATOM   8010  N  N     . THR A 1 1079 ? -21.952 -23.340 -62.714 1.00 47.08  ? 1079 THR A N     1 
ATOM   8011  C  CA    . THR A 1 1079 ? -21.761 -22.017 -63.297 1.00 47.64  ? 1079 THR A CA    1 
ATOM   8012  C  C     . THR A 1 1079 ? -20.926 -21.097 -62.425 1.00 46.76  ? 1079 THR A C     1 
ATOM   8013  O  O     . THR A 1 1079 ? -20.055 -20.396 -62.940 1.00 47.90  ? 1079 THR A O     1 
ATOM   8014  C  CB    . THR A 1 1079 ? -23.106 -21.333 -63.604 1.00 47.85  ? 1079 THR A CB    1 
ATOM   8015  O  OG1   . THR A 1 1079 ? -23.912 -21.293 -62.416 1.00 48.49  ? 1079 THR A OG1   1 
ATOM   8016  C  CG2   . THR A 1 1079 ? -23.828 -22.089 -64.728 1.00 46.70  ? 1079 THR A CG2   1 
ATOM   8017  N  N     . VAL A 1 1080 ? -21.204 -21.081 -61.124 1.00 45.27  ? 1080 VAL A N     1 
ATOM   8018  C  CA    . VAL A 1 1080 ? -20.447 -20.259 -60.181 1.00 45.85  ? 1080 VAL A CA    1 
ATOM   8019  C  C     . VAL A 1 1080 ? -19.898 -21.161 -59.082 1.00 46.54  ? 1080 VAL A C     1 
ATOM   8020  O  O     . VAL A 1 1080 ? -20.659 -21.645 -58.248 1.00 45.97  ? 1080 VAL A O     1 
ATOM   8021  C  CB    . VAL A 1 1080 ? -21.309 -19.141 -59.584 1.00 45.54  ? 1080 VAL A CB    1 
ATOM   8022  C  CG1   . VAL A 1 1080 ? -20.542 -18.389 -58.496 1.00 46.49  ? 1080 VAL A CG1   1 
ATOM   8023  C  CG2   . VAL A 1 1080 ? -21.769 -18.200 -60.695 1.00 44.80  ? 1080 VAL A CG2   1 
ATOM   8024  N  N     . PRO A 1 1081 ? -18.576 -21.400 -59.090 1.00 48.06  ? 1081 PRO A N     1 
ATOM   8025  C  CA    . PRO A 1 1081 ? -17.968 -22.325 -58.158 1.00 48.73  ? 1081 PRO A CA    1 
ATOM   8026  C  C     . PRO A 1 1081 ? -17.568 -21.667 -56.843 1.00 48.96  ? 1081 PRO A C     1 
ATOM   8027  O  O     . PRO A 1 1081 ? -17.364 -20.452 -56.787 1.00 49.63  ? 1081 PRO A O     1 
ATOM   8028  C  CB    . PRO A 1 1081 ? -16.710 -22.759 -58.905 1.00 49.73  ? 1081 PRO A CB    1 
ATOM   8029  C  CG    . PRO A 1 1081 ? -16.277 -21.505 -59.589 1.00 49.51  ? 1081 PRO A CG    1 
ATOM   8030  C  CD    . PRO A 1 1081 ? -17.565 -20.841 -60.010 1.00 48.82  ? 1081 PRO A CD    1 
ATOM   8031  N  N     . ASN A 1 1082 ? -17.445 -22.499 -55.813 1.00 49.12  ? 1082 ASN A N     1 
ATOM   8032  C  CA    . ASN A 1 1082 ? -16.910 -22.121 -54.506 1.00 49.88  ? 1082 ASN A CA    1 
ATOM   8033  C  C     . ASN A 1 1082 ? -17.686 -21.024 -53.755 1.00 50.49  ? 1082 ASN A C     1 
ATOM   8034  O  O     . ASN A 1 1082 ? -17.115 -20.336 -52.923 1.00 52.34  ? 1082 ASN A O     1 
ATOM   8035  C  CB    . ASN A 1 1082 ? -15.437 -21.722 -54.646 1.00 51.14  ? 1082 ASN A CB    1 
ATOM   8036  C  CG    . ASN A 1 1082 ? -14.657 -22.654 -55.553 1.00 52.12  ? 1082 ASN A CG    1 
ATOM   8037  O  OD1   . ASN A 1 1082 ? -14.842 -23.880 -55.535 1.00 52.67  ? 1082 ASN A OD1   1 
ATOM   8038  N  ND2   . ASN A 1 1082 ? -13.767 -22.081 -56.345 1.00 52.79  ? 1082 ASN A ND2   1 
ATOM   8039  N  N     . ALA A 1 1083 ? -18.981 -20.874 -54.025 1.00 50.52  ? 1083 ALA A N     1 
ATOM   8040  C  CA    . ALA A 1 1083 ? -19.780 -19.817 -53.400 1.00 50.92  ? 1083 ALA A CA    1 
ATOM   8041  C  C     . ALA A 1 1083 ? -20.016 -20.131 -51.926 1.00 52.82  ? 1083 ALA A C     1 
ATOM   8042  O  O     . ALA A 1 1083 ? -20.175 -21.299 -51.556 1.00 54.08  ? 1083 ALA A O     1 
ATOM   8043  C  CB    . ALA A 1 1083 ? -21.111 -19.659 -54.120 1.00 49.39  ? 1083 ALA A CB    1 
ATOM   8044  N  N     . ASN A 1 1084 ? -20.036 -19.094 -51.090 1.00 54.11  ? 1084 ASN A N     1 
ATOM   8045  C  CA    . ASN A 1 1084 ? -20.341 -19.258 -49.663 1.00 55.40  ? 1084 ASN A CA    1 
ATOM   8046  C  C     . ASN A 1 1084 ? -21.824 -19.507 -49.433 1.00 54.99  ? 1084 ASN A C     1 
ATOM   8047  O  O     . ASN A 1 1084 ? -22.643 -19.364 -50.336 1.00 53.08  ? 1084 ASN A O     1 
ATOM   8048  C  CB    . ASN A 1 1084 ? -19.911 -18.022 -48.862 1.00 56.78  ? 1084 ASN A CB    1 
ATOM   8049  C  CG    . ASN A 1 1084 ? -18.413 -17.964 -48.641 1.00 58.75  ? 1084 ASN A CG    1 
ATOM   8050  O  OD1   . ASN A 1 1084 ? -17.832 -18.886 -48.072 1.00 60.71  ? 1084 ASN A OD1   1 
ATOM   8051  N  ND2   . ASN A 1 1084 ? -17.779 -16.877 -49.076 1.00 58.91  ? 1084 ASN A ND2   1 
ATOM   8052  N  N     . ILE A 1 1085 ? -22.147 -19.871 -48.198 1.00 57.06  ? 1085 ILE A N     1 
ATOM   8053  C  CA    . ILE A 1 1085 ? -23.529 -20.063 -47.744 1.00 57.20  ? 1085 ILE A CA    1 
ATOM   8054  C  C     . ILE A 1 1085 ? -24.400 -18.823 -47.975 1.00 57.61  ? 1085 ILE A C     1 
ATOM   8055  O  O     . ILE A 1 1085 ? -23.932 -17.696 -47.841 1.00 59.23  ? 1085 ILE A O     1 
ATOM   8056  C  CB    . ILE A 1 1085 ? -23.565 -20.448 -46.236 1.00 57.42  ? 1085 ILE A CB    1 
ATOM   8057  C  CG1   . ILE A 1 1085 ? -24.972 -20.911 -45.830 1.00 57.38  ? 1085 ILE A CG1   1 
ATOM   8058  C  CG2   . ILE A 1 1085 ? -23.086 -19.299 -45.351 1.00 56.72  ? 1085 ILE A CG2   1 
ATOM   8059  C  CD1   . ILE A 1 1085 ? -25.045 -21.539 -44.456 1.00 57.71  ? 1085 ILE A CD1   1 
ATOM   8060  N  N     . SER A 1 1086 ? -25.660 -19.040 -48.333 1.00 58.03  ? 1086 SER A N     1 
ATOM   8061  C  CA    . SER A 1 1086 ? -26.635 -17.958 -48.373 1.00 58.33  ? 1086 SER A CA    1 
ATOM   8062  C  C     . SER A 1 1086 ? -27.178 -17.767 -46.963 1.00 61.83  ? 1086 SER A C     1 
ATOM   8063  O  O     . SER A 1 1086 ? -28.173 -18.384 -46.559 1.00 61.17  ? 1086 SER A O     1 
ATOM   8064  C  CB    . SER A 1 1086 ? -27.749 -18.231 -49.380 1.00 56.37  ? 1086 SER A CB    1 
ATOM   8065  O  OG    . SER A 1 1086 ? -27.333 -17.878 -50.684 1.00 53.90  ? 1086 SER A OG    1 
ATOM   8066  N  N     . GLY A 1 1087 ? -26.470 -16.925 -46.217 1.00 66.87  ? 1087 GLY A N     1 
ATOM   8067  C  CA    . GLY A 1 1087 ? -26.867 -16.501 -44.880 1.00 70.74  ? 1087 GLY A CA    1 
ATOM   8068  C  C     . GLY A 1 1087 ? -26.173 -15.211 -44.446 1.00 74.93  ? 1087 GLY A C     1 
ATOM   8069  O  O     . GLY A 1 1087 ? -25.607 -14.489 -45.274 1.00 77.05  ? 1087 GLY A O     1 
ATOM   8070  N  N     . GLY A 1 1088 ? -26.225 -14.921 -43.145 1.00 77.84  ? 1088 GLY A N     1 
ATOM   8071  C  CA    . GLY A 1 1088 ? -25.533 -13.768 -42.549 1.00 78.81  ? 1088 GLY A CA    1 
ATOM   8072  C  C     . GLY A 1 1088 ? -26.057 -12.375 -42.882 1.00 80.57  ? 1088 GLY A C     1 
ATOM   8073  O  O     . GLY A 1 1088 ? -25.343 -11.390 -42.653 1.00 82.78  ? 1088 GLY A O     1 
ATOM   8074  N  N     . SER A 1 1089 ? -27.291 -12.287 -43.403 1.00 80.53  ? 1089 SER A N     1 
ATOM   8075  C  CA    . SER A 1 1089 ? -27.942 -11.010 -43.815 1.00 79.49  ? 1089 SER A CA    1 
ATOM   8076  C  C     . SER A 1 1089 ? -27.281 -10.274 -44.994 1.00 75.00  ? 1089 SER A C     1 
ATOM   8077  O  O     . SER A 1 1089 ? -27.613 -9.121  -45.259 1.00 76.41  ? 1089 SER A O     1 
ATOM   8078  C  CB    . SER A 1 1089 ? -28.086 -10.034 -42.622 1.00 81.02  ? 1089 SER A CB    1 
ATOM   8079  O  OG    . SER A 1 1089 ? -28.620 -10.678 -41.477 1.00 83.41  ? 1089 SER A OG    1 
ATOM   8080  N  N     . VAL A 1 1090 ? -26.406 -10.953 -45.731 1.00 70.31  ? 1090 VAL A N     1 
ATOM   8081  C  CA    . VAL A 1 1090 ? -25.535 -10.294 -46.711 1.00 68.78  ? 1090 VAL A CA    1 
ATOM   8082  C  C     . VAL A 1 1090 ? -25.535 -10.928 -48.112 1.00 66.01  ? 1090 VAL A C     1 
ATOM   8083  O  O     . VAL A 1 1090 ? -24.699 -10.601 -48.943 1.00 65.75  ? 1090 VAL A O     1 
ATOM   8084  C  CB    . VAL A 1 1090 ? -24.084 -10.199 -46.170 1.00 68.55  ? 1090 VAL A CB    1 
ATOM   8085  C  CG1   . VAL A 1 1090 ? -24.023 -9.227  -45.010 1.00 68.60  ? 1090 VAL A CG1   1 
ATOM   8086  C  CG2   . VAL A 1 1090 ? -23.550 -11.566 -45.754 1.00 68.55  ? 1090 VAL A CG2   1 
ATOM   8087  N  N     . VAL A 1 1091 ? -26.497 -11.795 -48.396 1.00 64.55  ? 1091 VAL A N     1 
ATOM   8088  C  CA    . VAL A 1 1091 ? -26.513 -12.525 -49.662 1.00 63.70  ? 1091 VAL A CA    1 
ATOM   8089  C  C     . VAL A 1 1091 ? -26.603 -11.510 -50.807 1.00 63.44  ? 1091 VAL A C     1 
ATOM   8090  O  O     . VAL A 1 1091 ? -25.778 -11.533 -51.726 1.00 62.52  ? 1091 VAL A O     1 
ATOM   8091  C  CB    . VAL A 1 1091 ? -27.670 -13.573 -49.719 1.00 63.31  ? 1091 VAL A CB    1 
ATOM   8092  C  CG1   . VAL A 1 1091 ? -27.641 -14.395 -51.011 1.00 62.45  ? 1091 VAL A CG1   1 
ATOM   8093  C  CG2   . VAL A 1 1091 ? -27.618 -14.512 -48.511 1.00 63.16  ? 1091 VAL A CG2   1 
ATOM   8094  N  N     . ALA A 1 1092 ? -27.576 -10.605 -50.721 1.00 63.43  ? 1092 ALA A N     1 
ATOM   8095  C  CA    . ALA A 1 1092 ? -27.772 -9.588  -51.749 1.00 63.56  ? 1092 ALA A CA    1 
ATOM   8096  C  C     . ALA A 1 1092 ? -26.615 -8.588  -51.799 1.00 64.53  ? 1092 ALA A C     1 
ATOM   8097  O  O     . ALA A 1 1092 ? -26.130 -8.283  -52.878 1.00 65.45  ? 1092 ALA A O     1 
ATOM   8098  C  CB    . ALA A 1 1092 ? -29.100 -8.878  -51.555 1.00 63.54  ? 1092 ALA A CB    1 
ATOM   8099  N  N     . ASP A 1 1093 ? -26.167 -8.102  -50.644 1.00 66.59  ? 1093 ASP A N     1 
ATOM   8100  C  CA    . ASP A 1 1093 ? -25.013 -7.187  -50.560 1.00 69.44  ? 1093 ASP A CA    1 
ATOM   8101  C  C     . ASP A 1 1093 ? -23.839 -7.672  -51.391 1.00 67.45  ? 1093 ASP A C     1 
ATOM   8102  O  O     . ASP A 1 1093 ? -23.294 -6.943  -52.230 1.00 67.82  ? 1093 ASP A O     1 
ATOM   8103  C  CB    . ASP A 1 1093 ? -24.480 -7.088  -49.121 1.00 74.12  ? 1093 ASP A CB    1 
ATOM   8104  C  CG    . ASP A 1 1093 ? -25.370 -6.286  -48.199 1.00 78.06  ? 1093 ASP A CG    1 
ATOM   8105  O  OD1   . ASP A 1 1093 ? -26.598 -6.183  -48.452 1.00 79.70  ? 1093 ASP A OD1   1 
ATOM   8106  O  OD2   . ASP A 1 1093 ? -24.812 -5.777  -47.195 1.00 82.51  ? 1093 ASP A OD2   1 
ATOM   8107  N  N     . LEU A 1 1094 ? -23.460 -8.915  -51.123 1.00 64.02  ? 1094 LEU A N     1 
ATOM   8108  C  CA    . LEU A 1 1094 ? -22.207 -9.469  -51.606 1.00 62.67  ? 1094 LEU A CA    1 
ATOM   8109  C  C     . LEU A 1 1094 ? -22.326 -9.946  -53.043 1.00 60.31  ? 1094 LEU A C     1 
ATOM   8110  O  O     . LEU A 1 1094 ? -21.469 -9.631  -53.866 1.00 61.70  ? 1094 LEU A O     1 
ATOM   8111  C  CB    . LEU A 1 1094 ? -21.732 -10.589 -50.674 1.00 62.14  ? 1094 LEU A CB    1 
ATOM   8112  C  CG    . LEU A 1 1094 ? -21.546 -10.140 -49.217 1.00 63.26  ? 1094 LEU A CG    1 
ATOM   8113  C  CD1   . LEU A 1 1094 ? -21.332 -11.330 -48.296 1.00 62.94  ? 1094 LEU A CD1   1 
ATOM   8114  C  CD2   . LEU A 1 1094 ? -20.415 -9.129  -49.098 1.00 65.06  ? 1094 LEU A CD2   1 
ATOM   8115  N  N     . ASN A 1 1095 ? -23.383 -10.690 -53.354 1.00 57.98  ? 1095 ASN A N     1 
ATOM   8116  C  CA    . ASN A 1 1095 ? -23.615 -11.114 -54.734 1.00 56.84  ? 1095 ASN A CA    1 
ATOM   8117  C  C     . ASN A 1 1095 ? -23.977 -9.938  -55.621 1.00 56.35  ? 1095 ASN A C     1 
ATOM   8118  O  O     . ASN A 1 1095 ? -23.658 -9.944  -56.796 1.00 56.93  ? 1095 ASN A O     1 
ATOM   8119  C  CB    . ASN A 1 1095 ? -24.680 -12.205 -54.818 1.00 56.25  ? 1095 ASN A CB    1 
ATOM   8120  C  CG    . ASN A 1 1095 ? -24.189 -13.533 -54.274 1.00 55.41  ? 1095 ASN A CG    1 
ATOM   8121  O  OD1   . ASN A 1 1095 ? -23.451 -14.253 -54.939 1.00 56.42  ? 1095 ASN A OD1   1 
ATOM   8122  N  ND2   . ASN A 1 1095 ? -24.606 -13.867 -53.067 1.00 55.23  ? 1095 ASN A ND2   1 
ATOM   8123  N  N     . GLY A 1 1096 ? -24.633 -8.930  -55.057 1.00 56.61  ? 1096 GLY A N     1 
ATOM   8124  C  CA    . GLY A 1 1096 ? -24.833 -7.651  -55.743 1.00 57.21  ? 1096 GLY A CA    1 
ATOM   8125  C  C     . GLY A 1 1096 ? -23.545 -6.951  -56.150 1.00 58.00  ? 1096 GLY A C     1 
ATOM   8126  O  O     . GLY A 1 1096 ? -23.460 -6.408  -57.247 1.00 59.28  ? 1096 GLY A O     1 
ATOM   8127  N  N     . LEU A 1 1097 ? -22.543 -6.964  -55.277 1.00 58.22  ? 1097 LEU A N     1 
ATOM   8128  C  CA    . LEU A 1 1097 ? -21.232 -6.411  -55.608 1.00 60.12  ? 1097 LEU A CA    1 
ATOM   8129  C  C     . LEU A 1 1097 ? -20.514 -7.206  -56.696 1.00 59.86  ? 1097 LEU A C     1 
ATOM   8130  O  O     . LEU A 1 1097 ? -19.802 -6.629  -57.521 1.00 62.32  ? 1097 LEU A O     1 
ATOM   8131  C  CB    . LEU A 1 1097 ? -20.349 -6.294  -54.356 1.00 62.42  ? 1097 LEU A CB    1 
ATOM   8132  C  CG    . LEU A 1 1097 ? -20.735 -5.140  -53.408 1.00 63.57  ? 1097 LEU A CG    1 
ATOM   8133  C  CD1   . LEU A 1 1097 ? -20.239 -5.380  -51.991 1.00 64.91  ? 1097 LEU A CD1   1 
ATOM   8134  C  CD2   . LEU A 1 1097 ? -20.222 -3.809  -53.922 1.00 63.59  ? 1097 LEU A CD2   1 
ATOM   8135  N  N     . ALA A 1 1098 ? -20.703 -8.520  -56.704 1.00 58.84  ? 1098 ALA A N     1 
ATOM   8136  C  CA    . ALA A 1 1098 ? -20.099 -9.383  -57.721 1.00 57.84  ? 1098 ALA A CA    1 
ATOM   8137  C  C     . ALA A 1 1098 ? -20.795 -9.270  -59.080 1.00 57.53  ? 1098 ALA A C     1 
ATOM   8138  O  O     . ALA A 1 1098 ? -20.155 -9.385  -60.122 1.00 57.05  ? 1098 ALA A O     1 
ATOM   8139  C  CB    . ALA A 1 1098 ? -20.106 -10.820 -57.246 1.00 57.43  ? 1098 ALA A CB    1 
ATOM   8140  N  N     . VAL A 1 1099 ? -22.110 -9.070  -59.065 1.00 57.25  ? 1099 VAL A N     1 
ATOM   8141  C  CA    . VAL A 1 1099 ? -22.888 -8.868  -60.288 1.00 56.36  ? 1099 VAL A CA    1 
ATOM   8142  C  C     . VAL A 1 1099 ? -22.523 -7.526  -60.909 1.00 56.79  ? 1099 VAL A C     1 
ATOM   8143  O  O     . VAL A 1 1099 ? -22.278 -7.442  -62.109 1.00 57.16  ? 1099 VAL A O     1 
ATOM   8144  C  CB    . VAL A 1 1099 ? -24.404 -8.968  -60.001 1.00 56.38  ? 1099 VAL A CB    1 
ATOM   8145  C  CG1   . VAL A 1 1099 ? -25.242 -8.379  -61.129 1.00 56.86  ? 1099 VAL A CG1   1 
ATOM   8146  C  CG2   . VAL A 1 1099 ? -24.788 -10.423 -59.761 1.00 56.14  ? 1099 VAL A CG2   1 
ATOM   8147  N  N     . LYS A 1 1100 ? -22.494 -6.489  -60.080 1.00 57.09  ? 1100 LYS A N     1 
ATOM   8148  C  CA    . LYS A 1 1100 ? -22.016 -5.165  -60.480 1.00 57.95  ? 1100 LYS A CA    1 
ATOM   8149  C  C     . LYS A 1 1100 ? -20.609 -5.239  -61.085 1.00 56.95  ? 1100 LYS A C     1 
ATOM   8150  O  O     . LYS A 1 1100 ? -20.348 -4.636  -62.114 1.00 58.41  ? 1100 LYS A O     1 
ATOM   8151  C  CB    . LYS A 1 1100 ? -22.042 -4.225  -59.268 1.00 59.31  ? 1100 LYS A CB    1 
ATOM   8152  C  CG    . LYS A 1 1100 ? -21.531 -2.811  -59.499 1.00 61.35  ? 1100 LYS A CG    1 
ATOM   8153  C  CD    . LYS A 1 1100 ? -21.954 -1.925  -58.337 1.00 63.17  ? 1100 LYS A CD    1 
ATOM   8154  C  CE    . LYS A 1 1100 ? -21.194 -0.614  -58.304 1.00 66.19  ? 1100 LYS A CE    1 
ATOM   8155  N  NZ    . LYS A 1 1100 ? -19.734 -0.808  -58.069 1.00 67.87  ? 1100 LYS A NZ    1 
ATOM   8156  N  N     . ASP A 1 1101 ? -19.720 -6.000  -60.461 1.00 55.14  ? 1101 ASP A N     1 
ATOM   8157  C  CA    . ASP A 1 1101 ? -18.369 -6.163  -60.978 1.00 55.67  ? 1101 ASP A CA    1 
ATOM   8158  C  C     . ASP A 1 1101 ? -18.329 -6.748  -62.409 1.00 55.66  ? 1101 ASP A C     1 
ATOM   8159  O  O     . ASP A 1 1101 ? -17.599 -6.243  -63.253 1.00 57.16  ? 1101 ASP A O     1 
ATOM   8160  C  CB    . ASP A 1 1101 ? -17.543 -7.012  -60.010 1.00 55.50  ? 1101 ASP A CB    1 
ATOM   8161  C  CG    . ASP A 1 1101 ? -16.100 -7.135  -60.428 1.00 56.40  ? 1101 ASP A CG    1 
ATOM   8162  O  OD1   . ASP A 1 1101 ? -15.394 -6.104  -60.447 1.00 58.38  ? 1101 ASP A OD1   1 
ATOM   8163  O  OD2   . ASP A 1 1101 ? -15.667 -8.270  -60.727 1.00 56.85  ? 1101 ASP A OD2   1 
ATOM   8164  N  N     . ALA A 1 1102 ? -19.110 -7.794  -62.682 1.00 55.08  ? 1102 ALA A N     1 
ATOM   8165  C  CA    . ALA A 1 1102 ? -19.190 -8.367  -64.038 1.00 55.10  ? 1102 ALA A CA    1 
ATOM   8166  C  C     . ALA A 1 1102 ? -19.763 -7.382  -65.044 1.00 55.64  ? 1102 ALA A C     1 
ATOM   8167  O  O     . ALA A 1 1102 ? -19.267 -7.275  -66.158 1.00 56.27  ? 1102 ALA A O     1 
ATOM   8168  C  CB    . ALA A 1 1102 ? -20.028 -9.632  -64.049 1.00 54.67  ? 1102 ALA A CB    1 
ATOM   8169  N  N     . CYS A 1 1103 ? -20.827 -6.691  -64.649 1.00 56.36  ? 1103 CYS A N     1 
ATOM   8170  C  CA    . CYS A 1 1103 ? -21.473 -5.694  -65.498 1.00 57.36  ? 1103 CYS A CA    1 
ATOM   8171  C  C     . CYS A 1 1103 ? -20.523 -4.589  -65.903 1.00 58.83  ? 1103 CYS A C     1 
ATOM   8172  O  O     . CYS A 1 1103 ? -20.498 -4.214  -67.063 1.00 59.68  ? 1103 CYS A O     1 
ATOM   8173  C  CB    . CYS A 1 1103 ? -22.689 -5.084  -64.799 1.00 57.67  ? 1103 CYS A CB    1 
ATOM   8174  S  SG    . CYS A 1 1103 ? -24.065 -6.233  -64.614 1.00 57.97  ? 1103 CYS A SG    1 
ATOM   8175  N  N     . GLN A 1 1104 ? -19.753 -4.071  -64.951 1.00 60.69  ? 1104 GLN A N     1 
ATOM   8176  C  CA    . GLN A 1 1104 ? -18.821 -2.972  -65.219 1.00 64.35  ? 1104 GLN A CA    1 
ATOM   8177  C  C     . GLN A 1 1104 ? -17.712 -3.388  -66.185 1.00 64.87  ? 1104 GLN A C     1 
ATOM   8178  O  O     . GLN A 1 1104 ? -17.418 -2.675  -67.151 1.00 67.58  ? 1104 GLN A O     1 
ATOM   8179  C  CB    . GLN A 1 1104 ? -18.203 -2.456  -63.923 1.00 66.30  ? 1104 GLN A CB    1 
ATOM   8180  C  CG    . GLN A 1 1104 ? -19.167 -1.657  -63.073 1.00 67.54  ? 1104 GLN A CG    1 
ATOM   8181  C  CD    . GLN A 1 1104 ? -18.571 -1.221  -61.748 1.00 70.29  ? 1104 GLN A CD    1 
ATOM   8182  O  OE1   . GLN A 1 1104 ? -19.117 -0.348  -61.072 1.00 73.06  ? 1104 GLN A OE1   1 
ATOM   8183  N  NE2   . GLN A 1 1104 ? -17.452 -1.825  -61.365 1.00 71.42  ? 1104 GLN A NE2   1 
ATOM   8184  N  N     . THR A 1 1105 ? -17.105 -4.538  -65.914 1.00 62.98  ? 1105 THR A N     1 
ATOM   8185  C  CA    . THR A 1 1105 ? -16.185 -5.174  -66.846 1.00 62.78  ? 1105 THR A CA    1 
ATOM   8186  C  C     . THR A 1 1105 ? -16.767 -5.218  -68.252 1.00 63.51  ? 1105 THR A C     1 
ATOM   8187  O  O     . THR A 1 1105 ? -16.102 -4.817  -69.200 1.00 66.16  ? 1105 THR A O     1 
ATOM   8188  C  CB    . THR A 1 1105 ? -15.861 -6.611  -66.401 1.00 61.30  ? 1105 THR A CB    1 
ATOM   8189  O  OG1   . THR A 1 1105 ? -15.247 -6.571  -65.113 1.00 61.82  ? 1105 THR A OG1   1 
ATOM   8190  C  CG2   . THR A 1 1105 ? -14.934 -7.317  -67.387 1.00 60.98  ? 1105 THR A CG2   1 
ATOM   8191  N  N     . LEU A 1 1106 ? -18.000 -5.707  -68.375 1.00 63.04  ? 1106 LEU A N     1 
ATOM   8192  C  CA    . LEU A 1 1106 ? -18.662 -5.801  -69.674 1.00 63.47  ? 1106 LEU A CA    1 
ATOM   8193  C  C     . LEU A 1 1106 ? -18.870 -4.433  -70.303 1.00 65.93  ? 1106 LEU A C     1 
ATOM   8194  O  O     . LEU A 1 1106 ? -18.662 -4.272  -71.504 1.00 68.30  ? 1106 LEU A O     1 
ATOM   8195  C  CB    . LEU A 1 1106 ? -19.997 -6.546  -69.581 1.00 61.71  ? 1106 LEU A CB    1 
ATOM   8196  C  CG    . LEU A 1 1106 ? -19.897 -8.071  -69.524 1.00 60.58  ? 1106 LEU A CG    1 
ATOM   8197  C  CD1   . LEU A 1 1106 ? -21.243 -8.687  -69.181 1.00 59.69  ? 1106 LEU A CD1   1 
ATOM   8198  C  CD2   . LEU A 1 1106 ? -19.365 -8.655  -70.824 1.00 60.64  ? 1106 LEU A CD2   1 
ATOM   8199  N  N     . LEU A 1 1107 ? -19.259 -3.451  -69.495 1.00 67.25  ? 1107 LEU A N     1 
ATOM   8200  C  CA    . LEU A 1 1107 ? -19.474 -2.100  -69.997 1.00 68.40  ? 1107 LEU A CA    1 
ATOM   8201  C  C     . LEU A 1 1107 ? -18.167 -1.446  -70.427 1.00 70.98  ? 1107 LEU A C     1 
ATOM   8202  O  O     . LEU A 1 1107 ? -18.172 -0.723  -71.412 1.00 73.37  ? 1107 LEU A O     1 
ATOM   8203  C  CB    . LEU A 1 1107 ? -20.203 -1.231  -68.971 1.00 68.26  ? 1107 LEU A CB    1 
ATOM   8204  C  CG    . LEU A 1 1107 ? -21.031 -0.084  -69.569 1.00 69.92  ? 1107 LEU A CG    1 
ATOM   8205  C  CD1   . LEU A 1 1107 ? -22.167 -0.604  -70.450 1.00 69.56  ? 1107 LEU A CD1   1 
ATOM   8206  C  CD2   . LEU A 1 1107 ? -21.585 0.812   -68.468 1.00 69.91  ? 1107 LEU A CD2   1 
ATOM   8207  N  N     . LYS A 1 1108 ? -17.061 -1.699  -69.714 1.00 72.78  ? 1108 LYS A N     1 
ATOM   8208  C  CA    . LYS A 1 1108 ? -15.733 -1.170  -70.116 1.00 75.89  ? 1108 LYS A CA    1 
ATOM   8209  C  C     . LYS A 1 1108 ? -15.310 -1.658  -71.495 1.00 74.73  ? 1108 LYS A C     1 
ATOM   8210  O  O     . LYS A 1 1108 ? -14.850 -0.867  -72.315 1.00 75.83  ? 1108 LYS A O     1 
ATOM   8211  C  CB    . LYS A 1 1108 ? -14.619 -1.517  -69.109 1.00 78.69  ? 1108 LYS A CB    1 
ATOM   8212  C  CG    . LYS A 1 1108 ? -14.321 -0.428  -68.085 1.00 82.98  ? 1108 LYS A CG    1 
ATOM   8213  C  CD    . LYS A 1 1108 ? -15.383 -0.384  -66.993 1.00 85.63  ? 1108 LYS A CD    1 
ATOM   8214  C  CE    . LYS A 1 1108 ? -15.154 0.732   -65.981 1.00 88.23  ? 1108 LYS A CE    1 
ATOM   8215  N  NZ    . LYS A 1 1108 ? -16.016 0.526   -64.780 1.00 89.00  ? 1108 LYS A NZ    1 
ATOM   8216  N  N     . ARG A 1 1109 ? -15.470 -2.958  -71.733 1.00 73.06  ? 1109 ARG A N     1 
ATOM   8217  C  CA    . ARG A 1 1109 ? -15.169 -3.577  -73.031 1.00 72.32  ? 1109 ARG A CA    1 
ATOM   8218  C  C     . ARG A 1 1109 ? -15.963 -2.969  -74.166 1.00 73.47  ? 1109 ARG A C     1 
ATOM   8219  O  O     . ARG A 1 1109 ? -15.446 -2.812  -75.264 1.00 74.56  ? 1109 ARG A O     1 
ATOM   8220  C  CB    . ARG A 1 1109 ? -15.477 -5.067  -73.006 1.00 70.61  ? 1109 ARG A CB    1 
ATOM   8221  C  CG    . ARG A 1 1109 ? -14.564 -5.889  -72.124 1.00 70.23  ? 1109 ARG A CG    1 
ATOM   8222  C  CD    . ARG A 1 1109 ? -14.958 -7.349  -72.213 1.00 69.48  ? 1109 ARG A CD    1 
ATOM   8223  N  NE    . ARG A 1 1109 ? -14.466 -8.122  -71.076 1.00 69.14  ? 1109 ARG A NE    1 
ATOM   8224  C  CZ    . ARG A 1 1109 ? -14.829 -9.373  -70.798 1.00 69.27  ? 1109 ARG A CZ    1 
ATOM   8225  N  NH1   . ARG A 1 1109 ? -15.694 -10.026 -71.576 1.00 68.85  ? 1109 ARG A NH1   1 
ATOM   8226  N  NH2   . ARG A 1 1109 ? -14.328 -9.981  -69.725 1.00 69.58  ? 1109 ARG A NH2   1 
ATOM   8227  N  N     . LEU A 1 1110 ? -17.218 -2.638  -73.884 1.00 74.81  ? 1110 LEU A N     1 
ATOM   8228  C  CA    . LEU A 1 1110 ? -18.147 -2.101  -74.876 1.00 77.72  ? 1110 LEU A CA    1 
ATOM   8229  C  C     . LEU A 1 1110 ? -18.118 -0.588  -75.077 1.00 82.01  ? 1110 LEU A C     1 
ATOM   8230  O  O     . LEU A 1 1110 ? -18.692 -0.106  -76.055 1.00 85.38  ? 1110 LEU A O     1 
ATOM   8231  C  CB    . LEU A 1 1110 ? -19.581 -2.499  -74.504 1.00 76.22  ? 1110 LEU A CB    1 
ATOM   8232  C  CG    . LEU A 1 1110 ? -19.899 -3.980  -74.670 1.00 73.87  ? 1110 LEU A CG    1 
ATOM   8233  C  CD1   . LEU A 1 1110 ? -21.110 -4.324  -73.829 1.00 72.76  ? 1110 LEU A CD1   1 
ATOM   8234  C  CD2   . LEU A 1 1110 ? -20.131 -4.325  -76.136 1.00 73.93  ? 1110 LEU A CD2   1 
ATOM   8235  N  N     . GLU A 1 1111 ? -17.483 0.162   -74.176 1.00 85.36  ? 1111 GLU A N     1 
ATOM   8236  C  CA    . GLU A 1 1111 ? -17.546 1.636   -74.239 1.00 89.24  ? 1111 GLU A CA    1 
ATOM   8237  C  C     . GLU A 1 1111 ? -17.090 2.243   -75.575 1.00 88.30  ? 1111 GLU A C     1 
ATOM   8238  O  O     . GLU A 1 1111 ? -17.712 3.202   -76.035 1.00 90.11  ? 1111 GLU A O     1 
ATOM   8239  C  CB    . GLU A 1 1111 ? -16.857 2.303   -73.028 1.00 93.39  ? 1111 GLU A CB    1 
ATOM   8240  C  CG    . GLU A 1 1111 ? -17.844 2.594   -71.886 1.00 97.53  ? 1111 GLU A CG    1 
ATOM   8241  C  CD    . GLU A 1 1111 ? -17.230 2.613   -70.486 1.00 101.67 ? 1111 GLU A CD    1 
ATOM   8242  O  OE1   . GLU A 1 1111 ? -16.006 2.869   -70.350 1.00 106.56 ? 1111 GLU A OE1   1 
ATOM   8243  O  OE2   . GLU A 1 1111 ? -17.988 2.381   -69.508 1.00 99.83  ? 1111 GLU A OE2   1 
ATOM   8244  N  N     . PRO A 1 1112 ? -16.039 1.680   -76.212 1.00 86.07  ? 1112 PRO A N     1 
ATOM   8245  C  CA    . PRO A 1 1112 ? -15.723 2.069   -77.590 1.00 86.25  ? 1112 PRO A CA    1 
ATOM   8246  C  C     . PRO A 1 1112 ? -16.901 1.933   -78.556 1.00 85.83  ? 1112 PRO A C     1 
ATOM   8247  O  O     . PRO A 1 1112 ? -17.161 2.861   -79.329 1.00 89.04  ? 1112 PRO A O     1 
ATOM   8248  C  CB    . PRO A 1 1112 ? -14.592 1.113   -77.967 1.00 85.57  ? 1112 PRO A CB    1 
ATOM   8249  C  CG    . PRO A 1 1112 ? -13.872 0.919   -76.683 1.00 85.67  ? 1112 PRO A CG    1 
ATOM   8250  C  CD    . PRO A 1 1112 ? -14.948 0.879   -75.626 1.00 85.48  ? 1112 PRO A CD    1 
ATOM   8251  N  N     . ILE A 1 1113 ? -17.605 0.801   -78.490 1.00 81.85  ? 1113 ILE A N     1 
ATOM   8252  C  CA    . ILE A 1 1113 ? -18.777 0.535   -79.341 1.00 79.89  ? 1113 ILE A CA    1 
ATOM   8253  C  C     . ILE A 1 1113 ? -19.969 1.438   -78.984 1.00 81.09  ? 1113 ILE A C     1 
ATOM   8254  O  O     . ILE A 1 1113 ? -20.712 1.879   -79.872 1.00 79.38  ? 1113 ILE A O     1 
ATOM   8255  C  CB    . ILE A 1 1113 ? -19.147 -0.976  -79.304 1.00 77.36  ? 1113 ILE A CB    1 
ATOM   8256  C  CG1   . ILE A 1 1113 ? -18.130 -1.769  -80.140 1.00 76.51  ? 1113 ILE A CG1   1 
ATOM   8257  C  CG2   . ILE A 1 1113 ? -20.563 -1.245  -79.814 1.00 76.45  ? 1113 ILE A CG2   1 
ATOM   8258  C  CD1   . ILE A 1 1113 ? -17.999 -3.225  -79.765 1.00 74.35  ? 1113 ILE A CD1   1 
ATOM   8259  N  N     . ILE A 1 1114 ? -20.134 1.723   -77.695 1.00 82.93  ? 1114 ILE A N     1 
ATOM   8260  C  CA    . ILE A 1 1114 ? -21.244 2.552   -77.217 1.00 85.14  ? 1114 ILE A CA    1 
ATOM   8261  C  C     . ILE A 1 1114 ? -21.061 4.031   -77.594 1.00 87.46  ? 1114 ILE A C     1 
ATOM   8262  O  O     . ILE A 1 1114 ? -22.012 4.675   -78.035 1.00 87.62  ? 1114 ILE A O     1 
ATOM   8263  C  CB    . ILE A 1 1114 ? -21.452 2.387   -75.696 1.00 85.55  ? 1114 ILE A CB    1 
ATOM   8264  C  CG1   . ILE A 1 1114 ? -21.870 0.940   -75.383 1.00 85.46  ? 1114 ILE A CG1   1 
ATOM   8265  C  CG2   . ILE A 1 1114 ? -22.520 3.344   -75.180 1.00 86.08  ? 1114 ILE A CG2   1 
ATOM   8266  C  CD1   . ILE A 1 1114 ? -21.796 0.564   -73.917 1.00 85.12  ? 1114 ILE A CD1   1 
ATOM   8267  N  N     . SER A 1 1115 ? -19.850 4.563   -77.431 1.00 88.67  ? 1115 SER A N     1 
ATOM   8268  C  CA    . SER A 1 1115 ? -19.553 5.954   -77.826 1.00 90.54  ? 1115 SER A CA    1 
ATOM   8269  C  C     . SER A 1 1115 ? -19.698 6.202   -79.342 1.00 90.46  ? 1115 SER A C     1 
ATOM   8270  O  O     . SER A 1 1115 ? -20.108 7.280   -79.767 1.00 91.69  ? 1115 SER A O     1 
ATOM   8271  C  CB    . SER A 1 1115 ? -18.148 6.358   -77.360 1.00 92.00  ? 1115 SER A CB    1 
ATOM   8272  O  OG    . SER A 1 1115 ? -17.149 5.525   -77.932 1.00 93.11  ? 1115 SER A OG    1 
ATOM   8273  N  N     . LYS A 1 1116 ? -19.389 5.183   -80.139 1.00 89.16  ? 1116 LYS A N     1 
ATOM   8274  C  CA    . LYS A 1 1116 ? -19.444 5.268   -81.605 1.00 89.18  ? 1116 LYS A CA    1 
ATOM   8275  C  C     . LYS A 1 1116 ? -20.869 5.138   -82.177 1.00 87.35  ? 1116 LYS A C     1 
ATOM   8276  O  O     . LYS A 1 1116 ? -21.069 5.350   -83.367 1.00 87.61  ? 1116 LYS A O     1 
ATOM   8277  C  CB    . LYS A 1 1116 ? -18.545 4.174   -82.195 1.00 89.19  ? 1116 LYS A CB    1 
ATOM   8278  C  CG    . LYS A 1 1116 ? -17.981 4.471   -83.564 1.00 92.10  ? 1116 LYS A CG    1 
ATOM   8279  C  CD    . LYS A 1 1116 ? -17.001 3.385   -83.980 1.00 92.08  ? 1116 LYS A CD    1 
ATOM   8280  C  CE    . LYS A 1 1116 ? -16.297 3.735   -85.283 1.00 93.81  ? 1116 LYS A CE    1 
ATOM   8281  N  NZ    . LYS A 1 1116 ? -15.442 2.606   -85.745 1.00 92.85  ? 1116 LYS A NZ    1 
ATOM   8282  N  N     . ASN A 1 1117 ? -21.835 4.769   -81.331 1.00 85.65  ? 1117 ASN A N     1 
ATOM   8283  C  CA    . ASN A 1 1117 ? -23.232 4.543   -81.722 1.00 84.04  ? 1117 ASN A CA    1 
ATOM   8284  C  C     . ASN A 1 1117 ? -24.098 4.644   -80.457 1.00 82.96  ? 1117 ASN A C     1 
ATOM   8285  O  O     . ASN A 1 1117 ? -24.644 3.646   -79.987 1.00 81.44  ? 1117 ASN A O     1 
ATOM   8286  C  CB    . ASN A 1 1117 ? -23.368 3.162   -82.387 1.00 82.39  ? 1117 ASN A CB    1 
ATOM   8287  C  CG    . ASN A 1 1117 ? -24.807 2.790   -82.722 1.00 81.20  ? 1117 ASN A CG    1 
ATOM   8288  O  OD1   . ASN A 1 1117 ? -25.687 3.647   -82.824 1.00 81.24  ? 1117 ASN A OD1   1 
ATOM   8289  N  ND2   . ASN A 1 1117 ? -25.050 1.492   -82.882 1.00 79.96  ? 1117 ASN A ND2   1 
ATOM   8290  N  N     . PRO A 1 1118 ? -24.205 5.856   -79.888 1.00 83.52  ? 1118 PRO A N     1 
ATOM   8291  C  CA    . PRO A 1 1118 ? -24.827 6.034   -78.571 1.00 82.42  ? 1118 PRO A CA    1 
ATOM   8292  C  C     . PRO A 1 1118 ? -26.333 5.782   -78.529 1.00 81.58  ? 1118 PRO A C     1 
ATOM   8293  O  O     . PRO A 1 1118 ? -26.863 5.466   -77.463 1.00 79.24  ? 1118 PRO A O     1 
ATOM   8294  C  CB    . PRO A 1 1118 ? -24.508 7.493   -78.235 1.00 84.02  ? 1118 PRO A CB    1 
ATOM   8295  C  CG    . PRO A 1 1118 ? -24.395 8.160   -79.556 1.00 85.27  ? 1118 PRO A CG    1 
ATOM   8296  C  CD    . PRO A 1 1118 ? -23.794 7.144   -80.478 1.00 84.88  ? 1118 PRO A CD    1 
ATOM   8297  N  N     . LYS A 1 1119 ? -27.003 5.905   -79.673 1.00 82.83  ? 1119 LYS A N     1 
ATOM   8298  C  CA    . LYS A 1 1119 ? -28.446 5.681   -79.758 1.00 83.46  ? 1119 LYS A CA    1 
ATOM   8299  C  C     . LYS A 1 1119 ? -28.812 4.290   -80.293 1.00 81.16  ? 1119 LYS A C     1 
ATOM   8300  O  O     . LYS A 1 1119 ? -29.935 4.078   -80.746 1.00 81.14  ? 1119 LYS A O     1 
ATOM   8301  C  CB    . LYS A 1 1119 ? -29.082 6.788   -80.614 1.00 85.96  ? 1119 LYS A CB    1 
ATOM   8302  C  CG    . LYS A 1 1119 ? -28.892 8.190   -80.050 1.00 88.60  ? 1119 LYS A CG    1 
ATOM   8303  C  CD    . LYS A 1 1119 ? -29.601 8.363   -78.707 1.00 89.32  ? 1119 LYS A CD    1 
ATOM   8304  C  CE    . LYS A 1 1119 ? -29.536 9.800   -78.212 1.00 91.68  ? 1119 LYS A CE    1 
ATOM   8305  N  NZ    . LYS A 1 1119 ? -28.177 10.153  -77.712 1.00 92.75  ? 1119 LYS A NZ    1 
ATOM   8306  N  N     . GLY A 1 1120 ? -27.881 3.340   -80.212 1.00 79.56  ? 1120 GLY A N     1 
ATOM   8307  C  CA    . GLY A 1 1120 ? -28.114 1.973   -80.681 1.00 78.24  ? 1120 GLY A CA    1 
ATOM   8308  C  C     . GLY A 1 1120 ? -28.691 1.084   -79.596 1.00 75.71  ? 1120 GLY A C     1 
ATOM   8309  O  O     . GLY A 1 1120 ? -28.481 1.323   -78.404 1.00 76.54  ? 1120 GLY A O     1 
ATOM   8310  N  N     . THR A 1 1121 ? -29.409 0.047   -80.012 1.00 72.79  ? 1121 THR A N     1 
ATOM   8311  C  CA    . THR A 1 1121 ? -29.960 -0.940  -79.083 1.00 69.96  ? 1121 THR A CA    1 
ATOM   8312  C  C     . THR A 1 1121 ? -28.851 -1.854  -78.543 1.00 68.12  ? 1121 THR A C     1 
ATOM   8313  O  O     . THR A 1 1121 ? -27.753 -1.897  -79.087 1.00 68.87  ? 1121 THR A O     1 
ATOM   8314  C  CB    . THR A 1 1121 ? -31.032 -1.808  -79.773 1.00 69.53  ? 1121 THR A CB    1 
ATOM   8315  O  OG1   . THR A 1 1121 ? -30.459 -2.500  -80.893 1.00 69.76  ? 1121 THR A OG1   1 
ATOM   8316  C  CG2   . THR A 1 1121 ? -32.194 -0.952  -80.259 1.00 70.36  ? 1121 THR A CG2   1 
ATOM   8317  N  N     . TRP A 1 1122 ? -29.141 -2.584  -77.475 1.00 66.51  ? 1122 TRP A N     1 
ATOM   8318  C  CA    . TRP A 1 1122 ? -28.224 -3.627  -76.985 1.00 65.61  ? 1122 TRP A CA    1 
ATOM   8319  C  C     . TRP A 1 1122 ? -27.981 -4.758  -78.004 1.00 65.34  ? 1122 TRP A C     1 
ATOM   8320  O  O     . TRP A 1 1122 ? -26.886 -5.332  -78.050 1.00 64.39  ? 1122 TRP A O     1 
ATOM   8321  C  CB    . TRP A 1 1122 ? -28.691 -4.195  -75.630 1.00 64.66  ? 1122 TRP A CB    1 
ATOM   8322  C  CG    . TRP A 1 1122 ? -28.083 -3.456  -74.486 1.00 64.85  ? 1122 TRP A CG    1 
ATOM   8323  C  CD1   . TRP A 1 1122 ? -28.664 -2.488  -73.718 1.00 65.07  ? 1122 TRP A CD1   1 
ATOM   8324  C  CD2   . TRP A 1 1122 ? -26.747 -3.603  -74.011 1.00 64.84  ? 1122 TRP A CD2   1 
ATOM   8325  N  NE1   . TRP A 1 1122 ? -27.767 -2.032  -72.779 1.00 65.46  ? 1122 TRP A NE1   1 
ATOM   8326  C  CE2   . TRP A 1 1122 ? -26.578 -2.696  -72.940 1.00 65.01  ? 1122 TRP A CE2   1 
ATOM   8327  C  CE3   . TRP A 1 1122 ? -25.668 -4.414  -74.391 1.00 65.17  ? 1122 TRP A CE3   1 
ATOM   8328  C  CZ2   . TRP A 1 1122 ? -25.370 -2.587  -72.230 1.00 65.00  ? 1122 TRP A CZ2   1 
ATOM   8329  C  CZ3   . TRP A 1 1122 ? -24.470 -4.308  -73.693 1.00 65.28  ? 1122 TRP A CZ3   1 
ATOM   8330  C  CH2   . TRP A 1 1122 ? -24.329 -3.398  -72.622 1.00 65.49  ? 1122 TRP A CH2   1 
ATOM   8331  N  N     . LYS A 1 1123 ? -28.991 -5.059  -78.821 1.00 65.69  ? 1123 LYS A N     1 
ATOM   8332  C  CA    . LYS A 1 1123 ? -28.835 -5.992  -79.939 1.00 65.21  ? 1123 LYS A CA    1 
ATOM   8333  C  C     . LYS A 1 1123 ? -27.772 -5.535  -80.937 1.00 66.39  ? 1123 LYS A C     1 
ATOM   8334  O  O     . LYS A 1 1123 ? -27.041 -6.366  -81.470 1.00 67.12  ? 1123 LYS A O     1 
ATOM   8335  C  CB    . LYS A 1 1123 ? -30.163 -6.208  -80.670 1.00 65.24  ? 1123 LYS A CB    1 
ATOM   8336  C  CG    . LYS A 1 1123 ? -30.040 -7.139  -81.859 1.00 65.70  ? 1123 LYS A CG    1 
ATOM   8337  C  CD    . LYS A 1 1123 ? -31.373 -7.555  -82.429 1.00 66.96  ? 1123 LYS A CD    1 
ATOM   8338  C  CE    . LYS A 1 1123 ? -31.153 -8.399  -83.679 1.00 69.09  ? 1123 LYS A CE    1 
ATOM   8339  N  NZ    . LYS A 1 1123 ? -32.358 -9.191  -84.063 1.00 70.59  ? 1123 LYS A NZ    1 
ATOM   8340  N  N     . ASP A 1 1124 ? -27.699 -4.233  -81.202 1.00 67.42  ? 1124 ASP A N     1 
ATOM   8341  C  CA    . ASP A 1 1124 ? -26.700 -3.694  -82.137 1.00 68.68  ? 1124 ASP A CA    1 
ATOM   8342  C  C     . ASP A 1 1124 ? -25.312 -3.700  -81.544 1.00 66.47  ? 1124 ASP A C     1 
ATOM   8343  O  O     . ASP A 1 1124 ? -24.346 -4.041  -82.232 1.00 66.70  ? 1124 ASP A O     1 
ATOM   8344  C  CB    . ASP A 1 1124 ? -27.050 -2.269  -82.542 1.00 72.12  ? 1124 ASP A CB    1 
ATOM   8345  C  CG    . ASP A 1 1124 ? -28.410 -2.169  -83.185 1.00 74.64  ? 1124 ASP A CG    1 
ATOM   8346  O  OD1   . ASP A 1 1124 ? -28.759 -3.101  -83.957 1.00 75.24  ? 1124 ASP A OD1   1 
ATOM   8347  O  OD2   . ASP A 1 1124 ? -29.125 -1.167  -82.904 1.00 76.10  ? 1124 ASP A OD2   1 
ATOM   8348  N  N     . TRP A 1 1125 ? -25.226 -3.304  -80.275 1.00 64.83  ? 1125 TRP A N     1 
ATOM   8349  C  CA    . TRP A 1 1125 ? -23.963 -3.268  -79.540 1.00 64.90  ? 1125 TRP A CA    1 
ATOM   8350  C  C     . TRP A 1 1125 ? -23.374 -4.661  -79.365 1.00 63.10  ? 1125 TRP A C     1 
ATOM   8351  O  O     . TRP A 1 1125 ? -22.176 -4.855  -79.572 1.00 62.08  ? 1125 TRP A O     1 
ATOM   8352  C  CB    . TRP A 1 1125 ? -24.142 -2.605  -78.170 1.00 65.53  ? 1125 TRP A CB    1 
ATOM   8353  C  CG    . TRP A 1 1125 ? -24.512 -1.132  -78.224 1.00 68.27  ? 1125 TRP A CG    1 
ATOM   8354  C  CD1   . TRP A 1 1125 ? -24.285 -0.256  -79.254 1.00 69.67  ? 1125 TRP A CD1   1 
ATOM   8355  C  CD2   . TRP A 1 1125 ? -25.147 -0.371  -77.190 1.00 69.03  ? 1125 TRP A CD2   1 
ATOM   8356  N  NE1   . TRP A 1 1125 ? -24.750 0.990   -78.925 1.00 70.87  ? 1125 TRP A NE1   1 
ATOM   8357  C  CE2   . TRP A 1 1125 ? -25.279 0.952   -77.664 1.00 70.21  ? 1125 TRP A CE2   1 
ATOM   8358  C  CE3   . TRP A 1 1125 ? -25.618 -0.680  -75.907 1.00 68.85  ? 1125 TRP A CE3   1 
ATOM   8359  C  CZ2   . TRP A 1 1125 ? -25.858 1.970   -76.900 1.00 71.08  ? 1125 TRP A CZ2   1 
ATOM   8360  C  CZ3   . TRP A 1 1125 ? -26.200 0.336   -75.146 1.00 69.90  ? 1125 TRP A CZ3   1 
ATOM   8361  C  CH2   . TRP A 1 1125 ? -26.311 1.647   -75.648 1.00 70.25  ? 1125 TRP A CH2   1 
ATOM   8362  N  N     . ALA A 1 1126 ? -24.224 -5.616  -78.991 1.00 61.36  ? 1126 ALA A N     1 
ATOM   8363  C  CA    . ALA A 1 1126 ? -23.826 -7.018  -78.875 1.00 60.11  ? 1126 ALA A CA    1 
ATOM   8364  C  C     . ALA A 1 1126 ? -23.344 -7.583  -80.205 1.00 60.85  ? 1126 ALA A C     1 
ATOM   8365  O  O     . ALA A 1 1126 ? -22.338 -8.289  -80.248 1.00 61.37  ? 1126 ALA A O     1 
ATOM   8366  C  CB    . ALA A 1 1126 ? -24.974 -7.863  -78.340 1.00 58.50  ? 1126 ALA A CB    1 
ATOM   8367  N  N     . GLN A 1 1127 ? -24.050 -7.263  -81.286 1.00 61.79  ? 1127 GLN A N     1 
ATOM   8368  C  CA    . GLN A 1 1127 ? -23.716 -7.801  -82.599 1.00 62.67  ? 1127 GLN A CA    1 
ATOM   8369  C  C     . GLN A 1 1127 ? -22.394 -7.253  -83.102 1.00 63.53  ? 1127 GLN A C     1 
ATOM   8370  O  O     . GLN A 1 1127 ? -21.552 -8.031  -83.528 1.00 64.47  ? 1127 GLN A O     1 
ATOM   8371  C  CB    . GLN A 1 1127 ? -24.832 -7.543  -83.625 1.00 64.22  ? 1127 GLN A CB    1 
ATOM   8372  C  CG    . GLN A 1 1127 ? -24.698 -8.328  -84.926 1.00 65.32  ? 1127 GLN A CG    1 
ATOM   8373  C  CD    . GLN A 1 1127 ? -24.605 -9.827  -84.699 1.00 65.94  ? 1127 GLN A CD    1 
ATOM   8374  O  OE1   . GLN A 1 1127 ? -25.240 -10.373 -83.795 1.00 66.45  ? 1127 GLN A OE1   1 
ATOM   8375  N  NE2   . GLN A 1 1127 ? -23.792 -10.496 -85.499 1.00 67.18  ? 1127 GLN A NE2   1 
ATOM   8376  N  N     . THR A 1 1128 ? -22.196 -5.935  -83.042 1.00 64.25  ? 1128 THR A N     1 
ATOM   8377  C  CA    . THR A 1 1128 ? -20.923 -5.352  -83.488 1.00 65.65  ? 1128 THR A CA    1 
ATOM   8378  C  C     . THR A 1 1128 ? -19.754 -5.781  -82.595 1.00 63.96  ? 1128 THR A C     1 
ATOM   8379  O  O     . THR A 1 1128 ? -18.645 -5.938  -83.092 1.00 64.20  ? 1128 THR A O     1 
ATOM   8380  C  CB    . THR A 1 1128 ? -20.968 -3.813  -83.620 1.00 68.15  ? 1128 THR A CB    1 
ATOM   8381  O  OG1   . THR A 1 1128 ? -21.495 -3.234  -82.425 1.00 68.84  ? 1128 THR A OG1   1 
ATOM   8382  C  CG2   . THR A 1 1128 ? -21.846 -3.405  -84.794 1.00 69.93  ? 1128 THR A CG2   1 
ATOM   8383  N  N     . ALA A 1 1129 ? -20.005 -5.993  -81.300 1.00 62.03  ? 1129 ALA A N     1 
ATOM   8384  C  CA    . ALA A 1 1129 ? -18.995 -6.567  -80.391 1.00 60.82  ? 1129 ALA A CA    1 
ATOM   8385  C  C     . ALA A 1 1129 ? -18.543 -7.952  -80.845 1.00 59.84  ? 1129 ALA A C     1 
ATOM   8386  O  O     . ALA A 1 1129 ? -17.345 -8.239  -80.886 1.00 59.35  ? 1129 ALA A O     1 
ATOM   8387  C  CB    . ALA A 1 1129 ? -19.512 -6.629  -78.963 1.00 59.56  ? 1129 ALA A CB    1 
ATOM   8388  N  N     . PHE A 1 1130 ? -19.500 -8.795  -81.210 1.00 59.61  ? 1130 PHE A N     1 
ATOM   8389  C  CA    . PHE A 1 1130 ? -19.175 -10.096 -81.786 1.00 60.10  ? 1130 PHE A CA    1 
ATOM   8390  C  C     . PHE A 1 1130 ? -18.387 -9.918  -83.081 1.00 62.41  ? 1130 PHE A C     1 
ATOM   8391  O  O     . PHE A 1 1130 ? -17.365 -10.573 -83.266 1.00 63.94  ? 1130 PHE A O     1 
ATOM   8392  C  CB    . PHE A 1 1130 ? -20.431 -10.942 -82.038 1.00 58.69  ? 1130 PHE A CB    1 
ATOM   8393  C  CG    . PHE A 1 1130 ? -20.139 -12.303 -82.625 1.00 57.58  ? 1130 PHE A CG    1 
ATOM   8394  C  CD1   . PHE A 1 1130 ? -19.898 -13.397 -81.800 1.00 56.58  ? 1130 PHE A CD1   1 
ATOM   8395  C  CD2   . PHE A 1 1130 ? -20.108 -12.491 -84.004 1.00 57.70  ? 1130 PHE A CD2   1 
ATOM   8396  C  CE1   . PHE A 1 1130 ? -19.632 -14.648 -82.343 1.00 56.08  ? 1130 PHE A CE1   1 
ATOM   8397  C  CE2   . PHE A 1 1130 ? -19.836 -13.734 -84.548 1.00 57.32  ? 1130 PHE A CE2   1 
ATOM   8398  C  CZ    . PHE A 1 1130 ? -19.599 -14.814 -83.720 1.00 56.55  ? 1130 PHE A CZ    1 
ATOM   8399  N  N     . ASP A 1 1131 ? -18.844 -9.021  -83.953 1.00 64.22  ? 1131 ASP A N     1 
ATOM   8400  C  CA    . ASP A 1 1131 ? -18.185 -8.789  -85.246 1.00 66.38  ? 1131 ASP A CA    1 
ATOM   8401  C  C     . ASP A 1 1131 ? -16.756 -8.250  -85.094 1.00 66.70  ? 1131 ASP A C     1 
ATOM   8402  O  O     . ASP A 1 1131 ? -15.946 -8.411  -86.001 1.00 67.15  ? 1131 ASP A O     1 
ATOM   8403  C  CB    . ASP A 1 1131 ? -18.997 -7.816  -86.128 1.00 69.30  ? 1131 ASP A CB    1 
ATOM   8404  C  CG    . ASP A 1 1131 ? -20.446 -8.279  -86.382 1.00 69.90  ? 1131 ASP A CG    1 
ATOM   8405  O  OD1   . ASP A 1 1131 ? -20.785 -9.443  -86.063 1.00 68.93  ? 1131 ASP A OD1   1 
ATOM   8406  O  OD2   . ASP A 1 1131 ? -21.252 -7.457  -86.892 1.00 72.06  ? 1131 ASP A OD2   1 
ATOM   8407  N  N     . GLU A 1 1132 ? -16.464 -7.605  -83.962 1.00 66.83  ? 1132 GLU A N     1 
ATOM   8408  C  CA    . GLU A 1 1132 ? -15.129 -7.090  -83.652 1.00 68.26  ? 1132 GLU A CA    1 
ATOM   8409  C  C     . GLU A 1 1132 ? -14.355 -7.965  -82.668 1.00 66.79  ? 1132 GLU A C     1 
ATOM   8410  O  O     . GLU A 1 1132 ? -13.363 -7.518  -82.104 1.00 68.89  ? 1132 GLU A O     1 
ATOM   8411  C  CB    . GLU A 1 1132 ? -15.237 -5.661  -83.085 1.00 70.13  ? 1132 GLU A CB    1 
ATOM   8412  C  CG    . GLU A 1 1132 ? -15.770 -4.631  -84.076 1.00 72.76  ? 1132 GLU A CG    1 
ATOM   8413  C  CD    . GLU A 1 1132 ? -15.826 -3.215  -83.514 1.00 75.22  ? 1132 GLU A CD    1 
ATOM   8414  O  OE1   . GLU A 1 1132 ? -15.341 -2.985  -82.380 1.00 77.11  ? 1132 GLU A OE1   1 
ATOM   8415  O  OE2   . GLU A 1 1132 ? -16.353 -2.319  -84.212 1.00 76.79  ? 1132 GLU A OE2   1 
ATOM   8416  N  N     . SER A 1 1133 ? -14.787 -9.203  -82.459 1.00 64.91  ? 1133 SER A N     1 
ATOM   8417  C  CA    . SER A 1 1133 ? -14.115 -10.130 -81.536 1.00 63.41  ? 1133 SER A CA    1 
ATOM   8418  C  C     . SER A 1 1133 ? -13.893 -9.569  -80.123 1.00 61.92  ? 1133 SER A C     1 
ATOM   8419  O  O     . SER A 1 1133 ? -12.778 -9.578  -79.588 1.00 60.64  ? 1133 SER A O     1 
ATOM   8420  C  CB    . SER A 1 1133 ? -12.807 -10.643 -82.150 1.00 64.09  ? 1133 SER A CB    1 
ATOM   8421  O  OG    . SER A 1 1133 ? -13.092 -11.455 -83.270 1.00 64.41  ? 1133 SER A OG    1 
ATOM   8422  N  N     . ILE A 1 1134 ? -14.983 -9.066  -79.550 1.00 61.07  ? 1134 ILE A N     1 
ATOM   8423  C  CA    . ILE A 1 1134 ? -15.034 -8.658  -78.157 1.00 60.41  ? 1134 ILE A CA    1 
ATOM   8424  C  C     . ILE A 1 1134 ? -15.894 -9.678  -77.409 1.00 59.86  ? 1134 ILE A C     1 
ATOM   8425  O  O     . ILE A 1 1134 ? -16.997 -10.032 -77.829 1.00 59.96  ? 1134 ILE A O     1 
ATOM   8426  C  CB    . ILE A 1 1134 ? -15.563 -7.220  -78.012 1.00 61.26  ? 1134 ILE A CB    1 
ATOM   8427  C  CG1   . ILE A 1 1134 ? -14.473 -6.227  -78.471 1.00 62.97  ? 1134 ILE A CG1   1 
ATOM   8428  C  CG2   . ILE A 1 1134 ? -15.976 -6.924  -76.571 1.00 60.56  ? 1134 ILE A CG2   1 
ATOM   8429  C  CD1   . ILE A 1 1134 ? -14.979 -4.852  -78.854 1.00 63.39  ? 1134 ILE A CD1   1 
ATOM   8430  N  N     . ASN A 1 1135 ? -15.353 -10.154 -76.297 1.00 60.25  ? 1135 ASN A N     1 
ATOM   8431  C  CA    . ASN A 1 1135 ? -15.972 -11.183 -75.471 1.00 58.41  ? 1135 ASN A CA    1 
ATOM   8432  C  C     . ASN A 1 1135 ? -17.169 -10.590 -74.710 1.00 56.98  ? 1135 ASN A C     1 
ATOM   8433  O  O     . ASN A 1 1135 ? -17.039 -9.535  -74.086 1.00 55.46  ? 1135 ASN A O     1 
ATOM   8434  C  CB    . ASN A 1 1135 ? -14.892 -11.727 -74.523 1.00 58.47  ? 1135 ASN A CB    1 
ATOM   8435  C  CG    . ASN A 1 1135 ? -15.379 -12.819 -73.599 1.00 57.96  ? 1135 ASN A CG    1 
ATOM   8436  O  OD1   . ASN A 1 1135 ? -16.409 -13.452 -73.819 1.00 58.00  ? 1135 ASN A OD1   1 
ATOM   8437  N  ND2   . ASN A 1 1135 ? -14.623 -13.039 -72.537 1.00 58.64  ? 1135 ASN A ND2   1 
ATOM   8438  N  N     . LEU A 1 1136 ? -18.319 -11.276 -74.772 1.00 56.54  ? 1136 LEU A N     1 
ATOM   8439  C  CA    . LEU A 1 1136 ? -19.559 -10.843 -74.089 1.00 56.49  ? 1136 LEU A CA    1 
ATOM   8440  C  C     . LEU A 1 1136 ? -19.936 -11.712 -72.877 1.00 55.87  ? 1136 LEU A C     1 
ATOM   8441  O  O     . LEU A 1 1136 ? -21.095 -11.750 -72.466 1.00 56.86  ? 1136 LEU A O     1 
ATOM   8442  C  CB    . LEU A 1 1136 ? -20.719 -10.819 -75.082 1.00 56.04  ? 1136 LEU A CB    1 
ATOM   8443  C  CG    . LEU A 1 1136 ? -20.579 -9.836  -76.239 1.00 57.32  ? 1136 LEU A CG    1 
ATOM   8444  C  CD1   . LEU A 1 1136 ? -21.448 -10.300 -77.401 1.00 57.16  ? 1136 LEU A CD1   1 
ATOM   8445  C  CD2   . LEU A 1 1136 ? -20.904 -8.408  -75.795 1.00 57.70  ? 1136 LEU A CD2   1 
ATOM   8446  N  N     . SER A 1 1137 ? -18.957 -12.399 -72.301 1.00 55.50  ? 1137 SER A N     1 
ATOM   8447  C  CA    . SER A 1 1137 ? -19.155 -13.174 -71.083 1.00 54.40  ? 1137 SER A CA    1 
ATOM   8448  C  C     . SER A 1 1137 ? -18.147 -12.649 -70.065 1.00 54.44  ? 1137 SER A C     1 
ATOM   8449  O  O     . SER A 1 1137 ? -16.989 -12.411 -70.410 1.00 55.04  ? 1137 SER A O     1 
ATOM   8450  C  CB    . SER A 1 1137 ? -18.932 -14.663 -71.372 1.00 53.44  ? 1137 SER A CB    1 
ATOM   8451  O  OG    . SER A 1 1137 ? -19.255 -15.454 -70.250 1.00 51.78  ? 1137 SER A OG    1 
ATOM   8452  N  N     . ALA A 1 1138 ? -18.579 -12.454 -68.824 1.00 53.83  ? 1138 ALA A N     1 
ATOM   8453  C  CA    . ALA A 1 1138 ? -17.681 -11.978 -67.779 1.00 54.55  ? 1138 ALA A CA    1 
ATOM   8454  C  C     . ALA A 1 1138 ? -18.013 -12.583 -66.431 1.00 54.49  ? 1138 ALA A C     1 
ATOM   8455  O  O     . ALA A 1 1138 ? -19.176 -12.648 -66.034 1.00 55.33  ? 1138 ALA A O     1 
ATOM   8456  C  CB    . ALA A 1 1138 ? -17.730 -10.466 -67.689 1.00 55.62  ? 1138 ALA A CB    1 
ATOM   8457  N  N     . VAL A 1 1139 ? -16.974 -13.043 -65.745 1.00 55.06  ? 1139 VAL A N     1 
ATOM   8458  C  CA    . VAL A 1 1139 ? -17.055 -13.400 -64.337 1.00 54.87  ? 1139 VAL A CA    1 
ATOM   8459  C  C     . VAL A 1 1139 ? -17.006 -12.091 -63.546 1.00 55.58  ? 1139 VAL A C     1 
ATOM   8460  O  O     . VAL A 1 1139 ? -16.303 -11.157 -63.915 1.00 58.80  ? 1139 VAL A O     1 
ATOM   8461  C  CB    . VAL A 1 1139 ? -15.896 -14.338 -63.919 1.00 55.15  ? 1139 VAL A CB    1 
ATOM   8462  C  CG1   . VAL A 1 1139 ? -15.813 -14.495 -62.404 1.00 55.10  ? 1139 VAL A CG1   1 
ATOM   8463  C  CG2   . VAL A 1 1139 ? -16.044 -15.700 -64.593 1.00 54.09  ? 1139 VAL A CG2   1 
ATOM   8464  N  N     . GLY A 1 1140 ? -17.792 -12.031 -62.483 1.00 54.69  ? 1140 GLY A N     1 
ATOM   8465  C  CA    . GLY A 1 1140 ? -17.773 -10.928 -61.536 1.00 54.35  ? 1140 GLY A CA    1 
ATOM   8466  C  C     . GLY A 1 1140 ? -17.346 -11.523 -60.219 1.00 53.78  ? 1140 GLY A C     1 
ATOM   8467  O  O     . GLY A 1 1140 ? -17.617 -12.705 -59.951 1.00 51.94  ? 1140 GLY A O     1 
ATOM   8468  N  N     . TYR A 1 1141 ? -16.655 -10.718 -59.420 1.00 54.30  ? 1141 TYR A N     1 
ATOM   8469  C  CA    . TYR A 1 1141 ? -16.060 -11.178 -58.173 1.00 55.50  ? 1141 TYR A CA    1 
ATOM   8470  C  C     . TYR A 1 1141 ? -15.995 -10.065 -57.147 1.00 56.05  ? 1141 TYR A C     1 
ATOM   8471  O  O     . TYR A 1 1141 ? -15.572 -8.955  -57.456 1.00 56.61  ? 1141 TYR A O     1 
ATOM   8472  C  CB    . TYR A 1 1141 ? -14.648 -11.719 -58.425 1.00 56.42  ? 1141 TYR A CB    1 
ATOM   8473  C  CG    . TYR A 1 1141 ? -14.077 -12.485 -57.253 1.00 57.52  ? 1141 TYR A CG    1 
ATOM   8474  C  CD1   . TYR A 1 1141 ? -14.658 -13.686 -56.840 1.00 57.83  ? 1141 TYR A CD1   1 
ATOM   8475  C  CD2   . TYR A 1 1141 ? -12.960 -12.026 -56.558 1.00 58.72  ? 1141 TYR A CD2   1 
ATOM   8476  C  CE1   . TYR A 1 1141 ? -14.146 -14.412 -55.769 1.00 58.62  ? 1141 TYR A CE1   1 
ATOM   8477  C  CE2   . TYR A 1 1141 ? -12.439 -12.746 -55.483 1.00 59.96  ? 1141 TYR A CE2   1 
ATOM   8478  C  CZ    . TYR A 1 1141 ? -13.038 -13.942 -55.091 1.00 59.84  ? 1141 TYR A CZ    1 
ATOM   8479  O  OH    . TYR A 1 1141 ? -12.548 -14.679 -54.035 1.00 59.90  ? 1141 TYR A OH    1 
ATOM   8480  N  N     . PHE A 1 1142 ? -16.440 -10.370 -55.934 1.00 57.30  ? 1142 PHE A N     1 
ATOM   8481  C  CA    . PHE A 1 1142 ? -16.228 -9.503  -54.787 1.00 59.05  ? 1142 PHE A CA    1 
ATOM   8482  C  C     . PHE A 1 1142 ? -15.463 -10.285 -53.728 1.00 60.11  ? 1142 PHE A C     1 
ATOM   8483  O  O     . PHE A 1 1142 ? -15.848 -11.399 -53.374 1.00 59.20  ? 1142 PHE A O     1 
ATOM   8484  C  CB    . PHE A 1 1142 ? -17.541 -8.971  -54.210 1.00 58.81  ? 1142 PHE A CB    1 
ATOM   8485  C  CG    . PHE A 1 1142 ? -17.337 -8.074  -53.024 1.00 60.45  ? 1142 PHE A CG    1 
ATOM   8486  C  CD1   . PHE A 1 1142 ? -16.588 -6.899  -53.152 1.00 61.19  ? 1142 PHE A CD1   1 
ATOM   8487  C  CD2   . PHE A 1 1142 ? -17.846 -8.411  -51.769 1.00 60.72  ? 1142 PHE A CD2   1 
ATOM   8488  C  CE1   . PHE A 1 1142 ? -16.364 -6.072  -52.064 1.00 61.73  ? 1142 PHE A CE1   1 
ATOM   8489  C  CE2   . PHE A 1 1142 ? -17.624 -7.580  -50.674 1.00 61.53  ? 1142 PHE A CE2   1 
ATOM   8490  C  CZ    . PHE A 1 1142 ? -16.876 -6.413  -50.823 1.00 62.14  ? 1142 PHE A CZ    1 
ATOM   8491  N  N     . ARG A 1 1143 ? -14.397 -9.675  -53.214 1.00 62.33  ? 1143 ARG A N     1 
ATOM   8492  C  CA    . ARG A 1 1143 ? -13.443 -10.364 -52.352 1.00 63.33  ? 1143 ARG A CA    1 
ATOM   8493  C  C     . ARG A 1 1143 ? -13.927 -10.526 -50.918 1.00 62.95  ? 1143 ARG A C     1 
ATOM   8494  O  O     . ARG A 1 1143 ? -13.479 -11.427 -50.215 1.00 62.78  ? 1143 ARG A O     1 
ATOM   8495  C  CB    . ARG A 1 1143 ? -12.123 -9.616  -52.347 1.00 65.74  ? 1143 ARG A CB    1 
ATOM   8496  C  CG    . ARG A 1 1143 ? -11.526 -9.413  -53.729 1.00 66.95  ? 1143 ARG A CG    1 
ATOM   8497  C  CD    . ARG A 1 1143 ? -10.082 -8.953  -53.613 1.00 69.39  ? 1143 ARG A CD    1 
ATOM   8498  N  NE    . ARG A 1 1143 ? -9.228  -10.013 -53.067 1.00 70.10  ? 1143 ARG A NE    1 
ATOM   8499  C  CZ    . ARG A 1 1143 ? -7.994  -9.848  -52.595 1.00 70.66  ? 1143 ARG A CZ    1 
ATOM   8500  N  NH1   . ARG A 1 1143 ? -7.410  -8.653  -52.586 1.00 71.82  ? 1143 ARG A NH1   1 
ATOM   8501  N  NH2   . ARG A 1 1143 ? -7.334  -10.903 -52.129 1.00 71.15  ? 1143 ARG A NH2   1 
ATOM   8502  N  N     . GLY A 1 1144 ? -14.814 -9.640  -50.484 1.00 63.23  ? 1144 GLY A N     1 
ATOM   8503  C  CA    . GLY A 1 1144 ? -15.410 -9.706  -49.152 1.00 64.17  ? 1144 GLY A CA    1 
ATOM   8504  C  C     . GLY A 1 1144 ? -15.044 -8.498  -48.308 1.00 66.14  ? 1144 GLY A C     1 
ATOM   8505  O  O     . GLY A 1 1144 ? -14.006 -7.865  -48.512 1.00 65.59  ? 1144 GLY A O     1 
ATOM   8506  N  N     . TYR A 1 1145 ? -15.920 -8.180  -47.363 1.00 68.08  ? 1145 TYR A N     1 
ATOM   8507  C  CA    . TYR A 1 1145 ? -15.700 -7.095  -46.426 1.00 70.86  ? 1145 TYR A CA    1 
ATOM   8508  C  C     . TYR A 1 1145 ? -14.598 -7.520  -45.478 1.00 73.30  ? 1145 TYR A C     1 
ATOM   8509  O  O     . TYR A 1 1145 ? -14.593 -8.652  -45.005 1.00 71.19  ? 1145 TYR A O     1 
ATOM   8510  C  CB    . TYR A 1 1145 ? -16.959 -6.798  -45.602 1.00 71.62  ? 1145 TYR A CB    1 
ATOM   8511  C  CG    . TYR A 1 1145 ? -18.179 -6.296  -46.367 1.00 71.27  ? 1145 TYR A CG    1 
ATOM   8512  C  CD1   . TYR A 1 1145 ? -18.080 -5.275  -47.317 1.00 71.98  ? 1145 TYR A CD1   1 
ATOM   8513  C  CD2   . TYR A 1 1145 ? -19.446 -6.812  -46.091 1.00 71.08  ? 1145 TYR A CD2   1 
ATOM   8514  C  CE1   . TYR A 1 1145 ? -19.206 -4.814  -47.996 1.00 72.42  ? 1145 TYR A CE1   1 
ATOM   8515  C  CE2   . TYR A 1 1145 ? -20.577 -6.356  -46.757 1.00 71.96  ? 1145 TYR A CE2   1 
ATOM   8516  C  CZ    . TYR A 1 1145 ? -20.458 -5.355  -47.708 1.00 73.00  ? 1145 TYR A CZ    1 
ATOM   8517  O  OH    . TYR A 1 1145 ? -21.599 -4.911  -48.362 1.00 75.47  ? 1145 TYR A OH    1 
ATOM   8518  N  N     . GLU A 1 1146 ? -13.672 -6.602  -45.206 1.00 78.59  ? 1146 GLU A N     1 
ATOM   8519  C  CA    . GLU A 1 1146 ? -12.607 -6.832  -44.234 1.00 81.93  ? 1146 GLU A CA    1 
ATOM   8520  C  C     . GLU A 1 1146 ? -13.266 -7.024  -42.872 1.00 82.14  ? 1146 GLU A C     1 
ATOM   8521  O  O     . GLU A 1 1146 ? -14.188 -6.287  -42.516 1.00 83.86  ? 1146 GLU A O     1 
ATOM   8522  C  CB    . GLU A 1 1146 ? -11.626 -5.652  -44.178 1.00 85.43  ? 1146 GLU A CB    1 
ATOM   8523  C  CG    . GLU A 1 1146 ? -10.876 -5.337  -45.474 1.00 87.53  ? 1146 GLU A CG    1 
ATOM   8524  C  CD    . GLU A 1 1146 ? -9.861  -6.398  -45.890 1.00 90.38  ? 1146 GLU A CD    1 
ATOM   8525  O  OE1   . GLU A 1 1146 ? -9.623  -7.368  -45.138 1.00 92.94  ? 1146 GLU A OE1   1 
ATOM   8526  O  OE2   . GLU A 1 1146 ? -9.284  -6.256  -46.990 1.00 92.51  ? 1146 GLU A OE2   1 
ATOM   8527  N  N     . SER A 1 1147 ? -12.803 -8.024  -42.129 1.00 81.30  ? 1147 SER A N     1 
ATOM   8528  C  CA    . SER A 1 1147 ? -13.450 -8.432  -40.885 1.00 79.93  ? 1147 SER A CA    1 
ATOM   8529  C  C     . SER A 1 1147 ? -12.501 -9.258  -40.024 1.00 80.21  ? 1147 SER A C     1 
ATOM   8530  O  O     . SER A 1 1147 ? -11.768 -10.101 -40.545 1.00 81.81  ? 1147 SER A O     1 
ATOM   8531  C  CB    . SER A 1 1147 ? -14.706 -9.246  -41.211 1.00 77.85  ? 1147 SER A CB    1 
ATOM   8532  O  OG    . SER A 1 1147 ? -15.260 -9.851  -40.057 1.00 76.77  ? 1147 SER A OG    1 
ATOM   8533  N  N     . ASP A 1 1148 ? -12.523 -9.023  -38.714 1.00 79.57  ? 1148 ASP A N     1 
ATOM   8534  C  CA    . ASP A 1 1148 ? -11.706 -9.798  -37.785 1.00 80.22  ? 1148 ASP A CA    1 
ATOM   8535  C  C     . ASP A 1 1148 ? -12.130 -9.669  -36.321 1.00 79.84  ? 1148 ASP A C     1 
ATOM   8536  O  O     . ASP A 1 1148 ? -12.734 -8.678  -35.906 1.00 79.43  ? 1148 ASP A O     1 
ATOM   8537  C  CB    . ASP A 1 1148 ? -10.242 -9.377  -37.891 1.00 82.09  ? 1148 ASP A CB    1 
ATOM   8538  C  CG    . ASP A 1 1148 ? -10.044 -7.947  -37.504 1.00 83.25  ? 1148 ASP A CG    1 
ATOM   8539  O  OD1   . ASP A 1 1148 ? -10.294 -7.080  -38.363 1.00 83.43  ? 1148 ASP A OD1   1 
ATOM   8540  O  OD2   . ASP A 1 1148 ? -9.683  -7.697  -36.336 1.00 84.66  ? 1148 ASP A OD2   1 
ATOM   8541  N  N     . MET A 1 1149 ? -11.749 -10.680 -35.549 1.00 79.82  ? 1149 MET A N     1 
ATOM   8542  C  CA    . MET A 1 1149 ? -12.014 -10.741 -34.122 1.00 79.99  ? 1149 MET A CA    1 
ATOM   8543  C  C     . MET A 1 1149 ? -10.925 -11.593 -33.455 1.00 80.63  ? 1149 MET A C     1 
ATOM   8544  O  O     . MET A 1 1149 ? -10.769 -12.776 -33.763 1.00 80.74  ? 1149 MET A O     1 
ATOM   8545  C  CB    . MET A 1 1149 ? -13.409 -11.339 -33.871 1.00 77.98  ? 1149 MET A CB    1 
ATOM   8546  C  CG    . MET A 1 1149 ? -13.829 -11.433 -32.408 1.00 78.53  ? 1149 MET A CG    1 
ATOM   8547  S  SD    . MET A 1 1149 ? -13.878 -9.836  -31.573 1.00 79.31  ? 1149 MET A SD    1 
ATOM   8548  C  CE    . MET A 1 1149 ? -13.797 -10.359 -29.865 1.00 81.20  ? 1149 MET A CE    1 
ATOM   8549  N  N     . ASN A 1 1150 ? -10.163 -10.961 -32.571 1.00 81.25  ? 1150 ASN A N     1 
ATOM   8550  C  CA    . ASN A 1 1150 ? -9.238  -11.649 -31.695 1.00 82.68  ? 1150 ASN A CA    1 
ATOM   8551  C  C     . ASN A 1 1150 ? -9.997  -11.967 -30.406 1.00 83.07  ? 1150 ASN A C     1 
ATOM   8552  O  O     . ASN A 1 1150 ? -10.237 -11.082 -29.587 1.00 82.99  ? 1150 ASN A O     1 
ATOM   8553  C  CB    . ASN A 1 1150 ? -8.025  -10.747 -31.445 1.00 84.70  ? 1150 ASN A CB    1 
ATOM   8554  C  CG    . ASN A 1 1150 ? -7.000  -11.355 -30.507 1.00 86.47  ? 1150 ASN A CG    1 
ATOM   8555  O  OD1   . ASN A 1 1150 ? -7.309  -12.201 -29.669 1.00 86.94  ? 1150 ASN A OD1   1 
ATOM   8556  N  ND2   . ASN A 1 1150 ? -5.768  -10.888 -30.620 1.00 88.28  ? 1150 ASN A ND2   1 
ATOM   8557  N  N     . TRP A 1 1151 ? -10.384 -13.228 -30.238 1.00 83.48  ? 1151 TRP A N     1 
ATOM   8558  C  CA    . TRP A 1 1151 ? -11.113 -13.658 -29.034 1.00 84.97  ? 1151 TRP A CA    1 
ATOM   8559  C  C     . TRP A 1 1151 ? -10.265 -13.763 -27.762 1.00 88.02  ? 1151 TRP A C     1 
ATOM   8560  O  O     . TRP A 1 1151 ? -10.825 -13.810 -26.671 1.00 88.90  ? 1151 TRP A O     1 
ATOM   8561  C  CB    . TRP A 1 1151 ? -11.860 -14.977 -29.275 1.00 83.19  ? 1151 TRP A CB    1 
ATOM   8562  C  CG    . TRP A 1 1151 ? -13.191 -14.753 -29.862 1.00 81.78  ? 1151 TRP A CG    1 
ATOM   8563  C  CD1   . TRP A 1 1151 ? -13.547 -14.903 -31.165 1.00 80.56  ? 1151 TRP A CD1   1 
ATOM   8564  C  CD2   . TRP A 1 1151 ? -14.357 -14.298 -29.174 1.00 81.96  ? 1151 TRP A CD2   1 
ATOM   8565  N  NE1   . TRP A 1 1151 ? -14.873 -14.587 -31.334 1.00 79.43  ? 1151 TRP A NE1   1 
ATOM   8566  C  CE2   . TRP A 1 1151 ? -15.395 -14.210 -30.126 1.00 80.26  ? 1151 TRP A CE2   1 
ATOM   8567  C  CE3   . TRP A 1 1151 ? -14.629 -13.964 -27.841 1.00 82.76  ? 1151 TRP A CE3   1 
ATOM   8568  C  CZ2   . TRP A 1 1151 ? -16.688 -13.800 -29.790 1.00 79.56  ? 1151 TRP A CZ2   1 
ATOM   8569  C  CZ3   . TRP A 1 1151 ? -15.911 -13.557 -27.506 1.00 82.42  ? 1151 TRP A CZ3   1 
ATOM   8570  C  CH2   . TRP A 1 1151 ? -16.926 -13.476 -28.481 1.00 80.78  ? 1151 TRP A CH2   1 
ATOM   8571  N  N     . GLU A 1 1152 ? -8.939  -13.794 -27.889 1.00 90.87  ? 1152 GLU A N     1 
ATOM   8572  C  CA    . GLU A 1 1152 ? -8.062  -13.783 -26.711 1.00 94.96  ? 1152 GLU A CA    1 
ATOM   8573  C  C     . GLU A 1 1152 ? -8.091  -12.413 -26.029 1.00 96.08  ? 1152 GLU A C     1 
ATOM   8574  O  O     . GLU A 1 1152 ? -8.369  -12.309 -24.835 1.00 96.56  ? 1152 GLU A O     1 
ATOM   8575  C  CB    . GLU A 1 1152 ? -6.622  -14.150 -27.088 1.00 97.22  ? 1152 GLU A CB    1 
ATOM   8576  C  CG    . GLU A 1 1152 ? -5.780  -14.600 -25.898 1.00 101.08 ? 1152 GLU A CG    1 
ATOM   8577  C  CD    . GLU A 1 1152 ? -6.201  -15.957 -25.339 1.00 102.02 ? 1152 GLU A CD    1 
ATOM   8578  O  OE1   . GLU A 1 1152 ? -6.630  -16.843 -26.122 1.00 102.29 ? 1152 GLU A OE1   1 
ATOM   8579  O  OE2   . GLU A 1 1152 ? -6.103  -16.138 -24.106 1.00 103.04 ? 1152 GLU A OE2   1 
ATOM   8580  N  N     . LYS A 1 1153 ? -7.812  -11.375 -26.812 1.00 96.28  ? 1153 LYS A N     1 
ATOM   8581  C  CA    . LYS A 1 1153 ? -7.849  -9.988  -26.345 1.00 97.74  ? 1153 LYS A CA    1 
ATOM   8582  C  C     . LYS A 1 1153 ? -9.270  -9.424  -26.214 1.00 96.07  ? 1153 LYS A C     1 
ATOM   8583  O  O     . LYS A 1 1153 ? -9.467  -8.396  -25.576 1.00 96.53  ? 1153 LYS A O     1 
ATOM   8584  C  CB    . LYS A 1 1153 ? -7.037  -9.101  -27.291 1.00 99.18  ? 1153 LYS A CB    1 
ATOM   8585  C  CG    . LYS A 1 1153 ? -5.576  -9.510  -27.384 1.00 102.04 ? 1153 LYS A CG    1 
ATOM   8586  C  CD    . LYS A 1 1153 ? -4.713  -8.440  -28.035 1.00 103.89 ? 1153 LYS A CD    1 
ATOM   8587  C  CE    . LYS A 1 1153 ? -3.243  -8.646  -27.706 1.00 106.84 ? 1153 LYS A CE    1 
ATOM   8588  N  NZ    . LYS A 1 1153 ? -2.423  -7.470  -28.116 1.00 108.80 ? 1153 LYS A NZ    1 
ATOM   8589  N  N     . GLY A 1 1154 ? -10.250 -10.082 -26.827 1.00 94.09  ? 1154 GLY A N     1 
ATOM   8590  C  CA    . GLY A 1 1154 ? -11.632 -9.621  -26.800 1.00 93.19  ? 1154 GLY A CA    1 
ATOM   8591  C  C     . GLY A 1 1154 ? -11.910 -8.382  -27.640 1.00 92.17  ? 1154 GLY A C     1 
ATOM   8592  O  O     . GLY A 1 1154 ? -12.904 -7.705  -27.399 1.00 91.96  ? 1154 GLY A O     1 
ATOM   8593  N  N     . GLU A 1 1155 ? -11.057 -8.097  -28.630 1.00 91.42  ? 1155 GLU A N     1 
ATOM   8594  C  CA    . GLU A 1 1155 ? -11.179 -6.893  -29.464 1.00 90.33  ? 1155 GLU A CA    1 
ATOM   8595  C  C     . GLU A 1 1155 ? -11.052 -7.205  -30.947 1.00 87.26  ? 1155 GLU A C     1 
ATOM   8596  O  O     . GLU A 1 1155 ? -10.307 -8.097  -31.336 1.00 88.14  ? 1155 GLU A O     1 
ATOM   8597  C  CB    . GLU A 1 1155 ? -10.118 -5.860  -29.076 1.00 92.67  ? 1155 GLU A CB    1 
ATOM   8598  C  CG    . GLU A 1 1155 ? -8.685  -6.233  -29.441 1.00 94.26  ? 1155 GLU A CG    1 
ATOM   8599  C  CD    . GLU A 1 1155 ? -7.666  -5.263  -28.869 1.00 97.25  ? 1155 GLU A CD    1 
ATOM   8600  O  OE1   . GLU A 1 1155 ? -7.627  -5.091  -27.630 1.00 99.13  ? 1155 GLU A OE1   1 
ATOM   8601  O  OE2   . GLU A 1 1155 ? -6.896  -4.672  -29.657 1.00 98.27  ? 1155 GLU A OE2   1 
ATOM   8602  N  N     . GLY A 1 1156 ? -11.767 -6.446  -31.768 1.00 84.82  ? 1156 GLY A N     1 
ATOM   8603  C  CA    . GLY A 1 1156 ? -11.674 -6.580  -33.215 1.00 82.77  ? 1156 GLY A CA    1 
ATOM   8604  C  C     . GLY A 1 1156 ? -12.658 -5.700  -33.959 1.00 81.39  ? 1156 GLY A C     1 
ATOM   8605  O  O     . GLY A 1 1156 ? -13.411 -4.926  -33.346 1.00 81.21  ? 1156 GLY A O     1 
ATOM   8606  N  N     . GLN A 1 1157 ? -12.652 -5.844  -35.286 1.00 79.81  ? 1157 GLN A N     1 
ATOM   8607  C  CA    . GLN A 1 1157 ? -13.549 -5.128  -36.192 1.00 78.14  ? 1157 GLN A CA    1 
ATOM   8608  C  C     . GLN A 1 1157 ? -14.377 -6.154  -36.949 1.00 74.89  ? 1157 GLN A C     1 
ATOM   8609  O  O     . GLN A 1 1157 ? -14.221 -6.304  -38.157 1.00 73.50  ? 1157 GLN A O     1 
ATOM   8610  C  CB    . GLN A 1 1157 ? -12.735 -4.276  -37.169 1.00 79.82  ? 1157 GLN A CB    1 
ATOM   8611  C  CG    . GLN A 1 1157 ? -11.890 -3.189  -36.512 1.00 83.74  ? 1157 GLN A CG    1 
ATOM   8612  C  CD    . GLN A 1 1157 ? -12.731 -2.124  -35.827 1.00 86.04  ? 1157 GLN A CD    1 
ATOM   8613  O  OE1   . GLN A 1 1157 ? -13.852 -1.828  -36.264 1.00 86.38  ? 1157 GLN A OE1   1 
ATOM   8614  N  NE2   . GLN A 1 1157 ? -12.198 -1.543  -34.745 1.00 87.13  ? 1157 GLN A NE2   1 
ATOM   8615  N  N     . PRO A 1 1158 ? -15.253 -6.888  -36.238 1.00 73.54  ? 1158 PRO A N     1 
ATOM   8616  C  CA    . PRO A 1 1158 ? -16.012 -7.967  -36.876 1.00 71.31  ? 1158 PRO A CA    1 
ATOM   8617  C  C     . PRO A 1 1158 ? -17.094 -7.507  -37.842 1.00 69.56  ? 1158 PRO A C     1 
ATOM   8618  O  O     . PRO A 1 1158 ? -17.425 -8.252  -38.772 1.00 70.12  ? 1158 PRO A O     1 
ATOM   8619  C  CB    . PRO A 1 1158 ? -16.671 -8.674  -35.690 1.00 71.43  ? 1158 PRO A CB    1 
ATOM   8620  C  CG    . PRO A 1 1158 ? -16.861 -7.586  -34.701 1.00 73.15  ? 1158 PRO A CG    1 
ATOM   8621  C  CD    . PRO A 1 1158 ? -15.629 -6.741  -34.819 1.00 74.36  ? 1158 PRO A CD    1 
ATOM   8622  N  N     . PHE A 1 1159 ? -17.634 -6.308  -37.630 1.00 68.30  ? 1159 PHE A N     1 
ATOM   8623  C  CA    . PHE A 1 1159 ? -18.841 -5.869  -38.323 1.00 66.93  ? 1159 PHE A CA    1 
ATOM   8624  C  C     . PHE A 1 1159 ? -18.613 -4.709  -39.305 1.00 67.30  ? 1159 PHE A C     1 
ATOM   8625  O  O     . PHE A 1 1159 ? -17.921 -3.739  -39.001 1.00 68.29  ? 1159 PHE A O     1 
ATOM   8626  C  CB    . PHE A 1 1159 ? -19.916 -5.520  -37.293 1.00 66.67  ? 1159 PHE A CB    1 
ATOM   8627  C  CG    . PHE A 1 1159 ? -20.189 -6.625  -36.302 1.00 65.80  ? 1159 PHE A CG    1 
ATOM   8628  C  CD1   . PHE A 1 1159 ? -20.575 -7.888  -36.735 1.00 64.52  ? 1159 PHE A CD1   1 
ATOM   8629  C  CD2   . PHE A 1 1159 ? -20.085 -6.398  -34.936 1.00 66.32  ? 1159 PHE A CD2   1 
ATOM   8630  C  CE1   . PHE A 1 1159 ? -20.835 -8.908  -35.826 1.00 63.98  ? 1159 PHE A CE1   1 
ATOM   8631  C  CE2   . PHE A 1 1159 ? -20.341 -7.412  -34.026 1.00 65.88  ? 1159 PHE A CE2   1 
ATOM   8632  C  CZ    . PHE A 1 1159 ? -20.716 -8.668  -34.470 1.00 64.85  ? 1159 PHE A CZ    1 
ATOM   8633  N  N     . GLU A 1 1160 ? -19.213 -4.835  -40.487 1.00 67.31  ? 1160 GLU A N     1 
ATOM   8634  C  CA    . GLU A 1 1160 ? -19.079 -3.859  -41.558 1.00 68.41  ? 1160 GLU A CA    1 
ATOM   8635  C  C     . GLU A 1 1160 ? -20.021 -2.678  -41.355 1.00 68.26  ? 1160 GLU A C     1 
ATOM   8636  O  O     . GLU A 1 1160 ? -19.688 -1.559  -41.726 1.00 68.92  ? 1160 GLU A O     1 
ATOM   8637  C  CB    . GLU A 1 1160 ? -19.354 -4.528  -42.916 1.00 68.17  ? 1160 GLU A CB    1 
ATOM   8638  C  CG    . GLU A 1 1160 ? -19.029 -3.665  -44.137 1.00 70.39  ? 1160 GLU A CG    1 
ATOM   8639  C  CD    . GLU A 1 1160 ? -17.555 -3.272  -44.252 1.00 72.72  ? 1160 GLU A CD    1 
ATOM   8640  O  OE1   . GLU A 1 1160 ? -16.694 -3.949  -43.652 1.00 74.69  ? 1160 GLU A OE1   1 
ATOM   8641  O  OE2   . GLU A 1 1160 ? -17.243 -2.277  -44.948 1.00 74.85  ? 1160 GLU A OE2   1 
ATOM   8642  N  N     . TYR A 1 1161 ? -21.201 -2.947  -40.800 1.00 67.54  ? 1161 TYR A N     1 
ATOM   8643  C  CA    . TYR A 1 1161 ? -22.183 -1.916  -40.463 1.00 67.83  ? 1161 TYR A CA    1 
ATOM   8644  C  C     . TYR A 1 1161 ? -23.218 -2.462  -39.467 1.00 67.13  ? 1161 TYR A C     1 
ATOM   8645  O  O     . TYR A 1 1161 ? -23.209 -3.643  -39.118 1.00 66.22  ? 1161 TYR A O     1 
ATOM   8646  C  CB    . TYR A 1 1161 ? -22.878 -1.395  -41.725 1.00 67.18  ? 1161 TYR A CB    1 
ATOM   8647  C  CG    . TYR A 1 1161 ? -23.602 -2.463  -42.486 1.00 66.82  ? 1161 TYR A CG    1 
ATOM   8648  C  CD1   . TYR A 1 1161 ? -24.908 -2.834  -42.151 1.00 66.84  ? 1161 TYR A CD1   1 
ATOM   8649  C  CD2   . TYR A 1 1161 ? -22.976 -3.128  -43.538 1.00 67.00  ? 1161 TYR A CD2   1 
ATOM   8650  C  CE1   . TYR A 1 1161 ? -25.567 -3.838  -42.850 1.00 65.78  ? 1161 TYR A CE1   1 
ATOM   8651  C  CE2   . TYR A 1 1161 ? -23.624 -4.125  -44.242 1.00 65.71  ? 1161 TYR A CE2   1 
ATOM   8652  C  CZ    . TYR A 1 1161 ? -24.913 -4.477  -43.897 1.00 65.00  ? 1161 TYR A CZ    1 
ATOM   8653  O  OH    . TYR A 1 1161 ? -25.535 -5.464  -44.614 1.00 64.95  ? 1161 TYR A OH    1 
ATOM   8654  N  N     . PHE A 1 1162 ? -24.102 -1.583  -39.016 1.00 67.54  ? 1162 PHE A N     1 
ATOM   8655  C  CA    . PHE A 1 1162 ? -25.091 -1.906  -38.002 1.00 67.18  ? 1162 PHE A CA    1 
ATOM   8656  C  C     . PHE A 1 1162 ? -26.464 -1.453  -38.478 1.00 65.84  ? 1162 PHE A C     1 
ATOM   8657  O  O     . PHE A 1 1162 ? -26.643 -0.300  -38.879 1.00 66.35  ? 1162 PHE A O     1 
ATOM   8658  C  CB    . PHE A 1 1162 ? -24.734 -1.193  -36.694 1.00 68.63  ? 1162 PHE A CB    1 
ATOM   8659  C  CG    . PHE A 1 1162 ? -23.361 -1.521  -36.186 1.00 69.43  ? 1162 PHE A CG    1 
ATOM   8660  C  CD1   . PHE A 1 1162 ? -22.235 -0.922  -36.746 1.00 69.56  ? 1162 PHE A CD1   1 
ATOM   8661  C  CD2   . PHE A 1 1162 ? -23.183 -2.434  -35.151 1.00 69.85  ? 1162 PHE A CD2   1 
ATOM   8662  C  CE1   . PHE A 1 1162 ? -20.965 -1.230  -36.288 1.00 69.93  ? 1162 PHE A CE1   1 
ATOM   8663  C  CE2   . PHE A 1 1162 ? -21.910 -2.739  -34.682 1.00 69.96  ? 1162 PHE A CE2   1 
ATOM   8664  C  CZ    . PHE A 1 1162 ? -20.802 -2.139  -35.255 1.00 70.23  ? 1162 PHE A CZ    1 
ATOM   8665  N  N     . VAL A 1 1163 ? -27.430 -2.359  -38.439 1.00 63.79  ? 1163 VAL A N     1 
ATOM   8666  C  CA    . VAL A 1 1163 ? -28.813 -1.992  -38.690 1.00 63.33  ? 1163 VAL A CA    1 
ATOM   8667  C  C     . VAL A 1 1163 ? -29.399 -1.497  -37.377 1.00 64.45  ? 1163 VAL A C     1 
ATOM   8668  O  O     . VAL A 1 1163 ? -29.291 -2.183  -36.351 1.00 64.98  ? 1163 VAL A O     1 
ATOM   8669  C  CB    . VAL A 1 1163 ? -29.638 -3.177  -39.205 1.00 61.12  ? 1163 VAL A CB    1 
ATOM   8670  C  CG1   . VAL A 1 1163 ? -31.100 -2.770  -39.415 1.00 60.89  ? 1163 VAL A CG1   1 
ATOM   8671  C  CG2   . VAL A 1 1163 ? -29.019 -3.708  -40.482 1.00 60.23  ? 1163 VAL A CG2   1 
ATOM   8672  N  N     . TYR A 1 1164 ? -30.014 -0.313  -37.421 1.00 65.14  ? 1164 TYR A N     1 
ATOM   8673  C  CA    . TYR A 1 1164 ? -30.641 0.305   -36.245 1.00 65.82  ? 1164 TYR A CA    1 
ATOM   8674  C  C     . TYR A 1 1164 ? -32.164 0.352   -36.351 1.00 64.23  ? 1164 TYR A C     1 
ATOM   8675  O  O     . TYR A 1 1164 ? -32.727 0.520   -37.428 1.00 62.68  ? 1164 TYR A O     1 
ATOM   8676  C  CB    . TYR A 1 1164 ? -30.105 1.718   -36.040 1.00 67.64  ? 1164 TYR A CB    1 
ATOM   8677  C  CG    . TYR A 1 1164 ? -28.631 1.763   -35.742 1.00 68.57  ? 1164 TYR A CG    1 
ATOM   8678  C  CD1   . TYR A 1 1164 ? -28.138 1.258   -34.546 1.00 69.05  ? 1164 TYR A CD1   1 
ATOM   8679  C  CD2   . TYR A 1 1164 ? -27.723 2.312   -36.654 1.00 68.92  ? 1164 TYR A CD2   1 
ATOM   8680  C  CE1   . TYR A 1 1164 ? -26.787 1.302   -34.256 1.00 70.34  ? 1164 TYR A CE1   1 
ATOM   8681  C  CE2   . TYR A 1 1164 ? -26.365 2.356   -36.372 1.00 70.08  ? 1164 TYR A CE2   1 
ATOM   8682  C  CZ    . TYR A 1 1164 ? -25.903 1.850   -35.167 1.00 70.80  ? 1164 TYR A CZ    1 
ATOM   8683  O  OH    . TYR A 1 1164 ? -24.563 1.880   -34.867 1.00 72.76  ? 1164 TYR A OH    1 
ATOM   8684  N  N     . GLY A 1 1165 ? -32.826 0.216   -35.218 1.00 64.12  ? 1165 GLY A N     1 
ATOM   8685  C  CA    . GLY A 1 1165 ? -34.266 0.267   -35.200 1.00 64.36  ? 1165 GLY A CA    1 
ATOM   8686  C  C     . GLY A 1 1165 ? -34.799 0.452   -33.810 1.00 65.60  ? 1165 GLY A C     1 
ATOM   8687  O  O     . GLY A 1 1165 ? -34.043 0.438   -32.840 1.00 67.17  ? 1165 GLY A O     1 
ATOM   8688  N  N     . ALA A 1 1166 ? -36.110 0.637   -33.730 1.00 65.32  ? 1166 ALA A N     1 
ATOM   8689  C  CA    . ALA A 1 1166 ? -36.828 0.613   -32.462 1.00 65.81  ? 1166 ALA A CA    1 
ATOM   8690  C  C     . ALA A 1 1166 ? -38.236 0.102   -32.720 1.00 64.79  ? 1166 ALA A C     1 
ATOM   8691  O  O     . ALA A 1 1166 ? -38.705 0.117   -33.862 1.00 63.73  ? 1166 ALA A O     1 
ATOM   8692  C  CB    . ALA A 1 1166 ? -36.859 1.999   -31.842 1.00 67.12  ? 1166 ALA A CB    1 
ATOM   8693  N  N     . ALA A 1 1167 ? -38.905 -0.346  -31.665 1.00 65.05  ? 1167 ALA A N     1 
ATOM   8694  C  CA    . ALA A 1 1167 ? -40.260 -0.852  -31.807 1.00 65.37  ? 1167 ALA A CA    1 
ATOM   8695  C  C     . ALA A 1 1167 ? -41.050 -0.735  -30.529 1.00 66.90  ? 1167 ALA A C     1 
ATOM   8696  O  O     . ALA A 1 1167 ? -40.549 -1.048  -29.455 1.00 66.56  ? 1167 ALA A O     1 
ATOM   8697  C  CB    . ALA A 1 1167 ? -40.244 -2.302  -32.275 1.00 64.40  ? 1167 ALA A CB    1 
ATOM   8698  N  N     . CYS A 1 1168 ? -42.298 -0.302  -30.681 1.00 69.17  ? 1168 CYS A N     1 
ATOM   8699  C  CA    . CYS A 1 1168 ? -43.238 -0.123  -29.591 1.00 72.27  ? 1168 CYS A CA    1 
ATOM   8700  C  C     . CYS A 1 1168 ? -44.393 -1.090  -29.797 1.00 71.60  ? 1168 CYS A C     1 
ATOM   8701  O  O     . CYS A 1 1168 ? -44.859 -1.238  -30.922 1.00 71.11  ? 1168 CYS A O     1 
ATOM   8702  C  CB    . CYS A 1 1168 ? -43.759 1.306   -29.611 1.00 75.24  ? 1168 CYS A CB    1 
ATOM   8703  S  SG    . CYS A 1 1168 ? -45.080 1.613   -28.427 1.00 81.31  ? 1168 CYS A SG    1 
ATOM   8704  N  N     . SER A 1 1169 ? -44.853 -1.736  -28.725 1.00 72.44  ? 1169 SER A N     1 
ATOM   8705  C  CA    . SER A 1 1169 ? -45.965 -2.696  -28.798 1.00 72.04  ? 1169 SER A CA    1 
ATOM   8706  C  C     . SER A 1 1169 ? -46.919 -2.612  -27.609 1.00 72.08  ? 1169 SER A C     1 
ATOM   8707  O  O     . SER A 1 1169 ? -46.485 -2.456  -26.479 1.00 71.26  ? 1169 SER A O     1 
ATOM   8708  C  CB    . SER A 1 1169 ? -45.429 -4.129  -28.914 1.00 71.86  ? 1169 SER A CB    1 
ATOM   8709  O  OG    . SER A 1 1169 ? -45.177 -4.485  -30.263 1.00 71.48  ? 1169 SER A OG    1 
ATOM   8710  N  N     . GLU A 1 1170 ? -48.212 -2.759  -27.890 1.00 72.76  ? 1170 GLU A N     1 
ATOM   8711  C  CA    . GLU A 1 1170 ? -49.263 -2.702  -26.885 1.00 75.07  ? 1170 GLU A CA    1 
ATOM   8712  C  C     . GLU A 1 1170 ? -50.091 -3.974  -26.927 1.00 73.25  ? 1170 GLU A C     1 
ATOM   8713  O  O     . GLU A 1 1170 ? -50.464 -4.433  -28.003 1.00 72.18  ? 1170 GLU A O     1 
ATOM   8714  C  CB    . GLU A 1 1170 ? -50.174 -1.511  -27.152 1.00 78.39  ? 1170 GLU A CB    1 
ATOM   8715  C  CG    . GLU A 1 1170 ? -51.125 -1.167  -26.007 1.00 83.10  ? 1170 GLU A CG    1 
ATOM   8716  C  CD    . GLU A 1 1170 ? -52.109 -0.033  -26.321 1.00 86.87  ? 1170 GLU A CD    1 
ATOM   8717  O  OE1   . GLU A 1 1170 ? -52.151 0.444   -27.484 1.00 88.20  ? 1170 GLU A OE1   1 
ATOM   8718  O  OE2   . GLU A 1 1170 ? -52.852 0.385   -25.391 1.00 89.39  ? 1170 GLU A OE2   1 
ATOM   8719  N  N     . VAL A 1 1171 ? -50.403 -4.515  -25.750 1.00 73.52  ? 1171 VAL A N     1 
ATOM   8720  C  CA    . VAL A 1 1171 ? -51.221 -5.729  -25.618 1.00 73.04  ? 1171 VAL A CA    1 
ATOM   8721  C  C     . VAL A 1 1171 ? -52.300 -5.584  -24.544 1.00 74.30  ? 1171 VAL A C     1 
ATOM   8722  O  O     . VAL A 1 1171 ? -52.203 -4.724  -23.683 1.00 76.13  ? 1171 VAL A O     1 
ATOM   8723  C  CB    . VAL A 1 1171 ? -50.353 -6.972  -25.291 1.00 72.03  ? 1171 VAL A CB    1 
ATOM   8724  C  CG1   . VAL A 1 1171 ? -49.300 -7.186  -26.367 1.00 70.76  ? 1171 VAL A CG1   1 
ATOM   8725  C  CG2   . VAL A 1 1171 ? -49.708 -6.870  -23.906 1.00 72.85  ? 1171 VAL A CG2   1 
ATOM   8726  N  N     . GLU A 1 1172 ? -53.333 -6.417  -24.620 1.00 74.50  ? 1172 GLU A N     1 
ATOM   8727  C  CA    . GLU A 1 1172 ? -54.302 -6.572  -23.532 1.00 76.37  ? 1172 GLU A CA    1 
ATOM   8728  C  C     . GLU A 1 1172 ? -54.371 -8.054  -23.189 1.00 75.85  ? 1172 GLU A C     1 
ATOM   8729  O  O     . GLU A 1 1172 ? -54.552 -8.889  -24.083 1.00 73.42  ? 1172 GLU A O     1 
ATOM   8730  C  CB    . GLU A 1 1172 ? -55.692 -6.046  -23.924 1.00 77.57  ? 1172 GLU A CB    1 
ATOM   8731  C  CG    . GLU A 1 1172 ? -56.763 -6.160  -22.833 1.00 79.66  ? 1172 GLU A CG    1 
ATOM   8732  C  CD    . GLU A 1 1172 ? -58.120 -5.556  -23.221 1.00 80.99  ? 1172 GLU A CD    1 
ATOM   8733  O  OE1   . GLU A 1 1172 ? -58.287 -5.106  -24.379 1.00 80.40  ? 1172 GLU A OE1   1 
ATOM   8734  O  OE2   . GLU A 1 1172 ? -59.039 -5.540  -22.362 1.00 81.66  ? 1172 GLU A OE2   1 
ATOM   8735  N  N     . ILE A 1 1173 ? -54.226 -8.368  -21.901 1.00 76.78  ? 1173 ILE A N     1 
ATOM   8736  C  CA    . ILE A 1 1173 ? -54.310 -9.748  -21.422 1.00 76.38  ? 1173 ILE A CA    1 
ATOM   8737  C  C     . ILE A 1 1173 ? -55.618 -10.000 -20.685 1.00 78.24  ? 1173 ILE A C     1 
ATOM   8738  O  O     . ILE A 1 1173 ? -56.204 -9.085  -20.129 1.00 80.47  ? 1173 ILE A O     1 
ATOM   8739  C  CB    . ILE A 1 1173 ? -53.114 -10.141 -20.520 1.00 75.41  ? 1173 ILE A CB    1 
ATOM   8740  C  CG1   . ILE A 1 1173 ? -53.197 -9.501  -19.130 1.00 77.07  ? 1173 ILE A CG1   1 
ATOM   8741  C  CG2   . ILE A 1 1173 ? -51.809 -9.785  -21.202 1.00 74.43  ? 1173 ILE A CG2   1 
ATOM   8742  C  CD1   . ILE A 1 1173 ? -52.064 -9.902  -18.214 1.00 77.71  ? 1173 ILE A CD1   1 
ATOM   8743  N  N     . ASP A 1 1174 ? -56.049 -11.256 -20.711 1.00 79.42  ? 1174 ASP A N     1 
ATOM   8744  C  CA    . ASP A 1 1174 ? -57.148 -11.774 -19.912 1.00 81.90  ? 1174 ASP A CA    1 
ATOM   8745  C  C     . ASP A 1 1174 ? -56.488 -12.452 -18.719 1.00 82.79  ? 1174 ASP A C     1 
ATOM   8746  O  O     . ASP A 1 1174 ? -55.826 -13.480 -18.875 1.00 83.09  ? 1174 ASP A O     1 
ATOM   8747  C  CB    . ASP A 1 1174 ? -57.956 -12.785 -20.753 1.00 82.58  ? 1174 ASP A CB    1 
ATOM   8748  C  CG    . ASP A 1 1174 ? -59.259 -13.245 -20.083 1.00 84.42  ? 1174 ASP A CG    1 
ATOM   8749  O  OD1   . ASP A 1 1174 ? -59.398 -13.172 -18.839 1.00 87.96  ? 1174 ASP A OD1   1 
ATOM   8750  O  OD2   . ASP A 1 1174 ? -60.162 -13.687 -20.826 1.00 83.54  ? 1174 ASP A OD2   1 
ATOM   8751  N  N     . CYS A 1 1175 ? -56.657 -11.883 -17.532 1.00 84.06  ? 1175 CYS A N     1 
ATOM   8752  C  CA    . CYS A 1 1175 ? -56.043 -12.446 -16.335 1.00 85.87  ? 1175 CYS A CA    1 
ATOM   8753  C  C     . CYS A 1 1175 ? -56.700 -13.741 -15.858 1.00 85.94  ? 1175 CYS A C     1 
ATOM   8754  O  O     . CYS A 1 1175 ? -56.095 -14.473 -15.082 1.00 86.40  ? 1175 CYS A O     1 
ATOM   8755  C  CB    . CYS A 1 1175 ? -56.051 -11.417 -15.211 1.00 89.28  ? 1175 CYS A CB    1 
ATOM   8756  S  SG    . CYS A 1 1175 ? -55.229 -9.875  -15.673 1.00 91.61  ? 1175 CYS A SG    1 
ATOM   8757  N  N     . LEU A 1 1176 ? -57.926 -14.016 -16.313 1.00 85.77  ? 1176 LEU A N     1 
ATOM   8758  C  CA    . LEU A 1 1176 ? -58.656 -15.246 -15.956 1.00 85.76  ? 1176 LEU A CA    1 
ATOM   8759  C  C     . LEU A 1 1176 ? -58.337 -16.460 -16.828 1.00 84.19  ? 1176 LEU A C     1 
ATOM   8760  O  O     . LEU A 1 1176 ? -58.474 -17.594 -16.367 1.00 84.53  ? 1176 LEU A O     1 
ATOM   8761  C  CB    . LEU A 1 1176 ? -60.169 -15.008 -15.993 1.00 85.80  ? 1176 LEU A CB    1 
ATOM   8762  C  CG    . LEU A 1 1176 ? -60.697 -14.028 -14.954 1.00 87.23  ? 1176 LEU A CG    1 
ATOM   8763  C  CD1   . LEU A 1 1176 ? -62.167 -13.751 -15.217 1.00 88.15  ? 1176 LEU A CD1   1 
ATOM   8764  C  CD2   . LEU A 1 1176 ? -60.483 -14.565 -13.547 1.00 88.30  ? 1176 LEU A CD2   1 
ATOM   8765  N  N     . THR A 1 1177 ? -57.949 -16.233 -18.079 1.00 82.45  ? 1177 THR A N     1 
ATOM   8766  C  CA    . THR A 1 1177 ? -57.605 -17.322 -18.995 1.00 80.81  ? 1177 THR A CA    1 
ATOM   8767  C  C     . THR A 1 1177 ? -56.147 -17.335 -19.448 1.00 79.72  ? 1177 THR A C     1 
ATOM   8768  O  O     . THR A 1 1177 ? -55.698 -18.333 -20.009 1.00 80.46  ? 1177 THR A O     1 
ATOM   8769  C  CB    . THR A 1 1177 ? -58.501 -17.291 -20.250 1.00 80.19  ? 1177 THR A CB    1 
ATOM   8770  O  OG1   . THR A 1 1177 ? -58.178 -16.149 -21.057 1.00 78.65  ? 1177 THR A OG1   1 
ATOM   8771  C  CG2   . THR A 1 1177 ? -59.989 -17.254 -19.853 1.00 81.22  ? 1177 THR A CG2   1 
ATOM   8772  N  N     . GLY A 1 1178 ? -55.411 -16.247 -19.220 1.00 79.41  ? 1178 GLY A N     1 
ATOM   8773  C  CA    . GLY A 1 1178 ? -54.049 -16.111 -19.739 1.00 77.87  ? 1178 GLY A CA    1 
ATOM   8774  C  C     . GLY A 1 1178 ? -53.970 -15.821 -21.232 1.00 75.70  ? 1178 GLY A C     1 
ATOM   8775  O  O     . GLY A 1 1178 ? -52.901 -15.900 -21.816 1.00 73.95  ? 1178 GLY A O     1 
ATOM   8776  N  N     . ASP A 1 1179 ? -55.094 -15.460 -21.846 1.00 75.37  ? 1179 ASP A N     1 
ATOM   8777  C  CA    . ASP A 1 1179 ? -55.137 -15.097 -23.259 1.00 73.86  ? 1179 ASP A CA    1 
ATOM   8778  C  C     . ASP A 1 1179 ? -54.516 -13.709 -23.425 1.00 72.71  ? 1179 ASP A C     1 
ATOM   8779  O  O     . ASP A 1 1179 ? -54.327 -12.987 -22.446 1.00 72.18  ? 1179 ASP A O     1 
ATOM   8780  C  CB    . ASP A 1 1179 ? -56.598 -15.085 -23.730 1.00 75.69  ? 1179 ASP A CB    1 
ATOM   8781  C  CG    . ASP A 1 1179 ? -56.749 -15.016 -25.243 1.00 76.32  ? 1179 ASP A CG    1 
ATOM   8782  O  OD1   . ASP A 1 1179 ? -55.934 -15.618 -25.977 1.00 78.35  ? 1179 ASP A OD1   1 
ATOM   8783  O  OD2   . ASP A 1 1179 ? -57.715 -14.374 -25.703 1.00 78.43  ? 1179 ASP A OD2   1 
ATOM   8784  N  N     . HIS A 1 1180 ? -54.160 -13.348 -24.652 1.00 70.71  ? 1180 HIS A N     1 
ATOM   8785  C  CA    . HIS A 1 1180 ? -53.833 -11.958 -24.947 1.00 70.37  ? 1180 HIS A CA    1 
ATOM   8786  C  C     . HIS A 1 1180 ? -54.145 -11.577 -26.384 1.00 69.12  ? 1180 HIS A C     1 
ATOM   8787  O  O     . HIS A 1 1180 ? -54.500 -12.414 -27.212 1.00 67.96  ? 1180 HIS A O     1 
ATOM   8788  C  CB    . HIS A 1 1180 ? -52.382 -11.626 -24.573 1.00 69.72  ? 1180 HIS A CB    1 
ATOM   8789  C  CG    . HIS A 1 1180 ? -51.387 -11.939 -25.641 1.00 68.03  ? 1180 HIS A CG    1 
ATOM   8790  N  ND1   . HIS A 1 1180 ? -50.940 -13.217 -25.890 1.00 66.99  ? 1180 HIS A ND1   1 
ATOM   8791  C  CD2   . HIS A 1 1180 ? -50.740 -11.136 -26.515 1.00 67.25  ? 1180 HIS A CD2   1 
ATOM   8792  C  CE1   . HIS A 1 1180 ? -50.069 -13.190 -26.880 1.00 65.90  ? 1180 HIS A CE1   1 
ATOM   8793  N  NE2   . HIS A 1 1180 ? -49.926 -11.937 -27.274 1.00 66.12  ? 1180 HIS A NE2   1 
ATOM   8794  N  N     . LYS A 1 1181 ? -54.048 -10.282 -26.637 1.00 70.41  ? 1181 LYS A N     1 
ATOM   8795  C  CA    . LYS A 1 1181 ? -54.301 -9.707  -27.942 1.00 70.45  ? 1181 LYS A CA    1 
ATOM   8796  C  C     . LYS A 1 1181 ? -53.244 -8.647  -28.165 1.00 69.20  ? 1181 LYS A C     1 
ATOM   8797  O  O     . LYS A 1 1181 ? -52.974 -7.869  -27.262 1.00 70.69  ? 1181 LYS A O     1 
ATOM   8798  C  CB    . LYS A 1 1181 ? -55.700 -9.079  -27.974 1.00 73.08  ? 1181 LYS A CB    1 
ATOM   8799  C  CG    . LYS A 1 1181 ? -56.065 -8.331  -29.252 1.00 74.54  ? 1181 LYS A CG    1 
ATOM   8800  C  CD    . LYS A 1 1181 ? -55.984 -9.219  -30.490 1.00 75.01  ? 1181 LYS A CD    1 
ATOM   8801  C  CE    . LYS A 1 1181 ? -56.291 -8.436  -31.755 1.00 76.18  ? 1181 LYS A CE    1 
ATOM   8802  N  NZ    . LYS A 1 1181 ? -56.786 -9.324  -32.844 1.00 76.54  ? 1181 LYS A NZ    1 
ATOM   8803  N  N     . ASN A 1 1182 ? -52.636 -8.648  -29.349 1.00 67.37  ? 1182 ASN A N     1 
ATOM   8804  C  CA    . ASN A 1 1182 ? -51.698 -7.616  -29.752 1.00 66.50  ? 1182 ASN A CA    1 
ATOM   8805  C  C     . ASN A 1 1182 ? -52.509 -6.513  -30.354 1.00 66.18  ? 1182 ASN A C     1 
ATOM   8806  O  O     . ASN A 1 1182 ? -53.154 -6.700  -31.372 1.00 64.55  ? 1182 ASN A O     1 
ATOM   8807  C  CB    . ASN A 1 1182 ? -50.687 -8.151  -30.761 1.00 65.84  ? 1182 ASN A CB    1 
ATOM   8808  C  CG    . ASN A 1 1182 ? -49.858 -9.291  -30.201 1.00 66.30  ? 1182 ASN A CG    1 
ATOM   8809  O  OD1   . ASN A 1 1182 ? -49.570 -9.342  -29.003 1.00 67.39  ? 1182 ASN A OD1   1 
ATOM   8810  N  ND2   . ASN A 1 1182 ? -49.481 -10.221 -31.063 1.00 66.37  ? 1182 ASN A ND2   1 
ATOM   8811  N  N     . ILE A 1 1183 ? -52.501 -5.363  -29.697 1.00 68.20  ? 1183 ILE A N     1 
ATOM   8812  C  CA    . ILE A 1 1183 ? -53.354 -4.250  -30.096 1.00 69.45  ? 1183 ILE A CA    1 
ATOM   8813  C  C     . ILE A 1 1183 ? -52.688 -3.463  -31.210 1.00 69.29  ? 1183 ILE A C     1 
ATOM   8814  O  O     . ILE A 1 1183 ? -53.286 -3.215  -32.249 1.00 68.81  ? 1183 ILE A O     1 
ATOM   8815  C  CB    . ILE A 1 1183 ? -53.652 -3.328  -28.903 1.00 70.42  ? 1183 ILE A CB    1 
ATOM   8816  C  CG1   . ILE A 1 1183 ? -54.432 -4.103  -27.836 1.00 71.08  ? 1183 ILE A CG1   1 
ATOM   8817  C  CG2   . ILE A 1 1183 ? -54.425 -2.091  -29.344 1.00 70.68  ? 1183 ILE A CG2   1 
ATOM   8818  C  CD1   . ILE A 1 1183 ? -54.239 -3.545  -26.445 1.00 72.99  ? 1183 ILE A CD1   1 
ATOM   8819  N  N     . ARG A 1 1184 ? -51.445 -3.071  -30.982 1.00 70.20  ? 1184 ARG A N     1 
ATOM   8820  C  CA    . ARG A 1 1184 ? -50.763 -2.176  -31.895 1.00 70.98  ? 1184 ARG A CA    1 
ATOM   8821  C  C     . ARG A 1 1184 ? -49.263 -2.325  -31.786 1.00 70.33  ? 1184 ARG A C     1 
ATOM   8822  O  O     . ARG A 1 1184 ? -48.735 -2.531  -30.696 1.00 71.17  ? 1184 ARG A O     1 
ATOM   8823  C  CB    . ARG A 1 1184 ? -51.157 -0.744  -31.568 1.00 73.04  ? 1184 ARG A CB    1 
ATOM   8824  C  CG    . ARG A 1 1184 ? -50.433 0.301   -32.386 1.00 73.52  ? 1184 ARG A CG    1 
ATOM   8825  C  CD    . ARG A 1 1184 ? -51.050 1.652   -32.148 1.00 75.44  ? 1184 ARG A CD    1 
ATOM   8826  N  NE    . ARG A 1 1184 ? -50.520 2.625   -33.089 1.00 76.07  ? 1184 ARG A NE    1 
ATOM   8827  C  CZ    . ARG A 1 1184 ? -50.406 3.930   -32.864 1.00 77.81  ? 1184 ARG A CZ    1 
ATOM   8828  N  NH1   . ARG A 1 1184 ? -50.776 4.474   -31.702 1.00 79.25  ? 1184 ARG A NH1   1 
ATOM   8829  N  NH2   . ARG A 1 1184 ? -49.902 4.704   -33.823 1.00 78.29  ? 1184 ARG A NH2   1 
ATOM   8830  N  N     . THR A 1 1185 ? -48.591 -2.199  -32.924 1.00 69.11  ? 1185 THR A N     1 
ATOM   8831  C  CA    . THR A 1 1185 ? -47.145 -2.202  -32.968 1.00 68.79  ? 1185 THR A CA    1 
ATOM   8832  C  C     . THR A 1 1185 ? -46.658 -1.110  -33.917 1.00 69.30  ? 1185 THR A C     1 
ATOM   8833  O  O     . THR A 1 1185 ? -47.251 -0.891  -34.972 1.00 69.34  ? 1185 THR A O     1 
ATOM   8834  C  CB    . THR A 1 1185 ? -46.626 -3.588  -33.361 1.00 68.02  ? 1185 THR A CB    1 
ATOM   8835  O  OG1   . THR A 1 1185 ? -46.886 -4.496  -32.283 1.00 67.90  ? 1185 THR A OG1   1 
ATOM   8836  C  CG2   . THR A 1 1185 ? -45.124 -3.563  -33.641 1.00 68.33  ? 1185 THR A CG2   1 
ATOM   8837  N  N     . ASP A 1 1186 ? -45.592 -0.420  -33.510 1.00 70.29  ? 1186 ASP A N     1 
ATOM   8838  C  CA    . ASP A 1 1186 ? -44.974 0.654   -34.287 1.00 71.33  ? 1186 ASP A CA    1 
ATOM   8839  C  C     . ASP A 1 1186 ? -43.496 0.323   -34.443 1.00 70.40  ? 1186 ASP A C     1 
ATOM   8840  O  O     . ASP A 1 1186 ? -42.835 0.016   -33.458 1.00 71.14  ? 1186 ASP A O     1 
ATOM   8841  C  CB    . ASP A 1 1186 ? -45.145 1.985   -33.554 1.00 74.24  ? 1186 ASP A CB    1 
ATOM   8842  C  CG    . ASP A 1 1186 ? -46.610 2.407   -33.434 1.00 76.31  ? 1186 ASP A CG    1 
ATOM   8843  O  OD1   . ASP A 1 1186 ? -47.097 3.072   -34.380 1.00 76.92  ? 1186 ASP A OD1   1 
ATOM   8844  O  OD2   . ASP A 1 1186 ? -47.266 2.077   -32.400 1.00 76.57  ? 1186 ASP A OD2   1 
ATOM   8845  N  N     . ILE A 1 1187 ? -42.989 0.358   -35.673 1.00 68.99  ? 1187 ILE A N     1 
ATOM   8846  C  CA    . ILE A 1 1187 ? -41.599 0.000   -35.965 1.00 68.05  ? 1187 ILE A CA    1 
ATOM   8847  C  C     . ILE A 1 1187 ? -40.944 1.057   -36.845 1.00 67.97  ? 1187 ILE A C     1 
ATOM   8848  O  O     . ILE A 1 1187 ? -41.435 1.345   -37.935 1.00 66.23  ? 1187 ILE A O     1 
ATOM   8849  C  CB    . ILE A 1 1187 ? -41.506 -1.354  -36.708 1.00 66.73  ? 1187 ILE A CB    1 
ATOM   8850  C  CG1   . ILE A 1 1187 ? -42.119 -2.476  -35.866 1.00 65.86  ? 1187 ILE A CG1   1 
ATOM   8851  C  CG2   . ILE A 1 1187 ? -40.050 -1.686  -37.069 1.00 66.45  ? 1187 ILE A CG2   1 
ATOM   8852  C  CD1   . ILE A 1 1187 ? -42.245 -3.791  -36.601 1.00 64.05  ? 1187 ILE A CD1   1 
ATOM   8853  N  N     . VAL A 1 1188 ? -39.827 1.613   -36.380 1.00 69.15  ? 1188 VAL A N     1 
ATOM   8854  C  CA    . VAL A 1 1188 ? -38.978 2.467   -37.219 1.00 70.52  ? 1188 VAL A CA    1 
ATOM   8855  C  C     . VAL A 1 1188 ? -37.646 1.756   -37.439 1.00 71.44  ? 1188 VAL A C     1 
ATOM   8856  O  O     . VAL A 1 1188 ? -37.118 1.132   -36.518 1.00 71.28  ? 1188 VAL A O     1 
ATOM   8857  C  CB    . VAL A 1 1188 ? -38.743 3.861   -36.607 1.00 70.89  ? 1188 VAL A CB    1 
ATOM   8858  C  CG1   . VAL A 1 1188 ? -37.997 4.743   -37.603 1.00 70.94  ? 1188 VAL A CG1   1 
ATOM   8859  C  CG2   . VAL A 1 1188 ? -40.068 4.498   -36.199 1.00 71.39  ? 1188 VAL A CG2   1 
ATOM   8860  N  N     . MET A 1 1189 ? -37.105 1.872   -38.649 1.00 73.11  ? 1189 MET A N     1 
ATOM   8861  C  CA    . MET A 1 1189 ? -35.981 1.040   -39.073 1.00 75.31  ? 1189 MET A CA    1 
ATOM   8862  C  C     . MET A 1 1189 ? -35.035 1.758   -40.042 1.00 75.89  ? 1189 MET A C     1 
ATOM   8863  O  O     . MET A 1 1189 ? -35.460 2.224   -41.100 1.00 75.92  ? 1189 MET A O     1 
ATOM   8864  C  CB    . MET A 1 1189 ? -36.532 -0.216  -39.736 1.00 76.22  ? 1189 MET A CB    1 
ATOM   8865  C  CG    . MET A 1 1189 ? -35.527 -1.339  -39.928 1.00 77.98  ? 1189 MET A CG    1 
ATOM   8866  S  SD    . MET A 1 1189 ? -35.215 -2.292  -38.434 1.00 81.85  ? 1189 MET A SD    1 
ATOM   8867  C  CE    . MET A 1 1189 ? -36.799 -3.076  -38.179 1.00 81.48  ? 1189 MET A CE    1 
ATOM   8868  N  N     . ASP A 1 1190 ? -33.755 1.817   -39.667 1.00 75.78  ? 1190 ASP A N     1 
ATOM   8869  C  CA    . ASP A 1 1190 ? -32.686 2.372   -40.499 1.00 75.44  ? 1190 ASP A CA    1 
ATOM   8870  C  C     . ASP A 1 1190 ? -32.183 1.300   -41.455 1.00 73.85  ? 1190 ASP A C     1 
ATOM   8871  O  O     . ASP A 1 1190 ? -31.499 0.368   -41.035 1.00 73.98  ? 1190 ASP A O     1 
ATOM   8872  C  CB    . ASP A 1 1190 ? -31.536 2.860   -39.607 1.00 77.34  ? 1190 ASP A CB    1 
ATOM   8873  C  CG    . ASP A 1 1190 ? -30.297 3.282   -40.391 1.00 78.24  ? 1190 ASP A CG    1 
ATOM   8874  O  OD1   . ASP A 1 1190 ? -30.383 3.549   -41.608 1.00 78.08  ? 1190 ASP A OD1   1 
ATOM   8875  O  OD2   . ASP A 1 1190 ? -29.220 3.352   -39.764 1.00 80.17  ? 1190 ASP A OD2   1 
ATOM   8876  N  N     . VAL A 1 1191 ? -32.496 1.456   -42.739 1.00 73.75  ? 1191 VAL A N     1 
ATOM   8877  C  CA    . VAL A 1 1191 ? -32.092 0.492   -43.782 1.00 72.85  ? 1191 VAL A CA    1 
ATOM   8878  C  C     . VAL A 1 1191 ? -31.052 1.049   -44.762 1.00 71.88  ? 1191 VAL A C     1 
ATOM   8879  O  O     . VAL A 1 1191 ? -30.767 0.402   -45.776 1.00 72.11  ? 1191 VAL A O     1 
ATOM   8880  C  CB    . VAL A 1 1191 ? -33.317 -0.008  -44.595 1.00 72.84  ? 1191 VAL A CB    1 
ATOM   8881  C  CG1   . VAL A 1 1191 ? -34.428 -0.436  -43.654 1.00 73.42  ? 1191 VAL A CG1   1 
ATOM   8882  C  CG2   . VAL A 1 1191 ? -33.835 1.053   -45.574 1.00 73.83  ? 1191 VAL A CG2   1 
ATOM   8883  N  N     . GLY A 1 1192 ? -30.482 2.220   -44.462 1.00 70.84  ? 1192 GLY A N     1 
ATOM   8884  C  CA    . GLY A 1 1192 ? -29.696 2.971   -45.437 1.00 70.69  ? 1192 GLY A CA    1 
ATOM   8885  C  C     . GLY A 1 1192 ? -30.593 3.373   -46.594 1.00 70.72  ? 1192 GLY A C     1 
ATOM   8886  O  O     . GLY A 1 1192 ? -31.745 3.766   -46.378 1.00 70.85  ? 1192 GLY A O     1 
ATOM   8887  N  N     . CYS A 1 1193 ? -30.069 3.264   -47.814 1.00 70.96  ? 1193 CYS A N     1 
ATOM   8888  C  CA    . CYS A 1 1193 ? -30.885 3.362   -49.030 1.00 71.19  ? 1193 CYS A CA    1 
ATOM   8889  C  C     . CYS A 1 1193 ? -31.353 1.981   -49.463 1.00 69.23  ? 1193 CYS A C     1 
ATOM   8890  O  O     . CYS A 1 1193 ? -30.578 1.178   -49.987 1.00 68.86  ? 1193 CYS A O     1 
ATOM   8891  C  CB    . CYS A 1 1193 ? -30.100 4.002   -50.160 1.00 72.46  ? 1193 CYS A CB    1 
ATOM   8892  S  SG    . CYS A 1 1193 ? -29.391 5.571   -49.667 1.00 77.27  ? 1193 CYS A SG    1 
ATOM   8893  N  N     . SER A 1 1194 ? -32.631 1.713   -49.237 1.00 68.03  ? 1194 SER A N     1 
ATOM   8894  C  CA    . SER A 1 1194 ? -33.250 0.470   -49.664 1.00 66.20  ? 1194 SER A CA    1 
ATOM   8895  C  C     . SER A 1 1194 ? -33.122 0.270   -51.180 1.00 65.20  ? 1194 SER A C     1 
ATOM   8896  O  O     . SER A 1 1194 ? -33.479 1.160   -51.951 1.00 64.90  ? 1194 SER A O     1 
ATOM   8897  C  CB    . SER A 1 1194 ? -34.722 0.487   -49.257 1.00 66.70  ? 1194 SER A CB    1 
ATOM   8898  O  OG    . SER A 1 1194 ? -35.400 -0.656  -49.718 1.00 66.91  ? 1194 SER A OG    1 
ATOM   8899  N  N     . ILE A 1 1195 ? -32.588 -0.884  -51.594 1.00 64.09  ? 1195 ILE A N     1 
ATOM   8900  C  CA    . ILE A 1 1195 ? -32.561 -1.272  -53.021 1.00 63.26  ? 1195 ILE A CA    1 
ATOM   8901  C  C     . ILE A 1 1195 ? -33.975 -1.611  -53.516 1.00 62.19  ? 1195 ILE A C     1 
ATOM   8902  O  O     . ILE A 1 1195 ? -34.275 -1.434  -54.700 1.00 62.90  ? 1195 ILE A O     1 
ATOM   8903  C  CB    . ILE A 1 1195 ? -31.585 -2.454  -53.279 1.00 63.33  ? 1195 ILE A CB    1 
ATOM   8904  C  CG1   . ILE A 1 1195 ? -30.144 -2.024  -53.003 1.00 64.04  ? 1195 ILE A CG1   1 
ATOM   8905  C  CG2   . ILE A 1 1195 ? -31.664 -2.963  -54.719 1.00 63.69  ? 1195 ILE A CG2   1 
ATOM   8906  C  CD1   . ILE A 1 1195 ? -29.227 -3.177  -52.660 1.00 63.84  ? 1195 ILE A CD1   1 
ATOM   8907  N  N     . ASN A 1 1196 ? -34.832 -2.086  -52.612 1.00 60.67  ? 1196 ASN A N     1 
ATOM   8908  C  CA    . ASN A 1 1196 ? -36.218 -2.406  -52.929 1.00 59.52  ? 1196 ASN A CA    1 
ATOM   8909  C  C     . ASN A 1 1196 ? -37.063 -2.337  -51.657 1.00 59.14  ? 1196 ASN A C     1 
ATOM   8910  O  O     . ASN A 1 1196 ? -37.028 -3.261  -50.851 1.00 58.62  ? 1196 ASN A O     1 
ATOM   8911  C  CB    . ASN A 1 1196 ? -36.294 -3.804  -53.538 1.00 58.71  ? 1196 ASN A CB    1 
ATOM   8912  C  CG    . ASN A 1 1196 ? -37.681 -4.154  -54.045 1.00 58.67  ? 1196 ASN A CG    1 
ATOM   8913  O  OD1   . ASN A 1 1196 ? -38.692 -3.839  -53.415 1.00 59.79  ? 1196 ASN A OD1   1 
ATOM   8914  N  ND2   . ASN A 1 1196 ? -37.734 -4.819  -55.189 1.00 58.05  ? 1196 ASN A ND2   1 
ATOM   8915  N  N     . PRO A 1 1197 ? -37.812 -1.237  -51.460 1.00 59.68  ? 1197 PRO A N     1 
ATOM   8916  C  CA    . PRO A 1 1197 ? -38.528 -1.087  -50.191 1.00 59.30  ? 1197 PRO A CA    1 
ATOM   8917  C  C     . PRO A 1 1197 ? -39.703 -2.026  -49.981 1.00 58.77  ? 1197 PRO A C     1 
ATOM   8918  O  O     . PRO A 1 1197 ? -40.066 -2.269  -48.836 1.00 59.69  ? 1197 PRO A O     1 
ATOM   8919  C  CB    . PRO A 1 1197 ? -38.987 0.375   -50.212 1.00 60.22  ? 1197 PRO A CB    1 
ATOM   8920  C  CG    . PRO A 1 1197 ? -38.974 0.763   -51.640 1.00 60.31  ? 1197 PRO A CG    1 
ATOM   8921  C  CD    . PRO A 1 1197 ? -37.847 0.006   -52.251 1.00 59.99  ? 1197 PRO A CD    1 
ATOM   8922  N  N     . ALA A 1 1198 ? -40.294 -2.545  -51.054 1.00 58.96  ? 1198 ALA A N     1 
ATOM   8923  C  CA    . ALA A 1 1198 ? -41.332 -3.571  -50.933 1.00 58.74  ? 1198 ALA A CA    1 
ATOM   8924  C  C     . ALA A 1 1198 ? -40.750 -4.808  -50.277 1.00 58.76  ? 1198 ALA A C     1 
ATOM   8925  O  O     . ALA A 1 1198 ? -41.296 -5.307  -49.281 1.00 59.37  ? 1198 ALA A O     1 
ATOM   8926  C  CB    . ALA A 1 1198 ? -41.908 -3.932  -52.294 1.00 58.85  ? 1198 ALA A CB    1 
ATOM   8927  N  N     . ILE A 1 1199 ? -39.635 -5.280  -50.841 1.00 58.50  ? 1199 ILE A N     1 
ATOM   8928  C  CA    . ILE A 1 1199 ? -38.907 -6.447  -50.332 1.00 57.93  ? 1199 ILE A CA    1 
ATOM   8929  C  C     . ILE A 1 1199 ? -38.338 -6.199  -48.937 1.00 58.68  ? 1199 ILE A C     1 
ATOM   8930  O  O     . ILE A 1 1199 ? -38.430 -7.065  -48.072 1.00 59.36  ? 1199 ILE A O     1 
ATOM   8931  C  CB    . ILE A 1 1199 ? -37.789 -6.892  -51.304 1.00 57.42  ? 1199 ILE A CB    1 
ATOM   8932  C  CG1   . ILE A 1 1199 ? -38.414 -7.514  -52.552 1.00 56.65  ? 1199 ILE A CG1   1 
ATOM   8933  C  CG2   . ILE A 1 1199 ? -36.844 -7.903  -50.657 1.00 57.11  ? 1199 ILE A CG2   1 
ATOM   8934  C  CD1   . ILE A 1 1199 ? -37.444 -7.684  -53.700 1.00 57.22  ? 1199 ILE A CD1   1 
ATOM   8935  N  N     . ASP A 1 1200 ? -37.767 -5.024  -48.710 1.00 59.62  ? 1200 ASP A N     1 
ATOM   8936  C  CA    . ASP A 1 1200 ? -37.208 -4.708  -47.394 1.00 60.39  ? 1200 ASP A CA    1 
ATOM   8937  C  C     . ASP A 1 1200 ? -38.292 -4.560  -46.300 1.00 59.69  ? 1200 ASP A C     1 
ATOM   8938  O  O     . ASP A 1 1200 ? -38.129 -5.108  -45.212 1.00 60.03  ? 1200 ASP A O     1 
ATOM   8939  C  CB    . ASP A 1 1200 ? -36.242 -3.518  -47.497 1.00 61.90  ? 1200 ASP A CB    1 
ATOM   8940  C  CG    . ASP A 1 1200 ? -35.007 -3.847  -48.378 1.00 63.01  ? 1200 ASP A CG    1 
ATOM   8941  O  OD1   . ASP A 1 1200 ? -34.609 -5.035  -48.430 1.00 62.70  ? 1200 ASP A OD1   1 
ATOM   8942  O  OD2   . ASP A 1 1200 ? -34.433 -2.941  -49.031 1.00 64.24  ? 1200 ASP A OD2   1 
ATOM   8943  N  N     . ILE A 1 1201 ? -39.414 -3.907  -46.594 1.00 58.61  ? 1201 ILE A N     1 
ATOM   8944  C  CA    . ILE A 1 1201 ? -40.551 -3.881  -45.646 1.00 58.74  ? 1201 ILE A CA    1 
ATOM   8945  C  C     . ILE A 1 1201 ? -41.132 -5.292  -45.410 1.00 57.40  ? 1201 ILE A C     1 
ATOM   8946  O  O     . ILE A 1 1201 ? -41.498 -5.638  -44.280 1.00 56.61  ? 1201 ILE A O     1 
ATOM   8947  C  CB    . ILE A 1 1201 ? -41.642 -2.853  -46.073 1.00 60.33  ? 1201 ILE A CB    1 
ATOM   8948  C  CG1   . ILE A 1 1201 ? -41.102 -1.420  -45.868 1.00 61.36  ? 1201 ILE A CG1   1 
ATOM   8949  C  CG2   . ILE A 1 1201 ? -42.938 -3.036  -45.278 1.00 60.37  ? 1201 ILE A CG2   1 
ATOM   8950  C  CD1   . ILE A 1 1201 ? -41.912 -0.320  -46.516 1.00 61.94  ? 1201 ILE A CD1   1 
ATOM   8951  N  N     . GLY A 1 1202 ? -41.190 -6.108  -46.462 1.00 55.71  ? 1202 GLY A N     1 
ATOM   8952  C  CA    . GLY A 1 1202 ? -41.565 -7.517  -46.322 1.00 54.30  ? 1202 GLY A CA    1 
ATOM   8953  C  C     . GLY A 1 1202 ? -40.708 -8.290  -45.329 1.00 54.46  ? 1202 GLY A C     1 
ATOM   8954  O  O     . GLY A 1 1202 ? -41.213 -9.122  -44.571 1.00 54.06  ? 1202 GLY A O     1 
ATOM   8955  N  N     . GLN A 1 1203 ? -39.409 -8.007  -45.332 1.00 55.10  ? 1203 GLN A N     1 
ATOM   8956  C  CA    . GLN A 1 1203 ? -38.452 -8.658  -44.430 1.00 55.65  ? 1203 GLN A CA    1 
ATOM   8957  C  C     . GLN A 1 1203 ? -38.593 -8.201  -42.984 1.00 56.26  ? 1203 GLN A C     1 
ATOM   8958  O  O     . GLN A 1 1203 ? -38.429 -9.003  -42.073 1.00 55.50  ? 1203 GLN A O     1 
ATOM   8959  C  CB    . GLN A 1 1203 ? -37.027 -8.394  -44.904 1.00 57.28  ? 1203 GLN A CB    1 
ATOM   8960  C  CG    . GLN A 1 1203 ? -36.737 -8.989  -46.263 1.00 57.67  ? 1203 GLN A CG    1 
ATOM   8961  C  CD    . GLN A 1 1203 ? -36.440 -10.454 -46.172 1.00 58.66  ? 1203 GLN A CD    1 
ATOM   8962  O  OE1   . GLN A 1 1203 ? -37.285 -11.308 -46.447 1.00 58.31  ? 1203 GLN A OE1   1 
ATOM   8963  N  NE2   . GLN A 1 1203 ? -35.228 -10.758 -45.763 1.00 61.59  ? 1203 GLN A NE2   1 
ATOM   8964  N  N     . ILE A 1 1204 ? -38.900 -6.919  -42.779 1.00 57.15  ? 1204 ILE A N     1 
ATOM   8965  C  CA    . ILE A 1 1204 ? -39.127 -6.375  -41.438 1.00 58.95  ? 1204 ILE A CA    1 
ATOM   8966  C  C     . ILE A 1 1204 ? -40.349 -7.039  -40.764 1.00 59.48  ? 1204 ILE A C     1 
ATOM   8967  O  O     . ILE A 1 1204 ? -40.242 -7.543  -39.637 1.00 59.33  ? 1204 ILE A O     1 
ATOM   8968  C  CB    . ILE A 1 1204 ? -39.264 -4.821  -41.462 1.00 60.56  ? 1204 ILE A CB    1 
ATOM   8969  C  CG1   . ILE A 1 1204 ? -37.942 -4.178  -41.917 1.00 60.79  ? 1204 ILE A CG1   1 
ATOM   8970  C  CG2   . ILE A 1 1204 ? -39.642 -4.272  -40.086 1.00 61.33  ? 1204 ILE A CG2   1 
ATOM   8971  C  CD1   . ILE A 1 1204 ? -38.057 -2.756  -42.419 1.00 61.14  ? 1204 ILE A CD1   1 
ATOM   8972  N  N     . GLU A 1 1205 ? -41.481 -7.052  -41.470 1.00 59.61  ? 1205 GLU A N     1 
ATOM   8973  C  CA    . GLU A 1 1205 ? -42.728 -7.665  -40.982 1.00 60.10  ? 1205 GLU A CA    1 
ATOM   8974  C  C     . GLU A 1 1205 ? -42.571 -9.143  -40.685 1.00 58.62  ? 1205 GLU A C     1 
ATOM   8975  O  O     . GLU A 1 1205 ? -42.971 -9.615  -39.615 1.00 59.77  ? 1205 GLU A O     1 
ATOM   8976  C  CB    . GLU A 1 1205 ? -43.830 -7.540  -42.026 1.00 62.75  ? 1205 GLU A CB    1 
ATOM   8977  C  CG    . GLU A 1 1205 ? -44.297 -6.125  -42.257 1.00 66.61  ? 1205 GLU A CG    1 
ATOM   8978  C  CD    . GLU A 1 1205 ? -45.345 -6.020  -43.343 1.00 69.28  ? 1205 GLU A CD    1 
ATOM   8979  O  OE1   . GLU A 1 1205 ? -45.120 -6.541  -44.465 1.00 69.42  ? 1205 GLU A OE1   1 
ATOM   8980  O  OE2   . GLU A 1 1205 ? -46.393 -5.377  -43.077 1.00 72.27  ? 1205 GLU A OE2   1 
ATOM   8981  N  N     . GLY A 1 1206 ? -42.013 -9.866  -41.656 1.00 54.62  ? 1206 GLY A N     1 
ATOM   8982  C  CA    . GLY A 1 1206 ? -41.733 -11.276 -41.511 1.00 52.46  ? 1206 GLY A CA    1 
ATOM   8983  C  C     . GLY A 1 1206 ? -40.852 -11.619 -40.337 1.00 52.40  ? 1206 GLY A C     1 
ATOM   8984  O  O     . GLY A 1 1206 ? -41.190 -12.479 -39.542 1.00 52.96  ? 1206 GLY A O     1 
ATOM   8985  N  N     . ALA A 1 1207 ? -39.718 -10.944 -40.222 1.00 52.97  ? 1207 ALA A N     1 
ATOM   8986  C  CA    . ALA A 1 1207 ? -38.842 -11.133 -39.061 1.00 53.30  ? 1207 ALA A CA    1 
ATOM   8987  C  C     . ALA A 1 1207 ? -39.557 -10.806 -37.737 1.00 54.22  ? 1207 ALA A C     1 
ATOM   8988  O  O     . ALA A 1 1207 ? -39.429 -11.558 -36.766 1.00 53.31  ? 1207 ALA A O     1 
ATOM   8989  C  CB    . ALA A 1 1207 ? -37.577 -10.303 -39.207 1.00 53.59  ? 1207 ALA A CB    1 
ATOM   8990  N  N     . PHE A 1 1208 ? -40.319 -9.707  -37.716 1.00 54.64  ? 1208 PHE A N     1 
ATOM   8991  C  CA    . PHE A 1 1208 ? -41.034 -9.278  -36.511 1.00 56.10  ? 1208 PHE A CA    1 
ATOM   8992  C  C     . PHE A 1 1208 ? -42.004 -10.341 -36.019 1.00 55.37  ? 1208 PHE A C     1 
ATOM   8993  O  O     . PHE A 1 1208 ? -41.964 -10.711 -34.848 1.00 54.72  ? 1208 PHE A O     1 
ATOM   8994  C  CB    . PHE A 1 1208 ? -41.773 -7.941  -36.734 1.00 58.54  ? 1208 PHE A CB    1 
ATOM   8995  C  CG    . PHE A 1 1208 ? -42.715 -7.582  -35.617 1.00 60.58  ? 1208 PHE A CG    1 
ATOM   8996  C  CD1   . PHE A 1 1208 ? -42.243 -6.991  -34.455 1.00 62.05  ? 1208 PHE A CD1   1 
ATOM   8997  C  CD2   . PHE A 1 1208 ? -44.076 -7.889  -35.708 1.00 61.33  ? 1208 PHE A CD2   1 
ATOM   8998  C  CE1   . PHE A 1 1208 ? -43.114 -6.693  -33.415 1.00 63.53  ? 1208 PHE A CE1   1 
ATOM   8999  C  CE2   . PHE A 1 1208 ? -44.948 -7.600  -34.670 1.00 62.07  ? 1208 PHE A CE2   1 
ATOM   9000  C  CZ    . PHE A 1 1208 ? -44.467 -6.996  -33.525 1.00 63.27  ? 1208 PHE A CZ    1 
ATOM   9001  N  N     . ILE A 1 1209 ? -42.859 -10.835 -36.918 1.00 55.25  ? 1209 ILE A N     1 
ATOM   9002  C  CA    . ILE A 1 1209 ? -43.840 -11.888 -36.583 1.00 54.71  ? 1209 ILE A CA    1 
ATOM   9003  C  C     . ILE A 1 1209 ? -43.148 -13.182 -36.158 1.00 55.31  ? 1209 ILE A C     1 
ATOM   9004  O  O     . ILE A 1 1209 ? -43.628 -13.881 -35.264 1.00 56.36  ? 1209 ILE A O     1 
ATOM   9005  C  CB    . ILE A 1 1209 ? -44.839 -12.148 -37.746 1.00 53.32  ? 1209 ILE A CB    1 
ATOM   9006  C  CG1   . ILE A 1 1209 ? -45.707 -10.902 -38.005 1.00 54.16  ? 1209 ILE A CG1   1 
ATOM   9007  C  CG2   . ILE A 1 1209 ? -45.731 -13.365 -37.479 1.00 52.50  ? 1209 ILE A CG2   1 
ATOM   9008  C  CD1   . ILE A 1 1209 ? -46.543 -10.438 -36.826 1.00 55.21  ? 1209 ILE A CD1   1 
ATOM   9009  N  N     . GLN A 1 1210 ? -42.005 -13.477 -36.767 1.00 55.85  ? 1210 GLN A N     1 
ATOM   9010  C  CA    . GLN A 1 1210 ? -41.232 -14.670 -36.417 1.00 57.72  ? 1210 GLN A CA    1 
ATOM   9011  C  C     . GLN A 1 1210 ? -40.686 -14.549 -35.005 1.00 58.70  ? 1210 GLN A C     1 
ATOM   9012  O  O     . GLN A 1 1210 ? -40.745 -15.499 -34.225 1.00 59.85  ? 1210 GLN A O     1 
ATOM   9013  C  CB    . GLN A 1 1210 ? -40.101 -14.869 -37.420 1.00 59.47  ? 1210 GLN A CB    1 
ATOM   9014  C  CG    . GLN A 1 1210 ? -39.586 -16.282 -37.552 1.00 61.37  ? 1210 GLN A CG    1 
ATOM   9015  C  CD    . GLN A 1 1210 ? -39.111 -16.574 -38.966 1.00 64.62  ? 1210 GLN A CD    1 
ATOM   9016  O  OE1   . GLN A 1 1210 ? -38.598 -15.685 -39.659 1.00 66.29  ? 1210 GLN A OE1   1 
ATOM   9017  N  NE2   . GLN A 1 1210 ? -39.297 -17.823 -39.415 1.00 65.85  ? 1210 GLN A NE2   1 
ATOM   9018  N  N     . GLY A 1 1211 ? -40.166 -13.371 -34.682 1.00 59.34  ? 1211 GLY A N     1 
ATOM   9019  C  CA    . GLY A 1 1211 ? -39.769 -13.051 -33.322 1.00 60.77  ? 1211 GLY A CA    1 
ATOM   9020  C  C     . GLY A 1 1211 ? -40.933 -12.997 -32.357 1.00 62.01  ? 1211 GLY A C     1 
ATOM   9021  O  O     . GLY A 1 1211 ? -40.829 -13.472 -31.232 1.00 62.83  ? 1211 GLY A O     1 
ATOM   9022  N  N     . MET A 1 1212 ? -42.049 -12.423 -32.794 1.00 62.01  ? 1212 MET A N     1 
ATOM   9023  C  CA    . MET A 1 1212 ? -43.247 -12.396 -31.973 1.00 64.02  ? 1212 MET A CA    1 
ATOM   9024  C  C     . MET A 1 1212 ? -43.628 -13.808 -31.544 1.00 63.14  ? 1212 MET A C     1 
ATOM   9025  O  O     . MET A 1 1212 ? -43.867 -14.047 -30.364 1.00 64.78  ? 1212 MET A O     1 
ATOM   9026  C  CB    . MET A 1 1212 ? -44.408 -11.748 -32.715 1.00 65.81  ? 1212 MET A CB    1 
ATOM   9027  C  CG    . MET A 1 1212 ? -45.625 -11.496 -31.842 1.00 68.14  ? 1212 MET A CG    1 
ATOM   9028  S  SD    . MET A 1 1212 ? -47.020 -10.921 -32.814 1.00 71.50  ? 1212 MET A SD    1 
ATOM   9029  C  CE    . MET A 1 1212 ? -47.545 -12.467 -33.568 1.00 70.56  ? 1212 MET A CE    1 
ATOM   9030  N  N     . GLY A 1 1213 ? -43.662 -14.735 -32.499 1.00 60.82  ? 1213 GLY A N     1 
ATOM   9031  C  CA    . GLY A 1 1213 ? -43.926 -16.155 -32.207 1.00 59.97  ? 1213 GLY A CA    1 
ATOM   9032  C  C     . GLY A 1 1213 ? -42.923 -16.817 -31.264 1.00 59.12  ? 1213 GLY A C     1 
ATOM   9033  O  O     . GLY A 1 1213 ? -43.325 -17.520 -30.336 1.00 59.20  ? 1213 GLY A O     1 
ATOM   9034  N  N     . LEU A 1 1214 ? -41.627 -16.589 -31.503 1.00 57.41  ? 1214 LEU A N     1 
ATOM   9035  C  CA    . LEU A 1 1214 ? -40.551 -17.090 -30.630 1.00 57.89  ? 1214 LEU A CA    1 
ATOM   9036  C  C     . LEU A 1 1214 ? -40.770 -16.731 -29.165 1.00 59.16  ? 1214 LEU A C     1 
ATOM   9037  O  O     . LEU A 1 1214 ? -40.518 -17.543 -28.277 1.00 59.60  ? 1214 LEU A O     1 
ATOM   9038  C  CB    . LEU A 1 1214 ? -39.187 -16.521 -31.069 1.00 57.83  ? 1214 LEU A CB    1 
ATOM   9039  C  CG    . LEU A 1 1214 ? -37.943 -16.648 -30.165 1.00 57.99  ? 1214 LEU A CG    1 
ATOM   9040  C  CD1   . LEU A 1 1214 ? -37.511 -18.093 -29.974 1.00 57.53  ? 1214 LEU A CD1   1 
ATOM   9041  C  CD2   . LEU A 1 1214 ? -36.800 -15.819 -30.735 1.00 58.18  ? 1214 LEU A CD2   1 
ATOM   9042  N  N     . TYR A 1 1215 ? -41.215 -15.500 -28.932 1.00 59.73  ? 1215 TYR A N     1 
ATOM   9043  C  CA    . TYR A 1 1215 ? -41.328 -14.958 -27.592 1.00 60.77  ? 1215 TYR A CA    1 
ATOM   9044  C  C     . TYR A 1 1215 ? -42.705 -15.164 -26.956 1.00 62.11  ? 1215 TYR A C     1 
ATOM   9045  O  O     . TYR A 1 1215 ? -42.811 -15.070 -25.736 1.00 63.07  ? 1215 TYR A O     1 
ATOM   9046  C  CB    . TYR A 1 1215 ? -40.980 -13.473 -27.591 1.00 60.57  ? 1215 TYR A CB    1 
ATOM   9047  C  CG    . TYR A 1 1215 ? -39.567 -13.127 -28.048 1.00 59.76  ? 1215 TYR A CG    1 
ATOM   9048  C  CD1   . TYR A 1 1215 ? -38.449 -13.606 -27.372 1.00 60.07  ? 1215 TYR A CD1   1 
ATOM   9049  C  CD2   . TYR A 1 1215 ? -39.353 -12.266 -29.127 1.00 58.77  ? 1215 TYR A CD2   1 
ATOM   9050  C  CE1   . TYR A 1 1215 ? -37.159 -13.257 -27.777 1.00 60.03  ? 1215 TYR A CE1   1 
ATOM   9051  C  CE2   . TYR A 1 1215 ? -38.076 -11.917 -29.543 1.00 58.41  ? 1215 TYR A CE2   1 
ATOM   9052  C  CZ    . TYR A 1 1215 ? -36.975 -12.406 -28.867 1.00 58.83  ? 1215 TYR A CZ    1 
ATOM   9053  O  OH    . TYR A 1 1215 ? -35.701 -12.051 -29.282 1.00 57.18  ? 1215 TYR A OH    1 
ATOM   9054  N  N     . THR A 1 1216 ? -43.746 -15.454 -27.745 1.00 62.45  ? 1216 THR A N     1 
ATOM   9055  C  CA    . THR A 1 1216 ? -45.101 -15.654 -27.189 1.00 64.51  ? 1216 THR A CA    1 
ATOM   9056  C  C     . THR A 1 1216 ? -45.674 -17.066 -27.357 1.00 64.33  ? 1216 THR A C     1 
ATOM   9057  O  O     . THR A 1 1216 ? -45.851 -17.778 -26.361 1.00 65.98  ? 1216 THR A O     1 
ATOM   9058  C  CB    . THR A 1 1216 ? -46.119 -14.626 -27.729 1.00 64.74  ? 1216 THR A CB    1 
ATOM   9059  O  OG1   . THR A 1 1216 ? -46.203 -14.723 -29.150 1.00 65.19  ? 1216 THR A OG1   1 
ATOM   9060  C  CG2   . THR A 1 1216 ? -45.711 -13.220 -27.345 1.00 65.64  ? 1216 THR A CG2   1 
ATOM   9061  N  N     . ILE A 1 1217 ? -45.977 -17.477 -28.584 1.00 63.77  ? 1217 ILE A N     1 
ATOM   9062  C  CA    . ILE A 1 1217 ? -46.760 -18.708 -28.769 1.00 64.70  ? 1217 ILE A CA    1 
ATOM   9063  C  C     . ILE A 1 1217 ? -45.994 -19.958 -29.185 1.00 62.92  ? 1217 ILE A C     1 
ATOM   9064  O  O     . ILE A 1 1217 ? -46.519 -21.044 -29.012 1.00 62.48  ? 1217 ILE A O     1 
ATOM   9065  C  CB    . ILE A 1 1217 ? -47.983 -18.498 -29.695 1.00 65.69  ? 1217 ILE A CB    1 
ATOM   9066  C  CG1   . ILE A 1 1217 ? -47.568 -18.132 -31.119 1.00 64.67  ? 1217 ILE A CG1   1 
ATOM   9067  C  CG2   . ILE A 1 1217 ? -48.913 -17.431 -29.106 1.00 66.67  ? 1217 ILE A CG2   1 
ATOM   9068  C  CD1   . ILE A 1 1217 ? -48.683 -18.354 -32.117 1.00 64.79  ? 1217 ILE A CD1   1 
ATOM   9069  N  N     . GLU A 1 1218 ? -44.774 -19.821 -29.704 1.00 62.95  ? 1218 GLU A N     1 
ATOM   9070  C  CA    . GLU A 1 1218 ? -44.015 -20.986 -30.197 1.00 63.15  ? 1218 GLU A CA    1 
ATOM   9071  C  C     . GLU A 1 1218 ? -43.331 -21.716 -29.048 1.00 65.33  ? 1218 GLU A C     1 
ATOM   9072  O  O     . GLU A 1 1218 ? -42.526 -21.128 -28.350 1.00 68.32  ? 1218 GLU A O     1 
ATOM   9073  C  CB    . GLU A 1 1218 ? -43.010 -20.584 -31.294 1.00 61.44  ? 1218 GLU A CB    1 
ATOM   9074  C  CG    . GLU A 1 1218 ? -43.701 -20.281 -32.625 1.00 60.26  ? 1218 GLU A CG    1 
ATOM   9075  C  CD    . GLU A 1 1218 ? -42.777 -19.819 -33.744 1.00 58.78  ? 1218 GLU A CD    1 
ATOM   9076  O  OE1   . GLU A 1 1218 ? -41.807 -20.534 -34.079 1.00 57.90  ? 1218 GLU A OE1   1 
ATOM   9077  O  OE2   . GLU A 1 1218 ? -43.048 -18.748 -34.331 1.00 57.48  ? 1218 GLU A OE2   1 
ATOM   9078  N  N     . GLU A 1 1219 ? -43.652 -22.999 -28.872 1.00 67.25  ? 1219 GLU A N     1 
ATOM   9079  C  CA    . GLU A 1 1219 ? -43.245 -23.773 -27.694 1.00 69.86  ? 1219 GLU A CA    1 
ATOM   9080  C  C     . GLU A 1 1219 ? -43.109 -25.269 -28.022 1.00 69.82  ? 1219 GLU A C     1 
ATOM   9081  O  O     . GLU A 1 1219 ? -44.030 -25.869 -28.579 1.00 69.48  ? 1219 GLU A O     1 
ATOM   9082  C  CB    . GLU A 1 1219 ? -44.285 -23.588 -26.587 1.00 72.67  ? 1219 GLU A CB    1 
ATOM   9083  C  CG    . GLU A 1 1219 ? -43.921 -24.233 -25.254 1.00 75.96  ? 1219 GLU A CG    1 
ATOM   9084  C  CD    . GLU A 1 1219 ? -44.995 -24.065 -24.191 1.00 78.48  ? 1219 GLU A CD    1 
ATOM   9085  O  OE1   . GLU A 1 1219 ? -46.188 -24.293 -24.495 1.00 78.67  ? 1219 GLU A OE1   1 
ATOM   9086  O  OE2   . GLU A 1 1219 ? -44.639 -23.711 -23.043 1.00 81.80  ? 1219 GLU A OE2   1 
ATOM   9087  N  N     . LEU A 1 1220 ? -41.975 -25.859 -27.649 1.00 70.24  ? 1220 LEU A N     1 
ATOM   9088  C  CA    . LEU A 1 1220 ? -41.674 -27.261 -27.929 1.00 71.11  ? 1220 LEU A CA    1 
ATOM   9089  C  C     . LEU A 1 1220 ? -41.768 -28.076 -26.661 1.00 73.48  ? 1220 LEU A C     1 
ATOM   9090  O  O     . LEU A 1 1220 ? -41.019 -27.830 -25.720 1.00 76.73  ? 1220 LEU A O     1 
ATOM   9091  C  CB    . LEU A 1 1220 ? -40.258 -27.393 -28.481 1.00 71.31  ? 1220 LEU A CB    1 
ATOM   9092  C  CG    . LEU A 1 1220 ? -40.007 -26.744 -29.840 1.00 71.18  ? 1220 LEU A CG    1 
ATOM   9093  C  CD1   . LEU A 1 1220 ? -38.512 -26.579 -30.080 1.00 71.58  ? 1220 LEU A CD1   1 
ATOM   9094  C  CD2   . LEU A 1 1220 ? -40.650 -27.558 -30.957 1.00 70.73  ? 1220 LEU A CD2   1 
ATOM   9095  N  N     . ASN A 1 1221 ? -42.664 -29.058 -26.638 1.00 73.70  ? 1221 ASN A N     1 
ATOM   9096  C  CA    . ASN A 1 1221 ? -42.883 -29.870 -25.443 1.00 74.73  ? 1221 ASN A CA    1 
ATOM   9097  C  C     . ASN A 1 1221 ? -42.184 -31.220 -25.551 1.00 73.45  ? 1221 ASN A C     1 
ATOM   9098  O  O     . ASN A 1 1221 ? -42.535 -32.036 -26.407 1.00 72.34  ? 1221 ASN A O     1 
ATOM   9099  C  CB    . ASN A 1 1221 ? -44.384 -30.071 -25.205 1.00 75.93  ? 1221 ASN A CB    1 
ATOM   9100  C  CG    . ASN A 1 1221 ? -45.118 -28.765 -24.949 1.00 75.21  ? 1221 ASN A CG    1 
ATOM   9101  O  OD1   . ASN A 1 1221 ? -46.068 -28.427 -25.653 1.00 74.68  ? 1221 ASN A OD1   1 
ATOM   9102  N  ND2   . ASN A 1 1221 ? -44.672 -28.022 -23.948 1.00 75.40  ? 1221 ASN A ND2   1 
ATOM   9103  N  N     . TYR A 1 1222 ? -41.207 -31.437 -24.670 1.00 72.92  ? 1222 TYR A N     1 
ATOM   9104  C  CA    . TYR A 1 1222 ? -40.472 -32.691 -24.574 1.00 72.61  ? 1222 TYR A CA    1 
ATOM   9105  C  C     . TYR A 1 1222 ? -40.840 -33.454 -23.305 1.00 73.09  ? 1222 TYR A C     1 
ATOM   9106  O  O     . TYR A 1 1222 ? -41.041 -32.850 -22.255 1.00 74.24  ? 1222 TYR A O     1 
ATOM   9107  C  CB    . TYR A 1 1222 ? -38.977 -32.407 -24.560 1.00 73.41  ? 1222 TYR A CB    1 
ATOM   9108  C  CG    . TYR A 1 1222 ? -38.448 -31.845 -25.851 1.00 73.15  ? 1222 TYR A CG    1 
ATOM   9109  C  CD1   . TYR A 1 1222 ? -38.075 -32.690 -26.902 1.00 72.86  ? 1222 TYR A CD1   1 
ATOM   9110  C  CD2   . TYR A 1 1222 ? -38.309 -30.470 -26.028 1.00 73.38  ? 1222 TYR A CD2   1 
ATOM   9111  C  CE1   . TYR A 1 1222 ? -37.581 -32.181 -28.093 1.00 72.19  ? 1222 TYR A CE1   1 
ATOM   9112  C  CE2   . TYR A 1 1222 ? -37.813 -29.948 -27.216 1.00 73.31  ? 1222 TYR A CE2   1 
ATOM   9113  C  CZ    . TYR A 1 1222 ? -37.455 -30.807 -28.245 1.00 72.93  ? 1222 TYR A CZ    1 
ATOM   9114  O  OH    . TYR A 1 1222 ? -36.970 -30.287 -29.423 1.00 74.38  ? 1222 TYR A OH    1 
ATOM   9115  N  N     . SER A 1 1223 ? -40.900 -34.779 -23.398 1.00 73.05  ? 1223 SER A N     1 
ATOM   9116  C  CA    . SER A 1 1223 ? -41.169 -35.623 -22.233 1.00 75.53  ? 1223 SER A CA    1 
ATOM   9117  C  C     . SER A 1 1223 ? -39.895 -35.773 -21.395 1.00 77.70  ? 1223 SER A C     1 
ATOM   9118  O  O     . SER A 1 1223 ? -38.799 -35.536 -21.905 1.00 76.85  ? 1223 SER A O     1 
ATOM   9119  C  CB    . SER A 1 1223 ? -41.690 -37.004 -22.661 1.00 75.07  ? 1223 SER A CB    1 
ATOM   9120  O  OG    . SER A 1 1223 ? -40.656 -37.841 -23.145 1.00 74.58  ? 1223 SER A OG    1 
ATOM   9121  N  N     . PRO A 1 1224 ? -40.028 -36.180 -20.114 1.00 80.64  ? 1224 PRO A N     1 
ATOM   9122  C  CA    . PRO A 1 1224 ? -38.894 -36.591 -19.270 1.00 82.10  ? 1224 PRO A CA    1 
ATOM   9123  C  C     . PRO A 1 1224 ? -37.967 -37.650 -19.867 1.00 82.85  ? 1224 PRO A C     1 
ATOM   9124  O  O     . PRO A 1 1224 ? -36.829 -37.772 -19.411 1.00 84.52  ? 1224 PRO A O     1 
ATOM   9125  C  CB    . PRO A 1 1224 ? -39.578 -37.180 -18.041 1.00 83.99  ? 1224 PRO A CB    1 
ATOM   9126  C  CG    . PRO A 1 1224 ? -40.841 -36.414 -17.924 1.00 83.80  ? 1224 PRO A CG    1 
ATOM   9127  C  CD    . PRO A 1 1224 ? -41.274 -36.086 -19.328 1.00 81.95  ? 1224 PRO A CD    1 
ATOM   9128  N  N     . GLN A 1 1225 ? -38.468 -38.429 -20.833 1.00 82.56  ? 1225 GLN A N     1 
ATOM   9129  C  CA    . GLN A 1 1225 ? -37.645 -39.337 -21.654 1.00 81.71  ? 1225 GLN A CA    1 
ATOM   9130  C  C     . GLN A 1 1225 ? -37.052 -38.703 -22.936 1.00 79.29  ? 1225 GLN A C     1 
ATOM   9131  O  O     . GLN A 1 1225 ? -36.351 -39.383 -23.680 1.00 80.32  ? 1225 GLN A O     1 
ATOM   9132  C  CB    . GLN A 1 1225 ? -38.460 -40.590 -22.026 1.00 82.36  ? 1225 GLN A CB    1 
ATOM   9133  C  CG    . GLN A 1 1225 ? -39.057 -41.341 -20.841 1.00 84.43  ? 1225 GLN A CG    1 
ATOM   9134  C  CD    . GLN A 1 1225 ? -38.009 -41.725 -19.808 1.00 87.19  ? 1225 GLN A CD    1 
ATOM   9135  O  OE1   . GLN A 1 1225 ? -36.981 -42.319 -20.143 1.00 87.57  ? 1225 GLN A OE1   1 
ATOM   9136  N  NE2   . GLN A 1 1225 ? -38.254 -41.371 -18.549 1.00 89.26  ? 1225 GLN A NE2   1 
ATOM   9137  N  N     . GLY A 1 1226 ? -37.314 -37.418 -23.186 1.00 77.20  ? 1226 GLY A N     1 
ATOM   9138  C  CA    . GLY A 1 1226 ? -36.777 -36.708 -24.347 1.00 74.99  ? 1226 GLY A CA    1 
ATOM   9139  C  C     . GLY A 1 1226 ? -37.550 -36.872 -25.647 1.00 74.02  ? 1226 GLY A C     1 
ATOM   9140  O  O     . GLY A 1 1226 ? -37.040 -36.535 -26.713 1.00 72.54  ? 1226 GLY A O     1 
ATOM   9141  N  N     . ILE A 1 1227 ? -38.778 -37.383 -25.572 1.00 74.81  ? 1227 ILE A N     1 
ATOM   9142  C  CA    . ILE A 1 1227 ? -39.620 -37.573 -26.757 1.00 73.71  ? 1227 ILE A CA    1 
ATOM   9143  C  C     . ILE A 1 1227 ? -40.308 -36.242 -27.011 1.00 73.33  ? 1227 ILE A C     1 
ATOM   9144  O  O     . ILE A 1 1227 ? -40.800 -35.629 -26.083 1.00 74.86  ? 1227 ILE A O     1 
ATOM   9145  C  CB    . ILE A 1 1227 ? -40.652 -38.722 -26.559 1.00 73.94  ? 1227 ILE A CB    1 
ATOM   9146  C  CG1   . ILE A 1 1227 ? -39.992 -40.088 -26.788 1.00 74.44  ? 1227 ILE A CG1   1 
ATOM   9147  C  CG2   . ILE A 1 1227 ? -41.829 -38.607 -27.525 1.00 73.43  ? 1227 ILE A CG2   1 
ATOM   9148  C  CD1   . ILE A 1 1227 ? -38.866 -40.436 -25.838 1.00 75.63  ? 1227 ILE A CD1   1 
ATOM   9149  N  N     . LEU A 1 1228 ? -40.329 -35.797 -28.261 1.00 73.49  ? 1228 LEU A N     1 
ATOM   9150  C  CA    . LEU A 1 1228 ? -41.051 -34.580 -28.630 1.00 73.26  ? 1228 LEU A CA    1 
ATOM   9151  C  C     . LEU A 1 1228 ? -42.541 -34.885 -28.723 1.00 75.46  ? 1228 LEU A C     1 
ATOM   9152  O  O     . LEU A 1 1228 ? -42.932 -35.907 -29.289 1.00 76.22  ? 1228 LEU A O     1 
ATOM   9153  C  CB    . LEU A 1 1228 ? -40.549 -34.049 -29.966 1.00 70.86  ? 1228 LEU A CB    1 
ATOM   9154  C  CG    . LEU A 1 1228 ? -41.198 -32.784 -30.515 1.00 69.10  ? 1228 LEU A CG    1 
ATOM   9155  C  CD1   . LEU A 1 1228 ? -40.944 -31.598 -29.606 1.00 69.63  ? 1228 LEU A CD1   1 
ATOM   9156  C  CD2   . LEU A 1 1228 ? -40.666 -32.517 -31.910 1.00 67.45  ? 1228 LEU A CD2   1 
ATOM   9157  N  N     . HIS A 1 1229 ? -43.365 -33.996 -28.168 1.00 78.07  ? 1229 HIS A N     1 
ATOM   9158  C  CA    . HIS A 1 1229 ? -44.821 -34.137 -28.225 1.00 78.52  ? 1229 HIS A CA    1 
ATOM   9159  C  C     . HIS A 1 1229 ? -45.386 -33.260 -29.316 1.00 78.36  ? 1229 HIS A C     1 
ATOM   9160  O  O     . HIS A 1 1229 ? -45.029 -32.092 -29.437 1.00 78.66  ? 1229 HIS A O     1 
ATOM   9161  C  CB    . HIS A 1 1229 ? -45.453 -33.825 -26.875 1.00 79.52  ? 1229 HIS A CB    1 
ATOM   9162  C  CG    . HIS A 1 1229 ? -45.183 -34.873 -25.847 1.00 79.76  ? 1229 HIS A CG    1 
ATOM   9163  N  ND1   . HIS A 1 1229 ? -44.921 -34.579 -24.527 1.00 79.70  ? 1229 HIS A ND1   1 
ATOM   9164  C  CD2   . HIS A 1 1229 ? -45.100 -36.220 -25.959 1.00 80.12  ? 1229 HIS A CD2   1 
ATOM   9165  C  CE1   . HIS A 1 1229 ? -44.714 -35.703 -23.867 1.00 81.37  ? 1229 HIS A CE1   1 
ATOM   9166  N  NE2   . HIS A 1 1229 ? -44.810 -36.712 -24.713 1.00 81.61  ? 1229 HIS A NE2   1 
ATOM   9167  N  N     . THR A 1 1230 ? -46.283 -33.848 -30.094 1.00 80.73  ? 1230 THR A N     1 
ATOM   9168  C  CA    . THR A 1 1230 ? -46.631 -33.343 -31.412 1.00 82.78  ? 1230 THR A CA    1 
ATOM   9169  C  C     . THR A 1 1230 ? -48.142 -33.529 -31.716 1.00 83.88  ? 1230 THR A C     1 
ATOM   9170  O  O     . THR A 1 1230 ? -48.562 -33.504 -32.877 1.00 85.04  ? 1230 THR A O     1 
ATOM   9171  C  CB    . THR A 1 1230 ? -45.713 -34.072 -32.447 1.00 82.94  ? 1230 THR A CB    1 
ATOM   9172  O  OG1   . THR A 1 1230 ? -45.617 -33.330 -33.670 1.00 83.74  ? 1230 THR A OG1   1 
ATOM   9173  C  CG2   . THR A 1 1230 ? -46.186 -35.518 -32.730 1.00 82.63  ? 1230 THR A CG2   1 
ATOM   9174  N  N     . ARG A 1 1231 ? -48.956 -33.661 -30.670 1.00 84.99  ? 1231 ARG A N     1 
ATOM   9175  C  CA    . ARG A 1 1231 ? -50.321 -34.167 -30.800 1.00 86.45  ? 1231 ARG A CA    1 
ATOM   9176  C  C     . ARG A 1 1231 ? -51.232 -33.521 -29.760 1.00 84.98  ? 1231 ARG A C     1 
ATOM   9177  O  O     . ARG A 1 1231 ? -50.824 -33.331 -28.614 1.00 84.40  ? 1231 ARG A O     1 
ATOM   9178  C  CB    . ARG A 1 1231 ? -50.298 -35.686 -30.611 1.00 91.01  ? 1231 ARG A CB    1 
ATOM   9179  C  CG    . ARG A 1 1231 ? -51.528 -36.423 -31.112 1.00 94.39  ? 1231 ARG A CG    1 
ATOM   9180  C  CD    . ARG A 1 1231 ? -51.419 -37.924 -30.852 1.00 97.52  ? 1231 ARG A CD    1 
ATOM   9181  N  NE    . ARG A 1 1231 ? -50.419 -38.581 -31.703 1.00 99.62  ? 1231 ARG A NE    1 
ATOM   9182  C  CZ    . ARG A 1 1231 ? -50.215 -39.903 -31.777 1.00 102.48 ? 1231 ARG A CZ    1 
ATOM   9183  N  NH1   . ARG A 1 1231 ? -50.949 -40.759 -31.060 1.00 104.35 ? 1231 ARG A NH1   1 
ATOM   9184  N  NH2   . ARG A 1 1231 ? -49.272 -40.384 -32.592 1.00 101.37 ? 1231 ARG A NH2   1 
ATOM   9185  N  N     . GLY A 1 1232 ? -52.459 -33.187 -30.162 1.00 83.93  ? 1232 GLY A N     1 
ATOM   9186  C  CA    . GLY A 1 1232 ? -53.418 -32.518 -29.278 1.00 83.14  ? 1232 GLY A CA    1 
ATOM   9187  C  C     . GLY A 1 1232 ? -53.036 -31.059 -29.061 1.00 82.64  ? 1232 GLY A C     1 
ATOM   9188  O  O     . GLY A 1 1232 ? -52.613 -30.392 -30.005 1.00 81.77  ? 1232 GLY A O     1 
ATOM   9189  N  N     . PRO A 1 1233 ? -53.192 -30.542 -27.825 1.00 83.18  ? 1233 PRO A N     1 
ATOM   9190  C  CA    . PRO A 1 1233 ? -52.672 -29.198 -27.520 1.00 82.13  ? 1233 PRO A CA    1 
ATOM   9191  C  C     . PRO A 1 1233 ? -51.136 -29.050 -27.494 1.00 80.84  ? 1233 PRO A C     1 
ATOM   9192  O  O     . PRO A 1 1233 ? -50.650 -27.917 -27.448 1.00 79.54  ? 1233 PRO A O     1 
ATOM   9193  C  CB    . PRO A 1 1233 ? -53.253 -28.898 -26.130 1.00 84.11  ? 1233 PRO A CB    1 
ATOM   9194  C  CG    . PRO A 1 1233 ? -53.605 -30.224 -25.558 1.00 85.32  ? 1233 PRO A CG    1 
ATOM   9195  C  CD    . PRO A 1 1233 ? -54.040 -31.049 -26.731 1.00 84.64  ? 1233 PRO A CD    1 
ATOM   9196  N  N     . ASP A 1 1234 ? -50.386 -30.160 -27.504 1.00 79.22  ? 1234 ASP A N     1 
ATOM   9197  C  CA    . ASP A 1 1234 ? -48.922 -30.104 -27.663 1.00 77.83  ? 1234 ASP A CA    1 
ATOM   9198  C  C     . ASP A 1 1234 ? -48.484 -29.705 -29.092 1.00 73.99  ? 1234 ASP A C     1 
ATOM   9199  O  O     . ASP A 1 1234 ? -47.305 -29.424 -29.312 1.00 72.46  ? 1234 ASP A O     1 
ATOM   9200  C  CB    . ASP A 1 1234 ? -48.263 -31.442 -27.284 1.00 79.46  ? 1234 ASP A CB    1 
ATOM   9201  C  CG    . ASP A 1 1234 ? -48.424 -31.795 -25.812 1.00 82.63  ? 1234 ASP A CG    1 
ATOM   9202  O  OD1   . ASP A 1 1234 ? -47.950 -31.023 -24.951 1.00 83.70  ? 1234 ASP A OD1   1 
ATOM   9203  O  OD2   . ASP A 1 1234 ? -48.996 -32.870 -25.516 1.00 84.92  ? 1234 ASP A OD2   1 
ATOM   9204  N  N     . GLN A 1 1235 ? -49.409 -29.705 -30.057 1.00 71.25  ? 1235 GLN A N     1 
ATOM   9205  C  CA    . GLN A 1 1235 ? -49.132 -29.209 -31.411 1.00 69.26  ? 1235 GLN A CA    1 
ATOM   9206  C  C     . GLN A 1 1235 ? -48.428 -27.853 -31.423 1.00 66.70  ? 1235 GLN A C     1 
ATOM   9207  O  O     . GLN A 1 1235 ? -48.775 -26.954 -30.664 1.00 66.43  ? 1235 GLN A O     1 
ATOM   9208  C  CB    . GLN A 1 1235 ? -50.412 -29.095 -32.232 1.00 70.33  ? 1235 GLN A CB    1 
ATOM   9209  C  CG    . GLN A 1 1235 ? -50.928 -30.412 -32.768 1.00 72.73  ? 1235 GLN A CG    1 
ATOM   9210  C  CD    . GLN A 1 1235 ? -52.258 -30.265 -33.490 1.00 75.85  ? 1235 GLN A CD    1 
ATOM   9211  O  OE1   . GLN A 1 1235 ? -52.841 -29.174 -33.551 1.00 80.36  ? 1235 GLN A OE1   1 
ATOM   9212  N  NE2   . GLN A 1 1235 ? -52.749 -31.366 -34.038 1.00 75.72  ? 1235 GLN A NE2   1 
ATOM   9213  N  N     . TYR A 1 1236 ? -47.444 -27.734 -32.309 1.00 63.85  ? 1236 TYR A N     1 
ATOM   9214  C  CA    . TYR A 1 1236 ? -46.624 -26.545 -32.449 1.00 61.86  ? 1236 TYR A CA    1 
ATOM   9215  C  C     . TYR A 1 1236 ? -47.364 -25.555 -33.327 1.00 61.21  ? 1236 TYR A C     1 
ATOM   9216  O  O     . TYR A 1 1236 ? -47.847 -25.910 -34.406 1.00 62.05  ? 1236 TYR A O     1 
ATOM   9217  C  CB    . TYR A 1 1236 ? -45.282 -26.917 -33.079 1.00 60.53  ? 1236 TYR A CB    1 
ATOM   9218  C  CG    . TYR A 1 1236 ? -44.272 -25.809 -33.090 1.00 60.02  ? 1236 TYR A CG    1 
ATOM   9219  C  CD1   . TYR A 1 1236 ? -44.183 -24.920 -34.165 1.00 59.11  ? 1236 TYR A CD1   1 
ATOM   9220  C  CD2   . TYR A 1 1236 ? -43.385 -25.651 -32.032 1.00 60.29  ? 1236 TYR A CD2   1 
ATOM   9221  C  CE1   . TYR A 1 1236 ? -43.241 -23.897 -34.173 1.00 58.59  ? 1236 TYR A CE1   1 
ATOM   9222  C  CE2   . TYR A 1 1236 ? -42.445 -24.634 -32.033 1.00 60.01  ? 1236 TYR A CE2   1 
ATOM   9223  C  CZ    . TYR A 1 1236 ? -42.378 -23.756 -33.098 1.00 58.97  ? 1236 TYR A CZ    1 
ATOM   9224  O  OH    . TYR A 1 1236 ? -41.424 -22.759 -33.074 1.00 58.56  ? 1236 TYR A OH    1 
ATOM   9225  N  N     . LYS A 1 1237 ? -47.435 -24.316 -32.865 1.00 61.65  ? 1237 LYS A N     1 
ATOM   9226  C  CA    . LYS A 1 1237 ? -48.241 -23.286 -33.493 1.00 61.76  ? 1237 LYS A CA    1 
ATOM   9227  C  C     . LYS A 1 1237 ? -47.362 -22.104 -33.850 1.00 60.80  ? 1237 LYS A C     1 
ATOM   9228  O  O     . LYS A 1 1237 ? -46.784 -21.480 -32.965 1.00 61.06  ? 1237 LYS A O     1 
ATOM   9229  C  CB    . LYS A 1 1237 ? -49.338 -22.833 -32.530 1.00 63.16  ? 1237 LYS A CB    1 
ATOM   9230  C  CG    . LYS A 1 1237 ? -50.312 -23.934 -32.138 1.00 64.69  ? 1237 LYS A CG    1 
ATOM   9231  C  CD    . LYS A 1 1237 ? -51.321 -24.195 -33.243 1.00 65.84  ? 1237 LYS A CD    1 
ATOM   9232  C  CE    . LYS A 1 1237 ? -51.882 -25.605 -33.175 1.00 67.53  ? 1237 LYS A CE    1 
ATOM   9233  N  NZ    . LYS A 1 1237 ? -52.909 -25.837 -34.225 1.00 68.36  ? 1237 LYS A NZ    1 
ATOM   9234  N  N     . ILE A 1 1238 ? -47.244 -21.822 -35.145 1.00 59.01  ? 1238 ILE A N     1 
ATOM   9235  C  CA    . ILE A 1 1238 ? -46.635 -20.574 -35.612 1.00 58.85  ? 1238 ILE A CA    1 
ATOM   9236  C  C     . ILE A 1 1238 ? -47.722 -19.496 -35.677 1.00 59.14  ? 1238 ILE A C     1 
ATOM   9237  O  O     . ILE A 1 1238 ? -48.896 -19.822 -35.647 1.00 59.61  ? 1238 ILE A O     1 
ATOM   9238  C  CB    . ILE A 1 1238 ? -45.923 -20.741 -36.972 1.00 58.61  ? 1238 ILE A CB    1 
ATOM   9239  C  CG1   . ILE A 1 1238 ? -46.909 -21.134 -38.100 1.00 58.81  ? 1238 ILE A CG1   1 
ATOM   9240  C  CG2   . ILE A 1 1238 ? -44.817 -21.775 -36.834 1.00 58.20  ? 1238 ILE A CG2   1 
ATOM   9241  C  CD1   . ILE A 1 1238 ? -46.293 -21.205 -39.480 1.00 57.54  ? 1238 ILE A CD1   1 
ATOM   9242  N  N     . PRO A 1 1239 ? -47.341 -18.208 -35.741 1.00 58.92  ? 1239 PRO A N     1 
ATOM   9243  C  CA    . PRO A 1 1239 ? -48.346 -17.144 -35.823 1.00 59.39  ? 1239 PRO A CA    1 
ATOM   9244  C  C     . PRO A 1 1239 ? -49.309 -17.256 -37.005 1.00 59.41  ? 1239 PRO A C     1 
ATOM   9245  O  O     . PRO A 1 1239 ? -48.877 -17.511 -38.128 1.00 60.16  ? 1239 PRO A O     1 
ATOM   9246  C  CB    . PRO A 1 1239 ? -47.490 -15.888 -35.971 1.00 58.76  ? 1239 PRO A CB    1 
ATOM   9247  C  CG    . PRO A 1 1239 ? -46.266 -16.208 -35.212 1.00 58.61  ? 1239 PRO A CG    1 
ATOM   9248  C  CD    . PRO A 1 1239 ? -46.009 -17.665 -35.428 1.00 58.27  ? 1239 PRO A CD    1 
ATOM   9249  N  N     . ALA A 1 1240 ? -50.599 -17.076 -36.738 1.00 61.08  ? 1240 ALA A N     1 
ATOM   9250  C  CA    . ALA A 1 1240 ? -51.632 -17.003 -37.784 1.00 61.23  ? 1240 ALA A CA    1 
ATOM   9251  C  C     . ALA A 1 1240 ? -52.116 -15.547 -37.936 1.00 62.55  ? 1240 ALA A C     1 
ATOM   9252  O  O     . ALA A 1 1240 ? -51.553 -14.638 -37.313 1.00 61.78  ? 1240 ALA A O     1 
ATOM   9253  C  CB    . ALA A 1 1240 ? -52.776 -17.943 -37.445 1.00 60.74  ? 1240 ALA A CB    1 
ATOM   9254  N  N     . ILE A 1 1241 ? -53.140 -15.324 -38.763 1.00 63.86  ? 1241 ILE A N     1 
ATOM   9255  C  CA    . ILE A 1 1241 ? -53.719 -13.976 -38.941 1.00 66.17  ? 1241 ILE A CA    1 
ATOM   9256  C  C     . ILE A 1 1241 ? -54.252 -13.400 -37.628 1.00 66.82  ? 1241 ILE A C     1 
ATOM   9257  O  O     . ILE A 1 1241 ? -54.109 -12.209 -37.369 1.00 66.76  ? 1241 ILE A O     1 
ATOM   9258  C  CB    . ILE A 1 1241 ? -54.832 -13.960 -40.019 1.00 67.52  ? 1241 ILE A CB    1 
ATOM   9259  C  CG1   . ILE A 1 1241 ? -54.210 -14.239 -41.386 1.00 67.48  ? 1241 ILE A CG1   1 
ATOM   9260  C  CG2   . ILE A 1 1241 ? -55.570 -12.614 -40.033 1.00 70.27  ? 1241 ILE A CG2   1 
ATOM   9261  C  CD1   . ILE A 1 1241 ? -55.137 -14.032 -42.571 1.00 68.59  ? 1241 ILE A CD1   1 
ATOM   9262  N  N     . CYS A 1 1242 ? -54.845 -14.256 -36.800 1.00 68.45  ? 1242 CYS A N     1 
ATOM   9263  C  CA    . CYS A 1 1242 ? -55.409 -13.849 -35.510 1.00 69.65  ? 1242 CYS A CA    1 
ATOM   9264  C  C     . CYS A 1 1242 ? -54.383 -13.346 -34.495 1.00 69.05  ? 1242 CYS A C     1 
ATOM   9265  O  O     . CYS A 1 1242 ? -54.769 -12.737 -33.512 1.00 71.48  ? 1242 CYS A O     1 
ATOM   9266  C  CB    . CYS A 1 1242 ? -56.204 -15.008 -34.896 1.00 70.70  ? 1242 CYS A CB    1 
ATOM   9267  S  SG    . CYS A 1 1242 ? -55.228 -16.498 -34.568 1.00 72.50  ? 1242 CYS A SG    1 
ATOM   9268  N  N     . ASP A 1 1243 ? -53.101 -13.626 -34.722 1.00 68.57  ? 1243 ASP A N     1 
ATOM   9269  C  CA    . ASP A 1 1243 ? -51.994 -13.166 -33.872 1.00 69.76  ? 1243 ASP A CA    1 
ATOM   9270  C  C     . ASP A 1 1243 ? -51.335 -11.857 -34.349 1.00 69.65  ? 1243 ASP A C     1 
ATOM   9271  O  O     . ASP A 1 1243 ? -50.488 -11.292 -33.652 1.00 68.74  ? 1243 ASP A O     1 
ATOM   9272  C  CB    . ASP A 1 1243 ? -50.928 -14.266 -33.799 1.00 70.43  ? 1243 ASP A CB    1 
ATOM   9273  C  CG    . ASP A 1 1243 ? -51.468 -15.559 -33.211 1.00 72.12  ? 1243 ASP A CG    1 
ATOM   9274  O  OD1   . ASP A 1 1243 ? -51.848 -15.532 -32.018 1.00 74.78  ? 1243 ASP A OD1   1 
ATOM   9275  O  OD2   . ASP A 1 1243 ? -51.517 -16.590 -33.928 1.00 71.30  ? 1243 ASP A OD2   1 
ATOM   9276  N  N     . MET A 1 1244 ? -51.735 -11.372 -35.519 1.00 69.69  ? 1244 MET A N     1 
ATOM   9277  C  CA    . MET A 1 1244 ? -51.095 -10.227 -36.146 1.00 71.68  ? 1244 MET A CA    1 
ATOM   9278  C  C     . MET A 1 1244 ? -51.672 -8.946  -35.529 1.00 71.55  ? 1244 MET A C     1 
ATOM   9279  O  O     . MET A 1 1244 ? -52.890 -8.809  -35.449 1.00 72.96  ? 1244 MET A O     1 
ATOM   9280  C  CB    . MET A 1 1244 ? -51.374 -10.272 -37.646 1.00 74.67  ? 1244 MET A CB    1 
ATOM   9281  C  CG    . MET A 1 1244 ? -50.326 -9.599  -38.511 1.00 78.01  ? 1244 MET A CG    1 
ATOM   9282  S  SD    . MET A 1 1244 ? -51.012 -8.274  -39.532 1.00 85.86  ? 1244 MET A SD    1 
ATOM   9283  C  CE    . MET A 1 1244 ? -52.406 -9.093  -40.320 1.00 84.13  ? 1244 MET A CE    1 
ATOM   9284  N  N     . PRO A 1 1245 ? -50.818 -8.002  -35.088 1.00 69.85  ? 1245 PRO A N     1 
ATOM   9285  C  CA    . PRO A 1 1245 ? -51.355 -6.873  -34.319 1.00 70.35  ? 1245 PRO A CA    1 
ATOM   9286  C  C     . PRO A 1 1245 ? -52.396 -6.039  -35.064 1.00 70.57  ? 1245 PRO A C     1 
ATOM   9287  O  O     . PRO A 1 1245 ? -52.171 -5.690  -36.213 1.00 69.59  ? 1245 PRO A O     1 
ATOM   9288  C  CB    . PRO A 1 1245 ? -50.113 -6.036  -33.994 1.00 70.22  ? 1245 PRO A CB    1 
ATOM   9289  C  CG    . PRO A 1 1245 ? -49.071 -6.485  -34.950 1.00 69.32  ? 1245 PRO A CG    1 
ATOM   9290  C  CD    . PRO A 1 1245 ? -49.353 -7.931  -35.199 1.00 68.85  ? 1245 PRO A CD    1 
ATOM   9291  N  N     . THR A 1 1246 ? -53.512 -5.731  -34.394 1.00 72.29  ? 1246 THR A N     1 
ATOM   9292  C  CA    . THR A 1 1246 ? -54.643 -5.001  -34.985 1.00 74.96  ? 1246 THR A CA    1 
ATOM   9293  C  C     . THR A 1 1246 ? -54.169 -3.799  -35.792 1.00 76.76  ? 1246 THR A C     1 
ATOM   9294  O  O     . THR A 1 1246 ? -54.614 -3.594  -36.913 1.00 77.29  ? 1246 THR A O     1 
ATOM   9295  C  CB    . THR A 1 1246 ? -55.657 -4.542  -33.899 1.00 77.36  ? 1246 THR A CB    1 
ATOM   9296  O  OG1   . THR A 1 1246 ? -56.225 -5.690  -33.261 1.00 79.37  ? 1246 THR A OG1   1 
ATOM   9297  C  CG2   . THR A 1 1246 ? -56.796 -3.674  -34.472 1.00 77.92  ? 1246 THR A CG2   1 
ATOM   9298  N  N     . GLU A 1 1247 ? -53.259 -3.019  -35.218 1.00 79.31  ? 1247 GLU A N     1 
ATOM   9299  C  CA    . GLU A 1 1247 ? -52.650 -1.886  -35.907 1.00 80.63  ? 1247 GLU A CA    1 
ATOM   9300  C  C     . GLU A 1 1247 ? -51.158 -2.152  -36.103 1.00 78.32  ? 1247 GLU A C     1 
ATOM   9301  O  O     . GLU A 1 1247 ? -50.515 -2.785  -35.268 1.00 78.36  ? 1247 GLU A O     1 
ATOM   9302  C  CB    . GLU A 1 1247 ? -52.871 -0.615  -35.096 1.00 84.29  ? 1247 GLU A CB    1 
ATOM   9303  C  CG    . GLU A 1 1247 ? -53.586 0.493   -35.848 1.00 86.32  ? 1247 GLU A CG    1 
ATOM   9304  C  CD    . GLU A 1 1247 ? -53.911 1.664   -34.944 1.00 90.58  ? 1247 GLU A CD    1 
ATOM   9305  O  OE1   . GLU A 1 1247 ? -54.406 1.431   -33.814 1.00 91.88  ? 1247 GLU A OE1   1 
ATOM   9306  O  OE2   . GLU A 1 1247 ? -53.670 2.820   -35.361 1.00 94.12  ? 1247 GLU A OE2   1 
ATOM   9307  N  N     . LEU A 1 1248 ? -50.607 -1.667  -37.205 1.00 75.99  ? 1248 LEU A N     1 
ATOM   9308  C  CA    . LEU A 1 1248 ? -49.213 -1.921  -37.513 1.00 74.99  ? 1248 LEU A CA    1 
ATOM   9309  C  C     . LEU A 1 1248 ? -48.635 -0.806  -38.369 1.00 74.44  ? 1248 LEU A C     1 
ATOM   9310  O  O     . LEU A 1 1248 ? -49.008 -0.660  -39.519 1.00 73.59  ? 1248 LEU A O     1 
ATOM   9311  C  CB    . LEU A 1 1248 ? -49.097 -3.269  -38.227 1.00 74.48  ? 1248 LEU A CB    1 
ATOM   9312  C  CG    . LEU A 1 1248 ? -47.730 -3.741  -38.729 1.00 73.74  ? 1248 LEU A CG    1 
ATOM   9313  C  CD1   . LEU A 1 1248 ? -46.699 -3.815  -37.613 1.00 74.10  ? 1248 LEU A CD1   1 
ATOM   9314  C  CD2   . LEU A 1 1248 ? -47.907 -5.099  -39.385 1.00 73.52  ? 1248 LEU A CD2   1 
ATOM   9315  N  N     . HIS A 1 1249 ? -47.708 -0.035  -37.808 1.00 74.93  ? 1249 HIS A N     1 
ATOM   9316  C  CA    . HIS A 1 1249 ? -47.068 1.072   -38.526 1.00 74.95  ? 1249 HIS A CA    1 
ATOM   9317  C  C     . HIS A 1 1249 ? -45.590 0.789   -38.713 1.00 71.46  ? 1249 HIS A C     1 
ATOM   9318  O  O     . HIS A 1 1249 ? -44.929 0.370   -37.764 1.00 69.97  ? 1249 HIS A O     1 
ATOM   9319  C  CB    . HIS A 1 1249 ? -47.272 2.358   -37.749 1.00 77.68  ? 1249 HIS A CB    1 
ATOM   9320  C  CG    . HIS A 1 1249 ? -48.706 2.641   -37.461 1.00 80.00  ? 1249 HIS A CG    1 
ATOM   9321  N  ND1   . HIS A 1 1249 ? -49.463 3.495   -38.229 1.00 82.61  ? 1249 HIS A ND1   1 
ATOM   9322  C  CD2   . HIS A 1 1249 ? -49.538 2.143   -36.520 1.00 81.28  ? 1249 HIS A CD2   1 
ATOM   9323  C  CE1   . HIS A 1 1249 ? -50.696 3.534   -37.757 1.00 83.57  ? 1249 HIS A CE1   1 
ATOM   9324  N  NE2   . HIS A 1 1249 ? -50.767 2.721   -36.719 1.00 83.46  ? 1249 HIS A NE2   1 
ATOM   9325  N  N     . ILE A 1 1250 ? -45.087 0.990   -39.936 1.00 68.87  ? 1250 ILE A N     1 
ATOM   9326  C  CA    . ILE A 1 1250 ? -43.676 0.733   -40.251 1.00 68.01  ? 1250 ILE A CA    1 
ATOM   9327  C  C     . ILE A 1 1250 ? -43.058 1.879   -41.040 1.00 68.16  ? 1250 ILE A C     1 
ATOM   9328  O  O     . ILE A 1 1250 ? -43.479 2.166   -42.160 1.00 66.85  ? 1250 ILE A O     1 
ATOM   9329  C  CB    . ILE A 1 1250 ? -43.458 -0.579  -41.032 1.00 66.06  ? 1250 ILE A CB    1 
ATOM   9330  C  CG1   . ILE A 1 1250 ? -44.022 -1.767  -40.241 1.00 65.54  ? 1250 ILE A CG1   1 
ATOM   9331  C  CG2   . ILE A 1 1250 ? -41.969 -0.782  -41.310 1.00 65.26  ? 1250 ILE A CG2   1 
ATOM   9332  C  CD1   . ILE A 1 1250 ? -44.064 -3.071  -40.998 1.00 64.41  ? 1250 ILE A CD1   1 
ATOM   9333  N  N     . ALA A 1 1251 ? -42.034 2.492   -40.444 1.00 69.18  ? 1251 ALA A N     1 
ATOM   9334  C  CA    . ALA A 1 1251 ? -41.334 3.630   -41.019 1.00 70.10  ? 1251 ALA A CA    1 
ATOM   9335  C  C     . ALA A 1 1251 ? -39.896 3.239   -41.360 1.00 71.47  ? 1251 ALA A C     1 
ATOM   9336  O  O     . ALA A 1 1251 ? -39.245 2.512   -40.592 1.00 71.37  ? 1251 ALA A O     1 
ATOM   9337  C  CB    . ALA A 1 1251 ? -41.344 4.780   -40.036 1.00 70.79  ? 1251 ALA A CB    1 
ATOM   9338  N  N     . LEU A 1 1252 ? -39.419 3.708   -42.519 1.00 72.02  ? 1252 LEU A N     1 
ATOM   9339  C  CA    . LEU A 1 1252 ? -38.011 3.622   -42.895 1.00 71.65  ? 1252 LEU A CA    1 
ATOM   9340  C  C     . LEU A 1 1252 ? -37.343 4.982   -42.694 1.00 75.54  ? 1252 LEU A C     1 
ATOM   9341  O  O     . LEU A 1 1252 ? -37.630 5.948   -43.413 1.00 76.97  ? 1252 LEU A O     1 
ATOM   9342  C  CB    . LEU A 1 1252 ? -37.863 3.185   -44.347 1.00 70.07  ? 1252 LEU A CB    1 
ATOM   9343  C  CG    . LEU A 1 1252 ? -38.437 1.819   -44.733 1.00 68.61  ? 1252 LEU A CG    1 
ATOM   9344  C  CD1   . LEU A 1 1252 ? -38.033 1.476   -46.158 1.00 67.67  ? 1252 LEU A CD1   1 
ATOM   9345  C  CD2   . LEU A 1 1252 ? -38.007 0.714   -43.776 1.00 68.07  ? 1252 LEU A CD2   1 
ATOM   9346  N  N     . LEU A 1 1253 ? -36.454 5.045   -41.708 1.00 78.47  ? 1253 LEU A N     1 
ATOM   9347  C  CA    . LEU A 1 1253 ? -35.675 6.253   -41.392 1.00 82.04  ? 1253 LEU A CA    1 
ATOM   9348  C  C     . LEU A 1 1253 ? -35.024 6.809   -42.666 1.00 82.66  ? 1253 LEU A C     1 
ATOM   9349  O  O     . LEU A 1 1253 ? -34.515 6.033   -43.456 1.00 82.57  ? 1253 LEU A O     1 
ATOM   9350  C  CB    . LEU A 1 1253 ? -34.607 5.888   -40.355 1.00 82.52  ? 1253 LEU A CB    1 
ATOM   9351  C  CG    . LEU A 1 1253 ? -33.876 6.979   -39.581 1.00 84.89  ? 1253 LEU A CG    1 
ATOM   9352  C  CD1   . LEU A 1 1253 ? -33.338 6.394   -38.282 1.00 85.34  ? 1253 LEU A CD1   1 
ATOM   9353  C  CD2   . LEU A 1 1253 ? -32.760 7.620   -40.394 1.00 86.16  ? 1253 LEU A CD2   1 
ATOM   9354  N  N     . PRO A 1 1254 ? -35.070 8.139   -42.894 1.00 86.61  ? 1254 PRO A N     1 
ATOM   9355  C  CA    . PRO A 1 1254 ? -34.420 8.680   -44.108 1.00 88.90  ? 1254 PRO A CA    1 
ATOM   9356  C  C     . PRO A 1 1254 ? -32.899 8.392   -44.200 1.00 92.62  ? 1254 PRO A C     1 
ATOM   9357  O  O     . PRO A 1 1254 ? -32.197 8.529   -43.202 1.00 93.02  ? 1254 PRO A O     1 
ATOM   9358  C  CB    . PRO A 1 1254 ? -34.677 10.188  -43.998 1.00 88.60  ? 1254 PRO A CB    1 
ATOM   9359  C  CG    . PRO A 1 1254 ? -35.913 10.300  -43.184 1.00 87.85  ? 1254 PRO A CG    1 
ATOM   9360  C  CD    . PRO A 1 1254 ? -35.869 9.168   -42.202 1.00 87.06  ? 1254 PRO A CD    1 
ATOM   9361  N  N     . PRO A 1 1255 ? -32.389 8.041   -45.401 1.00 97.65  ? 1255 PRO A N     1 
ATOM   9362  C  CA    . PRO A 1 1255 ? -31.041 7.456   -45.590 1.00 99.71  ? 1255 PRO A CA    1 
ATOM   9363  C  C     . PRO A 1 1255 ? -29.881 8.386   -45.233 1.00 104.54 ? 1255 PRO A C     1 
ATOM   9364  O  O     . PRO A 1 1255 ? -30.108 9.583   -45.051 1.00 105.97 ? 1255 PRO A O     1 
ATOM   9365  C  CB    . PRO A 1 1255 ? -31.003 7.147   -47.090 1.00 99.15  ? 1255 PRO A CB    1 
ATOM   9366  C  CG    . PRO A 1 1255 ? -31.945 8.125   -47.723 1.00 99.02  ? 1255 PRO A CG    1 
ATOM   9367  C  CD    . PRO A 1 1255 ? -32.986 8.478   -46.680 1.00 98.80  ? 1255 PRO A CD    1 
ATOM   9368  N  N     . SER A 1 1256 ? -28.656 7.845   -45.140 1.00 109.25 ? 1256 SER A N     1 
ATOM   9369  C  CA    . SER A 1 1256 ? -27.453 8.684   -44.891 1.00 115.01 ? 1256 SER A CA    1 
ATOM   9370  C  C     . SER A 1 1256 ? -26.073 8.121   -45.333 1.00 114.22 ? 1256 SER A C     1 
ATOM   9371  O  O     . SER A 1 1256 ? -25.071 8.357   -44.653 1.00 117.49 ? 1256 SER A O     1 
ATOM   9372  C  CB    . SER A 1 1256 ? -27.394 9.127   -43.408 1.00 117.56 ? 1256 SER A CB    1 
ATOM   9373  O  OG    . SER A 1 1256 ? -26.883 8.104   -42.566 1.00 118.56 ? 1256 SER A OG    1 
ATOM   9374  N  N     . GLN A 1 1257 ? -26.027 7.407   -46.460 1.00 111.10 ? 1257 GLN A N     1 
ATOM   9375  C  CA    . GLN A 1 1257 ? -24.770 7.103   -47.195 1.00 111.33 ? 1257 GLN A CA    1 
ATOM   9376  C  C     . GLN A 1 1257 ? -23.721 6.201   -46.520 1.00 109.81 ? 1257 GLN A C     1 
ATOM   9377  O  O     . GLN A 1 1257 ? -23.161 6.534   -45.481 1.00 108.97 ? 1257 GLN A O     1 
ATOM   9378  C  CB    . GLN A 1 1257 ? -24.077 8.395   -47.655 1.00 114.40 ? 1257 GLN A CB    1 
ATOM   9379  C  CG    . GLN A 1 1257 ? -24.988 9.390   -48.365 1.00 116.49 ? 1257 GLN A CG    1 
ATOM   9380  C  CD    . GLN A 1 1257 ? -25.780 8.760   -49.498 1.00 115.51 ? 1257 GLN A CD    1 
ATOM   9381  O  OE1   . GLN A 1 1257 ? -25.228 8.030   -50.323 1.00 113.96 ? 1257 GLN A OE1   1 
ATOM   9382  N  NE2   . GLN A 1 1257 ? -27.080 9.029   -49.536 1.00 115.06 ? 1257 GLN A NE2   1 
ATOM   9383  N  N     . ASN A 1 1258 ? -23.430 5.085   -47.186 1.00 110.49 ? 1258 ASN A N     1 
ATOM   9384  C  CA    . ASN A 1 1258 ? -22.494 4.051   -46.737 1.00 108.60 ? 1258 ASN A CA    1 
ATOM   9385  C  C     . ASN A 1 1258 ? -21.695 3.621   -47.969 1.00 105.02 ? 1258 ASN A C     1 
ATOM   9386  O  O     . ASN A 1 1258 ? -21.994 2.593   -48.583 1.00 101.67 ? 1258 ASN A O     1 
ATOM   9387  C  CB    . ASN A 1 1258 ? -23.244 2.845   -46.131 1.00 108.32 ? 1258 ASN A CB    1 
ATOM   9388  C  CG    . ASN A 1 1258 ? -24.154 3.229   -44.971 1.00 110.52 ? 1258 ASN A CG    1 
ATOM   9389  O  OD1   . ASN A 1 1258 ? -23.773 4.016   -44.102 1.00 114.25 ? 1258 ASN A OD1   1 
ATOM   9390  N  ND2   . ASN A 1 1258 ? -25.365 2.672   -44.955 1.00 107.67 ? 1258 ASN A ND2   1 
ATOM   9391  N  N     . SER A 1 1259 ? -20.702 4.436   -48.336 1.00 103.69 ? 1259 SER A N     1 
ATOM   9392  C  CA    . SER A 1 1259 ? -19.850 4.205   -49.527 1.00 102.36 ? 1259 SER A CA    1 
ATOM   9393  C  C     . SER A 1 1259 ? -19.290 2.770   -49.621 1.00 100.51 ? 1259 SER A C     1 
ATOM   9394  O  O     . SER A 1 1259 ? -19.106 2.234   -50.715 1.00 99.25  ? 1259 SER A O     1 
ATOM   9395  C  CB    . SER A 1 1259 ? -18.699 5.224   -49.548 1.00 103.43 ? 1259 SER A CB    1 
ATOM   9396  O  OG    . SER A 1 1259 ? -17.837 5.025   -50.655 1.00 102.42 ? 1259 SER A OG    1 
ATOM   9397  N  N     . ASN A 1 1260 ? -19.009 2.185   -48.460 1.00 98.09  ? 1260 ASN A N     1 
ATOM   9398  C  CA    . ASN A 1 1260 ? -18.636 0.768   -48.308 1.00 95.27  ? 1260 ASN A CA    1 
ATOM   9399  C  C     . ASN A 1 1260 ? -19.630 -0.337  -48.802 1.00 89.74  ? 1260 ASN A C     1 
ATOM   9400  O  O     . ASN A 1 1260 ? -19.186 -1.382  -49.287 1.00 89.65  ? 1260 ASN A O     1 
ATOM   9401  C  CB    . ASN A 1 1260 ? -18.286 0.509   -46.833 1.00 96.64  ? 1260 ASN A CB    1 
ATOM   9402  C  CG    . ASN A 1 1260 ? -19.427 0.865   -45.891 1.00 97.13  ? 1260 ASN A CG    1 
ATOM   9403  O  OD1   . ASN A 1 1260 ? -20.053 1.913   -46.031 1.00 96.18  ? 1260 ASN A OD1   1 
ATOM   9404  N  ND2   . ASN A 1 1260 ? -19.701 -0.006  -44.932 1.00 98.34  ? 1260 ASN A ND2   1 
ATOM   9405  N  N     . THR A 1 1261 ? -20.942 -0.134  -48.658 1.00 83.63  ? 1261 THR A N     1 
ATOM   9406  C  CA    . THR A 1 1261 ? -21.943 -1.147  -49.068 1.00 77.45  ? 1261 THR A CA    1 
ATOM   9407  C  C     . THR A 1 1261 ? -22.556 -0.850  -50.439 1.00 74.48  ? 1261 THR A C     1 
ATOM   9408  O  O     . THR A 1 1261 ? -22.417 0.251   -50.972 1.00 76.27  ? 1261 THR A O     1 
ATOM   9409  C  CB    . THR A 1 1261 ? -23.094 -1.277  -48.048 1.00 76.20  ? 1261 THR A CB    1 
ATOM   9410  O  OG1   . THR A 1 1261 ? -23.881 -0.082  -48.046 1.00 76.74  ? 1261 THR A OG1   1 
ATOM   9411  C  CG2   . THR A 1 1261 ? -22.566 -1.538  -46.647 1.00 76.66  ? 1261 THR A CG2   1 
ATOM   9412  N  N     . LEU A 1 1262 ? -23.249 -1.842  -50.987 1.00 70.39  ? 1262 LEU A N     1 
ATOM   9413  C  CA    . LEU A 1 1262 ? -23.856 -1.755  -52.324 1.00 68.22  ? 1262 LEU A CA    1 
ATOM   9414  C  C     . LEU A 1 1262 ? -24.988 -0.725  -52.386 1.00 67.65  ? 1262 LEU A C     1 
ATOM   9415  O  O     . LEU A 1 1262 ? -26.071 -0.944  -51.820 1.00 66.00  ? 1262 LEU A O     1 
ATOM   9416  C  CB    . LEU A 1 1262 ? -24.396 -3.126  -52.751 1.00 66.74  ? 1262 LEU A CB    1 
ATOM   9417  C  CG    . LEU A 1 1262 ? -25.192 -3.219  -54.056 1.00 65.27  ? 1262 LEU A CG    1 
ATOM   9418  C  CD1   . LEU A 1 1262 ? -24.310 -2.931  -55.261 1.00 65.61  ? 1262 LEU A CD1   1 
ATOM   9419  C  CD2   . LEU A 1 1262 ? -25.838 -4.585  -54.155 1.00 64.03  ? 1262 LEU A CD2   1 
ATOM   9420  N  N     . TYR A 1 1263 ? -24.730 0.375   -53.096 1.00 66.52  ? 1263 TYR A N     1 
ATOM   9421  C  CA    . TYR A 1 1263 ? -25.653 1.505   -53.197 1.00 66.04  ? 1263 TYR A CA    1 
ATOM   9422  C  C     . TYR A 1 1263 ? -26.135 2.021   -51.830 1.00 65.50  ? 1263 TYR A C     1 
ATOM   9423  O  O     . TYR A 1 1263 ? -27.296 2.406   -51.691 1.00 65.80  ? 1263 TYR A O     1 
ATOM   9424  C  CB    . TYR A 1 1263 ? -26.865 1.147   -54.074 1.00 65.33  ? 1263 TYR A CB    1 
ATOM   9425  C  CG    . TYR A 1 1263 ? -26.553 0.555   -55.429 1.00 65.02  ? 1263 TYR A CG    1 
ATOM   9426  C  CD1   . TYR A 1 1263 ? -25.524 1.070   -56.233 1.00 65.98  ? 1263 TYR A CD1   1 
ATOM   9427  C  CD2   . TYR A 1 1263 ? -27.319 -0.499  -55.936 1.00 63.36  ? 1263 TYR A CD2   1 
ATOM   9428  C  CE1   . TYR A 1 1263 ? -25.256 0.528   -57.488 1.00 65.46  ? 1263 TYR A CE1   1 
ATOM   9429  C  CE2   . TYR A 1 1263 ? -27.055 -1.048  -57.183 1.00 62.87  ? 1263 TYR A CE2   1 
ATOM   9430  C  CZ    . TYR A 1 1263 ? -26.026 -0.535  -57.956 1.00 64.36  ? 1263 TYR A CZ    1 
ATOM   9431  O  OH    . TYR A 1 1263 ? -25.772 -1.087  -59.194 1.00 64.03  ? 1263 TYR A OH    1 
ATOM   9432  N  N     . SER A 1 1264 ? -25.252 2.011   -50.831 1.00 65.37  ? 1264 SER A N     1 
ATOM   9433  C  CA    . SER A 1 1264 ? -25.576 2.454   -49.464 1.00 66.80  ? 1264 SER A CA    1 
ATOM   9434  C  C     . SER A 1 1264 ? -26.744 1.718   -48.795 1.00 66.39  ? 1264 SER A C     1 
ATOM   9435  O  O     . SER A 1 1264 ? -27.386 2.265   -47.891 1.00 66.55  ? 1264 SER A O     1 
ATOM   9436  C  CB    . SER A 1 1264 ? -25.866 3.965   -49.441 1.00 68.34  ? 1264 SER A CB    1 
ATOM   9437  O  OG    . SER A 1 1264 ? -24.832 4.686   -50.074 1.00 69.34  ? 1264 SER A OG    1 
ATOM   9438  N  N     . SER A 1 1265 ? -27.029 0.492   -49.232 1.00 65.90  ? 1265 SER A N     1 
ATOM   9439  C  CA    . SER A 1 1265 ? -28.117 -0.289  -48.651 1.00 65.66  ? 1265 SER A CA    1 
ATOM   9440  C  C     . SER A 1 1265 ? -27.595 -1.050  -47.451 1.00 65.73  ? 1265 SER A C     1 
ATOM   9441  O  O     . SER A 1 1265 ? -26.406 -1.316  -47.350 1.00 65.16  ? 1265 SER A O     1 
ATOM   9442  C  CB    . SER A 1 1265 ? -28.690 -1.260  -49.680 1.00 65.10  ? 1265 SER A CB    1 
ATOM   9443  O  OG    . SER A 1 1265 ? -27.802 -2.334  -49.929 1.00 65.51  ? 1265 SER A OG    1 
ATOM   9444  N  N     . LYS A 1 1266 ? -28.489 -1.384  -46.533 1.00 67.86  ? 1266 LYS A N     1 
ATOM   9445  C  CA    . LYS A 1 1266 ? -28.149 -2.247  -45.411 1.00 69.48  ? 1266 LYS A CA    1 
ATOM   9446  C  C     . LYS A 1 1266 ? -28.933 -3.537  -45.528 1.00 69.54  ? 1266 LYS A C     1 
ATOM   9447  O  O     . LYS A 1 1266 ? -30.154 -3.518  -45.663 1.00 68.57  ? 1266 LYS A O     1 
ATOM   9448  C  CB    . LYS A 1 1266 ? -28.442 -1.563  -44.083 1.00 70.40  ? 1266 LYS A CB    1 
ATOM   9449  C  CG    . LYS A 1 1266 ? -27.480 -0.432  -43.778 1.00 71.28  ? 1266 LYS A CG    1 
ATOM   9450  C  CD    . LYS A 1 1266 ? -27.640 0.046   -42.350 1.00 72.14  ? 1266 LYS A CD    1 
ATOM   9451  C  CE    . LYS A 1 1266 ? -26.886 1.337   -42.117 1.00 73.11  ? 1266 LYS A CE    1 
ATOM   9452  N  NZ    . LYS A 1 1266 ? -26.934 1.702   -40.680 1.00 74.49  ? 1266 LYS A NZ    1 
ATOM   9453  N  N     . GLY A 1 1267 ? -28.200 -4.646  -45.519 1.00 71.52  ? 1267 GLY A N     1 
ATOM   9454  C  CA    . GLY A 1 1267 ? -28.765 -5.979  -45.379 1.00 72.92  ? 1267 GLY A CA    1 
ATOM   9455  C  C     . GLY A 1 1267 ? -29.464 -6.204  -44.044 1.00 74.85  ? 1267 GLY A C     1 
ATOM   9456  O  O     . GLY A 1 1267 ? -28.841 -6.529  -43.026 1.00 74.19  ? 1267 GLY A O     1 
ATOM   9457  N  N     . LEU A 1 1268 ? -30.770 -5.980  -44.065 1.00 77.76  ? 1268 LEU A N     1 
ATOM   9458  C  CA    . LEU A 1 1268 ? -31.672 -6.445  -43.012 1.00 80.25  ? 1268 LEU A CA    1 
ATOM   9459  C  C     . LEU A 1 1268 ? -32.129 -7.835  -43.434 1.00 81.51  ? 1268 LEU A C     1 
ATOM   9460  O  O     . LEU A 1 1268 ? -31.733 -8.328  -44.495 1.00 88.32  ? 1268 LEU A O     1 
ATOM   9461  C  CB    . LEU A 1 1268 ? -32.865 -5.501  -42.833 1.00 80.71  ? 1268 LEU A CB    1 
ATOM   9462  C  CG    . LEU A 1 1268 ? -33.630 -5.056  -44.091 1.00 80.50  ? 1268 LEU A CG    1 
ATOM   9463  C  CD1   . LEU A 1 1268 ? -35.123 -5.229  -43.917 1.00 80.47  ? 1268 LEU A CD1   1 
ATOM   9464  C  CD2   . LEU A 1 1268 ? -33.300 -3.613  -44.457 1.00 80.92  ? 1268 LEU A CD2   1 
ATOM   9465  N  N     . GLY A 1 1269 ? -32.953 -8.476  -42.625 1.00 79.88  ? 1269 GLY A N     1 
ATOM   9466  C  CA    . GLY A 1 1269 ? -33.339 -9.852  -42.898 1.00 77.15  ? 1269 GLY A CA    1 
ATOM   9467  C  C     . GLY A 1 1269 ? -33.400 -10.602 -41.605 1.00 76.74  ? 1269 GLY A C     1 
ATOM   9468  O  O     . GLY A 1 1269 ? -34.429 -11.167 -41.269 1.00 77.81  ? 1269 GLY A O     1 
ATOM   9469  N  N     . GLU A 1 1270 ? -32.300 -10.582 -40.868 1.00 76.44  ? 1270 GLU A N     1 
ATOM   9470  C  CA    . GLU A 1 1270 ? -32.282 -11.103 -39.503 1.00 77.99  ? 1270 GLU A CA    1 
ATOM   9471  C  C     . GLU A 1 1270 ? -32.731 -10.086 -38.426 1.00 77.59  ? 1270 GLU A C     1 
ATOM   9472  O  O     . GLU A 1 1270 ? -33.119 -10.491 -37.318 1.00 78.97  ? 1270 GLU A O     1 
ATOM   9473  C  CB    . GLU A 1 1270 ? -30.884 -11.625 -39.182 1.00 78.88  ? 1270 GLU A CB    1 
ATOM   9474  C  CG    . GLU A 1 1270 ? -30.478 -12.801 -40.049 1.00 79.11  ? 1270 GLU A CG    1 
ATOM   9475  C  CD    . GLU A 1 1270 ? -29.158 -13.394 -39.620 1.00 80.06  ? 1270 GLU A CD    1 
ATOM   9476  O  OE1   . GLU A 1 1270 ? -28.124 -12.709 -39.767 1.00 81.67  ? 1270 GLU A OE1   1 
ATOM   9477  O  OE2   . GLU A 1 1270 ? -29.166 -14.541 -39.122 1.00 79.77  ? 1270 GLU A OE2   1 
ATOM   9478  N  N     . SER A 1 1271 ? -32.684 -8.790  -38.762 1.00 75.31  ? 1271 SER A N     1 
ATOM   9479  C  CA    . SER A 1 1271 ? -32.759 -7.684  -37.781 1.00 74.46  ? 1271 SER A CA    1 
ATOM   9480  C  C     . SER A 1 1271 ? -34.049 -7.674  -36.976 1.00 73.25  ? 1271 SER A C     1 
ATOM   9481  O  O     . SER A 1 1271 ? -34.019 -7.653  -35.742 1.00 74.10  ? 1271 SER A O     1 
ATOM   9482  C  CB    . SER A 1 1271 ? -32.617 -6.332  -38.489 1.00 73.66  ? 1271 SER A CB    1 
ATOM   9483  O  OG    . SER A 1 1271 ? -31.644 -6.391  -39.509 1.00 74.93  ? 1271 SER A OG    1 
ATOM   9484  N  N     . GLY A 1 1272 ? -35.169 -7.740  -37.694 1.00 70.11  ? 1272 GLY A N     1 
ATOM   9485  C  CA    . GLY A 1 1272 ? -36.493 -7.577  -37.119 1.00 68.86  ? 1272 GLY A CA    1 
ATOM   9486  C  C     . GLY A 1 1272 ? -36.983 -8.649  -36.167 1.00 67.33  ? 1272 GLY A C     1 
ATOM   9487  O  O     . GLY A 1 1272 ? -38.025 -8.471  -35.544 1.00 67.94  ? 1272 GLY A O     1 
ATOM   9488  N  N     . VAL A 1 1273 ? -36.241 -9.747  -36.034 1.00 65.80  ? 1273 VAL A N     1 
ATOM   9489  C  CA    . VAL A 1 1273 ? -36.657 -10.861 -35.177 1.00 65.30  ? 1273 VAL A CA    1 
ATOM   9490  C  C     . VAL A 1 1273 ? -36.709 -10.419 -33.712 1.00 65.76  ? 1273 VAL A C     1 
ATOM   9491  O  O     . VAL A 1 1273 ? -37.711 -10.624 -33.028 1.00 64.22  ? 1273 VAL A O     1 
ATOM   9492  C  CB    . VAL A 1 1273 ? -35.730 -12.094 -35.334 1.00 64.53  ? 1273 VAL A CB    1 
ATOM   9493  C  CG1   . VAL A 1 1273 ? -36.152 -13.216 -34.388 1.00 64.70  ? 1273 VAL A CG1   1 
ATOM   9494  C  CG2   . VAL A 1 1273 ? -35.730 -12.590 -36.774 1.00 63.50  ? 1273 VAL A CG2   1 
ATOM   9495  N  N     . PHE A 1 1274 ? -35.631 -9.794  -33.248 1.00 66.41  ? 1274 PHE A N     1 
ATOM   9496  C  CA    . PHE A 1 1274 ? -35.571 -9.301  -31.874 1.00 66.70  ? 1274 PHE A CA    1 
ATOM   9497  C  C     . PHE A 1 1274 ? -36.680 -8.286  -31.526 1.00 67.20  ? 1274 PHE A C     1 
ATOM   9498  O  O     . PHE A 1 1274 ? -37.129 -8.226  -30.375 1.00 68.14  ? 1274 PHE A O     1 
ATOM   9499  C  CB    . PHE A 1 1274 ? -34.198 -8.702  -31.580 1.00 67.21  ? 1274 PHE A CB    1 
ATOM   9500  C  CG    . PHE A 1 1274 ? -34.154 -7.947  -30.297 1.00 68.56  ? 1274 PHE A CG    1 
ATOM   9501  C  CD1   . PHE A 1 1274 ? -34.148 -8.628  -29.088 1.00 69.33  ? 1274 PHE A CD1   1 
ATOM   9502  C  CD2   . PHE A 1 1274 ? -34.189 -6.557  -30.290 1.00 69.19  ? 1274 PHE A CD2   1 
ATOM   9503  C  CE1   . PHE A 1 1274 ? -34.139 -7.938  -27.892 1.00 70.82  ? 1274 PHE A CE1   1 
ATOM   9504  C  CE2   . PHE A 1 1274 ? -34.182 -5.865  -29.101 1.00 70.52  ? 1274 PHE A CE2   1 
ATOM   9505  C  CZ    . PHE A 1 1274 ? -34.153 -6.552  -27.902 1.00 71.82  ? 1274 PHE A CZ    1 
ATOM   9506  N  N     . LEU A 1 1275 ? -37.130 -7.502  -32.507 1.00 66.33  ? 1275 LEU A N     1 
ATOM   9507  C  CA    . LEU A 1 1275 ? -38.206 -6.532  -32.270 1.00 67.29  ? 1275 LEU A CA    1 
ATOM   9508  C  C     . LEU A 1 1275 ? -39.547 -7.171  -31.851 1.00 66.35  ? 1275 LEU A C     1 
ATOM   9509  O  O     . LEU A 1 1275 ? -40.400 -6.504  -31.256 1.00 66.19  ? 1275 LEU A O     1 
ATOM   9510  C  CB    . LEU A 1 1275 ? -38.395 -5.632  -33.491 1.00 67.84  ? 1275 LEU A CB    1 
ATOM   9511  C  CG    . LEU A 1 1275 ? -37.189 -4.760  -33.866 1.00 68.95  ? 1275 LEU A CG    1 
ATOM   9512  C  CD1   . LEU A 1 1275 ? -37.605 -3.841  -35.003 1.00 69.22  ? 1275 LEU A CD1   1 
ATOM   9513  C  CD2   . LEU A 1 1275 ? -36.636 -3.953  -32.689 1.00 69.97  ? 1275 LEU A CD2   1 
ATOM   9514  N  N     . GLY A 1 1276 ? -39.715 -8.459  -32.151 1.00 64.80  ? 1276 GLY A N     1 
ATOM   9515  C  CA    . GLY A 1 1276 ? -40.805 -9.258  -31.602 1.00 64.30  ? 1276 GLY A CA    1 
ATOM   9516  C  C     . GLY A 1 1276 ? -40.924 -9.268  -30.083 1.00 64.83  ? 1276 GLY A C     1 
ATOM   9517  O  O     . GLY A 1 1276 ? -42.023 -9.454  -29.570 1.00 63.92  ? 1276 GLY A O     1 
ATOM   9518  N  N     . CYS A 1 1277 ? -39.814 -9.079  -29.363 1.00 65.52  ? 1277 CYS A N     1 
ATOM   9519  C  CA    . CYS A 1 1277 ? -39.846 -9.025  -27.892 1.00 67.82  ? 1277 CYS A CA    1 
ATOM   9520  C  C     . CYS A 1 1277 ? -40.508 -7.748  -27.326 1.00 68.74  ? 1277 CYS A C     1 
ATOM   9521  O  O     . CYS A 1 1277 ? -40.810 -7.686  -26.128 1.00 69.23  ? 1277 CYS A O     1 
ATOM   9522  C  CB    . CYS A 1 1277 ? -38.444 -9.221  -27.284 1.00 69.55  ? 1277 CYS A CB    1 
ATOM   9523  S  SG    . CYS A 1 1277 ? -37.408 -7.738  -27.190 1.00 72.57  ? 1277 CYS A SG    1 
ATOM   9524  N  N     . SER A 1 1278 ? -40.738 -6.731  -28.165 1.00 68.18  ? 1278 SER A N     1 
ATOM   9525  C  CA    . SER A 1 1278 ? -41.628 -5.625  -27.770 1.00 68.43  ? 1278 SER A CA    1 
ATOM   9526  C  C     . SER A 1 1278 ? -42.980 -6.176  -27.249 1.00 67.24  ? 1278 SER A C     1 
ATOM   9527  O  O     . SER A 1 1278 ? -43.503 -5.687  -26.252 1.00 68.47  ? 1278 SER A O     1 
ATOM   9528  C  CB    . SER A 1 1278 ? -41.816 -4.605  -28.914 1.00 67.50  ? 1278 SER A CB    1 
ATOM   9529  O  OG    . SER A 1 1278 ? -42.476 -5.163  -30.033 1.00 65.76  ? 1278 SER A OG    1 
ATOM   9530  N  N     . VAL A 1 1279 ? -43.495 -7.225  -27.893 1.00 64.20  ? 1279 VAL A N     1 
ATOM   9531  C  CA    . VAL A 1 1279 ? -44.721 -7.896  -27.454 1.00 63.62  ? 1279 VAL A CA    1 
ATOM   9532  C  C     . VAL A 1 1279 ? -44.517 -8.595  -26.098 1.00 64.13  ? 1279 VAL A C     1 
ATOM   9533  O  O     . VAL A 1 1279 ? -45.380 -8.510  -25.212 1.00 65.65  ? 1279 VAL A O     1 
ATOM   9534  C  CB    . VAL A 1 1279 ? -45.231 -8.910  -28.514 1.00 62.04  ? 1279 VAL A CB    1 
ATOM   9535  C  CG1   . VAL A 1 1279 ? -46.510 -9.596  -28.050 1.00 62.12  ? 1279 VAL A CG1   1 
ATOM   9536  C  CG2   . VAL A 1 1279 ? -45.463 -8.214  -29.850 1.00 61.62  ? 1279 VAL A CG2   1 
ATOM   9537  N  N     . PHE A 1 1280 ? -43.389 -9.288  -25.953 1.00 62.53  ? 1280 PHE A N     1 
ATOM   9538  C  CA    . PHE A 1 1280 ? -43.010 -9.963  -24.706 1.00 62.44  ? 1280 PHE A CA    1 
ATOM   9539  C  C     . PHE A 1 1280 ? -43.023 -8.998  -23.518 1.00 63.61  ? 1280 PHE A C     1 
ATOM   9540  O  O     . PHE A 1 1280 ? -43.649 -9.272  -22.492 1.00 63.97  ? 1280 PHE A O     1 
ATOM   9541  C  CB    . PHE A 1 1280 ? -41.617 -10.592 -24.867 1.00 61.91  ? 1280 PHE A CB    1 
ATOM   9542  C  CG    . PHE A 1 1280 ? -41.152 -11.395 -23.684 1.00 62.48  ? 1280 PHE A CG    1 
ATOM   9543  C  CD1   . PHE A 1 1280 ? -41.480 -12.749 -23.573 1.00 61.67  ? 1280 PHE A CD1   1 
ATOM   9544  C  CD2   . PHE A 1 1280 ? -40.357 -10.812 -22.696 1.00 63.71  ? 1280 PHE A CD2   1 
ATOM   9545  C  CE1   . PHE A 1 1280 ? -41.044 -13.509 -22.495 1.00 62.61  ? 1280 PHE A CE1   1 
ATOM   9546  C  CE2   . PHE A 1 1280 ? -39.918 -11.563 -21.608 1.00 65.08  ? 1280 PHE A CE2   1 
ATOM   9547  C  CZ    . PHE A 1 1280 ? -40.258 -12.917 -21.510 1.00 64.56  ? 1280 PHE A CZ    1 
ATOM   9548  N  N     . PHE A 1 1281 ? -42.345 -7.866  -23.669 1.00 63.59  ? 1281 PHE A N     1 
ATOM   9549  C  CA    . PHE A 1 1281 ? -42.239 -6.905  -22.573 1.00 64.84  ? 1281 PHE A CA    1 
ATOM   9550  C  C     . PHE A 1 1281 ? -43.507 -6.083  -22.359 1.00 65.35  ? 1281 PHE A C     1 
ATOM   9551  O  O     . PHE A 1 1281 ? -43.737 -5.583  -21.256 1.00 66.55  ? 1281 PHE A O     1 
ATOM   9552  C  CB    . PHE A 1 1281 ? -40.985 -6.041  -22.730 1.00 64.80  ? 1281 PHE A CB    1 
ATOM   9553  C  CG    . PHE A 1 1281 ? -39.722 -6.803  -22.460 1.00 64.57  ? 1281 PHE A CG    1 
ATOM   9554  C  CD1   . PHE A 1 1281 ? -39.426 -7.231  -21.165 1.00 65.59  ? 1281 PHE A CD1   1 
ATOM   9555  C  CD2   . PHE A 1 1281 ? -38.857 -7.143  -23.489 1.00 63.55  ? 1281 PHE A CD2   1 
ATOM   9556  C  CE1   . PHE A 1 1281 ? -38.280 -7.963  -20.899 1.00 65.54  ? 1281 PHE A CE1   1 
ATOM   9557  C  CE2   . PHE A 1 1281 ? -37.706 -7.877  -23.229 1.00 63.78  ? 1281 PHE A CE2   1 
ATOM   9558  C  CZ    . PHE A 1 1281 ? -37.417 -8.289  -21.934 1.00 64.52  ? 1281 PHE A CZ    1 
ATOM   9559  N  N     . ALA A 1 1282 ? -44.333 -5.964  -23.396 1.00 64.62  ? 1282 ALA A N     1 
ATOM   9560  C  CA    . ALA A 1 1282 ? -45.676 -5.399  -23.248 1.00 65.64  ? 1282 ALA A CA    1 
ATOM   9561  C  C     . ALA A 1 1282 ? -46.555 -6.295  -22.361 1.00 66.71  ? 1282 ALA A C     1 
ATOM   9562  O  O     . ALA A 1 1282 ? -47.247 -5.802  -21.486 1.00 67.40  ? 1282 ALA A O     1 
ATOM   9563  C  CB    . ALA A 1 1282 ? -46.320 -5.178  -24.607 1.00 64.17  ? 1282 ALA A CB    1 
ATOM   9564  N  N     . ILE A 1 1283 ? -46.494 -7.606  -22.578 1.00 67.66  ? 1283 ILE A N     1 
ATOM   9565  C  CA    . ILE A 1 1283 ? -47.207 -8.585  -21.738 1.00 69.81  ? 1283 ILE A CA    1 
ATOM   9566  C  C     . ILE A 1 1283 ? -46.630 -8.609  -20.315 1.00 72.25  ? 1283 ILE A C     1 
ATOM   9567  O  O     . ILE A 1 1283 ? -47.375 -8.689  -19.332 1.00 73.34  ? 1283 ILE A O     1 
ATOM   9568  C  CB    . ILE A 1 1283 ? -47.142 -10.018 -22.333 1.00 68.94  ? 1283 ILE A CB    1 
ATOM   9569  C  CG1   . ILE A 1 1283 ? -47.850 -10.084 -23.696 1.00 67.95  ? 1283 ILE A CG1   1 
ATOM   9570  C  CG2   . ILE A 1 1283 ? -47.767 -11.040 -21.378 1.00 69.48  ? 1283 ILE A CG2   1 
ATOM   9571  C  CD1   . ILE A 1 1283 ? -47.469 -11.290 -24.537 1.00 66.97  ? 1283 ILE A CD1   1 
ATOM   9572  N  N     . HIS A 1 1284 ? -45.301 -8.564  -20.226 1.00 73.66  ? 1284 HIS A N     1 
ATOM   9573  C  CA    . HIS A 1 1284 ? -44.585 -8.477  -18.950 1.00 75.31  ? 1284 HIS A CA    1 
ATOM   9574  C  C     . HIS A 1 1284 ? -45.074 -7.280  -18.131 1.00 77.51  ? 1284 HIS A C     1 
ATOM   9575  O  O     . HIS A 1 1284 ? -45.261 -7.390  -16.914 1.00 79.95  ? 1284 HIS A O     1 
ATOM   9576  C  CB    . HIS A 1 1284 ? -43.083 -8.360  -19.207 1.00 75.23  ? 1284 HIS A CB    1 
ATOM   9577  C  CG    . HIS A 1 1284 ? -42.238 -8.552  -17.990 1.00 77.37  ? 1284 HIS A CG    1 
ATOM   9578  N  ND1   . HIS A 1 1284 ? -42.139 -7.605  -16.992 1.00 80.19  ? 1284 HIS A ND1   1 
ATOM   9579  C  CD2   . HIS A 1 1284 ? -41.424 -9.569  -17.626 1.00 78.06  ? 1284 HIS A CD2   1 
ATOM   9580  C  CE1   . HIS A 1 1284 ? -41.316 -8.040  -16.056 1.00 81.37  ? 1284 HIS A CE1   1 
ATOM   9581  N  NE2   . HIS A 1 1284 ? -40.866 -9.228  -16.419 1.00 80.60  ? 1284 HIS A NE2   1 
ATOM   9582  N  N     . ASP A 1 1285 ? -45.274 -6.149  -18.814 1.00 77.49  ? 1285 ASP A N     1 
ATOM   9583  C  CA    . ASP A 1 1285 ? -45.805 -4.916  -18.214 1.00 78.40  ? 1285 ASP A CA    1 
ATOM   9584  C  C     . ASP A 1 1285 ? -47.233 -5.120  -17.668 1.00 78.60  ? 1285 ASP A C     1 
ATOM   9585  O  O     . ASP A 1 1285 ? -47.522 -4.771  -16.514 1.00 78.81  ? 1285 ASP A O     1 
ATOM   9586  C  CB    . ASP A 1 1285 ? -45.779 -3.777  -19.259 1.00 77.71  ? 1285 ASP A CB    1 
ATOM   9587  C  CG    . ASP A 1 1285 ? -46.064 -2.410  -18.658 1.00 79.11  ? 1285 ASP A CG    1 
ATOM   9588  O  OD1   . ASP A 1 1285 ? -45.447 -2.077  -17.626 1.00 81.42  ? 1285 ASP A OD1   1 
ATOM   9589  O  OD2   . ASP A 1 1285 ? -46.892 -1.661  -19.226 1.00 78.20  ? 1285 ASP A OD2   1 
ATOM   9590  N  N     . ALA A 1 1286 ? -48.099 -5.692  -18.510 1.00 77.11  ? 1286 ALA A N     1 
ATOM   9591  C  CA    . ALA A 1 1286 ? -49.489 -6.004  -18.155 1.00 77.38  ? 1286 ALA A CA    1 
ATOM   9592  C  C     . ALA A 1 1286 ? -49.606 -6.919  -16.935 1.00 78.80  ? 1286 ALA A C     1 
ATOM   9593  O  O     . ALA A 1 1286 ? -50.442 -6.680  -16.059 1.00 79.71  ? 1286 ALA A O     1 
ATOM   9594  C  CB    . ALA A 1 1286 ? -50.206 -6.632  -19.339 1.00 75.65  ? 1286 ALA A CB    1 
ATOM   9595  N  N     . VAL A 1 1287 ? -48.773 -7.957  -16.884 1.00 78.44  ? 1287 VAL A N     1 
ATOM   9596  C  CA    . VAL A 1 1287 ? -48.739 -8.868  -15.734 1.00 79.92  ? 1287 VAL A CA    1 
ATOM   9597  C  C     . VAL A 1 1287 ? -48.299 -8.140  -14.459 1.00 82.33  ? 1287 VAL A C     1 
ATOM   9598  O  O     . VAL A 1 1287 ? -48.867 -8.373  -13.395 1.00 83.87  ? 1287 VAL A O     1 
ATOM   9599  C  CB    . VAL A 1 1287 ? -47.828 -10.095 -15.993 1.00 79.21  ? 1287 VAL A CB    1 
ATOM   9600  C  CG1   . VAL A 1 1287 ? -47.617 -10.925 -14.729 1.00 80.16  ? 1287 VAL A CG1   1 
ATOM   9601  C  CG2   . VAL A 1 1287 ? -48.421 -10.978 -17.083 1.00 78.04  ? 1287 VAL A CG2   1 
ATOM   9602  N  N     . SER A 1 1288 ? -47.301 -7.265  -14.567 1.00 83.14  ? 1288 SER A N     1 
ATOM   9603  C  CA    . SER A 1 1288 ? -46.828 -6.490  -13.412 1.00 85.71  ? 1288 SER A CA    1 
ATOM   9604  C  C     . SER A 1 1288 ? -47.918 -5.581  -12.823 1.00 87.23  ? 1288 SER A C     1 
ATOM   9605  O  O     . SER A 1 1288 ? -48.026 -5.447  -11.600 1.00 88.86  ? 1288 SER A O     1 
ATOM   9606  C  CB    . SER A 1 1288 ? -45.592 -5.661  -13.781 1.00 86.19  ? 1288 SER A CB    1 
ATOM   9607  O  OG    . SER A 1 1288 ? -44.516 -6.495  -14.181 1.00 85.91  ? 1288 SER A OG    1 
ATOM   9608  N  N     . ALA A 1 1289 ? -48.727 -4.980  -13.698 1.00 86.47  ? 1289 ALA A N     1 
ATOM   9609  C  CA    . ALA A 1 1289 ? -49.840 -4.124  -13.280 1.00 87.10  ? 1289 ALA A CA    1 
ATOM   9610  C  C     . ALA A 1 1289 ? -50.917 -4.887  -12.510 1.00 87.80  ? 1289 ALA A C     1 
ATOM   9611  O  O     . ALA A 1 1289 ? -51.550 -4.326  -11.618 1.00 90.39  ? 1289 ALA A O     1 
ATOM   9612  C  CB    . ALA A 1 1289 ? -50.452 -3.431  -14.484 1.00 85.85  ? 1289 ALA A CB    1 
ATOM   9613  N  N     . ALA A 1 1290 ? -51.134 -6.151  -12.869 1.00 86.36  ? 1290 ALA A N     1 
ATOM   9614  C  CA    . ALA A 1 1290 ? -52.015 -7.043  -12.109 1.00 87.35  ? 1290 ALA A CA    1 
ATOM   9615  C  C     . ALA A 1 1290 ? -51.382 -7.473  -10.789 1.00 89.02  ? 1290 ALA A C     1 
ATOM   9616  O  O     . ALA A 1 1290 ? -52.093 -7.654  -9.804  1.00 90.43  ? 1290 ALA A O     1 
ATOM   9617  C  CB    . ALA A 1 1290 ? -52.387 -8.270  -12.935 1.00 85.98  ? 1290 ALA A CB    1 
ATOM   9618  N  N     . ARG A 1 1291 ? -50.060 -7.652  -10.783 1.00 89.13  ? 1291 ARG A N     1 
ATOM   9619  C  CA    . ARG A 1 1291 ? -49.318 -8.036  -9.574  1.00 91.14  ? 1291 ARG A CA    1 
ATOM   9620  C  C     . ARG A 1 1291 ? -49.101 -6.901  -8.578  1.00 93.86  ? 1291 ARG A C     1 
ATOM   9621  O  O     . ARG A 1 1291 ? -48.954 -7.165  -7.386  1.00 94.46  ? 1291 ARG A O     1 
ATOM   9622  C  CB    . ARG A 1 1291 ? -47.965 -8.656  -9.935  1.00 90.30  ? 1291 ARG A CB    1 
ATOM   9623  C  CG    . ARG A 1 1291 ? -48.066 -10.016 -10.609 1.00 88.46  ? 1291 ARG A CG    1 
ATOM   9624  C  CD    . ARG A 1 1291 ? -46.686 -10.578 -10.898 1.00 87.53  ? 1291 ARG A CD    1 
ATOM   9625  N  NE    . ARG A 1 1291 ? -46.067 -11.091 -9.679  1.00 88.82  ? 1291 ARG A NE    1 
ATOM   9626  C  CZ    . ARG A 1 1291 ? -46.272 -12.304 -9.158  1.00 89.11  ? 1291 ARG A CZ    1 
ATOM   9627  N  NH1   . ARG A 1 1291 ? -47.085 -13.186 -9.739  1.00 88.10  ? 1291 ARG A NH1   1 
ATOM   9628  N  NH2   . ARG A 1 1291 ? -45.651 -12.645 -8.033  1.00 90.68  ? 1291 ARG A NH2   1 
ATOM   9629  N  N     . GLN A 1 1292 ? -49.060 -5.654  -9.056  1.00 95.89  ? 1292 GLN A N     1 
ATOM   9630  C  CA    . GLN A 1 1292 ? -48.938 -4.488  -8.164  1.00 99.32  ? 1292 GLN A CA    1 
ATOM   9631  C  C     . GLN A 1 1292 ? -50.274 -4.187  -7.473  1.00 99.89  ? 1292 GLN A C     1 
ATOM   9632  O  O     . GLN A 1 1292 ? -50.302 -3.968  -6.266  1.00 101.17 ? 1292 GLN A O     1 
ATOM   9633  C  CB    . GLN A 1 1292 ? -48.391 -3.248  -8.909  1.00 101.14 ? 1292 GLN A CB    1 
ATOM   9634  C  CG    . GLN A 1 1292 ? -49.429 -2.406  -9.655  1.00 102.92 ? 1292 GLN A CG    1 
ATOM   9635  C  CD    . GLN A 1 1292 ? -48.846 -1.428  -10.665 1.00 104.28 ? 1292 GLN A CD    1 
ATOM   9636  O  OE1   . GLN A 1 1292 ? -47.831 -1.696  -11.317 1.00 104.48 ? 1292 GLN A OE1   1 
ATOM   9637  N  NE2   . GLN A 1 1292 ? -49.523 -0.298  -10.831 1.00 105.80 ? 1292 GLN A NE2   1 
ATOM   9638  N  N     . GLU A 1 1293 ? -51.369 -4.215  -8.238  1.00 98.93  ? 1293 GLU A N     1 
ATOM   9639  C  CA    . GLU A 1 1293 ? -52.709 -3.906  -7.736  1.00 100.33 ? 1293 GLU A CA    1 
ATOM   9640  C  C     . GLU A 1 1293 ? -53.123 -4.901  -6.651  1.00 101.87 ? 1293 GLU A C     1 
ATOM   9641  O  O     . GLU A 1 1293 ? -53.766 -4.525  -5.669  1.00 104.01 ? 1293 GLU A O     1 
ATOM   9642  C  CB    . GLU A 1 1293 ? -53.729 -3.934  -8.885  1.00 99.41  ? 1293 GLU A CB    1 
ATOM   9643  C  CG    . GLU A 1 1293 ? -55.149 -3.486  -8.519  1.00 101.34 ? 1293 GLU A CG    1 
ATOM   9644  C  CD    . GLU A 1 1293 ? -56.195 -3.825  -9.581  1.00 100.54 ? 1293 GLU A CD    1 
ATOM   9645  O  OE1   . GLU A 1 1293 ? -56.176 -4.957  -10.123 1.00 102.43 ? 1293 GLU A OE1   1 
ATOM   9646  O  OE2   . GLU A 1 1293 ? -57.053 -2.964  -9.876  1.00 100.07 ? 1293 GLU A OE2   1 
ATOM   9647  N  N     . ARG A 1 1294 ? -52.744 -6.162  -6.841  1.00 101.36 ? 1294 ARG A N     1 
ATOM   9648  C  CA    . ARG A 1 1294 ? -53.090 -7.247  -5.925  1.00 102.39 ? 1294 ARG A CA    1 
ATOM   9649  C  C     . ARG A 1 1294 ? -52.052 -7.453  -4.820  1.00 103.64 ? 1294 ARG A C     1 
ATOM   9650  O  O     . ARG A 1 1294 ? -52.308 -8.199  -3.875  1.00 104.12 ? 1294 ARG A O     1 
ATOM   9651  C  CB    . ARG A 1 1294 ? -53.281 -8.538  -6.717  1.00 101.42 ? 1294 ARG A CB    1 
ATOM   9652  C  CG    . ARG A 1 1294 ? -54.374 -8.431  -7.767  1.00 100.94 ? 1294 ARG A CG    1 
ATOM   9653  C  CD    . ARG A 1 1294 ? -54.383 -9.625  -8.696  1.00 99.82  ? 1294 ARG A CD    1 
ATOM   9654  N  NE    . ARG A 1 1294 ? -55.220 -9.394  -9.871  1.00 99.18  ? 1294 ARG A NE    1 
ATOM   9655  C  CZ    . ARG A 1 1294 ? -55.450 -10.301 -10.820 1.00 98.02  ? 1294 ARG A CZ    1 
ATOM   9656  N  NH1   . ARG A 1 1294 ? -54.901 -11.515 -10.754 1.00 97.72  ? 1294 ARG A NH1   1 
ATOM   9657  N  NH2   . ARG A 1 1294 ? -56.234 -9.992  -11.849 1.00 97.71  ? 1294 ARG A NH2   1 
ATOM   9658  N  N     . GLY A 1 1295 ? -50.882 -6.827  -4.962  1.00 103.90 ? 1295 GLY A N     1 
ATOM   9659  C  CA    . GLY A 1 1295 ? -49.919 -6.675  -3.871  1.00 106.19 ? 1295 GLY A CA    1 
ATOM   9660  C  C     . GLY A 1 1295 ? -48.877 -7.770  -3.752  1.00 107.51 ? 1295 GLY A C     1 
ATOM   9661  O  O     . GLY A 1 1295 ? -48.460 -8.093  -2.643  1.00 107.78 ? 1295 GLY A O     1 
ATOM   9662  N  N     . LEU A 1 1296 ? -48.434 -8.311  -4.891  1.00 108.97 ? 1296 LEU A N     1 
ATOM   9663  C  CA    . LEU A 1 1296 ? -47.437 -9.391  -4.931  1.00 110.57 ? 1296 LEU A CA    1 
ATOM   9664  C  C     . LEU A 1 1296 ? -46.104 -8.864  -5.468  1.00 111.55 ? 1296 LEU A C     1 
ATOM   9665  O  O     . LEU A 1 1296 ? -45.795 -8.992  -6.651  1.00 110.44 ? 1296 LEU A O     1 
ATOM   9666  C  CB    . LEU A 1 1296 ? -47.938 -10.572 -5.773  1.00 110.04 ? 1296 LEU A CB    1 
ATOM   9667  C  CG    . LEU A 1 1296 ? -49.401 -10.989 -5.567  1.00 111.10 ? 1296 LEU A CG    1 
ATOM   9668  C  CD1   . LEU A 1 1296 ? -50.279 -10.472 -6.701  1.00 110.06 ? 1296 LEU A CD1   1 
ATOM   9669  C  CD2   . LEU A 1 1296 ? -49.528 -12.500 -5.466  1.00 111.67 ? 1296 LEU A CD2   1 
ATOM   9670  N  N     . HIS A 1 1297 ? -45.312 -8.288  -4.571  1.00 116.76 ? 1297 HIS A N     1 
ATOM   9671  C  CA    . HIS A 1 1297 ? -44.044 -7.642  -4.930  1.00 119.39 ? 1297 HIS A CA    1 
ATOM   9672  C  C     . HIS A 1 1297 ? -42.942 -8.700  -5.089  1.00 120.89 ? 1297 HIS A C     1 
ATOM   9673  O  O     . HIS A 1 1297 ? -43.222 -9.909  -5.092  1.00 120.77 ? 1297 HIS A O     1 
ATOM   9674  C  CB    . HIS A 1 1297 ? -43.645 -6.605  -3.863  1.00 122.58 ? 1297 HIS A CB    1 
ATOM   9675  C  CG    . HIS A 1 1297 ? -44.756 -5.684  -3.454  1.00 124.24 ? 1297 HIS A CG    1 
ATOM   9676  N  ND1   . HIS A 1 1297 ? -45.359 -5.752  -2.216  1.00 126.44 ? 1297 HIS A ND1   1 
ATOM   9677  C  CD2   . HIS A 1 1297 ? -45.376 -4.681  -4.121  1.00 123.82 ? 1297 HIS A CD2   1 
ATOM   9678  C  CE1   . HIS A 1 1297 ? -46.298 -4.827  -2.134  1.00 126.96 ? 1297 HIS A CE1   1 
ATOM   9679  N  NE2   . HIS A 1 1297 ? -46.331 -4.165  -3.278  1.00 125.55 ? 1297 HIS A NE2   1 
ATOM   9680  N  N     . GLY A 1 1298 ? -41.699 -8.242  -5.254  1.00 122.57 ? 1298 GLY A N     1 
ATOM   9681  C  CA    . GLY A 1 1298 ? -40.524 -9.113  -5.198  1.00 123.66 ? 1298 GLY A CA    1 
ATOM   9682  C  C     . GLY A 1 1298 ? -40.157 -9.718  -6.546  1.00 123.26 ? 1298 GLY A C     1 
ATOM   9683  O  O     . GLY A 1 1298 ? -40.125 -9.001  -7.549  1.00 122.18 ? 1298 GLY A O     1 
ATOM   9684  N  N     . PRO A 1 1299 ? -39.875 -11.042 -6.586  1.00 124.63 ? 1299 PRO A N     1 
ATOM   9685  C  CA    . PRO A 1 1299 ? -39.380 -11.668 -7.820  1.00 122.26 ? 1299 PRO A CA    1 
ATOM   9686  C  C     . PRO A 1 1299 ? -40.474 -12.011 -8.846  1.00 119.05 ? 1299 PRO A C     1 
ATOM   9687  O  O     . PRO A 1 1299 ? -41.286 -12.910 -8.604  1.00 118.28 ? 1299 PRO A O     1 
ATOM   9688  C  CB    . PRO A 1 1299 ? -38.704 -12.947 -7.306  1.00 123.24 ? 1299 PRO A CB    1 
ATOM   9689  C  CG    . PRO A 1 1299 ? -39.470 -13.309 -6.076  1.00 124.60 ? 1299 PRO A CG    1 
ATOM   9690  C  CD    . PRO A 1 1299 ? -39.986 -12.024 -5.484  1.00 125.81 ? 1299 PRO A CD    1 
ATOM   9691  N  N     . LEU A 1 1300 ? -40.488 -11.287 -9.968  1.00 115.99 ? 1300 LEU A N     1 
ATOM   9692  C  CA    . LEU A 1 1300 ? -41.265 -11.672 -11.157 1.00 112.39 ? 1300 LEU A CA    1 
ATOM   9693  C  C     . LEU A 1 1300 ? -40.301 -11.883 -12.305 1.00 108.09 ? 1300 LEU A C     1 
ATOM   9694  O  O     . LEU A 1 1300 ? -39.870 -10.912 -12.936 1.00 108.44 ? 1300 LEU A O     1 
ATOM   9695  C  CB    . LEU A 1 1300 ? -42.292 -10.593 -11.551 1.00 112.24 ? 1300 LEU A CB    1 
ATOM   9696  C  CG    . LEU A 1 1300 ? -43.006 -10.767 -12.911 1.00 110.32 ? 1300 LEU A CG    1 
ATOM   9697  C  CD1   . LEU A 1 1300 ? -43.854 -12.034 -12.913 1.00 109.72 ? 1300 LEU A CD1   1 
ATOM   9698  C  CD2   . LEU A 1 1300 ? -43.832 -9.537  -13.266 1.00 110.43 ? 1300 LEU A CD2   1 
ATOM   9699  N  N     . THR A 1 1301 ? -39.950 -13.139 -12.571 1.00 103.69 ? 1301 THR A N     1 
ATOM   9700  C  CA    . THR A 1 1301 ? -39.232 -13.473 -13.803 1.00 99.68  ? 1301 THR A CA    1 
ATOM   9701  C  C     . THR A 1 1301 ? -40.147 -14.342 -14.657 1.00 94.87  ? 1301 THR A C     1 
ATOM   9702  O  O     . THR A 1 1301 ? -40.488 -15.464 -14.276 1.00 93.10  ? 1301 THR A O     1 
ATOM   9703  C  CB    . THR A 1 1301 ? -37.873 -14.183 -13.561 1.00 99.53  ? 1301 THR A CB    1 
ATOM   9704  O  OG1   . THR A 1 1301 ? -37.326 -13.799 -12.291 1.00 100.41 ? 1301 THR A OG1   1 
ATOM   9705  C  CG2   . THR A 1 1301 ? -36.866 -13.846 -14.695 1.00 97.18  ? 1301 THR A CG2   1 
ATOM   9706  N  N     . LEU A 1 1302 ? -40.583 -13.783 -15.783 1.00 90.94  ? 1302 LEU A N     1 
ATOM   9707  C  CA    . LEU A 1 1302 ? -41.318 -14.530 -16.787 1.00 87.69  ? 1302 LEU A CA    1 
ATOM   9708  C  C     . LEU A 1 1302 ? -40.317 -14.985 -17.832 1.00 83.93  ? 1302 LEU A C     1 
ATOM   9709  O  O     . LEU A 1 1302 ? -39.503 -14.186 -18.308 1.00 84.17  ? 1302 LEU A O     1 
ATOM   9710  C  CB    . LEU A 1 1302 ? -42.389 -13.658 -17.443 1.00 87.37  ? 1302 LEU A CB    1 
ATOM   9711  C  CG    . LEU A 1 1302 ? -43.471 -13.078 -16.531 1.00 89.03  ? 1302 LEU A CG    1 
ATOM   9712  C  CD1   . LEU A 1 1302 ? -44.529 -12.386 -17.381 1.00 88.18  ? 1302 LEU A CD1   1 
ATOM   9713  C  CD2   . LEU A 1 1302 ? -44.101 -14.151 -15.651 1.00 89.61  ? 1302 LEU A CD2   1 
ATOM   9714  N  N     . ASN A 1 1303 ? -40.379 -16.268 -18.175 1.00 79.18  ? 1303 ASN A N     1 
ATOM   9715  C  CA    . ASN A 1 1303 ? -39.502 -16.848 -19.179 1.00 75.74  ? 1303 ASN A CA    1 
ATOM   9716  C  C     . ASN A 1 1303 ? -40.149 -16.870 -20.549 1.00 73.30  ? 1303 ASN A C     1 
ATOM   9717  O  O     . ASN A 1 1303 ? -41.375 -16.796 -20.679 1.00 74.10  ? 1303 ASN A O     1 
ATOM   9718  C  CB    . ASN A 1 1303 ? -39.111 -18.258 -18.774 1.00 74.88  ? 1303 ASN A CB    1 
ATOM   9719  C  CG    . ASN A 1 1303 ? -38.268 -18.277 -17.532 1.00 75.62  ? 1303 ASN A CG    1 
ATOM   9720  O  OD1   . ASN A 1 1303 ? -37.236 -17.620 -17.464 1.00 75.67  ? 1303 ASN A OD1   1 
ATOM   9721  N  ND2   . ASN A 1 1303 ? -38.706 -19.021 -16.536 1.00 76.63  ? 1303 ASN A ND2   1 
ATOM   9722  N  N     . SER A 1 1304 ? -39.304 -16.973 -21.568 1.00 70.17  ? 1304 SER A N     1 
ATOM   9723  C  CA    . SER A 1 1304 ? -39.751 -17.065 -22.938 1.00 67.73  ? 1304 SER A CA    1 
ATOM   9724  C  C     . SER A 1 1304 ? -39.827 -18.555 -23.333 1.00 66.00  ? 1304 SER A C     1 
ATOM   9725  O  O     . SER A 1 1304 ? -38.948 -19.328 -22.940 1.00 65.54  ? 1304 SER A O     1 
ATOM   9726  C  CB    . SER A 1 1304 ? -38.776 -16.313 -23.821 1.00 67.51  ? 1304 SER A CB    1 
ATOM   9727  O  OG    . SER A 1 1304 ? -39.291 -16.200 -25.126 1.00 67.37  ? 1304 SER A OG    1 
ATOM   9728  N  N     . PRO A 1 1305 ? -40.845 -18.989 -24.085 1.00 64.22  ? 1305 PRO A N     1 
ATOM   9729  C  CA    . PRO A 1 1305 ? -41.937 -18.171 -24.625 1.00 63.74  ? 1305 PRO A CA    1 
ATOM   9730  C  C     . PRO A 1 1305 ? -43.019 -17.856 -23.589 1.00 64.65  ? 1305 PRO A C     1 
ATOM   9731  O  O     . PRO A 1 1305 ? -43.339 -18.698 -22.756 1.00 64.73  ? 1305 PRO A O     1 
ATOM   9732  C  CB    . PRO A 1 1305 ? -42.509 -19.066 -25.727 1.00 61.92  ? 1305 PRO A CB    1 
ATOM   9733  C  CG    . PRO A 1 1305 ? -42.313 -20.443 -25.186 1.00 62.49  ? 1305 PRO A CG    1 
ATOM   9734  C  CD    . PRO A 1 1305 ? -41.018 -20.413 -24.423 1.00 63.22  ? 1305 PRO A CD    1 
ATOM   9735  N  N     . LEU A 1 1306 ? -43.568 -16.647 -23.663 1.00 65.36  ? 1306 LEU A N     1 
ATOM   9736  C  CA    . LEU A 1 1306 ? -44.586 -16.172 -22.728 1.00 66.47  ? 1306 LEU A CA    1 
ATOM   9737  C  C     . LEU A 1 1306 ? -45.952 -16.712 -23.192 1.00 66.01  ? 1306 LEU A C     1 
ATOM   9738  O  O     . LEU A 1 1306 ? -46.724 -16.031 -23.865 1.00 64.90  ? 1306 LEU A O     1 
ATOM   9739  C  CB    . LEU A 1 1306 ? -44.550 -14.638 -22.650 1.00 67.53  ? 1306 LEU A CB    1 
ATOM   9740  C  CG    . LEU A 1 1306 ? -44.678 -13.989 -21.274 1.00 69.66  ? 1306 LEU A CG    1 
ATOM   9741  C  CD1   . LEU A 1 1306 ? -44.634 -12.477 -21.415 1.00 70.10  ? 1306 LEU A CD1   1 
ATOM   9742  C  CD2   . LEU A 1 1306 ? -45.961 -14.418 -20.596 1.00 70.61  ? 1306 LEU A CD2   1 
ATOM   9743  N  N     . THR A 1 1307 ? -46.222 -17.962 -22.831 1.00 66.71  ? 1307 THR A N     1 
ATOM   9744  C  CA    . THR A 1 1307 ? -47.396 -18.692 -23.311 1.00 66.94  ? 1307 THR A CA    1 
ATOM   9745  C  C     . THR A 1 1307 ? -48.599 -18.296 -22.461 1.00 68.91  ? 1307 THR A C     1 
ATOM   9746  O  O     . THR A 1 1307 ? -48.424 -17.643 -21.432 1.00 71.39  ? 1307 THR A O     1 
ATOM   9747  C  CB    . THR A 1 1307 ? -47.171 -20.221 -23.230 1.00 66.66  ? 1307 THR A CB    1 
ATOM   9748  O  OG1   . THR A 1 1307 ? -47.087 -20.627 -21.862 1.00 68.77  ? 1307 THR A OG1   1 
ATOM   9749  C  CG2   . THR A 1 1307 ? -45.883 -20.624 -23.937 1.00 65.89  ? 1307 THR A CG2   1 
ATOM   9750  N  N     . PRO A 1 1308 ? -49.825 -18.685 -22.872 1.00 68.86  ? 1308 PRO A N     1 
ATOM   9751  C  CA    . PRO A 1 1308 ? -50.987 -18.416 -22.009 1.00 69.91  ? 1308 PRO A CA    1 
ATOM   9752  C  C     . PRO A 1 1308 ? -50.912 -19.052 -20.612 1.00 71.50  ? 1308 PRO A C     1 
ATOM   9753  O  O     . PRO A 1 1308 ? -51.443 -18.495 -19.648 1.00 72.19  ? 1308 PRO A O     1 
ATOM   9754  C  CB    . PRO A 1 1308 ? -52.163 -19.004 -22.803 1.00 69.28  ? 1308 PRO A CB    1 
ATOM   9755  C  CG    . PRO A 1 1308 ? -51.700 -19.050 -24.216 1.00 67.78  ? 1308 PRO A CG    1 
ATOM   9756  C  CD    . PRO A 1 1308 ? -50.228 -19.323 -24.139 1.00 67.55  ? 1308 PRO A CD    1 
ATOM   9757  N  N     . GLU A 1 1309 ? -50.277 -20.218 -20.528 1.00 72.29  ? 1309 GLU A N     1 
ATOM   9758  C  CA    . GLU A 1 1309 ? -49.997 -20.875 -19.257 1.00 75.27  ? 1309 GLU A CA    1 
ATOM   9759  C  C     . GLU A 1 1309 ? -49.217 -19.944 -18.340 1.00 76.82  ? 1309 GLU A C     1 
ATOM   9760  O  O     . GLU A 1 1309 ? -49.643 -19.678 -17.212 1.00 78.08  ? 1309 GLU A O     1 
ATOM   9761  C  CB    . GLU A 1 1309 ? -49.197 -22.152 -19.504 1.00 76.07  ? 1309 GLU A CB    1 
ATOM   9762  C  CG    . GLU A 1 1309 ? -48.663 -22.850 -18.263 1.00 78.89  ? 1309 GLU A CG    1 
ATOM   9763  C  CD    . GLU A 1 1309 ? -48.022 -24.188 -18.584 1.00 80.21  ? 1309 GLU A CD    1 
ATOM   9764  O  OE1   . GLU A 1 1309 ? -47.670 -24.427 -19.761 1.00 80.21  ? 1309 GLU A OE1   1 
ATOM   9765  O  OE2   . GLU A 1 1309 ? -47.867 -25.009 -17.653 1.00 83.80  ? 1309 GLU A OE2   1 
ATOM   9766  N  N     . LYS A 1 1310 ? -48.079 -19.456 -18.838 1.00 75.92  ? 1310 LYS A N     1 
ATOM   9767  C  CA    . LYS A 1 1310 ? -47.206 -18.569 -18.062 1.00 76.32  ? 1310 LYS A CA    1 
ATOM   9768  C  C     . LYS A 1 1310 ? -47.878 -17.249 -17.676 1.00 76.75  ? 1310 LYS A C     1 
ATOM   9769  O  O     . LYS A 1 1310 ? -47.655 -16.759 -16.568 1.00 78.17  ? 1310 LYS A O     1 
ATOM   9770  C  CB    . LYS A 1 1310 ? -45.898 -18.288 -18.802 1.00 75.64  ? 1310 LYS A CB    1 
ATOM   9771  C  CG    . LYS A 1 1310 ? -44.955 -19.477 -18.885 1.00 75.99  ? 1310 LYS A CG    1 
ATOM   9772  C  CD    . LYS A 1 1310 ? -43.550 -19.033 -19.272 1.00 76.24  ? 1310 LYS A CD    1 
ATOM   9773  C  CE    . LYS A 1 1310 ? -42.641 -20.210 -19.601 1.00 76.48  ? 1310 LYS A CE    1 
ATOM   9774  N  NZ    . LYS A 1 1310 ? -42.731 -20.655 -21.022 1.00 75.28  ? 1310 LYS A NZ    1 
ATOM   9775  N  N     . ILE A 1 1311 ? -48.700 -16.687 -18.566 1.00 75.23  ? 1311 ILE A N     1 
ATOM   9776  C  CA    . ILE A 1 1311 ? -49.432 -15.446 -18.258 1.00 76.19  ? 1311 ILE A CA    1 
ATOM   9777  C  C     . ILE A 1 1311 ? -50.376 -15.668 -17.065 1.00 77.55  ? 1311 ILE A C     1 
ATOM   9778  O  O     . ILE A 1 1311 ? -50.277 -14.969 -16.052 1.00 79.16  ? 1311 ILE A O     1 
ATOM   9779  C  CB    . ILE A 1 1311 ? -50.232 -14.895 -19.471 1.00 74.69  ? 1311 ILE A CB    1 
ATOM   9780  C  CG1   . ILE A 1 1311 ? -49.276 -14.475 -20.587 1.00 73.89  ? 1311 ILE A CG1   1 
ATOM   9781  C  CG2   . ILE A 1 1311 ? -51.072 -13.689 -19.060 1.00 75.77  ? 1311 ILE A CG2   1 
ATOM   9782  C  CD1   . ILE A 1 1311 ? -49.906 -14.176 -21.932 1.00 72.70  ? 1311 ILE A CD1   1 
ATOM   9783  N  N     . ARG A 1 1312 ? -51.267 -16.651 -17.197 1.00 76.86  ? 1312 ARG A N     1 
ATOM   9784  C  CA    . ARG A 1 1312 ? -52.306 -16.928 -16.200 1.00 78.22  ? 1312 ARG A CA    1 
ATOM   9785  C  C     . ARG A 1 1312 ? -51.760 -17.141 -14.798 1.00 79.31  ? 1312 ARG A C     1 
ATOM   9786  O  O     . ARG A 1 1312 ? -52.245 -16.538 -13.843 1.00 80.54  ? 1312 ARG A O     1 
ATOM   9787  C  CB    . ARG A 1 1312 ? -53.104 -18.176 -16.598 1.00 77.98  ? 1312 ARG A CB    1 
ATOM   9788  C  CG    . ARG A 1 1312 ? -54.238 -18.556 -15.642 1.00 79.00  ? 1312 ARG A CG    1 
ATOM   9789  C  CD    . ARG A 1 1312 ? -55.407 -17.596 -15.761 1.00 78.99  ? 1312 ARG A CD    1 
ATOM   9790  N  NE    . ARG A 1 1312 ? -56.382 -17.759 -14.679 1.00 80.17  ? 1312 ARG A NE    1 
ATOM   9791  C  CZ    . ARG A 1 1312 ? -56.217 -17.356 -13.416 1.00 81.21  ? 1312 ARG A CZ    1 
ATOM   9792  N  NH1   . ARG A 1 1312 ? -55.090 -16.771 -13.001 1.00 81.37  ? 1312 ARG A NH1   1 
ATOM   9793  N  NH2   . ARG A 1 1312 ? -57.193 -17.565 -12.542 1.00 82.59  ? 1312 ARG A NH2   1 
ATOM   9794  N  N     . MET A 1 1313 ? -50.759 -18.010 -14.695 1.00 78.75  ? 1313 MET A N     1 
ATOM   9795  C  CA    . MET A 1 1313 ? -50.195 -18.421 -13.412 1.00 80.40  ? 1313 MET A CA    1 
ATOM   9796  C  C     . MET A 1 1313 ? -49.405 -17.308 -12.736 1.00 82.61  ? 1313 MET A C     1 
ATOM   9797  O  O     . MET A 1 1313 ? -49.197 -17.340 -11.519 1.00 84.55  ? 1313 MET A O     1 
ATOM   9798  C  CB    . MET A 1 1313 ? -49.312 -19.660 -13.595 1.00 80.01  ? 1313 MET A CB    1 
ATOM   9799  C  CG    . MET A 1 1313 ? -50.041 -20.905 -14.118 1.00 79.10  ? 1313 MET A CG    1 
ATOM   9800  S  SD    . MET A 1 1313 ? -51.155 -21.682 -12.923 1.00 79.56  ? 1313 MET A SD    1 
ATOM   9801  C  CE    . MET A 1 1313 ? -52.685 -20.813 -13.220 1.00 80.07  ? 1313 MET A CE    1 
ATOM   9802  N  N     . ALA A 1 1314 ? -48.971 -16.331 -13.528 1.00 83.05  ? 1314 ALA A N     1 
ATOM   9803  C  CA    . ALA A 1 1314 ? -48.369 -15.108 -13.013 1.00 84.67  ? 1314 ALA A CA    1 
ATOM   9804  C  C     . ALA A 1 1314 ? -49.410 -14.133 -12.435 1.00 86.27  ? 1314 ALA A C     1 
ATOM   9805  O  O     . ALA A 1 1314 ? -49.106 -13.415 -11.485 1.00 87.25  ? 1314 ALA A O     1 
ATOM   9806  C  CB    . ALA A 1 1314 ? -47.552 -14.434 -14.105 1.00 83.49  ? 1314 ALA A CB    1 
ATOM   9807  N  N     . CYS A 1 1315 ? -50.610 -14.084 -13.021 1.00 86.57  ? 1315 CYS A N     1 
ATOM   9808  C  CA    . CYS A 1 1315 ? -51.721 -13.292 -12.464 1.00 88.75  ? 1315 CYS A CA    1 
ATOM   9809  C  C     . CYS A 1 1315 ? -52.406 -14.058 -11.328 1.00 92.01  ? 1315 CYS A C     1 
ATOM   9810  O  O     . CYS A 1 1315 ? -53.478 -14.666 -11.505 1.00 91.19  ? 1315 CYS A O     1 
ATOM   9811  C  CB    . CYS A 1 1315 ? -52.745 -12.931 -13.539 1.00 87.08  ? 1315 CYS A CB    1 
ATOM   9812  S  SG    . CYS A 1 1315 ? -52.078 -11.930 -14.871 1.00 85.41  ? 1315 CYS A SG    1 
ATOM   9813  N  N     . GLU A 1 1316 ? -51.778 -14.019 -10.156 1.00 95.01  ? 1316 GLU A N     1 
ATOM   9814  C  CA    . GLU A 1 1316 ? -52.301 -14.718 -8.993  1.00 96.80  ? 1316 GLU A CA    1 
ATOM   9815  C  C     . GLU A 1 1316 ? -53.548 -14.012 -8.475  1.00 97.90  ? 1316 GLU A C     1 
ATOM   9816  O  O     . GLU A 1 1316 ? -53.681 -12.791 -8.582  1.00 96.69  ? 1316 GLU A O     1 
ATOM   9817  C  CB    . GLU A 1 1316 ? -51.239 -14.846 -7.903  1.00 98.99  ? 1316 GLU A CB    1 
ATOM   9818  C  CG    . GLU A 1 1316 ? -50.042 -15.685 -8.340  1.00 98.62  ? 1316 GLU A CG    1 
ATOM   9819  C  CD    . GLU A 1 1316 ? -49.051 -15.981 -7.223  1.00 100.60 ? 1316 GLU A CD    1 
ATOM   9820  O  OE1   . GLU A 1 1316 ? -49.314 -15.631 -6.050  1.00 103.35 ? 1316 GLU A OE1   1 
ATOM   9821  O  OE2   . GLU A 1 1316 ? -47.996 -16.577 -7.524  1.00 99.69  ? 1316 GLU A OE2   1 
ATOM   9822  N  N     . ASP A 1 1317 ? -54.464 -14.822 -7.959  1.00 99.92  ? 1317 ASP A N     1 
ATOM   9823  C  CA    . ASP A 1 1317 ? -55.771 -14.397 -7.456  1.00 101.94 ? 1317 ASP A CA    1 
ATOM   9824  C  C     . ASP A 1 1317 ? -56.237 -15.511 -6.512  1.00 102.83 ? 1317 ASP A C     1 
ATOM   9825  O  O     . ASP A 1 1317 ? -55.452 -16.416 -6.221  1.00 102.67 ? 1317 ASP A O     1 
ATOM   9826  C  CB    . ASP A 1 1317 ? -56.759 -14.152 -8.619  1.00 101.76 ? 1317 ASP A CB    1 
ATOM   9827  C  CG    . ASP A 1 1317 ? -56.688 -15.227 -9.719  1.00 101.15 ? 1317 ASP A CG    1 
ATOM   9828  O  OD1   . ASP A 1 1317 ? -56.517 -16.427 -9.400  1.00 101.01 ? 1317 ASP A OD1   1 
ATOM   9829  O  OD2   . ASP A 1 1317 ? -56.811 -14.859 -10.914 1.00 100.68 ? 1317 ASP A OD2   1 
ATOM   9830  N  N     . LYS A 1 1318 ? -57.481 -15.471 -6.036  1.00 103.93 ? 1318 LYS A N     1 
ATOM   9831  C  CA    . LYS A 1 1318 ? -57.991 -16.561 -5.184  1.00 105.44 ? 1318 LYS A CA    1 
ATOM   9832  C  C     . LYS A 1 1318 ? -57.976 -17.923 -5.883  1.00 103.45 ? 1318 LYS A C     1 
ATOM   9833  O  O     . LYS A 1 1318 ? -57.805 -18.948 -5.228  1.00 103.15 ? 1318 LYS A O     1 
ATOM   9834  C  CB    . LYS A 1 1318 ? -59.394 -16.254 -4.633  1.00 107.25 ? 1318 LYS A CB    1 
ATOM   9835  C  CG    . LYS A 1 1318 ? -60.526 -16.241 -5.654  1.00 106.85 ? 1318 LYS A CG    1 
ATOM   9836  C  CD    . LYS A 1 1318 ? -61.835 -15.824 -4.997  1.00 108.79 ? 1318 LYS A CD    1 
ATOM   9837  C  CE    . LYS A 1 1318 ? -62.836 -15.251 -5.990  1.00 108.60 ? 1318 LYS A CE    1 
ATOM   9838  N  NZ    . LYS A 1 1318 ? -63.919 -14.494 -5.292  1.00 110.45 ? 1318 LYS A NZ    1 
ATOM   9839  N  N     . PHE A 1 1319 ? -58.124 -17.921 -7.205  1.00 101.58 ? 1319 PHE A N     1 
ATOM   9840  C  CA    . PHE A 1 1319 ? -58.178 -19.159 -7.988  1.00 100.80 ? 1319 PHE A CA    1 
ATOM   9841  C  C     . PHE A 1 1319 ? -56.812 -19.851 -8.080  1.00 100.44 ? 1319 PHE A C     1 
ATOM   9842  O  O     . PHE A 1 1319 ? -56.739 -21.075 -8.013  1.00 100.47 ? 1319 PHE A O     1 
ATOM   9843  C  CB    . PHE A 1 1319 ? -58.778 -18.892 -9.378  1.00 99.07  ? 1319 PHE A CB    1 
ATOM   9844  C  CG    . PHE A 1 1319 ? -60.084 -18.147 -9.328  1.00 99.95  ? 1319 PHE A CG    1 
ATOM   9845  C  CD1   . PHE A 1 1319 ? -61.196 -18.719 -8.717  1.00 101.84 ? 1319 PHE A CD1   1 
ATOM   9846  C  CD2   . PHE A 1 1319 ? -60.194 -16.859 -9.844  1.00 99.68  ? 1319 PHE A CD2   1 
ATOM   9847  C  CE1   . PHE A 1 1319 ? -62.399 -18.031 -8.640  1.00 102.51 ? 1319 PHE A CE1   1 
ATOM   9848  C  CE2   . PHE A 1 1319 ? -61.394 -16.167 -9.774  1.00 100.81 ? 1319 PHE A CE2   1 
ATOM   9849  C  CZ    . PHE A 1 1319 ? -62.498 -16.755 -9.173  1.00 102.29 ? 1319 PHE A CZ    1 
ATOM   9850  N  N     . THR A 1 1320 ? -55.737 -19.076 -8.203  1.00 100.31 ? 1320 THR A N     1 
ATOM   9851  C  CA    . THR A 1 1320 ? -54.382 -19.633 -8.165  1.00 99.88  ? 1320 THR A CA    1 
ATOM   9852  C  C     . THR A 1 1320 ? -54.052 -20.254 -6.800  1.00 100.82 ? 1320 THR A C     1 
ATOM   9853  O  O     . THR A 1 1320 ? -53.425 -21.310 -6.752  1.00 99.38  ? 1320 THR A O     1 
ATOM   9854  C  CB    . THR A 1 1320 ? -53.334 -18.568 -8.537  1.00 100.41 ? 1320 THR A CB    1 
ATOM   9855  O  OG1   . THR A 1 1320 ? -53.622 -18.075 -9.852  1.00 100.46 ? 1320 THR A OG1   1 
ATOM   9856  C  CG2   . THR A 1 1320 ? -51.923 -19.143 -8.526  1.00 100.42 ? 1320 THR A CG2   1 
ATOM   9857  N  N     . LYS A 1 1321 ? -54.488 -19.613 -5.709  1.00 102.53 ? 1321 LYS A N     1 
ATOM   9858  C  CA    . LYS A 1 1321 ? -54.275 -20.146 -4.341  1.00 103.50 ? 1321 LYS A CA    1 
ATOM   9859  C  C     . LYS A 1 1321 ? -55.092 -21.418 -4.098  1.00 103.30 ? 1321 LYS A C     1 
ATOM   9860  O  O     . LYS A 1 1321 ? -54.645 -22.325 -3.402  1.00 103.86 ? 1321 LYS A O     1 
ATOM   9861  C  CB    . LYS A 1 1321 ? -54.660 -19.147 -3.233  1.00 105.42 ? 1321 LYS A CB    1 
ATOM   9862  C  CG    . LYS A 1 1321 ? -54.295 -17.677 -3.410  1.00 106.03 ? 1321 LYS A CG    1 
ATOM   9863  C  CD    . LYS A 1 1321 ? -52.886 -17.415 -3.927  1.00 105.33 ? 1321 LYS A CD    1 
ATOM   9864  C  CE    . LYS A 1 1321 ? -52.663 -15.931 -4.196  1.00 104.57 ? 1321 LYS A CE    1 
ATOM   9865  N  NZ    . LYS A 1 1321 ? -52.969 -15.065 -3.019  1.00 106.55 ? 1321 LYS A NZ    1 
ATOM   9866  N  N     . MET A 1 1322 ? -56.290 -21.457 -4.678  1.00 102.53 ? 1322 MET A N     1 
ATOM   9867  C  CA    . MET A 1 1322 ? -57.289 -22.498 -4.420  1.00 103.01 ? 1322 MET A CA    1 
ATOM   9868  C  C     . MET A 1 1322 ? -56.938 -23.886 -4.953  1.00 101.39 ? 1322 MET A C     1 
ATOM   9869  O  O     . MET A 1 1322 ? -57.263 -24.881 -4.308  1.00 102.54 ? 1322 MET A O     1 
ATOM   9870  C  CB    . MET A 1 1322 ? -58.624 -22.056 -5.028  1.00 103.94 ? 1322 MET A CB    1 
ATOM   9871  C  CG    . MET A 1 1322 ? -59.851 -22.845 -4.613  1.00 106.22 ? 1322 MET A CG    1 
ATOM   9872  S  SD    . MET A 1 1322 ? -61.336 -22.042 -5.260  1.00 107.53 ? 1322 MET A SD    1 
ATOM   9873  C  CE    . MET A 1 1322 ? -61.461 -20.576 -4.230  1.00 109.10 ? 1322 MET A CE    1 
ATOM   9874  N  N     . ILE A 1 1323 ? -56.291 -23.954 -6.117  1.00 98.95  ? 1323 ILE A N     1 
ATOM   9875  C  CA    . ILE A 1 1323 ? -56.100 -25.234 -6.818  1.00 97.72  ? 1323 ILE A CA    1 
ATOM   9876  C  C     . ILE A 1 1323 ? -55.255 -26.239 -6.016  1.00 98.23  ? 1323 ILE A C     1 
ATOM   9877  O  O     . ILE A 1 1323 ? -54.318 -25.835 -5.322  1.00 98.29  ? 1323 ILE A O     1 
ATOM   9878  C  CB    . ILE A 1 1323 ? -55.509 -25.063 -8.252  1.00 95.61  ? 1323 ILE A CB    1 
ATOM   9879  C  CG1   . ILE A 1 1323 ? -54.082 -24.488 -8.236  1.00 95.38  ? 1323 ILE A CG1   1 
ATOM   9880  C  CG2   . ILE A 1 1323 ? -56.428 -24.227 -9.134  1.00 94.70  ? 1323 ILE A CG2   1 
ATOM   9881  C  CD1   . ILE A 1 1323 ? -53.022 -25.514 -8.573  1.00 94.88  ? 1323 ILE A CD1   1 
ATOM   9882  N  N     . PRO A 1 1324 ? -55.601 -27.545 -6.093  1.00 98.35  ? 1324 PRO A N     1 
ATOM   9883  C  CA    . PRO A 1 1324 ? -54.830 -28.579 -5.395  1.00 99.71  ? 1324 PRO A CA    1 
ATOM   9884  C  C     . PRO A 1 1324 ? -53.525 -28.889 -6.116  1.00 98.18  ? 1324 PRO A C     1 
ATOM   9885  O  O     . PRO A 1 1324 ? -53.511 -28.940 -7.338  1.00 96.91  ? 1324 PRO A O     1 
ATOM   9886  C  CB    . PRO A 1 1324 ? -55.767 -29.790 -5.420  1.00 99.79  ? 1324 PRO A CB    1 
ATOM   9887  C  CG    . PRO A 1 1324 ? -56.581 -29.607 -6.647  1.00 97.82  ? 1324 PRO A CG    1 
ATOM   9888  C  CD    . PRO A 1 1324 ? -56.765 -28.123 -6.796  1.00 97.64  ? 1324 PRO A CD    1 
ATOM   9889  N  N     . ARG A 1 1325 ? -52.450 -29.105 -5.360  1.00 99.69  ? 1325 ARG A N     1 
ATOM   9890  C  CA    . ARG A 1 1325 ? -51.107 -29.250 -5.928  1.00 99.52  ? 1325 ARG A CA    1 
ATOM   9891  C  C     . ARG A 1 1325 ? -50.435 -30.557 -5.533  1.00 101.53 ? 1325 ARG A C     1 
ATOM   9892  O  O     . ARG A 1 1325 ? -50.835 -31.210 -4.571  1.00 103.42 ? 1325 ARG A O     1 
ATOM   9893  C  CB    . ARG A 1 1325 ? -50.236 -28.078 -5.493  1.00 100.06 ? 1325 ARG A CB    1 
ATOM   9894  C  CG    . ARG A 1 1325 ? -50.915 -26.725 -5.637  1.00 99.61  ? 1325 ARG A CG    1 
ATOM   9895  C  CD    . ARG A 1 1325 ? -49.989 -25.700 -6.248  1.00 98.72  ? 1325 ARG A CD    1 
ATOM   9896  N  NE    . ARG A 1 1325 ? -50.645 -24.403 -6.374  1.00 99.07  ? 1325 ARG A NE    1 
ATOM   9897  C  CZ    . ARG A 1 1325 ? -50.215 -23.395 -7.134  1.00 97.80  ? 1325 ARG A CZ    1 
ATOM   9898  N  NH1   . ARG A 1 1325 ? -49.109 -23.502 -7.872  1.00 96.48  ? 1325 ARG A NH1   1 
ATOM   9899  N  NH2   . ARG A 1 1325 ? -50.911 -22.262 -7.161  1.00 97.79  ? 1325 ARG A NH2   1 
ATOM   9900  N  N     . ASP A 1 1326 ? -49.395 -30.913 -6.282  1.00 102.20 ? 1326 ASP A N     1 
ATOM   9901  C  CA    . ASP A 1 1326 ? -48.682 -32.182 -6.116  1.00 103.82 ? 1326 ASP A CA    1 
ATOM   9902  C  C     . ASP A 1 1326 ? -47.245 -31.958 -5.633  1.00 105.99 ? 1326 ASP A C     1 
ATOM   9903  O  O     . ASP A 1 1326 ? -46.669 -30.880 -5.835  1.00 105.01 ? 1326 ASP A O     1 
ATOM   9904  C  CB    . ASP A 1 1326 ? -48.668 -32.948 -7.447  1.00 102.13 ? 1326 ASP A CB    1 
ATOM   9905  C  CG    . ASP A 1 1326 ? -50.044 -33.007 -8.113  1.00 101.38 ? 1326 ASP A CG    1 
ATOM   9906  O  OD1   . ASP A 1 1326 ? -51.054 -33.147 -7.386  1.00 103.01 ? 1326 ASP A OD1   1 
ATOM   9907  O  OD2   . ASP A 1 1326 ? -50.111 -32.906 -9.360  1.00 97.43  ? 1326 ASP A OD2   1 
ATOM   9908  N  N     . GLU A 1 1327 ? -46.676 -32.990 -5.007  1.00 108.73 ? 1327 GLU A N     1 
ATOM   9909  C  CA    . GLU A 1 1327 ? -45.286 -32.963 -4.539  1.00 110.04 ? 1327 GLU A CA    1 
ATOM   9910  C  C     . GLU A 1 1327 ? -44.385 -33.186 -5.741  1.00 108.20 ? 1327 GLU A C     1 
ATOM   9911  O  O     . GLU A 1 1327 ? -44.722 -34.004 -6.595  1.00 106.95 ? 1327 GLU A O     1 
ATOM   9912  C  CB    . GLU A 1 1327 ? -45.000 -34.056 -3.506  1.00 112.63 ? 1327 GLU A CB    1 
ATOM   9913  C  CG    . GLU A 1 1327 ? -45.684 -33.860 -2.161  1.00 115.12 ? 1327 GLU A CG    1 
ATOM   9914  C  CD    . GLU A 1 1327 ? -47.114 -34.377 -2.124  1.00 115.98 ? 1327 GLU A CD    1 
ATOM   9915  O  OE1   . GLU A 1 1327 ? -47.756 -34.499 -3.195  1.00 113.15 ? 1327 GLU A OE1   1 
ATOM   9916  O  OE2   . GLU A 1 1327 ? -47.604 -34.656 -1.008  1.00 118.81 ? 1327 GLU A OE2   1 
ATOM   9917  N  N     . PRO A 1 1328 ? -43.237 -32.478 -5.811  1.00 108.69 ? 1328 PRO A N     1 
ATOM   9918  C  CA    . PRO A 1 1328 ? -42.325 -32.554 -6.972  1.00 107.84 ? 1328 PRO A CA    1 
ATOM   9919  C  C     . PRO A 1 1328 ? -41.968 -33.971 -7.480  1.00 108.10 ? 1328 PRO A C     1 
ATOM   9920  O  O     . PRO A 1 1328 ? -42.261 -34.300 -8.638  1.00 107.88 ? 1328 PRO A O     1 
ATOM   9921  C  CB    . PRO A 1 1328 ? -41.071 -31.818 -6.482  1.00 108.40 ? 1328 PRO A CB    1 
ATOM   9922  C  CG    . PRO A 1 1328 ? -41.576 -30.851 -5.467  1.00 109.73 ? 1328 PRO A CG    1 
ATOM   9923  C  CD    . PRO A 1 1328 ? -42.808 -31.443 -4.847  1.00 109.98 ? 1328 PRO A CD    1 
ATOM   9924  N  N     . GLY A 1 1329 ? -41.374 -34.796 -6.619  1.00 109.14 ? 1329 GLY A N     1 
ATOM   9925  C  CA    . GLY A 1 1329 ? -40.887 -36.125 -7.009  1.00 107.75 ? 1329 GLY A CA    1 
ATOM   9926  C  C     . GLY A 1 1329 ? -41.863 -37.280 -6.842  1.00 107.31 ? 1329 GLY A C     1 
ATOM   9927  O  O     . GLY A 1 1329 ? -41.468 -38.434 -7.014  1.00 107.15 ? 1329 GLY A O     1 
ATOM   9928  N  N     . SER A 1 1330 ? -43.123 -36.985 -6.512  1.00 106.99 ? 1330 SER A N     1 
ATOM   9929  C  CA    . SER A 1 1330 ? -44.143 -38.021 -6.290  1.00 107.32 ? 1330 SER A CA    1 
ATOM   9930  C  C     . SER A 1 1330 ? -44.681 -38.652 -7.585  1.00 105.15 ? 1330 SER A C     1 
ATOM   9931  O  O     . SER A 1 1330 ? -45.136 -39.802 -7.565  1.00 106.14 ? 1330 SER A O     1 
ATOM   9932  C  CB    . SER A 1 1330 ? -45.305 -37.456 -5.464  1.00 108.07 ? 1330 SER A CB    1 
ATOM   9933  O  OG    . SER A 1 1330 ? -45.876 -36.321 -6.087  1.00 106.54 ? 1330 SER A OG    1 
ATOM   9934  N  N     . TYR A 1 1331 ? -44.613 -37.906 -8.693  1.00 101.81 ? 1331 TYR A N     1 
ATOM   9935  C  CA    . TYR A 1 1331 ? -45.146 -38.330 -10.001 1.00 97.52  ? 1331 TYR A CA    1 
ATOM   9936  C  C     . TYR A 1 1331 ? -44.156 -37.997 -11.107 1.00 94.37  ? 1331 TYR A C     1 
ATOM   9937  O  O     . TYR A 1 1331 ? -43.289 -37.142 -10.928 1.00 93.36  ? 1331 TYR A O     1 
ATOM   9938  C  CB    . TYR A 1 1331 ? -46.460 -37.599 -10.296 1.00 96.43  ? 1331 TYR A CB    1 
ATOM   9939  C  CG    . TYR A 1 1331 ? -46.277 -36.111 -10.536 1.00 95.44  ? 1331 TYR A CG    1 
ATOM   9940  C  CD1   . TYR A 1 1331 ? -46.102 -35.228 -9.471  1.00 96.40  ? 1331 TYR A CD1   1 
ATOM   9941  C  CD2   . TYR A 1 1331 ? -46.254 -35.588 -11.828 1.00 93.16  ? 1331 TYR A CD2   1 
ATOM   9942  C  CE1   . TYR A 1 1331 ? -45.918 -33.868 -9.687  1.00 95.09  ? 1331 TYR A CE1   1 
ATOM   9943  C  CE2   . TYR A 1 1331 ? -46.076 -34.228 -12.050 1.00 92.06  ? 1331 TYR A CE2   1 
ATOM   9944  C  CZ    . TYR A 1 1331 ? -45.909 -33.374 -10.974 1.00 92.24  ? 1331 TYR A CZ    1 
ATOM   9945  O  OH    . TYR A 1 1331 ? -45.730 -32.032 -11.181 1.00 89.76  ? 1331 TYR A OH    1 
ATOM   9946  N  N     . VAL A 1 1332 ? -44.318 -38.661 -12.252 1.00 92.63  ? 1332 VAL A N     1 
ATOM   9947  C  CA    . VAL A 1 1332 ? -43.551 -38.350 -13.470 1.00 90.78  ? 1332 VAL A CA    1 
ATOM   9948  C  C     . VAL A 1 1332 ? -44.403 -37.446 -14.386 1.00 88.14  ? 1332 VAL A C     1 
ATOM   9949  O  O     . VAL A 1 1332 ? -45.488 -37.842 -14.804 1.00 86.91  ? 1332 VAL A O     1 
ATOM   9950  C  CB    . VAL A 1 1332 ? -43.042 -39.636 -14.194 1.00 91.26  ? 1332 VAL A CB    1 
ATOM   9951  C  CG1   . VAL A 1 1332 ? -44.167 -40.452 -14.839 1.00 91.25  ? 1332 VAL A CG1   1 
ATOM   9952  C  CG2   . VAL A 1 1332 ? -41.981 -39.287 -15.233 1.00 89.74  ? 1332 VAL A CG2   1 
ATOM   9953  N  N     . PRO A 1 1333 ? -43.930 -36.214 -14.679 1.00 86.82  ? 1333 PRO A N     1 
ATOM   9954  C  CA    . PRO A 1 1333 ? -44.761 -35.282 -15.449 1.00 84.94  ? 1333 PRO A CA    1 
ATOM   9955  C  C     . PRO A 1 1333 ? -44.831 -35.657 -16.922 1.00 82.30  ? 1333 PRO A C     1 
ATOM   9956  O  O     . PRO A 1 1333 ? -43.948 -36.346 -17.423 1.00 81.19  ? 1333 PRO A O     1 
ATOM   9957  C  CB    . PRO A 1 1333 ? -44.023 -33.950 -15.285 1.00 84.72  ? 1333 PRO A CB    1 
ATOM   9958  C  CG    . PRO A 1 1333 ? -42.592 -34.343 -15.176 1.00 85.16  ? 1333 PRO A CG    1 
ATOM   9959  C  CD    . PRO A 1 1333 ? -42.580 -35.662 -14.446 1.00 86.94  ? 1333 PRO A CD    1 
ATOM   9960  N  N     . TRP A 1 1334 ? -45.872 -35.198 -17.606 1.00 81.60  ? 1334 TRP A N     1 
ATOM   9961  C  CA    . TRP A 1 1334 ? -45.966 -35.366 -19.056 1.00 79.91  ? 1334 TRP A CA    1 
ATOM   9962  C  C     . TRP A 1 1334 ? -44.878 -34.569 -19.808 1.00 80.18  ? 1334 TRP A C     1 
ATOM   9963  O  O     . TRP A 1 1334 ? -44.468 -34.997 -20.877 1.00 78.98  ? 1334 TRP A O     1 
ATOM   9964  C  CB    . TRP A 1 1334 ? -47.368 -34.986 -19.541 1.00 79.01  ? 1334 TRP A CB    1 
ATOM   9965  C  CG    . TRP A 1 1334 ? -47.607 -35.088 -21.036 1.00 76.58  ? 1334 TRP A CG    1 
ATOM   9966  C  CD1   . TRP A 1 1334 ? -47.621 -34.055 -21.942 1.00 74.29  ? 1334 TRP A CD1   1 
ATOM   9967  C  CD2   . TRP A 1 1334 ? -47.888 -36.275 -21.783 1.00 75.44  ? 1334 TRP A CD2   1 
ATOM   9968  N  NE1   . TRP A 1 1334 ? -47.891 -34.529 -23.201 1.00 72.63  ? 1334 TRP A NE1   1 
ATOM   9969  C  CE2   . TRP A 1 1334 ? -48.057 -35.889 -23.136 1.00 73.13  ? 1334 TRP A CE2   1 
ATOM   9970  C  CE3   . TRP A 1 1334 ? -48.016 -37.631 -21.444 1.00 75.60  ? 1334 TRP A CE3   1 
ATOM   9971  C  CZ2   . TRP A 1 1334 ? -48.351 -36.807 -24.145 1.00 71.65  ? 1334 TRP A CZ2   1 
ATOM   9972  C  CZ3   . TRP A 1 1334 ? -48.302 -38.544 -22.449 1.00 74.41  ? 1334 TRP A CZ3   1 
ATOM   9973  C  CH2   . TRP A 1 1334 ? -48.464 -38.125 -23.787 1.00 72.95  ? 1334 TRP A CH2   1 
ATOM   9974  N  N     . ASN A 1 1335 ? -44.403 -33.447 -19.243 1.00 81.98  ? 1335 ASN A N     1 
ATOM   9975  C  CA    . ASN A 1 1335 ? -43.391 -32.569 -19.886 1.00 82.06  ? 1335 ASN A CA    1 
ATOM   9976  C  C     . ASN A 1 1335 ? -42.208 -32.152 -18.983 1.00 83.84  ? 1335 ASN A C     1 
ATOM   9977  O  O     . ASN A 1 1335 ? -42.144 -32.549 -17.822 1.00 87.55  ? 1335 ASN A O     1 
ATOM   9978  C  CB    . ASN A 1 1335 ? -44.088 -31.312 -20.419 1.00 81.77  ? 1335 ASN A CB    1 
ATOM   9979  C  CG    . ASN A 1 1335 ? -45.093 -31.615 -21.517 1.00 81.76  ? 1335 ASN A CG    1 
ATOM   9980  O  OD1   . ASN A 1 1335 ? -44.874 -32.481 -22.366 1.00 82.71  ? 1335 ASN A OD1   1 
ATOM   9981  N  ND2   . ASN A 1 1335 ? -46.198 -30.884 -21.518 1.00 82.85  ? 1335 ASN A ND2   1 
ATOM   9982  N  N     . VAL A 1 1336 ? -41.278 -31.366 -19.542 1.00 83.63  ? 1336 VAL A N     1 
ATOM   9983  C  CA    . VAL A 1 1336 ? -40.114 -30.762 -18.832 1.00 84.32  ? 1336 VAL A CA    1 
ATOM   9984  C  C     . VAL A 1 1336 ? -39.091 -31.830 -18.438 1.00 84.47  ? 1336 VAL A C     1 
ATOM   9985  O  O     . VAL A 1 1336 ? -38.616 -32.582 -19.290 1.00 82.57  ? 1336 VAL A O     1 
ATOM   9986  C  CB    . VAL A 1 1336 ? -40.518 -29.815 -17.634 1.00 85.79  ? 1336 VAL A CB    1 
ATOM   9987  C  CG1   . VAL A 1 1336 ? -40.302 -30.436 -16.246 1.00 86.93  ? 1336 VAL A CG1   1 
ATOM   9988  C  CG2   . VAL A 1 1336 ? -39.754 -28.491 -17.706 1.00 85.49  ? 1336 VAL A CG2   1 
HETATM 9989  C  C1    . MLI B 2 .    ? -44.823 -34.321 -57.982 0.50 49.03  ? 2337 MLI A C1    1 
HETATM 9990  C  C2    . MLI B 2 .    ? -44.238 -35.276 -56.971 0.50 49.77  ? 2337 MLI A C2    1 
HETATM 9991  C  C3    . MLI B 2 .    ? -44.221 -34.580 -59.341 0.50 48.34  ? 2337 MLI A C3    1 
HETATM 9992  O  O6    . MLI B 2 .    ? -44.540 -35.134 -55.765 0.50 51.17  ? 2337 MLI A O6    1 
HETATM 9993  O  O7    . MLI B 2 .    ? -43.479 -36.176 -57.383 0.50 49.22  ? 2337 MLI A O7    1 
HETATM 9994  O  O8    . MLI B 2 .    ? -43.135 -35.190 -59.378 0.50 47.41  ? 2337 MLI A O8    1 
HETATM 9995  O  O9    . MLI B 2 .    ? -44.826 -34.187 -60.367 0.50 46.76  ? 2337 MLI A O9    1 
HETATM 9996  C  C1    . MLI C 2 .    ? -50.354 -25.745 -37.295 0.50 51.83  ? 2338 MLI A C1    1 
HETATM 9997  C  C2    . MLI C 2 .    ? -49.435 -24.584 -37.011 0.50 52.24  ? 2338 MLI A C2    1 
HETATM 9998  C  C3    . MLI C 2 .    ? -49.615 -26.743 -38.150 0.50 51.54  ? 2338 MLI A C3    1 
HETATM 9999  O  O6    . MLI C 2 .    ? -48.202 -24.769 -37.082 0.50 53.02  ? 2338 MLI A O6    1 
HETATM 10000 O  O7    . MLI C 2 .    ? -49.938 -23.478 -36.732 0.50 51.26  ? 2338 MLI A O7    1 
HETATM 10001 O  O8    . MLI C 2 .    ? -48.681 -27.376 -37.623 0.50 52.25  ? 2338 MLI A O8    1 
HETATM 10002 O  O9    . MLI C 2 .    ? -49.956 -26.899 -39.342 0.50 52.10  ? 2338 MLI A O9    1 
HETATM 10003 FE FE1   . FES D 3 .    ? -46.072 -17.691 -47.369 1.00 49.87  ? 3001 FES A FE1   1 
HETATM 10004 FE FE2   . FES D 3 .    ? -43.131 -18.246 -47.529 1.00 47.02  ? 3001 FES A FE2   1 
HETATM 10005 S  S1    . FES D 3 .    ? -44.468 -16.853 -48.658 1.00 46.60  ? 3001 FES A S1    1 
HETATM 10006 S  S2    . FES D 3 .    ? -44.800 -19.268 -46.487 1.00 47.52  ? 3001 FES A S2    1 
HETATM 10007 FE FE1   . FES E 3 .    ? -51.084 -28.739 -44.367 1.00 75.82  ? 3002 FES A FE1   1 
HETATM 10008 FE FE2   . FES E 3 .    ? -53.000 -30.142 -46.291 1.00 74.59  ? 3002 FES A FE2   1 
HETATM 10009 S  S1    . FES E 3 .    ? -53.257 -28.474 -44.814 1.00 78.06  ? 3002 FES A S1    1 
HETATM 10010 S  S2    . FES E 3 .    ? -50.804 -29.729 -46.354 1.00 75.99  ? 3002 FES A S2    1 
HETATM 10011 N  N1    . MTE F 4 .    ? -36.963 -14.549 -45.965 1.00 75.70  ? 3003 MTE A N1    1 
HETATM 10012 C  C2    . MTE F 4 .    ? -37.647 -15.588 -46.506 1.00 75.09  ? 3003 MTE A C2    1 
HETATM 10013 N  N2    . MTE F 4 .    ? -38.816 -15.305 -47.132 1.00 76.41  ? 3003 MTE A N2    1 
HETATM 10014 N  N3    . MTE F 4 .    ? -37.200 -16.869 -46.442 1.00 75.97  ? 3003 MTE A N3    1 
HETATM 10015 C  C4    . MTE F 4 .    ? -36.040 -17.202 -45.829 1.00 76.22  ? 3003 MTE A C4    1 
HETATM 10016 O  O4    . MTE F 4 .    ? -35.641 -18.387 -45.770 1.00 72.04  ? 3003 MTE A O4    1 
HETATM 10017 N  N5    . MTE F 4 .    ? -34.089 -16.319 -44.535 1.00 79.02  ? 3003 MTE A N5    1 
HETATM 10018 C  C6    . MTE F 4 .    ? -33.594 -15.250 -43.669 1.00 80.68  ? 3003 MTE A C6    1 
HETATM 10019 C  C7    . MTE F 4 .    ? -33.728 -13.887 -44.336 1.00 80.97  ? 3003 MTE A C7    1 
HETATM 10020 N  N8    . MTE F 4 .    ? -35.092 -13.713 -44.813 1.00 78.71  ? 3003 MTE A N8    1 
HETATM 10021 C  C9    . MTE F 4 .    ? -35.232 -16.115 -45.224 1.00 77.83  ? 3003 MTE A C9    1 
HETATM 10022 C  C10   . MTE F 4 .    ? -35.792 -14.745 -45.319 1.00 78.41  ? 3003 MTE A C10   1 
HETATM 10023 C  "C1'" . MTE F 4 .    ? -32.180 -15.462 -43.231 1.00 81.34  ? 3003 MTE A "C1'" 1 
HETATM 10024 S  "S1'" . MTE F 4 .    ? -31.956 -16.534 -41.949 1.00 80.69  ? 3003 MTE A "S1'" 1 
HETATM 10025 C  "C2'" . MTE F 4 .    ? -31.159 -14.818 -43.822 1.00 84.27  ? 3003 MTE A "C2'" 1 
HETATM 10026 S  "S2'" . MTE F 4 .    ? -29.569 -15.117 -43.313 1.00 83.39  ? 3003 MTE A "S2'" 1 
HETATM 10027 C  "C3'" . MTE F 4 .    ? -31.403 -13.808 -44.930 1.00 83.75  ? 3003 MTE A "C3'" 1 
HETATM 10028 O  "O3'" . MTE F 4 .    ? -32.767 -13.822 -45.401 1.00 82.25  ? 3003 MTE A "O3'" 1 
HETATM 10029 C  "C4'" . MTE F 4 .    ? -30.425 -14.078 -46.081 1.00 83.15  ? 3003 MTE A "C4'" 1 
HETATM 10030 O  "O4'" . MTE F 4 .    ? -30.740 -13.314 -47.249 1.00 80.96  ? 3003 MTE A "O4'" 1 
HETATM 10031 P  P     . MTE F 4 .    ? -30.243 -11.788 -47.439 1.00 78.91  ? 3003 MTE A P     1 
HETATM 10032 O  O1P   . MTE F 4 .    ? -30.340 -11.520 -48.924 1.00 76.73  ? 3003 MTE A O1P   1 
HETATM 10033 O  O2P   . MTE F 4 .    ? -28.827 -11.780 -46.922 1.00 76.20  ? 3003 MTE A O2P   1 
HETATM 10034 O  O3P   . MTE F 4 .    ? -31.223 -10.983 -46.613 1.00 80.06  ? 3003 MTE A O3P   1 
HETATM 10035 MO MO    . MOS G 5 .    ? -29.593 -17.093 -41.852 1.00 107.97 ? 3004 MOS A MO    1 
HETATM 10036 S  S     . MOS G 5 .    ? -29.502 -17.658 -39.610 0.63 106.54 ? 3004 MOS A S     1 
HETATM 10037 O  O1    . MOS G 5 .    ? -27.546 -16.491 -41.584 1.00 113.82 ? 3004 MOS A O1    1 
HETATM 10038 O  O2    . MOS G 5 .    ? -29.451 -18.680 -42.558 1.00 109.54 ? 3004 MOS A O2    1 
HETATM 10039 P  PA    . FAD H 6 .    ? -64.921 -38.620 -39.983 1.00 54.41  ? 3006 FAD A PA    1 
HETATM 10040 O  O1A   . FAD H 6 .    ? -65.498 -38.729 -41.375 1.00 52.77  ? 3006 FAD A O1A   1 
HETATM 10041 O  O2A   . FAD H 6 .    ? -63.431 -38.568 -39.768 1.00 52.45  ? 3006 FAD A O2A   1 
HETATM 10042 O  O5B   . FAD H 6 .    ? -65.496 -39.815 -39.076 1.00 54.30  ? 3006 FAD A O5B   1 
HETATM 10043 C  C5B   . FAD H 6 .    ? -65.035 -39.928 -37.729 1.00 55.67  ? 3006 FAD A C5B   1 
HETATM 10044 C  C4B   . FAD H 6 .    ? -65.831 -40.972 -36.966 1.00 56.93  ? 3006 FAD A C4B   1 
HETATM 10045 O  O4B   . FAD H 6 .    ? -67.221 -40.639 -36.974 1.00 57.03  ? 3006 FAD A O4B   1 
HETATM 10046 C  C3B   . FAD H 6 .    ? -65.698 -42.339 -37.615 1.00 55.90  ? 3006 FAD A C3B   1 
HETATM 10047 O  O3B   . FAD H 6 .    ? -65.469 -43.322 -36.610 1.00 55.87  ? 3006 FAD A O3B   1 
HETATM 10048 C  C2B   . FAD H 6 .    ? -67.013 -42.539 -38.332 1.00 55.29  ? 3006 FAD A C2B   1 
HETATM 10049 O  O2B   . FAD H 6 .    ? -67.341 -43.925 -38.431 1.00 55.74  ? 3006 FAD A O2B   1 
HETATM 10050 C  C1B   . FAD H 6 .    ? -67.977 -41.752 -37.462 1.00 55.42  ? 3006 FAD A C1B   1 
HETATM 10051 N  N9A   . FAD H 6 .    ? -69.207 -41.248 -38.122 1.00 53.71  ? 3006 FAD A N9A   1 
HETATM 10052 C  C8A   . FAD H 6 .    ? -69.328 -40.167 -38.923 1.00 54.71  ? 3006 FAD A C8A   1 
HETATM 10053 N  N7A   . FAD H 6 .    ? -70.617 -39.987 -39.323 1.00 53.06  ? 3006 FAD A N7A   1 
HETATM 10054 C  C5A   . FAD H 6 .    ? -71.341 -40.967 -38.757 1.00 53.90  ? 3006 FAD A C5A   1 
HETATM 10055 C  C6A   . FAD H 6 .    ? -72.764 -41.380 -38.746 1.00 53.47  ? 3006 FAD A C6A   1 
HETATM 10056 N  N6A   . FAD H 6 .    ? -73.698 -40.692 -39.442 1.00 52.30  ? 3006 FAD A N6A   1 
HETATM 10057 N  N1A   . FAD H 6 .    ? -73.093 -42.477 -38.017 1.00 55.40  ? 3006 FAD A N1A   1 
HETATM 10058 C  C2A   . FAD H 6 .    ? -72.185 -43.189 -37.308 1.00 54.87  ? 3006 FAD A C2A   1 
HETATM 10059 N  N3A   . FAD H 6 .    ? -70.878 -42.865 -37.270 1.00 54.05  ? 3006 FAD A N3A   1 
HETATM 10060 C  C4A   . FAD H 6 .    ? -70.409 -41.790 -37.961 1.00 54.38  ? 3006 FAD A C4A   1 
HETATM 10061 N  N1    . FAD H 6 .    ? -62.396 -29.981 -33.248 1.00 71.71  ? 3006 FAD A N1    1 
HETATM 10062 C  C2    . FAD H 6 .    ? -62.721 -29.021 -32.352 1.00 71.19  ? 3006 FAD A C2    1 
HETATM 10063 O  O2    . FAD H 6 .    ? -63.649 -29.252 -31.559 1.00 70.77  ? 3006 FAD A O2    1 
HETATM 10064 N  N3    . FAD H 6 .    ? -62.079 -27.836 -32.286 1.00 73.79  ? 3006 FAD A N3    1 
HETATM 10065 C  C4    . FAD H 6 .    ? -61.068 -27.517 -33.108 1.00 72.87  ? 3006 FAD A C4    1 
HETATM 10066 O  O4    . FAD H 6 .    ? -60.502 -26.404 -33.019 1.00 72.35  ? 3006 FAD A O4    1 
HETATM 10067 C  C4X   . FAD H 6 .    ? -60.652 -28.518 -34.121 1.00 72.83  ? 3006 FAD A C4X   1 
HETATM 10068 N  N5    . FAD H 6 .    ? -59.641 -28.278 -34.983 1.00 74.08  ? 3006 FAD A N5    1 
HETATM 10069 C  C5X   . FAD H 6 .    ? -59.270 -29.199 -35.901 1.00 72.66  ? 3006 FAD A C5X   1 
HETATM 10070 C  C6    . FAD H 6 .    ? -58.220 -28.872 -36.754 1.00 70.36  ? 3006 FAD A C6    1 
HETATM 10071 C  C7    . FAD H 6 .    ? -57.790 -29.777 -37.716 1.00 68.84  ? 3006 FAD A C7    1 
HETATM 10072 C  C7M   . FAD H 6 .    ? -56.651 -29.405 -38.630 1.00 67.38  ? 3006 FAD A C7M   1 
HETATM 10073 C  C8    . FAD H 6 .    ? -58.470 -31.106 -37.828 1.00 69.49  ? 3006 FAD A C8    1 
HETATM 10074 C  C8M   . FAD H 6 .    ? -58.015 -32.096 -38.870 1.00 67.79  ? 3006 FAD A C8M   1 
HETATM 10075 C  C9    . FAD H 6 .    ? -59.525 -31.438 -36.970 1.00 68.68  ? 3006 FAD A C9    1 
HETATM 10076 C  C9A   . FAD H 6 .    ? -59.970 -30.531 -35.994 1.00 70.71  ? 3006 FAD A C9A   1 
HETATM 10077 N  N10   . FAD H 6 .    ? -61.050 -30.804 -35.088 1.00 69.14  ? 3006 FAD A N10   1 
HETATM 10078 C  C10   . FAD H 6 .    ? -61.396 -29.808 -34.144 1.00 71.18  ? 3006 FAD A C10   1 
HETATM 10079 C  "C1'" . FAD H 6 .    ? -61.793 -32.077 -35.069 1.00 64.18  ? 3006 FAD A "C1'" 1 
HETATM 10080 C  "C2'" . FAD H 6 .    ? -62.903 -32.088 -36.104 1.00 61.50  ? 3006 FAD A "C2'" 1 
HETATM 10081 O  "O2'" . FAD H 6 .    ? -63.914 -31.156 -35.704 1.00 59.08  ? 3006 FAD A "O2'" 1 
HETATM 10082 C  "C3'" . FAD H 6 .    ? -63.462 -33.503 -36.239 1.00 60.13  ? 3006 FAD A "C3'" 1 
HETATM 10083 O  "O3'" . FAD H 6 .    ? -62.410 -34.365 -36.690 1.00 61.06  ? 3006 FAD A "O3'" 1 
HETATM 10084 C  "C4'" . FAD H 6 .    ? -64.623 -33.580 -37.226 1.00 59.41  ? 3006 FAD A "C4'" 1 
HETATM 10085 O  "O4'" . FAD H 6 .    ? -65.732 -32.827 -36.729 1.00 59.04  ? 3006 FAD A "O4'" 1 
HETATM 10086 C  "C5'" . FAD H 6 .    ? -65.066 -35.015 -37.506 1.00 57.70  ? 3006 FAD A "C5'" 1 
HETATM 10087 O  "O5'" . FAD H 6 .    ? -65.999 -35.022 -38.590 1.00 56.35  ? 3006 FAD A "O5'" 1 
HETATM 10088 P  P     . FAD H 6 .    ? -65.690 -35.895 -39.907 1.00 54.36  ? 3006 FAD A P     1 
HETATM 10089 O  O1P   . FAD H 6 .    ? -66.860 -35.836 -40.847 1.00 51.69  ? 3006 FAD A O1P   1 
HETATM 10090 O  O2P   . FAD H 6 .    ? -64.335 -35.503 -40.439 1.00 57.81  ? 3006 FAD A O2P   1 
HETATM 10091 O  O3P   . FAD H 6 .    ? -65.593 -37.355 -39.246 1.00 55.16  ? 3006 FAD A O3P   1 
HETATM 10092 O  O     . HOH I 7 .    ? -45.403 -38.147 -61.462 1.00 51.46  ? 2001 HOH A O     1 
HETATM 10093 O  O     . HOH I 7 .    ? -43.882 -42.646 -54.758 1.00 54.00  ? 2002 HOH A O     1 
HETATM 10094 O  O     . HOH I 7 .    ? -47.913 -28.166 -62.921 1.00 56.25  ? 2003 HOH A O     1 
HETATM 10095 O  O     . HOH I 7 .    ? -45.708 -26.196 -59.224 1.00 46.01  ? 2004 HOH A O     1 
HETATM 10096 O  O     . HOH I 7 .    ? -52.417 -36.784 -48.763 1.00 55.36  ? 2005 HOH A O     1 
HETATM 10097 O  O     . HOH I 7 .    ? -38.722 -19.009 -53.377 1.00 43.91  ? 2006 HOH A O     1 
HETATM 10098 O  O     . HOH I 7 .    ? -61.839 2.725   -50.258 1.00 68.58  ? 2007 HOH A O     1 
HETATM 10099 O  O     . HOH I 7 .    ? -59.572 -2.028  -59.485 1.00 75.01  ? 2008 HOH A O     1 
HETATM 10100 O  O     . HOH I 7 .    ? -45.040 -34.677 -50.371 1.00 54.17  ? 2009 HOH A O     1 
HETATM 10101 O  O     . HOH I 7 .    ? -82.278 -42.351 -49.235 1.00 63.47  ? 2010 HOH A O     1 
HETATM 10102 O  O     . HOH I 7 .    ? -59.509 -42.895 -44.037 1.00 59.98  ? 2011 HOH A O     1 
HETATM 10103 O  O     . HOH I 7 .    ? -58.231 -35.537 -36.107 1.00 53.33  ? 2012 HOH A O     1 
HETATM 10104 O  O     . HOH I 7 .    ? -81.528 -22.891 -27.799 1.00 53.79  ? 2013 HOH A O     1 
HETATM 10105 O  O     . HOH I 7 .    ? -64.970 -35.036 -31.281 1.00 66.04  ? 2014 HOH A O     1 
HETATM 10106 O  O     . HOH I 7 .    ? -78.292 -32.057 -21.196 1.00 61.57  ? 2015 HOH A O     1 
HETATM 10107 O  O     . HOH I 7 .    ? -47.809 -25.514 -28.016 1.00 61.79  ? 2016 HOH A O     1 
HETATM 10108 O  O     . HOH I 7 .    ? -37.165 -26.321 -58.266 1.00 56.97  ? 2017 HOH A O     1 
HETATM 10109 O  O     . HOH I 7 .    ? -43.929 -32.188 -51.273 1.00 50.70  ? 2018 HOH A O     1 
HETATM 10110 O  O     . HOH I 7 .    ? -44.827 -32.434 -62.754 1.00 58.11  ? 2019 HOH A O     1 
HETATM 10111 O  O     . HOH I 7 .    ? -39.001 -36.836 -66.410 1.00 37.73  ? 2020 HOH A O     1 
HETATM 10112 O  O     . HOH I 7 .    ? -33.503 -43.642 -62.231 1.00 49.98  ? 2021 HOH A O     1 
HETATM 10113 O  O     . HOH I 7 .    ? -40.713 -43.938 -63.739 1.00 50.07  ? 2022 HOH A O     1 
HETATM 10114 O  O     . HOH I 7 .    ? -17.775 -28.696 -39.132 1.00 69.18  ? 2023 HOH A O     1 
HETATM 10115 O  O     . HOH I 7 .    ? -39.831 -49.000 -37.414 1.00 59.32  ? 2024 HOH A O     1 
HETATM 10116 O  O     . HOH I 7 .    ? -37.933 -50.346 -33.821 1.00 73.19  ? 2025 HOH A O     1 
HETATM 10117 O  O     . HOH I 7 .    ? -19.446 -32.335 -16.917 1.00 65.57  ? 2026 HOH A O     1 
HETATM 10118 O  O     . HOH I 7 .    ? -19.073 -31.001 -19.445 1.00 64.09  ? 2027 HOH A O     1 
HETATM 10119 O  O     . HOH I 7 .    ? -9.803  -10.704 -20.831 1.00 71.99  ? 2028 HOH A O     1 
HETATM 10120 O  O     . HOH I 7 .    ? -23.574 -41.347 -63.019 1.00 41.42  ? 2029 HOH A O     1 
HETATM 10121 O  O     . HOH I 7 .    ? -33.197 -27.387 -57.978 1.00 50.18  ? 2030 HOH A O     1 
HETATM 10122 O  O     . HOH I 7 .    ? -34.981 -25.752 -56.632 1.00 40.39  ? 2031 HOH A O     1 
HETATM 10123 O  O     . HOH I 7 .    ? -22.611 -45.574 -53.375 1.00 52.85  ? 2032 HOH A O     1 
HETATM 10124 O  O     . HOH I 7 .    ? -31.265 -44.208 -64.055 1.00 56.83  ? 2033 HOH A O     1 
HETATM 10125 O  O     . HOH I 7 .    ? -45.995 -35.712 -40.322 1.00 61.75  ? 2034 HOH A O     1 
HETATM 10126 O  O     . HOH I 7 .    ? -30.396 -18.328 -33.347 1.00 44.41  ? 2035 HOH A O     1 
HETATM 10127 O  O     . HOH I 7 .    ? -17.614 4.727   -20.717 1.00 74.88  ? 2036 HOH A O     1 
HETATM 10128 O  O     . HOH I 7 .    ? -12.056 -18.525 -54.235 1.00 49.46  ? 2037 HOH A O     1 
HETATM 10129 O  O     . HOH I 7 .    ? -27.870 4.978   -54.673 1.00 56.94  ? 2038 HOH A O     1 
HETATM 10130 O  O     . HOH I 7 .    ? -38.940 -10.649 -69.527 1.00 56.72  ? 2039 HOH A O     1 
HETATM 10131 O  O     . HOH I 7 .    ? -14.254 -12.355 -66.937 1.00 50.98  ? 2040 HOH A O     1 
HETATM 10132 O  O     . HOH I 7 .    ? -13.690 -7.014  -55.158 1.00 49.79  ? 2041 HOH A O     1 
HETATM 10133 O  O     . HOH I 7 .    ? -10.283 -8.960  -42.836 1.00 61.10  ? 2042 HOH A O     1 
HETATM 10134 O  O     . HOH I 7 .    ? -35.890 -27.141 -28.421 1.00 63.51  ? 2043 HOH A O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_a